data_3H8E
# 
_entry.id   3H8E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3H8E         
RCSB  RCSB052821   
WWPDB D_1000052821 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1GYT 
;X-Ray Structure of Aminopeptidase a from Escherichia Coli and a Model  
for the Nucleoprotein Complex in Xer Site-Specific Recombination
;
unspecified 
PDB 1BLL 
;X-RAY CRYSTALLOGRAPHIC DETERMINATION OF THE STRUCTURE OF BOVINE LENS LEUCINE  
AMINOPEPTIDASE COMPLEXED WITH AMASTATIN: FORMULATION OF A CATALYTIC MECHANISM  
FEATURING A GEM-DIOLATE TRANSITION STATE
;
unspecified 
PDB 3H8F 'High pH native structure of leucine aminopeptidase from Pseudomonas putida' unspecified 
PDB 3H8G 'Bestatin complex structure of leucine aminopeptidase from Pseudomonas putida' unspecified 
# 
_pdbx_database_status.entry_id                        3H8E 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-04-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kale, A.'             1 
'Dijkstra, B.W.'       2 
'Sonke, T.'            3 
'Thunnissen, A.M.W.H.' 4 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            398 
_citation.page_first                703 
_citation.page_last                 714 
_citation.year                      2010 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20359484 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2010.03.042 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kale, A.'         1 
primary 'Pijning, T.'      2 
primary 'Sonke, T.'        3 
primary 'Dijkstra, B.W.'   4 
primary 'Thunnissen, A.M.' 5 
# 
_cell.entry_id           3H8E 
_cell.length_a           116.946 
_cell.length_b           116.946 
_cell.length_c           137.899 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3H8E 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Cytosol aminopeptidase' 
_entity.formula_weight             52531.344 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    3.4.11.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Leucine aminopeptidase, LAP, Leucyl aminopeptidase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGK
DEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLL
ADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQG
SDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACA
ENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLV
GQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGAT
GRPVPLLTQYLLDRAGA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGK
DEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLL
ADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQG
SDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACA
ENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLV
GQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGAT
GRPVPLLTQYLLDRAGA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   LEU n 
1 4   VAL n 
1 5   VAL n 
1 6   LYS n 
1 7   SER n 
1 8   VAL n 
1 9   ALA n 
1 10  ALA n 
1 11  ALA n 
1 12  SER n 
1 13  VAL n 
1 14  LYS n 
1 15  THR n 
1 16  ALA n 
1 17  THR n 
1 18  LEU n 
1 19  VAL n 
1 20  ILE n 
1 21  PRO n 
1 22  VAL n 
1 23  GLY n 
1 24  GLU n 
1 25  ASN n 
1 26  ARG n 
1 27  LYS n 
1 28  LEU n 
1 29  GLY n 
1 30  ALA n 
1 31  VAL n 
1 32  ALA n 
1 33  LYS n 
1 34  ALA n 
1 35  VAL n 
1 36  ASP n 
1 37  LEU n 
1 38  ALA n 
1 39  SER n 
1 40  GLU n 
1 41  GLY n 
1 42  ALA n 
1 43  ILE n 
1 44  SER n 
1 45  ALA n 
1 46  VAL n 
1 47  LEU n 
1 48  LYS n 
1 49  ARG n 
1 50  GLY n 
1 51  ASP n 
1 52  LEU n 
1 53  ALA n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  GLY n 
1 58  GLN n 
1 59  THR n 
1 60  LEU n 
1 61  LEU n 
1 62  LEU n 
1 63  GLN n 
1 64  ASN n 
1 65  LEU n 
1 66  GLN n 
1 67  GLY n 
1 68  LEU n 
1 69  LYS n 
1 70  ALA n 
1 71  GLU n 
1 72  ARG n 
1 73  VAL n 
1 74  LEU n 
1 75  LEU n 
1 76  VAL n 
1 77  GLY n 
1 78  SER n 
1 79  GLY n 
1 80  LYS n 
1 81  ASP n 
1 82  GLU n 
1 83  ALA n 
1 84  LEU n 
1 85  GLY n 
1 86  ASP n 
1 87  ARG n 
1 88  THR n 
1 89  TRP n 
1 90  ARG n 
1 91  LYS n 
1 92  LEU n 
1 93  VAL n 
1 94  ALA n 
1 95  SER n 
1 96  VAL n 
1 97  ALA n 
1 98  GLY n 
1 99  VAL n 
1 100 LEU n 
1 101 LYS n 
1 102 GLY n 
1 103 LEU n 
1 104 ASN n 
1 105 GLY n 
1 106 ALA n 
1 107 ASP n 
1 108 ALA n 
1 109 VAL n 
1 110 LEU n 
1 111 ALA n 
1 112 LEU n 
1 113 ASP n 
1 114 ASP n 
1 115 VAL n 
1 116 ALA n 
1 117 VAL n 
1 118 ASN n 
1 119 ASN n 
1 120 ARG n 
1 121 ASP n 
1 122 ALA n 
1 123 HIS n 
1 124 TYR n 
1 125 GLY n 
1 126 LYS n 
1 127 TYR n 
1 128 ARG n 
1 129 LEU n 
1 130 LEU n 
1 131 ALA n 
1 132 GLU n 
1 133 THR n 
1 134 LEU n 
1 135 LEU n 
1 136 ASP n 
1 137 GLY n 
1 138 GLU n 
1 139 TYR n 
1 140 VAL n 
1 141 PHE n 
1 142 ASP n 
1 143 ARG n 
1 144 PHE n 
1 145 LYS n 
1 146 SER n 
1 147 GLN n 
1 148 LYS n 
1 149 VAL n 
1 150 GLU n 
1 151 PRO n 
1 152 ARG n 
1 153 ALA n 
1 154 LEU n 
1 155 LYS n 
1 156 LYS n 
1 157 VAL n 
1 158 THR n 
1 159 LEU n 
1 160 LEU n 
1 161 ALA n 
1 162 ASP n 
1 163 LYS n 
1 164 ALA n 
1 165 GLY n 
1 166 GLN n 
1 167 ALA n 
1 168 GLU n 
1 169 VAL n 
1 170 GLU n 
1 171 ARG n 
1 172 ALA n 
1 173 VAL n 
1 174 LYS n 
1 175 HIS n 
1 176 ALA n 
1 177 SER n 
1 178 ALA n 
1 179 ILE n 
1 180 ALA n 
1 181 THR n 
1 182 GLY n 
1 183 MET n 
1 184 ALA n 
1 185 PHE n 
1 186 THR n 
1 187 ARG n 
1 188 ASP n 
1 189 LEU n 
1 190 GLY n 
1 191 ASN n 
1 192 LEU n 
1 193 PRO n 
1 194 PRO n 
1 195 ASN n 
1 196 LEU n 
1 197 CYS n 
1 198 HIS n 
1 199 PRO n 
1 200 SER n 
1 201 PHE n 
1 202 LEU n 
1 203 ALA n 
1 204 GLU n 
1 205 GLN n 
1 206 ALA n 
1 207 LYS n 
1 208 GLU n 
1 209 LEU n 
1 210 GLY n 
1 211 LYS n 
1 212 ALA n 
1 213 HIS n 
1 214 LYS n 
1 215 ALA n 
1 216 LEU n 
1 217 LYS n 
1 218 VAL n 
1 219 GLU n 
1 220 VAL n 
1 221 LEU n 
1 222 ASP n 
1 223 GLU n 
1 224 LYS n 
1 225 LYS n 
1 226 ILE n 
1 227 LYS n 
1 228 ASP n 
1 229 LEU n 
1 230 GLY n 
1 231 MET n 
1 232 GLY n 
1 233 ALA n 
1 234 PHE n 
1 235 TYR n 
1 236 ALA n 
1 237 VAL n 
1 238 GLY n 
1 239 GLN n 
1 240 GLY n 
1 241 SER n 
1 242 ASP n 
1 243 GLN n 
1 244 PRO n 
1 245 PRO n 
1 246 ARG n 
1 247 LEU n 
1 248 ILE n 
1 249 VAL n 
1 250 LEU n 
1 251 ASN n 
1 252 TYR n 
1 253 GLN n 
1 254 GLY n 
1 255 GLY n 
1 256 LYS n 
1 257 LYS n 
1 258 ALA n 
1 259 ASP n 
1 260 LYS n 
1 261 PRO n 
1 262 PHE n 
1 263 VAL n 
1 264 LEU n 
1 265 VAL n 
1 266 GLY n 
1 267 LYS n 
1 268 GLY n 
1 269 ILE n 
1 270 THR n 
1 271 PHE n 
1 272 ASP n 
1 273 THR n 
1 274 GLY n 
1 275 GLY n 
1 276 ILE n 
1 277 SER n 
1 278 LEU n 
1 279 LYS n 
1 280 PRO n 
1 281 GLY n 
1 282 ALA n 
1 283 GLY n 
1 284 MET n 
1 285 ASP n 
1 286 GLU n 
1 287 MET n 
1 288 LYS n 
1 289 TYR n 
1 290 ASP n 
1 291 MET n 
1 292 CYS n 
1 293 GLY n 
1 294 ALA n 
1 295 ALA n 
1 296 SER n 
1 297 VAL n 
1 298 PHE n 
1 299 GLY n 
1 300 THR n 
1 301 LEU n 
1 302 ARG n 
1 303 ALA n 
1 304 VAL n 
1 305 LEU n 
1 306 GLU n 
1 307 LEU n 
1 308 GLN n 
1 309 LEU n 
1 310 PRO n 
1 311 VAL n 
1 312 ASN n 
1 313 LEU n 
1 314 VAL n 
1 315 CYS n 
1 316 LEU n 
1 317 LEU n 
1 318 ALA n 
1 319 CYS n 
1 320 ALA n 
1 321 GLU n 
1 322 ASN n 
1 323 MET n 
1 324 PRO n 
1 325 SER n 
1 326 GLY n 
1 327 GLY n 
1 328 ALA n 
1 329 THR n 
1 330 ARG n 
1 331 PRO n 
1 332 GLY n 
1 333 ASP n 
1 334 ILE n 
1 335 VAL n 
1 336 THR n 
1 337 THR n 
1 338 MET n 
1 339 SER n 
1 340 GLY n 
1 341 GLN n 
1 342 THR n 
1 343 VAL n 
1 344 GLU n 
1 345 ILE n 
1 346 LEU n 
1 347 ASN n 
1 348 THR n 
1 349 ASP n 
1 350 ALA n 
1 351 GLU n 
1 352 GLY n 
1 353 ARG n 
1 354 LEU n 
1 355 VAL n 
1 356 LEU n 
1 357 CYS n 
1 358 ASP n 
1 359 THR n 
1 360 LEU n 
1 361 THR n 
1 362 TYR n 
1 363 ALA n 
1 364 GLU n 
1 365 ARG n 
1 366 PHE n 
1 367 LYS n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 VAL n 
1 372 ILE n 
1 373 ASP n 
1 374 ILE n 
1 375 ALA n 
1 376 THR n 
1 377 LEU n 
1 378 THR n 
1 379 GLY n 
1 380 ALA n 
1 381 CYS n 
1 382 ILE n 
1 383 VAL n 
1 384 ALA n 
1 385 LEU n 
1 386 GLY n 
1 387 SER n 
1 388 HIS n 
1 389 THR n 
1 390 THR n 
1 391 GLY n 
1 392 LEU n 
1 393 MET n 
1 394 GLY n 
1 395 ASN n 
1 396 ASN n 
1 397 ASP n 
1 398 ASP n 
1 399 LEU n 
1 400 VAL n 
1 401 GLY n 
1 402 GLN n 
1 403 LEU n 
1 404 LEU n 
1 405 ASP n 
1 406 ALA n 
1 407 GLY n 
1 408 LYS n 
1 409 ARG n 
1 410 ALA n 
1 411 ASP n 
1 412 ASP n 
1 413 ARG n 
1 414 ALA n 
1 415 TRP n 
1 416 GLN n 
1 417 LEU n 
1 418 PRO n 
1 419 LEU n 
1 420 PHE n 
1 421 ASP n 
1 422 GLU n 
1 423 TYR n 
1 424 GLN n 
1 425 GLU n 
1 426 GLN n 
1 427 LEU n 
1 428 ASP n 
1 429 SER n 
1 430 PRO n 
1 431 PHE n 
1 432 ALA n 
1 433 ASP n 
1 434 MET n 
1 435 GLY n 
1 436 ASN n 
1 437 ILE n 
1 438 GLY n 
1 439 GLY n 
1 440 PRO n 
1 441 LYS n 
1 442 ALA n 
1 443 GLY n 
1 444 THR n 
1 445 ILE n 
1 446 THR n 
1 447 ALA n 
1 448 GLY n 
1 449 CYS n 
1 450 PHE n 
1 451 LEU n 
1 452 SER n 
1 453 ARG n 
1 454 PHE n 
1 455 ALA n 
1 456 LYS n 
1 457 ALA n 
1 458 TYR n 
1 459 ASN n 
1 460 TRP n 
1 461 ALA n 
1 462 HIS n 
1 463 MET n 
1 464 ASP n 
1 465 ILE n 
1 466 ALA n 
1 467 GLY n 
1 468 THR n 
1 469 ALA n 
1 470 TRP n 
1 471 ILE n 
1 472 SER n 
1 473 GLY n 
1 474 GLY n 
1 475 LYS n 
1 476 ASP n 
1 477 LYS n 
1 478 GLY n 
1 479 ALA n 
1 480 THR n 
1 481 GLY n 
1 482 ARG n 
1 483 PRO n 
1 484 VAL n 
1 485 PRO n 
1 486 LEU n 
1 487 LEU n 
1 488 THR n 
1 489 GLN n 
1 490 TYR n 
1 491 LEU n 
1 492 LEU n 
1 493 ASP n 
1 494 ARG n 
1 495 ALA n 
1 496 GLY n 
1 497 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pepA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ATCC12633 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas putida' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     303 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTrpLAP 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AMPA_PSEPU 
_struct_ref.pdbx_db_accession          O86436 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGK
DEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLL
ADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQG
SDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACA
ENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLV
GQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGAT
GRPVPLLTQYLLDRAGA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3H8E A 1 ? 497 ? O86436 1 ? 497 ? 1 497 
2 1 3H8E B 1 ? 497 ? O86436 1 ? 497 ? 1 497 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3H8E 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   52.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.2 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'11% (w/v) PEG 8000, 0.2 M Na formate, 0.1 M MES-NaOH, pH 5.2, 1 mM NaN3, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4r' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9300 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-3' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9300 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-3 
# 
_reflns.entry_id                     3H8E 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.75 
_reflns.d_resolution_low             101.535 
_reflns.number_all                   27831 
_reflns.number_obs                   27831 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.353 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        33.5 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.75 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3H8E 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.750 
_refine.ls_d_res_low                             58.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    100.000 
_refine.ls_number_reflns_obs                     27828 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.212 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.267 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  1313 
_refine.ls_number_reflns_R_work                  26515 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               13.301 
_refine.solvent_model_param_bsol                 32.163 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            5.583 
_refine.aniso_B[2][2]                            5.673 
_refine.aniso_B[3][3]                            -11.171 
_refine.aniso_B[1][2]                            -5.789 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                60.47 
_refine.B_iso_min                                3.86 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7006 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7006 
_refine_hist.d_res_high                       2.750 
_refine_hist.d_res_low                        58.000 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' c_mcbond_it  ? 0.016 1.500 ? ? 
'X-RAY DIFFRACTION' c_scbond_it  ? 0.763 1.500 ? ? 
'X-RAY DIFFRACTION' c_mcangle_it ? 1.723 2.000 ? ? 
'X-RAY DIFFRACTION' c_scangle_it ? 1.429 2.500 ? ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       CNS_TOPPAR:protein_rep.param 
_pdbx_xplor_file.topol_file       ? 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3H8E 
_struct.title                     'Low pH native structure of leucine aminopeptidase from Pseudomonas putida' 
_struct.pdbx_descriptor           'Cytosol aminopeptidase (E.C.3.4.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3H8E 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Aminopeptidase, Cytoplasm, Hydrolase, Manganese, Metal-binding, Protease' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 9   ? VAL A 13  ? ALA A 9   VAL A 13  5 ? 5  
HELX_P HELX_P2  2  ASN A 25  ? LYS A 27  ? ASN A 25  LYS A 27  5 ? 3  
HELX_P HELX_P3  3  GLY A 29  ? SER A 39  ? GLY A 29  SER A 39  1 ? 11 
HELX_P HELX_P4  4  GLY A 41  ? ARG A 49  ? GLY A 41  ARG A 49  1 ? 9  
HELX_P HELX_P5  5  GLY A 85  ? LEU A 103 ? GLY A 85  LEU A 103 1 ? 19 
HELX_P HELX_P6  6  HIS A 123 ? GLY A 137 ? HIS A 123 GLY A 137 1 ? 15 
HELX_P HELX_P7  7  GLY A 165 ? LEU A 192 ? GLY A 165 LEU A 192 1 ? 28 
HELX_P HELX_P8  8  HIS A 198 ? HIS A 213 ? HIS A 198 HIS A 213 1 ? 16 
HELX_P HELX_P9  9  ASP A 222 ? LEU A 229 ? ASP A 222 LEU A 229 1 ? 8  
HELX_P HELX_P10 10 MET A 231 ? GLN A 239 ? MET A 231 GLN A 239 1 ? 9  
HELX_P HELX_P11 11 MET A 291 ? GLN A 308 ? MET A 291 GLN A 308 1 ? 18 
HELX_P HELX_P12 12 GLU A 351 ? GLU A 364 ? GLU A 351 GLU A 364 1 ? 14 
HELX_P HELX_P13 13 ARG A 365 ? LYS A 367 ? ARG A 365 LYS A 367 5 ? 3  
HELX_P HELX_P14 14 THR A 378 ? GLY A 386 ? THR A 378 GLY A 386 1 ? 9  
HELX_P HELX_P15 15 ASN A 396 ? ASP A 411 ? ASN A 396 ASP A 411 1 ? 16 
HELX_P HELX_P16 16 PHE A 420 ? ASP A 428 ? PHE A 420 ASP A 428 5 ? 9  
HELX_P HELX_P17 17 ALA A 442 ? ARG A 453 ? ALA A 442 ARG A 453 1 ? 12 
HELX_P HELX_P18 18 PRO A 483 ? GLY A 496 ? PRO A 483 GLY A 496 1 ? 14 
HELX_P HELX_P19 19 ALA B 9   ? VAL B 13  ? ALA B 9   VAL B 13  5 ? 5  
HELX_P HELX_P20 20 GLY B 23  ? LYS B 27  ? GLY B 23  LYS B 27  5 ? 5  
HELX_P HELX_P21 21 GLY B 29  ? SER B 39  ? GLY B 29  SER B 39  1 ? 11 
HELX_P HELX_P22 22 GLY B 41  ? ARG B 49  ? GLY B 41  ARG B 49  1 ? 9  
HELX_P HELX_P23 23 GLY B 85  ? LEU B 103 ? GLY B 85  LEU B 103 1 ? 19 
HELX_P HELX_P24 24 HIS B 123 ? GLU B 138 ? HIS B 123 GLU B 138 1 ? 16 
HELX_P HELX_P25 25 ASP B 162 ? ALA B 164 ? ASP B 162 ALA B 164 5 ? 3  
HELX_P HELX_P26 26 GLY B 165 ? LEU B 192 ? GLY B 165 LEU B 192 1 ? 28 
HELX_P HELX_P27 27 HIS B 198 ? HIS B 213 ? HIS B 198 HIS B 213 1 ? 16 
HELX_P HELX_P28 28 ASP B 222 ? LEU B 229 ? ASP B 222 LEU B 229 1 ? 8  
HELX_P HELX_P29 29 MET B 231 ? GLN B 239 ? MET B 231 GLN B 239 1 ? 9  
HELX_P HELX_P30 30 MET B 291 ? GLN B 308 ? MET B 291 GLN B 308 1 ? 18 
HELX_P HELX_P31 31 GLU B 351 ? GLU B 364 ? GLU B 351 GLU B 364 1 ? 14 
HELX_P HELX_P32 32 ARG B 365 ? LYS B 367 ? ARG B 365 LYS B 367 5 ? 3  
HELX_P HELX_P33 33 THR B 378 ? GLY B 386 ? THR B 378 GLY B 386 1 ? 9  
HELX_P HELX_P34 34 ASN B 396 ? ASP B 411 ? ASN B 396 ASP B 411 1 ? 16 
HELX_P HELX_P35 35 PHE B 420 ? ASP B 428 ? PHE B 420 ASP B 428 5 ? 9  
HELX_P HELX_P36 36 ALA B 442 ? ARG B 453 ? ALA B 442 ARG B 453 1 ? 12 
HELX_P HELX_P37 37 ARG B 482 ? ALA B 495 ? ARG B 482 ALA B 495 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           482 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            482 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    483 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     483 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       12.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 8 ? 
C ? 3 ? 
D ? 2 ? 
E ? 6 ? 
F ? 8 ? 
G ? 3 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? anti-parallel 
F 7 8 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? parallel      
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 2   ? LYS A 6   ? GLU A 2   LYS A 6   
A 2 LYS A 156 ? LEU A 160 ? LYS A 156 LEU A 160 
A 3 ASP A 107 ? LEU A 110 ? ASP A 107 LEU A 110 
A 4 LEU A 18  ? GLY A 23  ? LEU A 18  GLY A 23  
A 5 VAL A 73  ? GLY A 79  ? VAL A 73  GLY A 79  
A 6 THR A 59  ? LEU A 62  ? THR A 59  LEU A 62  
B 1 LEU A 216 ? LEU A 221 ? LEU A 216 LEU A 221 
B 2 ARG A 246 ? GLN A 253 ? ARG A 246 GLN A 253 
B 3 ASN A 312 ? CYS A 319 ? ASN A 312 CYS A 319 
B 4 PHE A 262 ? GLY A 268 ? PHE A 262 GLY A 268 
B 5 ALA A 370 ? ALA A 375 ? ALA A 370 ALA A 375 
B 6 TRP A 460 ? ASP A 464 ? TRP A 460 ASP A 464 
B 7 THR A 390 ? GLY A 394 ? THR A 390 GLY A 394 
B 8 ALA A 414 ? GLN A 416 ? ALA A 414 GLN A 416 
C 1 ASP A 333 ? THR A 336 ? ASP A 333 THR A 336 
C 2 THR A 342 ? ILE A 345 ? THR A 342 ILE A 345 
C 3 MET A 434 ? GLY A 435 ? MET A 434 GLY A 435 
D 1 TRP A 470 ? ILE A 471 ? TRP A 470 ILE A 471 
D 2 GLY A 478 ? ALA A 479 ? GLY A 478 ALA A 479 
E 1 GLU B 2   ? LYS B 6   ? GLU B 2   LYS B 6   
E 2 LYS B 156 ? LEU B 160 ? LYS B 156 LEU B 160 
E 3 ASP B 107 ? LEU B 110 ? ASP B 107 LEU B 110 
E 4 LEU B 18  ? VAL B 22  ? LEU B 18  VAL B 22  
E 5 VAL B 73  ? GLY B 77  ? VAL B 73  GLY B 77  
E 6 THR B 59  ? LEU B 62  ? THR B 59  LEU B 62  
F 1 LEU B 216 ? LEU B 221 ? LEU B 216 LEU B 221 
F 2 ARG B 246 ? GLN B 253 ? ARG B 246 GLN B 253 
F 3 ASN B 312 ? CYS B 319 ? ASN B 312 CYS B 319 
F 4 PHE B 262 ? GLY B 268 ? PHE B 262 GLY B 268 
F 5 ALA B 370 ? ALA B 375 ? ALA B 370 ALA B 375 
F 6 TRP B 460 ? ASP B 464 ? TRP B 460 ASP B 464 
F 7 THR B 390 ? GLY B 394 ? THR B 390 GLY B 394 
F 8 ALA B 414 ? GLN B 416 ? ALA B 414 GLN B 416 
G 1 ASP B 333 ? THR B 336 ? ASP B 333 THR B 336 
G 2 THR B 342 ? ILE B 345 ? THR B 342 ILE B 345 
G 3 MET B 434 ? GLY B 435 ? MET B 434 GLY B 435 
H 1 TRP B 470 ? ILE B 471 ? TRP B 470 ILE B 471 
H 2 GLY B 478 ? ALA B 479 ? GLY B 478 ALA B 479 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 4   ? N VAL A 4   O LEU A 159 ? O LEU A 159 
A 2 3 O THR A 158 ? O THR A 158 N LEU A 110 ? N LEU A 110 
A 3 4 O VAL A 109 ? O VAL A 109 N VAL A 19  ? N VAL A 19  
A 4 5 N LEU A 18  ? N LEU A 18  O LEU A 74  ? O LEU A 74  
A 5 6 O VAL A 73  ? O VAL A 73  N LEU A 62  ? N LEU A 62  
B 1 2 N GLU A 219 ? N GLU A 219 O VAL A 249 ? O VAL A 249 
B 2 3 N TYR A 252 ? N TYR A 252 O LEU A 313 ? O LEU A 313 
B 3 4 O LEU A 316 ? O LEU A 316 N LEU A 264 ? N LEU A 264 
B 4 5 N VAL A 263 ? N VAL A 263 O ALA A 370 ? O ALA A 370 
B 5 6 N ASP A 373 ? N ASP A 373 O MET A 463 ? O MET A 463 
B 6 7 O HIS A 462 ? O HIS A 462 N MET A 393 ? N MET A 393 
B 7 8 N LEU A 392 ? N LEU A 392 O TRP A 415 ? O TRP A 415 
C 1 2 N ASP A 333 ? N ASP A 333 O ILE A 345 ? O ILE A 345 
C 2 3 N GLU A 344 ? N GLU A 344 O MET A 434 ? O MET A 434 
D 1 2 N ILE A 471 ? N ILE A 471 O GLY A 478 ? O GLY A 478 
E 1 2 N GLU B 2   ? N GLU B 2   O VAL B 157 ? O VAL B 157 
E 2 3 O THR B 158 ? O THR B 158 N LEU B 110 ? N LEU B 110 
E 3 4 O VAL B 109 ? O VAL B 109 N VAL B 19  ? N VAL B 19  
E 4 5 N LEU B 18  ? N LEU B 18  O LEU B 74  ? O LEU B 74  
E 5 6 O VAL B 73  ? O VAL B 73  N LEU B 62  ? N LEU B 62  
F 1 2 N LYS B 217 ? N LYS B 217 O ASN B 251 ? O ASN B 251 
F 2 3 N LEU B 250 ? N LEU B 250 O CYS B 315 ? O CYS B 315 
F 3 4 O LEU B 316 ? O LEU B 316 N LEU B 264 ? N LEU B 264 
F 4 5 N VAL B 265 ? N VAL B 265 O ILE B 372 ? O ILE B 372 
F 5 6 N ALA B 375 ? N ALA B 375 O MET B 463 ? O MET B 463 
F 6 7 O HIS B 462 ? O HIS B 462 N MET B 393 ? N MET B 393 
F 7 8 N LEU B 392 ? N LEU B 392 O TRP B 415 ? O TRP B 415 
G 1 2 N ASP B 333 ? N ASP B 333 O ILE B 345 ? O ILE B 345 
G 2 3 N GLU B 344 ? N GLU B 344 O MET B 434 ? O MET B 434 
H 1 2 N ILE B 471 ? N ILE B 471 O GLY B 478 ? O GLY B 478 
# 
_atom_sites.entry_id                    3H8E 
_atom_sites.fract_transf_matrix[1][1]   0.008551 
_atom_sites.fract_transf_matrix[1][2]   0.004937 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009874 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007252 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? -27.058 -0.711  25.557 1.00 31.50 ? 1   MET A N   1 
ATOM 2    C CA  . MET A 1 1   ? -26.120 0.067   26.423 1.00 28.39 ? 1   MET A CA  1 
ATOM 3    C C   . MET A 1 1   ? -24.640 -0.254  26.095 1.00 27.78 ? 1   MET A C   1 
ATOM 4    O O   . MET A 1 1   ? -24.272 -1.427  26.002 1.00 26.96 ? 1   MET A O   1 
ATOM 5    C CB  . MET A 1 1   ? -26.446 -0.182  27.904 1.00 31.27 ? 1   MET A CB  1 
ATOM 6    C CG  . MET A 1 1   ? -25.497 0.483   28.877 1.00 30.59 ? 1   MET A CG  1 
ATOM 7    S SD  . MET A 1 1   ? -25.707 0.379   30.671 1.00 32.19 ? 1   MET A SD  1 
ATOM 8    C CE  . MET A 1 1   ? -25.283 -1.241  31.230 1.00 34.59 ? 1   MET A CE  1 
ATOM 9    N N   . GLU A 1 2   ? -23.812 0.772   25.849 1.00 21.89 ? 2   GLU A N   1 
ATOM 10   C CA  . GLU A 1 2   ? -22.400 0.613   25.628 1.00 22.08 ? 2   GLU A CA  1 
ATOM 11   C C   . GLU A 1 2   ? -21.688 0.561   27.010 1.00 19.76 ? 2   GLU A C   1 
ATOM 12   O O   . GLU A 1 2   ? -22.116 1.277   27.909 1.00 18.60 ? 2   GLU A O   1 
ATOM 13   C CB  . GLU A 1 2   ? -21.891 1.792   24.821 1.00 24.48 ? 2   GLU A CB  1 
ATOM 14   C CG  . GLU A 1 2   ? -20.438 1.673   24.414 1.00 29.70 ? 2   GLU A CG  1 
ATOM 15   C CD  . GLU A 1 2   ? -19.816 2.967   23.775 1.00 37.89 ? 2   GLU A CD  1 
ATOM 16   O OE1 . GLU A 1 2   ? -20.444 4.086   23.754 1.00 40.31 ? 2   GLU A OE1 1 
ATOM 17   O OE2 . GLU A 1 2   ? -18.648 2.830   23.323 1.00 39.47 ? 2   GLU A OE2 1 
ATOM 18   N N   . LEU A 1 3   ? -20.775 -0.385  27.162 1.00 15.21 ? 3   LEU A N   1 
ATOM 19   C CA  . LEU A 1 3   ? -20.035 -0.534  28.388 1.00 16.54 ? 3   LEU A CA  1 
ATOM 20   C C   . LEU A 1 3   ? -18.588 -0.349  28.014 1.00 17.70 ? 3   LEU A C   1 
ATOM 21   O O   . LEU A 1 3   ? -18.058 -1.047  27.150 1.00 19.21 ? 3   LEU A O   1 
ATOM 22   C CB  . LEU A 1 3   ? -20.255 -1.924  28.988 1.00 17.41 ? 3   LEU A CB  1 
ATOM 23   C CG  . LEU A 1 3   ? -19.682 -2.157  30.387 1.00 21.25 ? 3   LEU A CG  1 
ATOM 24   C CD1 . LEU A 1 3   ? -20.560 -3.118  31.174 1.00 15.65 ? 3   LEU A CD1 1 
ATOM 25   C CD2 . LEU A 1 3   ? -18.254 -2.672  30.306 1.00 18.69 ? 3   LEU A CD2 1 
ATOM 26   N N   . VAL A 1 4   ? -17.950 0.599   28.675 1.00 13.60 ? 4   VAL A N   1 
ATOM 27   C CA  . VAL A 1 4   ? -16.523 0.862   28.440 1.00 14.75 ? 4   VAL A CA  1 
ATOM 28   C C   . VAL A 1 4   ? -15.708 1.000   29.730 1.00 15.05 ? 4   VAL A C   1 
ATOM 29   O O   . VAL A 1 4   ? -16.310 1.228   30.822 1.00 14.62 ? 4   VAL A O   1 
ATOM 30   C CB  . VAL A 1 4   ? -16.317 2.125   27.610 1.00 16.27 ? 4   VAL A CB  1 
ATOM 31   C CG1 . VAL A 1 4   ? -17.154 2.011   26.287 1.00 20.04 ? 4   VAL A CG1 1 
ATOM 32   C CG2 . VAL A 1 4   ? -16.757 3.408   28.297 1.00 14.79 ? 4   VAL A CG2 1 
ATOM 33   N N   . VAL A 1 5   ? -14.395 0.907   29.601 1.00 14.01 ? 5   VAL A N   1 
ATOM 34   C CA  . VAL A 1 5   ? -13.551 0.915   30.745 1.00 14.28 ? 5   VAL A CA  1 
ATOM 35   C C   . VAL A 1 5   ? -12.508 1.996   30.587 1.00 17.17 ? 5   VAL A C   1 
ATOM 36   O O   . VAL A 1 5   ? -11.857 2.087   29.513 1.00 20.02 ? 5   VAL A O   1 
ATOM 37   C CB  . VAL A 1 5   ? -12.797 -0.450  30.963 1.00 12.62 ? 5   VAL A CB  1 
ATOM 38   C CG1 . VAL A 1 5   ? -11.985 -0.404  32.289 1.00 17.75 ? 5   VAL A CG1 1 
ATOM 39   C CG2 . VAL A 1 5   ? -13.819 -1.636  30.968 1.00 14.60 ? 5   VAL A CG2 1 
ATOM 40   N N   . LYS A 1 6   ? -12.343 2.777   31.637 1.00 18.38 ? 6   LYS A N   1 
ATOM 41   C CA  . LYS A 1 6   ? -11.242 3.764   31.651 1.00 17.57 ? 6   LYS A CA  1 
ATOM 42   C C   . LYS A 1 6   ? -10.439 3.713   32.935 1.00 20.64 ? 6   LYS A C   1 
ATOM 43   O O   . LYS A 1 6   ? -10.836 3.099   33.945 1.00 16.57 ? 6   LYS A O   1 
ATOM 44   C CB  . LYS A 1 6   ? -11.810 5.189   31.459 1.00 19.14 ? 6   LYS A CB  1 
ATOM 45   C CG  . LYS A 1 6   ? -12.513 5.363   30.063 1.00 16.78 ? 6   LYS A CG  1 
ATOM 46   C CD  . LYS A 1 6   ? -13.011 6.811   29.907 1.00 26.10 ? 6   LYS A CD  1 
ATOM 47   C CE  . LYS A 1 6   ? -13.616 6.991   28.488 1.00 35.44 ? 6   LYS A CE  1 
ATOM 48   N NZ  . LYS A 1 6   ? -14.377 8.308   28.446 1.00 37.66 ? 6   LYS A NZ  1 
ATOM 49   N N   . SER A 1 7   ? -9.296  4.420   32.988 1.00 20.43 ? 7   SER A N   1 
ATOM 50   C CA  . SER A 1 7   ? -8.528  4.384   34.239 1.00 23.11 ? 7   SER A CA  1 
ATOM 51   C C   . SER A 1 7   ? -8.169  5.784   34.784 1.00 23.91 ? 7   SER A C   1 
ATOM 52   O O   . SER A 1 7   ? -7.357  5.926   35.753 1.00 26.56 ? 7   SER A O   1 
ATOM 53   C CB  . SER A 1 7   ? -7.290  3.514   34.056 1.00 25.44 ? 7   SER A CB  1 
ATOM 54   O OG  . SER A 1 7   ? -6.547  4.128   33.061 1.00 30.69 ? 7   SER A OG  1 
ATOM 55   N N   . VAL A 1 8   ? -8.883  6.771   34.262 1.00 23.51 ? 8   VAL A N   1 
ATOM 56   C CA  . VAL A 1 8   ? -8.762  8.136   34.734 1.00 23.66 ? 8   VAL A CA  1 
ATOM 57   C C   . VAL A 1 8   ? -9.409  8.350   36.147 1.00 22.70 ? 8   VAL A C   1 
ATOM 58   O O   . VAL A 1 8   ? -10.145 7.485   36.696 1.00 21.28 ? 8   VAL A O   1 
ATOM 59   C CB  . VAL A 1 8   ? -9.366  9.106   33.697 1.00 24.70 ? 8   VAL A CB  1 
ATOM 60   C CG1 . VAL A 1 8   ? -8.724  8.905   32.256 1.00 29.29 ? 8   VAL A CG1 1 
ATOM 61   C CG2 . VAL A 1 8   ? -10.859 8.964   33.608 1.00 23.46 ? 8   VAL A CG2 1 
ATOM 62   N N   . ALA A 1 9   ? -9.109  9.467   36.762 1.00 20.68 ? 9   ALA A N   1 
ATOM 63   C CA  . ALA A 1 9   ? -9.579  9.700   38.131 1.00 17.91 ? 9   ALA A CA  1 
ATOM 64   C C   . ALA A 1 9   ? -11.065 10.011  38.083 1.00 18.12 ? 9   ALA A C   1 
ATOM 65   O O   . ALA A 1 9   ? -11.505 10.749  37.165 1.00 18.34 ? 9   ALA A O   1 
ATOM 66   C CB  . ALA A 1 9   ? -8.781  10.822  38.800 1.00 21.98 ? 9   ALA A CB  1 
ATOM 67   N N   . ALA A 1 10  ? -11.820 9.478   39.068 1.00 16.47 ? 10  ALA A N   1 
ATOM 68   C CA  . ALA A 1 10  ? -13.310 9.650   39.066 1.00 14.81 ? 10  ALA A CA  1 
ATOM 69   C C   . ALA A 1 10  ? -13.737 11.121  38.987 1.00 16.92 ? 10  ALA A C   1 
ATOM 70   O O   . ALA A 1 10  ? -14.677 11.481  38.254 1.00 19.43 ? 10  ALA A O   1 
ATOM 71   C CB  . ALA A 1 10  ? -13.946 9.023   40.248 1.00 16.74 ? 10  ALA A CB  1 
ATOM 72   N N   . ALA A 1 11  ? -13.035 11.993  39.709 1.00 17.67 ? 11  ALA A N   1 
ATOM 73   C CA  . ALA A 1 11  ? -13.392 13.392  39.825 1.00 19.61 ? 11  ALA A CA  1 
ATOM 74   C C   . ALA A 1 11  ? -13.170 14.178  38.494 1.00 19.97 ? 11  ALA A C   1 
ATOM 75   O O   . ALA A 1 11  ? -13.787 15.247  38.262 1.00 25.34 ? 11  ALA A O   1 
ATOM 76   C CB  . ALA A 1 11  ? -12.588 14.024  41.000 1.00 19.54 ? 11  ALA A CB  1 
ATOM 77   N N   . SER A 1 12  ? -12.380 13.580  37.615 1.00 21.23 ? 12  SER A N   1 
ATOM 78   C CA  . SER A 1 12  ? -12.014 14.222  36.374 1.00 23.04 ? 12  SER A CA  1 
ATOM 79   C C   . SER A 1 12  ? -12.971 13.952  35.222 1.00 22.86 ? 12  SER A C   1 
ATOM 80   O O   . SER A 1 12  ? -12.806 14.460  34.111 1.00 23.04 ? 12  SER A O   1 
ATOM 81   C CB  . SER A 1 12  ? -10.588 13.774  36.001 1.00 22.98 ? 12  SER A CB  1 
ATOM 82   O OG  . SER A 1 12  ? -10.602 12.517  35.279 1.00 25.32 ? 12  SER A OG  1 
ATOM 83   N N   . VAL A 1 13  ? -13.925 13.051  35.426 1.00 19.98 ? 13  VAL A N   1 
ATOM 84   C CA  . VAL A 1 13  ? -14.633 12.563  34.250 1.00 19.55 ? 13  VAL A CA  1 
ATOM 85   C C   . VAL A 1 13  ? -15.956 13.342  34.057 1.00 19.54 ? 13  VAL A C   1 
ATOM 86   O O   . VAL A 1 13  ? -16.771 13.372  34.941 1.00 19.31 ? 13  VAL A O   1 
ATOM 87   C CB  . VAL A 1 13  ? -14.917 11.000  34.347 1.00 19.69 ? 13  VAL A CB  1 
ATOM 88   C CG1 . VAL A 1 13  ? -15.515 10.570  33.061 1.00 19.54 ? 13  VAL A CG1 1 
ATOM 89   C CG2 . VAL A 1 13  ? -13.643 10.194  34.620 1.00 24.52 ? 13  VAL A CG2 1 
ATOM 90   N N   . LYS A 1 14  ? -16.149 13.963  32.897 1.00 17.64 ? 14  LYS A N   1 
ATOM 91   C CA  . LYS A 1 14  ? -17.425 14.627  32.570 1.00 18.25 ? 14  LYS A CA  1 
ATOM 92   C C   . LYS A 1 14  ? -18.458 13.528  32.314 1.00 17.56 ? 14  LYS A C   1 
ATOM 93   O O   . LYS A 1 14  ? -18.307 12.671  31.437 1.00 19.32 ? 14  LYS A O   1 
ATOM 94   C CB  . LYS A 1 14  ? -17.222 15.357  31.238 1.00 19.40 ? 14  LYS A CB  1 
ATOM 95   C CG  . LYS A 1 14  ? -18.298 16.320  30.953 1.00 27.90 ? 14  LYS A CG  1 
ATOM 96   C CD  . LYS A 1 14  ? -18.004 17.112  29.641 1.00 33.94 ? 14  LYS A CD  1 
ATOM 97   C CE  . LYS A 1 14  ? -19.135 18.108  29.331 1.00 40.95 ? 14  LYS A CE  1 
ATOM 98   N NZ  . LYS A 1 14  ? -20.403 17.358  28.998 1.00 42.28 ? 14  LYS A NZ  1 
ATOM 99   N N   . THR A 1 15  ? -19.543 13.589  33.077 1.00 15.05 ? 15  THR A N   1 
ATOM 100  C CA  . THR A 1 15  ? -20.556 12.518  33.004 1.00 14.34 ? 15  THR A CA  1 
ATOM 101  C C   . THR A 1 15  ? -21.856 13.110  33.557 1.00 13.56 ? 15  THR A C   1 
ATOM 102  O O   . THR A 1 15  ? -21.857 14.047  34.377 1.00 13.39 ? 15  THR A O   1 
ATOM 103  C CB  . THR A 1 15  ? -20.135 11.325  33.786 1.00 14.39 ? 15  THR A CB  1 
ATOM 104  O OG1 . THR A 1 15  ? -21.138 10.336  33.636 1.00 14.59 ? 15  THR A OG1 1 
ATOM 105  C CG2 . THR A 1 15  ? -20.048 11.547  35.255 1.00 12.61 ? 15  THR A CG2 1 
ATOM 106  N N   . ALA A 1 16  ? -22.985 12.551  33.127 1.00 14.00 ? 16  ALA A N   1 
ATOM 107  C CA  . ALA A 1 16  ? -24.278 12.854  33.736 1.00 13.74 ? 16  ALA A CA  1 
ATOM 108  C C   . ALA A 1 16  ? -24.425 12.429  35.185 1.00 11.65 ? 16  ALA A C   1 
ATOM 109  O O   . ALA A 1 16  ? -24.991 13.150  35.992 1.00 11.16 ? 16  ALA A O   1 
ATOM 110  C CB  . ALA A 1 16  ? -25.470 12.240  32.866 1.00 13.43 ? 16  ALA A CB  1 
ATOM 111  N N   . THR A 1 17  ? -23.848 11.254  35.520 1.00 10.21 ? 17  THR A N   1 
ATOM 112  C CA  . THR A 1 17  ? -23.912 10.765  36.922 1.00 9.55  ? 17  THR A CA  1 
ATOM 113  C C   . THR A 1 17  ? -22.660 9.978   37.247 1.00 9.22  ? 17  THR A C   1 
ATOM 114  O O   . THR A 1 17  ? -22.290 8.984   36.540 1.00 10.11 ? 17  THR A O   1 
ATOM 115  C CB  . THR A 1 17  ? -25.106 9.763   37.075 1.00 11.12 ? 17  THR A CB  1 
ATOM 116  O OG1 . THR A 1 17  ? -26.337 10.422  36.649 1.00 11.45 ? 17  THR A OG1 1 
ATOM 117  C CG2 . THR A 1 17  ? -25.320 9.391   38.498 1.00 10.04 ? 17  THR A CG2 1 
ATOM 118  N N   . LEU A 1 18  ? -21.996 10.411  38.318 1.00 8.60  ? 18  LEU A N   1 
ATOM 119  C CA  . LEU A 1 18  ? -20.894 9.611   38.888 1.00 9.63  ? 18  LEU A CA  1 
ATOM 120  C C   . LEU A 1 18  ? -21.374 8.841   40.072 1.00 8.98  ? 18  LEU A C   1 
ATOM 121  O O   . LEU A 1 18  ? -22.029 9.419   40.904 1.00 9.20  ? 18  LEU A O   1 
ATOM 122  C CB  . LEU A 1 18  ? -19.814 10.623  39.354 1.00 10.46 ? 18  LEU A CB  1 
ATOM 123  C CG  . LEU A 1 18  ? -18.683 9.966   40.127 1.00 8.96  ? 18  LEU A CG  1 
ATOM 124  C CD1 . LEU A 1 18  ? -17.837 9.048   39.218 1.00 10.28 ? 18  LEU A CD1 1 
ATOM 125  C CD2 . LEU A 1 18  ? -17.767 11.198  40.687 1.00 12.56 ? 18  LEU A CD2 1 
ATOM 126  N N   . VAL A 1 19  ? -21.074 7.519   40.098 1.00 8.04  ? 19  VAL A N   1 
ATOM 127  C CA  . VAL A 1 19  ? -21.509 6.662   41.183 1.00 7.19  ? 19  VAL A CA  1 
ATOM 128  C C   . VAL A 1 19  ? -20.270 6.225   42.028 1.00 7.22  ? 19  VAL A C   1 
ATOM 129  O O   . VAL A 1 19  ? -19.322 5.665   41.490 1.00 8.66  ? 19  VAL A O   1 
ATOM 130  C CB  . VAL A 1 19  ? -22.163 5.403   40.617 1.00 8.03  ? 19  VAL A CB  1 
ATOM 131  C CG1 . VAL A 1 19  ? -22.691 4.547   41.804 1.00 8.39  ? 19  VAL A CG1 1 
ATOM 132  C CG2 . VAL A 1 19  ? -23.303 5.732   39.628 1.00 10.82 ? 19  VAL A CG2 1 
ATOM 133  N N   . ILE A 1 20  ? -20.377 6.455   43.326 1.00 8.28  ? 20  ILE A N   1 
ATOM 134  C CA  . ILE A 1 20  ? -19.286 6.073   44.296 1.00 9.55  ? 20  ILE A CA  1 
ATOM 135  C C   . ILE A 1 20  ? -19.932 5.348   45.440 1.00 9.22  ? 20  ILE A C   1 
ATOM 136  O O   . ILE A 1 20  ? -21.109 5.638   45.844 1.00 8.64  ? 20  ILE A O   1 
ATOM 137  C CB  . ILE A 1 20  ? -18.419 7.296   44.777 1.00 9.96  ? 20  ILE A CB  1 
ATOM 138  C CG1 . ILE A 1 20  ? -19.336 8.441   45.236 1.00 12.64 ? 20  ILE A CG1 1 
ATOM 139  C CG2 . ILE A 1 20  ? -17.500 7.712   43.622 1.00 10.82 ? 20  ILE A CG2 1 
ATOM 140  C CD1 . ILE A 1 20  ? -18.465 9.404   46.034 1.00 12.42 ? 20  ILE A CD1 1 
ATOM 141  N N   . PRO A 1 21  ? -19.167 4.438   46.068 1.00 9.74  ? 21  PRO A N   1 
ATOM 142  C CA  . PRO A 1 21  ? -19.710 3.710   47.175 1.00 9.35  ? 21  PRO A CA  1 
ATOM 143  C C   . PRO A 1 21  ? -19.436 4.401   48.538 1.00 10.23 ? 21  PRO A C   1 
ATOM 144  O O   . PRO A 1 21  ? -18.407 5.146   48.757 1.00 11.63 ? 21  PRO A O   1 
ATOM 145  C CB  . PRO A 1 21  ? -18.953 2.367   47.090 1.00 9.73  ? 21  PRO A CB  1 
ATOM 146  C CG  . PRO A 1 21  ? -17.586 2.699   46.498 1.00 10.33 ? 21  PRO A CG  1 
ATOM 147  C CD  . PRO A 1 21  ? -17.758 4.000   45.751 1.00 11.32 ? 21  PRO A CD  1 
ATOM 148  N N   . VAL A 1 22  ? -20.292 4.128   49.485 1.00 8.37  ? 22  VAL A N   1 
ATOM 149  C CA  . VAL A 1 22  ? -20.107 4.676   50.882 1.00 9.69  ? 22  VAL A CA  1 
ATOM 150  C C   . VAL A 1 22  ? -20.462 3.548   51.821 1.00 11.02 ? 22  VAL A C   1 
ATOM 151  O O   . VAL A 1 22  ? -21.514 2.906   51.725 1.00 10.90 ? 22  VAL A O   1 
ATOM 152  C CB  . VAL A 1 22  ? -21.100 5.862   51.147 1.00 11.56 ? 22  VAL A CB  1 
ATOM 153  C CG1 . VAL A 1 22  ? -20.986 6.358   52.594 1.00 13.81 ? 22  VAL A CG1 1 
ATOM 154  C CG2 . VAL A 1 22  ? -20.856 7.010   50.120 1.00 11.63 ? 22  VAL A CG2 1 
ATOM 155  N N   . GLY A 1 23  ? -19.566 3.251   52.792 1.00 10.87 ? 23  GLY A N   1 
ATOM 156  C CA  . GLY A 1 23  ? -19.844 2.220   53.711 1.00 11.94 ? 23  GLY A CA  1 
ATOM 157  C C   . GLY A 1 23  ? -20.669 2.688   54.913 1.00 13.37 ? 23  GLY A C   1 
ATOM 158  O O   . GLY A 1 23  ? -21.086 3.847   54.971 1.00 13.86 ? 23  GLY A O   1 
ATOM 159  N N   . GLU A 1 24  ? -21.040 1.717   55.759 1.00 12.28 ? 24  GLU A N   1 
ATOM 160  C CA  . GLU A 1 24  ? -21.656 2.075   57.042 1.00 13.78 ? 24  GLU A CA  1 
ATOM 161  C C   . GLU A 1 24  ? -20.748 3.054   57.805 1.00 14.86 ? 24  GLU A C   1 
ATOM 162  O O   . GLU A 1 24  ? -19.548 3.208   57.536 1.00 14.65 ? 24  GLU A O   1 
ATOM 163  C CB  . GLU A 1 24  ? -22.041 0.848   57.848 1.00 16.91 ? 24  GLU A CB  1 
ATOM 164  C CG  . GLU A 1 24  ? -23.205 0.163   57.076 1.00 18.37 ? 24  GLU A CG  1 
ATOM 165  C CD  . GLU A 1 24  ? -23.787 -1.198  57.584 1.00 29.23 ? 24  GLU A CD  1 
ATOM 166  O OE1 . GLU A 1 24  ? -23.745 -1.409  58.767 1.00 29.60 ? 24  GLU A OE1 1 
ATOM 167  O OE2 . GLU A 1 24  ? -24.323 -2.042  56.762 1.00 33.78 ? 24  GLU A OE2 1 
ATOM 168  N N   . ASN A 1 25  ? -21.341 3.783   58.744 1.00 15.67 ? 25  ASN A N   1 
ATOM 169  C CA  . ASN A 1 25  ? -20.583 4.870   59.460 1.00 15.65 ? 25  ASN A CA  1 
ATOM 170  C C   . ASN A 1 25  ? -19.957 5.881   58.555 1.00 15.26 ? 25  ASN A C   1 
ATOM 171  O O   . ASN A 1 25  ? -18.902 6.464   58.836 1.00 16.98 ? 25  ASN A O   1 
ATOM 172  C CB  . ASN A 1 25  ? -19.477 4.215   60.413 1.00 16.33 ? 25  ASN A CB  1 
ATOM 173  C CG  . ASN A 1 25  ? -20.038 3.122   61.245 1.00 18.73 ? 25  ASN A CG  1 
ATOM 174  O OD1 . ASN A 1 25  ? -21.144 3.329   61.838 1.00 26.03 ? 25  ASN A OD1 1 
ATOM 175  N ND2 . ASN A 1 25  ? -19.346 1.950   61.384 1.00 17.89 ? 25  ASN A ND2 1 
ATOM 176  N N   . ARG A 1 26  ? -20.561 6.030   57.383 1.00 14.58 ? 26  ARG A N   1 
ATOM 177  C CA  . ARG A 1 26  ? -20.098 7.005   56.411 1.00 14.48 ? 26  ARG A CA  1 
ATOM 178  C C   . ARG A 1 26  ? -18.619 6.796   56.111 1.00 12.43 ? 26  ARG A C   1 
ATOM 179  O O   . ARG A 1 26  ? -17.876 7.765   55.955 1.00 15.88 ? 26  ARG A O   1 
ATOM 180  C CB  . ARG A 1 26  ? -20.336 8.427   56.923 1.00 16.54 ? 26  ARG A CB  1 
ATOM 181  C CG  . ARG A 1 26  ? -21.802 8.816   57.017 1.00 25.04 ? 26  ARG A CG  1 
ATOM 182  C CD  . ARG A 1 26  ? -21.963 10.246  57.508 1.00 34.30 ? 26  ARG A CD  1 
ATOM 183  N NE  . ARG A 1 26  ? -21.485 10.411  58.878 1.00 39.34 ? 26  ARG A NE  1 
ATOM 184  C CZ  . ARG A 1 26  ? -20.325 10.973  59.200 1.00 39.83 ? 26  ARG A CZ  1 
ATOM 185  N NH1 . ARG A 1 26  ? -19.518 11.426  58.250 1.00 44.31 ? 26  ARG A NH1 1 
ATOM 186  N NH2 . ARG A 1 26  ? -19.969 11.082  60.473 1.00 38.17 ? 26  ARG A NH2 1 
ATOM 187  N N   . LYS A 1 27  ? -18.185 5.541   56.030 1.00 14.07 ? 27  LYS A N   1 
ATOM 188  C CA  . LYS A 1 27  ? -16.784 5.284   55.765 1.00 12.47 ? 27  LYS A CA  1 
ATOM 189  C C   . LYS A 1 27  ? -16.491 5.377   54.276 1.00 14.05 ? 27  LYS A C   1 
ATOM 190  O O   . LYS A 1 27  ? -17.109 4.621   53.433 1.00 14.65 ? 27  LYS A O   1 
ATOM 191  C CB  . LYS A 1 27  ? -16.439 3.947   56.288 1.00 12.57 ? 27  LYS A CB  1 
ATOM 192  C CG  . LYS A 1 27  ? -14.889 3.567   56.215 1.00 9.61  ? 27  LYS A CG  1 
ATOM 193  C CD  . LYS A 1 27  ? -14.637 2.307   56.964 1.00 13.39 ? 27  LYS A CD  1 
ATOM 194  C CE  . LYS A 1 27  ? -13.142 1.946   56.757 1.00 12.91 ? 27  LYS A CE  1 
ATOM 195  N NZ  . LYS A 1 27  ? -12.588 1.032   57.833 1.00 12.17 ? 27  LYS A NZ  1 
ATOM 196  N N   . LEU A 1 28  ? -15.543 6.222   53.941 1.00 13.28 ? 28  LEU A N   1 
ATOM 197  C CA  . LEU A 1 28  ? -15.132 6.378   52.540 1.00 12.12 ? 28  LEU A CA  1 
ATOM 198  C C   . LEU A 1 28  ? -13.846 5.708   52.214 1.00 15.07 ? 28  LEU A C   1 
ATOM 199  O O   . LEU A 1 28  ? -12.855 5.922   52.945 1.00 16.56 ? 28  LEU A O   1 
ATOM 200  C CB  . LEU A 1 28  ? -15.057 7.813   52.099 1.00 13.20 ? 28  LEU A CB  1 
ATOM 201  C CG  . LEU A 1 28  ? -16.341 8.669   52.342 1.00 13.63 ? 28  LEU A CG  1 
ATOM 202  C CD1 . LEU A 1 28  ? -16.152 10.071  51.926 1.00 14.40 ? 28  LEU A CD1 1 
ATOM 203  C CD2 . LEU A 1 28  ? -17.519 8.087   51.617 1.00 17.13 ? 28  LEU A CD2 1 
ATOM 204  N N   . GLY A 1 29  ? -13.837 4.851   51.201 1.00 13.75 ? 29  GLY A N   1 
ATOM 205  C CA  . GLY A 1 29  ? -12.562 4.307   50.673 1.00 12.92 ? 29  GLY A CA  1 
ATOM 206  C C   . GLY A 1 29  ? -11.825 5.385   49.901 1.00 14.13 ? 29  GLY A C   1 
ATOM 207  O O   . GLY A 1 29  ? -12.255 6.528   49.771 1.00 13.79 ? 29  GLY A O   1 
ATOM 208  N N   . ALA A 1 30  ? -10.613 5.028   49.521 1.00 13.43 ? 30  ALA A N   1 
ATOM 209  C CA  . ALA A 1 30  ? -9.728  5.951   48.833 1.00 13.90 ? 30  ALA A CA  1 
ATOM 210  C C   . ALA A 1 30  ? -10.338 6.622   47.595 1.00 13.56 ? 30  ALA A C   1 
ATOM 211  O O   . ALA A 1 30  ? -10.181 7.847   47.391 1.00 15.89 ? 30  ALA A O   1 
ATOM 212  C CB  . ALA A 1 30  ? -8.463  5.225   48.405 1.00 16.56 ? 30  ALA A CB  1 
ATOM 213  N N   . VAL A 1 31  ? -11.051 5.852   46.757 1.00 14.00 ? 31  VAL A N   1 
ATOM 214  C CA  . VAL A 1 31  ? -11.689 6.494   45.559 1.00 12.12 ? 31  VAL A CA  1 
ATOM 215  C C   . VAL A 1 31  ? -12.729 7.546   45.977 1.00 13.38 ? 31  VAL A C   1 
ATOM 216  O O   . VAL A 1 31  ? -12.734 8.709   45.492 1.00 13.83 ? 31  VAL A O   1 
ATOM 217  C CB  . VAL A 1 31  ? -12.377 5.432   44.701 1.00 11.52 ? 31  VAL A CB  1 
ATOM 218  C CG1 . VAL A 1 31  ? -13.106 6.058   43.572 1.00 13.41 ? 31  VAL A CG1 1 
ATOM 219  C CG2 . VAL A 1 31  ? -11.291 4.558   44.021 1.00 15.09 ? 31  VAL A CG2 1 
ATOM 220  N N   . ALA A 1 32  ? -13.640 7.184   46.906 1.00 12.44 ? 32  ALA A N   1 
ATOM 221  C CA  . ALA A 1 32  ? -14.660 8.112   47.366 1.00 11.79 ? 32  ALA A CA  1 
ATOM 222  C C   . ALA A 1 32  ? -14.056 9.342   48.087 1.00 12.87 ? 32  ALA A C   1 
ATOM 223  O O   . ALA A 1 32  ? -14.576 10.446  47.922 1.00 12.94 ? 32  ALA A O   1 
ATOM 224  C CB  . ALA A 1 32  ? -15.726 7.410   48.249 1.00 12.87 ? 32  ALA A CB  1 
ATOM 225  N N   . LYS A 1 33  ? -12.979 9.097   48.856 1.00 14.60 ? 33  LYS A N   1 
ATOM 226  C CA  . LYS A 1 33  ? -12.346 10.210  49.590 1.00 14.64 ? 33  LYS A CA  1 
ATOM 227  C C   . LYS A 1 33  ? -11.784 11.211  48.580 1.00 15.02 ? 33  LYS A C   1 
ATOM 228  O O   . LYS A 1 33  ? -11.870 12.441  48.820 1.00 14.08 ? 33  LYS A O   1 
ATOM 229  C CB  . LYS A 1 33  ? -11.253 9.714   50.566 1.00 16.57 ? 33  LYS A CB  1 
ATOM 230  C CG  . LYS A 1 33  ? -11.709 8.888   51.667 1.00 20.23 ? 33  LYS A CG  1 
ATOM 231  C CD  . LYS A 1 33  ? -10.520 8.449   52.581 1.00 25.19 ? 33  LYS A CD  1 
ATOM 232  C CE  . LYS A 1 33  ? -10.998 7.566   53.673 1.00 30.21 ? 33  LYS A CE  1 
ATOM 233  N NZ  . LYS A 1 33  ? -11.924 8.291   54.531 1.00 40.73 ? 33  LYS A NZ  1 
ATOM 234  N N   . ALA A 1 34  ? -11.219 10.726  47.462 1.00 14.72 ? 34  ALA A N   1 
ATOM 235  C CA  . ALA A 1 34  ? -10.608 11.646  46.451 1.00 13.48 ? 34  ALA A CA  1 
ATOM 236  C C   . ALA A 1 34  ? -11.706 12.502  45.806 1.00 14.72 ? 34  ALA A C   1 
ATOM 237  O O   . ALA A 1 34  ? -11.552 13.716  45.522 1.00 15.39 ? 34  ALA A O   1 
ATOM 238  C CB  . ALA A 1 34  ? -9.739  10.933  45.449 1.00 14.11 ? 34  ALA A CB  1 
ATOM 239  N N   . VAL A 1 35  ? -12.891 11.857  45.611 1.00 13.34 ? 35  VAL A N   1 
ATOM 240  C CA  . VAL A 1 35  ? -13.975 12.657  45.036 1.00 12.06 ? 35  VAL A CA  1 
ATOM 241  C C   . VAL A 1 35  ? -14.506 13.670  46.073 1.00 12.34 ? 35  VAL A C   1 
ATOM 242  O O   . VAL A 1 35  ? -14.832 14.769  45.695 1.00 13.84 ? 35  VAL A O   1 
ATOM 243  C CB  . VAL A 1 35  ? -15.111 11.665  44.645 1.00 10.96 ? 35  VAL A CB  1 
ATOM 244  C CG1 . VAL A 1 35  ? -16.349 12.475  44.094 1.00 14.09 ? 35  VAL A CG1 1 
ATOM 245  C CG2 . VAL A 1 35  ? -14.656 10.809  43.501 1.00 12.65 ? 35  VAL A CG2 1 
ATOM 246  N N   . ASP A 1 36  ? -14.630 13.310  47.346 1.00 13.91 ? 36  ASP A N   1 
ATOM 247  C CA  . ASP A 1 36  ? -15.022 14.209  48.355 1.00 12.71 ? 36  ASP A CA  1 
ATOM 248  C C   . ASP A 1 36  ? -14.039 15.423  48.378 1.00 13.67 ? 36  ASP A C   1 
ATOM 249  O O   . ASP A 1 36  ? -14.465 16.594  48.404 1.00 15.36 ? 36  ASP A O   1 
ATOM 250  C CB  . ASP A 1 36  ? -15.026 13.507  49.703 1.00 13.29 ? 36  ASP A CB  1 
ATOM 251  C CG  . ASP A 1 36  ? -15.574 14.375  50.801 1.00 16.40 ? 36  ASP A CG  1 
ATOM 252  O OD1 . ASP A 1 36  ? -16.535 15.138  50.508 1.00 15.06 ? 36  ASP A OD1 1 
ATOM 253  O OD2 . ASP A 1 36  ? -15.047 14.315  51.948 1.00 18.70 ? 36  ASP A OD2 1 
ATOM 254  N N   . LEU A 1 37  ? -12.769 15.120  48.331 1.00 15.43 ? 37  LEU A N   1 
ATOM 255  C CA  . LEU A 1 37  ? -11.776 16.234  48.357 1.00 17.26 ? 37  LEU A CA  1 
ATOM 256  C C   . LEU A 1 37  ? -11.954 17.120  47.147 1.00 15.45 ? 37  LEU A C   1 
ATOM 257  O O   . LEU A 1 37  ? -11.905 18.390  47.301 1.00 17.41 ? 37  LEU A O   1 
ATOM 258  C CB  . LEU A 1 37  ? -10.348 15.648  48.420 1.00 17.64 ? 37  LEU A CB  1 
ATOM 259  C CG  . LEU A 1 37  ? -9.173  16.663  48.489 1.00 22.68 ? 37  LEU A CG  1 
ATOM 260  C CD1 . LEU A 1 37  ? -9.249  17.314  49.787 1.00 25.52 ? 37  LEU A CD1 1 
ATOM 261  C CD2 . LEU A 1 37  ? -7.898  15.828  48.277 1.00 23.96 ? 37  LEU A CD2 1 
ATOM 262  N N   . ALA A 1 38  ? -12.171 16.580  45.949 1.00 15.14 ? 38  ALA A N   1 
ATOM 263  C CA  . ALA A 1 38  ? -12.394 17.410  44.762 1.00 16.62 ? 38  ALA A CA  1 
ATOM 264  C C   . ALA A 1 38  ? -13.639 18.270  44.898 1.00 18.58 ? 38  ALA A C   1 
ATOM 265  O O   . ALA A 1 38  ? -13.753 19.406  44.351 1.00 18.63 ? 38  ALA A O   1 
ATOM 266  C CB  . ALA A 1 38  ? -12.484 16.532  43.561 1.00 17.65 ? 38  ALA A CB  1 
ATOM 267  N N   . SER A 1 39  ? -14.636 17.738  45.627 1.00 17.64 ? 39  SER A N   1 
ATOM 268  C CA  . SER A 1 39  ? -15.881 18.527  45.933 1.00 16.66 ? 39  SER A CA  1 
ATOM 269  C C   . SER A 1 39  ? -15.759 19.487  47.139 1.00 18.62 ? 39  SER A C   1 
ATOM 270  O O   . SER A 1 39  ? -16.726 20.055  47.599 1.00 19.71 ? 39  SER A O   1 
ATOM 271  C CB  . SER A 1 39  ? -17.097 17.568  46.143 1.00 15.98 ? 39  SER A CB  1 
ATOM 272  O OG  . SER A 1 39  ? -17.078 17.089  47.502 1.00 16.99 ? 39  SER A OG  1 
ATOM 273  N N   . GLU A 1 40  ? -14.539 19.628  47.642 1.00 19.98 ? 40  GLU A N   1 
ATOM 274  C CA  . GLU A 1 40  ? -14.281 20.474  48.801 1.00 21.84 ? 40  GLU A CA  1 
ATOM 275  C C   . GLU A 1 40  ? -15.063 20.028  50.036 1.00 20.70 ? 40  GLU A C   1 
ATOM 276  O O   . GLU A 1 40  ? -15.497 20.858  50.835 1.00 21.88 ? 40  GLU A O   1 
ATOM 277  C CB  . GLU A 1 40  ? -14.600 21.935  48.477 1.00 23.74 ? 40  GLU A CB  1 
ATOM 278  C CG  . GLU A 1 40  ? -13.703 22.546  47.413 1.00 33.60 ? 40  GLU A CG  1 
ATOM 279  C CD  . GLU A 1 40  ? -12.236 22.490  47.786 1.00 48.11 ? 40  GLU A CD  1 
ATOM 280  O OE1 . GLU A 1 40  ? -11.912 22.719  48.971 1.00 49.71 ? 40  GLU A OE1 1 
ATOM 281  O OE2 . GLU A 1 40  ? -11.404 22.217  46.894 1.00 51.31 ? 40  GLU A OE2 1 
ATOM 282  N N   . GLY A 1 41  ? -15.235 18.718  50.193 1.00 17.04 ? 41  GLY A N   1 
ATOM 283  C CA  . GLY A 1 41  ? -15.835 18.188  51.354 1.00 16.00 ? 41  GLY A CA  1 
ATOM 284  C C   . GLY A 1 41  ? -17.371 18.190  51.304 1.00 14.13 ? 41  GLY A C   1 
ATOM 285  O O   . GLY A 1 41  ? -17.997 17.932  52.265 1.00 17.07 ? 41  GLY A O   1 
ATOM 286  N N   . ALA A 1 42  ? -17.931 18.452  50.128 1.00 16.36 ? 42  ALA A N   1 
ATOM 287  C CA  . ALA A 1 42  ? -19.399 18.589  50.015 1.00 14.78 ? 42  ALA A CA  1 
ATOM 288  C C   . ALA A 1 42  ? -20.065 17.206  50.258 1.00 15.92 ? 42  ALA A C   1 
ATOM 289  O O   . ALA A 1 42  ? -21.149 17.134  50.899 1.00 18.30 ? 42  ALA A O   1 
ATOM 290  C CB  . ALA A 1 42  ? -19.788 19.070  48.653 1.00 16.78 ? 42  ALA A CB  1 
ATOM 291  N N   . ILE A 1 43  ? -19.413 16.144  49.760 1.00 15.25 ? 43  ILE A N   1 
ATOM 292  C CA  . ILE A 1 43  ? -19.989 14.781  49.963 1.00 13.63 ? 43  ILE A CA  1 
ATOM 293  C C   . ILE A 1 43  ? -19.930 14.361  51.418 1.00 14.74 ? 43  ILE A C   1 
ATOM 294  O O   . ILE A 1 43  ? -20.914 13.844  51.960 1.00 14.55 ? 43  ILE A O   1 
ATOM 295  C CB  . ILE A 1 43  ? -19.272 13.803  49.059 1.00 12.26 ? 43  ILE A CB  1 
ATOM 296  C CG1 . ILE A 1 43  ? -19.667 14.181  47.611 1.00 15.88 ? 43  ILE A CG1 1 
ATOM 297  C CG2 . ILE A 1 43  ? -19.669 12.339  49.438 1.00 15.49 ? 43  ILE A CG2 1 
ATOM 298  C CD1 . ILE A 1 43  ? -18.760 13.542  46.547 1.00 16.32 ? 43  ILE A CD1 1 
ATOM 299  N N   . SER A 1 44  ? -18.773 14.556  52.079 1.00 16.10 ? 44  SER A N   1 
ATOM 300  C CA  . SER A 1 44  ? -18.767 14.234  53.494 1.00 15.06 ? 44  SER A CA  1 
ATOM 301  C C   . SER A 1 44  ? -19.685 15.126  54.365 1.00 14.61 ? 44  SER A C   1 
ATOM 302  O O   . SER A 1 44  ? -20.285 14.638  55.319 1.00 13.14 ? 44  SER A O   1 
ATOM 303  C CB  . SER A 1 44  ? -17.294 14.015  54.009 1.00 17.66 ? 44  SER A CB  1 
ATOM 304  O OG  . SER A 1 44  ? -16.650 15.194  53.756 1.00 19.80 ? 44  SER A OG  1 
ATOM 305  N N   . ALA A 1 45  ? -19.812 16.390  54.000 1.00 13.35 ? 45  ALA A N   1 
ATOM 306  C CA  . ALA A 1 45  ? -20.737 17.310  54.687 1.00 16.17 ? 45  ALA A CA  1 
ATOM 307  C C   . ALA A 1 45  ? -22.189 16.773  54.608 1.00 15.20 ? 45  ALA A C   1 
ATOM 308  O O   . ALA A 1 45  ? -22.869 16.776  55.637 1.00 16.53 ? 45  ALA A O   1 
ATOM 309  C CB  . ALA A 1 45  ? -20.648 18.683  54.118 1.00 15.58 ? 45  ALA A CB  1 
ATOM 310  N N   . VAL A 1 46  ? -22.637 16.278  53.426 1.00 15.17 ? 46  VAL A N   1 
ATOM 311  C CA  . VAL A 1 46  ? -24.032 15.767  53.330 1.00 14.49 ? 46  VAL A CA  1 
ATOM 312  C C   . VAL A 1 46  ? -24.096 14.511  54.093 1.00 12.50 ? 46  VAL A C   1 
ATOM 313  O O   . VAL A 1 46  ? -25.055 14.206  54.841 1.00 12.88 ? 46  VAL A O   1 
ATOM 314  C CB  . VAL A 1 46  ? -24.406 15.440  51.862 1.00 13.68 ? 46  VAL A CB  1 
ATOM 315  C CG1 . VAL A 1 46  ? -25.758 14.663  51.813 1.00 19.39 ? 46  VAL A CG1 1 
ATOM 316  C CG2 . VAL A 1 46  ? -24.488 16.635  50.967 1.00 18.45 ? 46  VAL A CG2 1 
ATOM 317  N N   . LEU A 1 47  ? -23.046 13.649  53.976 1.00 11.76 ? 47  LEU A N   1 
ATOM 318  C CA  . LEU A 1 47  ? -23.091 12.397  54.751 1.00 12.54 ? 47  LEU A CA  1 
ATOM 319  C C   . LEU A 1 47  ? -23.200 12.528  56.294 1.00 11.11 ? 47  LEU A C   1 
ATOM 320  O O   . LEU A 1 47  ? -23.898 11.694  56.989 1.00 11.97 ? 47  LEU A O   1 
ATOM 321  C CB  . LEU A 1 47  ? -21.919 11.479  54.433 1.00 11.69 ? 47  LEU A CB  1 
ATOM 322  C CG  . LEU A 1 47  ? -22.033 10.852  52.995 1.00 13.24 ? 47  LEU A CG  1 
ATOM 323  C CD1 . LEU A 1 47  ? -20.630 10.256  52.563 1.00 14.80 ? 47  LEU A CD1 1 
ATOM 324  C CD2 . LEU A 1 47  ? -23.101 9.739   52.933 1.00 13.63 ? 47  LEU A CD2 1 
ATOM 325  N N   . LYS A 1 48  ? -22.573 13.606  56.821 1.00 12.27 ? 48  LYS A N   1 
ATOM 326  C CA  . LYS A 1 48  ? -22.646 13.851  58.282 1.00 16.29 ? 48  LYS A CA  1 
ATOM 327  C C   . LYS A 1 48  ? -24.080 14.151  58.712 1.00 14.53 ? 48  LYS A C   1 
ATOM 328  O O   . LYS A 1 48  ? -24.396 13.949  59.893 1.00 16.95 ? 48  LYS A O   1 
ATOM 329  C CB  . LYS A 1 48  ? -21.816 15.074  58.626 1.00 16.97 ? 48  LYS A CB  1 
ATOM 330  C CG  . LYS A 1 48  ? -21.407 15.273  60.110 1.00 28.51 ? 48  LYS A CG  1 
ATOM 331  C CD  . LYS A 1 48  ? -20.964 16.800  60.344 1.00 38.34 ? 48  LYS A CD  1 
ATOM 332  C CE  . LYS A 1 48  ? -20.730 17.319  61.834 1.00 37.74 ? 48  LYS A CE  1 
ATOM 333  N NZ  . LYS A 1 48  ? -19.626 18.422  61.730 1.00 38.45 ? 48  LYS A NZ  1 
ATOM 334  N N   . ARG A 1 49  ? -24.973 14.586  57.773 1.00 13.34 ? 49  ARG A N   1 
ATOM 335  C CA  . ARG A 1 49  ? -26.364 14.798  58.121 1.00 14.89 ? 49  ARG A CA  1 
ATOM 336  C C   . ARG A 1 49  ? -27.156 13.506  58.378 1.00 13.36 ? 49  ARG A C   1 
ATOM 337  O O   . ARG A 1 49  ? -28.243 13.555  58.973 1.00 16.60 ? 49  ARG A O   1 
ATOM 338  C CB  . ARG A 1 49  ? -27.075 15.675  57.124 1.00 16.96 ? 49  ARG A CB  1 
ATOM 339  C CG  . ARG A 1 49  ? -26.627 17.180  56.914 1.00 24.11 ? 49  ARG A CG  1 
ATOM 340  C CD  . ARG A 1 49  ? -27.904 17.928  56.334 1.00 26.01 ? 49  ARG A CD  1 
ATOM 341  N NE  . ARG A 1 49  ? -28.027 17.862  54.871 1.00 28.19 ? 49  ARG A NE  1 
ATOM 342  C CZ  . ARG A 1 49  ? -27.170 18.472  54.055 1.00 30.18 ? 49  ARG A CZ  1 
ATOM 343  N NH1 . ARG A 1 49  ? -26.154 19.158  54.594 1.00 39.20 ? 49  ARG A NH1 1 
ATOM 344  N NH2 . ARG A 1 49  ? -27.286 18.464  52.725 1.00 26.74 ? 49  ARG A NH2 1 
ATOM 345  N N   . GLY A 1 50  ? -26.603 12.349  57.964 1.00 12.59 ? 50  GLY A N   1 
ATOM 346  C CA  . GLY A 1 50  ? -27.107 11.067  58.402 1.00 13.66 ? 50  GLY A CA  1 
ATOM 347  C C   . GLY A 1 50  ? -28.234 10.447  57.542 1.00 12.09 ? 50  GLY A C   1 
ATOM 348  O O   . GLY A 1 50  ? -28.787 9.444   57.967 1.00 14.19 ? 50  GLY A O   1 
ATOM 349  N N   . ASP A 1 51  ? -28.492 10.961  56.346 1.00 11.46 ? 51  ASP A N   1 
ATOM 350  C CA  . ASP A 1 51  ? -29.609 10.334  55.636 1.00 10.40 ? 51  ASP A CA  1 
ATOM 351  C C   . ASP A 1 51  ? -29.251 8.981   55.040 1.00 11.97 ? 51  ASP A C   1 
ATOM 352  O O   . ASP A 1 51  ? -30.218 8.171   54.727 1.00 12.65 ? 51  ASP A O   1 
ATOM 353  C CB  . ASP A 1 51  ? -30.116 11.199  54.505 1.00 9.56  ? 51  ASP A CB  1 
ATOM 354  C CG  . ASP A 1 51  ? -30.749 12.533  54.995 1.00 10.35 ? 51  ASP A CG  1 
ATOM 355  O OD1 . ASP A 1 51  ? -31.099 12.664  56.161 1.00 12.09 ? 51  ASP A OD1 1 
ATOM 356  O OD2 . ASP A 1 51  ? -30.828 13.443  54.159 1.00 13.52 ? 51  ASP A OD2 1 
ATOM 357  N N   . LEU A 1 52  ? -27.972 8.737   54.816 1.00 9.39  ? 52  LEU A N   1 
ATOM 358  C CA  . LEU A 1 52  ? -27.521 7.446   54.166 1.00 10.81 ? 52  LEU A CA  1 
ATOM 359  C C   . LEU A 1 52  ? -26.793 6.604   55.183 1.00 10.97 ? 52  LEU A C   1 
ATOM 360  O O   . LEU A 1 52  ? -25.678 6.980   55.585 1.00 13.75 ? 52  LEU A O   1 
ATOM 361  C CB  . LEU A 1 52  ? -26.647 7.742   52.959 1.00 9.28  ? 52  LEU A CB  1 
ATOM 362  C CG  . LEU A 1 52  ? -25.973 6.538   52.251 1.00 9.39  ? 52  LEU A CG  1 
ATOM 363  C CD1 . LEU A 1 52  ? -27.090 5.611   51.799 1.00 14.03 ? 52  LEU A CD1 1 
ATOM 364  C CD2 . LEU A 1 52  ? -25.090 6.959   51.034 1.00 11.26 ? 52  LEU A CD2 1 
ATOM 365  N N   . ALA A 1 53  ? -27.406 5.525   55.608 1.00 13.02 ? 53  ALA A N   1 
ATOM 366  C CA  . ALA A 1 53  ? -26.759 4.645   56.588 1.00 12.12 ? 53  ALA A CA  1 
ATOM 367  C C   . ALA A 1 53  ? -25.713 3.755   55.954 1.00 13.78 ? 53  ALA A C   1 
ATOM 368  O O   . ALA A 1 53  ? -24.895 3.220   56.642 1.00 15.41 ? 53  ALA A O   1 
ATOM 369  C CB  . ALA A 1 53  ? -27.805 3.812   57.347 1.00 13.32 ? 53  ALA A CB  1 
ATOM 370  N N   . GLY A 1 54  ? -25.659 3.632   54.642 1.00 12.01 ? 54  GLY A N   1 
ATOM 371  C CA  . GLY A 1 54  ? -24.613 2.852   54.035 1.00 13.31 ? 54  GLY A CA  1 
ATOM 372  C C   . GLY A 1 54  ? -24.876 1.369   53.898 1.00 15.22 ? 54  GLY A C   1 
ATOM 373  O O   . GLY A 1 54  ? -23.897 0.678   53.602 1.00 12.14 ? 54  GLY A O   1 
ATOM 374  N N   . LYS A 1 55  ? -26.094 0.889   54.148 1.00 13.78 ? 55  LYS A N   1 
ATOM 375  C CA  . LYS A 1 55  ? -26.387 -0.557  54.006 1.00 14.58 ? 55  LYS A CA  1 
ATOM 376  C C   . LYS A 1 55  ? -26.376 -0.837  52.502 1.00 15.52 ? 55  LYS A C   1 
ATOM 377  O O   . LYS A 1 55  ? -26.596 0.042   51.676 1.00 14.65 ? 55  LYS A O   1 
ATOM 378  C CB  . LYS A 1 55  ? -27.733 -0.857  54.657 1.00 14.85 ? 55  LYS A CB  1 
ATOM 379  C CG  . LYS A 1 55  ? -27.808 -0.499  56.130 1.00 20.32 ? 55  LYS A CG  1 
ATOM 380  C CD  . LYS A 1 55  ? -28.982 -1.124  56.842 1.00 29.65 ? 55  LYS A CD  1 
ATOM 381  C CE  . LYS A 1 55  ? -28.839 -0.662  58.338 1.00 34.84 ? 55  LYS A CE  1 
ATOM 382  N NZ  . LYS A 1 55  ? -27.520 -1.061  58.961 1.00 43.21 ? 55  LYS A NZ  1 
ATOM 383  N N   . PRO A 1 56  ? -26.043 -2.086  52.058 1.00 15.33 ? 56  PRO A N   1 
ATOM 384  C CA  . PRO A 1 56  ? -25.717 -2.304  50.660 1.00 15.55 ? 56  PRO A CA  1 
ATOM 385  C C   . PRO A 1 56  ? -26.873 -1.913  49.785 1.00 14.11 ? 56  PRO A C   1 
ATOM 386  O O   . PRO A 1 56  ? -28.016 -2.261  50.087 1.00 14.89 ? 56  PRO A O   1 
ATOM 387  C CB  . PRO A 1 56  ? -25.485 -3.841  50.613 1.00 15.63 ? 56  PRO A CB  1 
ATOM 388  C CG  . PRO A 1 56  ? -24.943 -4.143  52.015 1.00 17.98 ? 56  PRO A CG  1 
ATOM 389  C CD  . PRO A 1 56  ? -25.680 -3.250  52.941 1.00 16.91 ? 56  PRO A CD  1 
ATOM 390  N N   . GLY A 1 57  ? -26.576 -1.104  48.730 1.00 13.66 ? 57  GLY A N   1 
ATOM 391  C CA  . GLY A 1 57  ? -27.724 -0.721  47.849 1.00 14.09 ? 57  GLY A CA  1 
ATOM 392  C C   . GLY A 1 57  ? -28.528 0.485   48.217 1.00 12.18 ? 57  GLY A C   1 
ATOM 393  O O   . GLY A 1 57  ? -29.275 0.998   47.357 1.00 14.24 ? 57  GLY A O   1 
ATOM 394  N N   . GLN A 1 58  ? -28.439 0.975   49.442 1.00 12.18 ? 58  GLN A N   1 
ATOM 395  C CA  . GLN A 1 58  ? -29.123 2.242   49.804 1.00 11.01 ? 58  GLN A CA  1 
ATOM 396  C C   . GLN A 1 58  ? -28.438 3.289   48.975 1.00 10.27 ? 58  GLN A C   1 
ATOM 397  O O   . GLN A 1 58  ? -27.304 3.147   48.561 1.00 11.68 ? 58  GLN A O   1 
ATOM 398  C CB  . GLN A 1 58  ? -28.882 2.595   51.255 1.00 9.37  ? 58  GLN A CB  1 
ATOM 399  C CG  . GLN A 1 58  ? -29.724 1.751   52.232 1.00 12.87 ? 58  GLN A CG  1 
ATOM 400  C CD  . GLN A 1 58  ? -29.491 2.080   53.694 1.00 13.99 ? 58  GLN A CD  1 
ATOM 401  O OE1 . GLN A 1 58  ? -28.468 2.662   54.095 1.00 13.66 ? 58  GLN A OE1 1 
ATOM 402  N NE2 . GLN A 1 58  ? -30.466 1.710   54.537 1.00 19.04 ? 58  GLN A NE2 1 
ATOM 403  N N   . THR A 1 59  ? -29.201 4.348   48.666 1.00 10.60 ? 59  THR A N   1 
ATOM 404  C CA  . THR A 1 59  ? -28.692 5.433   47.777 1.00 10.58 ? 59  THR A CA  1 
ATOM 405  C C   . THR A 1 59  ? -29.012 6.828   48.277 1.00 10.56 ? 59  THR A C   1 
ATOM 406  O O   . THR A 1 59  ? -29.989 7.055   49.023 1.00 12.32 ? 59  THR A O   1 
ATOM 407  C CB  . THR A 1 59  ? -29.178 5.305   46.317 1.00 11.23 ? 59  THR A CB  1 
ATOM 408  O OG1 . THR A 1 59  ? -30.606 5.269   46.370 1.00 13.18 ? 59  THR A OG1 1 
ATOM 409  C CG2 . THR A 1 59  ? -28.665 4.046   45.644 1.00 11.15 ? 59  THR A CG2 1 
ATOM 410  N N   . LEU A 1 60  ? -28.118 7.736   47.900 1.00 8.46  ? 60  LEU A N   1 
ATOM 411  C CA  . LEU A 1 60  ? -28.373 9.206   48.109 1.00 9.29  ? 60  LEU A CA  1 
ATOM 412  C C   . LEU A 1 60  ? -27.911 9.907   46.852 1.00 9.13  ? 60  LEU A C   1 
ATOM 413  O O   . LEU A 1 60  ? -26.798 9.669   46.447 1.00 9.99  ? 60  LEU A O   1 
ATOM 414  C CB  . LEU A 1 60  ? -27.603 9.683   49.328 1.00 9.90  ? 60  LEU A CB  1 
ATOM 415  C CG  . LEU A 1 60  ? -28.016 11.066  49.872 1.00 10.46 ? 60  LEU A CG  1 
ATOM 416  C CD1 . LEU A 1 60  ? -27.539 11.206  51.323 1.00 12.52 ? 60  LEU A CD1 1 
ATOM 417  C CD2 . LEU A 1 60  ? -27.457 12.186  49.049 1.00 14.03 ? 60  LEU A CD2 1 
ATOM 418  N N   . LEU A 1 61  ? -28.780 10.661  46.176 1.00 10.00 ? 61  LEU A N   1 
ATOM 419  C CA  . LEU A 1 61  ? -28.433 11.281  44.916 1.00 8.26  ? 61  LEU A CA  1 
ATOM 420  C C   . LEU A 1 61  ? -28.263 12.795  45.121 1.00 9.41  ? 61  LEU A C   1 
ATOM 421  O O   . LEU A 1 61  ? -29.144 13.502  45.567 1.00 11.76 ? 61  LEU A O   1 
ATOM 422  C CB  . LEU A 1 61  ? -29.611 10.987  43.925 1.00 9.65  ? 61  LEU A CB  1 
ATOM 423  C CG  . LEU A 1 61  ? -29.316 11.589  42.527 1.00 9.63  ? 61  LEU A CG  1 
ATOM 424  C CD1 . LEU A 1 61  ? -28.143 10.910  41.864 1.00 12.72 ? 61  LEU A CD1 1 
ATOM 425  C CD2 . LEU A 1 61  ? -30.513 11.412  41.690 1.00 15.12 ? 61  LEU A CD2 1 
ATOM 426  N N   . LEU A 1 62  ? -27.112 13.259  44.678 1.00 10.58 ? 62  LEU A N   1 
ATOM 427  C CA  . LEU A 1 62  ? -26.741 14.663  44.715 1.00 10.12 ? 62  LEU A CA  1 
ATOM 428  C C   . LEU A 1 62  ? -26.782 15.211  43.384 1.00 10.35 ? 62  LEU A C   1 
ATOM 429  O O   . LEU A 1 62  ? -26.560 14.500  42.329 1.00 10.82 ? 62  LEU A O   1 
ATOM 430  C CB  . LEU A 1 62  ? -25.310 14.831  45.311 1.00 9.75  ? 62  LEU A CB  1 
ATOM 431  C CG  . LEU A 1 62  ? -25.288 14.332  46.760 1.00 12.14 ? 62  LEU A CG  1 
ATOM 432  C CD1 . LEU A 1 62  ? -23.801 14.353  47.325 1.00 14.86 ? 62  LEU A CD1 1 
ATOM 433  C CD2 . LEU A 1 62  ? -26.175 15.176  47.679 1.00 13.27 ? 62  LEU A CD2 1 
ATOM 434  N N   . GLN A 1 63  ? -27.034 16.521  43.390 1.00 11.83 ? 63  GLN A N   1 
ATOM 435  C CA  . GLN A 1 63  ? -26.996 17.426  42.244 1.00 12.23 ? 63  GLN A CA  1 
ATOM 436  C C   . GLN A 1 63  ? -25.607 18.032  42.013 1.00 14.13 ? 63  GLN A C   1 
ATOM 437  O O   . GLN A 1 63  ? -24.621 17.610  42.617 1.00 14.37 ? 63  GLN A O   1 
ATOM 438  C CB  . GLN A 1 63  ? -28.033 18.540  42.408 1.00 13.56 ? 63  GLN A CB  1 
ATOM 439  C CG  . GLN A 1 63  ? -29.469 18.046  42.472 1.00 14.71 ? 63  GLN A CG  1 
ATOM 440  C CD  . GLN A 1 63  ? -29.791 17.048  41.378 1.00 12.86 ? 63  GLN A CD  1 
ATOM 441  O OE1 . GLN A 1 63  ? -30.292 15.955  41.646 1.00 19.38 ? 63  GLN A OE1 1 
ATOM 442  N NE2 . GLN A 1 63  ? -29.505 17.419  40.135 1.00 12.62 ? 63  GLN A NE2 1 
ATOM 443  N N   . ASN A 1 64  ? -25.547 19.014  41.116 1.00 16.60 ? 64  ASN A N   1 
ATOM 444  C CA  . ASN A 1 64  ? -24.283 19.531  40.552 1.00 21.08 ? 64  ASN A CA  1 
ATOM 445  C C   . ASN A 1 64  ? -23.459 20.010  41.723 1.00 21.08 ? 64  ASN A C   1 
ATOM 446  O O   . ASN A 1 64  ? -23.964 20.840  42.439 1.00 21.31 ? 64  ASN A O   1 
ATOM 447  C CB  . ASN A 1 64  ? -24.583 20.874  39.872 1.00 23.33 ? 64  ASN A CB  1 
ATOM 448  C CG  . ASN A 1 64  ? -25.342 20.789  38.624 1.00 31.20 ? 64  ASN A CG  1 
ATOM 449  O OD1 . ASN A 1 64  ? -25.851 19.735  38.216 1.00 41.83 ? 64  ASN A OD1 1 
ATOM 450  N ND2 . ASN A 1 64  ? -25.476 21.961  37.973 1.00 35.83 ? 64  ASN A ND2 1 
ATOM 451  N N   . LEU A 1 65  ? -22.233 19.492  41.931 1.00 16.11 ? 65  LEU A N   1 
ATOM 452  C CA  . LEU A 1 65  ? -21.366 19.952  42.989 1.00 18.97 ? 65  LEU A CA  1 
ATOM 453  C C   . LEU A 1 65  ? -20.191 20.703  42.380 1.00 19.56 ? 65  LEU A C   1 
ATOM 454  O O   . LEU A 1 65  ? -19.566 20.241  41.459 1.00 20.42 ? 65  LEU A O   1 
ATOM 455  C CB  . LEU A 1 65  ? -20.826 18.823  43.866 1.00 17.18 ? 65  LEU A CB  1 
ATOM 456  C CG  . LEU A 1 65  ? -21.884 17.871  44.476 1.00 20.16 ? 65  LEU A CG  1 
ATOM 457  C CD1 . LEU A 1 65  ? -21.282 16.644  45.112 1.00 18.74 ? 65  LEU A CD1 1 
ATOM 458  C CD2 . LEU A 1 65  ? -22.805 18.655  45.453 1.00 17.77 ? 65  LEU A CD2 1 
ATOM 459  N N   . GLN A 1 66  ? -19.901 21.883  42.934 1.00 20.99 ? 66  GLN A N   1 
ATOM 460  C CA  . GLN A 1 66  ? -18.666 22.618  42.574 1.00 22.89 ? 66  GLN A CA  1 
ATOM 461  C C   . GLN A 1 66  ? -17.409 21.773  42.761 1.00 20.62 ? 66  GLN A C   1 
ATOM 462  O O   . GLN A 1 66  ? -17.242 21.088  43.798 1.00 20.13 ? 66  GLN A O   1 
ATOM 463  C CB  . GLN A 1 66  ? -18.610 23.831  43.536 1.00 24.97 ? 66  GLN A CB  1 
ATOM 464  C CG  . GLN A 1 66  ? -17.458 24.873  43.311 1.00 32.02 ? 66  GLN A CG  1 
ATOM 465  C CD  . GLN A 1 66  ? -17.541 25.620  41.943 1.00 43.00 ? 66  GLN A CD  1 
ATOM 466  O OE1 . GLN A 1 66  ? -18.535 26.320  41.629 1.00 44.90 ? 66  GLN A OE1 1 
ATOM 467  N NE2 . GLN A 1 66  ? -16.503 25.430  41.106 1.00 45.46 ? 66  GLN A NE2 1 
ATOM 468  N N   . GLY A 1 67  ? -16.525 21.789  41.778 1.00 20.91 ? 67  GLY A N   1 
ATOM 469  C CA  . GLY A 1 67  ? -15.300 21.025  41.884 1.00 19.69 ? 67  GLY A CA  1 
ATOM 470  C C   . GLY A 1 67  ? -15.334 19.717  41.128 1.00 20.69 ? 67  GLY A C   1 
ATOM 471  O O   . GLY A 1 67  ? -14.293 19.133  40.844 1.00 22.32 ? 67  GLY A O   1 
ATOM 472  N N   . LEU A 1 68  ? -16.566 19.188  40.815 1.00 18.99 ? 68  LEU A N   1 
ATOM 473  C CA  . LEU A 1 68  ? -16.616 17.962  40.067 1.00 18.34 ? 68  LEU A CA  1 
ATOM 474  C C   . LEU A 1 68  ? -17.093 18.253  38.645 1.00 19.54 ? 68  LEU A C   1 
ATOM 475  O O   . LEU A 1 68  ? -17.735 19.285  38.408 1.00 22.47 ? 68  LEU A O   1 
ATOM 476  C CB  . LEU A 1 68  ? -17.711 17.084  40.766 1.00 18.80 ? 68  LEU A CB  1 
ATOM 477  C CG  . LEU A 1 68  ? -17.424 16.736  42.229 1.00 18.40 ? 68  LEU A CG  1 
ATOM 478  C CD1 . LEU A 1 68  ? -18.455 15.698  42.784 1.00 17.42 ? 68  LEU A CD1 1 
ATOM 479  C CD2 . LEU A 1 68  ? -16.075 16.090  42.323 1.00 17.15 ? 68  LEU A CD2 1 
ATOM 480  N N   . LYS A 1 69  ? -16.877 17.306  37.741 1.00 17.36 ? 69  LYS A N   1 
ATOM 481  C CA  . LYS A 1 69  ? -17.398 17.481  36.331 1.00 17.64 ? 69  LYS A CA  1 
ATOM 482  C C   . LYS A 1 69  ? -18.656 16.640  36.093 1.00 18.18 ? 69  LYS A C   1 
ATOM 483  O O   . LYS A 1 69  ? -19.117 16.473  34.989 1.00 18.64 ? 69  LYS A O   1 
ATOM 484  C CB  . LYS A 1 69  ? -16.336 17.081  35.348 1.00 18.49 ? 69  LYS A CB  1 
ATOM 485  C CG  . LYS A 1 69  ? -14.998 17.968  35.507 1.00 25.80 ? 69  LYS A CG  1 
ATOM 486  C CD  . LYS A 1 69  ? -14.095 17.611  34.312 1.00 32.22 ? 69  LYS A CD  1 
ATOM 487  C CE  . LYS A 1 69  ? -14.738 18.052  33.028 1.00 38.87 ? 69  LYS A CE  1 
ATOM 488  N NZ  . LYS A 1 69  ? -13.824 18.060  31.809 1.00 44.87 ? 69  LYS A NZ  1 
ATOM 489  N N   . ALA A 1 70  ? -19.085 15.958  37.137 1.00 14.65 ? 70  ALA A N   1 
ATOM 490  C CA  . ALA A 1 70  ? -20.306 15.139  37.004 1.00 14.51 ? 70  ALA A CA  1 
ATOM 491  C C   . ALA A 1 70  ? -21.460 16.058  37.270 1.00 14.46 ? 70  ALA A C   1 
ATOM 492  O O   . ALA A 1 70  ? -21.440 16.870  38.212 1.00 14.75 ? 70  ALA A O   1 
ATOM 493  C CB  . ALA A 1 70  ? -20.277 14.041  38.066 1.00 14.82 ? 70  ALA A CB  1 
ATOM 494  N N   . GLU A 1 71  ? -22.534 15.867  36.531 1.00 12.38 ? 71  GLU A N   1 
ATOM 495  C CA  . GLU A 1 71  ? -23.740 16.605  36.761 1.00 12.06 ? 71  GLU A CA  1 
ATOM 496  C C   . GLU A 1 71  ? -24.486 16.194  38.018 1.00 12.18 ? 71  GLU A C   1 
ATOM 497  O O   . GLU A 1 71  ? -25.219 16.976  38.605 1.00 13.74 ? 71  GLU A O   1 
ATOM 498  C CB  . GLU A 1 71  ? -24.686 16.585  35.529 1.00 12.47 ? 71  GLU A CB  1 
ATOM 499  C CG  . GLU A 1 71  ? -24.154 17.330  34.304 1.00 18.57 ? 71  GLU A CG  1 
ATOM 500  C CD  . GLU A 1 71  ? -25.073 17.221  33.115 1.00 29.34 ? 71  GLU A CD  1 
ATOM 501  O OE1 . GLU A 1 71  ? -26.011 16.430  33.171 1.00 35.91 ? 71  GLU A OE1 1 
ATOM 502  O OE2 . GLU A 1 71  ? -24.849 17.953  32.124 1.00 40.02 ? 71  GLU A OE2 1 
ATOM 503  N N   . ARG A 1 72  ? -24.323 14.911  38.439 1.00 11.40 ? 72  ARG A N   1 
ATOM 504  C CA  . ARG A 1 72  ? -25.037 14.360  39.597 1.00 11.12 ? 72  ARG A CA  1 
ATOM 505  C C   . ARG A 1 72  ? -24.010 13.384  40.158 1.00 9.51  ? 72  ARG A C   1 
ATOM 506  O O   . ARG A 1 72  ? -23.144 12.847  39.465 1.00 10.42 ? 72  ARG A O   1 
ATOM 507  C CB  . ARG A 1 72  ? -26.242 13.454  39.171 1.00 9.90  ? 72  ARG A CB  1 
ATOM 508  C CG  . ARG A 1 72  ? -27.309 14.133  38.363 1.00 9.70  ? 72  ARG A CG  1 
ATOM 509  C CD  . ARG A 1 72  ? -28.201 13.078  37.740 1.00 11.86 ? 72  ARG A CD  1 
ATOM 510  N NE  . ARG A 1 72  ? -29.206 13.556  36.733 1.00 9.87  ? 72  ARG A NE  1 
ATOM 511  C CZ  . ARG A 1 72  ? -28.923 13.923  35.469 1.00 13.74 ? 72  ARG A CZ  1 
ATOM 512  N NH1 . ARG A 1 72  ? -27.676 13.885  34.979 1.00 14.56 ? 72  ARG A NH1 1 
ATOM 513  N NH2 . ARG A 1 72  ? -29.937 14.302  34.662 1.00 13.45 ? 72  ARG A NH2 1 
ATOM 514  N N   . VAL A 1 73  ? -24.065 13.196  41.489 1.00 9.67  ? 73  VAL A N   1 
ATOM 515  C CA  . VAL A 1 73  ? -23.278 12.107  42.152 1.00 9.84  ? 73  VAL A CA  1 
ATOM 516  C C   . VAL A 1 73  ? -24.262 11.197  42.890 1.00 9.93  ? 73  VAL A C   1 
ATOM 517  O O   . VAL A 1 73  ? -25.063 11.620  43.759 1.00 11.09 ? 73  VAL A O   1 
ATOM 518  C CB  . VAL A 1 73  ? -22.339 12.658  43.187 1.00 12.14 ? 73  VAL A CB  1 
ATOM 519  C CG1 . VAL A 1 73  ? -21.601 11.570  43.887 1.00 13.00 ? 73  VAL A CG1 1 
ATOM 520  C CG2 . VAL A 1 73  ? -21.274 13.548  42.406 1.00 10.92 ? 73  VAL A CG2 1 
ATOM 521  N N   . LEU A 1 74  ? -24.218 9.915   42.513 1.00 8.90  ? 74  LEU A N   1 
ATOM 522  C CA  . LEU A 1 74  ? -25.013 8.926   43.254 1.00 9.87  ? 74  LEU A CA  1 
ATOM 523  C C   . LEU A 1 74  ? -24.100 8.215   44.272 1.00 10.02 ? 74  LEU A C   1 
ATOM 524  O O   . LEU A 1 74  ? -23.133 7.585   43.868 1.00 10.34 ? 74  LEU A O   1 
ATOM 525  C CB  . LEU A 1 74  ? -25.571 7.899   42.253 1.00 8.18  ? 74  LEU A CB  1 
ATOM 526  C CG  . LEU A 1 74  ? -26.418 6.811   42.926 1.00 8.75  ? 74  LEU A CG  1 
ATOM 527  C CD1 . LEU A 1 74  ? -27.630 7.341   43.608 1.00 11.52 ? 74  LEU A CD1 1 
ATOM 528  C CD2 . LEU A 1 74  ? -26.844 5.820   41.812 1.00 11.54 ? 74  LEU A CD2 1 
ATOM 529  N N   . LEU A 1 75  ? -24.431 8.358   45.558 1.00 7.87  ? 75  LEU A N   1 
ATOM 530  C CA  . LEU A 1 75  ? -23.768 7.627   46.627 1.00 9.47  ? 75  LEU A CA  1 
ATOM 531  C C   . LEU A 1 75  ? -24.545 6.266   46.836 1.00 9.84  ? 75  LEU A C   1 
ATOM 532  O O   . LEU A 1 75  ? -25.784 6.294   46.970 1.00 11.28 ? 75  LEU A O   1 
ATOM 533  C CB  . LEU A 1 75  ? -23.852 8.387   47.960 1.00 10.26 ? 75  LEU A CB  1 
ATOM 534  C CG  . LEU A 1 75  ? -23.323 9.828   47.754 1.00 9.75  ? 75  LEU A CG  1 
ATOM 535  C CD1 . LEU A 1 75  ? -23.408 10.604  49.120 1.00 14.20 ? 75  LEU A CD1 1 
ATOM 536  C CD2 . LEU A 1 75  ? -21.871 9.889   47.275 1.00 12.78 ? 75  LEU A CD2 1 
ATOM 537  N N   . VAL A 1 76  ? -23.848 5.154   46.797 1.00 8.81  ? 76  VAL A N   1 
ATOM 538  C CA  . VAL A 1 76  ? -24.512 3.841   47.020 1.00 10.45 ? 76  VAL A CA  1 
ATOM 539  C C   . VAL A 1 76  ? -23.852 3.137   48.189 1.00 8.27  ? 76  VAL A C   1 
ATOM 540  O O   . VAL A 1 76  ? -22.589 3.056   48.281 1.00 9.97  ? 76  VAL A O   1 
ATOM 541  C CB  . VAL A 1 76  ? -24.484 2.963   45.694 1.00 10.28 ? 76  VAL A CB  1 
ATOM 542  C CG1 . VAL A 1 76  ? -22.986 2.678   45.220 1.00 9.63  ? 76  VAL A CG1 1 
ATOM 543  C CG2 . VAL A 1 76  ? -25.255 1.595   46.000 1.00 9.46  ? 76  VAL A CG2 1 
ATOM 544  N N   . GLY A 1 77  ? -24.668 2.627   49.109 1.00 8.32  ? 77  GLY A N   1 
ATOM 545  C CA  . GLY A 1 77  ? -24.192 1.894   50.327 1.00 8.97  ? 77  GLY A CA  1 
ATOM 546  C C   . GLY A 1 77  ? -23.442 0.664   49.901 1.00 11.24 ? 77  GLY A C   1 
ATOM 547  O O   . GLY A 1 77  ? -23.857 -0.106  49.068 1.00 12.53 ? 77  GLY A O   1 
ATOM 548  N N   . SER A 1 78  ? -22.313 0.397   50.586 1.00 10.32 ? 78  SER A N   1 
ATOM 549  C CA  . SER A 1 78  ? -21.580 -0.870  50.336 1.00 12.93 ? 78  SER A CA  1 
ATOM 550  C C   . SER A 1 78  ? -21.544 -1.760  51.580 1.00 14.84 ? 78  SER A C   1 
ATOM 551  O O   . SER A 1 78  ? -20.834 -2.782  51.583 1.00 16.80 ? 78  SER A O   1 
ATOM 552  C CB  . SER A 1 78  ? -20.163 -0.526  49.861 1.00 13.15 ? 78  SER A CB  1 
ATOM 553  O OG  . SER A 1 78  ? -19.503 0.279   50.870 1.00 11.79 ? 78  SER A OG  1 
ATOM 554  N N   . GLY A 1 79  ? -22.225 -1.352  52.619 1.00 14.49 ? 79  GLY A N   1 
ATOM 555  C CA  . GLY A 1 79  ? -22.389 -2.104  53.870 1.00 15.47 ? 79  GLY A CA  1 
ATOM 556  C C   . GLY A 1 79  ? -21.174 -1.982  54.817 1.00 16.46 ? 79  GLY A C   1 
ATOM 557  O O   . GLY A 1 79  ? -20.407 -1.030  54.773 1.00 17.23 ? 79  GLY A O   1 
ATOM 558  N N   . LYS A 1 80  ? -21.024 -3.075  55.592 1.00 22.63 ? 80  LYS A N   1 
ATOM 559  C CA  . LYS A 1 80  ? -19.945 -3.153  56.621 1.00 25.45 ? 80  LYS A CA  1 
ATOM 560  C C   . LYS A 1 80  ? -18.636 -3.367  55.940 1.00 25.78 ? 80  LYS A C   1 
ATOM 561  O O   . LYS A 1 80  ? -18.641 -3.643  54.706 1.00 26.52 ? 80  LYS A O   1 
ATOM 562  C CB  . LYS A 1 80  ? -20.297 -4.232  57.647 1.00 27.99 ? 80  LYS A CB  1 
ATOM 563  C CG  . LYS A 1 80  ? -21.051 -3.572  58.792 1.00 31.68 ? 80  LYS A CG  1 
ATOM 564  C CD  . LYS A 1 80  ? -21.560 -4.616  59.824 1.00 37.47 ? 80  LYS A CD  1 
ATOM 565  C CE  . LYS A 1 80  ? -22.639 -4.040  60.781 1.00 39.89 ? 80  LYS A CE  1 
ATOM 566  N NZ  . LYS A 1 80  ? -24.047 -4.062  60.131 1.00 41.49 ? 80  LYS A NZ  1 
ATOM 567  N N   . ASP A 1 81  ? -17.485 -3.221  56.604 1.00 23.33 ? 81  ASP A N   1 
ATOM 568  C CA  . ASP A 1 81  ? -16.168 -3.436  55.868 1.00 25.15 ? 81  ASP A CA  1 
ATOM 569  C C   . ASP A 1 81  ? -16.011 -4.771  55.145 1.00 25.63 ? 81  ASP A C   1 
ATOM 570  O O   . ASP A 1 81  ? -15.272 -4.925  54.152 1.00 28.74 ? 81  ASP A O   1 
ATOM 571  C CB  . ASP A 1 81  ? -14.893 -3.256  56.709 1.00 26.08 ? 81  ASP A CB  1 
ATOM 572  C CG  . ASP A 1 81  ? -14.445 -1.839  56.793 1.00 23.80 ? 81  ASP A CG  1 
ATOM 573  O OD1 . ASP A 1 81  ? -14.564 -1.060  55.821 1.00 28.52 ? 81  ASP A OD1 1 
ATOM 574  O OD2 . ASP A 1 81  ? -13.981 -1.503  57.918 1.00 18.90 ? 81  ASP A OD2 1 
ATOM 575  N N   . GLU A 1 82  ? -16.712 -5.758  55.589 1.00 25.21 ? 82  GLU A N   1 
ATOM 576  C CA  . GLU A 1 82  ? -16.481 -7.061  55.024 1.00 25.46 ? 82  GLU A CA  1 
ATOM 577  C C   . GLU A 1 82  ? -16.629 -7.033  53.463 1.00 25.33 ? 82  GLU A C   1 
ATOM 578  O O   . GLU A 1 82  ? -17.334 -6.183  52.891 1.00 25.01 ? 82  GLU A O   1 
ATOM 579  C CB  . GLU A 1 82  ? -17.499 -7.981  55.599 1.00 26.13 ? 82  GLU A CB  1 
ATOM 580  C CG  . GLU A 1 82  ? -17.312 -8.201  57.044 1.00 29.21 ? 82  GLU A CG  1 
ATOM 581  C CD  . GLU A 1 82  ? -18.421 -9.081  57.563 1.00 41.67 ? 82  GLU A CD  1 
ATOM 582  O OE1 . GLU A 1 82  ? -19.401 -9.311  56.765 1.00 40.68 ? 82  GLU A OE1 1 
ATOM 583  O OE2 . GLU A 1 82  ? -18.307 -9.483  58.764 1.00 45.38 ? 82  GLU A OE2 1 
ATOM 584  N N   . ALA A 1 83  ? -15.967 -7.958  52.786 1.00 21.22 ? 83  ALA A N   1 
ATOM 585  C CA  . ALA A 1 83  ? -16.175 -8.144  51.329 1.00 20.11 ? 83  ALA A CA  1 
ATOM 586  C C   . ALA A 1 83  ? -17.609 -8.633  51.150 1.00 18.50 ? 83  ALA A C   1 
ATOM 587  O O   . ALA A 1 83  ? -18.214 -9.367  52.013 1.00 17.85 ? 83  ALA A O   1 
ATOM 588  C CB  . ALA A 1 83  ? -15.184 -9.151  50.834 1.00 20.97 ? 83  ALA A CB  1 
ATOM 589  N N   . LEU A 1 84  ? -18.208 -8.266  50.013 1.00 15.15 ? 84  LEU A N   1 
ATOM 590  C CA  . LEU A 1 84  ? -19.593 -8.625  49.820 1.00 14.63 ? 84  LEU A CA  1 
ATOM 591  C C   . LEU A 1 84  ? -19.705 -9.998  49.176 1.00 12.57 ? 84  LEU A C   1 
ATOM 592  O O   . LEU A 1 84  ? -18.840 -10.393 48.383 1.00 16.04 ? 84  LEU A O   1 
ATOM 593  C CB  . LEU A 1 84  ? -20.211 -7.667  48.793 1.00 15.67 ? 84  LEU A CB  1 
ATOM 594  C CG  . LEU A 1 84  ? -20.251 -6.195  49.216 1.00 16.64 ? 84  LEU A CG  1 
ATOM 595  C CD1 . LEU A 1 84  ? -20.910 -5.379  48.093 1.00 16.23 ? 84  LEU A CD1 1 
ATOM 596  C CD2 . LEU A 1 84  ? -20.996 -6.021  50.506 1.00 20.87 ? 84  LEU A CD2 1 
ATOM 597  N N   . GLY A 1 85  ? -20.744 -10.702 49.542 1.00 13.85 ? 85  GLY A N   1 
ATOM 598  C CA  . GLY A 1 85  ? -20.971 -11.970 48.770 1.00 13.70 ? 85  GLY A CA  1 
ATOM 599  C C   . GLY A 1 85  ? -21.512 -11.638 47.378 1.00 12.69 ? 85  GLY A C   1 
ATOM 600  O O   . GLY A 1 85  ? -21.869 -10.485 47.022 1.00 12.09 ? 85  GLY A O   1 
ATOM 601  N N   . ASP A 1 86  ? -21.620 -12.655 46.505 1.00 11.93 ? 86  ASP A N   1 
ATOM 602  C CA  . ASP A 1 86  ? -22.036 -12.386 45.145 1.00 12.06 ? 86  ASP A CA  1 
ATOM 603  C C   . ASP A 1 86  ? -23.436 -11.797 45.104 1.00 11.72 ? 86  ASP A C   1 
ATOM 604  O O   . ASP A 1 86  ? -23.726 -10.876 44.290 1.00 11.63 ? 86  ASP A O   1 
ATOM 605  C CB  . ASP A 1 86  ? -22.066 -13.712 44.324 1.00 10.47 ? 86  ASP A CB  1 
ATOM 606  C CG  . ASP A 1 86  ? -20.718 -14.181 43.915 1.00 12.79 ? 86  ASP A CG  1 
ATOM 607  O OD1 . ASP A 1 86  ? -19.712 -13.465 44.036 1.00 11.25 ? 86  ASP A OD1 1 
ATOM 608  O OD2 . ASP A 1 86  ? -20.670 -15.358 43.391 1.00 12.33 ? 86  ASP A OD2 1 
ATOM 609  N N   . ARG A 1 87  ? -24.387 -12.288 45.917 1.00 11.74 ? 87  ARG A N   1 
ATOM 610  C CA  . ARG A 1 87  ? -25.742 -11.802 45.790 1.00 11.54 ? 87  ARG A CA  1 
ATOM 611  C C   . ARG A 1 87  ? -25.805 -10.330 46.182 1.00 12.28 ? 87  ARG A C   1 
ATOM 612  O O   . ARG A 1 87  ? -26.528 -9.562  45.558 1.00 12.23 ? 87  ARG A O   1 
ATOM 613  C CB  . ARG A 1 87  ? -26.665 -12.601 46.746 1.00 12.71 ? 87  ARG A CB  1 
ATOM 614  C CG  . ARG A 1 87  ? -28.094 -12.633 46.340 1.00 15.53 ? 87  ARG A CG  1 
ATOM 615  C CD  . ARG A 1 87  ? -28.371 -13.197 44.907 1.00 13.48 ? 87  ARG A CD  1 
ATOM 616  N NE  . ARG A 1 87  ? -27.591 -14.459 44.772 1.00 13.55 ? 87  ARG A NE  1 
ATOM 617  C CZ  . ARG A 1 87  ? -26.742 -14.732 43.791 1.00 15.48 ? 87  ARG A CZ  1 
ATOM 618  N NH1 . ARG A 1 87  ? -26.540 -13.887 42.748 1.00 14.54 ? 87  ARG A NH1 1 
ATOM 619  N NH2 . ARG A 1 87  ? -25.964 -15.832 43.918 1.00 12.87 ? 87  ARG A NH2 1 
ATOM 620  N N   . THR A 1 88  ? -25.103 -10.029 47.293 1.00 11.14 ? 88  THR A N   1 
ATOM 621  C CA  . THR A 1 88  ? -25.162 -8.603  47.761 1.00 12.57 ? 88  THR A CA  1 
ATOM 622  C C   . THR A 1 88  ? -24.523 -7.689  46.727 1.00 11.97 ? 88  THR A C   1 
ATOM 623  O O   . THR A 1 88  ? -25.035 -6.539  46.524 1.00 11.40 ? 88  THR A O   1 
ATOM 624  C CB  . THR A 1 88  ? -24.448 -8.505  49.091 1.00 12.86 ? 88  THR A CB  1 
ATOM 625  O OG1 . THR A 1 88  ? -25.191 -9.356  50.041 1.00 17.90 ? 88  THR A OG1 1 
ATOM 626  C CG2 . THR A 1 88  ? -24.429 -7.055  49.659 1.00 13.15 ? 88  THR A CG2 1 
ATOM 627  N N   . TRP A 1 89  ? -23.395 -8.084  46.222 1.00 10.68 ? 89  TRP A N   1 
ATOM 628  C CA  . TRP A 1 89  ? -22.738 -7.252  45.151 1.00 7.65  ? 89  TRP A CA  1 
ATOM 629  C C   . TRP A 1 89  ? -23.686 -7.084  43.981 1.00 10.18 ? 89  TRP A C   1 
ATOM 630  O O   . TRP A 1 89  ? -23.839 -5.949  43.462 1.00 9.51  ? 89  TRP A O   1 
ATOM 631  C CB  . TRP A 1 89  ? -21.478 -7.989  44.676 1.00 8.45  ? 89  TRP A CB  1 
ATOM 632  C CG  . TRP A 1 89  ? -20.782 -7.449  43.448 1.00 10.11 ? 89  TRP A CG  1 
ATOM 633  C CD1 . TRP A 1 89  ? -20.299 -8.180  42.344 1.00 10.60 ? 89  TRP A CD1 1 
ATOM 634  C CD2 . TRP A 1 89  ? -20.274 -6.071  43.229 1.00 10.07 ? 89  TRP A CD2 1 
ATOM 635  N NE1 . TRP A 1 89  ? -19.625 -7.363  41.469 1.00 10.66 ? 89  TRP A NE1 1 
ATOM 636  C CE2 . TRP A 1 89  ? -19.598 -6.077  42.003 1.00 8.86  ? 89  TRP A CE2 1 
ATOM 637  C CE3 . TRP A 1 89  ? -20.434 -4.864  43.954 1.00 9.41  ? 89  TRP A CE3 1 
ATOM 638  C CZ2 . TRP A 1 89  ? -18.982 -4.946  41.457 1.00 8.76  ? 89  TRP A CZ2 1 
ATOM 639  C CZ3 . TRP A 1 89  ? -19.831 -3.727  43.471 1.00 11.72 ? 89  TRP A CZ3 1 
ATOM 640  C CH2 . TRP A 1 89  ? -19.110 -3.758  42.220 1.00 11.56 ? 89  TRP A CH2 1 
ATOM 641  N N   . ARG A 1 90  ? -24.316 -8.157  43.458 1.00 8.79  ? 90  ARG A N   1 
ATOM 642  C CA  . ARG A 1 90  ? -25.237 -7.986  42.312 1.00 9.08  ? 90  ARG A CA  1 
ATOM 643  C C   . ARG A 1 90  ? -26.440 -7.172  42.693 1.00 10.81 ? 90  ARG A C   1 
ATOM 644  O O   . ARG A 1 90  ? -26.939 -6.450  41.801 1.00 10.98 ? 90  ARG A O   1 
ATOM 645  C CB  . ARG A 1 90  ? -25.618 -9.358  41.680 1.00 8.52  ? 90  ARG A CB  1 
ATOM 646  C CG  . ARG A 1 90  ? -24.354 -10.041 41.192 1.00 10.27 ? 90  ARG A CG  1 
ATOM 647  C CD  . ARG A 1 90  ? -24.596 -11.399 40.499 1.00 9.64  ? 90  ARG A CD  1 
ATOM 648  N NE  . ARG A 1 90  ? -24.916 -11.128 39.105 1.00 13.10 ? 90  ARG A NE  1 
ATOM 649  C CZ  . ARG A 1 90  ? -25.097 -12.102 38.196 1.00 14.49 ? 90  ARG A CZ  1 
ATOM 650  N NH1 . ARG A 1 90  ? -24.863 -13.399 38.481 1.00 12.12 ? 90  ARG A NH1 1 
ATOM 651  N NH2 . ARG A 1 90  ? -25.368 -11.715 36.969 1.00 16.01 ? 90  ARG A NH2 1 
ATOM 652  N N   . LYS A 1 91  ? -26.921 -7.307  43.928 1.00 11.20 ? 91  LYS A N   1 
ATOM 653  C CA  . LYS A 1 91  ? -28.076 -6.440  44.326 1.00 10.94 ? 91  LYS A CA  1 
ATOM 654  C C   . LYS A 1 91  ? -27.647 -4.991  44.378 1.00 11.14 ? 91  LYS A C   1 
ATOM 655  O O   . LYS A 1 91  ? -28.462 -4.104  44.025 1.00 13.03 ? 91  LYS A O   1 
ATOM 656  C CB  . LYS A 1 91  ? -28.650 -6.913  45.653 1.00 13.56 ? 91  LYS A CB  1 
ATOM 657  C CG  . LYS A 1 91  ? -29.326 -8.361  45.485 1.00 18.26 ? 91  LYS A CG  1 
ATOM 658  C CD  . LYS A 1 91  ? -29.878 -8.808  46.894 1.00 27.24 ? 91  LYS A CD  1 
ATOM 659  C CE  . LYS A 1 91  ? -30.544 -10.121 46.851 1.00 31.20 ? 91  LYS A CE  1 
ATOM 660  N NZ  . LYS A 1 91  ? -31.044 -10.568 48.151 1.00 39.77 ? 91  LYS A NZ  1 
ATOM 661  N N   . LEU A 1 92  ? -26.412 -4.683  44.790 1.00 10.10 ? 92  LEU A N   1 
ATOM 662  C CA  . LEU A 1 92  ? -25.946 -3.262  44.843 1.00 10.46 ? 92  LEU A CA  1 
ATOM 663  C C   . LEU A 1 92  ? -25.913 -2.720  43.408 1.00 10.94 ? 92  LEU A C   1 
ATOM 664  O O   . LEU A 1 92  ? -26.430 -1.621  43.106 1.00 10.45 ? 92  LEU A O   1 
ATOM 665  C CB  . LEU A 1 92  ? -24.550 -3.247  45.438 1.00 10.73 ? 92  LEU A CB  1 
ATOM 666  C CG  . LEU A 1 92  ? -23.815 -1.924  45.553 1.00 13.21 ? 92  LEU A CG  1 
ATOM 667  C CD1 . LEU A 1 92  ? -22.657 -2.115  46.647 1.00 14.00 ? 92  LEU A CD1 1 
ATOM 668  C CD2 . LEU A 1 92  ? -23.156 -1.450  44.238 1.00 11.04 ? 92  LEU A CD2 1 
ATOM 669  N N   . VAL A 1 93  ? -25.422 -3.496  42.466 1.00 9.32  ? 93  VAL A N   1 
ATOM 670  C CA  . VAL A 1 93  ? -25.312 -3.078  41.067 1.00 8.40  ? 93  VAL A CA  1 
ATOM 671  C C   . VAL A 1 93  ? -26.710 -2.869  40.517 1.00 8.98  ? 93  VAL A C   1 
ATOM 672  O O   . VAL A 1 93  ? -26.990 -1.852  39.840 1.00 10.51 ? 93  VAL A O   1 
ATOM 673  C CB  . VAL A 1 93  ? -24.590 -4.134  40.253 1.00 7.20  ? 93  VAL A CB  1 
ATOM 674  C CG1 . VAL A 1 93  ? -24.604 -3.814  38.696 1.00 8.84  ? 93  VAL A CG1 1 
ATOM 675  C CG2 . VAL A 1 93  ? -23.135 -4.106  40.707 1.00 9.90  ? 93  VAL A CG2 1 
ATOM 676  N N   . ALA A 1 94  ? -27.642 -3.814  40.772 1.00 8.22  ? 94  ALA A N   1 
ATOM 677  C CA  . ALA A 1 94  ? -29.005 -3.564  40.291 1.00 8.59  ? 94  ALA A CA  1 
ATOM 678  C C   . ALA A 1 94  ? -29.686 -2.354  40.914 1.00 8.96  ? 94  ALA A C   1 
ATOM 679  O O   . ALA A 1 94  ? -30.511 -1.731  40.301 1.00 9.80  ? 94  ALA A O   1 
ATOM 680  C CB  . ALA A 1 94  ? -29.838 -4.880  40.660 1.00 10.51 ? 94  ALA A CB  1 
ATOM 681  N N   . SER A 1 95  ? -29.351 -2.063  42.166 1.00 9.43  ? 95  SER A N   1 
ATOM 682  C CA  . SER A 1 95  ? -29.913 -0.839  42.819 1.00 9.92  ? 95  SER A CA  1 
ATOM 683  C C   . SER A 1 95  ? -29.374 0.392   42.122 1.00 10.12 ? 95  SER A C   1 
ATOM 684  O O   . SER A 1 95  ? -30.143 1.326   41.816 1.00 11.39 ? 95  SER A O   1 
ATOM 685  C CB  . SER A 1 95  ? -29.502 -0.846  44.306 1.00 11.39 ? 95  SER A CB  1 
ATOM 686  O OG  . SER A 1 95  ? -30.216 -1.936  44.984 1.00 19.73 ? 95  SER A OG  1 
ATOM 687  N N   . VAL A 1 96  ? -28.114 0.437   41.809 1.00 8.83  ? 96  VAL A N   1 
ATOM 688  C CA  . VAL A 1 96  ? -27.569 1.552   40.988 1.00 10.94 ? 96  VAL A CA  1 
ATOM 689  C C   . VAL A 1 96  ? -28.289 1.628   39.690 1.00 9.56  ? 96  VAL A C   1 
ATOM 690  O O   . VAL A 1 96  ? -28.703 2.731   39.263 1.00 9.45  ? 96  VAL A O   1 
ATOM 691  C CB  . VAL A 1 96  ? -26.052 1.351   40.801 1.00 9.20  ? 96  VAL A CB  1 
ATOM 692  C CG1 . VAL A 1 96  ? -25.455 2.349   39.793 1.00 8.62  ? 96  VAL A CG1 1 
ATOM 693  C CG2 . VAL A 1 96  ? -25.344 1.484   42.173 1.00 11.50 ? 96  VAL A CG2 1 
ATOM 694  N N   . ALA A 1 97  ? -28.361 0.502   38.953 1.00 9.80  ? 97  ALA A N   1 
ATOM 695  C CA  . ALA A 1 97  ? -29.005 0.535   37.659 1.00 10.10 ? 97  ALA A CA  1 
ATOM 696  C C   . ALA A 1 97  ? -30.452 1.046   37.725 1.00 10.63 ? 97  ALA A C   1 
ATOM 697  O O   . ALA A 1 97  ? -30.840 1.802   36.839 1.00 11.23 ? 97  ALA A O   1 
ATOM 698  C CB  . ALA A 1 97  ? -28.977 -0.849  37.057 1.00 9.69  ? 97  ALA A CB  1 
ATOM 699  N N   . GLY A 1 98  ? -31.188 0.651   38.741 1.00 8.90  ? 98  GLY A N   1 
ATOM 700  C CA  . GLY A 1 98  ? -32.559 1.164   38.993 1.00 11.63 ? 98  GLY A CA  1 
ATOM 701  C C   . GLY A 1 98  ? -32.622 2.667   39.037 1.00 11.54 ? 98  GLY A C   1 
ATOM 702  O O   . GLY A 1 98  ? -33.529 3.233   38.429 1.00 14.80 ? 98  GLY A O   1 
ATOM 703  N N   . VAL A 1 99  ? -31.726 3.292   39.816 1.00 10.30 ? 99  VAL A N   1 
ATOM 704  C CA  . VAL A 1 99  ? -31.759 4.768   39.889 1.00 8.48  ? 99  VAL A CA  1 
ATOM 705  C C   . VAL A 1 99  ? -31.434 5.324   38.522 1.00 11.72 ? 99  VAL A C   1 
ATOM 706  O O   . VAL A 1 99  ? -32.094 6.264   38.046 1.00 10.61 ? 99  VAL A O   1 
ATOM 707  C CB  . VAL A 1 99  ? -30.697 5.241   40.900 1.00 10.74 ? 99  VAL A CB  1 
ATOM 708  C CG1 . VAL A 1 99  ? -30.641 6.771   40.908 1.00 13.47 ? 99  VAL A CG1 1 
ATOM 709  C CG2 . VAL A 1 99  ? -31.162 4.789   42.278 1.00 15.38 ? 99  VAL A CG2 1 
ATOM 710  N N   . LEU A 1 100 ? -30.362 4.853   37.889 1.00 10.11 ? 100 LEU A N   1 
ATOM 711  C CA  . LEU A 1 100 ? -29.934 5.377   36.576 1.00 11.72 ? 100 LEU A CA  1 
ATOM 712  C C   . LEU A 1 100 ? -31.024 5.267   35.534 1.00 14.07 ? 100 LEU A C   1 
ATOM 713  O O   . LEU A 1 100 ? -31.176 6.169   34.670 1.00 13.89 ? 100 LEU A O   1 
ATOM 714  C CB  . LEU A 1 100 ? -28.641 4.726   36.082 1.00 10.81 ? 100 LEU A CB  1 
ATOM 715  C CG  . LEU A 1 100 ? -27.443 4.850   37.001 1.00 11.44 ? 100 LEU A CG  1 
ATOM 716  C CD1 . LEU A 1 100 ? -26.244 4.071   36.385 1.00 13.86 ? 100 LEU A CD1 1 
ATOM 717  C CD2 . LEU A 1 100 ? -27.011 6.308   37.287 1.00 13.40 ? 100 LEU A CD2 1 
ATOM 718  N N   . LYS A 1 101 ? -31.795 4.204   35.586 1.00 12.75 ? 101 LYS A N   1 
ATOM 719  C CA  . LYS A 1 101 ? -32.845 3.979   34.571 1.00 15.23 ? 101 LYS A CA  1 
ATOM 720  C C   . LYS A 1 101 ? -33.861 5.054   34.647 1.00 16.39 ? 101 LYS A C   1 
ATOM 721  O O   . LYS A 1 101 ? -34.477 5.370   33.596 1.00 16.48 ? 101 LYS A O   1 
ATOM 722  C CB  . LYS A 1 101 ? -33.580 2.600   34.776 1.00 16.06 ? 101 LYS A CB  1 
ATOM 723  C CG  . LYS A 1 101 ? -32.836 1.298   34.996 1.00 28.14 ? 101 LYS A CG  1 
ATOM 724  C CD  . LYS A 1 101 ? -33.519 0.023   34.344 1.00 34.34 ? 101 LYS A CD  1 
ATOM 725  C CE  . LYS A 1 101 ? -32.862 -1.360  34.858 1.00 35.22 ? 101 LYS A CE  1 
ATOM 726  N NZ  . LYS A 1 101 ? -33.173 -1.645  36.378 1.00 27.18 ? 101 LYS A NZ  1 
ATOM 727  N N   . GLY A 1 102 ? -34.131 5.550   35.840 1.00 14.58 ? 102 GLY A N   1 
ATOM 728  C CA  . GLY A 1 102 ? -35.121 6.597   36.071 1.00 13.95 ? 102 GLY A CA  1 
ATOM 729  C C   . GLY A 1 102 ? -34.674 8.020   35.806 1.00 14.23 ? 102 GLY A C   1 
ATOM 730  O O   . GLY A 1 102 ? -35.501 8.975   35.800 1.00 15.39 ? 102 GLY A O   1 
ATOM 731  N N   . LEU A 1 103 ? -33.384 8.209   35.654 1.00 14.24 ? 103 LEU A N   1 
ATOM 732  C CA  . LEU A 1 103 ? -32.860 9.571   35.360 1.00 13.87 ? 103 LEU A CA  1 
ATOM 733  C C   . LEU A 1 103 ? -32.807 9.872   33.880 1.00 14.05 ? 103 LEU A C   1 
ATOM 734  O O   . LEU A 1 103 ? -32.749 8.972   33.020 1.00 16.91 ? 103 LEU A O   1 
ATOM 735  C CB  . LEU A 1 103 ? -31.385 9.720   35.869 1.00 14.26 ? 103 LEU A CB  1 
ATOM 736  C CG  . LEU A 1 103 ? -31.271 9.418   37.401 1.00 9.43  ? 103 LEU A CG  1 
ATOM 737  C CD1 . LEU A 1 103 ? -29.758 9.484   37.826 1.00 11.29 ? 103 LEU A CD1 1 
ATOM 738  C CD2 . LEU A 1 103 ? -32.123 10.412  38.294 1.00 13.84 ? 103 LEU A CD2 1 
ATOM 739  N N   . ASN A 1 104 ? -32.689 11.160  33.558 1.00 13.16 ? 104 ASN A N   1 
ATOM 740  C CA  . ASN A 1 104 ? -32.626 11.554  32.154 1.00 13.43 ? 104 ASN A CA  1 
ATOM 741  C C   . ASN A 1 104 ? -31.196 11.788  31.841 1.00 15.29 ? 104 ASN A C   1 
ATOM 742  O O   . ASN A 1 104 ? -30.872 12.712  31.135 1.00 20.99 ? 104 ASN A O   1 
ATOM 743  C CB  . ASN A 1 104 ? -33.416 12.871  31.915 1.00 13.72 ? 104 ASN A CB  1 
ATOM 744  C CG  . ASN A 1 104 ? -33.587 13.199  30.440 1.00 21.72 ? 104 ASN A CG  1 
ATOM 745  O OD1 . ASN A 1 104 ? -33.725 12.284  29.644 1.00 23.27 ? 104 ASN A OD1 1 
ATOM 746  N ND2 . ASN A 1 104 ? -33.543 14.508  30.076 1.00 19.12 ? 104 ASN A ND2 1 
ATOM 747  N N   . GLY A 1 105 ? -30.294 10.973  32.370 1.00 12.38 ? 105 GLY A N   1 
ATOM 748  C CA  . GLY A 1 105 ? -28.856 11.102  32.044 1.00 12.90 ? 105 GLY A CA  1 
ATOM 749  C C   . GLY A 1 105 ? -28.383 10.164  30.938 1.00 12.76 ? 105 GLY A C   1 
ATOM 750  O O   . GLY A 1 105 ? -28.829 9.013   30.929 1.00 15.25 ? 105 GLY A O   1 
ATOM 751  N N   . ALA A 1 106 ? -27.642 10.678  29.969 1.00 12.79 ? 106 ALA A N   1 
ATOM 752  C CA  . ALA A 1 106 ? -27.199 9.890   28.845 1.00 13.59 ? 106 ALA A CA  1 
ATOM 753  C C   . ALA A 1 106 ? -26.098 8.936   29.111 1.00 11.43 ? 106 ALA A C   1 
ATOM 754  O O   . ALA A 1 106 ? -25.913 7.951   28.334 1.00 13.82 ? 106 ALA A O   1 
ATOM 755  C CB  . ALA A 1 106 ? -26.762 10.802  27.657 1.00 14.99 ? 106 ALA A CB  1 
ATOM 756  N N   . ASP A 1 107 ? -25.398 9.120   30.229 1.00 12.86 ? 107 ASP A N   1 
ATOM 757  C CA  . ASP A 1 107 ? -24.333 8.170   30.498 1.00 12.91 ? 107 ASP A CA  1 
ATOM 758  C C   . ASP A 1 107 ? -24.136 8.165   32.015 1.00 11.60 ? 107 ASP A C   1 
ATOM 759  O O   . ASP A 1 107 ? -24.771 8.982   32.732 1.00 11.78 ? 107 ASP A O   1 
ATOM 760  C CB  . ASP A 1 107 ? -23.022 8.550   29.783 1.00 12.20 ? 107 ASP A CB  1 
ATOM 761  C CG  . ASP A 1 107 ? -22.445 9.892   30.327 1.00 21.88 ? 107 ASP A CG  1 
ATOM 762  O OD1 . ASP A 1 107 ? -22.912 10.432  31.312 1.00 16.20 ? 107 ASP A OD1 1 
ATOM 763  O OD2 . ASP A 1 107 ? -21.342 10.311  29.863 1.00 27.41 ? 107 ASP A OD2 1 
ATOM 764  N N   . ALA A 1 108 ? -23.255 7.300   32.467 1.00 10.67 ? 108 ALA A N   1 
ATOM 765  C CA  . ALA A 1 108 ? -22.909 7.248   33.904 1.00 10.37 ? 108 ALA A CA  1 
ATOM 766  C C   . ALA A 1 108 ? -21.539 6.682   34.033 1.00 11.69 ? 108 ALA A C   1 
ATOM 767  O O   . ALA A 1 108 ? -21.043 5.981   33.108 1.00 13.28 ? 108 ALA A O   1 
ATOM 768  C CB  . ALA A 1 108 ? -23.867 6.372   34.696 1.00 10.86 ? 108 ALA A CB  1 
ATOM 769  N N   . VAL A 1 109 ? -20.908 7.012   35.140 1.00 10.59 ? 109 VAL A N   1 
ATOM 770  C CA  . VAL A 1 109 ? -19.524 6.502   35.474 1.00 10.56 ? 109 VAL A CA  1 
ATOM 771  C C   . VAL A 1 109 ? -19.629 5.791   36.777 1.00 10.94 ? 109 VAL A C   1 
ATOM 772  O O   . VAL A 1 109 ? -20.094 6.336   37.769 1.00 11.17 ? 109 VAL A O   1 
ATOM 773  C CB  . VAL A 1 109 ? -18.504 7.633   35.590 1.00 10.93 ? 109 VAL A CB  1 
ATOM 774  C CG1 . VAL A 1 109 ? -17.170 7.055   35.961 1.00 13.12 ? 109 VAL A CG1 1 
ATOM 775  C CG2 . VAL A 1 109 ? -18.357 8.344   34.243 1.00 12.23 ? 109 VAL A CG2 1 
ATOM 776  N N   . LEU A 1 110 ? -19.230 4.499   36.757 1.00 10.01 ? 110 LEU A N   1 
ATOM 777  C CA  . LEU A 1 110 ? -19.193 3.759   38.013 1.00 9.52  ? 110 LEU A CA  1 
ATOM 778  C C   . LEU A 1 110 ? -17.762 3.741   38.545 1.00 10.21 ? 110 LEU A C   1 
ATOM 779  O O   . LEU A 1 110 ? -16.853 3.154   37.873 1.00 10.74 ? 110 LEU A O   1 
ATOM 780  C CB  . LEU A 1 110 ? -19.749 2.302   37.806 1.00 10.05 ? 110 LEU A CB  1 
ATOM 781  C CG  . LEU A 1 110 ? -21.196 2.202   37.433 1.00 13.32 ? 110 LEU A CG  1 
ATOM 782  C CD1 . LEU A 1 110 ? -21.422 3.156   36.234 1.00 15.04 ? 110 LEU A CD1 1 
ATOM 783  C CD2 . LEU A 1 110 ? -21.713 0.870   37.101 1.00 14.34 ? 110 LEU A CD2 1 
ATOM 784  N N   . ALA A 1 111 ? -17.568 4.229   39.788 1.00 9.42  ? 111 ALA A N   1 
ATOM 785  C CA  . ALA A 1 111 ? -16.238 4.240   40.428 1.00 9.43  ? 111 ALA A CA  1 
ATOM 786  C C   . ALA A 1 111 ? -16.283 3.435   41.654 1.00 10.86 ? 111 ALA A C   1 
ATOM 787  O O   . ALA A 1 111 ? -16.260 3.908   42.790 1.00 11.12 ? 111 ALA A O   1 
ATOM 788  C CB  . ALA A 1 111 ? -15.830 5.712   40.703 1.00 11.08 ? 111 ALA A CB  1 
ATOM 789  N N   . LEU A 1 112 ? -16.444 2.116   41.411 1.00 12.02 ? 112 LEU A N   1 
ATOM 790  C CA  . LEU A 1 112 ? -16.651 1.160   42.488 1.00 11.89 ? 112 LEU A CA  1 
ATOM 791  C C   . LEU A 1 112 ? -15.437 0.265   42.710 1.00 14.00 ? 112 LEU A C   1 
ATOM 792  O O   . LEU A 1 112 ? -15.566 -0.820  43.310 1.00 13.50 ? 112 LEU A O   1 
ATOM 793  C CB  . LEU A 1 112 ? -17.855 0.258   42.200 1.00 10.95 ? 112 LEU A CB  1 
ATOM 794  C CG  . LEU A 1 112 ? -19.163 1.045   41.951 1.00 9.71  ? 112 LEU A CG  1 
ATOM 795  C CD1 . LEU A 1 112 ? -20.297 0.069   41.449 1.00 10.44 ? 112 LEU A CD1 1 
ATOM 796  C CD2 . LEU A 1 112 ? -19.570 1.762   43.245 1.00 13.77 ? 112 LEU A CD2 1 
ATOM 797  N N   . ASP A 1 113 ? -14.233 0.745   42.348 1.00 13.91 ? 113 ASP A N   1 
ATOM 798  C CA  . ASP A 1 113 ? -12.999 -0.082  42.542 1.00 16.06 ? 113 ASP A CA  1 
ATOM 799  C C   . ASP A 1 113 ? -12.788 -0.513  43.970 1.00 14.49 ? 113 ASP A C   1 
ATOM 800  O O   . ASP A 1 113 ? -12.255 -1.649  44.157 1.00 17.66 ? 113 ASP A O   1 
ATOM 801  C CB  . ASP A 1 113 ? -11.765 0.698   42.112 1.00 17.60 ? 113 ASP A CB  1 
ATOM 802  C CG  . ASP A 1 113 ? -10.540 -0.184  41.876 1.00 25.25 ? 113 ASP A CG  1 
ATOM 803  O OD1 . ASP A 1 113 ? -10.619 -1.068  40.984 1.00 24.68 ? 113 ASP A OD1 1 
ATOM 804  O OD2 . ASP A 1 113 ? -9.496  0.061   42.588 1.00 27.26 ? 113 ASP A OD2 1 
ATOM 805  N N   . ASP A 1 114 ? -13.182 0.275   44.940 1.00 16.23 ? 114 ASP A N   1 
ATOM 806  C CA  . ASP A 1 114 ? -12.867 -0.062  46.300 1.00 17.43 ? 114 ASP A CA  1 
ATOM 807  C C   . ASP A 1 114 ? -13.706 -1.201  46.856 1.00 18.91 ? 114 ASP A C   1 
ATOM 808  O O   . ASP A 1 114 ? -13.363 -1.719  47.944 1.00 20.47 ? 114 ASP A O   1 
ATOM 809  C CB  . ASP A 1 114 ? -12.939 1.186   47.161 1.00 19.43 ? 114 ASP A CB  1 
ATOM 810  C CG  . ASP A 1 114 ? -11.705 2.052   46.989 1.00 19.00 ? 114 ASP A CG  1 
ATOM 811  O OD1 . ASP A 1 114 ? -10.587 1.647   46.532 1.00 18.93 ? 114 ASP A OD1 1 
ATOM 812  O OD2 . ASP A 1 114 ? -11.871 3.207   47.312 1.00 14.58 ? 114 ASP A OD2 1 
ATOM 813  N N   . VAL A 1 115 ? -14.810 -1.559  46.195 1.00 13.51 ? 115 VAL A N   1 
ATOM 814  C CA  . VAL A 1 115 ? -15.687 -2.575  46.779 1.00 12.91 ? 115 VAL A CA  1 
ATOM 815  C C   . VAL A 1 115 ? -15.139 -3.939  46.620 1.00 12.19 ? 115 VAL A C   1 
ATOM 816  O O   . VAL A 1 115 ? -14.899 -4.374  45.520 1.00 17.74 ? 115 VAL A O   1 
ATOM 817  C CB  . VAL A 1 115 ? -17.099 -2.484  46.090 1.00 12.02 ? 115 VAL A CB  1 
ATOM 818  C CG1 . VAL A 1 115 ? -18.113 -3.563  46.727 1.00 13.86 ? 115 VAL A CG1 1 
ATOM 819  C CG2 . VAL A 1 115 ? -17.682 -1.060  46.233 1.00 15.56 ? 115 VAL A CG2 1 
ATOM 820  N N   . ALA A 1 116 ? -14.852 -4.564  47.723 1.00 14.95 ? 116 ALA A N   1 
ATOM 821  C CA  . ALA A 1 116 ? -14.335 -5.956  47.617 1.00 15.84 ? 116 ALA A CA  1 
ATOM 822  C C   . ALA A 1 116 ? -15.491 -6.953  47.534 1.00 15.05 ? 116 ALA A C   1 
ATOM 823  O O   . ALA A 1 116 ? -16.500 -6.866  48.253 1.00 15.35 ? 116 ALA A O   1 
ATOM 824  C CB  . ALA A 1 116 ? -13.531 -6.290  48.860 1.00 17.61 ? 116 ALA A CB  1 
ATOM 825  N N   . VAL A 1 117 ? -15.246 -7.979  46.692 1.00 16.46 ? 117 VAL A N   1 
ATOM 826  C CA  . VAL A 1 117 ? -16.255 -9.065  46.512 1.00 15.56 ? 117 VAL A CA  1 
ATOM 827  C C   . VAL A 1 117 ? -15.532 -10.379 46.942 1.00 16.53 ? 117 VAL A C   1 
ATOM 828  O O   . VAL A 1 117 ? -14.491 -10.695 46.390 1.00 16.67 ? 117 VAL A O   1 
ATOM 829  C CB  . VAL A 1 117 ? -16.839 -9.129  45.049 1.00 15.15 ? 117 VAL A CB  1 
ATOM 830  C CG1 . VAL A 1 117 ? -17.819 -10.361 44.888 1.00 14.99 ? 117 VAL A CG1 1 
ATOM 831  C CG2 . VAL A 1 117 ? -17.591 -7.873  44.735 1.00 18.44 ? 117 VAL A CG2 1 
ATOM 832  N N   . ASN A 1 118 ? -16.188 -11.108 47.842 1.00 16.84 ? 118 ASN A N   1 
ATOM 833  C CA  . ASN A 1 118 ? -15.599 -12.326 48.434 1.00 19.39 ? 118 ASN A CA  1 
ATOM 834  C C   . ASN A 1 118 ? -15.236 -13.356 47.334 1.00 20.27 ? 118 ASN A C   1 
ATOM 835  O O   . ASN A 1 118 ? -16.035 -13.678 46.420 1.00 18.00 ? 118 ASN A O   1 
ATOM 836  C CB  . ASN A 1 118 ? -16.600 -12.918 49.410 1.00 21.80 ? 118 ASN A CB  1 
ATOM 837  C CG  . ASN A 1 118 ? -15.975 -13.990 50.269 1.00 28.34 ? 118 ASN A CG  1 
ATOM 838  O OD1 . ASN A 1 118 ? -14.783 -13.921 50.565 1.00 30.90 ? 118 ASN A OD1 1 
ATOM 839  N ND2 . ASN A 1 118 ? -16.773 -15.001 50.637 1.00 30.42 ? 118 ASN A ND2 1 
ATOM 840  N N   . ASN A 1 119 ? -13.992 -13.823 47.417 1.00 21.59 ? 119 ASN A N   1 
ATOM 841  C CA  . ASN A 1 119 ? -13.469 -14.850 46.499 1.00 22.38 ? 119 ASN A CA  1 
ATOM 842  C C   . ASN A 1 119 ? -13.415 -14.463 45.021 1.00 22.93 ? 119 ASN A C   1 
ATOM 843  O O   . ASN A 1 119 ? -13.254 -15.340 44.192 1.00 24.96 ? 119 ASN A O   1 
ATOM 844  C CB  . ASN A 1 119 ? -14.224 -16.192 46.660 1.00 21.81 ? 119 ASN A CB  1 
ATOM 845  C CG  . ASN A 1 119 ? -13.376 -17.413 46.194 1.00 30.99 ? 119 ASN A CG  1 
ATOM 846  O OD1 . ASN A 1 119 ? -12.170 -17.488 46.473 1.00 35.60 ? 119 ASN A OD1 1 
ATOM 847  N ND2 . ASN A 1 119 ? -14.005 -18.312 45.387 1.00 35.00 ? 119 ASN A ND2 1 
ATOM 848  N N   . ARG A 1 120 ? -13.457 -13.164 44.693 1.00 21.88 ? 120 ARG A N   1 
ATOM 849  C CA  . ARG A 1 120 ? -13.340 -12.750 43.299 1.00 20.22 ? 120 ARG A CA  1 
ATOM 850  C C   . ARG A 1 120 ? -12.290 -11.723 43.112 1.00 22.85 ? 120 ARG A C   1 
ATOM 851  O O   . ARG A 1 120 ? -12.366 -10.726 43.841 1.00 21.93 ? 120 ARG A O   1 
ATOM 852  C CB  . ARG A 1 120 ? -14.681 -12.200 42.850 1.00 20.98 ? 120 ARG A CB  1 
ATOM 853  C CG  . ARG A 1 120 ? -15.711 -13.368 42.877 1.00 20.47 ? 120 ARG A CG  1 
ATOM 854  C CD  . ARG A 1 120 ? -16.744 -13.136 41.897 1.00 17.85 ? 120 ARG A CD  1 
ATOM 855  N NE  . ARG A 1 120 ? -17.794 -14.141 41.951 1.00 11.79 ? 120 ARG A NE  1 
ATOM 856  C CZ  . ARG A 1 120 ? -17.962 -15.124 41.029 1.00 12.67 ? 120 ARG A CZ  1 
ATOM 857  N NH1 . ARG A 1 120 ? -17.092 -15.310 40.052 1.00 11.33 ? 120 ARG A NH1 1 
ATOM 858  N NH2 . ARG A 1 120 ? -19.008 -15.944 41.191 1.00 11.74 ? 120 ARG A NH2 1 
ATOM 859  N N   . ASP A 1 121 ? -11.422 -11.894 42.081 1.00 22.62 ? 121 ASP A N   1 
ATOM 860  C CA  . ASP A 1 121 ? -10.304 -10.884 41.840 1.00 23.48 ? 121 ASP A CA  1 
ATOM 861  C C   . ASP A 1 121 ? -10.962 -9.545  41.462 1.00 24.39 ? 121 ASP A C   1 
ATOM 862  O O   . ASP A 1 121 ? -12.131 -9.467  40.898 1.00 22.48 ? 121 ASP A O   1 
ATOM 863  C CB  . ASP A 1 121 ? -9.313  -11.318 40.734 1.00 23.25 ? 121 ASP A CB  1 
ATOM 864  C CG  . ASP A 1 121 ? -9.938  -11.398 39.388 1.00 23.76 ? 121 ASP A CG  1 
ATOM 865  O OD1 . ASP A 1 121 ? -11.117 -10.943 39.283 1.00 28.64 ? 121 ASP A OD1 1 
ATOM 866  O OD2 . ASP A 1 121 ? -9.287  -11.939 38.456 1.00 27.70 ? 121 ASP A OD2 1 
ATOM 867  N N   . ALA A 1 122 ? -10.233 -8.476  41.800 1.00 24.31 ? 122 ALA A N   1 
ATOM 868  C CA  . ALA A 1 122 ? -10.762 -7.123  41.642 1.00 22.14 ? 122 ALA A CA  1 
ATOM 869  C C   . ALA A 1 122 ? -11.084 -6.696  40.226 1.00 21.83 ? 122 ALA A C   1 
ATOM 870  O O   . ALA A 1 122 ? -11.812 -5.655  40.093 1.00 21.39 ? 122 ALA A O   1 
ATOM 871  C CB  . ALA A 1 122 ? -9.783  -6.094  42.258 1.00 24.16 ? 122 ALA A CB  1 
ATOM 872  N N   . HIS A 1 123 ? -10.706 -7.472  39.170 1.00 18.57 ? 123 HIS A N   1 
ATOM 873  C CA  . HIS A 1 123 ? -10.877 -6.949  37.866 1.00 20.29 ? 123 HIS A CA  1 
ATOM 874  C C   . HIS A 1 123 ? -11.716 -7.904  37.064 1.00 21.11 ? 123 HIS A C   1 
ATOM 875  O O   . HIS A 1 123 ? -12.713 -7.414  36.505 1.00 23.33 ? 123 HIS A O   1 
ATOM 876  C CB  . HIS A 1 123 ? -9.614  -6.671  37.232 1.00 21.56 ? 123 HIS A CB  1 
ATOM 877  C CG  . HIS A 1 123 ? -8.792  -5.717  38.029 1.00 24.72 ? 123 HIS A CG  1 
ATOM 878  N ND1 . HIS A 1 123 ? -9.207  -4.420  38.296 1.00 33.69 ? 123 HIS A ND1 1 
ATOM 879  C CD2 . HIS A 1 123 ? -7.604  -5.882  38.653 1.00 26.89 ? 123 HIS A CD2 1 
ATOM 880  C CE1 . HIS A 1 123 ? -8.278  -3.814  39.027 1.00 29.23 ? 123 HIS A CE1 1 
ATOM 881  N NE2 . HIS A 1 123 ? -7.299  -4.679  39.255 1.00 34.07 ? 123 HIS A NE2 1 
ATOM 882  N N   . TYR A 1 124 ? -11.395 -9.194  37.032 1.00 14.61 ? 124 TYR A N   1 
ATOM 883  C CA  . TYR A 1 124 ? -12.215 -10.062 36.125 1.00 13.58 ? 124 TYR A CA  1 
ATOM 884  C C   . TYR A 1 124 ? -13.464 -10.600 36.785 1.00 11.46 ? 124 TYR A C   1 
ATOM 885  O O   . TYR A 1 124 ? -14.566 -10.316 36.291 1.00 12.78 ? 124 TYR A O   1 
ATOM 886  C CB  . TYR A 1 124 ? -11.388 -11.217 35.540 1.00 12.84 ? 124 TYR A CB  1 
ATOM 887  C CG  . TYR A 1 124 ? -12.164 -12.076 34.532 1.00 10.73 ? 124 TYR A CG  1 
ATOM 888  C CD1 . TYR A 1 124 ? -12.364 -11.632 33.217 1.00 10.55 ? 124 TYR A CD1 1 
ATOM 889  C CD2 . TYR A 1 124 ? -12.740 -13.286 34.945 1.00 12.45 ? 124 TYR A CD2 1 
ATOM 890  C CE1 . TYR A 1 124 ? -13.053 -12.405 32.297 1.00 10.22 ? 124 TYR A CE1 1 
ATOM 891  C CE2 . TYR A 1 124 ? -13.500 -14.099 34.040 1.00 10.02 ? 124 TYR A CE2 1 
ATOM 892  C CZ  . TYR A 1 124 ? -13.632 -13.658 32.746 1.00 8.88  ? 124 TYR A CZ  1 
ATOM 893  O OH  . TYR A 1 124 ? -14.313 -14.403 31.858 1.00 12.14 ? 124 TYR A OH  1 
ATOM 894  N N   . GLY A 1 125 ? -13.417 -11.379 37.870 1.00 13.41 ? 125 GLY A N   1 
ATOM 895  C CA  . GLY A 1 125 ? -14.635 -12.013 38.344 1.00 13.67 ? 125 GLY A CA  1 
ATOM 896  C C   . GLY A 1 125 ? -15.575 -10.941 38.898 1.00 12.95 ? 125 GLY A C   1 
ATOM 897  O O   . GLY A 1 125 ? -16.767 -11.066 38.682 1.00 12.81 ? 125 GLY A O   1 
ATOM 898  N N   . LYS A 1 126 ? -15.054 -9.899  39.576 1.00 11.43 ? 126 LYS A N   1 
ATOM 899  C CA  . LYS A 1 126 ? -15.964 -8.891  40.156 1.00 10.76 ? 126 LYS A CA  1 
ATOM 900  C C   . LYS A 1 126 ? -16.754 -8.265  39.006 1.00 8.60  ? 126 LYS A C   1 
ATOM 901  O O   . LYS A 1 126 ? -18.004 -8.026  39.186 1.00 10.33 ? 126 LYS A O   1 
ATOM 902  C CB  . LYS A 1 126 ? -15.095 -7.850  40.939 1.00 10.69 ? 126 LYS A CB  1 
ATOM 903  C CG  . LYS A 1 126 ? -15.831 -6.553  41.207 1.00 12.11 ? 126 LYS A CG  1 
ATOM 904  C CD  . LYS A 1 126 ? -14.847 -5.695  41.971 1.00 11.10 ? 126 LYS A CD  1 
ATOM 905  C CE  . LYS A 1 126 ? -15.496 -4.423  42.250 1.00 10.58 ? 126 LYS A CE  1 
ATOM 906  N NZ  . LYS A 1 126 ? -14.525 -3.470  43.014 1.00 11.79 ? 126 LYS A NZ  1 
ATOM 907  N N   . TYR A 1 127 ? -16.074 -7.935  37.880 1.00 8.99  ? 127 TYR A N   1 
ATOM 908  C CA  . TYR A 1 127 ? -16.785 -7.216  36.848 1.00 10.19 ? 127 TYR A CA  1 
ATOM 909  C C   . TYR A 1 127 ? -17.579 -8.121  35.892 1.00 9.04  ? 127 TYR A C   1 
ATOM 910  O O   . TYR A 1 127 ? -18.490 -7.622  35.203 1.00 10.03 ? 127 TYR A O   1 
ATOM 911  C CB  . TYR A 1 127 ? -15.803 -6.225  36.082 1.00 10.09 ? 127 TYR A CB  1 
ATOM 912  C CG  . TYR A 1 127 ? -15.519 -5.049  36.982 1.00 10.45 ? 127 TYR A CG  1 
ATOM 913  C CD1 . TYR A 1 127 ? -16.453 -4.028  37.075 1.00 13.28 ? 127 TYR A CD1 1 
ATOM 914  C CD2 . TYR A 1 127 ? -14.339 -4.982  37.680 1.00 12.61 ? 127 TYR A CD2 1 
ATOM 915  C CE1 . TYR A 1 127 ? -16.236 -2.915  37.951 1.00 13.58 ? 127 TYR A CE1 1 
ATOM 916  C CE2 . TYR A 1 127 ? -14.117 -3.905  38.581 1.00 13.30 ? 127 TYR A CE2 1 
ATOM 917  C CZ  . TYR A 1 127 ? -15.054 -2.894  38.651 1.00 14.39 ? 127 TYR A CZ  1 
ATOM 918  O OH  . TYR A 1 127 ? -14.828 -1.768  39.492 1.00 16.63 ? 127 TYR A OH  1 
ATOM 919  N N   . ARG A 1 128 ? -17.197 -9.392  35.777 1.00 9.28  ? 128 ARG A N   1 
ATOM 920  C CA  . ARG A 1 128 ? -18.130 -10.332 35.150 1.00 9.00  ? 128 ARG A CA  1 
ATOM 921  C C   . ARG A 1 128 ? -19.588 -10.210 35.750 1.00 8.70  ? 128 ARG A C   1 
ATOM 922  O O   . ARG A 1 128 ? -20.587 -10.174 34.974 1.00 9.06  ? 128 ARG A O   1 
ATOM 923  C CB  . ARG A 1 128 ? -17.685 -11.785 35.341 1.00 8.27  ? 128 ARG A CB  1 
ATOM 924  C CG  . ARG A 1 128 ? -16.582 -12.250 34.341 1.00 7.83  ? 128 ARG A CG  1 
ATOM 925  C CD  . ARG A 1 128 ? -17.136 -12.575 32.892 1.00 10.31 ? 128 ARG A CD  1 
ATOM 926  N NE  . ARG A 1 128 ? -18.199 -13.575 32.997 1.00 9.46  ? 128 ARG A NE  1 
ATOM 927  C CZ  . ARG A 1 128 ? -17.946 -14.876 33.093 1.00 11.37 ? 128 ARG A CZ  1 
ATOM 928  N NH1 . ARG A 1 128 ? -18.937 -15.730 33.418 1.00 10.09 ? 128 ARG A NH1 1 
ATOM 929  N NH2 . ARG A 1 128 ? -16.668 -15.351 32.976 1.00 12.52 ? 128 ARG A NH2 1 
ATOM 930  N N   . LEU A 1 129 ? -19.673 -10.184 37.074 1.00 9.06  ? 129 LEU A N   1 
ATOM 931  C CA  . LEU A 1 129 ? -20.996 -10.209 37.700 1.00 10.04 ? 129 LEU A CA  1 
ATOM 932  C C   . LEU A 1 129 ? -21.612 -8.817  37.538 1.00 9.84  ? 129 LEU A C   1 
ATOM 933  O O   . LEU A 1 129 ? -22.800 -8.719  37.249 1.00 9.45  ? 129 LEU A O   1 
ATOM 934  C CB  . LEU A 1 129 ? -20.870 -10.571 39.198 1.00 9.37  ? 129 LEU A CB  1 
ATOM 935  C CG  . LEU A 1 129 ? -20.898 -12.098 39.457 1.00 12.43 ? 129 LEU A CG  1 
ATOM 936  C CD1 . LEU A 1 129 ? -19.907 -12.891 38.646 1.00 19.32 ? 129 LEU A CD1 1 
ATOM 937  C CD2 . LEU A 1 129 ? -20.684 -12.330 40.969 1.00 11.83 ? 129 LEU A CD2 1 
ATOM 938  N N   . LEU A 1 130 ? -20.833 -7.727  37.731 1.00 8.05  ? 130 LEU A N   1 
ATOM 939  C CA  . LEU A 1 130 ? -21.433 -6.352  37.560 1.00 8.36  ? 130 LEU A CA  1 
ATOM 940  C C   . LEU A 1 130 ? -21.891 -6.182  36.141 1.00 8.99  ? 130 LEU A C   1 
ATOM 941  O O   . LEU A 1 130 ? -23.070 -5.740  35.980 1.00 8.92  ? 130 LEU A O   1 
ATOM 942  C CB  . LEU A 1 130 ? -20.418 -5.255  37.991 1.00 9.17  ? 130 LEU A CB  1 
ATOM 943  C CG  . LEU A 1 130 ? -20.856 -3.801  37.686 1.00 9.29  ? 130 LEU A CG  1 
ATOM 944  C CD1 . LEU A 1 130 ? -20.036 -2.952  38.711 1.00 12.07 ? 130 LEU A CD1 1 
ATOM 945  C CD2 . LEU A 1 130 ? -20.605 -3.357  36.244 1.00 8.80  ? 130 LEU A CD2 1 
ATOM 946  N N   . ALA A 1 131 ? -21.072 -6.531  35.122 1.00 7.28  ? 131 ALA A N   1 
ATOM 947  C CA  . ALA A 1 131 ? -21.447 -6.220  33.771 1.00 9.05  ? 131 ALA A CA  1 
ATOM 948  C C   . ALA A 1 131 ? -22.656 -7.065  33.343 1.00 8.35  ? 131 ALA A C   1 
ATOM 949  O O   . ALA A 1 131 ? -23.531 -6.540  32.672 1.00 9.38  ? 131 ALA A O   1 
ATOM 950  C CB  . ALA A 1 131 ? -20.330 -6.478  32.842 1.00 8.16  ? 131 ALA A CB  1 
ATOM 951  N N   . GLU A 1 132 ? -22.726 -8.339  33.744 1.00 8.66  ? 132 GLU A N   1 
ATOM 952  C CA  . GLU A 1 132 ? -23.874 -9.174  33.384 1.00 7.93  ? 132 GLU A CA  1 
ATOM 953  C C   . GLU A 1 132 ? -25.186 -8.633  34.022 1.00 9.37  ? 132 GLU A C   1 
ATOM 954  O O   . GLU A 1 132 ? -26.219 -8.525  33.372 1.00 8.77  ? 132 GLU A O   1 
ATOM 955  C CB  . GLU A 1 132 ? -23.565 -10.592 33.817 1.00 8.23  ? 132 GLU A CB  1 
ATOM 956  C CG  . GLU A 1 132 ? -24.715 -11.599 33.405 1.00 8.82  ? 132 GLU A CG  1 
ATOM 957  C CD  . GLU A 1 132 ? -24.335 -12.970 33.811 1.00 11.48 ? 132 GLU A CD  1 
ATOM 958  O OE1 . GLU A 1 132 ? -23.299 -13.139 34.393 1.00 11.56 ? 132 GLU A OE1 1 
ATOM 959  O OE2 . GLU A 1 132 ? -25.193 -13.810 33.601 1.00 14.51 ? 132 GLU A OE2 1 
ATOM 960  N N   . THR A 1 133 ? -25.101 -8.232  35.282 1.00 8.47  ? 133 THR A N   1 
ATOM 961  C CA  . THR A 1 133 ? -26.275 -7.655  35.955 1.00 9.68  ? 133 THR A CA  1 
ATOM 962  C C   . THR A 1 133 ? -26.729 -6.376  35.287 1.00 10.98 ? 133 THR A C   1 
ATOM 963  O O   . THR A 1 133 ? -27.955 -6.220  35.029 1.00 9.87  ? 133 THR A O   1 
ATOM 964  C CB  . THR A 1 133 ? -25.989 -7.442  37.424 1.00 8.94  ? 133 THR A CB  1 
ATOM 965  O OG1 . THR A 1 133 ? -25.842 -8.721  38.025 1.00 13.48 ? 133 THR A OG1 1 
ATOM 966  C CG2 . THR A 1 133 ? -27.153 -6.734  38.133 1.00 10.47 ? 133 THR A CG2 1 
ATOM 967  N N   . LEU A 1 134 ? -25.780 -5.508  34.957 1.00 9.58  ? 134 LEU A N   1 
ATOM 968  C CA  . LEU A 1 134 ? -26.073 -4.252  34.281 1.00 11.68 ? 134 LEU A CA  1 
ATOM 969  C C   . LEU A 1 134 ? -26.682 -4.423  32.887 1.00 10.40 ? 134 LEU A C   1 
ATOM 970  O O   . LEU A 1 134 ? -27.584 -3.672  32.514 1.00 10.12 ? 134 LEU A O   1 
ATOM 971  C CB  . LEU A 1 134 ? -24.811 -3.389  34.195 1.00 13.32 ? 134 LEU A CB  1 
ATOM 972  C CG  . LEU A 1 134 ? -25.001 -1.961  33.681 1.00 17.67 ? 134 LEU A CG  1 
ATOM 973  C CD1 . LEU A 1 134 ? -26.065 -1.235  34.489 1.00 22.18 ? 134 LEU A CD1 1 
ATOM 974  C CD2 . LEU A 1 134 ? -23.685 -1.198  33.713 1.00 16.63 ? 134 LEU A CD2 1 
ATOM 975  N N   . LEU A 1 135 ? -26.194 -5.389  32.109 1.00 10.41 ? 135 LEU A N   1 
ATOM 976  C CA  . LEU A 1 135 ? -26.688 -5.534  30.736 1.00 9.21  ? 135 LEU A CA  1 
ATOM 977  C C   . LEU A 1 135 ? -27.949 -6.425  30.699 1.00 10.48 ? 135 LEU A C   1 
ATOM 978  O O   . LEU A 1 135 ? -28.905 -6.129  29.973 1.00 11.31 ? 135 LEU A O   1 
ATOM 979  C CB  . LEU A 1 135 ? -25.614 -6.212  29.840 1.00 8.36  ? 135 LEU A CB  1 
ATOM 980  C CG  . LEU A 1 135 ? -24.376 -5.287  29.746 1.00 10.15 ? 135 LEU A CG  1 
ATOM 981  C CD1 . LEU A 1 135 ? -23.257 -6.109  29.027 1.00 12.35 ? 135 LEU A CD1 1 
ATOM 982  C CD2 . LEU A 1 135 ? -24.713 -4.045  28.947 1.00 14.48 ? 135 LEU A CD2 1 
ATOM 983  N N   . ASP A 1 136 ? -27.971 -7.498  31.483 1.00 10.38 ? 136 ASP A N   1 
ATOM 984  C CA  . ASP A 1 136 ? -29.227 -8.290  31.543 1.00 8.61  ? 136 ASP A CA  1 
ATOM 985  C C   . ASP A 1 136 ? -30.353 -7.459  32.124 1.00 11.18 ? 136 ASP A C   1 
ATOM 986  O O   . ASP A 1 136 ? -31.536 -7.670  31.771 1.00 12.50 ? 136 ASP A O   1 
ATOM 987  C CB  . ASP A 1 136 ? -28.975 -9.533  32.394 1.00 10.68 ? 136 ASP A CB  1 
ATOM 988  C CG  . ASP A 1 136 ? -30.161 -10.556 32.377 1.00 10.87 ? 136 ASP A CG  1 
ATOM 989  O OD1 . ASP A 1 136 ? -30.601 -10.989 31.242 1.00 12.49 ? 136 ASP A OD1 1 
ATOM 990  O OD2 . ASP A 1 136 ? -30.659 -10.826 33.524 1.00 13.79 ? 136 ASP A OD2 1 
ATOM 991  N N   . GLY A 1 137 ? -30.072 -6.516  33.013 1.00 9.84  ? 137 GLY A N   1 
ATOM 992  C CA  . GLY A 1 137 ? -31.135 -5.712  33.588 1.00 11.15 ? 137 GLY A CA  1 
ATOM 993  C C   . GLY A 1 137 ? -31.733 -4.705  32.645 1.00 11.53 ? 137 GLY A C   1 
ATOM 994  O O   . GLY A 1 137 ? -32.819 -4.161  32.937 1.00 14.15 ? 137 GLY A O   1 
ATOM 995  N N   . GLU A 1 138 ? -31.116 -4.532  31.452 1.00 11.00 ? 138 GLU A N   1 
ATOM 996  C CA  . GLU A 1 138 ? -31.700 -3.661  30.393 1.00 14.12 ? 138 GLU A CA  1 
ATOM 997  C C   . GLU A 1 138 ? -32.865 -4.365  29.665 1.00 13.21 ? 138 GLU A C   1 
ATOM 998  O O   . GLU A 1 138 ? -33.572 -3.772  28.815 1.00 14.52 ? 138 GLU A O   1 
ATOM 999  C CB  . GLU A 1 138 ? -30.661 -3.308  29.311 1.00 13.17 ? 138 GLU A CB  1 
ATOM 1000 C CG  . GLU A 1 138 ? -29.483 -2.470  29.732 1.00 22.16 ? 138 GLU A CG  1 
ATOM 1001 C CD  . GLU A 1 138 ? -29.956 -1.195  30.299 1.00 35.36 ? 138 GLU A CD  1 
ATOM 1002 O OE1 . GLU A 1 138 ? -30.932 -0.615  29.748 1.00 36.43 ? 138 GLU A OE1 1 
ATOM 1003 O OE2 . GLU A 1 138 ? -29.342 -0.797  31.319 1.00 37.54 ? 138 GLU A OE2 1 
ATOM 1004 N N   . TYR A 1 139 ? -33.046 -5.707  29.904 1.00 11.86 ? 139 TYR A N   1 
ATOM 1005 C CA  . TYR A 1 139 ? -33.987 -6.515  29.100 1.00 10.65 ? 139 TYR A CA  1 
ATOM 1006 C C   . TYR A 1 139 ? -35.392 -5.924  29.153 1.00 11.47 ? 139 TYR A C   1 
ATOM 1007 O O   . TYR A 1 139 ? -35.876 -5.633  30.256 1.00 13.51 ? 139 TYR A O   1 
ATOM 1008 C CB  . TYR A 1 139 ? -33.967 -7.953  29.682 1.00 11.83 ? 139 TYR A CB  1 
ATOM 1009 C CG  . TYR A 1 139 ? -34.839 -8.878  28.873 1.00 9.78  ? 139 TYR A CG  1 
ATOM 1010 C CD1 . TYR A 1 139 ? -36.084 -9.155  29.379 1.00 8.98  ? 139 TYR A CD1 1 
ATOM 1011 C CD2 . TYR A 1 139 ? -34.413 -9.407  27.668 1.00 7.38  ? 139 TYR A CD2 1 
ATOM 1012 C CE1 . TYR A 1 139 ? -36.982 -9.978  28.677 1.00 8.69  ? 139 TYR A CE1 1 
ATOM 1013 C CE2 . TYR A 1 139 ? -35.289 -10.243 26.987 1.00 9.77  ? 139 TYR A CE2 1 
ATOM 1014 C CZ  . TYR A 1 139 ? -36.588 -10.481 27.516 1.00 8.53  ? 139 TYR A CZ  1 
ATOM 1015 O OH  . TYR A 1 139 ? -37.325 -11.320 26.759 1.00 9.42  ? 139 TYR A OH  1 
ATOM 1016 N N   . VAL A 1 140 ? -35.988 -5.858  27.946 1.00 12.08 ? 140 VAL A N   1 
ATOM 1017 C CA  . VAL A 1 140 ? -37.420 -5.487  27.880 1.00 15.06 ? 140 VAL A CA  1 
ATOM 1018 C C   . VAL A 1 140 ? -38.091 -6.444  26.926 1.00 11.45 ? 140 VAL A C   1 
ATOM 1019 O O   . VAL A 1 140 ? -37.563 -6.745  25.858 1.00 14.40 ? 140 VAL A O   1 
ATOM 1020 C CB  . VAL A 1 140 ? -37.561 -4.056  27.304 1.00 16.46 ? 140 VAL A CB  1 
ATOM 1021 C CG1 . VAL A 1 140 ? -39.099 -3.789  27.027 1.00 19.77 ? 140 VAL A CG1 1 
ATOM 1022 C CG2 . VAL A 1 140 ? -37.023 -3.095  28.316 1.00 21.86 ? 140 VAL A CG2 1 
ATOM 1023 N N   . PHE A 1 141 ? -39.301 -6.872  27.304 1.00 11.72 ? 141 PHE A N   1 
ATOM 1024 C CA  . PHE A 1 141 ? -40.120 -7.754  26.403 1.00 12.35 ? 141 PHE A CA  1 
ATOM 1025 C C   . PHE A 1 141 ? -41.515 -7.099  26.434 1.00 10.77 ? 141 PHE A C   1 
ATOM 1026 O O   . PHE A 1 141 ? -42.421 -7.526  27.197 1.00 12.96 ? 141 PHE A O   1 
ATOM 1027 C CB  . PHE A 1 141 ? -40.161 -9.199  26.942 1.00 10.31 ? 141 PHE A CB  1 
ATOM 1028 C CG  . PHE A 1 141 ? -40.870 -10.171 26.007 1.00 10.26 ? 141 PHE A CG  1 
ATOM 1029 C CD1 . PHE A 1 141 ? -42.153 -10.621 26.307 1.00 11.66 ? 141 PHE A CD1 1 
ATOM 1030 C CD2 . PHE A 1 141 ? -40.194 -10.649 24.938 1.00 12.86 ? 141 PHE A CD2 1 
ATOM 1031 C CE1 . PHE A 1 141 ? -42.763 -11.526 25.472 1.00 12.83 ? 141 PHE A CE1 1 
ATOM 1032 C CE2 . PHE A 1 141 ? -40.784 -11.642 24.089 1.00 10.17 ? 141 PHE A CE2 1 
ATOM 1033 C CZ  . PHE A 1 141 ? -42.049 -12.028 24.387 1.00 9.04  ? 141 PHE A CZ  1 
ATOM 1034 N N   . ASP A 1 142 ? -41.655 -6.101  25.584 1.00 12.10 ? 142 ASP A N   1 
ATOM 1035 C CA  . ASP A 1 142 ? -42.935 -5.310  25.472 1.00 10.38 ? 142 ASP A CA  1 
ATOM 1036 C C   . ASP A 1 142 ? -43.597 -5.528  24.158 1.00 10.80 ? 142 ASP A C   1 
ATOM 1037 O O   . ASP A 1 142 ? -44.537 -4.743  23.790 1.00 11.02 ? 142 ASP A O   1 
ATOM 1038 C CB  . ASP A 1 142 ? -42.730 -3.847  25.831 1.00 13.48 ? 142 ASP A CB  1 
ATOM 1039 C CG  . ASP A 1 142 ? -41.870 -3.160  24.892 1.00 17.36 ? 142 ASP A CG  1 
ATOM 1040 O OD1 . ASP A 1 142 ? -41.304 -3.803  23.993 1.00 18.68 ? 142 ASP A OD1 1 
ATOM 1041 O OD2 . ASP A 1 142 ? -41.770 -1.876  25.035 1.00 19.83 ? 142 ASP A OD2 1 
ATOM 1042 N N   . ARG A 1 143 ? -43.224 -6.568  23.413 1.00 10.49 ? 143 ARG A N   1 
ATOM 1043 C CA  . ARG A 1 143 ? -43.797 -6.821  22.088 1.00 12.49 ? 143 ARG A CA  1 
ATOM 1044 C C   . ARG A 1 143 ? -45.323 -6.868  22.113 1.00 11.78 ? 143 ARG A C   1 
ATOM 1045 O O   . ARG A 1 143 ? -45.950 -6.404  21.203 1.00 14.96 ? 143 ARG A O   1 
ATOM 1046 C CB  . ARG A 1 143 ? -43.304 -8.232  21.605 1.00 15.91 ? 143 ARG A CB  1 
ATOM 1047 C CG  . ARG A 1 143 ? -44.126 -8.773  20.402 1.00 25.80 ? 143 ARG A CG  1 
ATOM 1048 C CD  . ARG A 1 143 ? -43.468 -9.883  19.673 1.00 25.58 ? 143 ARG A CD  1 
ATOM 1049 N NE  . ARG A 1 143 ? -44.369 -10.321 18.596 1.00 31.97 ? 143 ARG A NE  1 
ATOM 1050 C CZ  . ARG A 1 143 ? -44.071 -11.306 17.776 1.00 35.35 ? 143 ARG A CZ  1 
ATOM 1051 N NH1 . ARG A 1 143 ? -44.953 -11.675 16.826 1.00 39.28 ? 143 ARG A NH1 1 
ATOM 1052 N NH2 . ARG A 1 143 ? -42.888 -11.900 17.912 1.00 28.36 ? 143 ARG A NH2 1 
ATOM 1053 N N   . PHE A 1 144 ? -45.886 -7.413  23.192 1.00 11.07 ? 144 PHE A N   1 
ATOM 1054 C CA  . PHE A 1 144 ? -47.376 -7.629  23.156 1.00 10.89 ? 144 PHE A CA  1 
ATOM 1055 C C   . PHE A 1 144 ? -48.040 -6.533  23.938 1.00 12.06 ? 144 PHE A C   1 
ATOM 1056 O O   . PHE A 1 144 ? -49.276 -6.611  24.226 1.00 14.71 ? 144 PHE A O   1 
ATOM 1057 C CB  . PHE A 1 144 ? -47.674 -9.004  23.813 1.00 11.06 ? 144 PHE A CB  1 
ATOM 1058 C CG  . PHE A 1 144 ? -47.121 -10.094 22.967 1.00 9.29  ? 144 PHE A CG  1 
ATOM 1059 C CD1 . PHE A 1 144 ? -45.907 -10.726 23.284 1.00 9.69  ? 144 PHE A CD1 1 
ATOM 1060 C CD2 . PHE A 1 144 ? -47.759 -10.434 21.848 1.00 11.82 ? 144 PHE A CD2 1 
ATOM 1061 C CE1 . PHE A 1 144 ? -45.328 -11.695 22.435 1.00 11.46 ? 144 PHE A CE1 1 
ATOM 1062 C CE2 . PHE A 1 144 ? -47.200 -11.427 21.001 1.00 12.90 ? 144 PHE A CE2 1 
ATOM 1063 C CZ  . PHE A 1 144 ? -45.975 -12.056 21.297 1.00 10.22 ? 144 PHE A CZ  1 
ATOM 1064 N N   . LYS A 1 145 ? -47.340 -5.490  24.342 1.00 9.02  ? 145 LYS A N   1 
ATOM 1065 C CA  . LYS A 1 145 ? -48.007 -4.396  25.091 1.00 11.25 ? 145 LYS A CA  1 
ATOM 1066 C C   . LYS A 1 145 ? -48.381 -3.310  24.090 1.00 12.87 ? 145 LYS A C   1 
ATOM 1067 O O   . LYS A 1 145 ? -47.600 -2.894  23.202 1.00 14.21 ? 145 LYS A O   1 
ATOM 1068 C CB  . LYS A 1 145 ? -47.028 -3.787  26.066 1.00 12.11 ? 145 LYS A CB  1 
ATOM 1069 C CG  . LYS A 1 145 ? -46.622 -4.637  27.190 1.00 11.46 ? 145 LYS A CG  1 
ATOM 1070 C CD  . LYS A 1 145 ? -47.714 -4.750  28.175 1.00 15.00 ? 145 LYS A CD  1 
ATOM 1071 C CE  . LYS A 1 145 ? -47.285 -5.403  29.545 1.00 14.78 ? 145 LYS A CE  1 
ATOM 1072 N NZ  . LYS A 1 145 ? -48.453 -5.343  30.538 1.00 13.82 ? 145 LYS A NZ  1 
ATOM 1073 N N   . SER A 1 146 ? -49.547 -2.717  24.277 1.00 13.30 ? 146 SER A N   1 
ATOM 1074 C CA  . SER A 1 146 ? -49.922 -1.611  23.419 1.00 15.19 ? 146 SER A CA  1 
ATOM 1075 C C   . SER A 1 146 ? -49.194 -0.333  23.915 1.00 15.86 ? 146 SER A C   1 
ATOM 1076 O O   . SER A 1 146 ? -48.844 0.494   23.014 1.00 20.68 ? 146 SER A O   1 
ATOM 1077 C CB  . SER A 1 146 ? -51.424 -1.367  23.530 1.00 15.27 ? 146 SER A CB  1 
ATOM 1078 O OG  . SER A 1 146 ? -52.151 -2.453  22.908 1.00 16.69 ? 146 SER A OG  1 
ATOM 1079 N N   . GLU A 1 150 ? -41.127 3.487   27.426 1.00 37.84 ? 150 GLU A N   1 
ATOM 1080 C CA  . GLU A 1 150 ? -40.354 4.647   26.944 1.00 40.50 ? 150 GLU A CA  1 
ATOM 1081 C C   . GLU A 1 150 ? -38.855 4.299   27.020 1.00 40.22 ? 150 GLU A C   1 
ATOM 1082 O O   . GLU A 1 150 ? -38.382 3.778   28.072 1.00 39.92 ? 150 GLU A O   1 
ATOM 1083 C CB  . GLU A 1 150 ? -40.639 5.936   27.724 1.00 41.41 ? 150 GLU A CB  1 
ATOM 1084 C CG  . GLU A 1 150 ? -42.092 6.509   27.602 1.00 45.85 ? 150 GLU A CG  1 
ATOM 1085 C CD  . GLU A 1 150 ? -43.087 5.858   28.617 1.00 53.77 ? 150 GLU A CD  1 
ATOM 1086 O OE1 . GLU A 1 150 ? -42.660 4.923   29.373 1.00 54.02 ? 150 GLU A OE1 1 
ATOM 1087 O OE2 . GLU A 1 150 ? -44.287 6.285   28.652 1.00 53.60 ? 150 GLU A OE2 1 
ATOM 1088 N N   . PRO A 1 151 ? -38.156 4.508   25.871 1.00 40.09 ? 151 PRO A N   1 
ATOM 1089 C CA  . PRO A 1 151 ? -36.703 4.357   25.648 1.00 38.03 ? 151 PRO A CA  1 
ATOM 1090 C C   . PRO A 1 151 ? -35.967 5.121   26.732 1.00 34.88 ? 151 PRO A C   1 
ATOM 1091 O O   . PRO A 1 151 ? -36.353 6.219   27.115 1.00 35.57 ? 151 PRO A O   1 
ATOM 1092 C CB  . PRO A 1 151 ? -36.496 4.988   24.258 1.00 39.02 ? 151 PRO A CB  1 
ATOM 1093 C CG  . PRO A 1 151 ? -37.860 4.734   23.578 1.00 41.10 ? 151 PRO A CG  1 
ATOM 1094 C CD  . PRO A 1 151 ? -38.628 4.007   24.669 1.00 40.49 ? 151 PRO A CD  1 
ATOM 1095 N N   . ARG A 1 152 ? -34.931 4.515   27.268 1.00 31.22 ? 152 ARG A N   1 
ATOM 1096 C CA  . ARG A 1 152 ? -34.327 5.169   28.413 1.00 28.20 ? 152 ARG A CA  1 
ATOM 1097 C C   . ARG A 1 152 ? -33.177 6.016   27.965 1.00 23.52 ? 152 ARG A C   1 
ATOM 1098 O O   . ARG A 1 152 ? -32.582 5.766   26.897 1.00 20.46 ? 152 ARG A O   1 
ATOM 1099 C CB  . ARG A 1 152 ? -33.869 4.114   29.342 1.00 28.42 ? 152 ARG A CB  1 
ATOM 1100 C CG  . ARG A 1 152 ? -35.070 3.568   30.136 1.00 34.22 ? 152 ARG A CG  1 
ATOM 1101 C CD  . ARG A 1 152 ? -34.575 2.453   30.942 1.00 35.18 ? 152 ARG A CD  1 
ATOM 1102 N NE  . ARG A 1 152 ? -33.867 1.450   30.116 1.00 32.82 ? 152 ARG A NE  1 
ATOM 1103 C CZ  . ARG A 1 152 ? -34.198 0.136   30.081 1.00 36.13 ? 152 ARG A CZ  1 
ATOM 1104 N NH1 . ARG A 1 152 ? -35.237 -0.348  30.767 1.00 37.25 ? 152 ARG A NH1 1 
ATOM 1105 N NH2 . ARG A 1 152 ? -33.490 -0.707  29.350 1.00 27.90 ? 152 ARG A NH2 1 
ATOM 1106 N N   . ALA A 1 153 ? -32.896 7.031   28.802 1.00 19.86 ? 153 ALA A N   1 
ATOM 1107 C CA  . ALA A 1 153 ? -31.892 7.998   28.407 1.00 18.69 ? 153 ALA A CA  1 
ATOM 1108 C C   . ALA A 1 153 ? -30.505 7.366   28.470 1.00 17.25 ? 153 ALA A C   1 
ATOM 1109 O O   . ALA A 1 153 ? -29.649 7.762   27.714 1.00 14.44 ? 153 ALA A O   1 
ATOM 1110 C CB  . ALA A 1 153 ? -31.966 9.249   29.263 1.00 19.65 ? 153 ALA A CB  1 
ATOM 1111 N N   . LEU A 1 154 ? -30.278 6.389   29.385 1.00 15.41 ? 154 LEU A N   1 
ATOM 1112 C CA  . LEU A 1 154 ? -28.934 5.863   29.612 1.00 15.90 ? 154 LEU A CA  1 
ATOM 1113 C C   . LEU A 1 154 ? -28.457 5.010   28.471 1.00 15.62 ? 154 LEU A C   1 
ATOM 1114 O O   . LEU A 1 154 ? -29.022 3.945   28.239 1.00 18.40 ? 154 LEU A O   1 
ATOM 1115 C CB  . LEU A 1 154 ? -28.846 5.064   30.936 1.00 16.17 ? 154 LEU A CB  1 
ATOM 1116 C CG  . LEU A 1 154 ? -27.482 4.547   31.270 1.00 14.89 ? 154 LEU A CG  1 
ATOM 1117 C CD1 . LEU A 1 154 ? -26.709 5.730   31.879 1.00 17.84 ? 154 LEU A CD1 1 
ATOM 1118 C CD2 . LEU A 1 154 ? -27.487 3.363   32.346 1.00 20.39 ? 154 LEU A CD2 1 
ATOM 1119 N N   . LYS A 1 155 ? -27.431 5.496   27.808 1.00 16.34 ? 155 LYS A N   1 
ATOM 1120 C CA  . LYS A 1 155 ? -26.879 4.806   26.653 1.00 18.04 ? 155 LYS A CA  1 
ATOM 1121 C C   . LYS A 1 155 ? -25.488 4.254   26.847 1.00 17.20 ? 155 LYS A C   1 
ATOM 1122 O O   . LYS A 1 155 ? -25.021 3.425   26.088 1.00 18.01 ? 155 LYS A O   1 
ATOM 1123 C CB  . LYS A 1 155 ? -26.903 5.711   25.417 1.00 20.72 ? 155 LYS A CB  1 
ATOM 1124 C CG  . LYS A 1 155 ? -28.422 6.095   25.102 1.00 25.60 ? 155 LYS A CG  1 
ATOM 1125 C CD  . LYS A 1 155 ? -29.311 4.938   24.724 1.00 37.39 ? 155 LYS A CD  1 
ATOM 1126 C CE  . LYS A 1 155 ? -30.746 5.419   24.364 1.00 38.15 ? 155 LYS A CE  1 
ATOM 1127 N NZ  . LYS A 1 155 ? -31.703 4.346   24.000 1.00 40.87 ? 155 LYS A NZ  1 
ATOM 1128 N N   . LYS A 1 156 ? -24.749 4.756   27.851 1.00 16.11 ? 156 LYS A N   1 
ATOM 1129 C CA  . LYS A 1 156 ? -23.413 4.374   28.052 1.00 13.94 ? 156 LYS A CA  1 
ATOM 1130 C C   . LYS A 1 156 ? -23.058 4.365   29.512 1.00 14.65 ? 156 LYS A C   1 
ATOM 1131 O O   . LYS A 1 156 ? -23.463 5.292   30.233 1.00 14.01 ? 156 LYS A O   1 
ATOM 1132 C CB  . LYS A 1 156 ? -22.491 5.384   27.340 1.00 14.72 ? 156 LYS A CB  1 
ATOM 1133 C CG  . LYS A 1 156 ? -20.972 5.126   27.448 1.00 15.42 ? 156 LYS A CG  1 
ATOM 1134 C CD  . LYS A 1 156 ? -20.227 6.300   26.706 1.00 20.04 ? 156 LYS A CD  1 
ATOM 1135 C CE  . LYS A 1 156 ? -18.774 6.382   27.080 1.00 26.02 ? 156 LYS A CE  1 
ATOM 1136 N NZ  . LYS A 1 156 ? -18.046 7.555   26.401 1.00 33.03 ? 156 LYS A NZ  1 
ATOM 1137 N N   . VAL A 1 157 ? -22.264 3.351   29.960 1.00 13.42 ? 157 VAL A N   1 
ATOM 1138 C CA  . VAL A 1 157 ? -21.726 3.337   31.269 1.00 11.82 ? 157 VAL A CA  1 
ATOM 1139 C C   . VAL A 1 157 ? -20.217 3.142   31.113 1.00 13.07 ? 157 VAL A C   1 
ATOM 1140 O O   . VAL A 1 157 ? -19.742 2.286   30.341 1.00 13.55 ? 157 VAL A O   1 
ATOM 1141 C CB  . VAL A 1 157 ? -22.389 2.181   32.083 1.00 12.02 ? 157 VAL A CB  1 
ATOM 1142 C CG1 . VAL A 1 157 ? -21.626 2.013   33.428 1.00 12.86 ? 157 VAL A CG1 1 
ATOM 1143 C CG2 . VAL A 1 157 ? -23.789 2.592   32.448 1.00 13.60 ? 157 VAL A CG2 1 
ATOM 1144 N N   . THR A 1 158 ? -19.463 3.925   31.842 1.00 12.80 ? 158 THR A N   1 
ATOM 1145 C CA  . THR A 1 158 ? -18.035 3.754   31.995 1.00 13.38 ? 158 THR A CA  1 
ATOM 1146 C C   . THR A 1 158 ? -17.711 3.195   33.354 1.00 12.64 ? 158 THR A C   1 
ATOM 1147 O O   . THR A 1 158 ? -18.134 3.731   34.374 1.00 14.51 ? 158 THR A O   1 
ATOM 1148 C CB  . THR A 1 158 ? -17.360 5.135   31.866 1.00 15.57 ? 158 THR A CB  1 
ATOM 1149 O OG1 . THR A 1 158 ? -17.678 5.624   30.551 1.00 16.95 ? 158 THR A OG1 1 
ATOM 1150 C CG2 . THR A 1 158 ? -15.834 4.993   31.979 1.00 16.65 ? 158 THR A CG2 1 
ATOM 1151 N N   . LEU A 1 159 ? -16.898 2.107   33.364 1.00 12.32 ? 159 LEU A N   1 
ATOM 1152 C CA  . LEU A 1 159 ? -16.355 1.591   34.601 1.00 12.65 ? 159 LEU A CA  1 
ATOM 1153 C C   . LEU A 1 159 ? -14.923 2.077   34.799 1.00 12.64 ? 159 LEU A C   1 
ATOM 1154 O O   . LEU A 1 159 ? -14.096 1.944   33.896 1.00 12.30 ? 159 LEU A O   1 
ATOM 1155 C CB  . LEU A 1 159 ? -16.235 0.036   34.478 1.00 11.55 ? 159 LEU A CB  1 
ATOM 1156 C CG  . LEU A 1 159 ? -17.532 -0.643  33.984 1.00 10.58 ? 159 LEU A CG  1 
ATOM 1157 C CD1 . LEU A 1 159 ? -17.253 -2.210  33.887 1.00 12.91 ? 159 LEU A CD1 1 
ATOM 1158 C CD2 . LEU A 1 159 ? -18.705 -0.369  34.958 1.00 10.80 ? 159 LEU A CD2 1 
ATOM 1159 N N   . LEU A 1 160 ? -14.665 2.617   35.965 1.00 11.78 ? 160 LEU A N   1 
ATOM 1160 C CA  . LEU A 1 160 ? -13.266 3.028   36.234 1.00 14.83 ? 160 LEU A CA  1 
ATOM 1161 C C   . LEU A 1 160 ? -12.526 1.992   37.039 1.00 15.39 ? 160 LEU A C   1 
ATOM 1162 O O   . LEU A 1 160 ? -13.004 1.521   38.040 1.00 15.23 ? 160 LEU A O   1 
ATOM 1163 C CB  . LEU A 1 160 ? -13.246 4.318   37.070 1.00 13.95 ? 160 LEU A CB  1 
ATOM 1164 C CG  . LEU A 1 160 ? -13.853 5.478   36.307 1.00 12.46 ? 160 LEU A CG  1 
ATOM 1165 C CD1 . LEU A 1 160 ? -13.782 6.719   37.229 1.00 14.74 ? 160 LEU A CD1 1 
ATOM 1166 C CD2 . LEU A 1 160 ? -13.145 5.771   34.972 1.00 15.92 ? 160 LEU A CD2 1 
ATOM 1167 N N   . ALA A 1 161 ? -11.303 1.737   36.580 1.00 16.06 ? 161 ALA A N   1 
ATOM 1168 C CA  . ALA A 1 161 ? -10.405 0.819   37.330 1.00 18.73 ? 161 ALA A CA  1 
ATOM 1169 C C   . ALA A 1 161 ? -8.996  1.369   37.186 1.00 20.45 ? 161 ALA A C   1 
ATOM 1170 O O   . ALA A 1 161 ? -8.782  2.220   36.371 1.00 19.85 ? 161 ALA A O   1 
ATOM 1171 C CB  . ALA A 1 161 ? -10.466 -0.649  36.757 1.00 19.49 ? 161 ALA A CB  1 
ATOM 1172 N N   . ASP A 1 162 ? -8.066  0.866   37.963 1.00 24.66 ? 162 ASP A N   1 
ATOM 1173 C CA  . ASP A 1 162 ? -6.713  1.274   37.789 1.00 27.69 ? 162 ASP A CA  1 
ATOM 1174 C C   . ASP A 1 162 ? -6.117  0.747   36.497 1.00 28.08 ? 162 ASP A C   1 
ATOM 1175 O O   . ASP A 1 162 ? -6.601  -0.275  35.924 1.00 25.58 ? 162 ASP A O   1 
ATOM 1176 C CB  . ASP A 1 162 ? -5.883  1.071   39.101 1.00 31.73 ? 162 ASP A CB  1 
ATOM 1177 C CG  . ASP A 1 162 ? -5.809  -0.347  39.564 1.00 38.76 ? 162 ASP A CG  1 
ATOM 1178 O OD1 . ASP A 1 162 ? -6.451  -1.225  38.946 1.00 45.05 ? 162 ASP A OD1 1 
ATOM 1179 O OD2 . ASP A 1 162 ? -5.117  -0.580  40.598 1.00 46.42 ? 162 ASP A OD2 1 
ATOM 1180 N N   . LYS A 1 163 ? -5.132  1.464   35.950 1.00 27.75 ? 163 LYS A N   1 
ATOM 1181 C CA  . LYS A 1 163 ? -4.568  1.060   34.687 1.00 28.56 ? 163 LYS A CA  1 
ATOM 1182 C C   . LYS A 1 163 ? -4.101  -0.419  34.626 1.00 28.18 ? 163 LYS A C   1 
ATOM 1183 O O   . LYS A 1 163 ? -4.272  -1.054  33.547 1.00 29.77 ? 163 LYS A O   1 
ATOM 1184 C CB  . LYS A 1 163 ? -3.426  2.038   34.273 1.00 30.34 ? 163 LYS A CB  1 
ATOM 1185 C CG  . LYS A 1 163 ? -2.815  1.750   32.870 1.00 34.39 ? 163 LYS A CG  1 
ATOM 1186 C CD  . LYS A 1 163 ? -3.725  2.108   31.708 1.00 39.91 ? 163 LYS A CD  1 
ATOM 1187 C CE  . LYS A 1 163 ? -3.327  1.387   30.440 1.00 42.62 ? 163 LYS A CE  1 
ATOM 1188 N NZ  . LYS A 1 163 ? -4.404  1.472   29.403 1.00 42.99 ? 163 LYS A NZ  1 
ATOM 1189 N N   . ALA A 1 164 ? -3.619  -0.960  35.767 1.00 28.62 ? 164 ALA A N   1 
ATOM 1190 C CA  . ALA A 1 164 ? -3.126  -2.362  35.865 1.00 28.63 ? 164 ALA A CA  1 
ATOM 1191 C C   . ALA A 1 164 ? -4.220  -3.339  35.531 1.00 27.50 ? 164 ALA A C   1 
ATOM 1192 O O   . ALA A 1 164 ? -3.995  -4.243  34.666 1.00 26.49 ? 164 ALA A O   1 
ATOM 1193 C CB  . ALA A 1 164 ? -2.550  -2.705  37.276 1.00 29.74 ? 164 ALA A CB  1 
ATOM 1194 N N   . GLY A 1 165 ? -5.412  -3.021  36.065 1.00 24.85 ? 165 GLY A N   1 
ATOM 1195 C CA  . GLY A 1 165 ? -6.604  -3.901  35.924 1.00 23.76 ? 165 GLY A CA  1 
ATOM 1196 C C   . GLY A 1 165 ? -7.482  -3.689  34.742 1.00 22.06 ? 165 GLY A C   1 
ATOM 1197 O O   . GLY A 1 165 ? -8.421  -4.489  34.576 1.00 20.10 ? 165 GLY A O   1 
ATOM 1198 N N   . GLN A 1 166 ? -7.214  -2.696  33.880 1.00 21.38 ? 166 GLN A N   1 
ATOM 1199 C CA  . GLN A 1 166 ? -8.044  -2.306  32.751 1.00 20.29 ? 166 GLN A CA  1 
ATOM 1200 C C   . GLN A 1 166 ? -8.275  -3.446  31.776 1.00 18.91 ? 166 GLN A C   1 
ATOM 1201 O O   . GLN A 1 166 ? -9.480  -3.691  31.415 1.00 18.13 ? 166 GLN A O   1 
ATOM 1202 C CB  . GLN A 1 166 ? -7.466  -1.115  31.960 1.00 21.82 ? 166 GLN A CB  1 
ATOM 1203 C CG  . GLN A 1 166 ? -8.294  -0.750  30.773 1.00 24.86 ? 166 GLN A CG  1 
ATOM 1204 C CD  . GLN A 1 166 ? -8.119  0.698   30.409 1.00 34.61 ? 166 GLN A CD  1 
ATOM 1205 O OE1 . GLN A 1 166 ? -7.269  1.376   31.013 1.00 34.05 ? 166 GLN A OE1 1 
ATOM 1206 N NE2 . GLN A 1 166 ? -8.926  1.193   29.478 1.00 31.54 ? 166 GLN A NE2 1 
ATOM 1207 N N   . ALA A 1 167 ? -7.231  -4.209  31.408 1.00 17.72 ? 167 ALA A N   1 
ATOM 1208 C CA  . ALA A 1 167 ? -7.431  -5.204  30.343 1.00 17.17 ? 167 ALA A CA  1 
ATOM 1209 C C   . ALA A 1 167 ? -8.342  -6.339  30.954 1.00 16.83 ? 167 ALA A C   1 
ATOM 1210 O O   . ALA A 1 167 ? -9.161  -6.903  30.132 1.00 15.87 ? 167 ALA A O   1 
ATOM 1211 C CB  . ALA A 1 167 ? -6.131  -5.795  29.858 1.00 20.35 ? 167 ALA A CB  1 
ATOM 1212 N N   . GLU A 1 168 ? -8.180  -6.678  32.248 1.00 16.73 ? 168 GLU A N   1 
ATOM 1213 C CA  . GLU A 1 168 ? -9.011  -7.737  32.841 1.00 14.78 ? 168 GLU A CA  1 
ATOM 1214 C C   . GLU A 1 168 ? -10.442 -7.270  32.969 1.00 14.17 ? 168 GLU A C   1 
ATOM 1215 O O   . GLU A 1 168 ? -11.349 -8.082  32.695 1.00 12.85 ? 168 GLU A O   1 
ATOM 1216 C CB  . GLU A 1 168 ? -8.468  -8.233  34.173 1.00 16.26 ? 168 GLU A CB  1 
ATOM 1217 C CG  . GLU A 1 168 ? -7.059  -8.932  33.896 1.00 19.46 ? 168 GLU A CG  1 
ATOM 1218 C CD  . GLU A 1 168 ? -7.181  -10.061 32.918 1.00 19.06 ? 168 GLU A CD  1 
ATOM 1219 O OE1 . GLU A 1 168 ? -8.196  -10.864 32.970 1.00 22.20 ? 168 GLU A OE1 1 
ATOM 1220 O OE2 . GLU A 1 168 ? -6.162  -10.144 32.176 1.00 21.85 ? 168 GLU A OE2 1 
ATOM 1221 N N   . VAL A 1 169 ? -10.661 -6.005  33.313 1.00 13.32 ? 169 VAL A N   1 
ATOM 1222 C CA  . VAL A 1 169 ? -12.068 -5.532  33.329 1.00 12.67 ? 169 VAL A CA  1 
ATOM 1223 C C   . VAL A 1 169 ? -12.615 -5.570  31.918 1.00 11.38 ? 169 VAL A C   1 
ATOM 1224 O O   . VAL A 1 169 ? -13.786 -5.984  31.723 1.00 11.97 ? 169 VAL A O   1 
ATOM 1225 C CB  . VAL A 1 169 ? -12.199 -4.088  33.936 1.00 11.06 ? 169 VAL A CB  1 
ATOM 1226 C CG1 . VAL A 1 169 ? -13.690 -3.665  33.990 1.00 12.08 ? 169 VAL A CG1 1 
ATOM 1227 C CG2 . VAL A 1 169 ? -11.618 -4.088  35.285 1.00 13.25 ? 169 VAL A CG2 1 
ATOM 1228 N N   . GLU A 1 170 ? -11.818 -5.191  30.881 1.00 13.16 ? 170 GLU A N   1 
ATOM 1229 C CA  . GLU A 1 170 ? -12.321 -5.268  29.520 1.00 11.74 ? 170 GLU A CA  1 
ATOM 1230 C C   . GLU A 1 170 ? -12.701 -6.701  29.070 1.00 11.58 ? 170 GLU A C   1 
ATOM 1231 O O   . GLU A 1 170 ? -13.702 -6.886  28.380 1.00 10.97 ? 170 GLU A O   1 
ATOM 1232 C CB  . GLU A 1 170 ? -11.323 -4.608  28.466 1.00 13.41 ? 170 GLU A CB  1 
ATOM 1233 C CG  . GLU A 1 170 ? -11.342 -3.092  28.672 1.00 16.48 ? 170 GLU A CG  1 
ATOM 1234 C CD  . GLU A 1 170 ? -10.301 -2.310  27.910 1.00 24.90 ? 170 GLU A CD  1 
ATOM 1235 O OE1 . GLU A 1 170 ? -9.198  -2.875  27.668 1.00 24.55 ? 170 GLU A OE1 1 
ATOM 1236 O OE2 . GLU A 1 170 ? -10.606 -1.107  27.682 1.00 22.23 ? 170 GLU A OE2 1 
ATOM 1237 N N   . ARG A 1 171 ? -11.906 -7.667  29.490 1.00 12.31 ? 171 ARG A N   1 
ATOM 1238 C CA  . ARG A 1 171 ? -12.162 -9.065  29.185 1.00 10.72 ? 171 ARG A CA  1 
ATOM 1239 C C   . ARG A 1 171 ? -13.505 -9.470  29.872 1.00 10.17 ? 171 ARG A C   1 
ATOM 1240 O O   . ARG A 1 171 ? -14.305 -10.188 29.222 1.00 9.70  ? 171 ARG A O   1 
ATOM 1241 C CB  . ARG A 1 171 ? -11.005 -9.951  29.662 1.00 12.67 ? 171 ARG A CB  1 
ATOM 1242 C CG  . ARG A 1 171 ? -11.126 -11.337 29.010 1.00 13.87 ? 171 ARG A CG  1 
ATOM 1243 C CD  . ARG A 1 171 ? -9.864  -12.238 29.303 1.00 15.91 ? 171 ARG A CD  1 
ATOM 1244 N NE  . ARG A 1 171 ? -9.559  -12.393 30.713 1.00 15.02 ? 171 ARG A NE  1 
ATOM 1245 C CZ  . ARG A 1 171 ? -9.868  -13.492 31.400 1.00 13.33 ? 171 ARG A CZ  1 
ATOM 1246 N NH1 . ARG A 1 171 ? -10.521 -14.529 30.749 1.00 17.93 ? 171 ARG A NH1 1 
ATOM 1247 N NH2 . ARG A 1 171 ? -9.572  -13.535 32.688 1.00 16.47 ? 171 ARG A NH2 1 
ATOM 1248 N N   . ALA A 1 172 ? -13.683 -9.078  31.127 1.00 10.24 ? 172 ALA A N   1 
ATOM 1249 C CA  . ALA A 1 172 ? -14.928 -9.360  31.856 1.00 10.17 ? 172 ALA A CA  1 
ATOM 1250 C C   . ALA A 1 172 ? -16.095 -8.778  31.076 1.00 11.19 ? 172 ALA A C   1 
ATOM 1251 O O   . ALA A 1 172 ? -17.148 -9.434  30.958 1.00 9.36  ? 172 ALA A O   1 
ATOM 1252 C CB  . ALA A 1 172 ? -14.869 -8.784  33.269 1.00 11.24 ? 172 ALA A CB  1 
ATOM 1253 N N   . VAL A 1 173 ? -15.992 -7.531  30.628 1.00 8.91  ? 173 VAL A N   1 
ATOM 1254 C CA  . VAL A 1 173 ? -17.055 -6.872  29.870 1.00 9.41  ? 173 VAL A CA  1 
ATOM 1255 C C   . VAL A 1 173 ? -17.314 -7.636  28.569 1.00 9.93  ? 173 VAL A C   1 
ATOM 1256 O O   . VAL A 1 173 ? -18.510 -7.854  28.196 1.00 9.65  ? 173 VAL A O   1 
ATOM 1257 C CB  . VAL A 1 173 ? -16.717 -5.372  29.614 1.00 9.67  ? 173 VAL A CB  1 
ATOM 1258 C CG1 . VAL A 1 173 ? -17.614 -4.822  28.577 1.00 12.65 ? 173 VAL A CG1 1 
ATOM 1259 C CG2 . VAL A 1 173 ? -16.830 -4.639  30.898 1.00 10.63 ? 173 VAL A CG2 1 
ATOM 1260 N N   . LYS A 1 174 ? -16.265 -8.052  27.838 1.00 8.62  ? 174 LYS A N   1 
ATOM 1261 C CA  . LYS A 1 174 ? -16.454 -8.775  26.592 1.00 8.79  ? 174 LYS A CA  1 
ATOM 1262 C C   . LYS A 1 174 ? -17.249 -10.060 26.846 1.00 9.57  ? 174 LYS A C   1 
ATOM 1263 O O   . LYS A 1 174 ? -18.218 -10.387 26.103 1.00 10.58 ? 174 LYS A O   1 
ATOM 1264 C CB  . LYS A 1 174 ? -15.073 -9.129  25.993 1.00 10.56 ? 174 LYS A CB  1 
ATOM 1265 C CG  . LYS A 1 174 ? -15.151 -9.938  24.764 1.00 11.76 ? 174 LYS A CG  1 
ATOM 1266 C CD  . LYS A 1 174 ? -13.693 -10.308 24.326 1.00 14.38 ? 174 LYS A CD  1 
ATOM 1267 C CE  . LYS A 1 174 ? -13.597 -11.330 23.184 1.00 21.06 ? 174 LYS A CE  1 
ATOM 1268 N NZ  . LYS A 1 174 ? -14.028 -10.862 21.849 1.00 28.75 ? 174 LYS A NZ  1 
ATOM 1269 N N   . HIS A 1 175 ? -16.888 -10.791 27.855 1.00 9.46  ? 175 HIS A N   1 
ATOM 1270 C CA  . HIS A 1 175 ? -17.548 -12.113 28.151 1.00 8.84  ? 175 HIS A CA  1 
ATOM 1271 C C   . HIS A 1 175 ? -18.957 -11.896 28.699 1.00 9.23  ? 175 HIS A C   1 
ATOM 1272 O O   . HIS A 1 175 ? -19.900 -12.556 28.240 1.00 7.50  ? 175 HIS A O   1 
ATOM 1273 C CB  . HIS A 1 175 ? -16.713 -12.899 29.172 1.00 8.52  ? 175 HIS A CB  1 
ATOM 1274 C CG  . HIS A 1 175 ? -15.401 -13.350 28.582 1.00 9.44  ? 175 HIS A CG  1 
ATOM 1275 N ND1 . HIS A 1 175 ? -14.359 -13.920 29.305 1.00 10.12 ? 175 HIS A ND1 1 
ATOM 1276 C CD2 . HIS A 1 175 ? -15.004 -13.329 27.291 1.00 10.87 ? 175 HIS A CD2 1 
ATOM 1277 C CE1 . HIS A 1 175 ? -13.396 -14.237 28.476 1.00 11.17 ? 175 HIS A CE1 1 
ATOM 1278 N NE2 . HIS A 1 175 ? -13.743 -13.886 27.257 1.00 13.46 ? 175 HIS A NE2 1 
ATOM 1279 N N   . ALA A 1 176 ? -19.116 -10.943 29.636 1.00 8.49  ? 176 ALA A N   1 
ATOM 1280 C CA  . ALA A 1 176 ? -20.499 -10.614 30.142 1.00 8.08  ? 176 ALA A CA  1 
ATOM 1281 C C   . ALA A 1 176 ? -21.392 -10.135 29.040 1.00 7.74  ? 176 ALA A C   1 
ATOM 1282 O O   . ALA A 1 176 ? -22.615 -10.403 29.063 1.00 8.32  ? 176 ALA A O   1 
ATOM 1283 C CB  . ALA A 1 176 ? -20.377 -9.497  31.241 1.00 9.00  ? 176 ALA A CB  1 
ATOM 1284 N N   . SER A 1 177 ? -20.880 -9.347  28.079 1.00 7.37  ? 177 SER A N   1 
ATOM 1285 C CA  . SER A 1 177 ? -21.770 -8.870  26.992 1.00 7.88  ? 177 SER A CA  1 
ATOM 1286 C C   . SER A 1 177 ? -22.270 -9.986  26.126 1.00 9.42  ? 177 SER A C   1 
ATOM 1287 O O   . SER A 1 177 ? -23.438 -10.043 25.801 1.00 8.36  ? 177 SER A O   1 
ATOM 1288 C CB  . SER A 1 177 ? -20.961 -7.894  26.076 1.00 11.65 ? 177 SER A CB  1 
ATOM 1289 O OG  . SER A 1 177 ? -20.639 -6.716  26.885 1.00 17.46 ? 177 SER A OG  1 
ATOM 1290 N N   . ALA A 1 178 ? -21.379 -10.919 25.823 1.00 7.87  ? 178 ALA A N   1 
ATOM 1291 C CA  . ALA A 1 178 ? -21.761 -12.114 25.049 1.00 7.34  ? 178 ALA A CA  1 
ATOM 1292 C C   . ALA A 1 178 ? -22.808 -12.910 25.856 1.00 7.14  ? 178 ALA A C   1 
ATOM 1293 O O   . ALA A 1 178 ? -23.834 -13.327 25.237 1.00 7.66  ? 178 ALA A O   1 
ATOM 1294 C CB  . ALA A 1 178 ? -20.549 -13.015 24.734 1.00 7.85  ? 178 ALA A CB  1 
ATOM 1295 N N   . ILE A 1 179 ? -22.531 -13.134 27.129 1.00 9.11  ? 179 ILE A N   1 
ATOM 1296 C CA  . ILE A 1 179 ? -23.516 -13.873 27.940 1.00 8.43  ? 179 ILE A CA  1 
ATOM 1297 C C   . ILE A 1 179 ? -24.858 -13.144 27.957 1.00 8.74  ? 179 ILE A C   1 
ATOM 1298 O O   . ILE A 1 179 ? -25.919 -13.800 27.768 1.00 8.66  ? 179 ILE A O   1 
ATOM 1299 C CB  . ILE A 1 179 ? -22.957 -14.087 29.287 1.00 5.35  ? 179 ILE A CB  1 
ATOM 1300 C CG1 . ILE A 1 179 ? -21.815 -15.134 29.210 1.00 7.74  ? 179 ILE A CG1 1 
ATOM 1301 C CG2 . ILE A 1 179 ? -24.020 -14.602 30.304 1.00 8.90  ? 179 ILE A CG2 1 
ATOM 1302 C CD1 . ILE A 1 179 ? -20.884 -15.179 30.507 1.00 9.36  ? 179 ILE A CD1 1 
ATOM 1303 N N   . ALA A 1 180 ? -24.832 -11.832 28.191 1.00 8.15  ? 180 ALA A N   1 
ATOM 1304 C CA  . ALA A 1 180 ? -26.116 -11.127 28.332 1.00 7.90  ? 180 ALA A CA  1 
ATOM 1305 C C   . ALA A 1 180 ? -26.817 -11.098 27.022 1.00 7.67  ? 180 ALA A C   1 
ATOM 1306 O O   . ALA A 1 180 ? -28.083 -11.170 27.001 1.00 8.10  ? 180 ALA A O   1 
ATOM 1307 C CB  . ALA A 1 180 ? -25.851 -9.699  28.845 1.00 9.85  ? 180 ALA A CB  1 
ATOM 1308 N N   . THR A 1 181 ? -26.131 -10.958 25.907 1.00 9.77  ? 181 THR A N   1 
ATOM 1309 C CA  . THR A 1 181 ? -26.822 -11.018 24.601 1.00 9.49  ? 181 THR A CA  1 
ATOM 1310 C C   . THR A 1 181 ? -27.469 -12.371 24.369 1.00 8.66  ? 181 THR A C   1 
ATOM 1311 O O   . THR A 1 181 ? -28.601 -12.506 23.894 1.00 9.27  ? 181 THR A O   1 
ATOM 1312 C CB  . THR A 1 181 ? -25.839 -10.680 23.481 1.00 11.75 ? 181 THR A CB  1 
ATOM 1313 O OG1 . THR A 1 181 ? -25.480 -9.291  23.680 1.00 17.15 ? 181 THR A OG1 1 
ATOM 1314 C CG2 . THR A 1 181 ? -26.367 -10.869 22.090 1.00 15.99 ? 181 THR A CG2 1 
ATOM 1315 N N   . GLY A 1 182 ? -26.740 -13.417 24.739 1.00 7.23  ? 182 GLY A N   1 
ATOM 1316 C CA  . GLY A 1 182 ? -27.317 -14.782 24.658 1.00 7.59  ? 182 GLY A CA  1 
ATOM 1317 C C   . GLY A 1 182 ? -28.540 -14.967 25.539 1.00 7.54  ? 182 GLY A C   1 
ATOM 1318 O O   . GLY A 1 182 ? -29.578 -15.542 25.116 1.00 8.02  ? 182 GLY A O   1 
ATOM 1319 N N   . MET A 1 183 ? -28.393 -14.470 26.780 1.00 6.82  ? 183 MET A N   1 
ATOM 1320 C CA  . MET A 1 183 ? -29.530 -14.529 27.691 1.00 7.28  ? 183 MET A CA  1 
ATOM 1321 C C   . MET A 1 183 ? -30.772 -13.836 27.136 1.00 7.62  ? 183 MET A C   1 
ATOM 1322 O O   . MET A 1 183 ? -31.907 -14.263 27.374 1.00 7.61  ? 183 MET A O   1 
ATOM 1323 C CB  . MET A 1 183 ? -29.187 -13.915 29.053 1.00 6.81  ? 183 MET A CB  1 
ATOM 1324 C CG  . MET A 1 183 ? -28.231 -14.861 29.852 1.00 6.96  ? 183 MET A CG  1 
ATOM 1325 S SD  . MET A 1 183 ? -27.598 -13.962 31.356 1.00 10.64 ? 183 MET A SD  1 
ATOM 1326 C CE  . MET A 1 183 ? -29.076 -14.073 32.408 1.00 13.63 ? 183 MET A CE  1 
ATOM 1327 N N   . ALA A 1 184 ? -30.588 -12.674 26.521 1.00 5.01  ? 184 ALA A N   1 
ATOM 1328 C CA  . ALA A 1 184 ? -31.777 -11.967 25.996 1.00 5.62  ? 184 ALA A CA  1 
ATOM 1329 C C   . ALA A 1 184 ? -32.452 -12.779 24.955 1.00 7.08  ? 184 ALA A C   1 
ATOM 1330 O O   . ALA A 1 184 ? -33.660 -12.690 24.832 1.00 8.09  ? 184 ALA A O   1 
ATOM 1331 C CB  . ALA A 1 184 ? -31.296 -10.564 25.445 1.00 8.50  ? 184 ALA A CB  1 
ATOM 1332 N N   . PHE A 1 185 ? -31.689 -13.433 24.080 1.00 7.24  ? 185 PHE A N   1 
ATOM 1333 C CA  . PHE A 1 185 ? -32.258 -14.293 23.076 1.00 6.90  ? 185 PHE A CA  1 
ATOM 1334 C C   . PHE A 1 185 ? -33.048 -15.450 23.754 1.00 6.34  ? 185 PHE A C   1 
ATOM 1335 O O   . PHE A 1 185 ? -34.235 -15.749 23.391 1.00 6.79  ? 185 PHE A O   1 
ATOM 1336 C CB  . PHE A 1 185 ? -31.107 -14.863 22.209 1.00 7.68  ? 185 PHE A CB  1 
ATOM 1337 C CG  . PHE A 1 185 ? -31.511 -15.859 21.128 1.00 7.58  ? 185 PHE A CG  1 
ATOM 1338 C CD1 . PHE A 1 185 ? -32.039 -15.549 19.895 1.00 9.67  ? 185 PHE A CD1 1 
ATOM 1339 C CD2 . PHE A 1 185 ? -31.208 -17.218 21.396 1.00 10.03 ? 185 PHE A CD2 1 
ATOM 1340 C CE1 . PHE A 1 185 ? -32.324 -16.634 18.923 1.00 10.13 ? 185 PHE A CE1 1 
ATOM 1341 C CE2 . PHE A 1 185 ? -31.460 -18.217 20.471 1.00 9.74  ? 185 PHE A CE2 1 
ATOM 1342 C CZ  . PHE A 1 185 ? -31.963 -17.942 19.218 1.00 11.72 ? 185 PHE A CZ  1 
ATOM 1343 N N   . THR A 1 186 ? -32.422 -16.084 24.734 1.00 6.95  ? 186 THR A N   1 
ATOM 1344 C CA  . THR A 1 186 ? -33.092 -17.169 25.515 1.00 7.11  ? 186 THR A CA  1 
ATOM 1345 C C   . THR A 1 186 ? -34.379 -16.671 26.184 1.00 7.03  ? 186 THR A C   1 
ATOM 1346 O O   . THR A 1 186 ? -35.460 -17.338 26.047 1.00 7.18  ? 186 THR A O   1 
ATOM 1347 C CB  . THR A 1 186 ? -32.116 -17.625 26.634 1.00 7.08  ? 186 THR A CB  1 
ATOM 1348 O OG1 . THR A 1 186 ? -31.057 -18.279 25.956 1.00 7.97  ? 186 THR A OG1 1 
ATOM 1349 C CG2 . THR A 1 186 ? -32.772 -18.652 27.538 1.00 8.04  ? 186 THR A CG2 1 
ATOM 1350 N N   . ARG A 1 187 ? -34.341 -15.480 26.788 1.00 7.22  ? 187 ARG A N   1 
ATOM 1351 C CA  . ARG A 1 187 ? -35.518 -14.931 27.469 1.00 5.72  ? 187 ARG A CA  1 
ATOM 1352 C C   . ARG A 1 187 ? -36.540 -14.581 26.458 1.00 7.20  ? 187 ARG A C   1 
ATOM 1353 O O   . ARG A 1 187 ? -37.722 -14.884 26.737 1.00 7.55  ? 187 ARG A O   1 
ATOM 1354 C CB  . ARG A 1 187 ? -35.100 -13.689 28.264 1.00 5.45  ? 187 ARG A CB  1 
ATOM 1355 C CG  . ARG A 1 187 ? -34.210 -14.106 29.457 1.00 6.89  ? 187 ARG A CG  1 
ATOM 1356 C CD  . ARG A 1 187 ? -33.616 -12.816 30.162 1.00 6.82  ? 187 ARG A CD  1 
ATOM 1357 N NE  . ARG A 1 187 ? -34.716 -12.202 30.946 1.00 9.47  ? 187 ARG A NE  1 
ATOM 1358 C CZ  . ARG A 1 187 ? -34.531 -11.117 31.670 1.00 11.41 ? 187 ARG A CZ  1 
ATOM 1359 N NH1 . ARG A 1 187 ? -33.309 -10.512 31.710 1.00 13.00 ? 187 ARG A NH1 1 
ATOM 1360 N NH2 . ARG A 1 187 ? -35.578 -10.602 32.357 1.00 12.63 ? 187 ARG A NH2 1 
ATOM 1361 N N   . ASP A 1 188 ? -36.196 -14.050 25.248 1.00 6.83  ? 188 ASP A N   1 
ATOM 1362 C CA  . ASP A 1 188 ? -37.293 -13.754 24.317 1.00 6.52  ? 188 ASP A CA  1 
ATOM 1363 C C   . ASP A 1 188 ? -37.982 -15.050 23.910 1.00 8.11  ? 188 ASP A C   1 
ATOM 1364 O O   . ASP A 1 188 ? -39.210 -15.120 23.845 1.00 8.41  ? 188 ASP A O   1 
ATOM 1365 C CB  . ASP A 1 188 ? -36.698 -13.118 23.024 1.00 7.95  ? 188 ASP A CB  1 
ATOM 1366 C CG  . ASP A 1 188 ? -36.215 -11.652 23.228 1.00 9.29  ? 188 ASP A CG  1 
ATOM 1367 O OD1 . ASP A 1 188 ? -36.616 -10.983 24.184 1.00 11.08 ? 188 ASP A OD1 1 
ATOM 1368 O OD2 . ASP A 1 188 ? -35.535 -11.187 22.274 1.00 13.03 ? 188 ASP A OD2 1 
ATOM 1369 N N   . LEU A 1 189 ? -37.205 -16.101 23.561 1.00 7.22  ? 189 LEU A N   1 
ATOM 1370 C CA  . LEU A 1 189 ? -37.835 -17.336 23.083 1.00 6.56  ? 189 LEU A CA  1 
ATOM 1371 C C   . LEU A 1 189 ? -38.678 -17.923 24.211 1.00 6.77  ? 189 LEU A C   1 
ATOM 1372 O O   . LEU A 1 189 ? -39.833 -18.411 23.946 1.00 7.35  ? 189 LEU A O   1 
ATOM 1373 C CB  . LEU A 1 189 ? -36.732 -18.314 22.723 1.00 5.59  ? 189 LEU A CB  1 
ATOM 1374 C CG  . LEU A 1 189 ? -35.934 -17.875 21.487 1.00 6.25  ? 189 LEU A CG  1 
ATOM 1375 C CD1 . LEU A 1 189 ? -34.782 -18.911 21.315 1.00 7.70  ? 189 LEU A CD1 1 
ATOM 1376 C CD2 . LEU A 1 189 ? -36.750 -17.765 20.145 1.00 10.74 ? 189 LEU A CD2 1 
ATOM 1377 N N   . GLY A 1 190 ? -38.219 -17.870 25.460 1.00 6.69  ? 190 GLY A N   1 
ATOM 1378 C CA  . GLY A 1 190 ? -39.057 -18.424 26.536 1.00 5.25  ? 190 GLY A CA  1 
ATOM 1379 C C   . GLY A 1 190 ? -40.321 -17.633 26.762 1.00 6.52  ? 190 GLY A C   1 
ATOM 1380 O O   . GLY A 1 190 ? -41.396 -18.213 26.963 1.00 6.85  ? 190 GLY A O   1 
ATOM 1381 N N   . ASN A 1 191 ? -40.174 -16.307 26.791 1.00 6.94  ? 191 ASN A N   1 
ATOM 1382 C CA  . ASN A 1 191 ? -41.352 -15.442 27.009 1.00 4.89  ? 191 ASN A CA  1 
ATOM 1383 C C   . ASN A 1 191 ? -42.392 -15.469 25.929 1.00 6.61  ? 191 ASN A C   1 
ATOM 1384 O O   . ASN A 1 191 ? -43.553 -15.145 26.186 1.00 8.05  ? 191 ASN A O   1 
ATOM 1385 C CB  . ASN A 1 191 ? -40.893 -13.999 27.329 1.00 5.60  ? 191 ASN A CB  1 
ATOM 1386 C CG  . ASN A 1 191 ? -40.109 -13.909 28.629 1.00 6.03  ? 191 ASN A CG  1 
ATOM 1387 O OD1 . ASN A 1 191 ? -40.431 -14.585 29.638 1.00 7.00  ? 191 ASN A OD1 1 
ATOM 1388 N ND2 . ASN A 1 191 ? -39.177 -12.952 28.705 1.00 6.79  ? 191 ASN A ND2 1 
ATOM 1389 N N   . LEU A 1 192 ? -41.984 -15.758 24.666 1.00 6.13  ? 192 LEU A N   1 
ATOM 1390 C CA  . LEU A 1 192 ? -42.960 -15.800 23.556 1.00 7.50  ? 192 LEU A CA  1 
ATOM 1391 C C   . LEU A 1 192 ? -44.060 -16.794 23.875 1.00 6.83  ? 192 LEU A C   1 
ATOM 1392 O O   . LEU A 1 192 ? -43.784 -17.904 24.400 1.00 7.09  ? 192 LEU A O   1 
ATOM 1393 C CB  . LEU A 1 192 ? -42.247 -16.191 22.238 1.00 8.10  ? 192 LEU A CB  1 
ATOM 1394 C CG  . LEU A 1 192 ? -41.574 -14.991 21.591 1.00 12.08 ? 192 LEU A CG  1 
ATOM 1395 C CD1 . LEU A 1 192 ? -42.617 -14.042 20.870 1.00 10.20 ? 192 LEU A CD1 1 
ATOM 1396 C CD2 . LEU A 1 192 ? -40.897 -14.149 22.577 1.00 31.27 ? 192 LEU A CD2 1 
ATOM 1397 N N   . PRO A 1 193 ? -45.317 -16.431 23.560 1.00 6.03  ? 193 PRO A N   1 
ATOM 1398 C CA  . PRO A 1 193 ? -46.410 -17.345 23.903 1.00 6.03  ? 193 PRO A CA  1 
ATOM 1399 C C   . PRO A 1 193 ? -46.498 -18.528 22.988 1.00 7.90  ? 193 PRO A C   1 
ATOM 1400 O O   . PRO A 1 193 ? -46.011 -18.452 21.843 1.00 6.23  ? 193 PRO A O   1 
ATOM 1401 C CB  . PRO A 1 193 ? -47.680 -16.405 23.701 1.00 6.53  ? 193 PRO A CB  1 
ATOM 1402 C CG  . PRO A 1 193 ? -47.247 -15.469 22.590 1.00 8.35  ? 193 PRO A CG  1 
ATOM 1403 C CD  . PRO A 1 193 ? -45.735 -15.170 22.929 1.00 8.83  ? 193 PRO A CD  1 
ATOM 1404 N N   . PRO A 1 194 ? -47.113 -19.604 23.434 1.00 6.86  ? 194 PRO A N   1 
ATOM 1405 C CA  . PRO A 1 194 ? -46.948 -20.904 22.701 1.00 7.79  ? 194 PRO A CA  1 
ATOM 1406 C C   . PRO A 1 194 ? -47.739 -20.977 21.428 1.00 7.17  ? 194 PRO A C   1 
ATOM 1407 O O   . PRO A 1 194 ? -47.419 -21.882 20.618 1.00 8.92  ? 194 PRO A O   1 
ATOM 1408 C CB  . PRO A 1 194 ? -47.412 -21.980 23.766 1.00 7.33  ? 194 PRO A CB  1 
ATOM 1409 C CG  . PRO A 1 194 ? -48.271 -21.167 24.743 1.00 7.44  ? 194 PRO A CG  1 
ATOM 1410 C CD  . PRO A 1 194 ? -47.739 -19.756 24.759 1.00 6.90  ? 194 PRO A CD  1 
ATOM 1411 N N   . ASN A 1 195 ? -48.686 -20.074 21.223 1.00 5.69  ? 195 ASN A N   1 
ATOM 1412 C CA  . ASN A 1 195 ? -49.369 -19.980 19.950 1.00 6.34  ? 195 ASN A CA  1 
ATOM 1413 C C   . ASN A 1 195 ? -48.345 -19.625 18.885 1.00 8.25  ? 195 ASN A C   1 
ATOM 1414 O O   . ASN A 1 195 ? -48.414 -20.110 17.754 1.00 9.45  ? 195 ASN A O   1 
ATOM 1415 C CB  . ASN A 1 195 ? -50.470 -18.920 20.004 1.00 6.85  ? 195 ASN A CB  1 
ATOM 1416 C CG  . ASN A 1 195 ? -49.924 -17.524 20.232 1.00 6.95  ? 195 ASN A CG  1 
ATOM 1417 O OD1 . ASN A 1 195 ? -48.837 -17.187 19.764 1.00 13.57 ? 195 ASN A OD1 1 
ATOM 1418 N ND2 . ASN A 1 195 ? -50.680 -16.704 20.953 1.00 4.08  ? 195 ASN A ND2 1 
ATOM 1419 N N   . LEU A 1 196 ? -47.398 -18.765 19.251 1.00 7.73  ? 196 LEU A N   1 
ATOM 1420 C CA  . LEU A 1 196 ? -46.423 -18.229 18.269 1.00 9.08  ? 196 LEU A CA  1 
ATOM 1421 C C   . LEU A 1 196 ? -45.161 -19.041 18.325 1.00 9.07  ? 196 LEU A C   1 
ATOM 1422 O O   . LEU A 1 196 ? -44.549 -19.349 17.249 1.00 10.74 ? 196 LEU A O   1 
ATOM 1423 C CB  . LEU A 1 196 ? -46.083 -16.749 18.669 1.00 8.70  ? 196 LEU A CB  1 
ATOM 1424 C CG  . LEU A 1 196 ? -47.386 -15.970 18.486 1.00 12.41 ? 196 LEU A CG  1 
ATOM 1425 C CD1 . LEU A 1 196 ? -46.929 -14.552 18.685 1.00 16.16 ? 196 LEU A CD1 1 
ATOM 1426 C CD2 . LEU A 1 196 ? -48.097 -16.044 17.123 1.00 16.14 ? 196 LEU A CD2 1 
ATOM 1427 N N   . CYS A 1 197 ? -44.697 -19.398 19.506 1.00 7.16  ? 197 CYS A N   1 
ATOM 1428 C CA  . CYS A 1 197 ? -43.422 -20.137 19.648 1.00 7.58  ? 197 CYS A CA  1 
ATOM 1429 C C   . CYS A 1 197 ? -43.725 -21.627 19.674 1.00 8.82  ? 197 CYS A C   1 
ATOM 1430 O O   . CYS A 1 197 ? -43.873 -22.221 20.748 1.00 11.30 ? 197 CYS A O   1 
ATOM 1431 C CB  . CYS A 1 197 ? -42.799 -19.659 20.923 1.00 6.79  ? 197 CYS A CB  1 
ATOM 1432 S SG  . CYS A 1 197 ? -41.137 -20.442 21.222 1.00 11.21 ? 197 CYS A SG  1 
ATOM 1433 N N   . HIS A 1 198 ? -43.773 -22.215 18.495 1.00 7.76  ? 198 HIS A N   1 
ATOM 1434 C CA  . HIS A 1 198 ? -43.977 -23.672 18.351 1.00 7.46  ? 198 HIS A CA  1 
ATOM 1435 C C   . HIS A 1 198 ? -42.721 -24.258 17.664 1.00 6.05  ? 198 HIS A C   1 
ATOM 1436 O O   . HIS A 1 198 ? -41.777 -23.526 17.388 1.00 6.68  ? 198 HIS A O   1 
ATOM 1437 C CB  . HIS A 1 198 ? -45.290 -23.922 17.588 1.00 6.99  ? 198 HIS A CB  1 
ATOM 1438 C CG  . HIS A 1 198 ? -45.469 -23.061 16.377 1.00 9.45  ? 198 HIS A CG  1 
ATOM 1439 N ND1 . HIS A 1 198 ? -44.551 -22.978 15.371 1.00 11.47 ? 198 HIS A ND1 1 
ATOM 1440 C CD2 . HIS A 1 198 ? -46.503 -22.238 16.039 1.00 10.28 ? 198 HIS A CD2 1 
ATOM 1441 C CE1 . HIS A 1 198 ? -44.985 -22.132 14.450 1.00 11.34 ? 198 HIS A CE1 1 
ATOM 1442 N NE2 . HIS A 1 198 ? -46.180 -21.664 14.828 1.00 11.82 ? 198 HIS A NE2 1 
ATOM 1443 N N   . PRO A 1 199 ? -42.656 -25.576 17.485 1.00 6.35  ? 199 PRO A N   1 
ATOM 1444 C CA  . PRO A 1 199 ? -41.392 -26.182 16.941 1.00 6.55  ? 199 PRO A CA  1 
ATOM 1445 C C   . PRO A 1 199 ? -41.060 -25.585 15.584 1.00 5.85  ? 199 PRO A C   1 
ATOM 1446 O O   . PRO A 1 199 ? -39.859 -25.340 15.350 1.00 8.03  ? 199 PRO A O   1 
ATOM 1447 C CB  . PRO A 1 199 ? -41.726 -27.689 16.880 1.00 7.34  ? 199 PRO A CB  1 
ATOM 1448 C CG  . PRO A 1 199 ? -42.756 -27.834 18.038 1.00 7.31  ? 199 PRO A CG  1 
ATOM 1449 C CD  . PRO A 1 199 ? -42.877 -26.414 18.604 1.00 5.02  ? 199 PRO A CD  1 
ATOM 1450 N N   . SER A 1 200 ? -42.030 -25.342 14.726 1.00 6.76  ? 200 SER A N   1 
ATOM 1451 C CA  . SER A 1 200 ? -41.668 -24.793 13.380 1.00 7.66  ? 200 SER A CA  1 
ATOM 1452 C C   . SER A 1 200 ? -41.142 -23.409 13.501 1.00 9.84  ? 200 SER A C   1 
ATOM 1453 O O   . SER A 1 200 ? -40.209 -23.050 12.707 1.00 9.76  ? 200 SER A O   1 
ATOM 1454 C CB  . SER A 1 200 ? -42.913 -24.813 12.536 1.00 9.10  ? 200 SER A CB  1 
ATOM 1455 O OG  . SER A 1 200 ? -43.314 -26.136 12.167 1.00 13.42 ? 200 SER A OG  1 
ATOM 1456 N N   . PHE A 1 201 ? -41.653 -22.594 14.452 1.00 7.14  ? 201 PHE A N   1 
ATOM 1457 C CA  . PHE A 1 201 ? -41.045 -21.272 14.662 1.00 7.36  ? 201 PHE A CA  1 
ATOM 1458 C C   . PHE A 1 201 ? -39.575 -21.449 15.089 1.00 6.75  ? 201 PHE A C   1 
ATOM 1459 O O   . PHE A 1 201 ? -38.704 -20.651 14.620 1.00 8.31  ? 201 PHE A O   1 
ATOM 1460 C CB  . PHE A 1 201 ? -41.868 -20.486 15.760 1.00 9.93  ? 201 PHE A CB  1 
ATOM 1461 C CG  . PHE A 1 201 ? -41.220 -19.241 16.199 1.00 7.91  ? 201 PHE A CG  1 
ATOM 1462 C CD1 . PHE A 1 201 ? -41.253 -18.093 15.397 1.00 11.35 ? 201 PHE A CD1 1 
ATOM 1463 C CD2 . PHE A 1 201 ? -40.528 -19.220 17.386 1.00 7.96  ? 201 PHE A CD2 1 
ATOM 1464 C CE1 . PHE A 1 201 ? -40.590 -16.900 15.896 1.00 12.55 ? 201 PHE A CE1 1 
ATOM 1465 C CE2 . PHE A 1 201 ? -39.918 -18.081 17.839 1.00 9.98  ? 201 PHE A CE2 1 
ATOM 1466 C CZ  . PHE A 1 201 ? -39.951 -16.922 17.065 1.00 10.54 ? 201 PHE A CZ  1 
ATOM 1467 N N   . LEU A 1 202 ? -39.272 -22.340 16.035 1.00 7.47  ? 202 LEU A N   1 
ATOM 1468 C CA  . LEU A 1 202 ? -37.888 -22.494 16.477 1.00 7.72  ? 202 LEU A CA  1 
ATOM 1469 C C   . LEU A 1 202 ? -37.015 -22.903 15.305 1.00 8.80  ? 202 LEU A C   1 
ATOM 1470 O O   . LEU A 1 202 ? -35.867 -22.456 15.200 1.00 7.70  ? 202 LEU A O   1 
ATOM 1471 C CB  . LEU A 1 202 ? -37.814 -23.484 17.692 1.00 7.86  ? 202 LEU A CB  1 
ATOM 1472 C CG  . LEU A 1 202 ? -38.532 -22.915 18.983 1.00 7.33  ? 202 LEU A CG  1 
ATOM 1473 C CD1 . LEU A 1 202 ? -38.406 -23.978 20.064 1.00 8.42  ? 202 LEU A CD1 1 
ATOM 1474 C CD2 . LEU A 1 202 ? -37.885 -21.647 19.378 1.00 8.60  ? 202 LEU A CD2 1 
ATOM 1475 N N   . ALA A 1 203 ? -37.566 -23.734 14.420 1.00 7.69  ? 203 ALA A N   1 
ATOM 1476 C CA  . ALA A 1 203 ? -36.776 -24.191 13.264 1.00 8.35  ? 203 ALA A CA  1 
ATOM 1477 C C   . ALA A 1 203 ? -36.520 -23.015 12.357 1.00 9.49  ? 203 ALA A C   1 
ATOM 1478 O O   . ALA A 1 203 ? -35.428 -22.885 11.825 1.00 8.36  ? 203 ALA A O   1 
ATOM 1479 C CB  . ALA A 1 203 ? -37.567 -25.272 12.499 1.00 9.24  ? 203 ALA A CB  1 
ATOM 1480 N N   . GLU A 1 204 ? -37.495 -22.110 12.222 1.00 8.93  ? 204 GLU A N   1 
ATOM 1481 C CA  . GLU A 1 204 ? -37.227 -20.889 11.357 1.00 9.58  ? 204 GLU A CA  1 
ATOM 1482 C C   . GLU A 1 204 ? -36.177 -19.989 11.993 1.00 7.80  ? 204 GLU A C   1 
ATOM 1483 O O   . GLU A 1 204 ? -35.286 -19.445 11.350 1.00 9.52  ? 204 GLU A O   1 
ATOM 1484 C CB  . GLU A 1 204 ? -38.544 -20.107 11.137 1.00 10.95 ? 204 GLU A CB  1 
ATOM 1485 C CG  . GLU A 1 204 ? -39.491 -20.803 10.253 1.00 18.18 ? 204 GLU A CG  1 
ATOM 1486 C CD  . GLU A 1 204 ? -38.986 -21.205 8.828  1.00 26.06 ? 204 GLU A CD  1 
ATOM 1487 O OE1 . GLU A 1 204 ? -38.216 -20.413 8.186  1.00 28.74 ? 204 GLU A OE1 1 
ATOM 1488 O OE2 . GLU A 1 204 ? -39.349 -22.337 8.335  1.00 31.38 ? 204 GLU A OE2 1 
ATOM 1489 N N   . GLN A 1 205 ? -36.249 -19.821 13.313 1.00 7.75  ? 205 GLN A N   1 
ATOM 1490 C CA  . GLN A 1 205 ? -35.238 -19.024 14.073 1.00 8.49  ? 205 GLN A CA  1 
ATOM 1491 C C   . GLN A 1 205 ? -33.834 -19.665 13.838 1.00 8.33  ? 205 GLN A C   1 
ATOM 1492 O O   . GLN A 1 205 ? -32.834 -18.889 13.652 1.00 9.97  ? 205 GLN A O   1 
ATOM 1493 C CB  . GLN A 1 205 ? -35.500 -19.062 15.593 1.00 8.32  ? 205 GLN A CB  1 
ATOM 1494 C CG  . GLN A 1 205 ? -36.740 -18.216 15.968 1.00 10.52 ? 205 GLN A CG  1 
ATOM 1495 C CD  . GLN A 1 205 ? -36.382 -16.713 15.836 1.00 12.45 ? 205 GLN A CD  1 
ATOM 1496 O OE1 . GLN A 1 205 ? -36.980 -16.036 14.967 1.00 16.08 ? 205 GLN A OE1 1 
ATOM 1497 N NE2 . GLN A 1 205 ? -35.440 -16.223 16.579 1.00 11.90 ? 205 GLN A NE2 1 
ATOM 1498 N N   . ALA A 1 206 ? -33.745 -20.982 13.815 1.00 6.74  ? 206 ALA A N   1 
ATOM 1499 C CA  . ALA A 1 206 ? -32.414 -21.583 13.660 1.00 7.67  ? 206 ALA A CA  1 
ATOM 1500 C C   . ALA A 1 206 ? -31.933 -21.426 12.207 1.00 8.89  ? 206 ALA A C   1 
ATOM 1501 O O   . ALA A 1 206 ? -30.736 -21.142 12.026 1.00 8.25  ? 206 ALA A O   1 
ATOM 1502 C CB  . ALA A 1 206 ? -32.604 -23.079 13.975 1.00 7.87  ? 206 ALA A CB  1 
ATOM 1503 N N   . LYS A 1 207 ? -32.804 -21.598 11.221 1.00 9.22  ? 207 LYS A N   1 
ATOM 1504 C CA  . LYS A 1 207 ? -32.364 -21.424 9.817  1.00 9.16  ? 207 LYS A CA  1 
ATOM 1505 C C   . LYS A 1 207 ? -31.936 -19.945 9.661  1.00 10.98 ? 207 LYS A C   1 
ATOM 1506 O O   . LYS A 1 207 ? -30.961 -19.661 8.907  1.00 11.84 ? 207 LYS A O   1 
ATOM 1507 C CB  . LYS A 1 207 ? -33.540 -21.754 8.900  1.00 11.41 ? 207 LYS A CB  1 
ATOM 1508 C CG  . LYS A 1 207 ? -33.778 -23.226 8.849  1.00 14.85 ? 207 LYS A CG  1 
ATOM 1509 C CD  . LYS A 1 207 ? -34.932 -23.803 7.916  1.00 23.54 ? 207 LYS A CD  1 
ATOM 1510 C CE  . LYS A 1 207 ? -36.152 -22.957 7.842  1.00 32.40 ? 207 LYS A CE  1 
ATOM 1511 N NZ  . LYS A 1 207 ? -37.197 -23.633 6.955  1.00 34.38 ? 207 LYS A NZ  1 
ATOM 1512 N N   . GLU A 1 208 ? -32.614 -18.995 10.298 1.00 11.21 ? 208 GLU A N   1 
ATOM 1513 C CA  . GLU A 1 208 ? -32.219 -17.581 10.093 1.00 11.10 ? 208 GLU A CA  1 
ATOM 1514 C C   . GLU A 1 208 ? -30.862 -17.349 10.724 1.00 12.92 ? 208 GLU A C   1 
ATOM 1515 O O   . GLU A 1 208 ? -29.982 -16.642 10.152 1.00 12.36 ? 208 GLU A O   1 
ATOM 1516 C CB  . GLU A 1 208 ? -33.240 -16.694 10.792 1.00 12.85 ? 208 GLU A CB  1 
ATOM 1517 C CG  . GLU A 1 208 ? -34.586 -16.782 10.124 1.00 19.48 ? 208 GLU A CG  1 
ATOM 1518 C CD  . GLU A 1 208 ? -35.607 -15.921 10.917 1.00 26.19 ? 208 GLU A CD  1 
ATOM 1519 O OE1 . GLU A 1 208 ? -35.231 -15.456 12.077 1.00 27.94 ? 208 GLU A OE1 1 
ATOM 1520 O OE2 . GLU A 1 208 ? -36.672 -15.707 10.301 1.00 27.47 ? 208 GLU A OE2 1 
ATOM 1521 N N   . LEU A 1 209 ? -30.605 -17.919 11.896 1.00 11.19 ? 209 LEU A N   1 
ATOM 1522 C CA  . LEU A 1 209 ? -29.340 -17.782 12.590 1.00 11.38 ? 209 LEU A CA  1 
ATOM 1523 C C   . LEU A 1 209 ? -28.213 -18.423 11.736 1.00 12.37 ? 209 LEU A C   1 
ATOM 1524 O O   . LEU A 1 209 ? -27.132 -17.844 11.514 1.00 11.70 ? 209 LEU A O   1 
ATOM 1525 C CB  . LEU A 1 209 ? -29.423 -18.430 14.035 1.00 10.51 ? 209 LEU A CB  1 
ATOM 1526 C CG  . LEU A 1 209 ? -28.187 -18.316 14.865 1.00 12.95 ? 209 LEU A CG  1 
ATOM 1527 C CD1 . LEU A 1 209 ? -28.038 -16.837 15.331 1.00 13.41 ? 209 LEU A CD1 1 
ATOM 1528 C CD2 . LEU A 1 209 ? -28.379 -19.150 16.157 1.00 12.42 ? 209 LEU A CD2 1 
ATOM 1529 N N   . GLY A 1 210 ? -28.454 -19.552 11.151 1.00 10.33 ? 210 GLY A N   1 
ATOM 1530 C CA  . GLY A 1 210 ? -27.506 -20.158 10.197 1.00 11.05 ? 210 GLY A CA  1 
ATOM 1531 C C   . GLY A 1 210 ? -27.104 -19.270 9.045  1.00 11.31 ? 210 GLY A C   1 
ATOM 1532 O O   . GLY A 1 210 ? -25.935 -19.239 8.721  1.00 13.21 ? 210 GLY A O   1 
ATOM 1533 N N   . LYS A 1 211 ? -28.110 -18.636 8.467  1.00 9.61  ? 211 LYS A N   1 
ATOM 1534 C CA  . LYS A 1 211 ? -27.764 -17.776 7.260  1.00 12.93 ? 211 LYS A CA  1 
ATOM 1535 C C   . LYS A 1 211 ? -26.879 -16.625 7.712  1.00 13.26 ? 211 LYS A C   1 
ATOM 1536 O O   . LYS A 1 211 ? -26.071 -16.157 6.832  1.00 14.21 ? 211 LYS A O   1 
ATOM 1537 C CB  . LYS A 1 211 ? -29.019 -17.277 6.572  1.00 12.79 ? 211 LYS A CB  1 
ATOM 1538 C CG  . LYS A 1 211 ? -29.683 -18.334 5.749  1.00 17.04 ? 211 LYS A CG  1 
ATOM 1539 C CD  . LYS A 1 211 ? -31.064 -17.878 5.329  1.00 27.95 ? 211 LYS A CD  1 
ATOM 1540 C CE  . LYS A 1 211 ? -32.132 -18.974 5.117  1.00 36.98 ? 211 LYS A CE  1 
ATOM 1541 N NZ  . LYS A 1 211 ? -33.112 -18.762 3.964  1.00 41.42 ? 211 LYS A NZ  1 
ATOM 1542 N N   . ALA A 1 212 ? -26.912 -16.204 8.969  1.00 12.86 ? 212 ALA A N   1 
ATOM 1543 C CA  . ALA A 1 212 ? -26.207 -14.971 9.440  1.00 15.49 ? 212 ALA A CA  1 
ATOM 1544 C C   . ALA A 1 212 ? -24.799 -15.261 9.934  1.00 14.90 ? 212 ALA A C   1 
ATOM 1545 O O   . ALA A 1 212 ? -24.032 -14.270 10.179 1.00 16.88 ? 212 ALA A O   1 
ATOM 1546 C CB  . ALA A 1 212 ? -27.005 -14.289 10.549 1.00 14.82 ? 212 ALA A CB  1 
ATOM 1547 N N   . HIS A 1 213 ? -24.359 -16.538 9.943  1.00 13.95 ? 213 HIS A N   1 
ATOM 1548 C CA  . HIS A 1 213 ? -23.036 -16.851 10.564 1.00 13.98 ? 213 HIS A CA  1 
ATOM 1549 C C   . HIS A 1 213 ? -22.305 -17.835 9.703  1.00 14.75 ? 213 HIS A C   1 
ATOM 1550 O O   . HIS A 1 213 ? -22.707 -18.995 9.469  1.00 14.77 ? 213 HIS A O   1 
ATOM 1551 C CB  . HIS A 1 213 ? -23.196 -17.369 12.018 1.00 13.70 ? 213 HIS A CB  1 
ATOM 1552 C CG  . HIS A 1 213 ? -23.823 -16.380 12.923 1.00 14.08 ? 213 HIS A CG  1 
ATOM 1553 N ND1 . HIS A 1 213 ? -23.064 -15.405 13.553 1.00 17.76 ? 213 HIS A ND1 1 
ATOM 1554 C CD2 . HIS A 1 213 ? -25.099 -16.140 13.267 1.00 16.53 ? 213 HIS A CD2 1 
ATOM 1555 C CE1 . HIS A 1 213 ? -23.845 -14.618 14.250 1.00 21.02 ? 213 HIS A CE1 1 
ATOM 1556 N NE2 . HIS A 1 213 ? -25.089 -15.036 14.107 1.00 19.79 ? 213 HIS A NE2 1 
ATOM 1557 N N   . LYS A 1 214 ? -21.138 -17.397 9.238  1.00 17.64 ? 214 LYS A N   1 
ATOM 1558 C CA  . LYS A 1 214 ? -20.327 -18.241 8.359  1.00 19.56 ? 214 LYS A CA  1 
ATOM 1559 C C   . LYS A 1 214 ? -19.972 -19.682 8.838  1.00 18.68 ? 214 LYS A C   1 
ATOM 1560 O O   . LYS A 1 214 ? -19.957 -20.618 8.071  1.00 19.35 ? 214 LYS A O   1 
ATOM 1561 C CB  . LYS A 1 214 ? -19.000 -17.449 8.028  1.00 21.67 ? 214 LYS A CB  1 
ATOM 1562 C CG  . LYS A 1 214 ? -18.054 -18.177 7.041  1.00 34.12 ? 214 LYS A CG  1 
ATOM 1563 C CD  . LYS A 1 214 ? -16.792 -17.282 6.741  1.00 39.58 ? 214 LYS A CD  1 
ATOM 1564 C CE  . LYS A 1 214 ? -15.759 -17.952 5.764  1.00 51.19 ? 214 LYS A CE  1 
ATOM 1565 N NZ  . LYS A 1 214 ? -14.532 -17.095 5.466  1.00 52.13 ? 214 LYS A NZ  1 
ATOM 1566 N N   . ALA A 1 215 ? -19.656 -19.800 10.111 1.00 17.54 ? 215 ALA A N   1 
ATOM 1567 C CA  . ALA A 1 215 ? -19.077 -21.030 10.684 1.00 16.06 ? 215 ALA A CA  1 
ATOM 1568 C C   . ALA A 1 215 ? -20.270 -21.900 11.191 1.00 15.29 ? 215 ALA A C   1 
ATOM 1569 O O   . ALA A 1 215 ? -20.017 -22.962 11.787 1.00 14.31 ? 215 ALA A O   1 
ATOM 1570 C CB  . ALA A 1 215 ? -18.189 -20.651 11.900 1.00 19.65 ? 215 ALA A CB  1 
ATOM 1571 N N   . LEU A 1 216 ? -21.492 -21.496 10.847 1.00 12.05 ? 216 LEU A N   1 
ATOM 1572 C CA  . LEU A 1 216 ? -22.687 -22.285 11.412 1.00 11.82 ? 216 LEU A CA  1 
ATOM 1573 C C   . LEU A 1 216 ? -23.473 -22.948 10.273 1.00 10.47 ? 216 LEU A C   1 
ATOM 1574 O O   . LEU A 1 216 ? -23.800 -22.257 9.258  1.00 12.29 ? 216 LEU A O   1 
ATOM 1575 C CB  . LEU A 1 216 ? -23.511 -21.288 12.233 1.00 10.76 ? 216 LEU A CB  1 
ATOM 1576 C CG  . LEU A 1 216 ? -24.743 -21.996 12.954 1.00 8.92  ? 216 LEU A CG  1 
ATOM 1577 C CD1 . LEU A 1 216 ? -24.220 -22.866 14.065 1.00 10.82 ? 216 LEU A CD1 1 
ATOM 1578 C CD2 . LEU A 1 216 ? -25.653 -20.888 13.512 1.00 12.62 ? 216 LEU A CD2 1 
ATOM 1579 N N   . LYS A 1 217 ? -23.769 -24.219 10.372 1.00 10.85 ? 217 LYS A N   1 
ATOM 1580 C CA  . LYS A 1 217 ? -24.586 -24.977 9.386  1.00 11.76 ? 217 LYS A CA  1 
ATOM 1581 C C   . LYS A 1 217 ? -25.798 -25.506 10.180 1.00 10.37 ? 217 LYS A C   1 
ATOM 1582 O O   . LYS A 1 217 ? -25.640 -26.071 11.246 1.00 11.29 ? 217 LYS A O   1 
ATOM 1583 C CB  . LYS A 1 217 ? -23.805 -26.154 8.835  1.00 14.78 ? 217 LYS A CB  1 
ATOM 1584 C CG  . LYS A 1 217 ? -24.685 -27.134 8.066  1.00 24.87 ? 217 LYS A CG  1 
ATOM 1585 C CD  . LYS A 1 217 ? -23.958 -28.557 7.798  1.00 40.23 ? 217 LYS A CD  1 
ATOM 1586 C CE  . LYS A 1 217 ? -24.827 -29.474 6.894  1.00 43.36 ? 217 LYS A CE  1 
ATOM 1587 N NZ  . LYS A 1 217 ? -24.044 -30.315 5.903  1.00 47.20 ? 217 LYS A NZ  1 
ATOM 1588 N N   . VAL A 1 218 ? -26.989 -25.286 9.619  1.00 8.58  ? 218 VAL A N   1 
ATOM 1589 C CA  . VAL A 1 218 ? -28.271 -25.709 10.275 1.00 8.40  ? 218 VAL A CA  1 
ATOM 1590 C C   . VAL A 1 218 ? -29.002 -26.738 9.438  1.00 8.72  ? 218 VAL A C   1 
ATOM 1591 O O   . VAL A 1 218 ? -29.104 -26.566 8.178  1.00 11.37 ? 218 VAL A O   1 
ATOM 1592 C CB  . VAL A 1 218 ? -29.105 -24.486 10.568 1.00 7.76  ? 218 VAL A CB  1 
ATOM 1593 C CG1 . VAL A 1 218 ? -30.496 -24.932 11.108 1.00 10.09 ? 218 VAL A CG1 1 
ATOM 1594 C CG2 . VAL A 1 218 ? -28.441 -23.562 11.593 1.00 9.66  ? 218 VAL A CG2 1 
ATOM 1595 N N   . GLU A 1 219 ? -29.456 -27.822 10.033 1.00 8.52  ? 219 GLU A N   1 
ATOM 1596 C CA  . GLU A 1 219 ? -30.335 -28.846 9.408  1.00 10.04 ? 219 GLU A CA  1 
ATOM 1597 C C   . GLU A 1 219 ? -31.567 -28.994 10.324 1.00 10.77 ? 219 GLU A C   1 
ATOM 1598 O O   . GLU A 1 219 ? -31.440 -28.999 11.542 1.00 11.75 ? 219 GLU A O   1 
ATOM 1599 C CB  . GLU A 1 219 ? -29.539 -30.200 9.363  1.00 12.04 ? 219 GLU A CB  1 
ATOM 1600 C CG  . GLU A 1 219 ? -30.184 -31.368 8.663  1.00 24.08 ? 219 GLU A CG  1 
ATOM 1601 C CD  . GLU A 1 219 ? -29.202 -32.571 8.574  1.00 33.03 ? 219 GLU A CD  1 
ATOM 1602 O OE1 . GLU A 1 219 ? -27.999 -32.360 8.865  1.00 29.49 ? 219 GLU A OE1 1 
ATOM 1603 O OE2 . GLU A 1 219 ? -29.644 -33.717 8.248  1.00 38.69 ? 219 GLU A OE2 1 
ATOM 1604 N N   . VAL A 1 220 ? -32.709 -29.101 9.718  1.00 9.88  ? 220 VAL A N   1 
ATOM 1605 C CA  . VAL A 1 220 ? -33.970 -29.315 10.493 1.00 10.39 ? 220 VAL A CA  1 
ATOM 1606 C C   . VAL A 1 220 ? -34.573 -30.650 9.994  1.00 8.83  ? 220 VAL A C   1 
ATOM 1607 O O   . VAL A 1 220 ? -34.758 -30.852 8.746  1.00 12.26 ? 220 VAL A O   1 
ATOM 1608 C CB  . VAL A 1 220 ? -34.926 -28.131 10.144 1.00 9.91  ? 220 VAL A CB  1 
ATOM 1609 C CG1 . VAL A 1 220 ? -36.272 -28.310 10.881 1.00 14.08 ? 220 VAL A CG1 1 
ATOM 1610 C CG2 . VAL A 1 220 ? -34.315 -26.836 10.526 1.00 12.68 ? 220 VAL A CG2 1 
ATOM 1611 N N   . LEU A 1 221 ? -34.865 -31.527 10.948 1.00 8.57  ? 221 LEU A N   1 
ATOM 1612 C CA  . LEU A 1 221 ? -35.489 -32.820 10.687 1.00 8.65  ? 221 LEU A CA  1 
ATOM 1613 C C   . LEU A 1 221 ? -36.967 -32.705 11.019 1.00 8.55  ? 221 LEU A C   1 
ATOM 1614 O O   . LEU A 1 221 ? -37.309 -32.349 12.185 1.00 9.43  ? 221 LEU A O   1 
ATOM 1615 C CB  . LEU A 1 221 ? -34.834 -33.936 11.563 1.00 11.46 ? 221 LEU A CB  1 
ATOM 1616 C CG  . LEU A 1 221 ? -33.293 -34.180 11.239 1.00 16.59 ? 221 LEU A CG  1 
ATOM 1617 C CD1 . LEU A 1 221 ? -32.311 -33.058 11.302 1.00 28.43 ? 221 LEU A CD1 1 
ATOM 1618 C CD2 . LEU A 1 221 ? -32.825 -35.200 12.115 1.00 24.38 ? 221 LEU A CD2 1 
ATOM 1619 N N   . ASP A 1 222 ? -37.804 -33.025 10.104 1.00 9.63  ? 222 ASP A N   1 
ATOM 1620 C CA  . ASP A 1 222 ? -39.236 -32.856 10.322 1.00 8.28  ? 222 ASP A CA  1 
ATOM 1621 C C   . ASP A 1 222 ? -39.842 -34.165 10.896 1.00 9.31  ? 222 ASP A C   1 
ATOM 1622 O O   . ASP A 1 222 ? -39.098 -35.114 11.231 1.00 8.78  ? 222 ASP A O   1 
ATOM 1623 C CB  . ASP A 1 222 ? -39.957 -32.415 9.026  1.00 8.57  ? 222 ASP A CB  1 
ATOM 1624 C CG  . ASP A 1 222 ? -39.938 -33.478 7.924  1.00 14.16 ? 222 ASP A CG  1 
ATOM 1625 O OD1 . ASP A 1 222 ? -39.587 -34.677 8.067  1.00 12.77 ? 222 ASP A OD1 1 
ATOM 1626 O OD2 . ASP A 1 222 ? -40.340 -33.100 6.777  1.00 19.37 ? 222 ASP A OD2 1 
ATOM 1627 N N   . GLU A 1 223 ? -41.169 -34.260 11.024 1.00 9.49  ? 223 GLU A N   1 
ATOM 1628 C CA  . GLU A 1 223 ? -41.830 -35.364 11.730 1.00 8.33  ? 223 GLU A CA  1 
ATOM 1629 C C   . GLU A 1 223 ? -41.569 -36.690 11.046 1.00 10.56 ? 223 GLU A C   1 
ATOM 1630 O O   . GLU A 1 223 ? -41.308 -37.672 11.691 1.00 9.57  ? 223 GLU A O   1 
ATOM 1631 C CB  . GLU A 1 223 ? -43.309 -35.040 11.869 1.00 10.15 ? 223 GLU A CB  1 
ATOM 1632 C CG  . GLU A 1 223 ? -44.007 -36.082 12.719 1.00 12.14 ? 223 GLU A CG  1 
ATOM 1633 C CD  . GLU A 1 223 ? -45.512 -35.814 12.846 1.00 19.12 ? 223 GLU A CD  1 
ATOM 1634 O OE1 . GLU A 1 223 ? -46.174 -35.317 11.850 1.00 22.58 ? 223 GLU A OE1 1 
ATOM 1635 O OE2 . GLU A 1 223 ? -46.003 -35.981 14.021 1.00 14.31 ? 223 GLU A OE2 1 
ATOM 1636 N N   . LYS A 1 224 ? -41.622 -36.653 9.715  1.00 10.45 ? 224 LYS A N   1 
ATOM 1637 C CA  . LYS A 1 224 ? -41.442 -37.920 8.960  1.00 10.64 ? 224 LYS A CA  1 
ATOM 1638 C C   . LYS A 1 224 ? -40.001 -38.376 9.118  1.00 11.29 ? 224 LYS A C   1 
ATOM 1639 O O   . LYS A 1 224 ? -39.777 -39.606 9.246  1.00 11.51 ? 224 LYS A O   1 
ATOM 1640 C CB  . LYS A 1 224 ? -41.741 -37.670 7.448  1.00 11.76 ? 224 LYS A CB  1 
ATOM 1641 C CG  . LYS A 1 224 ? -41.590 -38.966 6.676  1.00 17.08 ? 224 LYS A CG  1 
ATOM 1642 C CD  . LYS A 1 224 ? -41.924 -38.695 5.202  1.00 26.58 ? 224 LYS A CD  1 
ATOM 1643 C CE  . LYS A 1 224 ? -42.327 -40.036 4.538  1.00 33.43 ? 224 LYS A CE  1 
ATOM 1644 N NZ  . LYS A 1 224 ? -41.272 -41.079 4.534  1.00 35.34 ? 224 LYS A NZ  1 
ATOM 1645 N N   . LYS A 1 225 ? -39.044 -37.474 9.122  1.00 10.58 ? 225 LYS A N   1 
ATOM 1646 C CA  . LYS A 1 225 ? -37.664 -37.882 9.323  1.00 9.18  ? 225 LYS A CA  1 
ATOM 1647 C C   . LYS A 1 225 ? -37.422 -38.441 10.730 1.00 9.69  ? 225 LYS A C   1 
ATOM 1648 O O   . LYS A 1 225 ? -36.757 -39.487 10.849 1.00 10.92 ? 225 LYS A O   1 
ATOM 1649 C CB  . LYS A 1 225 ? -36.705 -36.719 9.066  1.00 11.85 ? 225 LYS A CB  1 
ATOM 1650 C CG  . LYS A 1 225 ? -35.230 -37.080 9.277  1.00 15.92 ? 225 LYS A CG  1 
ATOM 1651 C CD  . LYS A 1 225 ? -34.700 -38.100 8.242  1.00 21.29 ? 225 LYS A CD  1 
ATOM 1652 C CE  . LYS A 1 225 ? -33.164 -38.034 8.356  1.00 22.73 ? 225 LYS A CE  1 
ATOM 1653 N NZ  . LYS A 1 225 ? -32.616 -39.176 7.561  1.00 26.55 ? 225 LYS A NZ  1 
ATOM 1654 N N   . ILE A 1 226 ? -37.943 -37.774 11.744 1.00 8.88  ? 226 ILE A N   1 
ATOM 1655 C CA  . ILE A 1 226 ? -37.898 -38.310 13.107 1.00 9.51  ? 226 ILE A CA  1 
ATOM 1656 C C   . ILE A 1 226 ? -38.455 -39.767 13.162 1.00 8.90  ? 226 ILE A C   1 
ATOM 1657 O O   . ILE A 1 226 ? -37.821 -40.688 13.712 1.00 9.89  ? 226 ILE A O   1 
ATOM 1658 C CB  . ILE A 1 226 ? -38.690 -37.342 14.015 1.00 6.90  ? 226 ILE A CB  1 
ATOM 1659 C CG1 . ILE A 1 226 ? -37.878 -36.045 14.155 1.00 8.49  ? 226 ILE A CG1 1 
ATOM 1660 C CG2 . ILE A 1 226 ? -38.927 -37.986 15.387 1.00 7.69  ? 226 ILE A CG2 1 
ATOM 1661 C CD1 . ILE A 1 226 ? -38.717 -34.865 14.846 1.00 6.76  ? 226 ILE A CD1 1 
ATOM 1662 N N   . LYS A 1 227 ? -39.598 -40.006 12.547 1.00 8.90  ? 227 LYS A N   1 
ATOM 1663 C CA  . LYS A 1 227 ? -40.236 -41.336 12.543 1.00 9.89  ? 227 LYS A CA  1 
ATOM 1664 C C   . LYS A 1 227 ? -39.345 -42.301 11.775 1.00 11.76 ? 227 LYS A C   1 
ATOM 1665 O O   . LYS A 1 227 ? -39.102 -43.415 12.234 1.00 10.62 ? 227 LYS A O   1 
ATOM 1666 C CB  . LYS A 1 227 ? -41.593 -41.216 11.819 1.00 12.48 ? 227 LYS A CB  1 
ATOM 1667 C CG  . LYS A 1 227 ? -42.314 -42.610 11.829 1.00 16.59 ? 227 LYS A CG  1 
ATOM 1668 C CD  . LYS A 1 227 ? -43.741 -42.448 11.274 1.00 21.17 ? 227 LYS A CD  1 
ATOM 1669 C CE  . LYS A 1 227 ? -44.336 -43.838 10.949 1.00 32.41 ? 227 LYS A CE  1 
ATOM 1670 N NZ  . LYS A 1 227 ? -45.573 -43.535 10.096 1.00 35.53 ? 227 LYS A NZ  1 
ATOM 1671 N N   . ASP A 1 228 ? -38.871 -41.848 10.591 1.00 11.77 ? 228 ASP A N   1 
ATOM 1672 C CA  . ASP A 1 228 ? -38.057 -42.754 9.693  1.00 14.28 ? 228 ASP A CA  1 
ATOM 1673 C C   . ASP A 1 228 ? -36.695 -43.075 10.262 1.00 13.81 ? 228 ASP A C   1 
ATOM 1674 O O   . ASP A 1 228 ? -36.055 -44.162 9.908  1.00 15.37 ? 228 ASP A O   1 
ATOM 1675 C CB  . ASP A 1 228 ? -37.912 -42.110 8.347  1.00 16.67 ? 228 ASP A CB  1 
ATOM 1676 C CG  . ASP A 1 228 ? -39.217 -42.196 7.475  1.00 16.68 ? 228 ASP A CG  1 
ATOM 1677 O OD1 . ASP A 1 228 ? -40.220 -42.854 7.843  1.00 19.25 ? 228 ASP A OD1 1 
ATOM 1678 O OD2 . ASP A 1 228 ? -39.085 -41.527 6.365  1.00 20.53 ? 228 ASP A OD2 1 
ATOM 1679 N N   . LEU A 1 229 ? -36.148 -42.209 11.078 1.00 10.76 ? 229 LEU A N   1 
ATOM 1680 C CA  . LEU A 1 229 ? -34.870 -42.562 11.865 1.00 10.15 ? 229 LEU A CA  1 
ATOM 1681 C C   . LEU A 1 229 ? -35.131 -43.629 12.978 1.00 8.95  ? 229 LEU A C   1 
ATOM 1682 O O   . LEU A 1 229 ? -34.167 -44.127 13.529 1.00 11.23 ? 229 LEU A O   1 
ATOM 1683 C CB  . LEU A 1 229 ? -34.205 -41.304 12.499 1.00 12.20 ? 229 LEU A CB  1 
ATOM 1684 C CG  . LEU A 1 229 ? -33.459 -40.325 11.520 1.00 15.73 ? 229 LEU A CG  1 
ATOM 1685 C CD1 . LEU A 1 229 ? -33.158 -39.038 12.340 1.00 19.15 ? 229 LEU A CD1 1 
ATOM 1686 C CD2 . LEU A 1 229 ? -32.149 -40.995 11.102 1.00 23.85 ? 229 LEU A CD2 1 
ATOM 1687 N N   . GLY A 1 230 ? -36.404 -43.948 13.272 1.00 8.28  ? 230 GLY A N   1 
ATOM 1688 C CA  . GLY A 1 230 ? -36.761 -44.896 14.342 1.00 9.13  ? 230 GLY A CA  1 
ATOM 1689 C C   . GLY A 1 230 ? -36.895 -44.226 15.691 1.00 7.40  ? 230 GLY A C   1 
ATOM 1690 O O   . GLY A 1 230 ? -36.816 -44.953 16.690 1.00 7.45  ? 230 GLY A O   1 
ATOM 1691 N N   . MET A 1 231 ? -37.083 -42.893 15.667 1.00 7.45  ? 231 MET A N   1 
ATOM 1692 C CA  . MET A 1 231 ? -37.181 -42.155 16.971 1.00 7.73  ? 231 MET A CA  1 
ATOM 1693 C C   . MET A 1 231 ? -38.630 -42.293 17.525 1.00 6.64  ? 231 MET A C   1 
ATOM 1694 O O   . MET A 1 231 ? -39.401 -41.347 17.518 1.00 7.51  ? 231 MET A O   1 
ATOM 1695 C CB  . MET A 1 231 ? -36.834 -40.690 16.849 1.00 6.18  ? 231 MET A CB  1 
ATOM 1696 C CG  . MET A 1 231 ? -35.368 -40.563 16.434 1.00 9.59  ? 231 MET A CG  1 
ATOM 1697 S SD  . MET A 1 231 ? -35.071 -38.746 16.248 1.00 11.21 ? 231 MET A SD  1 
ATOM 1698 C CE  . MET A 1 231 ? -33.274 -38.720 16.314 1.00 13.62 ? 231 MET A CE  1 
ATOM 1699 N N   . GLY A 1 232 ? -38.975 -43.502 18.002 1.00 6.62  ? 232 GLY A N   1 
ATOM 1700 C CA  . GLY A 1 232 ? -40.316 -43.782 18.416 1.00 5.87  ? 232 GLY A CA  1 
ATOM 1701 C C   . GLY A 1 232 ? -40.773 -43.047 19.655 1.00 6.07  ? 232 GLY A C   1 
ATOM 1702 O O   . GLY A 1 232 ? -41.987 -42.755 19.753 1.00 7.95  ? 232 GLY A O   1 
ATOM 1703 N N   . ALA A 1 233 ? -39.834 -42.736 20.550 1.00 6.68  ? 233 ALA A N   1 
ATOM 1704 C CA  . ALA A 1 233 ? -40.292 -41.941 21.709 1.00 5.66  ? 233 ALA A CA  1 
ATOM 1705 C C   . ALA A 1 233 ? -40.519 -40.485 21.366 1.00 6.66  ? 233 ALA A C   1 
ATOM 1706 O O   . ALA A 1 233 ? -41.531 -39.869 21.778 1.00 6.07  ? 233 ALA A O   1 
ATOM 1707 C CB  . ALA A 1 233 ? -39.186 -42.070 22.797 1.00 7.00  ? 233 ALA A CB  1 
ATOM 1708 N N   . PHE A 1 234 ? -39.594 -39.864 20.587 1.00 5.59  ? 234 PHE A N   1 
ATOM 1709 C CA  . PHE A 1 234 ? -39.797 -38.474 20.188 1.00 4.79  ? 234 PHE A CA  1 
ATOM 1710 C C   . PHE A 1 234 ? -41.100 -38.369 19.347 1.00 5.33  ? 234 PHE A C   1 
ATOM 1711 O O   . PHE A 1 234 ? -41.940 -37.468 19.594 1.00 6.34  ? 234 PHE A O   1 
ATOM 1712 C CB  . PHE A 1 234 ? -38.524 -38.140 19.420 1.00 8.26  ? 234 PHE A CB  1 
ATOM 1713 C CG  . PHE A 1 234 ? -38.440 -36.772 18.800 1.00 6.98  ? 234 PHE A CG  1 
ATOM 1714 C CD1 . PHE A 1 234 ? -38.090 -35.720 19.668 1.00 7.29  ? 234 PHE A CD1 1 
ATOM 1715 C CD2 . PHE A 1 234 ? -38.714 -36.495 17.471 1.00 6.84  ? 234 PHE A CD2 1 
ATOM 1716 C CE1 . PHE A 1 234 ? -37.968 -34.379 19.168 1.00 9.30  ? 234 PHE A CE1 1 
ATOM 1717 C CE2 . PHE A 1 234 ? -38.654 -35.175 16.973 1.00 6.51  ? 234 PHE A CE2 1 
ATOM 1718 C CZ  . PHE A 1 234 ? -38.209 -34.134 17.763 1.00 8.17  ? 234 PHE A CZ  1 
ATOM 1719 N N   . TYR A 1 235 ? -41.278 -39.323 18.401 1.00 5.90  ? 235 TYR A N   1 
ATOM 1720 C CA  . TYR A 1 235 ? -42.496 -39.203 17.580 1.00 6.62  ? 235 TYR A CA  1 
ATOM 1721 C C   . TYR A 1 235 ? -43.767 -39.341 18.451 1.00 6.63  ? 235 TYR A C   1 
ATOM 1722 O O   . TYR A 1 235 ? -44.762 -38.615 18.207 1.00 7.56  ? 235 TYR A O   1 
ATOM 1723 C CB  . TYR A 1 235 ? -42.451 -40.359 16.551 1.00 6.34  ? 235 TYR A CB  1 
ATOM 1724 C CG  . TYR A 1 235 ? -43.617 -40.295 15.608 1.00 9.37  ? 235 TYR A CG  1 
ATOM 1725 C CD1 . TYR A 1 235 ? -43.630 -39.468 14.491 1.00 11.46 ? 235 TYR A CD1 1 
ATOM 1726 C CD2 . TYR A 1 235 ? -44.708 -41.087 15.935 1.00 11.89 ? 235 TYR A CD2 1 
ATOM 1727 C CE1 . TYR A 1 235 ? -44.964 -39.512 13.697 1.00 14.08 ? 235 TYR A CE1 1 
ATOM 1728 C CE2 . TYR A 1 235 ? -45.920 -41.104 15.182 1.00 19.61 ? 235 TYR A CE2 1 
ATOM 1729 C CZ  . TYR A 1 235 ? -45.995 -40.317 14.139 1.00 15.84 ? 235 TYR A CZ  1 
ATOM 1730 O OH  . TYR A 1 235 ? -47.257 -40.474 13.457 1.00 22.32 ? 235 TYR A OH  1 
ATOM 1731 N N   . ALA A 1 236 ? -43.717 -40.233 19.457 1.00 6.63  ? 236 ALA A N   1 
ATOM 1732 C CA  . ALA A 1 236 ? -44.935 -40.424 20.303 1.00 6.97  ? 236 ALA A CA  1 
ATOM 1733 C C   . ALA A 1 236 ? -45.285 -39.136 21.044 1.00 6.46  ? 236 ALA A C   1 
ATOM 1734 O O   . ALA A 1 236 ? -46.484 -38.821 21.189 1.00 7.11  ? 236 ALA A O   1 
ATOM 1735 C CB  . ALA A 1 236 ? -44.596 -41.533 21.346 1.00 7.95  ? 236 ALA A CB  1 
ATOM 1736 N N   . VAL A 1 237 ? -44.308 -38.333 21.438 1.00 5.11  ? 237 VAL A N   1 
ATOM 1737 C CA  . VAL A 1 237 ? -44.676 -37.094 22.186 1.00 6.70  ? 237 VAL A CA  1 
ATOM 1738 C C   . VAL A 1 237 ? -45.391 -36.133 21.263 1.00 7.42  ? 237 VAL A C   1 
ATOM 1739 O O   . VAL A 1 237 ? -46.399 -35.522 21.703 1.00 7.96  ? 237 VAL A O   1 
ATOM 1740 C CB  . VAL A 1 237 ? -43.391 -36.399 22.687 1.00 6.37  ? 237 VAL A CB  1 
ATOM 1741 C CG1 . VAL A 1 237 ? -43.743 -35.021 23.348 1.00 7.22  ? 237 VAL A CG1 1 
ATOM 1742 C CG2 . VAL A 1 237 ? -42.736 -37.298 23.726 1.00 7.93  ? 237 VAL A CG2 1 
ATOM 1743 N N   . GLY A 1 238 ? -44.854 -35.968 20.005 1.00 7.69  ? 238 GLY A N   1 
ATOM 1744 C CA  . GLY A 1 238 ? -45.392 -34.895 19.172 1.00 10.10 ? 238 GLY A CA  1 
ATOM 1745 C C   . GLY A 1 238 ? -46.707 -35.192 18.477 1.00 8.90  ? 238 GLY A C   1 
ATOM 1746 O O   . GLY A 1 238 ? -47.301 -34.257 17.900 1.00 9.24  ? 238 GLY A O   1 
ATOM 1747 N N   . GLN A 1 239 ? -47.083 -36.484 18.428 1.00 6.91  ? 239 GLN A N   1 
ATOM 1748 C CA  . GLN A 1 239 ? -48.163 -36.870 17.454 1.00 8.31  ? 239 GLN A CA  1 
ATOM 1749 C C   . GLN A 1 239 ? -49.517 -36.283 17.794 1.00 8.97  ? 239 GLN A C   1 
ATOM 1750 O O   . GLN A 1 239 ? -50.379 -36.112 16.888 1.00 9.83  ? 239 GLN A O   1 
ATOM 1751 C CB  . GLN A 1 239 ? -48.191 -38.420 17.277 1.00 8.63  ? 239 GLN A CB  1 
ATOM 1752 C CG  . GLN A 1 239 ? -48.691 -39.175 18.473 1.00 8.35  ? 239 GLN A CG  1 
ATOM 1753 C CD  . GLN A 1 239 ? -48.933 -40.648 18.080 1.00 20.07 ? 239 GLN A CD  1 
ATOM 1754 O OE1 . GLN A 1 239 ? -48.881 -40.944 16.887 1.00 29.12 ? 239 GLN A OE1 1 
ATOM 1755 N NE2 . GLN A 1 239 ? -49.482 -41.427 18.927 1.00 22.50 ? 239 GLN A NE2 1 
ATOM 1756 N N   . GLY A 1 240 ? -49.721 -36.048 19.078 1.00 7.03  ? 240 GLY A N   1 
ATOM 1757 C CA  . GLY A 1 240 ? -51.026 -35.501 19.562 1.00 7.36  ? 240 GLY A CA  1 
ATOM 1758 C C   . GLY A 1 240 ? -51.352 -34.135 19.044 1.00 8.56  ? 240 GLY A C   1 
ATOM 1759 O O   . GLY A 1 240 ? -52.536 -33.753 19.073 1.00 12.78 ? 240 GLY A O   1 
ATOM 1760 N N   . SER A 1 241 ? -50.377 -33.327 18.633 1.00 9.15  ? 241 SER A N   1 
ATOM 1761 C CA  . SER A 1 241 ? -50.592 -31.909 18.365 1.00 7.72  ? 241 SER A CA  1 
ATOM 1762 C C   . SER A 1 241 ? -50.791 -31.660 16.853 1.00 6.38  ? 241 SER A C   1 
ATOM 1763 O O   . SER A 1 241 ? -50.258 -32.416 16.005 1.00 9.59  ? 241 SER A O   1 
ATOM 1764 C CB  . SER A 1 241 ? -49.368 -31.130 18.809 1.00 7.47  ? 241 SER A CB  1 
ATOM 1765 O OG  . SER A 1 241 ? -49.586 -29.756 18.472 1.00 8.01  ? 241 SER A OG  1 
ATOM 1766 N N   . ASP A 1 242 ? -51.511 -30.556 16.512 1.00 6.99  ? 242 ASP A N   1 
ATOM 1767 C CA  . ASP A 1 242 ? -51.505 -30.146 15.140 1.00 7.31  ? 242 ASP A CA  1 
ATOM 1768 C C   . ASP A 1 242 ? -50.205 -29.491 14.735 1.00 9.41  ? 242 ASP A C   1 
ATOM 1769 O O   . ASP A 1 242 ? -50.002 -29.272 13.517 1.00 11.69 ? 242 ASP A O   1 
ATOM 1770 C CB  . ASP A 1 242 ? -52.634 -29.109 14.970 1.00 8.31  ? 242 ASP A CB  1 
ATOM 1771 C CG  . ASP A 1 242 ? -54.019 -29.706 15.012 1.00 11.47 ? 242 ASP A CG  1 
ATOM 1772 O OD1 . ASP A 1 242 ? -54.176 -30.928 15.030 1.00 17.00 ? 242 ASP A OD1 1 
ATOM 1773 O OD2 . ASP A 1 242 ? -54.975 -28.879 14.944 1.00 12.12 ? 242 ASP A OD2 1 
ATOM 1774 N N   . GLN A 1 243 ? -49.355 -29.046 15.688 1.00 7.86  ? 243 GLN A N   1 
ATOM 1775 C CA  . GLN A 1 243 ? -48.050 -28.483 15.356 1.00 7.00  ? 243 GLN A CA  1 
ATOM 1776 C C   . GLN A 1 243 ? -47.002 -29.586 15.378 1.00 7.34  ? 243 GLN A C   1 
ATOM 1777 O O   . GLN A 1 243 ? -46.850 -30.244 16.409 1.00 9.84  ? 243 GLN A O   1 
ATOM 1778 C CB  . GLN A 1 243 ? -47.639 -27.451 16.410 1.00 7.48  ? 243 GLN A CB  1 
ATOM 1779 C CG  . GLN A 1 243 ? -48.268 -26.071 16.203 1.00 8.85  ? 243 GLN A CG  1 
ATOM 1780 C CD  . GLN A 1 243 ? -47.856 -25.369 14.945 1.00 13.52 ? 243 GLN A CD  1 
ATOM 1781 O OE1 . GLN A 1 243 ? -46.934 -25.779 14.206 1.00 12.58 ? 243 GLN A OE1 1 
ATOM 1782 N NE2 . GLN A 1 243 ? -48.708 -24.374 14.581 1.00 18.72 ? 243 GLN A NE2 1 
ATOM 1783 N N   . PRO A 1 244 ? -46.376 -29.923 14.286 1.00 6.62  ? 244 PRO A N   1 
ATOM 1784 C CA  . PRO A 1 244 ? -45.540 -31.097 14.291 1.00 7.52  ? 244 PRO A CA  1 
ATOM 1785 C C   . PRO A 1 244 ? -44.172 -30.818 14.963 1.00 5.80  ? 244 PRO A C   1 
ATOM 1786 O O   . PRO A 1 244 ? -43.733 -29.642 15.087 1.00 7.57  ? 244 PRO A O   1 
ATOM 1787 C CB  . PRO A 1 244 ? -45.321 -31.376 12.792 1.00 8.15  ? 244 PRO A CB  1 
ATOM 1788 C CG  . PRO A 1 244 ? -45.390 -29.974 12.155 1.00 8.56  ? 244 PRO A CG  1 
ATOM 1789 C CD  . PRO A 1 244 ? -45.645 -29.072 13.413 1.00 9.41  ? 244 PRO A CD  1 
ATOM 1790 N N   . PRO A 1 245 ? -43.488 -31.913 15.350 1.00 6.18  ? 245 PRO A N   1 
ATOM 1791 C CA  . PRO A 1 245 ? -42.179 -31.753 15.998 1.00 6.15  ? 245 PRO A CA  1 
ATOM 1792 C C   . PRO A 1 245 ? -41.047 -31.456 15.001 1.00 6.89  ? 245 PRO A C   1 
ATOM 1793 O O   . PRO A 1 245 ? -41.224 -31.610 13.816 1.00 9.30  ? 245 PRO A O   1 
ATOM 1794 C CB  . PRO A 1 245 ? -41.997 -33.118 16.628 1.00 5.76  ? 245 PRO A CB  1 
ATOM 1795 C CG  . PRO A 1 245 ? -42.775 -34.100 15.670 1.00 9.24  ? 245 PRO A CG  1 
ATOM 1796 C CD  . PRO A 1 245 ? -43.280 -33.120 14.635 1.00 9.49  ? 245 PRO A CD  1 
ATOM 1797 N N   . ARG A 1 246 ? -39.945 -30.979 15.544 1.00 5.61  ? 246 ARG A N   1 
ATOM 1798 C CA  . ARG A 1 246 ? -38.761 -30.696 14.759 1.00 6.84  ? 246 ARG A CA  1 
ATOM 1799 C C   . ARG A 1 246 ? -37.562 -31.084 15.589 1.00 6.25  ? 246 ARG A C   1 
ATOM 1800 O O   . ARG A 1 246 ? -37.486 -30.726 16.801 1.00 7.90  ? 246 ARG A O   1 
ATOM 1801 C CB  . ARG A 1 246 ? -38.677 -29.182 14.444 1.00 8.80  ? 246 ARG A CB  1 
ATOM 1802 C CG  . ARG A 1 246 ? -39.806 -28.616 13.652 1.00 10.47 ? 246 ARG A CG  1 
ATOM 1803 C CD  . ARG A 1 246 ? -39.635 -29.036 12.201 1.00 11.73 ? 246 ARG A CD  1 
ATOM 1804 N NE  . ARG A 1 246 ? -40.690 -28.527 11.233 1.00 13.10 ? 246 ARG A NE  1 
ATOM 1805 C CZ  . ARG A 1 246 ? -41.719 -29.267 10.825 1.00 12.32 ? 246 ARG A CZ  1 
ATOM 1806 N NH1 . ARG A 1 246 ? -42.015 -30.486 11.299 1.00 9.93  ? 246 ARG A NH1 1 
ATOM 1807 N NH2 . ARG A 1 246 ? -42.542 -28.765 9.830  1.00 14.22 ? 246 ARG A NH2 1 
ATOM 1808 N N   . LEU A 1 247 ? -36.565 -31.743 14.977 1.00 6.73  ? 247 LEU A N   1 
ATOM 1809 C CA  . LEU A 1 247 ? -35.255 -31.896 15.624 1.00 6.08  ? 247 LEU A CA  1 
ATOM 1810 C C   . LEU A 1 247 ? -34.320 -30.966 14.858 1.00 7.10  ? 247 LEU A C   1 
ATOM 1811 O O   . LEU A 1 247 ? -34.131 -31.098 13.628 1.00 8.11  ? 247 LEU A O   1 
ATOM 1812 C CB  . LEU A 1 247 ? -34.797 -33.358 15.544 1.00 7.48  ? 247 LEU A CB  1 
ATOM 1813 C CG  . LEU A 1 247 ? -33.345 -33.587 16.058 1.00 11.57 ? 247 LEU A CG  1 
ATOM 1814 C CD1 . LEU A 1 247 ? -33.027 -33.087 17.357 1.00 15.08 ? 247 LEU A CD1 1 
ATOM 1815 C CD2 . LEU A 1 247 ? -33.068 -35.167 15.906 1.00 18.11 ? 247 LEU A CD2 1 
ATOM 1816 N N   . ILE A 1 248 ? -33.819 -29.949 15.538 1.00 5.70  ? 248 ILE A N   1 
ATOM 1817 C CA  . ILE A 1 248 ? -33.052 -28.901 14.876 1.00 6.23  ? 248 ILE A CA  1 
ATOM 1818 C C   . ILE A 1 248 ? -31.562 -29.106 15.222 1.00 7.15  ? 248 ILE A C   1 
ATOM 1819 O O   . ILE A 1 248 ? -31.187 -29.279 16.401 1.00 6.95  ? 248 ILE A O   1 
ATOM 1820 C CB  . ILE A 1 248 ? -33.485 -27.511 15.398 1.00 6.79  ? 248 ILE A CB  1 
ATOM 1821 C CG1 . ILE A 1 248 ? -34.969 -27.295 15.104 1.00 8.19  ? 248 ILE A CG1 1 
ATOM 1822 C CG2 . ILE A 1 248 ? -32.648 -26.450 14.703 1.00 8.46  ? 248 ILE A CG2 1 
ATOM 1823 C CD1 . ILE A 1 248 ? -35.513 -26.097 16.030 1.00 10.74 ? 248 ILE A CD1 1 
ATOM 1824 N N   . VAL A 1 249 ? -30.689 -29.125 14.206 1.00 6.58  ? 249 VAL A N   1 
ATOM 1825 C CA  . VAL A 1 249 ? -29.260 -29.340 14.412 1.00 8.19  ? 249 VAL A CA  1 
ATOM 1826 C C   . VAL A 1 249 ? -28.535 -28.057 14.046 1.00 6.49  ? 249 VAL A C   1 
ATOM 1827 O O   . VAL A 1 249 ? -28.648 -27.574 12.909 1.00 8.70  ? 249 VAL A O   1 
ATOM 1828 C CB  . VAL A 1 249 ? -28.793 -30.477 13.470 1.00 7.54  ? 249 VAL A CB  1 
ATOM 1829 C CG1 . VAL A 1 249 ? -27.262 -30.697 13.719 1.00 8.58  ? 249 VAL A CG1 1 
ATOM 1830 C CG2 . VAL A 1 249 ? -29.588 -31.775 13.679 1.00 7.31  ? 249 VAL A CG2 1 
ATOM 1831 N N   . LEU A 1 250 ? -27.698 -27.524 14.926 1.00 6.43  ? 250 LEU A N   1 
ATOM 1832 C CA  . LEU A 1 250 ? -26.943 -26.309 14.590 1.00 6.61  ? 250 LEU A CA  1 
ATOM 1833 C C   . LEU A 1 250 ? -25.509 -26.649 14.896 1.00 8.99  ? 250 LEU A C   1 
ATOM 1834 O O   . LEU A 1 250 ? -25.140 -26.870 16.063 1.00 10.03 ? 250 LEU A O   1 
ATOM 1835 C CB  . LEU A 1 250 ? -27.369 -25.045 15.394 1.00 9.25  ? 250 LEU A CB  1 
ATOM 1836 C CG  . LEU A 1 250 ? -28.886 -24.796 15.393 1.00 7.06  ? 250 LEU A CG  1 
ATOM 1837 C CD1 . LEU A 1 250 ? -29.565 -25.361 16.635 1.00 11.32 ? 250 LEU A CD1 1 
ATOM 1838 C CD2 . LEU A 1 250 ? -29.115 -23.246 15.422 1.00 10.94 ? 250 LEU A CD2 1 
ATOM 1839 N N   . ASN A 1 251 ? -24.685 -26.644 13.801 1.00 7.58  ? 251 ASN A N   1 
ATOM 1840 C CA  . ASN A 1 251 ? -23.319 -27.154 13.947 1.00 7.99  ? 251 ASN A CA  1 
ATOM 1841 C C   . ASN A 1 251 ? -22.339 -26.041 13.708 1.00 6.69  ? 251 ASN A C   1 
ATOM 1842 O O   . ASN A 1 251 ? -22.255 -25.510 12.569 1.00 8.87  ? 251 ASN A O   1 
ATOM 1843 C CB  . ASN A 1 251 ? -23.124 -28.296 12.950 1.00 7.22  ? 251 ASN A CB  1 
ATOM 1844 C CG  . ASN A 1 251 ? -21.787 -29.010 13.107 1.00 10.30 ? 251 ASN A CG  1 
ATOM 1845 O OD1 . ASN A 1 251 ? -20.870 -28.468 13.660 1.00 10.04 ? 251 ASN A OD1 1 
ATOM 1846 N ND2 . ASN A 1 251 ? -21.789 -30.305 12.733 1.00 12.99 ? 251 ASN A ND2 1 
ATOM 1847 N N   . TYR A 1 252 ? -21.695 -25.591 14.771 1.00 6.82  ? 252 TYR A N   1 
ATOM 1848 C CA  . TYR A 1 252 ? -20.686 -24.515 14.734 1.00 7.04  ? 252 TYR A CA  1 
ATOM 1849 C C   . TYR A 1 252 ? -19.327 -25.147 14.694 1.00 9.42  ? 252 TYR A C   1 
ATOM 1850 O O   . TYR A 1 252 ? -18.883 -25.799 15.650 1.00 8.83  ? 252 TYR A O   1 
ATOM 1851 C CB  . TYR A 1 252 ? -20.836 -23.624 15.952 1.00 9.11  ? 252 TYR A CB  1 
ATOM 1852 C CG  . TYR A 1 252 ? -19.713 -22.658 16.174 1.00 7.83  ? 252 TYR A CG  1 
ATOM 1853 C CD1 . TYR A 1 252 ? -19.544 -21.569 15.330 1.00 12.35 ? 252 TYR A CD1 1 
ATOM 1854 C CD2 . TYR A 1 252 ? -18.813 -22.853 17.237 1.00 8.63  ? 252 TYR A CD2 1 
ATOM 1855 C CE1 . TYR A 1 252 ? -18.526 -20.674 15.643 1.00 11.04 ? 252 TYR A CE1 1 
ATOM 1856 C CE2 . TYR A 1 252 ? -17.736 -21.965 17.528 1.00 8.78  ? 252 TYR A CE2 1 
ATOM 1857 C CZ  . TYR A 1 252 ? -17.651 -20.901 16.721 1.00 9.65  ? 252 TYR A CZ  1 
ATOM 1858 O OH  . TYR A 1 252 ? -16.586 -20.005 16.933 1.00 11.90 ? 252 TYR A OH  1 
ATOM 1859 N N   . GLN A 1 253 ? -18.594 -24.880 13.564 1.00 10.10 ? 253 GLN A N   1 
ATOM 1860 C CA  . GLN A 1 253 ? -17.238 -25.522 13.472 1.00 9.95  ? 253 GLN A CA  1 
ATOM 1861 C C   . GLN A 1 253 ? -16.186 -24.481 13.745 1.00 11.92 ? 253 GLN A C   1 
ATOM 1862 O O   . GLN A 1 253 ? -15.545 -23.913 12.779 1.00 15.95 ? 253 GLN A O   1 
ATOM 1863 C CB  . GLN A 1 253 ? -17.147 -26.183 12.093 1.00 10.68 ? 253 GLN A CB  1 
ATOM 1864 C CG  . GLN A 1 253 ? -18.009 -27.462 11.987 1.00 13.08 ? 253 GLN A CG  1 
ATOM 1865 C CD  . GLN A 1 253 ? -17.341 -28.603 12.774 1.00 17.09 ? 253 GLN A CD  1 
ATOM 1866 O OE1 . GLN A 1 253 ? -16.133 -28.950 12.556 1.00 15.64 ? 253 GLN A OE1 1 
ATOM 1867 N NE2 . GLN A 1 253 ? -18.116 -29.244 13.660 1.00 11.86 ? 253 GLN A NE2 1 
ATOM 1868 N N   . GLY A 1 254 ? -15.939 -24.221 15.002 1.00 9.35  ? 254 GLY A N   1 
ATOM 1869 C CA  . GLY A 1 254 ? -14.949 -23.193 15.353 1.00 9.29  ? 254 GLY A CA  1 
ATOM 1870 C C   . GLY A 1 254 ? -13.608 -23.755 15.763 1.00 10.54 ? 254 GLY A C   1 
ATOM 1871 O O   . GLY A 1 254 ? -12.599 -23.009 15.940 1.00 10.68 ? 254 GLY A O   1 
ATOM 1872 N N   . GLY A 1 255 ? -13.601 -25.086 15.962 1.00 9.20  ? 255 GLY A N   1 
ATOM 1873 C CA  . GLY A 1 255 ? -12.334 -25.752 16.385 1.00 9.69  ? 255 GLY A CA  1 
ATOM 1874 C C   . GLY A 1 255 ? -11.522 -26.295 15.210 1.00 9.65  ? 255 GLY A C   1 
ATOM 1875 O O   . GLY A 1 255 ? -11.862 -26.110 14.094 1.00 11.03 ? 255 GLY A O   1 
ATOM 1876 N N   . LYS A 1 256 ? -10.443 -27.013 15.555 1.00 10.51 ? 256 LYS A N   1 
ATOM 1877 C CA  . LYS A 1 256 ? -9.748  -27.763 14.522 1.00 10.30 ? 256 LYS A CA  1 
ATOM 1878 C C   . LYS A 1 256 ? -10.625 -28.843 13.990 1.00 11.67 ? 256 LYS A C   1 
ATOM 1879 O O   . LYS A 1 256 ? -11.540 -29.355 14.662 1.00 11.05 ? 256 LYS A O   1 
ATOM 1880 C CB  . LYS A 1 256 ? -8.481  -28.389 15.145 1.00 10.72 ? 256 LYS A CB  1 
ATOM 1881 C CG  . LYS A 1 256 ? -7.542  -27.279 15.658 1.00 13.27 ? 256 LYS A CG  1 
ATOM 1882 C CD  . LYS A 1 256 ? -6.168  -27.926 15.890 1.00 18.92 ? 256 LYS A CD  1 
ATOM 1883 C CE  . LYS A 1 256 ? -5.188  -26.944 16.411 1.00 21.84 ? 256 LYS A CE  1 
ATOM 1884 N NZ  . LYS A 1 256 ? -5.231  -26.996 17.903 1.00 31.93 ? 256 LYS A NZ  1 
ATOM 1885 N N   . LYS A 1 257 ? -10.343 -29.292 12.780 1.00 9.81  ? 257 LYS A N   1 
ATOM 1886 C CA  . LYS A 1 257 ? -11.282 -30.248 12.132 1.00 10.89 ? 257 LYS A CA  1 
ATOM 1887 C C   . LYS A 1 257 ? -11.363 -31.594 12.871 1.00 11.64 ? 257 LYS A C   1 
ATOM 1888 O O   . LYS A 1 257 ? -12.479 -32.217 12.940 1.00 13.55 ? 257 LYS A O   1 
ATOM 1889 C CB  . LYS A 1 257 ? -10.813 -30.500 10.601 1.00 13.52 ? 257 LYS A CB  1 
ATOM 1890 C CG  . LYS A 1 257 ? -11.535 -31.613 9.915  1.00 23.00 ? 257 LYS A CG  1 
ATOM 1891 C CD  . LYS A 1 257 ? -12.950 -31.239 9.533  1.00 35.41 ? 257 LYS A CD  1 
ATOM 1892 C CE  . LYS A 1 257 ? -13.494 -32.116 8.367  1.00 37.33 ? 257 LYS A CE  1 
ATOM 1893 N NZ  . LYS A 1 257 ? -14.898 -31.683 8.133  1.00 43.53 ? 257 LYS A NZ  1 
ATOM 1894 N N   . ALA A 1 258 ? -10.245 -32.032 13.487 1.00 8.83  ? 258 ALA A N   1 
ATOM 1895 C CA  . ALA A 1 258 ? -10.303 -33.287 14.121 1.00 7.24  ? 258 ALA A CA  1 
ATOM 1896 C C   . ALA A 1 258 ? -10.500 -33.138 15.650 1.00 9.77  ? 258 ALA A C   1 
ATOM 1897 O O   . ALA A 1 258 ? -10.347 -34.128 16.395 1.00 11.53 ? 258 ALA A O   1 
ATOM 1898 C CB  . ALA A 1 258 ? -9.005  -34.074 13.841 1.00 11.57 ? 258 ALA A CB  1 
ATOM 1899 N N   . ASP A 1 259 ? -10.876 -31.909 16.130 1.00 8.67  ? 259 ASP A N   1 
ATOM 1900 C CA  . ASP A 1 259 ? -11.231 -31.805 17.528 1.00 10.42 ? 259 ASP A CA  1 
ATOM 1901 C C   . ASP A 1 259 ? -12.662 -32.383 17.732 1.00 8.54  ? 259 ASP A C   1 
ATOM 1902 O O   . ASP A 1 259 ? -13.597 -32.095 16.912 1.00 8.76  ? 259 ASP A O   1 
ATOM 1903 C CB  . ASP A 1 259 ? -11.317 -30.351 17.878 1.00 9.10  ? 259 ASP A CB  1 
ATOM 1904 C CG  . ASP A 1 259 ? -9.969  -29.689 18.068 1.00 12.10 ? 259 ASP A CG  1 
ATOM 1905 O OD1 . ASP A 1 259 ? -8.879  -30.401 18.197 1.00 13.25 ? 259 ASP A OD1 1 
ATOM 1906 O OD2 . ASP A 1 259 ? -9.913  -28.424 18.171 1.00 14.11 ? 259 ASP A OD2 1 
ATOM 1907 N N   . LYS A 1 260 ? -12.818 -33.196 18.747 1.00 7.47  ? 260 LYS A N   1 
ATOM 1908 C CA  . LYS A 1 260 ? -14.199 -33.738 18.976 1.00 8.19  ? 260 LYS A CA  1 
ATOM 1909 C C   . LYS A 1 260 ? -15.101 -32.580 19.481 1.00 8.74  ? 260 LYS A C   1 
ATOM 1910 O O   . LYS A 1 260 ? -14.681 -31.688 20.208 1.00 8.96  ? 260 LYS A O   1 
ATOM 1911 C CB  . LYS A 1 260 ? -14.147 -34.758 20.085 1.00 9.49  ? 260 LYS A CB  1 
ATOM 1912 C CG  . LYS A 1 260 ? -13.434 -36.069 19.603 1.00 11.90 ? 260 LYS A CG  1 
ATOM 1913 C CD  . LYS A 1 260 ? -13.483 -37.057 20.751 1.00 15.96 ? 260 LYS A CD  1 
ATOM 1914 C CE  . LYS A 1 260 ? -12.997 -38.463 20.304 1.00 25.22 ? 260 LYS A CE  1 
ATOM 1915 N NZ  . LYS A 1 260 ? -14.100 -38.896 19.433 1.00 31.43 ? 260 LYS A NZ  1 
ATOM 1916 N N   . PRO A 1 261 ? -16.349 -32.619 19.038 1.00 7.32  ? 261 PRO A N   1 
ATOM 1917 C CA  . PRO A 1 261 ? -17.216 -31.473 19.449 1.00 6.31  ? 261 PRO A CA  1 
ATOM 1918 C C   . PRO A 1 261 ? -17.815 -31.672 20.884 1.00 6.89  ? 261 PRO A C   1 
ATOM 1919 O O   . PRO A 1 261 ? -17.832 -32.786 21.477 1.00 8.64  ? 261 PRO A O   1 
ATOM 1920 C CB  . PRO A 1 261 ? -18.381 -31.542 18.460 1.00 8.28  ? 261 PRO A CB  1 
ATOM 1921 C CG  . PRO A 1 261 ? -18.434 -33.056 18.089 1.00 8.20  ? 261 PRO A CG  1 
ATOM 1922 C CD  . PRO A 1 261 ? -16.950 -33.477 18.025 1.00 6.76  ? 261 PRO A CD  1 
ATOM 1923 N N   . PHE A 1 262 ? -18.297 -30.528 21.378 1.00 6.78  ? 262 PHE A N   1 
ATOM 1924 C CA  . PHE A 1 262 ? -19.171 -30.480 22.553 1.00 6.45  ? 262 PHE A CA  1 
ATOM 1925 C C   . PHE A 1 262 ? -20.573 -30.483 22.010 1.00 7.03  ? 262 PHE A C   1 
ATOM 1926 O O   . PHE A 1 262 ? -20.867 -29.717 21.097 1.00 7.35  ? 262 PHE A O   1 
ATOM 1927 C CB  . PHE A 1 262 ? -18.883 -29.189 23.309 1.00 7.15  ? 262 PHE A CB  1 
ATOM 1928 C CG  . PHE A 1 262 ? -17.480 -29.116 23.806 1.00 7.48  ? 262 PHE A CG  1 
ATOM 1929 C CD1 . PHE A 1 262 ? -17.078 -29.705 24.986 1.00 7.28  ? 262 PHE A CD1 1 
ATOM 1930 C CD2 . PHE A 1 262 ? -16.515 -28.564 22.968 1.00 8.46  ? 262 PHE A CD2 1 
ATOM 1931 C CE1 . PHE A 1 262 ? -15.694 -29.718 25.432 1.00 8.43  ? 262 PHE A CE1 1 
ATOM 1932 C CE2 . PHE A 1 262 ? -15.131 -28.628 23.388 1.00 9.16  ? 262 PHE A CE2 1 
ATOM 1933 C CZ  . PHE A 1 262 ? -14.755 -29.175 24.576 1.00 8.14  ? 262 PHE A CZ  1 
ATOM 1934 N N   . VAL A 1 263 ? -21.446 -31.321 22.580 1.00 6.21  ? 263 VAL A N   1 
ATOM 1935 C CA  . VAL A 1 263 ? -22.826 -31.365 22.117 1.00 6.04  ? 263 VAL A CA  1 
ATOM 1936 C C   . VAL A 1 263 ? -23.749 -30.851 23.184 1.00 5.68  ? 263 VAL A C   1 
ATOM 1937 O O   . VAL A 1 263 ? -23.643 -31.293 24.350 1.00 7.47  ? 263 VAL A O   1 
ATOM 1938 C CB  . VAL A 1 263 ? -23.238 -32.788 21.748 1.00 6.87  ? 263 VAL A CB  1 
ATOM 1939 C CG1 . VAL A 1 263 ? -24.722 -32.839 21.260 1.00 8.46  ? 263 VAL A CG1 1 
ATOM 1940 C CG2 . VAL A 1 263 ? -22.423 -33.286 20.571 1.00 8.83  ? 263 VAL A CG2 1 
ATOM 1941 N N   . LEU A 1 264 ? -24.592 -29.867 22.866 1.00 5.61  ? 264 LEU A N   1 
ATOM 1942 C CA  . LEU A 1 264 ? -25.653 -29.405 23.808 1.00 4.74  ? 264 LEU A CA  1 
ATOM 1943 C C   . LEU A 1 264 ? -26.987 -29.874 23.250 1.00 6.45  ? 264 LEU A C   1 
ATOM 1944 O O   . LEU A 1 264 ? -27.325 -29.623 22.102 1.00 6.87  ? 264 LEU A O   1 
ATOM 1945 C CB  . LEU A 1 264 ? -25.662 -27.901 23.937 1.00 5.38  ? 264 LEU A CB  1 
ATOM 1946 C CG  . LEU A 1 264 ? -24.372 -27.286 24.383 1.00 7.58  ? 264 LEU A CG  1 
ATOM 1947 C CD1 . LEU A 1 264 ? -24.551 -25.699 24.323 1.00 9.17  ? 264 LEU A CD1 1 
ATOM 1948 C CD2 . LEU A 1 264 ? -23.960 -27.821 25.807 1.00 11.19 ? 264 LEU A CD2 1 
ATOM 1949 N N   . VAL A 1 265 ? -27.759 -30.590 24.128 1.00 5.32  ? 265 VAL A N   1 
ATOM 1950 C CA  . VAL A 1 265 ? -29.084 -31.119 23.767 1.00 6.12  ? 265 VAL A CA  1 
ATOM 1951 C C   . VAL A 1 265 ? -30.107 -30.325 24.558 1.00 6.02  ? 265 VAL A C   1 
ATOM 1952 O O   . VAL A 1 265 ? -30.037 -30.374 25.782 1.00 7.12  ? 265 VAL A O   1 
ATOM 1953 C CB  . VAL A 1 265 ? -29.169 -32.647 24.074 1.00 4.97  ? 265 VAL A CB  1 
ATOM 1954 C CG1 . VAL A 1 265 ? -30.581 -33.076 23.672 1.00 7.63  ? 265 VAL A CG1 1 
ATOM 1955 C CG2 . VAL A 1 265 ? -28.059 -33.356 23.243 1.00 6.98  ? 265 VAL A CG2 1 
ATOM 1956 N N   . GLY A 1 266 ? -31.064 -29.674 23.906 1.00 6.03  ? 266 GLY A N   1 
ATOM 1957 C CA  . GLY A 1 266 ? -32.047 -28.878 24.683 1.00 6.00  ? 266 GLY A CA  1 
ATOM 1958 C C   . GLY A 1 266 ? -33.437 -29.407 24.519 1.00 7.69  ? 266 GLY A C   1 
ATOM 1959 O O   . GLY A 1 266 ? -33.883 -29.661 23.377 1.00 6.51  ? 266 GLY A O   1 
ATOM 1960 N N   . LYS A 1 267 ? -34.131 -29.566 25.658 1.00 5.93  ? 267 LYS A N   1 
ATOM 1961 C CA  . LYS A 1 267 ? -35.591 -29.952 25.578 1.00 6.33  ? 267 LYS A CA  1 
ATOM 1962 C C   . LYS A 1 267 ? -36.362 -28.703 25.034 1.00 5.54  ? 267 LYS A C   1 
ATOM 1963 O O   . LYS A 1 267 ? -36.355 -27.633 25.668 1.00 6.78  ? 267 LYS A O   1 
ATOM 1964 C CB  . LYS A 1 267 ? -36.047 -30.281 27.030 1.00 5.21  ? 267 LYS A CB  1 
ATOM 1965 C CG  . LYS A 1 267 ? -37.554 -30.491 27.094 1.00 6.58  ? 267 LYS A CG  1 
ATOM 1966 C CD  . LYS A 1 267 ? -38.024 -30.875 28.546 1.00 5.40  ? 267 LYS A CD  1 
ATOM 1967 C CE  . LYS A 1 267 ? -39.579 -30.912 28.581 1.00 6.05  ? 267 LYS A CE  1 
ATOM 1968 N NZ  . LYS A 1 267 ? -40.052 -31.226 30.022 1.00 6.84  ? 267 LYS A NZ  1 
ATOM 1969 N N   . GLY A 1 268 ? -37.114 -28.938 23.990 1.00 5.33  ? 268 GLY A N   1 
ATOM 1970 C CA  . GLY A 1 268 ? -37.825 -27.866 23.364 1.00 7.53  ? 268 GLY A CA  1 
ATOM 1971 C C   . GLY A 1 268 ? -39.325 -28.202 23.288 1.00 6.41  ? 268 GLY A C   1 
ATOM 1972 O O   . GLY A 1 268 ? -39.940 -28.107 22.208 1.00 6.37  ? 268 GLY A O   1 
ATOM 1973 N N   . ILE A 1 269 ? -39.901 -28.500 24.447 1.00 6.54  ? 269 ILE A N   1 
ATOM 1974 C CA  . ILE A 1 269 ? -41.338 -28.716 24.461 1.00 6.26  ? 269 ILE A CA  1 
ATOM 1975 C C   . ILE A 1 269 ? -41.993 -27.339 24.537 1.00 6.12  ? 269 ILE A C   1 
ATOM 1976 O O   . ILE A 1 269 ? -41.940 -26.669 25.572 1.00 8.39  ? 269 ILE A O   1 
ATOM 1977 C CB  . ILE A 1 269 ? -41.760 -29.664 25.588 1.00 5.67  ? 269 ILE A CB  1 
ATOM 1978 C CG1 . ILE A 1 269 ? -41.109 -31.043 25.490 1.00 6.25  ? 269 ILE A CG1 1 
ATOM 1979 C CG2 . ILE A 1 269 ? -43.259 -29.741 25.687 1.00 5.80  ? 269 ILE A CG2 1 
ATOM 1980 C CD1 . ILE A 1 269 ? -41.577 -31.824 24.158 1.00 7.45  ? 269 ILE A CD1 1 
ATOM 1981 N N   . MET A 1 291 ? -39.698 -25.073 26.906 1.00 5.56  ? 291 MET A N   1 
ATOM 1982 C CA  . MET A 1 291 ? -38.683 -25.084 25.848 1.00 6.49  ? 291 MET A CA  1 
ATOM 1983 C C   . MET A 1 291 ? -37.472 -24.256 26.253 1.00 8.33  ? 291 MET A C   1 
ATOM 1984 O O   . MET A 1 291 ? -36.639 -23.950 25.383 1.00 6.85  ? 291 MET A O   1 
ATOM 1985 C CB  . MET A 1 291 ? -39.294 -24.657 24.464 1.00 6.34  ? 291 MET A CB  1 
ATOM 1986 C CG  . MET A 1 291 ? -38.318 -24.630 23.267 1.00 6.48  ? 291 MET A CG  1 
ATOM 1987 S SD  . MET A 1 291 ? -39.134 -24.383 21.661 1.00 7.91  ? 291 MET A SD  1 
ATOM 1988 C CE  . MET A 1 291 ? -37.691 -24.230 20.607 1.00 6.95  ? 291 MET A CE  1 
ATOM 1989 N N   . CYS A 1 292 ? -37.377 -23.899 27.529 1.00 6.57  ? 292 CYS A N   1 
ATOM 1990 C CA  . CYS A 1 292 ? -36.206 -23.078 27.996 1.00 6.92  ? 292 CYS A CA  1 
ATOM 1991 C C   . CYS A 1 292 ? -34.904 -23.836 27.926 1.00 8.49  ? 292 CYS A C   1 
ATOM 1992 O O   . CYS A 1 292 ? -33.859 -23.220 27.872 1.00 8.58  ? 292 CYS A O   1 
ATOM 1993 C CB  . CYS A 1 292 ? -36.414 -22.681 29.458 1.00 9.72  ? 292 CYS A CB  1 
ATOM 1994 S SG  . CYS A 1 292 ? -37.509 -21.205 29.583 1.00 11.92 ? 292 CYS A SG  1 
ATOM 1995 N N   . GLY A 1 293 ? -34.907 -25.203 27.904 1.00 7.75  ? 293 GLY A N   1 
ATOM 1996 C CA  . GLY A 1 293 ? -33.666 -25.974 27.600 1.00 7.44  ? 293 GLY A CA  1 
ATOM 1997 C C   . GLY A 1 293 ? -33.191 -25.652 26.236 1.00 7.70  ? 293 GLY A C   1 
ATOM 1998 O O   . GLY A 1 293 ? -32.012 -25.196 26.041 1.00 7.59  ? 293 GLY A O   1 
ATOM 1999 N N   . ALA A 1 294 ? -34.027 -25.872 25.250 1.00 6.55  ? 294 ALA A N   1 
ATOM 2000 C CA  . ALA A 1 294 ? -33.658 -25.434 23.897 1.00 7.42  ? 294 ALA A CA  1 
ATOM 2001 C C   . ALA A 1 294 ? -33.314 -23.953 23.824 1.00 6.15  ? 294 ALA A C   1 
ATOM 2002 O O   . ALA A 1 294 ? -32.385 -23.589 23.072 1.00 7.72  ? 294 ALA A O   1 
ATOM 2003 C CB  . ALA A 1 294 ? -34.810 -25.772 22.901 1.00 7.91  ? 294 ALA A CB  1 
ATOM 2004 N N   . ALA A 1 295 ? -34.085 -23.091 24.473 1.00 6.83  ? 295 ALA A N   1 
ATOM 2005 C CA  . ALA A 1 295 ? -33.771 -21.652 24.441 1.00 6.81  ? 295 ALA A CA  1 
ATOM 2006 C C   . ALA A 1 295 ? -32.407 -21.376 24.986 1.00 5.77  ? 295 ALA A C   1 
ATOM 2007 O O   . ALA A 1 295 ? -31.728 -20.482 24.432 1.00 7.31  ? 295 ALA A O   1 
ATOM 2008 C CB  . ALA A 1 295 ? -34.855 -20.877 25.293 1.00 7.26  ? 295 ALA A CB  1 
ATOM 2009 N N   . SER A 1 296 ? -32.016 -22.058 26.085 1.00 7.12  ? 296 SER A N   1 
ATOM 2010 C CA  . SER A 1 296 ? -30.677 -21.783 26.650 1.00 6.99  ? 296 SER A CA  1 
ATOM 2011 C C   . SER A 1 296 ? -29.576 -22.283 25.700 1.00 6.40  ? 296 SER A C   1 
ATOM 2012 O O   . SER A 1 296 ? -28.517 -21.713 25.712 1.00 7.02  ? 296 SER A O   1 
ATOM 2013 C CB  . SER A 1 296 ? -30.570 -22.422 28.062 1.00 9.19  ? 296 SER A CB  1 
ATOM 2014 O OG  . SER A 1 296 ? -30.472 -23.851 27.974 1.00 10.19 ? 296 SER A OG  1 
ATOM 2015 N N   . VAL A 1 297 ? -29.846 -23.300 24.912 1.00 6.02  ? 297 VAL A N   1 
ATOM 2016 C CA  . VAL A 1 297 ? -28.860 -23.769 23.887 1.00 5.11  ? 297 VAL A CA  1 
ATOM 2017 C C   . VAL A 1 297 ? -28.732 -22.677 22.822 1.00 7.71  ? 297 VAL A C   1 
ATOM 2018 O O   . VAL A 1 297 ? -27.615 -22.307 22.426 1.00 6.26  ? 297 VAL A O   1 
ATOM 2019 C CB  . VAL A 1 297 ? -29.235 -25.151 23.375 1.00 6.80  ? 297 VAL A CB  1 
ATOM 2020 C CG1 . VAL A 1 297 ? -28.275 -25.498 22.294 1.00 7.29  ? 297 VAL A CG1 1 
ATOM 2021 C CG2 . VAL A 1 297 ? -29.151 -26.130 24.545 1.00 8.35  ? 297 VAL A CG2 1 
ATOM 2022 N N   . PHE A 1 298 ? -29.870 -22.171 22.327 1.00 6.79  ? 298 PHE A N   1 
ATOM 2023 C CA  . PHE A 1 298 ? -29.768 -21.071 21.366 1.00 7.82  ? 298 PHE A CA  1 
ATOM 2024 C C   . PHE A 1 298 ? -28.987 -19.928 21.972 1.00 7.79  ? 298 PHE A C   1 
ATOM 2025 O O   . PHE A 1 298 ? -28.171 -19.290 21.274 1.00 7.81  ? 298 PHE A O   1 
ATOM 2026 C CB  . PHE A 1 298 ? -31.187 -20.499 21.046 1.00 7.44  ? 298 PHE A CB  1 
ATOM 2027 C CG  . PHE A 1 298 ? -31.907 -21.063 19.842 1.00 5.62  ? 298 PHE A CG  1 
ATOM 2028 C CD1 . PHE A 1 298 ? -33.132 -21.710 19.992 1.00 7.61  ? 298 PHE A CD1 1 
ATOM 2029 C CD2 . PHE A 1 298 ? -31.391 -20.808 18.553 1.00 10.88 ? 298 PHE A CD2 1 
ATOM 2030 C CE1 . PHE A 1 298 ? -33.813 -22.154 18.928 1.00 11.47 ? 298 PHE A CE1 1 
ATOM 2031 C CE2 . PHE A 1 298 ? -32.141 -21.275 17.425 1.00 11.04 ? 298 PHE A CE2 1 
ATOM 2032 C CZ  . PHE A 1 298 ? -33.334 -21.912 17.674 1.00 8.82  ? 298 PHE A CZ  1 
ATOM 2033 N N   . GLY A 1 299 ? -29.269 -19.536 23.214 1.00 6.78  ? 299 GLY A N   1 
ATOM 2034 C CA  . GLY A 1 299 ? -28.551 -18.411 23.833 1.00 5.18  ? 299 GLY A CA  1 
ATOM 2035 C C   . GLY A 1 299 ? -27.079 -18.665 24.018 1.00 6.51  ? 299 GLY A C   1 
ATOM 2036 O O   . GLY A 1 299 ? -26.270 -17.727 23.779 1.00 6.70  ? 299 GLY A O   1 
ATOM 2037 N N   . THR A 1 300 ? -26.714 -19.858 24.436 1.00 7.55  ? 300 THR A N   1 
ATOM 2038 C CA  . THR A 1 300 ? -25.265 -20.204 24.596 1.00 5.90  ? 300 THR A CA  1 
ATOM 2039 C C   . THR A 1 300 ? -24.617 -20.175 23.190 1.00 6.27  ? 300 THR A C   1 
ATOM 2040 O O   . THR A 1 300 ? -23.530 -19.576 23.105 1.00 6.38  ? 300 THR A O   1 
ATOM 2041 C CB  . THR A 1 300 ? -25.168 -21.592 25.192 1.00 6.84  ? 300 THR A CB  1 
ATOM 2042 O OG1 . THR A 1 300 ? -25.768 -21.573 26.506 1.00 8.23  ? 300 THR A OG1 1 
ATOM 2043 C CG2 . THR A 1 300 ? -23.727 -22.008 25.338 1.00 6.84  ? 300 THR A CG2 1 
ATOM 2044 N N   . LEU A 1 301 ? -25.271 -20.721 22.183 1.00 6.67  ? 301 LEU A N   1 
ATOM 2045 C CA  . LEU A 1 301 ? -24.685 -20.640 20.810 1.00 7.12  ? 301 LEU A CA  1 
ATOM 2046 C C   . LEU A 1 301 ? -24.520 -19.194 20.436 1.00 7.34  ? 301 LEU A C   1 
ATOM 2047 O O   . LEU A 1 301 ? -23.490 -18.854 19.868 1.00 7.89  ? 301 LEU A O   1 
ATOM 2048 C CB  . LEU A 1 301 ? -25.604 -21.430 19.838 1.00 7.15  ? 301 LEU A CB  1 
ATOM 2049 C CG  . LEU A 1 301 ? -25.198 -21.202 18.364 1.00 7.48  ? 301 LEU A CG  1 
ATOM 2050 C CD1 . LEU A 1 301 ? -23.809 -21.880 18.136 1.00 8.40  ? 301 LEU A CD1 1 
ATOM 2051 C CD2 . LEU A 1 301 ? -26.245 -21.975 17.612 1.00 8.32  ? 301 LEU A CD2 1 
ATOM 2052 N N   . ARG A 1 302 ? -25.544 -18.319 20.661 1.00 7.18  ? 302 ARG A N   1 
ATOM 2053 C CA  . ARG A 1 302 ? -25.375 -16.911 20.280 1.00 7.21  ? 302 ARG A CA  1 
ATOM 2054 C C   . ARG A 1 302 ? -24.149 -16.290 21.016 1.00 7.74  ? 302 ARG A C   1 
ATOM 2055 O O   . ARG A 1 302 ? -23.387 -15.529 20.384 1.00 8.38  ? 302 ARG A O   1 
ATOM 2056 C CB  . ARG A 1 302 ? -26.690 -16.158 20.633 1.00 8.35  ? 302 ARG A CB  1 
ATOM 2057 C CG  . ARG A 1 302 ? -26.528 -14.666 20.523 1.00 14.76 ? 302 ARG A CG  1 
ATOM 2058 C CD  . ARG A 1 302 ? -27.765 -13.848 20.313 1.00 18.44 ? 302 ARG A CD  1 
ATOM 2059 N NE  . ARG A 1 302 ? -28.223 -14.030 18.911 1.00 20.59 ? 302 ARG A NE  1 
ATOM 2060 C CZ  . ARG A 1 302 ? -29.417 -13.614 18.426 1.00 25.79 ? 302 ARG A CZ  1 
ATOM 2061 N NH1 . ARG A 1 302 ? -30.268 -12.909 19.176 1.00 21.23 ? 302 ARG A NH1 1 
ATOM 2062 N NH2 . ARG A 1 302 ? -29.748 -13.843 17.151 1.00 24.35 ? 302 ARG A NH2 1 
ATOM 2063 N N   . ALA A 1 303 ? -23.894 -16.589 22.284 1.00 6.78  ? 303 ALA A N   1 
ATOM 2064 C CA  . ALA A 1 303 ? -22.720 -16.120 23.012 1.00 5.36  ? 303 ALA A CA  1 
ATOM 2065 C C   . ALA A 1 303 ? -21.447 -16.646 22.394 1.00 7.61  ? 303 ALA A C   1 
ATOM 2066 O O   . ALA A 1 303 ? -20.476 -15.890 22.248 1.00 7.82  ? 303 ALA A O   1 
ATOM 2067 C CB  . ALA A 1 303 ? -22.802 -16.509 24.502 1.00 6.21  ? 303 ALA A CB  1 
ATOM 2068 N N   . VAL A 1 304 ? -21.414 -17.930 22.043 1.00 7.53  ? 304 VAL A N   1 
ATOM 2069 C CA  . VAL A 1 304 ? -20.190 -18.569 21.461 1.00 6.69  ? 304 VAL A CA  1 
ATOM 2070 C C   . VAL A 1 304 ? -19.895 -17.910 20.099 1.00 8.65  ? 304 VAL A C   1 
ATOM 2071 O O   . VAL A 1 304 ? -18.742 -17.691 19.788 1.00 8.80  ? 304 VAL A O   1 
ATOM 2072 C CB  . VAL A 1 304 ? -20.506 -20.075 21.294 1.00 4.86  ? 304 VAL A CB  1 
ATOM 2073 C CG1 . VAL A 1 304 ? -19.490 -20.739 20.406 1.00 9.39  ? 304 VAL A CG1 1 
ATOM 2074 C CG2 . VAL A 1 304 ? -20.486 -20.703 22.680 1.00 8.22  ? 304 VAL A CG2 1 
ATOM 2075 N N   . LEU A 1 305 ? -20.953 -17.628 19.324 1.00 8.00  ? 305 LEU A N   1 
ATOM 2076 C CA  . LEU A 1 305 ? -20.736 -16.936 17.987 1.00 8.12  ? 305 LEU A CA  1 
ATOM 2077 C C   . LEU A 1 305 ? -20.189 -15.556 18.262 1.00 10.47 ? 305 LEU A C   1 
ATOM 2078 O O   . LEU A 1 305 ? -19.256 -15.165 17.452 1.00 11.41 ? 305 LEU A O   1 
ATOM 2079 C CB  . LEU A 1 305 ? -22.055 -16.877 17.269 1.00 9.18  ? 305 LEU A CB  1 
ATOM 2080 C CG  . LEU A 1 305 ? -22.585 -18.221 16.839 1.00 8.40  ? 305 LEU A CG  1 
ATOM 2081 C CD1 . LEU A 1 305 ? -24.023 -18.189 16.298 1.00 10.78 ? 305 LEU A CD1 1 
ATOM 2082 C CD2 . LEU A 1 305 ? -21.789 -18.773 15.647 1.00 12.68 ? 305 LEU A CD2 1 
ATOM 2083 N N   . GLU A 1 306 ? -20.701 -14.820 19.251 1.00 8.75  ? 306 GLU A N   1 
ATOM 2084 C CA  . GLU A 1 306 ? -20.160 -13.525 19.494 1.00 9.66  ? 306 GLU A CA  1 
ATOM 2085 C C   . GLU A 1 306 ? -18.706 -13.537 19.853 1.00 11.78 ? 306 GLU A C   1 
ATOM 2086 O O   . GLU A 1 306 ? -17.920 -12.697 19.336 1.00 13.33 ? 306 GLU A O   1 
ATOM 2087 C CB  . GLU A 1 306 ? -21.014 -12.822 20.550 1.00 10.52 ? 306 GLU A CB  1 
ATOM 2088 C CG  . GLU A 1 306 ? -20.494 -11.418 20.764 1.00 12.91 ? 306 GLU A CG  1 
ATOM 2089 C CD  . GLU A 1 306 ? -21.390 -10.690 21.796 1.00 23.87 ? 306 GLU A CD  1 
ATOM 2090 O OE1 . GLU A 1 306 ? -22.348 -11.353 22.311 1.00 25.97 ? 306 GLU A OE1 1 
ATOM 2091 O OE2 . GLU A 1 306 ? -21.166 -9.491  22.097 1.00 18.06 ? 306 GLU A OE2 1 
ATOM 2092 N N   . LEU A 1 307 ? -18.317 -14.504 20.628 1.00 8.88  ? 307 LEU A N   1 
ATOM 2093 C CA  . LEU A 1 307 ? -16.919 -14.661 21.144 1.00 9.42  ? 307 LEU A CA  1 
ATOM 2094 C C   . LEU A 1 307 ? -16.041 -15.340 20.147 1.00 11.14 ? 307 LEU A C   1 
ATOM 2095 O O   . LEU A 1 307 ? -14.840 -15.345 20.360 1.00 12.96 ? 307 LEU A O   1 
ATOM 2096 C CB  . LEU A 1 307 ? -16.978 -15.459 22.419 1.00 9.10  ? 307 LEU A CB  1 
ATOM 2097 C CG  . LEU A 1 307 ? -17.700 -14.702 23.572 1.00 9.35  ? 307 LEU A CG  1 
ATOM 2098 C CD1 . LEU A 1 307 ? -17.759 -15.612 24.697 1.00 14.05 ? 307 LEU A CD1 1 
ATOM 2099 C CD2 . LEU A 1 307 ? -16.969 -13.382 23.858 1.00 15.11 ? 307 LEU A CD2 1 
ATOM 2100 N N   . GLN A 1 308 ? -16.619 -15.959 19.118 1.00 10.41 ? 308 GLN A N   1 
ATOM 2101 C CA  . GLN A 1 308 ? -15.871 -16.760 18.112 1.00 10.65 ? 308 GLN A CA  1 
ATOM 2102 C C   . GLN A 1 308 ? -14.969 -17.736 18.823 1.00 11.14 ? 308 GLN A C   1 
ATOM 2103 O O   . GLN A 1 308 ? -13.774 -17.891 18.495 1.00 12.65 ? 308 GLN A O   1 
ATOM 2104 C CB  . GLN A 1 308 ? -15.058 -15.843 17.119 1.00 13.36 ? 308 GLN A CB  1 
ATOM 2105 C CG  . GLN A 1 308 ? -15.968 -14.984 16.188 1.00 17.76 ? 308 GLN A CG  1 
ATOM 2106 C CD  . GLN A 1 308 ? -15.067 -14.064 15.306 1.00 28.50 ? 308 GLN A CD  1 
ATOM 2107 O OE1 . GLN A 1 308 ? -13.934 -13.741 15.693 1.00 38.00 ? 308 GLN A OE1 1 
ATOM 2108 N NE2 . GLN A 1 308 ? -15.614 -13.551 14.185 1.00 34.17 ? 308 GLN A NE2 1 
ATOM 2109 N N   . LEU A 1 309 ? -15.545 -18.497 19.792 1.00 10.63 ? 309 LEU A N   1 
ATOM 2110 C CA  . LEU A 1 309 ? -14.712 -19.464 20.500 1.00 11.35 ? 309 LEU A CA  1 
ATOM 2111 C C   . LEU A 1 309 ? -14.180 -20.540 19.545 1.00 9.50  ? 309 LEU A C   1 
ATOM 2112 O O   . LEU A 1 309 ? -14.946 -21.039 18.724 1.00 10.28 ? 309 LEU A O   1 
ATOM 2113 C CB  . LEU A 1 309 ? -15.448 -20.122 21.730 1.00 9.36  ? 309 LEU A CB  1 
ATOM 2114 C CG  . LEU A 1 309 ? -15.906 -19.219 22.818 1.00 11.33 ? 309 LEU A CG  1 
ATOM 2115 C CD1 . LEU A 1 309 ? -16.481 -20.121 23.913 1.00 12.37 ? 309 LEU A CD1 1 
ATOM 2116 C CD2 . LEU A 1 309 ? -14.789 -18.371 23.441 1.00 13.56 ? 309 LEU A CD2 1 
ATOM 2117 N N   . PRO A 1 310 ? -12.983 -21.027 19.817 1.00 10.51 ? 310 PRO A N   1 
ATOM 2118 C CA  . PRO A 1 310 ? -12.361 -22.012 18.902 1.00 10.92 ? 310 PRO A CA  1 
ATOM 2119 C C   . PRO A 1 310 ? -12.689 -23.382 19.353 1.00 11.02 ? 310 PRO A C   1 
ATOM 2120 O O   . PRO A 1 310 ? -11.792 -24.178 19.706 1.00 13.35 ? 310 PRO A O   1 
ATOM 2121 C CB  . PRO A 1 310 ? -10.849 -21.669 19.004 1.00 13.23 ? 310 PRO A CB  1 
ATOM 2122 C CG  . PRO A 1 310 ? -10.735 -21.103 20.511 1.00 13.76 ? 310 PRO A CG  1 
ATOM 2123 C CD  . PRO A 1 310 ? -12.239 -21.273 20.887 1.00 11.04 ? 310 PRO A CD  1 
ATOM 2124 N N   . VAL A 1 311 ? -13.995 -23.713 19.311 1.00 10.75 ? 311 VAL A N   1 
ATOM 2125 C CA  . VAL A 1 311 ? -14.482 -25.100 19.635 1.00 9.05  ? 311 VAL A CA  1 
ATOM 2126 C C   . VAL A 1 311 ? -15.444 -25.475 18.569 1.00 6.93  ? 311 VAL A C   1 
ATOM 2127 O O   . VAL A 1 311 ? -16.065 -24.679 17.892 1.00 9.26  ? 311 VAL A O   1 
ATOM 2128 C CB  . VAL A 1 311 ? -15.231 -25.153 21.030 1.00 8.97  ? 311 VAL A CB  1 
ATOM 2129 C CG1 . VAL A 1 311 ? -14.178 -24.801 22.136 1.00 11.69 ? 311 VAL A CG1 1 
ATOM 2130 C CG2 . VAL A 1 311 ? -16.409 -24.229 21.064 1.00 11.06 ? 311 VAL A CG2 1 
ATOM 2131 N N   . ASN A 1 312 ? -15.621 -26.791 18.480 1.00 7.06  ? 312 ASN A N   1 
ATOM 2132 C CA  . ASN A 1 312 ? -16.689 -27.365 17.655 1.00 6.78  ? 312 ASN A CA  1 
ATOM 2133 C C   . ASN A 1 312 ? -17.887 -27.649 18.585 1.00 6.95  ? 312 ASN A C   1 
ATOM 2134 O O   . ASN A 1 312 ? -17.710 -28.336 19.606 1.00 8.40  ? 312 ASN A O   1 
ATOM 2135 C CB  . ASN A 1 312 ? -16.233 -28.688 16.946 1.00 7.42  ? 312 ASN A CB  1 
ATOM 2136 C CG  . ASN A 1 312 ? -15.083 -28.451 15.992 1.00 9.11  ? 312 ASN A CG  1 
ATOM 2137 O OD1 . ASN A 1 312 ? -14.204 -29.375 15.826 1.00 12.82 ? 312 ASN A OD1 1 
ATOM 2138 N ND2 . ASN A 1 312 ? -15.082 -27.382 15.375 1.00 6.37  ? 312 ASN A ND2 1 
ATOM 2139 N N   . LEU A 1 313 ? -18.987 -26.983 18.301 1.00 7.85  ? 313 LEU A N   1 
ATOM 2140 C CA  . LEU A 1 313 ? -20.237 -27.086 19.148 1.00 7.21  ? 313 LEU A CA  1 
ATOM 2141 C C   . LEU A 1 313 ? -21.379 -27.487 18.337 1.00 6.81  ? 313 LEU A C   1 
ATOM 2142 O O   . LEU A 1 313 ? -21.734 -26.810 17.315 1.00 9.20  ? 313 LEU A O   1 
ATOM 2143 C CB  . LEU A 1 313 ? -20.490 -25.652 19.698 1.00 8.42  ? 313 LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 313 ? -21.785 -25.535 20.532 1.00 7.52  ? 313 LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 313 ? -21.607 -26.316 21.834 1.00 11.41 ? 313 LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 313 ? -21.991 -24.080 20.954 1.00 10.05 ? 313 LEU A CD2 1 
ATOM 2147 N N   . VAL A 1 314 ? -21.999 -28.664 18.636 1.00 6.06  ? 314 VAL A N   1 
ATOM 2148 C CA  . VAL A 1 314 ? -23.192 -29.154 17.912 1.00 4.90  ? 314 VAL A CA  1 
ATOM 2149 C C   . VAL A 1 314 ? -24.343 -28.995 18.901 1.00 6.87  ? 314 VAL A C   1 
ATOM 2150 O O   . VAL A 1 314 ? -24.304 -29.522 20.039 1.00 8.32  ? 314 VAL A O   1 
ATOM 2151 C CB  . VAL A 1 314 ? -23.026 -30.589 17.493 1.00 6.15  ? 314 VAL A CB  1 
ATOM 2152 C CG1 . VAL A 1 314 ? -24.311 -31.096 16.818 1.00 10.82 ? 314 VAL A CG1 1 
ATOM 2153 C CG2 . VAL A 1 314 ? -21.835 -30.737 16.495 1.00 7.79  ? 314 VAL A CG2 1 
ATOM 2154 N N   . CYS A 1 315 ? -25.366 -28.272 18.441 1.00 5.72  ? 315 CYS A N   1 
ATOM 2155 C CA  . CYS A 1 315 ? -26.571 -28.045 19.216 1.00 6.79  ? 315 CYS A CA  1 
ATOM 2156 C C   . CYS A 1 315 ? -27.698 -28.825 18.631 1.00 6.37  ? 315 CYS A C   1 
ATOM 2157 O O   . CYS A 1 315 ? -27.932 -28.854 17.426 1.00 7.51  ? 315 CYS A O   1 
ATOM 2158 C CB  . CYS A 1 315 ? -26.933 -26.583 19.214 1.00 6.46  ? 315 CYS A CB  1 
ATOM 2159 S SG  . CYS A 1 315 ? -25.652 -25.513 19.850 1.00 9.41  ? 315 CYS A SG  1 
ATOM 2160 N N   . LEU A 1 316 ? -28.403 -29.571 19.525 1.00 5.75  ? 316 LEU A N   1 
ATOM 2161 C CA  . LEU A 1 316 ? -29.538 -30.451 19.053 1.00 6.05  ? 316 LEU A CA  1 
ATOM 2162 C C   . LEU A 1 316 ? -30.748 -30.001 19.832 1.00 8.00  ? 316 LEU A C   1 
ATOM 2163 O O   . LEU A 1 316 ? -30.755 -30.107 21.058 1.00 6.79  ? 316 LEU A O   1 
ATOM 2164 C CB  . LEU A 1 316 ? -29.270 -31.927 19.306 1.00 7.66  ? 316 LEU A CB  1 
ATOM 2165 C CG  . LEU A 1 316 ? -27.938 -32.433 18.715 1.00 7.86  ? 316 LEU A CG  1 
ATOM 2166 C CD1 . LEU A 1 316 ? -27.711 -33.885 19.136 1.00 9.36  ? 316 LEU A CD1 1 
ATOM 2167 C CD2 . LEU A 1 316 ? -28.068 -32.376 17.183 1.00 9.08  ? 316 LEU A CD2 1 
ATOM 2168 N N   . LEU A 1 317 ? -31.729 -29.452 19.164 1.00 5.40  ? 317 LEU A N   1 
ATOM 2169 C CA  . LEU A 1 317 ? -32.951 -28.950 19.852 1.00 7.60  ? 317 LEU A CA  1 
ATOM 2170 C C   . LEU A 1 317 ? -34.081 -29.922 19.566 1.00 7.25  ? 317 LEU A C   1 
ATOM 2171 O O   . LEU A 1 317 ? -34.524 -30.078 18.465 1.00 6.95  ? 317 LEU A O   1 
ATOM 2172 C CB  . LEU A 1 317 ? -33.322 -27.566 19.363 1.00 7.10  ? 317 LEU A CB  1 
ATOM 2173 C CG  . LEU A 1 317 ? -32.123 -26.568 19.298 1.00 7.61  ? 317 LEU A CG  1 
ATOM 2174 C CD1 . LEU A 1 317 ? -32.682 -25.192 18.918 1.00 9.37  ? 317 LEU A CD1 1 
ATOM 2175 C CD2 . LEU A 1 317 ? -31.380 -26.472 20.661 1.00 8.17  ? 317 LEU A CD2 1 
ATOM 2176 N N   . ALA A 1 318 ? -34.568 -30.596 20.620 1.00 5.91  ? 318 ALA A N   1 
ATOM 2177 C CA  . ALA A 1 318 ? -35.632 -31.610 20.488 1.00 6.93  ? 318 ALA A CA  1 
ATOM 2178 C C   . ALA A 1 318 ? -36.976 -30.963 20.740 1.00 6.23  ? 318 ALA A C   1 
ATOM 2179 O O   . ALA A 1 318 ? -37.373 -30.824 21.864 1.00 6.81  ? 318 ALA A O   1 
ATOM 2180 C CB  . ALA A 1 318 ? -35.409 -32.719 21.523 1.00 7.22  ? 318 ALA A CB  1 
ATOM 2181 N N   . CYS A 1 319 ? -37.669 -30.584 19.700 1.00 5.74  ? 319 CYS A N   1 
ATOM 2182 C CA  . CYS A 1 319 ? -38.872 -29.702 19.848 1.00 5.61  ? 319 CYS A CA  1 
ATOM 2183 C C   . CYS A 1 319 ? -40.160 -30.415 19.437 1.00 6.12  ? 319 CYS A C   1 
ATOM 2184 O O   . CYS A 1 319 ? -40.267 -31.097 18.420 1.00 6.65  ? 319 CYS A O   1 
ATOM 2185 C CB  . CYS A 1 319 ? -38.737 -28.514 18.911 1.00 5.77  ? 319 CYS A CB  1 
ATOM 2186 S SG  . CYS A 1 319 ? -37.204 -27.539 19.249 1.00 8.33  ? 319 CYS A SG  1 
ATOM 2187 N N   . ALA A 1 320 ? -41.154 -30.229 20.330 1.00 5.59  ? 320 ALA A N   1 
ATOM 2188 C CA  . ALA A 1 320 ? -42.472 -30.844 20.066 1.00 4.70  ? 320 ALA A CA  1 
ATOM 2189 C C   . ALA A 1 320 ? -43.482 -30.071 20.974 1.00 6.13  ? 320 ALA A C   1 
ATOM 2190 O O   . ALA A 1 320 ? -43.051 -29.355 21.871 1.00 6.18  ? 320 ALA A O   1 
ATOM 2191 C CB  . ALA A 1 320 ? -42.458 -32.400 20.481 1.00 5.07  ? 320 ALA A CB  1 
ATOM 2192 N N   . GLU A 1 321 ? -44.786 -30.268 20.707 1.00 7.44  ? 321 GLU A N   1 
ATOM 2193 C CA  . GLU A 1 321 ? -45.846 -29.650 21.501 1.00 6.55  ? 321 GLU A CA  1 
ATOM 2194 C C   . GLU A 1 321 ? -46.664 -30.782 22.022 1.00 5.90  ? 321 GLU A C   1 
ATOM 2195 O O   . GLU A 1 321 ? -47.068 -31.654 21.257 1.00 7.82  ? 321 GLU A O   1 
ATOM 2196 C CB  . GLU A 1 321 ? -46.686 -28.729 20.624 1.00 7.52  ? 321 GLU A CB  1 
ATOM 2197 C CG  . GLU A 1 321 ? -47.766 -28.007 21.457 1.00 9.19  ? 321 GLU A CG  1 
ATOM 2198 C CD  . GLU A 1 321 ? -48.556 -27.068 20.598 1.00 9.18  ? 321 GLU A CD  1 
ATOM 2199 O OE1 . GLU A 1 321 ? -48.337 -26.968 19.372 1.00 10.43 ? 321 GLU A OE1 1 
ATOM 2200 O OE2 . GLU A 1 321 ? -49.484 -26.445 21.144 1.00 8.47  ? 321 GLU A OE2 1 
ATOM 2201 N N   . ASN A 1 322 ? -46.823 -30.875 23.340 1.00 5.87  ? 322 ASN A N   1 
ATOM 2202 C CA  . ASN A 1 322 ? -47.501 -32.036 23.968 1.00 5.87  ? 322 ASN A CA  1 
ATOM 2203 C C   . ASN A 1 322 ? -49.006 -31.720 24.258 1.00 5.64  ? 322 ASN A C   1 
ATOM 2204 O O   . ASN A 1 322 ? -49.316 -30.919 25.170 1.00 6.35  ? 322 ASN A O   1 
ATOM 2205 C CB  . ASN A 1 322 ? -46.804 -32.327 25.315 1.00 6.69  ? 322 ASN A CB  1 
ATOM 2206 C CG  . ASN A 1 322 ? -47.243 -33.697 25.917 1.00 6.92  ? 322 ASN A CG  1 
ATOM 2207 O OD1 . ASN A 1 322 ? -47.793 -34.586 25.230 1.00 8.62  ? 322 ASN A OD1 1 
ATOM 2208 N ND2 . ASN A 1 322 ? -46.950 -33.908 27.220 1.00 7.01  ? 322 ASN A ND2 1 
ATOM 2209 N N   . MET A 1 323 ? -49.893 -32.216 23.386 1.00 6.54  ? 323 MET A N   1 
ATOM 2210 C CA  . MET A 1 323 ? -51.318 -31.845 23.441 1.00 6.92  ? 323 MET A CA  1 
ATOM 2211 C C   . MET A 1 323 ? -52.184 -33.083 23.529 1.00 6.99  ? 323 MET A C   1 
ATOM 2212 O O   . MET A 1 323 ? -51.824 -34.173 23.035 1.00 6.91  ? 323 MET A O   1 
ATOM 2213 C CB  . MET A 1 323 ? -51.643 -31.219 22.087 1.00 6.07  ? 323 MET A CB  1 
ATOM 2214 C CG  . MET A 1 323 ? -50.878 -29.904 21.822 1.00 7.45  ? 323 MET A CG  1 
ATOM 2215 S SD  . MET A 1 323 ? -51.455 -28.490 22.872 1.00 8.26  ? 323 MET A SD  1 
ATOM 2216 C CE  . MET A 1 323 ? -52.893 -27.827 21.994 1.00 10.49 ? 323 MET A CE  1 
ATOM 2217 N N   . PRO A 1 324 ? -53.378 -32.996 24.136 1.00 6.68  ? 324 PRO A N   1 
ATOM 2218 C CA  . PRO A 1 324 ? -54.362 -34.125 24.132 1.00 6.74  ? 324 PRO A CA  1 
ATOM 2219 C C   . PRO A 1 324 ? -55.168 -34.031 22.818 1.00 7.01  ? 324 PRO A C   1 
ATOM 2220 O O   . PRO A 1 324 ? -55.476 -32.946 22.357 1.00 9.62  ? 324 PRO A O   1 
ATOM 2221 C CB  . PRO A 1 324 ? -55.247 -33.786 25.381 1.00 8.52  ? 324 PRO A CB  1 
ATOM 2222 C CG  . PRO A 1 324 ? -55.330 -32.246 25.321 1.00 8.06  ? 324 PRO A CG  1 
ATOM 2223 C CD  . PRO A 1 324 ? -53.910 -31.764 24.816 1.00 8.61  ? 324 PRO A CD  1 
ATOM 2224 N N   . SER A 1 325 ? -55.522 -35.188 22.274 1.00 6.23  ? 325 SER A N   1 
ATOM 2225 C CA  . SER A 1 325 ? -56.360 -35.235 21.070 1.00 7.19  ? 325 SER A CA  1 
ATOM 2226 C C   . SER A 1 325 ? -56.723 -36.695 20.805 1.00 7.98  ? 325 SER A C   1 
ATOM 2227 O O   . SER A 1 325 ? -56.305 -37.623 21.466 1.00 7.31  ? 325 SER A O   1 
ATOM 2228 C CB  . SER A 1 325 ? -55.557 -34.685 19.899 1.00 7.99  ? 325 SER A CB  1 
ATOM 2229 O OG  . SER A 1 325 ? -54.616 -35.674 19.422 1.00 10.12 ? 325 SER A OG  1 
ATOM 2230 N N   . GLY A 1 326 ? -57.450 -36.871 19.700 1.00 8.06  ? 326 GLY A N   1 
ATOM 2231 C CA  . GLY A 1 326 ? -57.915 -38.278 19.382 1.00 8.38  ? 326 GLY A CA  1 
ATOM 2232 C C   . GLY A 1 326 ? -56.849 -39.123 18.733 1.00 8.39  ? 326 GLY A C   1 
ATOM 2233 O O   . GLY A 1 326 ? -57.088 -40.317 18.559 1.00 8.48  ? 326 GLY A O   1 
ATOM 2234 N N   . GLY A 1 327 ? -55.689 -38.515 18.470 1.00 8.87  ? 327 GLY A N   1 
ATOM 2235 C CA  . GLY A 1 327 ? -54.541 -39.278 17.956 1.00 9.00  ? 327 GLY A CA  1 
ATOM 2236 C C   . GLY A 1 327 ? -53.304 -39.179 18.875 1.00 9.43  ? 327 GLY A C   1 
ATOM 2237 O O   . GLY A 1 327 ? -52.228 -39.526 18.454 1.00 10.98 ? 327 GLY A O   1 
ATOM 2238 N N   . ALA A 1 328 ? -53.474 -38.697 20.103 1.00 7.09  ? 328 ALA A N   1 
ATOM 2239 C CA  . ALA A 1 328 ? -52.368 -38.579 21.002 1.00 6.12  ? 328 ALA A CA  1 
ATOM 2240 C C   . ALA A 1 328 ? -51.907 -39.912 21.543 1.00 7.09  ? 328 ALA A C   1 
ATOM 2241 O O   . ALA A 1 328 ? -52.681 -40.883 21.683 1.00 8.50  ? 328 ALA A O   1 
ATOM 2242 C CB  . ALA A 1 328 ? -52.767 -37.646 22.176 1.00 8.58  ? 328 ALA A CB  1 
ATOM 2243 N N   . THR A 1 329 ? -50.666 -39.948 21.994 1.00 5.80  ? 329 THR A N   1 
ATOM 2244 C CA  . THR A 1 329 ? -50.172 -41.134 22.737 1.00 7.69  ? 329 THR A CA  1 
ATOM 2245 C C   . THR A 1 329 ? -50.965 -41.348 24.055 1.00 5.37  ? 329 THR A C   1 
ATOM 2246 O O   . THR A 1 329 ? -51.413 -40.417 24.756 1.00 6.26  ? 329 THR A O   1 
ATOM 2247 C CB  . THR A 1 329 ? -48.704 -40.855 23.106 1.00 8.95  ? 329 THR A CB  1 
ATOM 2248 O OG1 . THR A 1 329 ? -48.039 -40.915 21.860 1.00 10.71 ? 329 THR A OG1 1 
ATOM 2249 C CG2 . THR A 1 329 ? -48.069 -41.911 24.020 1.00 9.19  ? 329 THR A CG2 1 
ATOM 2250 N N   . ARG A 1 330 ? -51.168 -42.615 24.403 1.00 5.42  ? 330 ARG A N   1 
ATOM 2251 C CA  . ARG A 1 330 ? -51.954 -42.953 25.594 1.00 5.69  ? 330 ARG A CA  1 
ATOM 2252 C C   . ARG A 1 330 ? -51.189 -43.783 26.624 1.00 6.56  ? 330 ARG A C   1 
ATOM 2253 O O   . ARG A 1 330 ? -50.516 -44.751 26.267 1.00 7.53  ? 330 ARG A O   1 
ATOM 2254 C CB  . ARG A 1 330 ? -53.241 -43.678 25.192 1.00 6.95  ? 330 ARG A CB  1 
ATOM 2255 C CG  . ARG A 1 330 ? -53.880 -43.151 23.918 1.00 6.37  ? 330 ARG A CG  1 
ATOM 2256 C CD  . ARG A 1 330 ? -54.393 -44.286 23.047 1.00 7.13  ? 330 ARG A CD  1 
ATOM 2257 N NE  . ARG A 1 330 ? -53.331 -44.881 22.241 1.00 8.25  ? 330 ARG A NE  1 
ATOM 2258 C CZ  . ARG A 1 330 ? -53.039 -44.510 20.998 1.00 7.78  ? 330 ARG A CZ  1 
ATOM 2259 N NH1 . ARG A 1 330 ? -53.731 -43.542 20.414 1.00 9.24  ? 330 ARG A NH1 1 
ATOM 2260 N NH2 . ARG A 1 330 ? -52.055 -45.107 20.340 1.00 8.64  ? 330 ARG A NH2 1 
ATOM 2261 N N   . PRO A 1 331 ? -51.290 -43.411 27.900 1.00 6.16  ? 331 PRO A N   1 
ATOM 2262 C CA  . PRO A 1 331 ? -50.601 -44.159 28.934 1.00 6.90  ? 331 PRO A CA  1 
ATOM 2263 C C   . PRO A 1 331 ? -50.747 -45.675 28.658 1.00 6.82  ? 331 PRO A C   1 
ATOM 2264 O O   . PRO A 1 331 ? -51.799 -46.192 28.294 1.00 7.61  ? 331 PRO A O   1 
ATOM 2265 C CB  . PRO A 1 331 ? -51.425 -43.791 30.189 1.00 7.67  ? 331 PRO A CB  1 
ATOM 2266 C CG  . PRO A 1 331 ? -51.945 -42.421 29.874 1.00 7.87  ? 331 PRO A CG  1 
ATOM 2267 C CD  . PRO A 1 331 ? -51.391 -42.117 28.494 1.00 6.13  ? 331 PRO A CD  1 
ATOM 2268 N N   . GLY A 1 332 ? -49.568 -46.385 28.763 1.00 5.89  ? 332 GLY A N   1 
ATOM 2269 C CA  . GLY A 1 332 ? -49.551 -47.792 28.369 1.00 4.79  ? 332 GLY A CA  1 
ATOM 2270 C C   . GLY A 1 332 ? -49.038 -48.052 26.977 1.00 7.21  ? 332 GLY A C   1 
ATOM 2271 O O   . GLY A 1 332 ? -48.661 -49.218 26.662 1.00 8.03  ? 332 GLY A O   1 
ATOM 2272 N N   . ASP A 1 333 ? -48.885 -47.030 26.131 1.00 5.74  ? 333 ASP A N   1 
ATOM 2273 C CA  . ASP A 1 333 ? -48.299 -47.275 24.819 1.00 6.02  ? 333 ASP A CA  1 
ATOM 2274 C C   . ASP A 1 333 ? -46.865 -47.784 24.961 1.00 5.41  ? 333 ASP A C   1 
ATOM 2275 O O   . ASP A 1 333 ? -46.201 -47.357 25.918 1.00 7.28  ? 333 ASP A O   1 
ATOM 2276 C CB  . ASP A 1 333 ? -48.280 -45.991 23.967 1.00 6.49  ? 333 ASP A CB  1 
ATOM 2277 C CG  . ASP A 1 333 ? -49.653 -45.643 23.335 1.00 8.03  ? 333 ASP A CG  1 
ATOM 2278 O OD1 . ASP A 1 333 ? -50.635 -46.354 23.521 1.00 7.11  ? 333 ASP A OD1 1 
ATOM 2279 O OD2 . ASP A 1 333 ? -49.641 -44.569 22.656 1.00 7.08  ? 333 ASP A OD2 1 
ATOM 2280 N N   . ILE A 1 334 ? -46.456 -48.614 24.037 1.00 5.55  ? 334 ILE A N   1 
ATOM 2281 C CA  . ILE A 1 334 ? -45.011 -49.098 24.067 1.00 5.96  ? 334 ILE A CA  1 
ATOM 2282 C C   . ILE A 1 334 ? -44.432 -48.714 22.734 1.00 5.52  ? 334 ILE A C   1 
ATOM 2283 O O   . ILE A 1 334 ? -45.035 -48.953 21.680 1.00 8.56  ? 334 ILE A O   1 
ATOM 2284 C CB  . ILE A 1 334 ? -44.922 -50.602 24.274 1.00 5.78  ? 334 ILE A CB  1 
ATOM 2285 C CG1 . ILE A 1 334 ? -45.408 -50.913 25.698 1.00 8.58  ? 334 ILE A CG1 1 
ATOM 2286 C CG2 . ILE A 1 334 ? -43.379 -50.999 24.228 1.00 9.30  ? 334 ILE A CG2 1 
ATOM 2287 C CD1 . ILE A 1 334 ? -45.587 -52.453 25.935 1.00 8.74  ? 334 ILE A CD1 1 
ATOM 2288 N N   . VAL A 1 335 ? -43.261 -48.038 22.769 1.00 6.33  ? 335 VAL A N   1 
ATOM 2289 C CA  . VAL A 1 335 ? -42.611 -47.557 21.563 1.00 6.65  ? 335 VAL A CA  1 
ATOM 2290 C C   . VAL A 1 335 ? -41.193 -48.056 21.494 1.00 6.32  ? 335 VAL A C   1 
ATOM 2291 O O   . VAL A 1 335 ? -40.611 -48.433 22.529 1.00 7.03  ? 335 VAL A O   1 
ATOM 2292 C CB  . VAL A 1 335 ? -42.622 -46.014 21.489 1.00 8.00  ? 335 VAL A CB  1 
ATOM 2293 C CG1 . VAL A 1 335 ? -44.077 -45.465 21.538 1.00 9.85  ? 335 VAL A CG1 1 
ATOM 2294 C CG2 . VAL A 1 335 ? -41.750 -45.392 22.530 1.00 10.36 ? 335 VAL A CG2 1 
ATOM 2295 N N   . THR A 1 336 ? -40.674 -48.141 20.275 1.00 6.38  ? 336 THR A N   1 
ATOM 2296 C CA  . THR A 1 336 ? -39.239 -48.482 20.042 1.00 6.10  ? 336 THR A CA  1 
ATOM 2297 C C   . THR A 1 336 ? -38.437 -47.208 19.793 1.00 5.39  ? 336 THR A C   1 
ATOM 2298 O O   . THR A 1 336 ? -38.738 -46.436 18.897 1.00 7.87  ? 336 THR A O   1 
ATOM 2299 C CB  . THR A 1 336 ? -39.114 -49.437 18.809 1.00 8.02  ? 336 THR A CB  1 
ATOM 2300 O OG1 . THR A 1 336 ? -39.916 -50.616 19.096 1.00 9.34  ? 336 THR A OG1 1 
ATOM 2301 C CG2 . THR A 1 336 ? -37.646 -49.810 18.575 1.00 9.59  ? 336 THR A CG2 1 
ATOM 2302 N N   . THR A 1 337 ? -37.507 -46.988 20.735 1.00 6.45  ? 337 THR A N   1 
ATOM 2303 C CA  . THR A 1 337 ? -36.630 -45.772 20.617 1.00 6.87  ? 337 THR A CA  1 
ATOM 2304 C C   . THR A 1 337 ? -35.633 -46.002 19.473 1.00 5.90  ? 337 THR A C   1 
ATOM 2305 O O   . THR A 1 337 ? -35.461 -47.150 18.970 1.00 6.69  ? 337 THR A O   1 
ATOM 2306 C CB  . THR A 1 337 ? -35.916 -45.537 21.935 1.00 5.80  ? 337 THR A CB  1 
ATOM 2307 O OG1 . THR A 1 337 ? -34.971 -46.602 22.158 1.00 6.87  ? 337 THR A OG1 1 
ATOM 2308 C CG2 . THR A 1 337 ? -36.880 -45.431 23.137 1.00 7.14  ? 337 THR A CG2 1 
ATOM 2309 N N   . MET A 1 338 ? -34.918 -44.923 19.076 1.00 7.63  ? 338 MET A N   1 
ATOM 2310 C CA  . MET A 1 338 ? -33.940 -45.021 17.988 1.00 5.91  ? 338 MET A CA  1 
ATOM 2311 C C   . MET A 1 338 ? -32.877 -46.070 18.345 1.00 8.87  ? 338 MET A C   1 
ATOM 2312 O O   . MET A 1 338 ? -32.384 -46.773 17.387 1.00 10.44 ? 338 MET A O   1 
ATOM 2313 C CB  . MET A 1 338 ? -33.285 -43.660 17.829 1.00 8.47  ? 338 MET A CB  1 
ATOM 2314 C CG  . MET A 1 338 ? -32.380 -43.621 16.591 1.00 7.91  ? 338 MET A CG  1 
ATOM 2315 S SD  . MET A 1 338 ? -31.639 -41.979 16.516 1.00 10.40 ? 338 MET A SD  1 
ATOM 2316 C CE  . MET A 1 338 ? -30.729 -42.239 14.958 1.00 15.73 ? 338 MET A CE  1 
ATOM 2317 N N   . SER A 1 339 ? -32.514 -46.129 19.648 1.00 7.49  ? 339 SER A N   1 
ATOM 2318 C CA  . SER A 1 339 ? -31.471 -47.078 20.146 1.00 7.46  ? 339 SER A CA  1 
ATOM 2319 C C   . SER A 1 339 ? -31.919 -48.578 20.019 1.00 7.31  ? 339 SER A C   1 
ATOM 2320 O O   . SER A 1 339 ? -31.004 -49.458 20.202 1.00 9.45  ? 339 SER A O   1 
ATOM 2321 C CB  . SER A 1 339 ? -31.164 -46.791 21.598 1.00 7.61  ? 339 SER A CB  1 
ATOM 2322 O OG  . SER A 1 339 ? -32.232 -47.185 22.474 1.00 8.18  ? 339 SER A OG  1 
ATOM 2323 N N   . GLY A 1 340 ? -33.216 -48.803 19.802 1.00 8.05  ? 340 GLY A N   1 
ATOM 2324 C CA  . GLY A 1 340 ? -33.752 -50.163 19.837 1.00 6.82  ? 340 GLY A CA  1 
ATOM 2325 C C   . GLY A 1 340 ? -34.308 -50.528 21.190 1.00 8.42  ? 340 GLY A C   1 
ATOM 2326 O O   . GLY A 1 340 ? -35.091 -51.506 21.273 1.00 9.47  ? 340 GLY A O   1 
ATOM 2327 N N   . GLN A 1 341 ? -33.999 -49.782 22.268 1.00 6.65  ? 341 GLN A N   1 
ATOM 2328 C CA  . GLN A 1 341 ? -34.623 -50.067 23.554 1.00 7.47  ? 341 GLN A CA  1 
ATOM 2329 C C   . GLN A 1 341 ? -36.140 -49.671 23.435 1.00 6.84  ? 341 GLN A C   1 
ATOM 2330 O O   . GLN A 1 341 ? -36.486 -48.696 22.834 1.00 8.31  ? 341 GLN A O   1 
ATOM 2331 C CB  . GLN A 1 341 ? -33.954 -49.185 24.609 1.00 7.58  ? 341 GLN A CB  1 
ATOM 2332 C CG  . GLN A 1 341 ? -32.480 -49.609 24.807 1.00 8.88  ? 341 GLN A CG  1 
ATOM 2333 C CD  . GLN A 1 341 ? -31.712 -48.756 25.775 1.00 9.49  ? 341 GLN A CD  1 
ATOM 2334 O OE1 . GLN A 1 341 ? -32.040 -47.548 26.017 1.00 12.40 ? 341 GLN A OE1 1 
ATOM 2335 N NE2 . GLN A 1 341 ? -30.584 -49.255 26.179 1.00 12.84 ? 341 GLN A NE2 1 
ATOM 2336 N N   . THR A 1 342 ? -36.944 -50.519 24.086 1.00 5.93  ? 342 THR A N   1 
ATOM 2337 C CA  . THR A 1 342 ? -38.366 -50.193 24.101 1.00 5.70  ? 342 THR A CA  1 
ATOM 2338 C C   . THR A 1 342 ? -38.743 -49.473 25.361 1.00 6.46  ? 342 THR A C   1 
ATOM 2339 O O   . THR A 1 342 ? -38.146 -49.702 26.450 1.00 7.70  ? 342 THR A O   1 
ATOM 2340 C CB  . THR A 1 342 ? -39.238 -51.475 24.020 1.00 8.22  ? 342 THR A CB  1 
ATOM 2341 O OG1 . THR A 1 342 ? -38.839 -52.414 25.038 1.00 8.40  ? 342 THR A OG1 1 
ATOM 2342 C CG2 . THR A 1 342 ? -39.017 -52.099 22.602 1.00 8.47  ? 342 THR A CG2 1 
ATOM 2343 N N   . VAL A 1 343 ? -39.714 -48.591 25.320 1.00 6.14  ? 343 VAL A N   1 
ATOM 2344 C CA  . VAL A 1 343 ? -40.157 -47.769 26.472 1.00 5.02  ? 343 VAL A CA  1 
ATOM 2345 C C   . VAL A 1 343 ? -41.679 -47.876 26.558 1.00 7.16  ? 343 VAL A C   1 
ATOM 2346 O O   . VAL A 1 343 ? -42.395 -47.690 25.607 1.00 6.26  ? 343 VAL A O   1 
ATOM 2347 C CB  . VAL A 1 343 ? -39.773 -46.274 26.247 1.00 5.94  ? 343 VAL A CB  1 
ATOM 2348 C CG1 . VAL A 1 343 ? -40.406 -45.395 27.375 1.00 7.37  ? 343 VAL A CG1 1 
ATOM 2349 C CG2 . VAL A 1 343 ? -38.262 -46.177 26.237 1.00 6.57  ? 343 VAL A CG2 1 
ATOM 2350 N N   . GLU A 1 344 ? -42.134 -48.227 27.766 1.00 6.22  ? 344 GLU A N   1 
ATOM 2351 C CA  . GLU A 1 344 ? -43.572 -48.154 28.106 1.00 6.63  ? 344 GLU A CA  1 
ATOM 2352 C C   . GLU A 1 344 ? -43.835 -46.747 28.582 1.00 5.99  ? 344 GLU A C   1 
ATOM 2353 O O   . GLU A 1 344 ? -43.279 -46.364 29.626 1.00 6.54  ? 344 GLU A O   1 
ATOM 2354 C CB  . GLU A 1 344 ? -43.883 -49.235 29.146 1.00 7.69  ? 344 GLU A CB  1 
ATOM 2355 C CG  . GLU A 1 344 ? -45.441 -49.321 29.401 1.00 7.04  ? 344 GLU A CG  1 
ATOM 2356 C CD  . GLU A 1 344 ? -45.778 -50.377 30.464 1.00 9.88  ? 344 GLU A CD  1 
ATOM 2357 O OE1 . GLU A 1 344 ? -44.973 -50.710 31.321 1.00 11.54 ? 344 GLU A OE1 1 
ATOM 2358 O OE2 . GLU A 1 344 ? -46.979 -50.773 30.419 1.00 13.53 ? 344 GLU A OE2 1 
ATOM 2359 N N   . ILE A 1 345 ? -44.721 -46.018 27.913 1.00 7.06  ? 345 ILE A N   1 
ATOM 2360 C CA  . ILE A 1 345 ? -45.040 -44.612 28.228 1.00 6.81  ? 345 ILE A CA  1 
ATOM 2361 C C   . ILE A 1 345 ? -46.186 -44.728 29.224 1.00 6.93  ? 345 ILE A C   1 
ATOM 2362 O O   . ILE A 1 345 ? -47.356 -44.709 28.858 1.00 7.86  ? 345 ILE A O   1 
ATOM 2363 C CB  . ILE A 1 345 ? -45.353 -43.822 26.985 1.00 6.14  ? 345 ILE A CB  1 
ATOM 2364 C CG1 . ILE A 1 345 ? -44.204 -43.849 26.012 1.00 5.87  ? 345 ILE A CG1 1 
ATOM 2365 C CG2 . ILE A 1 345 ? -45.767 -42.390 27.367 1.00 7.27  ? 345 ILE A CG2 1 
ATOM 2366 C CD1 . ILE A 1 345 ? -44.508 -43.220 24.629 1.00 7.23  ? 345 ILE A CD1 1 
ATOM 2367 N N   . LEU A 1 346 ? -45.825 -44.819 30.496 1.00 6.07  ? 346 LEU A N   1 
ATOM 2368 C CA  . LEU A 1 346 ? -46.801 -44.967 31.623 1.00 5.41  ? 346 LEU A CA  1 
ATOM 2369 C C   . LEU A 1 346 ? -47.564 -43.654 31.851 1.00 6.89  ? 346 LEU A C   1 
ATOM 2370 O O   . LEU A 1 346 ? -48.739 -43.602 32.335 1.00 8.10  ? 346 LEU A O   1 
ATOM 2371 C CB  . LEU A 1 346 ? -46.148 -45.455 32.910 1.00 6.07  ? 346 LEU A CB  1 
ATOM 2372 C CG  . LEU A 1 346 ? -45.723 -46.911 32.736 1.00 9.46  ? 346 LEU A CG  1 
ATOM 2373 C CD1 . LEU A 1 346 ? -44.899 -47.161 33.863 1.00 15.95 ? 346 LEU A CD1 1 
ATOM 2374 C CD2 . LEU A 1 346 ? -47.003 -47.849 32.684 1.00 12.19 ? 346 LEU A CD2 1 
ATOM 2375 N N   . ASN A 1 347 ? -46.874 -42.528 31.599 1.00 6.40  ? 347 ASN A N   1 
ATOM 2376 C CA  . ASN A 1 347 ? -47.440 -41.180 31.896 1.00 6.94  ? 347 ASN A CA  1 
ATOM 2377 C C   . ASN A 1 347 ? -46.965 -40.301 30.725 1.00 5.74  ? 347 ASN A C   1 
ATOM 2378 O O   . ASN A 1 347 ? -45.779 -40.122 30.483 1.00 6.69  ? 347 ASN A O   1 
ATOM 2379 C CB  . ASN A 1 347 ? -47.031 -40.682 33.298 1.00 7.64  ? 347 ASN A CB  1 
ATOM 2380 C CG  . ASN A 1 347 ? -47.730 -39.419 33.639 1.00 10.94 ? 347 ASN A CG  1 
ATOM 2381 O OD1 . ASN A 1 347 ? -47.698 -38.472 32.893 1.00 7.76  ? 347 ASN A OD1 1 
ATOM 2382 N ND2 . ASN A 1 347 ? -48.413 -39.378 34.810 1.00 13.76 ? 347 ASN A ND2 1 
ATOM 2383 N N   . THR A 1 348 ? -47.970 -39.734 30.013 1.00 4.41  ? 348 THR A N   1 
ATOM 2384 C CA  . THR A 1 348 ? -47.635 -38.932 28.806 1.00 6.02  ? 348 THR A CA  1 
ATOM 2385 C C   . THR A 1 348 ? -47.116 -37.548 29.199 1.00 5.06  ? 348 THR A C   1 
ATOM 2386 O O   . THR A 1 348 ? -46.635 -36.812 28.340 1.00 6.28  ? 348 THR A O   1 
ATOM 2387 C CB  . THR A 1 348 ? -48.842 -38.795 27.882 1.00 6.35  ? 348 THR A CB  1 
ATOM 2388 O OG1 . THR A 1 348 ? -49.870 -37.997 28.549 1.00 6.42  ? 348 THR A OG1 1 
ATOM 2389 C CG2 . THR A 1 348 ? -49.393 -40.157 27.483 1.00 6.01  ? 348 THR A CG2 1 
ATOM 2390 N N   . ASP A 1 349 ? -47.146 -37.214 30.495 1.00 5.11  ? 349 ASP A N   1 
ATOM 2391 C CA  . ASP A 1 349 ? -46.592 -35.958 30.910 1.00 4.92  ? 349 ASP A CA  1 
ATOM 2392 C C   . ASP A 1 349 ? -45.101 -36.135 31.319 1.00 4.57  ? 349 ASP A C   1 
ATOM 2393 O O   . ASP A 1 349 ? -44.458 -35.171 31.763 1.00 5.94  ? 349 ASP A O   1 
ATOM 2394 C CB  . ASP A 1 349 ? -47.408 -35.478 32.155 1.00 6.28  ? 349 ASP A CB  1 
ATOM 2395 C CG  . ASP A 1 349 ? -47.183 -34.022 32.514 1.00 5.51  ? 349 ASP A CG  1 
ATOM 2396 O OD1 . ASP A 1 349 ? -46.654 -33.239 31.688 1.00 5.85  ? 349 ASP A OD1 1 
ATOM 2397 O OD2 . ASP A 1 349 ? -47.665 -33.618 33.583 1.00 8.19  ? 349 ASP A OD2 1 
ATOM 2398 N N   . ALA A 1 350 ? -44.542 -37.354 31.215 1.00 4.19  ? 350 ALA A N   1 
ATOM 2399 C CA  . ALA A 1 350 ? -43.076 -37.523 31.355 1.00 6.98  ? 350 ALA A CA  1 
ATOM 2400 C C   . ALA A 1 350 ? -42.517 -37.536 29.908 1.00 5.73  ? 350 ALA A C   1 
ATOM 2401 O O   . ALA A 1 350 ? -41.915 -38.536 29.459 1.00 6.63  ? 350 ALA A O   1 
ATOM 2402 C CB  . ALA A 1 350 ? -42.746 -38.769 32.181 1.00 7.47  ? 350 ALA A CB  1 
ATOM 2403 N N   . GLU A 1 351 ? -42.730 -36.411 29.236 1.00 4.63  ? 351 GLU A N   1 
ATOM 2404 C CA  . GLU A 1 351 ? -42.476 -36.371 27.742 1.00 4.71  ? 351 GLU A CA  1 
ATOM 2405 C C   . GLU A 1 351 ? -41.134 -35.831 27.401 1.00 5.29  ? 351 GLU A C   1 
ATOM 2406 O O   . GLU A 1 351 ? -40.622 -36.150 26.297 1.00 6.33  ? 351 GLU A O   1 
ATOM 2407 C CB  . GLU A 1 351 ? -43.559 -35.518 27.024 1.00 7.43  ? 351 GLU A CB  1 
ATOM 2408 C CG  . GLU A 1 351 ? -43.503 -34.004 27.252 1.00 5.30  ? 351 GLU A CG  1 
ATOM 2409 C CD  . GLU A 1 351 ? -44.074 -33.534 28.555 1.00 4.02  ? 351 GLU A CD  1 
ATOM 2410 O OE1 . GLU A 1 351 ? -44.449 -34.454 29.365 1.00 6.09  ? 351 GLU A OE1 1 
ATOM 2411 O OE2 . GLU A 1 351 ? -44.193 -32.330 28.777 1.00 5.85  ? 351 GLU A OE2 1 
ATOM 2412 N N   . GLY A 1 352 ? -40.594 -34.933 28.207 1.00 5.27  ? 352 GLY A N   1 
ATOM 2413 C CA  . GLY A 1 352 ? -39.247 -34.394 27.896 1.00 4.35  ? 352 GLY A CA  1 
ATOM 2414 C C   . GLY A 1 352 ? -38.247 -35.487 27.755 1.00 4.78  ? 352 GLY A C   1 
ATOM 2415 O O   . GLY A 1 352 ? -37.382 -35.407 26.880 1.00 5.82  ? 352 GLY A O   1 
ATOM 2416 N N   . ARG A 1 353 ? -38.253 -36.435 28.656 1.00 5.10  ? 353 ARG A N   1 
ATOM 2417 C CA  . ARG A 1 353 ? -37.212 -37.498 28.614 1.00 7.02  ? 353 ARG A CA  1 
ATOM 2418 C C   . ARG A 1 353 ? -37.387 -38.354 27.361 1.00 7.77  ? 353 ARG A C   1 
ATOM 2419 O O   . ARG A 1 353 ? -36.429 -38.970 26.941 1.00 5.78  ? 353 ARG A O   1 
ATOM 2420 C CB  . ARG A 1 353 ? -37.263 -38.303 29.921 1.00 6.13  ? 353 ARG A CB  1 
ATOM 2421 C CG  . ARG A 1 353 ? -38.558 -39.188 30.008 1.00 6.55  ? 353 ARG A CG  1 
ATOM 2422 C CD  . ARG A 1 353 ? -38.745 -39.635 31.474 1.00 7.62  ? 353 ARG A CD  1 
ATOM 2423 N NE  . ARG A 1 353 ? -39.114 -38.464 32.318 1.00 6.05  ? 353 ARG A NE  1 
ATOM 2424 C CZ  . ARG A 1 353 ? -39.303 -38.536 33.660 1.00 6.38  ? 353 ARG A CZ  1 
ATOM 2425 N NH1 . ARG A 1 353 ? -39.038 -39.666 34.286 1.00 8.16  ? 353 ARG A NH1 1 
ATOM 2426 N NH2 . ARG A 1 353 ? -39.640 -37.435 34.310 1.00 8.43  ? 353 ARG A NH2 1 
ATOM 2427 N N   . LEU A 1 354 ? -38.584 -38.351 26.797 1.00 6.16  ? 354 LEU A N   1 
ATOM 2428 C CA  . LEU A 1 354 ? -38.871 -39.127 25.552 1.00 6.57  ? 354 LEU A CA  1 
ATOM 2429 C C   . LEU A 1 354 ? -38.284 -38.458 24.344 1.00 6.67  ? 354 LEU A C   1 
ATOM 2430 O O   . LEU A 1 354 ? -37.593 -39.144 23.531 1.00 6.42  ? 354 LEU A O   1 
ATOM 2431 C CB  . LEU A 1 354 ? -40.409 -39.354 25.443 1.00 6.35  ? 354 LEU A CB  1 
ATOM 2432 C CG  . LEU A 1 354 ? -41.033 -40.186 26.538 1.00 7.01  ? 354 LEU A CG  1 
ATOM 2433 C CD1 . LEU A 1 354 ? -42.543 -40.184 26.181 1.00 8.86  ? 354 LEU A CD1 1 
ATOM 2434 C CD2 . LEU A 1 354 ? -40.476 -41.630 26.553 1.00 8.23  ? 354 LEU A CD2 1 
ATOM 2435 N N   . VAL A 1 355 ? -38.407 -37.133 24.252 1.00 5.04  ? 355 VAL A N   1 
ATOM 2436 C CA  . VAL A 1 355 ? -37.785 -36.509 23.056 1.00 5.58  ? 355 VAL A CA  1 
ATOM 2437 C C   . VAL A 1 355 ? -36.294 -36.473 23.282 1.00 6.48  ? 355 VAL A C   1 
ATOM 2438 O O   . VAL A 1 355 ? -35.511 -36.599 22.306 1.00 6.99  ? 355 VAL A O   1 
ATOM 2439 C CB  . VAL A 1 355 ? -38.287 -35.080 22.759 1.00 5.07  ? 355 VAL A CB  1 
ATOM 2440 C CG1 . VAL A 1 355 ? -39.822 -35.072 22.592 1.00 7.98  ? 355 VAL A CG1 1 
ATOM 2441 C CG2 . VAL A 1 355 ? -37.949 -34.033 23.834 1.00 7.29  ? 355 VAL A CG2 1 
ATOM 2442 N N   . LEU A 1 356 ? -35.837 -36.350 24.530 1.00 5.61  ? 356 LEU A N   1 
ATOM 2443 C CA  . LEU A 1 356 ? -34.389 -36.297 24.838 1.00 6.21  ? 356 LEU A CA  1 
ATOM 2444 C C   . LEU A 1 356 ? -33.736 -37.629 24.511 1.00 6.14  ? 356 LEU A C   1 
ATOM 2445 O O   . LEU A 1 356 ? -32.589 -37.655 24.036 1.00 6.06  ? 356 LEU A O   1 
ATOM 2446 C CB  . LEU A 1 356 ? -34.107 -35.881 26.270 1.00 5.26  ? 356 LEU A CB  1 
ATOM 2447 C CG  . LEU A 1 356 ? -34.452 -34.373 26.502 1.00 6.82  ? 356 LEU A CG  1 
ATOM 2448 C CD1 . LEU A 1 356 ? -34.284 -34.162 28.039 1.00 8.02  ? 356 LEU A CD1 1 
ATOM 2449 C CD2 . LEU A 1 356 ? -33.525 -33.455 25.769 1.00 7.85  ? 356 LEU A CD2 1 
ATOM 2450 N N   . CYS A 1 357 ? -34.364 -38.777 24.893 1.00 5.22  ? 357 CYS A N   1 
ATOM 2451 C CA  . CYS A 1 357 ? -33.631 -40.046 24.788 1.00 5.19  ? 357 CYS A CA  1 
ATOM 2452 C C   . CYS A 1 357 ? -33.298 -40.360 23.320 1.00 6.79  ? 357 CYS A C   1 
ATOM 2453 O O   . CYS A 1 357 ? -32.146 -40.762 23.072 1.00 7.08  ? 357 CYS A O   1 
ATOM 2454 C CB  . CYS A 1 357 ? -34.408 -41.176 25.503 1.00 6.17  ? 357 CYS A CB  1 
ATOM 2455 S SG  . CYS A 1 357 ? -35.883 -41.859 24.599 1.00 7.51  ? 357 CYS A SG  1 
ATOM 2456 N N   . ASP A 1 358 ? -34.186 -40.054 22.380 1.00 5.52  ? 358 ASP A N   1 
ATOM 2457 C CA  . ASP A 1 358 ? -33.915 -40.305 20.978 1.00 6.51  ? 358 ASP A CA  1 
ATOM 2458 C C   . ASP A 1 358 ? -32.874 -39.305 20.480 1.00 6.89  ? 358 ASP A C   1 
ATOM 2459 O O   . ASP A 1 358 ? -32.047 -39.678 19.637 1.00 6.78  ? 358 ASP A O   1 
ATOM 2460 C CB  . ASP A 1 358 ? -35.201 -40.236 20.182 1.00 5.07  ? 358 ASP A CB  1 
ATOM 2461 C CG  . ASP A 1 358 ? -35.989 -41.539 20.275 1.00 7.75  ? 358 ASP A CG  1 
ATOM 2462 O OD1 . ASP A 1 358 ? -35.362 -42.608 20.503 1.00 7.79  ? 358 ASP A OD1 1 
ATOM 2463 O OD2 . ASP A 1 358 ? -37.210 -41.455 20.078 1.00 5.66  ? 358 ASP A OD2 1 
ATOM 2464 N N   . THR A 1 359 ? -32.872 -38.086 21.017 1.00 6.24  ? 359 THR A N   1 
ATOM 2465 C CA  . THR A 1 359 ? -31.875 -37.103 20.584 1.00 5.82  ? 359 THR A CA  1 
ATOM 2466 C C   . THR A 1 359 ? -30.513 -37.461 21.122 1.00 5.22  ? 359 THR A C   1 
ATOM 2467 O O   . THR A 1 359 ? -29.491 -37.201 20.427 1.00 7.22  ? 359 THR A O   1 
ATOM 2468 C CB  . THR A 1 359 ? -32.351 -35.731 21.026 1.00 5.75  ? 359 THR A CB  1 
ATOM 2469 O OG1 . THR A 1 359 ? -33.618 -35.459 20.439 1.00 8.01  ? 359 THR A OG1 1 
ATOM 2470 C CG2 . THR A 1 359 ? -31.421 -34.640 20.437 1.00 6.18  ? 359 THR A CG2 1 
ATOM 2471 N N   . LEU A 1 360 ? -30.431 -38.024 22.330 1.00 5.13  ? 360 LEU A N   1 
ATOM 2472 C CA  . LEU A 1 360 ? -29.112 -38.535 22.859 1.00 5.04  ? 360 LEU A CA  1 
ATOM 2473 C C   . LEU A 1 360 ? -28.601 -39.647 21.952 1.00 5.60  ? 360 LEU A C   1 
ATOM 2474 O O   . LEU A 1 360 ? -27.378 -39.709 21.662 1.00 6.69  ? 360 LEU A O   1 
ATOM 2475 C CB  . LEU A 1 360 ? -29.388 -39.039 24.299 1.00 6.02  ? 360 LEU A CB  1 
ATOM 2476 C CG  . LEU A 1 360 ? -29.535 -37.832 25.275 1.00 3.86  ? 360 LEU A CG  1 
ATOM 2477 C CD1 . LEU A 1 360 ? -29.935 -38.429 26.626 1.00 7.24  ? 360 LEU A CD1 1 
ATOM 2478 C CD2 . LEU A 1 360 ? -28.269 -36.991 25.489 1.00 8.26  ? 360 LEU A CD2 1 
ATOM 2479 N N   . THR A 1 361 ? -29.473 -40.540 21.443 1.00 5.82  ? 361 THR A N   1 
ATOM 2480 C CA  . THR A 1 361 ? -28.954 -41.561 20.508 1.00 5.83  ? 361 THR A CA  1 
ATOM 2481 C C   . THR A 1 361 ? -28.414 -40.856 19.261 1.00 7.26  ? 361 THR A C   1 
ATOM 2482 O O   . THR A 1 361 ? -27.370 -41.243 18.672 1.00 7.92  ? 361 THR A O   1 
ATOM 2483 C CB  . THR A 1 361 ? -30.100 -42.524 20.199 1.00 6.22  ? 361 THR A CB  1 
ATOM 2484 O OG1 . THR A 1 361 ? -30.496 -43.130 21.435 1.00 8.46  ? 361 THR A OG1 1 
ATOM 2485 C CG2 . THR A 1 361 ? -29.554 -43.650 19.302 1.00 7.31  ? 361 THR A CG2 1 
ATOM 2486 N N   . TYR A 1 362 ? -29.204 -39.887 18.737 1.00 6.20  ? 362 TYR A N   1 
ATOM 2487 C CA  . TYR A 1 362 ? -28.816 -39.148 17.523 1.00 7.60  ? 362 TYR A CA  1 
ATOM 2488 C C   . TYR A 1 362 ? -27.443 -38.517 17.709 1.00 8.82  ? 362 TYR A C   1 
ATOM 2489 O O   . TYR A 1 362 ? -26.624 -38.507 16.704 1.00 9.00  ? 362 TYR A O   1 
ATOM 2490 C CB  . TYR A 1 362 ? -29.875 -38.043 17.193 1.00 9.04  ? 362 TYR A CB  1 
ATOM 2491 C CG  . TYR A 1 362 ? -29.633 -37.387 15.885 1.00 7.01  ? 362 TYR A CG  1 
ATOM 2492 C CD1 . TYR A 1 362 ? -28.915 -36.184 15.787 1.00 7.13  ? 362 TYR A CD1 1 
ATOM 2493 C CD2 . TYR A 1 362 ? -30.175 -37.966 14.742 1.00 11.06 ? 362 TYR A CD2 1 
ATOM 2494 C CE1 . TYR A 1 362 ? -28.706 -35.612 14.513 1.00 8.15  ? 362 TYR A CE1 1 
ATOM 2495 C CE2 . TYR A 1 362 ? -29.937 -37.344 13.461 1.00 11.55 ? 362 TYR A CE2 1 
ATOM 2496 C CZ  . TYR A 1 362 ? -29.290 -36.183 13.441 1.00 8.70  ? 362 TYR A CZ  1 
ATOM 2497 O OH  . TYR A 1 362 ? -29.007 -35.619 12.163 1.00 13.52 ? 362 TYR A OH  1 
ATOM 2498 N N   . ALA A 1 363 ? -27.177 -38.021 18.919 1.00 7.33  ? 363 ALA A N   1 
ATOM 2499 C CA  . ALA A 1 363 ? -25.876 -37.353 19.180 1.00 7.21  ? 363 ALA A CA  1 
ATOM 2500 C C   . ALA A 1 363 ? -24.636 -38.257 19.011 1.00 7.79  ? 363 ALA A C   1 
ATOM 2501 O O   . ALA A 1 363 ? -23.532 -37.695 18.883 1.00 7.91  ? 363 ALA A O   1 
ATOM 2502 C CB  . ALA A 1 363 ? -25.902 -36.768 20.602 1.00 7.51  ? 363 ALA A CB  1 
ATOM 2503 N N   . GLU A 1 364 ? -24.843 -39.557 19.002 1.00 8.05  ? 364 GLU A N   1 
ATOM 2504 C CA  . GLU A 1 364 ? -23.662 -40.490 18.915 1.00 6.49  ? 364 GLU A CA  1 
ATOM 2505 C C   . GLU A 1 364 ? -22.878 -40.205 17.637 1.00 7.65  ? 364 GLU A C   1 
ATOM 2506 O O   . GLU A 1 364 ? -21.614 -40.405 17.672 1.00 9.14  ? 364 GLU A O   1 
ATOM 2507 C CB  . GLU A 1 364 ? -24.101 -41.935 19.036 1.00 6.82  ? 364 GLU A CB  1 
ATOM 2508 C CG  . GLU A 1 364 ? -24.605 -42.352 20.386 1.00 10.04 ? 364 GLU A CG  1 
ATOM 2509 C CD  . GLU A 1 364 ? -25.068 -43.777 20.375 1.00 14.78 ? 364 GLU A CD  1 
ATOM 2510 O OE1 . GLU A 1 364 ? -24.845 -44.525 19.373 1.00 18.68 ? 364 GLU A OE1 1 
ATOM 2511 O OE2 . GLU A 1 364 ? -25.601 -44.190 21.421 1.00 14.08 ? 364 GLU A OE2 1 
ATOM 2512 N N   . ARG A 1 365 ? -23.574 -39.826 16.583 1.00 7.67  ? 365 ARG A N   1 
ATOM 2513 C CA  . ARG A 1 365 ? -22.928 -39.674 15.245 1.00 6.57  ? 365 ARG A CA  1 
ATOM 2514 C C   . ARG A 1 365 ? -21.812 -38.645 15.263 1.00 9.78  ? 365 ARG A C   1 
ATOM 2515 O O   . ARG A 1 365 ? -20.919 -38.697 14.389 1.00 10.91 ? 365 ARG A O   1 
ATOM 2516 C CB  . ARG A 1 365 ? -23.915 -39.392 14.156 1.00 7.55  ? 365 ARG A CB  1 
ATOM 2517 C CG  . ARG A 1 365 ? -24.537 -37.960 14.164 1.00 9.06  ? 365 ARG A CG  1 
ATOM 2518 C CD  . ARG A 1 365 ? -25.773 -37.863 13.314 1.00 8.83  ? 365 ARG A CD  1 
ATOM 2519 N NE  . ARG A 1 365 ? -26.728 -38.839 13.821 1.00 10.26 ? 365 ARG A NE  1 
ATOM 2520 C CZ  . ARG A 1 365 ? -27.418 -39.654 13.045 1.00 10.39 ? 365 ARG A CZ  1 
ATOM 2521 N NH1 . ARG A 1 365 ? -27.473 -39.372 11.698 1.00 13.12 ? 365 ARG A NH1 1 
ATOM 2522 N NH2 . ARG A 1 365 ? -28.160 -40.640 13.574 1.00 10.25 ? 365 ARG A NH2 1 
ATOM 2523 N N   . PHE A 1 366 ? -21.867 -37.676 16.182 1.00 7.29  ? 366 PHE A N   1 
ATOM 2524 C CA  . PHE A 1 366 ? -20.869 -36.618 16.194 1.00 6.85  ? 366 PHE A CA  1 
ATOM 2525 C C   . PHE A 1 366 ? -19.551 -36.994 16.868 1.00 8.61  ? 366 PHE A C   1 
ATOM 2526 O O   . PHE A 1 366 ? -18.621 -36.182 16.925 1.00 9.48  ? 366 PHE A O   1 
ATOM 2527 C CB  . PHE A 1 366 ? -21.462 -35.354 16.832 1.00 7.94  ? 366 PHE A CB  1 
ATOM 2528 C CG  . PHE A 1 366 ? -22.675 -34.892 16.126 1.00 8.24  ? 366 PHE A CG  1 
ATOM 2529 C CD1 . PHE A 1 366 ? -22.498 -34.189 14.895 1.00 10.31 ? 366 PHE A CD1 1 
ATOM 2530 C CD2 . PHE A 1 366 ? -23.994 -35.154 16.545 1.00 8.45  ? 366 PHE A CD2 1 
ATOM 2531 C CE1 . PHE A 1 366 ? -23.604 -33.800 14.148 1.00 9.95  ? 366 PHE A CE1 1 
ATOM 2532 C CE2 . PHE A 1 366 ? -25.091 -34.694 15.782 1.00 8.76  ? 366 PHE A CE2 1 
ATOM 2533 C CZ  . PHE A 1 366 ? -24.853 -34.072 14.527 1.00 9.52  ? 366 PHE A CZ  1 
ATOM 2534 N N   . LYS A 1 367 ? -19.514 -38.164 17.480 1.00 7.56  ? 367 LYS A N   1 
ATOM 2535 C CA  . LYS A 1 367 ? -18.342 -38.670 18.221 1.00 8.49  ? 367 LYS A CA  1 
ATOM 2536 C C   . LYS A 1 367 ? -17.820 -37.607 19.199 1.00 9.38  ? 367 LYS A C   1 
ATOM 2537 O O   . LYS A 1 367 ? -16.713 -37.084 19.131 1.00 8.37  ? 367 LYS A O   1 
ATOM 2538 C CB  . LYS A 1 367 ? -17.211 -39.087 17.237 1.00 9.27  ? 367 LYS A CB  1 
ATOM 2539 C CG  . LYS A 1 367 ? -17.686 -40.260 16.299 1.00 12.71 ? 367 LYS A CG  1 
ATOM 2540 C CD  . LYS A 1 367 ? -17.963 -41.603 17.041 1.00 24.27 ? 367 LYS A CD  1 
ATOM 2541 C CE  . LYS A 1 367 ? -18.641 -42.803 16.218 1.00 33.29 ? 367 LYS A CE  1 
ATOM 2542 N NZ  . LYS A 1 367 ? -20.183 -42.764 16.224 1.00 37.30 ? 367 LYS A NZ  1 
ATOM 2543 N N   . PRO A 1 368 ? -18.700 -37.186 20.113 1.00 7.92  ? 368 PRO A N   1 
ATOM 2544 C CA  . PRO A 1 368 ? -18.443 -36.035 20.934 1.00 8.45  ? 368 PRO A CA  1 
ATOM 2545 C C   . PRO A 1 368 ? -17.491 -36.268 22.112 1.00 7.47  ? 368 PRO A C   1 
ATOM 2546 O O   . PRO A 1 368 ? -17.386 -37.413 22.569 1.00 9.12  ? 368 PRO A O   1 
ATOM 2547 C CB  . PRO A 1 368 ? -19.853 -35.664 21.474 1.00 9.09  ? 368 PRO A CB  1 
ATOM 2548 C CG  . PRO A 1 368 ? -20.494 -36.988 21.581 1.00 9.48  ? 368 PRO A CG  1 
ATOM 2549 C CD  . PRO A 1 368 ? -20.036 -37.775 20.363 1.00 9.62  ? 368 PRO A CD  1 
ATOM 2550 N N   . GLN A 1 369 ? -16.847 -35.213 22.566 1.00 7.84  ? 369 GLN A N   1 
ATOM 2551 C CA  . GLN A 1 369 ? -16.051 -35.339 23.795 1.00 7.70  ? 369 GLN A CA  1 
ATOM 2552 C C   . GLN A 1 369 ? -16.905 -35.047 25.060 1.00 7.88  ? 369 GLN A C   1 
ATOM 2553 O O   . GLN A 1 369 ? -16.483 -35.368 26.202 1.00 7.92  ? 369 GLN A O   1 
ATOM 2554 C CB  . GLN A 1 369 ? -14.788 -34.485 23.771 1.00 9.19  ? 369 GLN A CB  1 
ATOM 2555 C CG  . GLN A 1 369 ? -15.048 -32.994 23.712 1.00 7.61  ? 369 GLN A CG  1 
ATOM 2556 C CD  . GLN A 1 369 ? -13.718 -32.238 23.692 1.00 9.08  ? 369 GLN A CD  1 
ATOM 2557 O OE1 . GLN A 1 369 ? -12.625 -32.806 23.350 1.00 10.85 ? 369 GLN A OE1 1 
ATOM 2558 N NE2 . GLN A 1 369 ? -13.818 -30.927 23.943 1.00 10.57 ? 369 GLN A NE2 1 
ATOM 2559 N N   . ALA A 1 370 ? -18.115 -34.414 24.865 1.00 6.59  ? 370 ALA A N   1 
ATOM 2560 C CA  . ALA A 1 370 ? -19.012 -34.186 26.045 1.00 7.41  ? 370 ALA A CA  1 
ATOM 2561 C C   . ALA A 1 370 ? -20.371 -33.947 25.403 1.00 7.62  ? 370 ALA A C   1 
ATOM 2562 O O   . ALA A 1 370 ? -20.479 -33.328 24.341 1.00 7.75  ? 370 ALA A O   1 
ATOM 2563 C CB  . ALA A 1 370 ? -18.602 -32.879 26.748 1.00 7.64  ? 370 ALA A CB  1 
ATOM 2564 N N   . VAL A 1 371 ? -21.428 -34.505 26.062 1.00 7.02  ? 371 VAL A N   1 
ATOM 2565 C CA  . VAL A 1 371 ? -22.832 -34.249 25.637 1.00 6.35  ? 371 VAL A CA  1 
ATOM 2566 C C   . VAL A 1 371 ? -23.580 -33.821 26.888 1.00 7.63  ? 371 VAL A C   1 
ATOM 2567 O O   . VAL A 1 371 ? -23.490 -34.454 27.885 1.00 7.77  ? 371 VAL A O   1 
ATOM 2568 C CB  . VAL A 1 371 ? -23.496 -35.568 25.160 1.00 5.98  ? 371 VAL A CB  1 
ATOM 2569 C CG1 . VAL A 1 371 ? -24.945 -35.267 24.780 1.00 5.78  ? 371 VAL A CG1 1 
ATOM 2570 C CG2 . VAL A 1 371 ? -22.707 -36.068 23.894 1.00 8.99  ? 371 VAL A CG2 1 
ATOM 2571 N N   . ILE A 1 372 ? -24.171 -32.641 26.829 1.00 6.38  ? 372 ILE A N   1 
ATOM 2572 C CA  . ILE A 1 372 ? -24.874 -32.131 27.977 1.00 5.14  ? 372 ILE A CA  1 
ATOM 2573 C C   . ILE A 1 372 ? -26.282 -31.827 27.553 1.00 6.02  ? 372 ILE A C   1 
ATOM 2574 O O   . ILE A 1 372 ? -26.514 -31.039 26.636 1.00 6.07  ? 372 ILE A O   1 
ATOM 2575 C CB  . ILE A 1 372 ? -24.218 -30.847 28.516 1.00 5.71  ? 372 ILE A CB  1 
ATOM 2576 C CG1 . ILE A 1 372 ? -22.731 -31.081 28.789 1.00 7.12  ? 372 ILE A CG1 1 
ATOM 2577 C CG2 . ILE A 1 372 ? -24.928 -30.376 29.777 1.00 7.99  ? 372 ILE A CG2 1 
ATOM 2578 C CD1 . ILE A 1 372 ? -21.902 -29.815 28.781 1.00 14.98 ? 372 ILE A CD1 1 
ATOM 2579 N N   . ASP A 1 373 ? -27.230 -32.442 28.236 1.00 5.78  ? 373 ASP A N   1 
ATOM 2580 C CA  . ASP A 1 373 ? -28.653 -32.126 27.970 1.00 6.47  ? 373 ASP A CA  1 
ATOM 2581 C C   . ASP A 1 373 ? -29.150 -31.134 29.019 1.00 6.73  ? 373 ASP A C   1 
ATOM 2582 O O   . ASP A 1 373 ? -28.681 -31.160 30.163 1.00 7.07  ? 373 ASP A O   1 
ATOM 2583 C CB  . ASP A 1 373 ? -29.515 -33.407 27.855 1.00 6.98  ? 373 ASP A CB  1 
ATOM 2584 C CG  . ASP A 1 373 ? -29.498 -34.193 29.084 1.00 9.24  ? 373 ASP A CG  1 
ATOM 2585 O OD1 . ASP A 1 373 ? -28.755 -33.821 30.060 1.00 8.82  ? 373 ASP A OD1 1 
ATOM 2586 O OD2 . ASP A 1 373 ? -30.262 -35.146 29.139 1.00 9.03  ? 373 ASP A OD2 1 
ATOM 2587 N N   . ILE A 1 374 ? -29.994 -30.224 28.570 1.00 5.54  ? 374 ILE A N   1 
ATOM 2588 C CA  . ILE A 1 374 ? -30.536 -29.198 29.466 1.00 5.34  ? 374 ILE A CA  1 
ATOM 2589 C C   . ILE A 1 374 ? -32.043 -29.262 29.306 1.00 6.94  ? 374 ILE A C   1 
ATOM 2590 O O   . ILE A 1 374 ? -32.578 -29.137 28.196 1.00 6.35  ? 374 ILE A O   1 
ATOM 2591 C CB  . ILE A 1 374 ? -29.980 -27.809 29.065 1.00 6.24  ? 374 ILE A CB  1 
ATOM 2592 C CG1 . ILE A 1 374 ? -28.429 -27.779 29.140 1.00 8.75  ? 374 ILE A CG1 1 
ATOM 2593 C CG2 . ILE A 1 374 ? -30.606 -26.702 29.958 1.00 6.93  ? 374 ILE A CG2 1 
ATOM 2594 C CD1 . ILE A 1 374 ? -27.802 -27.949 27.732 1.00 11.15 ? 374 ILE A CD1 1 
ATOM 2595 N N   . ALA A 1 375 ? -32.783 -29.370 30.426 1.00 6.46  ? 375 ALA A N   1 
ATOM 2596 C CA  . ALA A 1 375 ? -34.232 -29.615 30.285 1.00 6.52  ? 375 ALA A CA  1 
ATOM 2597 C C   . ALA A 1 375 ? -34.928 -29.084 31.568 1.00 7.46  ? 375 ALA A C   1 
ATOM 2598 O O   . ALA A 1 375 ? -34.450 -29.304 32.681 1.00 6.86  ? 375 ALA A O   1 
ATOM 2599 C CB  . ALA A 1 375 ? -34.443 -31.154 30.219 1.00 7.35  ? 375 ALA A CB  1 
ATOM 2600 N N   . THR A 1 376 ? -36.147 -28.550 31.369 1.00 8.16  ? 376 THR A N   1 
ATOM 2601 C CA  . THR A 1 376 ? -37.079 -28.202 32.476 1.00 8.09  ? 376 THR A CA  1 
ATOM 2602 C C   . THR A 1 376 ? -37.821 -29.490 32.836 1.00 8.56  ? 376 THR A C   1 
ATOM 2603 O O   . THR A 1 376 ? -38.997 -29.737 32.464 1.00 8.88  ? 376 THR A O   1 
ATOM 2604 C CB  . THR A 1 376 ? -38.006 -27.101 32.005 1.00 6.78  ? 376 THR A CB  1 
ATOM 2605 O OG1 . THR A 1 376 ? -38.427 -27.386 30.621 1.00 9.15  ? 376 THR A OG1 1 
ATOM 2606 C CG2 . THR A 1 376 ? -37.249 -25.780 31.992 1.00 9.39  ? 376 THR A CG2 1 
ATOM 2607 N N   . LEU A 1 377 ? -37.154 -30.418 33.499 1.00 10.14 ? 377 LEU A N   1 
ATOM 2608 C CA  . LEU A 1 377 ? -37.630 -31.758 33.451 1.00 10.11 ? 377 LEU A CA  1 
ATOM 2609 C C   . LEU A 1 377 ? -38.509 -32.203 34.571 1.00 12.43 ? 377 LEU A C   1 
ATOM 2610 O O   . LEU A 1 377 ? -39.495 -32.972 34.291 1.00 12.57 ? 377 LEU A O   1 
ATOM 2611 C CB  . LEU A 1 377 ? -36.394 -32.707 33.273 1.00 9.15  ? 377 LEU A CB  1 
ATOM 2612 C CG  . LEU A 1 377 ? -36.711 -34.210 33.003 1.00 9.00  ? 377 LEU A CG  1 
ATOM 2613 C CD1 . LEU A 1 377 ? -38.141 -34.397 32.517 1.00 10.84 ? 377 LEU A CD1 1 
ATOM 2614 C CD2 . LEU A 1 377 ? -35.735 -34.876 32.136 1.00 8.93  ? 377 LEU A CD2 1 
ATOM 2615 N N   . THR A 1 378 ? -38.254 -31.775 35.805 1.00 8.95  ? 378 THR A N   1 
ATOM 2616 C CA  . THR A 1 378 ? -39.023 -32.362 36.907 1.00 10.14 ? 378 THR A CA  1 
ATOM 2617 C C   . THR A 1 378 ? -39.449 -31.369 37.894 1.00 12.69 ? 378 THR A C   1 
ATOM 2618 O O   . THR A 1 378 ? -38.657 -30.498 38.351 1.00 13.27 ? 378 THR A O   1 
ATOM 2619 C CB  . THR A 1 378 ? -38.262 -33.571 37.632 1.00 11.29 ? 378 THR A CB  1 
ATOM 2620 O OG1 . THR A 1 378 ? -37.121 -33.064 38.274 1.00 10.22 ? 378 THR A OG1 1 
ATOM 2621 C CG2 . THR A 1 378 ? -37.874 -34.759 36.667 1.00 11.67 ? 378 THR A CG2 1 
ATOM 2622 N N   . GLY A 1 379 ? -40.745 -31.429 38.268 1.00 12.86 ? 379 GLY A N   1 
ATOM 2623 C CA  . GLY A 1 379 ? -41.164 -30.712 39.486 1.00 13.91 ? 379 GLY A CA  1 
ATOM 2624 C C   . GLY A 1 379 ? -40.417 -31.173 40.721 1.00 12.61 ? 379 GLY A C   1 
ATOM 2625 O O   . GLY A 1 379 ? -40.173 -30.319 41.625 1.00 12.40 ? 379 GLY A O   1 
ATOM 2626 N N   . ALA A 1 380 ? -39.914 -32.408 40.739 1.00 12.89 ? 380 ALA A N   1 
ATOM 2627 C CA  . ALA A 1 380 ? -39.172 -32.842 41.872 1.00 11.82 ? 380 ALA A CA  1 
ATOM 2628 C C   . ALA A 1 380 ? -37.862 -32.066 42.076 1.00 13.19 ? 380 ALA A C   1 
ATOM 2629 O O   . ALA A 1 380 ? -37.328 -32.020 43.205 1.00 13.28 ? 380 ALA A O   1 
ATOM 2630 C CB  . ALA A 1 380 ? -38.826 -34.386 41.741 1.00 13.94 ? 380 ALA A CB  1 
ATOM 2631 N N   . CYS A 1 381 ? -37.265 -31.541 40.990 1.00 10.90 ? 381 CYS A N   1 
ATOM 2632 C CA  . CYS A 1 381 ? -35.993 -30.758 41.163 1.00 11.09 ? 381 CYS A CA  1 
ATOM 2633 C C   . CYS A 1 381 ? -36.327 -29.502 41.957 1.00 11.67 ? 381 CYS A C   1 
ATOM 2634 O O   . CYS A 1 381 ? -35.449 -29.036 42.678 1.00 11.00 ? 381 CYS A O   1 
ATOM 2635 C CB  . CYS A 1 381 ? -35.429 -30.486 39.750 1.00 9.95  ? 381 CYS A CB  1 
ATOM 2636 S SG  . CYS A 1 381 ? -33.638 -29.974 39.955 1.00 12.93 ? 381 CYS A SG  1 
ATOM 2637 N N   . ILE A 1 382 ? -37.483 -28.912 41.805 1.00 11.47 ? 382 ILE A N   1 
ATOM 2638 C CA  . ILE A 1 382 ? -37.871 -27.697 42.557 1.00 10.59 ? 382 ILE A CA  1 
ATOM 2639 C C   . ILE A 1 382 ? -38.066 -28.094 43.995 1.00 11.53 ? 382 ILE A C   1 
ATOM 2640 O O   . ILE A 1 382 ? -37.599 -27.396 44.900 1.00 12.29 ? 382 ILE A O   1 
ATOM 2641 C CB  . ILE A 1 382 ? -39.137 -27.092 41.974 1.00 12.39 ? 382 ILE A CB  1 
ATOM 2642 C CG1 . ILE A 1 382 ? -38.951 -26.965 40.459 1.00 11.47 ? 382 ILE A CG1 1 
ATOM 2643 C CG2 . ILE A 1 382 ? -39.331 -25.674 42.620 1.00 14.71 ? 382 ILE A CG2 1 
ATOM 2644 C CD1 . ILE A 1 382 ? -40.165 -26.453 39.670 1.00 16.61 ? 382 ILE A CD1 1 
ATOM 2645 N N   . VAL A 1 383 ? -38.606 -29.296 44.260 1.00 10.89 ? 383 VAL A N   1 
ATOM 2646 C CA  . VAL A 1 383 ? -38.633 -29.713 45.664 1.00 13.99 ? 383 VAL A CA  1 
ATOM 2647 C C   . VAL A 1 383 ? -37.221 -29.946 46.238 1.00 13.96 ? 383 VAL A C   1 
ATOM 2648 O O   . VAL A 1 383 ? -36.945 -29.589 47.450 1.00 13.53 ? 383 VAL A O   1 
ATOM 2649 C CB  . VAL A 1 383 ? -39.486 -31.027 45.740 1.00 12.33 ? 383 VAL A CB  1 
ATOM 2650 C CG1 . VAL A 1 383 ? -39.338 -31.649 47.167 1.00 15.61 ? 383 VAL A CG1 1 
ATOM 2651 C CG2 . VAL A 1 383 ? -40.927 -30.636 45.418 1.00 11.57 ? 383 VAL A CG2 1 
ATOM 2652 N N   . ALA A 1 384 ? -36.317 -30.510 45.429 1.00 13.41 ? 384 ALA A N   1 
ATOM 2653 C CA  . ALA A 1 384 ? -34.956 -30.790 45.958 1.00 11.88 ? 384 ALA A CA  1 
ATOM 2654 C C   . ALA A 1 384 ? -34.073 -29.552 46.067 1.00 11.73 ? 384 ALA A C   1 
ATOM 2655 O O   . ALA A 1 384 ? -33.277 -29.447 47.064 1.00 14.00 ? 384 ALA A O   1 
ATOM 2656 C CB  . ALA A 1 384 ? -34.292 -31.862 45.075 1.00 12.96 ? 384 ALA A CB  1 
ATOM 2657 N N   . LEU A 1 385 ? -34.057 -28.682 45.049 1.00 10.28 ? 385 LEU A N   1 
ATOM 2658 C CA  . LEU A 1 385 ? -33.104 -27.612 45.013 1.00 9.28  ? 385 LEU A CA  1 
ATOM 2659 C C   . LEU A 1 385 ? -33.684 -26.232 44.754 1.00 8.36  ? 385 LEU A C   1 
ATOM 2660 O O   . LEU A 1 385 ? -32.953 -25.219 44.769 1.00 9.88  ? 385 LEU A O   1 
ATOM 2661 C CB  . LEU A 1 385 ? -32.041 -27.902 43.905 1.00 9.40  ? 385 LEU A CB  1 
ATOM 2662 C CG  . LEU A 1 385 ? -31.119 -29.035 44.201 1.00 8.47  ? 385 LEU A CG  1 
ATOM 2663 C CD1 . LEU A 1 385 ? -30.458 -29.448 42.820 1.00 14.59 ? 385 LEU A CD1 1 
ATOM 2664 C CD2 . LEU A 1 385 ? -30.024 -28.620 45.190 1.00 11.37 ? 385 LEU A CD2 1 
ATOM 2665 N N   . GLY A 1 386 ? -35.038 -26.108 44.658 1.00 9.71  ? 386 GLY A N   1 
ATOM 2666 C CA  . GLY A 1 386 ? -35.702 -24.799 44.654 1.00 9.12  ? 386 GLY A CA  1 
ATOM 2667 C C   . GLY A 1 386 ? -35.314 -23.990 43.446 1.00 8.81  ? 386 GLY A C   1 
ATOM 2668 O O   . GLY A 1 386 ? -35.061 -24.522 42.331 1.00 11.62 ? 386 GLY A O   1 
ATOM 2669 N N   . SER A 1 387 ? -35.389 -22.695 43.604 1.00 10.65 ? 387 SER A N   1 
ATOM 2670 C CA  . SER A 1 387 ? -35.251 -21.792 42.461 1.00 10.62 ? 387 SER A CA  1 
ATOM 2671 C C   . SER A 1 387 ? -33.844 -21.332 42.260 1.00 11.01 ? 387 SER A C   1 
ATOM 2672 O O   . SER A 1 387 ? -33.585 -20.621 41.248 1.00 14.86 ? 387 SER A O   1 
ATOM 2673 C CB  . SER A 1 387 ? -36.114 -20.527 42.698 1.00 14.19 ? 387 SER A CB  1 
ATOM 2674 O OG  . SER A 1 387 ? -35.658 -19.788 43.823 1.00 23.79 ? 387 SER A OG  1 
ATOM 2675 N N   . HIS A 1 388 ? -32.914 -21.693 43.136 1.00 10.53 ? 388 HIS A N   1 
ATOM 2676 C CA  . HIS A 1 388 ? -31.571 -21.087 43.158 1.00 10.68 ? 388 HIS A CA  1 
ATOM 2677 C C   . HIS A 1 388 ? -30.477 -21.889 42.424 1.00 8.82  ? 388 HIS A C   1 
ATOM 2678 O O   . HIS A 1 388 ? -29.466 -21.311 42.028 1.00 11.17 ? 388 HIS A O   1 
ATOM 2679 C CB  . HIS A 1 388 ? -31.108 -20.767 44.607 1.00 11.01 ? 388 HIS A CB  1 
ATOM 2680 C CG  . HIS A 1 388 ? -32.042 -19.799 45.206 1.00 14.56 ? 388 HIS A CG  1 
ATOM 2681 N ND1 . HIS A 1 388 ? -32.165 -18.504 44.707 1.00 21.94 ? 388 HIS A ND1 1 
ATOM 2682 C CD2 . HIS A 1 388 ? -32.987 -19.945 46.176 1.00 14.95 ? 388 HIS A CD2 1 
ATOM 2683 C CE1 . HIS A 1 388 ? -33.146 -17.902 45.393 1.00 20.77 ? 388 HIS A CE1 1 
ATOM 2684 N NE2 . HIS A 1 388 ? -33.598 -18.728 46.327 1.00 16.58 ? 388 HIS A NE2 1 
ATOM 2685 N N   . THR A 1 389 ? -30.678 -23.181 42.344 1.00 7.71  ? 389 THR A N   1 
ATOM 2686 C CA  . THR A 1 389 ? -29.582 -24.072 42.004 1.00 8.09  ? 389 THR A CA  1 
ATOM 2687 C C   . THR A 1 389 ? -30.090 -25.089 41.012 1.00 6.24  ? 389 THR A C   1 
ATOM 2688 O O   . THR A 1 389 ? -31.077 -25.793 41.261 1.00 8.61  ? 389 THR A O   1 
ATOM 2689 C CB  . THR A 1 389 ? -29.128 -24.797 43.262 1.00 8.89  ? 389 THR A CB  1 
ATOM 2690 O OG1 . THR A 1 389 ? -28.814 -23.803 44.293 1.00 8.76  ? 389 THR A OG1 1 
ATOM 2691 C CG2 . THR A 1 389 ? -27.864 -25.582 42.936 1.00 8.45  ? 389 THR A CG2 1 
ATOM 2692 N N   . THR A 1 390 ? -29.423 -25.258 39.859 1.00 6.14  ? 390 THR A N   1 
ATOM 2693 C CA  . THR A 1 390 ? -29.846 -26.251 38.857 1.00 6.73  ? 390 THR A CA  1 
ATOM 2694 C C   . THR A 1 390 ? -29.379 -27.673 39.291 1.00 8.23  ? 390 THR A C   1 
ATOM 2695 O O   . THR A 1 390 ? -28.306 -27.824 39.882 1.00 7.96  ? 390 THR A O   1 
ATOM 2696 C CB  . THR A 1 390 ? -29.103 -25.929 37.548 1.00 7.18  ? 390 THR A CB  1 
ATOM 2697 O OG1 . THR A 1 390 ? -29.641 -24.652 37.072 1.00 8.60  ? 390 THR A OG1 1 
ATOM 2698 C CG2 . THR A 1 390 ? -29.221 -27.020 36.473 1.00 10.73 ? 390 THR A CG2 1 
ATOM 2699 N N   . GLY A 1 391 ? -30.233 -28.676 39.053 1.00 6.93  ? 391 GLY A N   1 
ATOM 2700 C CA  . GLY A 1 391 ? -29.843 -30.095 39.391 1.00 6.41  ? 391 GLY A CA  1 
ATOM 2701 C C   . GLY A 1 391 ? -28.964 -30.637 38.309 1.00 7.01  ? 391 GLY A C   1 
ATOM 2702 O O   . GLY A 1 391 ? -29.168 -30.374 37.140 1.00 8.24  ? 391 GLY A O   1 
ATOM 2703 N N   . LEU A 1 392 ? -27.896 -31.308 38.669 1.00 4.92  ? 392 LEU A N   1 
ATOM 2704 C CA  . LEU A 1 392 ? -26.926 -31.831 37.712 1.00 5.25  ? 392 LEU A CA  1 
ATOM 2705 C C   . LEU A 1 392 ? -26.624 -33.295 38.025 1.00 7.32  ? 392 LEU A C   1 
ATOM 2706 O O   . LEU A 1 392 ? -26.376 -33.675 39.127 1.00 7.86  ? 392 LEU A O   1 
ATOM 2707 C CB  . LEU A 1 392 ? -25.638 -30.977 37.795 1.00 6.84  ? 392 LEU A CB  1 
ATOM 2708 C CG  . LEU A 1 392 ? -24.419 -31.449 36.994 1.00 6.29  ? 392 LEU A CG  1 
ATOM 2709 C CD1 . LEU A 1 392 ? -24.688 -31.328 35.497 1.00 10.04 ? 392 LEU A CD1 1 
ATOM 2710 C CD2 . LEU A 1 392 ? -23.216 -30.564 37.385 1.00 8.51  ? 392 LEU A CD2 1 
ATOM 2711 N N   . MET A 1 393 ? -26.646 -34.104 37.003 1.00 6.39  ? 393 MET A N   1 
ATOM 2712 C CA  . MET A 1 393 ? -26.317 -35.532 37.045 1.00 5.69  ? 393 MET A CA  1 
ATOM 2713 C C   . MET A 1 393 ? -25.468 -35.918 35.891 1.00 6.37  ? 393 MET A C   1 
ATOM 2714 O O   . MET A 1 393 ? -25.397 -35.126 34.936 1.00 6.72  ? 393 MET A O   1 
ATOM 2715 C CB  . MET A 1 393 ? -27.620 -36.376 36.980 1.00 5.97  ? 393 MET A CB  1 
ATOM 2716 C CG  . MET A 1 393 ? -28.463 -36.171 38.270 1.00 9.06  ? 393 MET A CG  1 
ATOM 2717 S SD  . MET A 1 393 ? -29.998 -37.192 38.351 1.00 9.24  ? 393 MET A SD  1 
ATOM 2718 C CE  . MET A 1 393 ? -30.996 -36.225 37.192 1.00 11.52 ? 393 MET A CE  1 
ATOM 2719 N N   . GLY A 1 394 ? -24.729 -37.002 35.950 1.00 6.44  ? 394 GLY A N   1 
ATOM 2720 C CA  . GLY A 1 394 ? -24.032 -37.415 34.729 1.00 6.79  ? 394 GLY A CA  1 
ATOM 2721 C C   . GLY A 1 394 ? -23.360 -38.758 34.909 1.00 7.34  ? 394 GLY A C   1 
ATOM 2722 O O   . GLY A 1 394 ? -23.475 -39.404 35.954 1.00 10.76 ? 394 GLY A O   1 
ATOM 2723 N N   . ASN A 1 395 ? -22.637 -39.155 33.854 1.00 5.96  ? 395 ASN A N   1 
ATOM 2724 C CA  . ASN A 1 395 ? -21.980 -40.460 33.846 1.00 7.47  ? 395 ASN A CA  1 
ATOM 2725 C C   . ASN A 1 395 ? -20.478 -40.334 33.862 1.00 7.81  ? 395 ASN A C   1 
ATOM 2726 O O   . ASN A 1 395 ? -19.757 -41.365 33.706 1.00 9.17  ? 395 ASN A O   1 
ATOM 2727 C CB  . ASN A 1 395 ? -22.358 -41.354 32.703 1.00 7.01  ? 395 ASN A CB  1 
ATOM 2728 C CG  . ASN A 1 395 ? -21.963 -40.822 31.336 1.00 7.14  ? 395 ASN A CG  1 
ATOM 2729 O OD1 . ASN A 1 395 ? -21.119 -39.919 31.221 1.00 7.36  ? 395 ASN A OD1 1 
ATOM 2730 N ND2 . ASN A 1 395 ? -22.575 -41.434 30.257 1.00 6.87  ? 395 ASN A ND2 1 
ATOM 2731 N N   . ASN A 1 396 ? -19.980 -39.102 34.030 1.00 8.19  ? 396 ASN A N   1 
ATOM 2732 C CA  . ASN A 1 396 ? -18.558 -38.809 33.964 1.00 9.17  ? 396 ASN A CA  1 
ATOM 2733 C C   . ASN A 1 396 ? -18.239 -37.796 35.035 1.00 9.87  ? 396 ASN A C   1 
ATOM 2734 O O   . ASN A 1 396 ? -18.691 -36.641 34.988 1.00 10.72 ? 396 ASN A O   1 
ATOM 2735 C CB  . ASN A 1 396 ? -18.117 -38.294 32.558 1.00 8.03  ? 396 ASN A CB  1 
ATOM 2736 C CG  . ASN A 1 396 ? -16.598 -38.278 32.430 1.00 10.48 ? 396 ASN A CG  1 
ATOM 2737 O OD1 . ASN A 1 396 ? -15.861 -39.156 33.075 1.00 17.46 ? 396 ASN A OD1 1 
ATOM 2738 N ND2 . ASN A 1 396 ? -16.133 -37.360 31.740 1.00 8.36  ? 396 ASN A ND2 1 
ATOM 2739 N N   . ASP A 1 397 ? -17.347 -38.150 35.979 1.00 11.28 ? 397 ASP A N   1 
ATOM 2740 C CA  . ASP A 1 397 ? -17.108 -37.265 37.111 1.00 12.75 ? 397 ASP A CA  1 
ATOM 2741 C C   . ASP A 1 397 ? -16.341 -36.036 36.681 1.00 10.78 ? 397 ASP A C   1 
ATOM 2742 O O   . ASP A 1 397 ? -16.590 -34.922 37.211 1.00 11.69 ? 397 ASP A O   1 
ATOM 2743 C CB  . ASP A 1 397 ? -16.212 -37.989 38.092 1.00 17.04 ? 397 ASP A CB  1 
ATOM 2744 C CG  . ASP A 1 397 ? -16.970 -39.050 38.867 1.00 23.97 ? 397 ASP A CG  1 
ATOM 2745 O OD1 . ASP A 1 397 ? -18.219 -38.958 38.931 1.00 34.03 ? 397 ASP A OD1 1 
ATOM 2746 O OD2 . ASP A 1 397 ? -16.295 -39.971 39.404 1.00 29.85 ? 397 ASP A OD2 1 
ATOM 2747 N N   . ASP A 1 398 ? -15.447 -36.167 35.716 1.00 11.17 ? 398 ASP A N   1 
ATOM 2748 C CA  . ASP A 1 398 ? -14.696 -34.965 35.332 1.00 10.09 ? 398 ASP A CA  1 
ATOM 2749 C C   . ASP A 1 398 ? -15.628 -33.923 34.676 1.00 7.95  ? 398 ASP A C   1 
ATOM 2750 O O   . ASP A 1 398 ? -15.539 -32.746 34.929 1.00 9.63  ? 398 ASP A O   1 
ATOM 2751 C CB  . ASP A 1 398 ? -13.566 -35.260 34.267 1.00 12.02 ? 398 ASP A CB  1 
ATOM 2752 C CG  . ASP A 1 398 ? -12.307 -35.853 34.954 1.00 20.22 ? 398 ASP A CG  1 
ATOM 2753 O OD1 . ASP A 1 398 ? -12.313 -35.967 36.218 1.00 20.40 ? 398 ASP A OD1 1 
ATOM 2754 O OD2 . ASP A 1 398 ? -11.404 -36.185 34.149 1.00 25.72 ? 398 ASP A OD2 1 
ATOM 2755 N N   . LEU A 1 399 ? -16.552 -34.364 33.819 1.00 7.49  ? 399 LEU A N   1 
ATOM 2756 C CA  . LEU A 1 399 ? -17.454 -33.404 33.079 1.00 8.22  ? 399 LEU A CA  1 
ATOM 2757 C C   . LEU A 1 399 ? -18.378 -32.779 34.134 1.00 8.75  ? 399 LEU A C   1 
ATOM 2758 O O   . LEU A 1 399 ? -18.604 -31.563 34.132 1.00 7.79  ? 399 LEU A O   1 
ATOM 2759 C CB  . LEU A 1 399 ? -18.343 -34.222 32.126 1.00 6.52  ? 399 LEU A CB  1 
ATOM 2760 C CG  . LEU A 1 399 ? -19.441 -33.412 31.438 1.00 5.45  ? 399 LEU A CG  1 
ATOM 2761 C CD1 . LEU A 1 399 ? -18.910 -32.149 30.740 1.00 10.22 ? 399 LEU A CD1 1 
ATOM 2762 C CD2 . LEU A 1 399 ? -20.125 -34.345 30.458 1.00 8.68  ? 399 LEU A CD2 1 
ATOM 2763 N N   . VAL A 1 400 ? -18.898 -33.582 35.094 1.00 6.75  ? 400 VAL A N   1 
ATOM 2764 C CA  . VAL A 1 400 ? -19.785 -33.011 36.143 1.00 5.97  ? 400 VAL A CA  1 
ATOM 2765 C C   . VAL A 1 400 ? -19.022 -31.966 36.934 1.00 4.95  ? 400 VAL A C   1 
ATOM 2766 O O   . VAL A 1 400 ? -19.515 -30.876 37.226 1.00 7.54  ? 400 VAL A O   1 
ATOM 2767 C CB  . VAL A 1 400 ? -20.387 -34.185 37.017 1.00 7.18  ? 400 VAL A CB  1 
ATOM 2768 C CG1 . VAL A 1 400 ? -20.975 -33.641 38.289 1.00 9.28  ? 400 VAL A CG1 1 
ATOM 2769 C CG2 . VAL A 1 400 ? -21.403 -34.977 36.234 1.00 9.87  ? 400 VAL A CG2 1 
ATOM 2770 N N   . GLY A 1 401 ? -17.776 -32.272 37.263 1.00 6.79  ? 401 GLY A N   1 
ATOM 2771 C CA  . GLY A 1 401 ? -16.985 -31.270 38.044 1.00 7.63  ? 401 GLY A CA  1 
ATOM 2772 C C   . GLY A 1 401 ? -16.694 -30.019 37.274 1.00 7.56  ? 401 GLY A C   1 
ATOM 2773 O O   . GLY A 1 401 ? -16.702 -28.953 37.867 1.00 9.59  ? 401 GLY A O   1 
ATOM 2774 N N   . GLN A 1 402 ? -16.458 -30.148 35.972 1.00 6.48  ? 402 GLN A N   1 
ATOM 2775 C CA  . GLN A 1 402 ? -16.203 -28.981 35.163 1.00 5.77  ? 402 GLN A CA  1 
ATOM 2776 C C   . GLN A 1 402 ? -17.486 -28.081 35.158 1.00 6.66  ? 402 GLN A C   1 
ATOM 2777 O O   . GLN A 1 402 ? -17.363 -26.877 35.147 1.00 7.70  ? 402 GLN A O   1 
ATOM 2778 C CB  . GLN A 1 402 ? -15.929 -29.425 33.740 1.00 6.68  ? 402 GLN A CB  1 
ATOM 2779 C CG  . GLN A 1 402 ? -14.474 -30.015 33.640 1.00 8.42  ? 402 GLN A CG  1 
ATOM 2780 C CD  . GLN A 1 402 ? -14.229 -30.590 32.262 1.00 11.36 ? 402 GLN A CD  1 
ATOM 2781 O OE1 . GLN A 1 402 ? -15.128 -30.937 31.529 1.00 10.89 ? 402 GLN A OE1 1 
ATOM 2782 N NE2 . GLN A 1 402 ? -12.967 -30.799 31.963 1.00 13.60 ? 402 GLN A NE2 1 
ATOM 2783 N N   . LEU A 1 403 ? -18.671 -28.713 35.030 1.00 6.71  ? 403 LEU A N   1 
ATOM 2784 C CA  . LEU A 1 403 ? -19.915 -27.915 34.956 1.00 6.61  ? 403 LEU A CA  1 
ATOM 2785 C C   . LEU A 1 403 ? -20.173 -27.227 36.321 1.00 6.45  ? 403 LEU A C   1 
ATOM 2786 O O   . LEU A 1 403 ? -20.602 -26.069 36.390 1.00 7.24  ? 403 LEU A O   1 
ATOM 2787 C CB  . LEU A 1 403 ? -21.078 -28.857 34.587 1.00 6.07  ? 403 LEU A CB  1 
ATOM 2788 C CG  . LEU A 1 403 ? -20.910 -29.276 33.081 1.00 6.65  ? 403 LEU A CG  1 
ATOM 2789 C CD1 . LEU A 1 403 ? -21.848 -30.490 32.829 1.00 9.18  ? 403 LEU A CD1 1 
ATOM 2790 C CD2 . LEU A 1 403 ? -21.229 -28.096 32.143 1.00 8.67  ? 403 LEU A CD2 1 
ATOM 2791 N N   . LEU A 1 404 ? -19.933 -27.957 37.416 1.00 6.66  ? 404 LEU A N   1 
ATOM 2792 C CA  . LEU A 1 404 ? -20.071 -27.348 38.744 1.00 7.16  ? 404 LEU A CA  1 
ATOM 2793 C C   . LEU A 1 404 ? -19.109 -26.195 38.906 1.00 5.53  ? 404 LEU A C   1 
ATOM 2794 O O   . LEU A 1 404 ? -19.522 -25.139 39.396 1.00 7.13  ? 404 LEU A O   1 
ATOM 2795 C CB  . LEU A 1 404 ? -19.842 -28.338 39.872 1.00 7.09  ? 404 LEU A CB  1 
ATOM 2796 C CG  . LEU A 1 404 ? -20.860 -29.471 39.979 1.00 7.38  ? 404 LEU A CG  1 
ATOM 2797 C CD1 . LEU A 1 404 ? -21.044 -30.139 38.648 1.00 8.85  ? 404 LEU A CD1 1 
ATOM 2798 C CD2 . LEU A 1 404 ? -20.390 -30.462 41.077 1.00 8.83  ? 404 LEU A CD2 1 
ATOM 2799 N N   . ASP A 1 405 ? -17.862 -26.380 38.505 1.00 7.25  ? 405 ASP A N   1 
ATOM 2800 C CA  . ASP A 1 405 ? -16.918 -25.259 38.695 1.00 8.22  ? 405 ASP A CA  1 
ATOM 2801 C C   . ASP A 1 405 ? -17.312 -24.078 37.839 1.00 8.02  ? 405 ASP A C   1 
ATOM 2802 O O   . ASP A 1 405 ? -17.220 -22.917 38.304 1.00 9.23  ? 405 ASP A O   1 
ATOM 2803 C CB  . ASP A 1 405 ? -15.500 -25.785 38.360 1.00 7.95  ? 405 ASP A CB  1 
ATOM 2804 C CG  . ASP A 1 405 ? -14.451 -24.801 38.880 1.00 16.02 ? 405 ASP A CG  1 
ATOM 2805 O OD1 . ASP A 1 405 ? -14.342 -24.656 40.134 1.00 24.28 ? 405 ASP A OD1 1 
ATOM 2806 O OD2 . ASP A 1 405 ? -13.722 -24.288 38.025 1.00 26.56 ? 405 ASP A OD2 1 
ATOM 2807 N N   . ALA A 1 406 ? -17.688 -24.344 36.552 1.00 7.07  ? 406 ALA A N   1 
ATOM 2808 C CA  . ALA A 1 406 ? -18.230 -23.259 35.720 1.00 8.18  ? 406 ALA A CA  1 
ATOM 2809 C C   . ALA A 1 406 ? -19.383 -22.538 36.378 1.00 6.70  ? 406 ALA A C   1 
ATOM 2810 O O   . ALA A 1 406 ? -19.448 -21.310 36.309 1.00 9.15  ? 406 ALA A O   1 
ATOM 2811 C CB  . ALA A 1 406 ? -18.666 -23.791 34.397 1.00 8.98  ? 406 ALA A CB  1 
ATOM 2812 N N   . GLY A 1 407 ? -20.321 -23.260 36.957 1.00 6.35  ? 407 GLY A N   1 
ATOM 2813 C CA  . GLY A 1 407 ? -21.479 -22.565 37.583 1.00 6.67  ? 407 GLY A CA  1 
ATOM 2814 C C   . GLY A 1 407 ? -21.040 -21.715 38.746 1.00 7.08  ? 407 GLY A C   1 
ATOM 2815 O O   . GLY A 1 407 ? -21.600 -20.637 38.943 1.00 9.08  ? 407 GLY A O   1 
ATOM 2816 N N   . LYS A 1 408 ? -20.070 -22.177 39.571 1.00 8.23  ? 408 LYS A N   1 
ATOM 2817 C CA  . LYS A 1 408 ? -19.588 -21.321 40.667 1.00 9.26  ? 408 LYS A CA  1 
ATOM 2818 C C   . LYS A 1 408 ? -18.941 -20.052 40.165 1.00 8.71  ? 408 LYS A C   1 
ATOM 2819 O O   . LYS A 1 408 ? -19.317 -18.956 40.626 1.00 8.77  ? 408 LYS A O   1 
ATOM 2820 C CB  . LYS A 1 408 ? -18.559 -22.097 41.499 1.00 8.85  ? 408 LYS A CB  1 
ATOM 2821 C CG  . LYS A 1 408 ? -19.198 -23.204 42.313 1.00 11.47 ? 408 LYS A CG  1 
ATOM 2822 C CD  . LYS A 1 408 ? -18.019 -24.047 42.909 1.00 18.48 ? 408 LYS A CD  1 
ATOM 2823 C CE  . LYS A 1 408 ? -18.453 -25.339 43.398 1.00 21.09 ? 408 LYS A CE  1 
ATOM 2824 N NZ  . LYS A 1 408 ? -17.285 -25.997 44.086 1.00 21.69 ? 408 LYS A NZ  1 
ATOM 2825 N N   . ARG A 1 409 ? -18.115 -20.143 39.111 1.00 8.46  ? 409 ARG A N   1 
ATOM 2826 C CA  . ARG A 1 409 ? -17.375 -18.894 38.653 1.00 8.71  ? 409 ARG A CA  1 
ATOM 2827 C C   . ARG A 1 409 ? -18.356 -17.993 37.939 1.00 9.14  ? 409 ARG A C   1 
ATOM 2828 O O   . ARG A 1 409 ? -18.184 -16.769 37.930 1.00 11.98 ? 409 ARG A O   1 
ATOM 2829 C CB  . ARG A 1 409 ? -16.164 -19.287 37.824 1.00 9.98  ? 409 ARG A CB  1 
ATOM 2830 C CG  . ARG A 1 409 ? -15.034 -19.591 38.796 1.00 13.93 ? 409 ARG A CG  1 
ATOM 2831 C CD  . ARG A 1 409 ? -13.782 -20.003 38.012 1.00 16.34 ? 409 ARG A CD  1 
ATOM 2832 N NE  . ARG A 1 409 ? -13.964 -21.321 37.449 1.00 15.59 ? 409 ARG A NE  1 
ATOM 2833 C CZ  . ARG A 1 409 ? -14.133 -21.572 36.171 1.00 12.71 ? 409 ARG A CZ  1 
ATOM 2834 N NH1 . ARG A 1 409 ? -14.182 -20.622 35.242 1.00 14.70 ? 409 ARG A NH1 1 
ATOM 2835 N NH2 . ARG A 1 409 ? -14.276 -22.834 35.824 1.00 14.55 ? 409 ARG A NH2 1 
ATOM 2836 N N   . ALA A 1 410 ? -19.418 -18.549 37.300 1.00 7.69  ? 410 ALA A N   1 
ATOM 2837 C CA  . ALA A 1 410 ? -20.361 -17.706 36.569 1.00 7.90  ? 410 ALA A CA  1 
ATOM 2838 C C   . ALA A 1 410 ? -21.447 -17.186 37.482 1.00 8.02  ? 410 ALA A C   1 
ATOM 2839 O O   . ALA A 1 410 ? -22.273 -16.422 37.017 1.00 9.88  ? 410 ALA A O   1 
ATOM 2840 C CB  . ALA A 1 410 ? -20.963 -18.525 35.435 1.00 10.19 ? 410 ALA A CB  1 
ATOM 2841 N N   . ASP A 1 411 ? -21.528 -17.638 38.744 1.00 8.04  ? 411 ASP A N   1 
ATOM 2842 C CA  . ASP A 1 411 ? -22.631 -17.346 39.607 1.00 7.55  ? 411 ASP A CA  1 
ATOM 2843 C C   . ASP A 1 411 ? -23.981 -17.774 38.979 1.00 7.13  ? 411 ASP A C   1 
ATOM 2844 O O   . ASP A 1 411 ? -25.005 -17.008 38.904 1.00 8.78  ? 411 ASP A O   1 
ATOM 2845 C CB  . ASP A 1 411 ? -22.645 -15.872 40.081 1.00 7.81  ? 411 ASP A CB  1 
ATOM 2846 C CG  . ASP A 1 411 ? -23.818 -15.657 41.101 1.00 10.99 ? 411 ASP A CG  1 
ATOM 2847 O OD1 . ASP A 1 411 ? -24.205 -16.600 41.907 1.00 9.60  ? 411 ASP A OD1 1 
ATOM 2848 O OD2 . ASP A 1 411 ? -24.401 -14.499 41.089 1.00 10.79 ? 411 ASP A OD2 1 
ATOM 2849 N N   . ASP A 1 412 ? -23.992 -19.035 38.491 1.00 7.69  ? 412 ASP A N   1 
ATOM 2850 C CA  . ASP A 1 412 ? -25.153 -19.700 37.910 1.00 7.26  ? 412 ASP A CA  1 
ATOM 2851 C C   . ASP A 1 412 ? -25.049 -21.137 38.373 1.00 8.25  ? 412 ASP A C   1 
ATOM 2852 O O   . ASP A 1 412 ? -24.714 -22.051 37.606 1.00 8.18  ? 412 ASP A O   1 
ATOM 2853 C CB  . ASP A 1 412 ? -25.112 -19.510 36.379 1.00 9.41  ? 412 ASP A CB  1 
ATOM 2854 C CG  . ASP A 1 412 ? -26.292 -20.178 35.716 1.00 11.32 ? 412 ASP A CG  1 
ATOM 2855 O OD1 . ASP A 1 412 ? -27.281 -20.657 36.309 1.00 13.29 ? 412 ASP A OD1 1 
ATOM 2856 O OD2 . ASP A 1 412 ? -26.253 -20.270 34.469 1.00 10.48 ? 412 ASP A OD2 1 
ATOM 2857 N N   . ARG A 1 413 ? -25.259 -21.343 39.681 1.00 7.47  ? 413 ARG A N   1 
ATOM 2858 C CA  . ARG A 1 413 ? -24.794 -22.627 40.247 1.00 7.33  ? 413 ARG A CA  1 
ATOM 2859 C C   . ARG A 1 413 ? -25.660 -23.790 39.982 1.00 6.50  ? 413 ARG A C   1 
ATOM 2860 O O   . ARG A 1 413 ? -26.911 -23.639 39.803 1.00 7.72  ? 413 ARG A O   1 
ATOM 2861 C CB  . ARG A 1 413 ? -24.667 -22.512 41.783 1.00 6.10  ? 413 ARG A CB  1 
ATOM 2862 C CG  . ARG A 1 413 ? -23.371 -21.628 42.141 1.00 8.09  ? 413 ARG A CG  1 
ATOM 2863 C CD  . ARG A 1 413 ? -23.340 -21.319 43.617 1.00 9.19  ? 413 ARG A CD  1 
ATOM 2864 N NE  . ARG A 1 413 ? -24.460 -20.435 43.940 1.00 10.80 ? 413 ARG A NE  1 
ATOM 2865 C CZ  . ARG A 1 413 ? -24.749 -20.016 45.195 1.00 15.73 ? 413 ARG A CZ  1 
ATOM 2866 N NH1 . ARG A 1 413 ? -23.938 -20.297 46.205 1.00 11.61 ? 413 ARG A NH1 1 
ATOM 2867 N NH2 . ARG A 1 413 ? -25.814 -19.228 45.351 1.00 15.18 ? 413 ARG A NH2 1 
ATOM 2868 N N   . ALA A 1 414 ? -24.976 -24.936 39.938 1.00 5.63  ? 414 ALA A N   1 
ATOM 2869 C CA  . ALA A 1 414 ? -25.645 -26.215 39.944 1.00 6.32  ? 414 ALA A CA  1 
ATOM 2870 C C   . ALA A 1 414 ? -25.227 -27.039 41.130 1.00 8.59  ? 414 ALA A C   1 
ATOM 2871 O O   . ALA A 1 414 ? -24.416 -26.600 41.982 1.00 8.86  ? 414 ALA A O   1 
ATOM 2872 C CB  . ALA A 1 414 ? -25.275 -26.922 38.646 1.00 7.69  ? 414 ALA A CB  1 
ATOM 2873 N N   . TRP A 1 415 ? -25.813 -28.226 41.259 1.00 7.35  ? 415 TRP A N   1 
ATOM 2874 C CA  . TRP A 1 415 ? -25.492 -29.107 42.360 1.00 7.19  ? 415 TRP A CA  1 
ATOM 2875 C C   . TRP A 1 415 ? -25.746 -30.549 41.903 1.00 5.92  ? 415 TRP A C   1 
ATOM 2876 O O   . TRP A 1 415 ? -26.806 -30.852 41.366 1.00 7.48  ? 415 TRP A O   1 
ATOM 2877 C CB  . TRP A 1 415 ? -26.384 -28.766 43.600 1.00 7.17  ? 415 TRP A CB  1 
ATOM 2878 C CG  . TRP A 1 415 ? -25.892 -29.440 44.851 1.00 8.13  ? 415 TRP A CG  1 
ATOM 2879 C CD1 . TRP A 1 415 ? -26.348 -30.679 45.388 1.00 8.29  ? 415 TRP A CD1 1 
ATOM 2880 C CD2 . TRP A 1 415 ? -24.861 -28.971 45.685 1.00 7.15  ? 415 TRP A CD2 1 
ATOM 2881 N NE1 . TRP A 1 415 ? -25.607 -30.962 46.544 1.00 7.75  ? 415 TRP A NE1 1 
ATOM 2882 C CE2 . TRP A 1 415 ? -24.726 -29.938 46.759 1.00 8.76  ? 415 TRP A CE2 1 
ATOM 2883 C CE3 . TRP A 1 415 ? -24.052 -27.784 45.715 1.00 8.55  ? 415 TRP A CE3 1 
ATOM 2884 C CZ2 . TRP A 1 415 ? -23.802 -29.778 47.815 1.00 11.77 ? 415 TRP A CZ2 1 
ATOM 2885 C CZ3 . TRP A 1 415 ? -23.119 -27.699 46.771 1.00 9.96  ? 415 TRP A CZ3 1 
ATOM 2886 C CH2 . TRP A 1 415 ? -23.039 -28.681 47.793 1.00 11.22 ? 415 TRP A CH2 1 
ATOM 2887 N N   . GLN A 1 416 ? -24.769 -31.430 42.179 1.00 7.74  ? 416 GLN A N   1 
ATOM 2888 C CA  . GLN A 1 416 ? -24.883 -32.840 41.684 1.00 7.39  ? 416 GLN A CA  1 
ATOM 2889 C C   . GLN A 1 416 ? -25.874 -33.613 42.531 1.00 7.36  ? 416 GLN A C   1 
ATOM 2890 O O   . GLN A 1 416 ? -25.929 -33.432 43.790 1.00 8.33  ? 416 GLN A O   1 
ATOM 2891 C CB  . GLN A 1 416 ? -23.506 -33.486 41.775 1.00 8.01  ? 416 GLN A CB  1 
ATOM 2892 C CG  . GLN A 1 416 ? -23.525 -34.871 41.065 1.00 6.70  ? 416 GLN A CG  1 
ATOM 2893 C CD  . GLN A 1 416 ? -22.277 -35.589 41.096 1.00 8.51  ? 416 GLN A CD  1 
ATOM 2894 O OE1 . GLN A 1 416 ? -21.324 -35.160 41.758 1.00 11.03 ? 416 GLN A OE1 1 
ATOM 2895 N NE2 . GLN A 1 416 ? -22.211 -36.680 40.299 1.00 10.13 ? 416 GLN A NE2 1 
ATOM 2896 N N   . LEU A 1 417 ? -26.641 -34.470 41.882 1.00 7.01  ? 417 LEU A N   1 
ATOM 2897 C CA  . LEU A 1 417 ? -27.463 -35.511 42.515 1.00 6.29  ? 417 LEU A CA  1 
ATOM 2898 C C   . LEU A 1 417 ? -26.938 -36.848 41.993 1.00 7.30  ? 417 LEU A C   1 
ATOM 2899 O O   . LEU A 1 417 ? -26.465 -36.923 40.859 1.00 7.99  ? 417 LEU A O   1 
ATOM 2900 C CB  . LEU A 1 417 ? -28.960 -35.343 42.218 1.00 8.40  ? 417 LEU A CB  1 
ATOM 2901 C CG  . LEU A 1 417 ? -29.514 -34.031 42.726 1.00 9.26  ? 417 LEU A CG  1 
ATOM 2902 C CD1 . LEU A 1 417 ? -30.927 -33.765 42.188 1.00 13.22 ? 417 LEU A CD1 1 
ATOM 2903 C CD2 . LEU A 1 417 ? -29.626 -34.116 44.329 1.00 10.89 ? 417 LEU A CD2 1 
ATOM 2904 N N   . PRO A 1 418 ? -27.045 -37.934 42.772 1.00 6.86  ? 418 PRO A N   1 
ATOM 2905 C CA  . PRO A 1 418 ? -26.436 -39.205 42.377 1.00 7.23  ? 418 PRO A CA  1 
ATOM 2906 C C   . PRO A 1 418 ? -27.296 -40.085 41.481 1.00 8.58  ? 418 PRO A C   1 
ATOM 2907 O O   . PRO A 1 418 ? -28.533 -40.108 41.727 1.00 12.94 ? 418 PRO A O   1 
ATOM 2908 C CB  . PRO A 1 418 ? -26.202 -39.934 43.737 1.00 8.59  ? 418 PRO A CB  1 
ATOM 2909 C CG  . PRO A 1 418 ? -27.379 -39.441 44.576 1.00 8.16  ? 418 PRO A CG  1 
ATOM 2910 C CD  . PRO A 1 418 ? -27.592 -37.946 44.179 1.00 7.15  ? 418 PRO A CD  1 
ATOM 2911 N N   . LEU A 1 419 ? -26.672 -40.744 40.538 1.00 8.14  ? 419 LEU A N   1 
ATOM 2912 C CA  . LEU A 1 419 ? -27.427 -41.732 39.738 1.00 9.07  ? 419 LEU A CA  1 
ATOM 2913 C C   . LEU A 1 419 ? -27.025 -43.137 40.218 1.00 9.42  ? 419 LEU A C   1 
ATOM 2914 O O   . LEU A 1 419 ? -26.671 -44.014 39.420 1.00 14.12 ? 419 LEU A O   1 
ATOM 2915 C CB  . LEU A 1 419 ? -27.156 -41.540 38.253 1.00 9.53  ? 419 LEU A CB  1 
ATOM 2916 C CG  . LEU A 1 419 ? -27.544 -40.184 37.647 1.00 9.42  ? 419 LEU A CG  1 
ATOM 2917 C CD1 . LEU A 1 419 ? -27.258 -40.209 36.093 1.00 10.39 ? 419 LEU A CD1 1 
ATOM 2918 C CD2 . LEU A 1 419 ? -29.037 -39.896 37.896 1.00 11.39 ? 419 LEU A CD2 1 
ATOM 2919 N N   . PHE A 1 420 ? -27.255 -43.434 41.496 1.00 8.41  ? 420 PHE A N   1 
ATOM 2920 C CA  . PHE A 1 420 ? -26.829 -44.723 41.932 1.00 9.70  ? 420 PHE A CA  1 
ATOM 2921 C C   . PHE A 1 420 ? -27.648 -45.794 41.239 1.00 9.05  ? 420 PHE A C   1 
ATOM 2922 O O   . PHE A 1 420 ? -28.872 -45.607 40.959 1.00 10.14 ? 420 PHE A O   1 
ATOM 2923 C CB  . PHE A 1 420 ? -27.054 -44.858 43.466 1.00 7.87  ? 420 PHE A CB  1 
ATOM 2924 C CG  . PHE A 1 420 ? -26.173 -43.957 44.297 1.00 9.45  ? 420 PHE A CG  1 
ATOM 2925 C CD1 . PHE A 1 420 ? -24.881 -43.566 43.823 1.00 9.70  ? 420 PHE A CD1 1 
ATOM 2926 C CD2 . PHE A 1 420 ? -26.643 -43.534 45.514 1.00 10.46 ? 420 PHE A CD2 1 
ATOM 2927 C CE1 . PHE A 1 420 ? -24.081 -42.728 44.698 1.00 8.97  ? 420 PHE A CE1 1 
ATOM 2928 C CE2 . PHE A 1 420 ? -25.837 -42.700 46.343 1.00 10.20 ? 420 PHE A CE2 1 
ATOM 2929 C CZ  . PHE A 1 420 ? -24.555 -42.368 45.954 1.00 11.84 ? 420 PHE A CZ  1 
ATOM 2930 N N   . ASP A 1 421 ? -26.980 -46.955 41.132 1.00 9.38  ? 421 ASP A N   1 
ATOM 2931 C CA  . ASP A 1 421 ? -27.720 -48.043 40.386 1.00 11.07 ? 421 ASP A CA  1 
ATOM 2932 C C   . ASP A 1 421 ? -28.992 -48.454 41.090 1.00 10.97 ? 421 ASP A C   1 
ATOM 2933 O O   . ASP A 1 421 ? -29.963 -48.914 40.403 1.00 9.90  ? 421 ASP A O   1 
ATOM 2934 C CB  . ASP A 1 421 ? -26.813 -49.268 40.270 1.00 12.57 ? 421 ASP A CB  1 
ATOM 2935 C CG  . ASP A 1 421 ? -27.337 -50.280 39.243 1.00 19.95 ? 421 ASP A CG  1 
ATOM 2936 O OD1 . ASP A 1 421 ? -27.504 -49.943 38.006 1.00 24.19 ? 421 ASP A OD1 1 
ATOM 2937 O OD2 . ASP A 1 421 ? -27.651 -51.413 39.747 1.00 25.36 ? 421 ASP A OD2 1 
ATOM 2938 N N   . GLU A 1 422 ? -29.113 -48.339 42.417 1.00 11.28 ? 422 GLU A N   1 
ATOM 2939 C CA  . GLU A 1 422 ? -30.284 -48.724 43.114 1.00 10.51 ? 422 GLU A CA  1 
ATOM 2940 C C   . GLU A 1 422 ? -31.580 -47.997 42.649 1.00 12.01 ? 422 GLU A C   1 
ATOM 2941 O O   . GLU A 1 422 ? -32.662 -48.538 42.734 1.00 13.49 ? 422 GLU A O   1 
ATOM 2942 C CB  . GLU A 1 422 ? -30.147 -48.444 44.634 1.00 12.30 ? 422 GLU A CB  1 
ATOM 2943 C CG  . GLU A 1 422 ? -29.098 -49.357 45.336 1.00 13.29 ? 422 GLU A CG  1 
ATOM 2944 C CD  . GLU A 1 422 ? -27.657 -49.109 45.130 1.00 17.30 ? 422 GLU A CD  1 
ATOM 2945 O OE1 . GLU A 1 422 ? -27.228 -48.138 44.484 1.00 15.19 ? 422 GLU A OE1 1 
ATOM 2946 O OE2 . GLU A 1 422 ? -26.860 -49.951 45.592 1.00 17.20 ? 422 GLU A OE2 1 
ATOM 2947 N N   . TYR A 1 423 ? -31.428 -46.772 42.057 1.00 9.39  ? 423 TYR A N   1 
ATOM 2948 C CA  . TYR A 1 423 ? -32.602 -46.063 41.578 1.00 9.02  ? 423 TYR A CA  1 
ATOM 2949 C C   . TYR A 1 423 ? -33.109 -46.618 40.257 1.00 11.63 ? 423 TYR A C   1 
ATOM 2950 O O   . TYR A 1 423 ? -34.271 -46.390 39.963 1.00 11.04 ? 423 TYR A O   1 
ATOM 2951 C CB  . TYR A 1 423 ? -32.233 -44.597 41.411 1.00 9.38  ? 423 TYR A CB  1 
ATOM 2952 C CG  . TYR A 1 423 ? -31.861 -43.915 42.715 1.00 8.73  ? 423 TYR A CG  1 
ATOM 2953 C CD1 . TYR A 1 423 ? -30.546 -43.579 42.986 1.00 6.76  ? 423 TYR A CD1 1 
ATOM 2954 C CD2 . TYR A 1 423 ? -32.864 -43.555 43.626 1.00 9.82  ? 423 TYR A CD2 1 
ATOM 2955 C CE1 . TYR A 1 423 ? -30.192 -42.909 44.137 1.00 9.29  ? 423 TYR A CE1 1 
ATOM 2956 C CE2 . TYR A 1 423 ? -32.484 -42.909 44.848 1.00 11.25 ? 423 TYR A CE2 1 
ATOM 2957 C CZ  . TYR A 1 423 ? -31.152 -42.619 45.062 1.00 10.12 ? 423 TYR A CZ  1 
ATOM 2958 O OH  . TYR A 1 423 ? -30.867 -41.909 46.275 1.00 10.65 ? 423 TYR A OH  1 
ATOM 2959 N N   . GLN A 1 424 ? -32.269 -47.375 39.543 1.00 10.81 ? 424 GLN A N   1 
ATOM 2960 C CA  . GLN A 1 424 ? -32.644 -47.819 38.168 1.00 10.86 ? 424 GLN A CA  1 
ATOM 2961 C C   . GLN A 1 424 ? -33.815 -48.734 38.173 1.00 12.52 ? 424 GLN A C   1 
ATOM 2962 O O   . GLN A 1 424 ? -34.648 -48.678 37.237 1.00 10.28 ? 424 GLN A O   1 
ATOM 2963 C CB  . GLN A 1 424 ? -31.430 -48.567 37.593 1.00 11.07 ? 424 GLN A CB  1 
ATOM 2964 C CG  . GLN A 1 424 ? -30.229 -47.602 37.392 1.00 12.25 ? 424 GLN A CG  1 
ATOM 2965 C CD  . GLN A 1 424 ? -30.489 -46.410 36.421 1.00 11.41 ? 424 GLN A CD  1 
ATOM 2966 O OE1 . GLN A 1 424 ? -31.142 -46.536 35.353 1.00 12.06 ? 424 GLN A OE1 1 
ATOM 2967 N NE2 . GLN A 1 424 ? -29.994 -45.217 36.788 1.00 11.49 ? 424 GLN A NE2 1 
ATOM 2968 N N   . GLU A 1 425 ? -33.980 -49.582 39.204 1.00 11.05 ? 425 GLU A N   1 
ATOM 2969 C CA  . GLU A 1 425 ? -35.105 -50.552 39.177 1.00 11.47 ? 425 GLU A CA  1 
ATOM 2970 C C   . GLU A 1 425 ? -36.449 -49.920 39.216 1.00 10.76 ? 425 GLU A C   1 
ATOM 2971 O O   . GLU A 1 425 ? -37.474 -50.541 38.880 1.00 13.23 ? 425 GLU A O   1 
ATOM 2972 C CB  . GLU A 1 425 ? -34.915 -51.605 40.230 1.00 15.75 ? 425 GLU A CB  1 
ATOM 2973 C CG  . GLU A 1 425 ? -34.920 -51.229 41.587 1.00 20.77 ? 425 GLU A CG  1 
ATOM 2974 C CD  . GLU A 1 425 ? -34.974 -52.457 42.513 1.00 36.96 ? 425 GLU A CD  1 
ATOM 2975 O OE1 . GLU A 1 425 ? -34.830 -53.629 42.064 1.00 42.14 ? 425 GLU A OE1 1 
ATOM 2976 O OE2 . GLU A 1 425 ? -35.145 -52.232 43.717 1.00 42.81 ? 425 GLU A OE2 1 
ATOM 2977 N N   . GLN A 1 426 ? -36.469 -48.645 39.678 1.00 9.64  ? 426 GLN A N   1 
ATOM 2978 C CA  . GLN A 1 426 ? -37.737 -47.933 39.705 1.00 9.65  ? 426 GLN A CA  1 
ATOM 2979 C C   . GLN A 1 426 ? -38.339 -47.742 38.318 1.00 12.00 ? 426 GLN A C   1 
ATOM 2980 O O   . GLN A 1 426 ? -39.579 -47.522 38.232 1.00 13.46 ? 426 GLN A O   1 
ATOM 2981 C CB  . GLN A 1 426 ? -37.535 -46.561 40.354 1.00 10.38 ? 426 GLN A CB  1 
ATOM 2982 C CG  . GLN A 1 426 ? -37.174 -46.702 41.891 1.00 12.81 ? 426 GLN A CG  1 
ATOM 2983 C CD  . GLN A 1 426 ? -36.886 -45.366 42.590 1.00 12.43 ? 426 GLN A CD  1 
ATOM 2984 O OE1 . GLN A 1 426 ? -36.489 -44.362 41.972 1.00 16.81 ? 426 GLN A OE1 1 
ATOM 2985 N NE2 . GLN A 1 426 ? -37.083 -45.368 43.895 1.00 12.15 ? 426 GLN A NE2 1 
ATOM 2986 N N   . LEU A 1 427 ? -37.498 -47.832 37.291 1.00 9.88  ? 427 LEU A N   1 
ATOM 2987 C CA  . LEU A 1 427 ? -38.015 -47.740 35.914 1.00 9.61  ? 427 LEU A CA  1 
ATOM 2988 C C   . LEU A 1 427 ? -38.345 -49.071 35.306 1.00 13.61 ? 427 LEU A C   1 
ATOM 2989 O O   . LEU A 1 427 ? -38.752 -49.159 34.155 1.00 15.13 ? 427 LEU A O   1 
ATOM 2990 C CB  . LEU A 1 427 ? -36.907 -47.144 35.054 1.00 10.10 ? 427 LEU A CB  1 
ATOM 2991 C CG  . LEU A 1 427 ? -36.451 -45.736 35.476 1.00 7.89  ? 427 LEU A CG  1 
ATOM 2992 C CD1 . LEU A 1 427 ? -35.238 -45.355 34.644 1.00 12.12 ? 427 LEU A CD1 1 
ATOM 2993 C CD2 . LEU A 1 427 ? -37.600 -44.712 35.283 1.00 11.07 ? 427 LEU A CD2 1 
ATOM 2994 N N   . ASP A 1 428 ? -38.291 -50.178 36.047 1.00 13.24 ? 428 ASP A N   1 
ATOM 2995 C CA  . ASP A 1 428 ? -38.587 -51.450 35.388 1.00 13.93 ? 428 ASP A CA  1 
ATOM 2996 C C   . ASP A 1 428 ? -40.056 -51.550 34.970 1.00 12.87 ? 428 ASP A C   1 
ATOM 2997 O O   . ASP A 1 428 ? -40.993 -51.065 35.651 1.00 14.43 ? 428 ASP A O   1 
ATOM 2998 C CB  . ASP A 1 428 ? -38.335 -52.545 36.449 1.00 13.78 ? 428 ASP A CB  1 
ATOM 2999 C CG  . ASP A 1 428 ? -36.858 -52.833 36.642 1.00 18.77 ? 428 ASP A CG  1 
ATOM 3000 O OD1 . ASP A 1 428 ? -35.979 -52.277 35.906 1.00 18.77 ? 428 ASP A OD1 1 
ATOM 3001 O OD2 . ASP A 1 428 ? -36.580 -53.624 37.606 1.00 19.29 ? 428 ASP A OD2 1 
ATOM 3002 N N   . SER A 1 429 ? -40.258 -52.237 33.835 1.00 10.98 ? 429 SER A N   1 
ATOM 3003 C CA  . SER A 1 429 ? -41.601 -52.504 33.310 1.00 9.64  ? 429 SER A CA  1 
ATOM 3004 C C   . SER A 1 429 ? -41.675 -54.011 33.118 1.00 9.60  ? 429 SER A C   1 
ATOM 3005 O O   . SER A 1 429 ? -40.750 -54.701 32.647 1.00 10.86 ? 429 SER A O   1 
ATOM 3006 C CB  . SER A 1 429 ? -41.664 -51.824 31.931 1.00 7.89  ? 429 SER A CB  1 
ATOM 3007 O OG  . SER A 1 429 ? -42.779 -52.355 31.195 1.00 9.20  ? 429 SER A OG  1 
ATOM 3008 N N   . PRO A 1 430 ? -42.857 -54.604 33.370 1.00 10.38 ? 430 PRO A N   1 
ATOM 3009 C CA  . PRO A 1 430 ? -43.004 -56.003 33.085 1.00 11.69 ? 430 PRO A CA  1 
ATOM 3010 C C   . PRO A 1 430 ? -43.082 -56.297 31.598 1.00 12.19 ? 430 PRO A C   1 
ATOM 3011 O O   . PRO A 1 430 ? -42.955 -57.515 31.170 1.00 14.88 ? 430 PRO A O   1 
ATOM 3012 C CB  . PRO A 1 430 ? -44.390 -56.377 33.650 1.00 15.09 ? 430 PRO A CB  1 
ATOM 3013 C CG  . PRO A 1 430 ? -45.004 -55.166 34.161 1.00 16.36 ? 430 PRO A CG  1 
ATOM 3014 C CD  . PRO A 1 430 ? -43.968 -53.994 34.110 1.00 12.69 ? 430 PRO A CD  1 
ATOM 3015 N N   . PHE A 1 431 ? -43.303 -55.301 30.742 1.00 9.79  ? 431 PHE A N   1 
ATOM 3016 C CA  . PHE A 1 431 ? -43.528 -55.529 29.296 1.00 11.48 ? 431 PHE A CA  1 
ATOM 3017 C C   . PHE A 1 431 ? -42.375 -55.019 28.416 1.00 12.33 ? 431 PHE A C   1 
ATOM 3018 O O   . PHE A 1 431 ? -41.844 -55.718 27.567 1.00 13.39 ? 431 PHE A O   1 
ATOM 3019 C CB  . PHE A 1 431 ? -44.853 -54.792 28.904 1.00 11.94 ? 431 PHE A CB  1 
ATOM 3020 C CG  . PHE A 1 431 ? -46.035 -55.174 29.811 1.00 13.51 ? 431 PHE A CG  1 
ATOM 3021 C CD1 . PHE A 1 431 ? -46.469 -56.494 29.747 1.00 16.49 ? 431 PHE A CD1 1 
ATOM 3022 C CD2 . PHE A 1 431 ? -46.660 -54.242 30.600 1.00 13.72 ? 431 PHE A CD2 1 
ATOM 3023 C CE1 . PHE A 1 431 ? -47.567 -56.917 30.661 1.00 17.40 ? 431 PHE A CE1 1 
ATOM 3024 C CE2 . PHE A 1 431 ? -47.699 -54.581 31.478 1.00 17.50 ? 431 PHE A CE2 1 
ATOM 3025 C CZ  . PHE A 1 431 ? -48.156 -55.948 31.480 1.00 16.70 ? 431 PHE A CZ  1 
ATOM 3026 N N   . ALA A 1 432 ? -41.930 -53.827 28.698 1.00 9.96  ? 432 ALA A N   1 
ATOM 3027 C CA  . ALA A 1 432 ? -40.910 -53.175 27.834 1.00 7.80  ? 432 ALA A CA  1 
ATOM 3028 C C   . ALA A 1 432 ? -39.540 -53.195 28.578 1.00 7.66  ? 432 ALA A C   1 
ATOM 3029 O O   . ALA A 1 432 ? -39.393 -53.584 29.760 1.00 10.34 ? 432 ALA A O   1 
ATOM 3030 C CB  . ALA A 1 432 ? -41.323 -51.743 27.543 1.00 7.69  ? 432 ALA A CB  1 
ATOM 3031 N N   . ASP A 1 433 ? -38.491 -52.718 27.838 1.00 7.26  ? 433 ASP A N   1 
ATOM 3032 C CA  . ASP A 1 433 ? -37.152 -52.656 28.448 1.00 8.99  ? 433 ASP A CA  1 
ATOM 3033 C C   . ASP A 1 433 ? -37.162 -51.708 29.663 1.00 10.10 ? 433 ASP A C   1 
ATOM 3034 O O   . ASP A 1 433 ? -36.379 -51.864 30.627 1.00 14.10 ? 433 ASP A O   1 
ATOM 3035 C CB  . ASP A 1 433 ? -36.169 -52.155 27.405 1.00 8.57  ? 433 ASP A CB  1 
ATOM 3036 C CG  . ASP A 1 433 ? -35.935 -53.179 26.323 1.00 9.44  ? 433 ASP A CG  1 
ATOM 3037 O OD1 . ASP A 1 433 ? -36.126 -54.413 26.594 1.00 10.35 ? 433 ASP A OD1 1 
ATOM 3038 O OD2 . ASP A 1 433 ? -35.531 -52.806 25.221 1.00 10.56 ? 433 ASP A OD2 1 
ATOM 3039 N N   . MET A 1 434 ? -38.007 -50.658 29.624 1.00 7.68  ? 434 MET A N   1 
ATOM 3040 C CA  . MET A 1 434 ? -38.128 -49.753 30.770 1.00 8.04  ? 434 MET A CA  1 
ATOM 3041 C C   . MET A 1 434 ? -39.467 -49.012 30.645 1.00 6.31  ? 434 MET A C   1 
ATOM 3042 O O   . MET A 1 434 ? -40.050 -48.973 29.519 1.00 8.14  ? 434 MET A O   1 
ATOM 3043 C CB  . MET A 1 434 ? -37.020 -48.645 30.750 1.00 8.78  ? 434 MET A CB  1 
ATOM 3044 C CG  . MET A 1 434 ? -37.130 -47.712 29.532 1.00 8.49  ? 434 MET A CG  1 
ATOM 3045 S SD  . MET A 1 434 ? -35.579 -46.796 29.266 1.00 10.28 ? 434 MET A SD  1 
ATOM 3046 C CE  . MET A 1 434 ? -34.730 -48.103 28.323 1.00 12.59 ? 434 MET A CE  1 
ATOM 3047 N N   . GLY A 1 435 ? -39.945 -48.498 31.772 1.00 6.46  ? 435 GLY A N   1 
ATOM 3048 C CA  . GLY A 1 435 ? -41.016 -47.467 31.773 1.00 6.58  ? 435 GLY A CA  1 
ATOM 3049 C C   . GLY A 1 435 ? -40.418 -46.114 31.784 1.00 6.53  ? 435 GLY A C   1 
ATOM 3050 O O   . GLY A 1 435 ? -39.223 -45.922 32.053 1.00 9.01  ? 435 GLY A O   1 
ATOM 3051 N N   . ASN A 1 436 ? -41.280 -45.098 31.556 1.00 6.00  ? 436 ASN A N   1 
ATOM 3052 C CA  . ASN A 1 436 ? -40.721 -43.719 31.538 1.00 7.43  ? 436 ASN A CA  1 
ATOM 3053 C C   . ASN A 1 436 ? -40.885 -43.022 32.895 1.00 9.12  ? 436 ASN A C   1 
ATOM 3054 O O   . ASN A 1 436 ? -40.618 -41.792 32.949 1.00 11.45 ? 436 ASN A O   1 
ATOM 3055 C CB  . ASN A 1 436 ? -41.288 -42.833 30.379 1.00 8.07  ? 436 ASN A CB  1 
ATOM 3056 C CG  . ASN A 1 436 ? -42.783 -42.474 30.515 1.00 8.21  ? 436 ASN A CG  1 
ATOM 3057 O OD1 . ASN A 1 436 ? -43.562 -43.200 31.185 1.00 6.98  ? 436 ASN A OD1 1 
ATOM 3058 N ND2 . ASN A 1 436 ? -43.158 -41.325 29.976 1.00 6.98  ? 436 ASN A ND2 1 
ATOM 3059 N N   . ILE A 1 437 ? -41.463 -43.679 33.907 1.00 8.03  ? 437 ILE A N   1 
ATOM 3060 C CA  . ILE A 1 437 ? -41.613 -43.037 35.252 1.00 9.03  ? 437 ILE A CA  1 
ATOM 3061 C C   . ILE A 1 437 ? -41.074 -43.998 36.272 1.00 10.31 ? 437 ILE A C   1 
ATOM 3062 O O   . ILE A 1 437 ? -41.141 -45.215 36.128 1.00 11.34 ? 437 ILE A O   1 
ATOM 3063 C CB  . ILE A 1 437 ? -43.067 -42.627 35.523 1.00 9.04  ? 437 ILE A CB  1 
ATOM 3064 C CG1 . ILE A 1 437 ? -43.977 -43.832 35.440 1.00 11.75 ? 437 ILE A CG1 1 
ATOM 3065 C CG2 . ILE A 1 437 ? -43.516 -41.564 34.518 1.00 14.60 ? 437 ILE A CG2 1 
ATOM 3066 C CD1 . ILE A 1 437 ? -45.475 -43.523 35.968 1.00 16.08 ? 437 ILE A CD1 1 
ATOM 3067 N N   . GLY A 1 438 ? -40.611 -43.376 37.366 1.00 11.58 ? 438 GLY A N   1 
ATOM 3068 C CA  . GLY A 1 438 ? -40.105 -44.135 38.590 1.00 12.99 ? 438 GLY A CA  1 
ATOM 3069 C C   . GLY A 1 438 ? -40.898 -44.023 39.855 1.00 14.28 ? 438 GLY A C   1 
ATOM 3070 O O   . GLY A 1 438 ? -40.450 -44.567 40.839 1.00 13.12 ? 438 GLY A O   1 
ATOM 3071 N N   . GLY A 1 439 ? -42.060 -43.382 39.816 1.00 14.81 ? 439 GLY A N   1 
ATOM 3072 C CA  . GLY A 1 439 ? -42.874 -43.286 41.106 1.00 14.33 ? 439 GLY A CA  1 
ATOM 3073 C C   . GLY A 1 439 ? -42.519 -42.019 41.821 1.00 13.75 ? 439 GLY A C   1 
ATOM 3074 O O   . GLY A 1 439 ? -41.747 -41.148 41.314 1.00 15.07 ? 439 GLY A O   1 
ATOM 3075 N N   . PRO A 1 440 ? -43.102 -41.854 43.011 1.00 16.44 ? 440 PRO A N   1 
ATOM 3076 C CA  . PRO A 1 440 ? -42.989 -40.603 43.769 1.00 17.84 ? 440 PRO A CA  1 
ATOM 3077 C C   . PRO A 1 440 ? -41.613 -40.330 44.405 1.00 16.79 ? 440 PRO A C   1 
ATOM 3078 O O   . PRO A 1 440 ? -41.370 -39.193 44.826 1.00 20.07 ? 440 PRO A O   1 
ATOM 3079 C CB  . PRO A 1 440 ? -44.058 -40.788 44.882 1.00 18.53 ? 440 PRO A CB  1 
ATOM 3080 C CG  . PRO A 1 440 ? -44.238 -42.300 45.031 1.00 19.81 ? 440 PRO A CG  1 
ATOM 3081 C CD  . PRO A 1 440 ? -43.927 -42.912 43.641 1.00 18.18 ? 440 PRO A CD  1 
ATOM 3082 N N   . LYS A 1 441 ? -40.766 -41.335 44.571 1.00 13.43 ? 441 LYS A N   1 
ATOM 3083 C CA  . LYS A 1 441 ? -39.497 -41.173 45.289 1.00 13.44 ? 441 LYS A CA  1 
ATOM 3084 C C   . LYS A 1 441 ? -38.405 -40.883 44.264 1.00 13.16 ? 441 LYS A C   1 
ATOM 3085 O O   . LYS A 1 441 ? -38.278 -41.591 43.232 1.00 13.18 ? 441 LYS A O   1 
ATOM 3086 C CB  . LYS A 1 441 ? -39.153 -42.473 45.973 1.00 13.80 ? 441 LYS A CB  1 
ATOM 3087 C CG  . LYS A 1 441 ? -40.295 -42.843 47.033 1.00 16.03 ? 441 LYS A CG  1 
ATOM 3088 C CD  . LYS A 1 441 ? -39.805 -44.002 47.900 1.00 18.67 ? 441 LYS A CD  1 
ATOM 3089 C CE  . LYS A 1 441 ? -40.886 -44.365 48.870 1.00 21.19 ? 441 LYS A CE  1 
ATOM 3090 N NZ  . LYS A 1 441 ? -40.325 -45.427 49.833 1.00 28.84 ? 441 LYS A NZ  1 
ATOM 3091 N N   . ALA A 1 442 ? -37.561 -39.899 44.614 1.00 12.06 ? 442 ALA A N   1 
ATOM 3092 C CA  . ALA A 1 442 ? -36.355 -39.569 43.802 1.00 10.64 ? 442 ALA A CA  1 
ATOM 3093 C C   . ALA A 1 442 ? -36.705 -39.219 42.332 1.00 10.17 ? 442 ALA A C   1 
ATOM 3094 O O   . ALA A 1 442 ? -36.016 -39.671 41.469 1.00 8.62  ? 442 ALA A O   1 
ATOM 3095 C CB  . ALA A 1 442 ? -35.306 -40.691 43.938 1.00 11.79 ? 442 ALA A CB  1 
ATOM 3096 N N   . GLY A 1 443 ? -37.726 -38.403 42.117 1.00 10.54 ? 443 GLY A N   1 
ATOM 3097 C CA  . GLY A 1 443 ? -38.136 -38.177 40.722 1.00 9.68  ? 443 GLY A CA  1 
ATOM 3098 C C   . GLY A 1 443 ? -37.133 -37.477 39.790 1.00 8.89  ? 443 GLY A C   1 
ATOM 3099 O O   . GLY A 1 443 ? -36.997 -37.793 38.608 1.00 9.92  ? 443 GLY A O   1 
ATOM 3100 N N   . THR A 1 444 ? -36.323 -36.545 40.359 1.00 8.23  ? 444 THR A N   1 
ATOM 3101 C CA  . THR A 1 444 ? -35.303 -35.889 39.493 1.00 7.39  ? 444 THR A CA  1 
ATOM 3102 C C   . THR A 1 444 ? -34.262 -36.932 39.111 1.00 6.85  ? 444 THR A C   1 
ATOM 3103 O O   . THR A 1 444 ? -33.789 -37.007 37.984 1.00 6.35  ? 444 THR A O   1 
ATOM 3104 C CB  . THR A 1 444 ? -34.608 -34.785 40.301 1.00 8.01  ? 444 THR A CB  1 
ATOM 3105 O OG1 . THR A 1 444 ? -35.676 -33.877 40.705 1.00 11.81 ? 444 THR A OG1 1 
ATOM 3106 C CG2 . THR A 1 444 ? -33.570 -34.005 39.540 1.00 9.42  ? 444 THR A CG2 1 
ATOM 3107 N N   . ILE A 1 445 ? -33.846 -37.766 40.097 1.00 6.74  ? 445 ILE A N   1 
ATOM 3108 C CA  . ILE A 1 445 ? -32.795 -38.828 39.892 1.00 7.97  ? 445 ILE A CA  1 
ATOM 3109 C C   . ILE A 1 445 ? -33.340 -39.871 38.925 1.00 8.69  ? 445 ILE A C   1 
ATOM 3110 O O   . ILE A 1 445 ? -32.602 -40.307 38.011 1.00 7.73  ? 445 ILE A O   1 
ATOM 3111 C CB  . ILE A 1 445 ? -32.417 -39.434 41.254 1.00 8.08  ? 445 ILE A CB  1 
ATOM 3112 C CG1 . ILE A 1 445 ? -31.572 -38.391 42.048 1.00 8.55  ? 445 ILE A CG1 1 
ATOM 3113 C CG2 . ILE A 1 445 ? -31.683 -40.782 41.031 1.00 6.82  ? 445 ILE A CG2 1 
ATOM 3114 C CD1 . ILE A 1 445 ? -31.349 -38.881 43.463 1.00 11.61 ? 445 ILE A CD1 1 
ATOM 3115 N N   . THR A 1 446 ? -34.615 -40.295 39.071 1.00 7.84  ? 446 THR A N   1 
ATOM 3116 C CA  . THR A 1 446 ? -35.044 -41.395 38.151 1.00 7.93  ? 446 THR A CA  1 
ATOM 3117 C C   . THR A 1 446 ? -35.181 -40.884 36.734 1.00 7.22  ? 446 THR A C   1 
ATOM 3118 O O   . THR A 1 446 ? -34.913 -41.671 35.813 1.00 6.89  ? 446 THR A O   1 
ATOM 3119 C CB  . THR A 1 446 ? -36.309 -42.137 38.568 1.00 8.98  ? 446 THR A CB  1 
ATOM 3120 O OG1 . THR A 1 446 ? -37.334 -41.155 38.691 1.00 11.39 ? 446 THR A OG1 1 
ATOM 3121 C CG2 . THR A 1 446 ? -36.115 -42.745 39.956 1.00 10.89 ? 446 THR A CG2 1 
ATOM 3122 N N   . ALA A 1 447 ? -35.528 -39.593 36.545 1.00 8.19  ? 447 ALA A N   1 
ATOM 3123 C CA  . ALA A 1 447 ? -35.480 -39.062 35.200 1.00 7.30  ? 447 ALA A CA  1 
ATOM 3124 C C   . ALA A 1 447 ? -34.067 -39.054 34.612 1.00 7.09  ? 447 ALA A C   1 
ATOM 3125 O O   . ALA A 1 447 ? -33.828 -39.393 33.446 1.00 6.75  ? 447 ALA A O   1 
ATOM 3126 C CB  . ALA A 1 447 ? -36.051 -37.614 35.162 1.00 7.47  ? 447 ALA A CB  1 
ATOM 3127 N N   . GLY A 1 448 ? -33.091 -38.647 35.473 1.00 6.80  ? 448 GLY A N   1 
ATOM 3128 C CA  . GLY A 1 448 ? -31.673 -38.769 35.055 1.00 7.04  ? 448 GLY A CA  1 
ATOM 3129 C C   . GLY A 1 448 ? -31.259 -40.172 34.739 1.00 7.43  ? 448 GLY A C   1 
ATOM 3130 O O   . GLY A 1 448 ? -30.524 -40.460 33.808 1.00 6.33  ? 448 GLY A O   1 
ATOM 3131 N N   . CYS A 1 449 ? -31.745 -41.099 35.579 1.00 8.12  ? 449 CYS A N   1 
ATOM 3132 C CA  . CYS A 1 449 ? -31.474 -42.521 35.303 1.00 8.05  ? 449 CYS A CA  1 
ATOM 3133 C C   . CYS A 1 449 ? -31.986 -43.049 34.004 1.00 7.62  ? 449 CYS A C   1 
ATOM 3134 O O   . CYS A 1 449 ? -31.293 -43.775 33.267 1.00 8.35  ? 449 CYS A O   1 
ATOM 3135 C CB  . CYS A 1 449 ? -32.062 -43.443 36.408 1.00 7.08  ? 449 CYS A CB  1 
ATOM 3136 S SG  . CYS A 1 449 ? -31.060 -43.439 37.949 1.00 9.71  ? 449 CYS A SG  1 
ATOM 3137 N N   . PHE A 1 450 ? -33.215 -42.577 33.683 1.00 6.06  ? 450 PHE A N   1 
ATOM 3138 C CA  . PHE A 1 450 ? -33.813 -42.938 32.364 1.00 6.12  ? 450 PHE A CA  1 
ATOM 3139 C C   . PHE A 1 450 ? -32.892 -42.455 31.248 1.00 5.62  ? 450 PHE A C   1 
ATOM 3140 O O   . PHE A 1 450 ? -32.529 -43.228 30.378 1.00 7.42  ? 450 PHE A O   1 
ATOM 3141 C CB  . PHE A 1 450 ? -35.203 -42.284 32.304 1.00 6.47  ? 450 PHE A CB  1 
ATOM 3142 C CG  . PHE A 1 450 ? -35.955 -42.565 31.009 1.00 5.71  ? 450 PHE A CG  1 
ATOM 3143 C CD1 . PHE A 1 450 ? -35.791 -41.749 29.941 1.00 5.80  ? 450 PHE A CD1 1 
ATOM 3144 C CD2 . PHE A 1 450 ? -36.846 -43.644 30.898 1.00 6.85  ? 450 PHE A CD2 1 
ATOM 3145 C CE1 . PHE A 1 450 ? -36.393 -41.956 28.679 1.00 7.12  ? 450 PHE A CE1 1 
ATOM 3146 C CE2 . PHE A 1 450 ? -37.528 -43.852 29.615 1.00 6.07  ? 450 PHE A CE2 1 
ATOM 3147 C CZ  . PHE A 1 450 ? -37.261 -43.013 28.490 1.00 6.58  ? 450 PHE A CZ  1 
ATOM 3148 N N   . LEU A 1 451 ? -32.506 -41.176 31.349 1.00 6.40  ? 451 LEU A N   1 
ATOM 3149 C CA  . LEU A 1 451 ? -31.683 -40.605 30.267 1.00 6.71  ? 451 LEU A CA  1 
ATOM 3150 C C   . LEU A 1 451 ? -30.326 -41.307 30.187 1.00 6.76  ? 451 LEU A C   1 
ATOM 3151 O O   . LEU A 1 451 ? -29.841 -41.487 29.037 1.00 7.62  ? 451 LEU A O   1 
ATOM 3152 C CB  . LEU A 1 451 ? -31.484 -39.084 30.499 1.00 7.02  ? 451 LEU A CB  1 
ATOM 3153 C CG  . LEU A 1 451 ? -32.800 -38.292 30.309 1.00 8.23  ? 451 LEU A CG  1 
ATOM 3154 C CD1 . LEU A 1 451 ? -32.468 -36.835 30.815 1.00 9.09  ? 451 LEU A CD1 1 
ATOM 3155 C CD2 . LEU A 1 451 ? -33.365 -38.320 28.886 1.00 9.64  ? 451 LEU A CD2 1 
ATOM 3156 N N   . SER A 1 452 ? -29.775 -41.698 31.315 1.00 7.09  ? 452 SER A N   1 
ATOM 3157 C CA  . SER A 1 452 ? -28.434 -42.322 31.298 1.00 8.31  ? 452 SER A CA  1 
ATOM 3158 C C   . SER A 1 452 ? -28.375 -43.550 30.429 1.00 9.91  ? 452 SER A C   1 
ATOM 3159 O O   . SER A 1 452 ? -27.305 -43.897 29.963 1.00 7.68  ? 452 SER A O   1 
ATOM 3160 C CB  . SER A 1 452 ? -27.992 -42.601 32.723 1.00 6.46  ? 452 SER A CB  1 
ATOM 3161 O OG  . SER A 1 452 ? -28.650 -43.752 33.286 1.00 8.62  ? 452 SER A OG  1 
ATOM 3162 N N   . ARG A 1 453 ? -29.512 -44.236 30.291 1.00 6.50  ? 453 ARG A N   1 
ATOM 3163 C CA  . ARG A 1 453 ? -29.528 -45.492 29.513 1.00 5.93  ? 453 ARG A CA  1 
ATOM 3164 C C   . ARG A 1 453 ? -29.400 -45.218 28.045 1.00 7.79  ? 453 ARG A C   1 
ATOM 3165 O O   . ARG A 1 453 ? -29.199 -46.197 27.266 1.00 10.29 ? 453 ARG A O   1 
ATOM 3166 C CB  . ARG A 1 453 ? -30.835 -46.193 29.684 1.00 7.01  ? 453 ARG A CB  1 
ATOM 3167 C CG  . ARG A 1 453 ? -31.072 -46.580 31.158 1.00 6.96  ? 453 ARG A CG  1 
ATOM 3168 C CD  . ARG A 1 453 ? -32.247 -47.463 31.247 1.00 11.71 ? 453 ARG A CD  1 
ATOM 3169 N NE  . ARG A 1 453 ? -32.570 -47.767 32.660 1.00 12.23 ? 453 ARG A NE  1 
ATOM 3170 C CZ  . ARG A 1 453 ? -33.287 -48.828 33.033 1.00 12.04 ? 453 ARG A CZ  1 
ATOM 3171 N NH1 . ARG A 1 453 ? -33.731 -49.712 32.208 1.00 11.48 ? 453 ARG A NH1 1 
ATOM 3172 N NH2 . ARG A 1 453 ? -33.601 -48.939 34.330 1.00 11.35 ? 453 ARG A NH2 1 
ATOM 3173 N N   . PHE A 1 454 ? -29.349 -43.958 27.654 1.00 7.98  ? 454 PHE A N   1 
ATOM 3174 C CA  . PHE A 1 454 ? -29.170 -43.593 26.225 1.00 6.93  ? 454 PHE A CA  1 
ATOM 3175 C C   . PHE A 1 454 ? -27.886 -42.832 25.953 1.00 7.00  ? 454 PHE A C   1 
ATOM 3176 O O   . PHE A 1 454 ? -27.581 -42.464 24.803 1.00 8.65  ? 454 PHE A O   1 
ATOM 3177 C CB  . PHE A 1 454 ? -30.359 -42.717 25.758 1.00 5.99  ? 454 PHE A CB  1 
ATOM 3178 C CG  . PHE A 1 454 ? -31.668 -43.449 25.932 1.00 5.26  ? 454 PHE A CG  1 
ATOM 3179 C CD1 . PHE A 1 454 ? -32.310 -43.497 27.186 1.00 7.52  ? 454 PHE A CD1 1 
ATOM 3180 C CD2 . PHE A 1 454 ? -32.244 -44.062 24.833 1.00 7.85  ? 454 PHE A CD2 1 
ATOM 3181 C CE1 . PHE A 1 454 ? -33.564 -44.186 27.330 1.00 8.07  ? 454 PHE A CE1 1 
ATOM 3182 C CE2 . PHE A 1 454 ? -33.440 -44.803 24.957 1.00 6.98  ? 454 PHE A CE2 1 
ATOM 3183 C CZ  . PHE A 1 454 ? -34.080 -44.832 26.199 1.00 6.71  ? 454 PHE A CZ  1 
ATOM 3184 N N   . ALA A 1 455 ? -27.150 -42.694 27.045 1.00 7.25  ? 455 ALA A N   1 
ATOM 3185 C CA  . ALA A 1 455 ? -25.874 -41.882 27.037 1.00 6.94  ? 455 ALA A CA  1 
ATOM 3186 C C   . ALA A 1 455 ? -24.588 -42.673 27.262 1.00 8.42  ? 455 ALA A C   1 
ATOM 3187 O O   . ALA A 1 455 ? -23.518 -42.061 27.494 1.00 9.30  ? 455 ALA A O   1 
ATOM 3188 C CB  . ALA A 1 455 ? -26.015 -40.730 28.059 1.00 8.28  ? 455 ALA A CB  1 
ATOM 3189 N N   . LYS A 1 456 ? -24.662 -44.001 27.120 1.00 7.95  ? 456 LYS A N   1 
ATOM 3190 C CA  . LYS A 1 456 ? -23.514 -44.813 27.474 1.00 8.52  ? 456 LYS A CA  1 
ATOM 3191 C C   . LYS A 1 456 ? -22.376 -44.655 26.527 1.00 9.43  ? 456 LYS A C   1 
ATOM 3192 O O   . LYS A 1 456 ? -21.252 -44.996 26.962 1.00 12.63 ? 456 LYS A O   1 
ATOM 3193 C CB  . LYS A 1 456 ? -23.895 -46.288 27.714 1.00 10.12 ? 456 LYS A CB  1 
ATOM 3194 C CG  . LYS A 1 456 ? -24.869 -46.482 28.858 1.00 14.66 ? 456 LYS A CG  1 
ATOM 3195 C CD  . LYS A 1 456 ? -25.403 -47.924 28.903 1.00 16.26 ? 456 LYS A CD  1 
ATOM 3196 C CE  . LYS A 1 456 ? -26.028 -48.016 30.316 1.00 26.16 ? 456 LYS A CE  1 
ATOM 3197 N NZ  . LYS A 1 456 ? -27.076 -49.052 30.543 1.00 35.58 ? 456 LYS A NZ  1 
ATOM 3198 N N   . ALA A 1 457 ? -22.556 -44.116 25.357 1.00 9.28  ? 457 ALA A N   1 
ATOM 3199 C CA  . ALA A 1 457 ? -21.488 -44.083 24.323 1.00 9.96  ? 457 ALA A CA  1 
ATOM 3200 C C   . ALA A 1 457 ? -20.514 -42.950 24.555 1.00 9.37  ? 457 ALA A C   1 
ATOM 3201 O O   . ALA A 1 457 ? -19.520 -42.885 23.781 1.00 10.85 ? 457 ALA A O   1 
ATOM 3202 C CB  . ALA A 1 457 ? -22.083 -43.937 22.861 1.00 12.16 ? 457 ALA A CB  1 
ATOM 3203 N N   . TYR A 1 458 ? -20.776 -42.039 25.490 1.00 7.43  ? 458 TYR A N   1 
ATOM 3204 C CA  . TYR A 1 458 ? -19.986 -40.800 25.525 1.00 6.08  ? 458 TYR A CA  1 
ATOM 3205 C C   . TYR A 1 458 ? -20.043 -40.196 26.936 1.00 6.52  ? 458 TYR A C   1 
ATOM 3206 O O   . TYR A 1 458 ? -20.772 -40.695 27.789 1.00 8.41  ? 458 TYR A O   1 
ATOM 3207 C CB  . TYR A 1 458 ? -20.360 -39.751 24.459 1.00 6.64  ? 458 TYR A CB  1 
ATOM 3208 C CG  . TYR A 1 458 ? -21.903 -39.606 24.294 1.00 5.13  ? 458 TYR A CG  1 
ATOM 3209 C CD1 . TYR A 1 458 ? -22.670 -39.171 25.391 1.00 6.10  ? 458 TYR A CD1 1 
ATOM 3210 C CD2 . TYR A 1 458 ? -22.490 -39.862 23.062 1.00 7.33  ? 458 TYR A CD2 1 
ATOM 3211 C CE1 . TYR A 1 458 ? -24.076 -39.020 25.240 1.00 5.38  ? 458 TYR A CE1 1 
ATOM 3212 C CE2 . TYR A 1 458 ? -23.942 -39.689 22.889 1.00 8.14  ? 458 TYR A CE2 1 
ATOM 3213 C CZ  . TYR A 1 458 ? -24.633 -39.316 24.027 1.00 7.30  ? 458 TYR A CZ  1 
ATOM 3214 O OH  . TYR A 1 458 ? -26.009 -39.119 23.957 1.00 8.29  ? 458 TYR A OH  1 
ATOM 3215 N N   . ASN A 1 459 ? -19.207 -39.191 27.191 1.00 7.16  ? 459 ASN A N   1 
ATOM 3216 C CA  . ASN A 1 459 ? -19.230 -38.496 28.544 1.00 6.75  ? 459 ASN A CA  1 
ATOM 3217 C C   . ASN A 1 459 ? -20.451 -37.571 28.495 1.00 6.96  ? 459 ASN A C   1 
ATOM 3218 O O   . ASN A 1 459 ? -20.540 -36.739 27.613 1.00 7.26  ? 459 ASN A O   1 
ATOM 3219 C CB  . ASN A 1 459 ? -17.948 -37.645 28.628 1.00 8.19  ? 459 ASN A CB  1 
ATOM 3220 C CG  . ASN A 1 459 ? -16.679 -38.484 28.674 1.00 14.76 ? 459 ASN A CG  1 
ATOM 3221 O OD1 . ASN A 1 459 ? -16.693 -39.584 29.151 1.00 14.35 ? 459 ASN A OD1 1 
ATOM 3222 N ND2 . ASN A 1 459 ? -15.631 -37.981 28.040 1.00 20.93 ? 459 ASN A ND2 1 
ATOM 3223 N N   . TRP A 1 460 ? -21.293 -37.740 29.508 1.00 6.08  ? 460 TRP A N   1 
ATOM 3224 C CA  . TRP A 1 460 ? -22.621 -37.034 29.409 1.00 5.39  ? 460 TRP A CA  1 
ATOM 3225 C C   . TRP A 1 460 ? -22.998 -36.461 30.790 1.00 5.73  ? 460 TRP A C   1 
ATOM 3226 O O   . TRP A 1 460 ? -22.650 -37.007 31.844 1.00 5.98  ? 460 TRP A O   1 
ATOM 3227 C CB  . TRP A 1 460 ? -23.660 -38.124 28.976 1.00 6.32  ? 460 TRP A CB  1 
ATOM 3228 C CG  . TRP A 1 460 ? -25.104 -37.715 29.334 1.00 5.91  ? 460 TRP A CG  1 
ATOM 3229 C CD1 . TRP A 1 460 ? -25.987 -36.883 28.617 1.00 7.04  ? 460 TRP A CD1 1 
ATOM 3230 C CD2 . TRP A 1 460 ? -25.822 -38.251 30.433 1.00 5.51  ? 460 TRP A CD2 1 
ATOM 3231 N NE1 . TRP A 1 460 ? -27.213 -36.877 29.302 1.00 6.44  ? 460 TRP A NE1 1 
ATOM 3232 C CE2 . TRP A 1 460 ? -27.125 -37.725 30.381 1.00 5.64  ? 460 TRP A CE2 1 
ATOM 3233 C CE3 . TRP A 1 460 ? -25.481 -39.138 31.487 1.00 5.80  ? 460 TRP A CE3 1 
ATOM 3234 C CZ2 . TRP A 1 460 ? -28.097 -38.042 31.369 1.00 6.57  ? 460 TRP A CZ2 1 
ATOM 3235 C CZ3 . TRP A 1 460 ? -26.433 -39.460 32.477 1.00 7.67  ? 460 TRP A CZ3 1 
ATOM 3236 C CH2 . TRP A 1 460 ? -27.726 -38.855 32.427 1.00 6.83  ? 460 TRP A CH2 1 
ATOM 3237 N N   . ALA A 1 461 ? -23.688 -35.332 30.691 1.00 5.68  ? 461 ALA A N   1 
ATOM 3238 C CA  . ALA A 1 461 ? -24.309 -34.755 31.935 1.00 5.68  ? 461 ALA A CA  1 
ATOM 3239 C C   . ALA A 1 461 ? -25.636 -34.184 31.571 1.00 5.54  ? 461 ALA A C   1 
ATOM 3240 O O   . ALA A 1 461 ? -25.926 -33.968 30.390 1.00 6.26  ? 461 ALA A O   1 
ATOM 3241 C CB  . ALA A 1 461 ? -23.416 -33.612 32.486 1.00 7.07  ? 461 ALA A CB  1 
ATOM 3242 N N   . HIS A 1 462 ? -26.475 -34.111 32.581 1.00 5.26  ? 462 HIS A N   1 
ATOM 3243 C CA  . HIS A 1 462 ? -27.899 -33.720 32.423 1.00 5.98  ? 462 HIS A CA  1 
ATOM 3244 C C   . HIS A 1 462 ? -28.148 -32.596 33.443 1.00 5.99  ? 462 HIS A C   1 
ATOM 3245 O O   . HIS A 1 462 ? -27.886 -32.734 34.661 1.00 6.56  ? 462 HIS A O   1 
ATOM 3246 C CB  . HIS A 1 462 ? -28.727 -34.951 32.758 1.00 6.32  ? 462 HIS A CB  1 
ATOM 3247 C CG  . HIS A 1 462 ? -30.138 -34.664 33.129 1.00 6.93  ? 462 HIS A CG  1 
ATOM 3248 N ND1 . HIS A 1 462 ? -31.034 -33.987 32.309 1.00 8.41  ? 462 HIS A ND1 1 
ATOM 3249 C CD2 . HIS A 1 462 ? -30.850 -35.032 34.250 1.00 6.94  ? 462 HIS A CD2 1 
ATOM 3250 C CE1 . HIS A 1 462 ? -32.199 -33.892 32.919 1.00 8.89  ? 462 HIS A CE1 1 
ATOM 3251 N NE2 . HIS A 1 462 ? -32.123 -34.501 34.123 1.00 7.91  ? 462 HIS A NE2 1 
ATOM 3252 N N   . MET A 1 463 ? -28.758 -31.514 32.990 1.00 4.66  ? 463 MET A N   1 
ATOM 3253 C CA  . MET A 1 463 ? -29.028 -30.334 33.820 1.00 6.57  ? 463 MET A CA  1 
ATOM 3254 C C   . MET A 1 463 ? -30.556 -30.190 33.876 1.00 6.54  ? 463 MET A C   1 
ATOM 3255 O O   . MET A 1 463 ? -31.167 -30.014 32.834 1.00 6.76  ? 463 MET A O   1 
ATOM 3256 C CB  . MET A 1 463 ? -28.429 -29.077 33.226 1.00 6.80  ? 463 MET A CB  1 
ATOM 3257 C CG  . MET A 1 463 ? -26.905 -29.188 33.323 1.00 9.79  ? 463 MET A CG  1 
ATOM 3258 S SD  . MET A 1 463 ? -25.990 -27.821 32.528 1.00 11.97 ? 463 MET A SD  1 
ATOM 3259 C CE  . MET A 1 463 ? -26.668 -26.427 33.494 1.00 12.77 ? 463 MET A CE  1 
ATOM 3260 N N   . ASP A 1 464 ? -31.150 -30.290 35.044 1.00 6.70  ? 464 ASP A N   1 
ATOM 3261 C CA  . ASP A 1 464 ? -32.597 -30.121 35.218 1.00 6.91  ? 464 ASP A CA  1 
ATOM 3262 C C   . ASP A 1 464 ? -32.759 -28.683 35.784 1.00 6.09  ? 464 ASP A C   1 
ATOM 3263 O O   . ASP A 1 464 ? -32.408 -28.323 36.908 1.00 6.54  ? 464 ASP A O   1 
ATOM 3264 C CB  . ASP A 1 464 ? -33.110 -31.168 36.241 1.00 8.16  ? 464 ASP A CB  1 
ATOM 3265 C CG  . ASP A 1 464 ? -34.617 -31.272 36.258 1.00 9.35  ? 464 ASP A CG  1 
ATOM 3266 O OD1 . ASP A 1 464 ? -35.307 -30.296 35.924 1.00 8.44  ? 464 ASP A OD1 1 
ATOM 3267 O OD2 . ASP A 1 464 ? -35.111 -32.336 36.714 1.00 8.53  ? 464 ASP A OD2 1 
ATOM 3268 N N   . ILE A 1 465 ? -33.290 -27.903 34.878 1.00 4.86  ? 465 ILE A N   1 
ATOM 3269 C CA  . ILE A 1 465 ? -33.494 -26.415 35.075 1.00 5.56  ? 465 ILE A CA  1 
ATOM 3270 C C   . ILE A 1 465 ? -34.943 -26.040 35.352 1.00 5.75  ? 465 ILE A C   1 
ATOM 3271 O O   . ILE A 1 465 ? -35.334 -24.884 35.210 1.00 8.03  ? 465 ILE A O   1 
ATOM 3272 C CB  . ILE A 1 465 ? -32.903 -25.611 33.850 1.00 6.91  ? 465 ILE A CB  1 
ATOM 3273 C CG1 . ILE A 1 465 ? -33.603 -25.999 32.542 1.00 7.02  ? 465 ILE A CG1 1 
ATOM 3274 C CG2 . ILE A 1 465 ? -31.343 -25.810 33.802 1.00 7.84  ? 465 ILE A CG2 1 
ATOM 3275 C CD1 . ILE A 1 465 ? -33.342 -24.932 31.344 1.00 9.27  ? 465 ILE A CD1 1 
ATOM 3276 N N   . ALA A 1 466 ? -35.732 -27.034 35.780 1.00 6.45  ? 466 ALA A N   1 
ATOM 3277 C CA  . ALA A 1 466 ? -37.162 -26.764 36.041 1.00 7.96  ? 466 ALA A CA  1 
ATOM 3278 C C   . ALA A 1 466 ? -37.332 -25.635 37.091 1.00 8.23  ? 466 ALA A C   1 
ATOM 3279 O O   . ALA A 1 466 ? -38.364 -24.956 37.039 1.00 10.91 ? 466 ALA A O   1 
ATOM 3280 C CB  . ALA A 1 466 ? -37.835 -28.089 36.642 1.00 8.88  ? 466 ALA A CB  1 
ATOM 3281 N N   . GLY A 1 467 ? -36.390 -25.486 38.030 1.00 9.05  ? 467 GLY A N   1 
ATOM 3282 C CA  . GLY A 1 467 ? -36.478 -24.455 39.066 1.00 8.66  ? 467 GLY A CA  1 
ATOM 3283 C C   . GLY A 1 467 ? -35.754 -23.154 38.776 1.00 8.09  ? 467 GLY A C   1 
ATOM 3284 O O   . GLY A 1 467 ? -36.115 -22.102 39.342 1.00 10.34 ? 467 GLY A O   1 
ATOM 3285 N N   . THR A 1 468 ? -34.779 -23.200 37.826 1.00 6.97  ? 468 THR A N   1 
ATOM 3286 C CA  . THR A 1 468 ? -33.931 -22.014 37.604 1.00 8.35  ? 468 THR A CA  1 
ATOM 3287 C C   . THR A 1 468 ? -34.187 -21.296 36.306 1.00 8.89  ? 468 THR A C   1 
ATOM 3288 O O   . THR A 1 468 ? -33.730 -20.200 36.128 1.00 9.26  ? 468 THR A O   1 
ATOM 3289 C CB  . THR A 1 468 ? -32.479 -22.419 37.624 1.00 7.85  ? 468 THR A CB  1 
ATOM 3290 O OG1 . THR A 1 468 ? -32.261 -23.486 36.692 1.00 8.97  ? 468 THR A OG1 1 
ATOM 3291 C CG2 . THR A 1 468 ? -32.007 -22.951 39.006 1.00 9.29  ? 468 THR A CG2 1 
ATOM 3292 N N   . ALA A 1 469 ? -34.994 -21.890 35.396 1.00 7.75  ? 469 ALA A N   1 
ATOM 3293 C CA  . ALA A 1 469 ? -35.225 -21.282 34.042 1.00 7.61  ? 469 ALA A CA  1 
ATOM 3294 C C   . ALA A 1 469 ? -36.251 -20.119 33.978 1.00 6.98  ? 469 ALA A C   1 
ATOM 3295 O O   . ALA A 1 469 ? -36.210 -19.356 33.020 1.00 8.39  ? 469 ALA A O   1 
ATOM 3296 C CB  . ALA A 1 469 ? -35.643 -22.420 33.077 1.00 10.76 ? 469 ALA A CB  1 
ATOM 3297 N N   . TRP A 1 470 ? -37.122 -20.031 34.978 1.00 6.96  ? 470 TRP A N   1 
ATOM 3298 C CA  . TRP A 1 470 ? -38.064 -18.927 34.968 1.00 7.94  ? 470 TRP A CA  1 
ATOM 3299 C C   . TRP A 1 470 ? -38.509 -18.536 36.356 1.00 10.01 ? 470 TRP A C   1 
ATOM 3300 O O   . TRP A 1 470 ? -38.351 -19.337 37.242 1.00 11.08 ? 470 TRP A O   1 
ATOM 3301 C CB  . TRP A 1 470 ? -39.305 -19.165 34.027 1.00 8.48  ? 470 TRP A CB  1 
ATOM 3302 C CG  . TRP A 1 470 ? -40.330 -20.113 34.516 1.00 7.75  ? 470 TRP A CG  1 
ATOM 3303 C CD1 . TRP A 1 470 ? -41.481 -19.770 35.243 1.00 11.50 ? 470 TRP A CD1 1 
ATOM 3304 C CD2 . TRP A 1 470 ? -40.376 -21.499 34.295 1.00 8.58  ? 470 TRP A CD2 1 
ATOM 3305 N NE1 . TRP A 1 470 ? -42.232 -20.925 35.490 1.00 11.69 ? 470 TRP A NE1 1 
ATOM 3306 C CE2 . TRP A 1 470 ? -41.590 -21.993 34.905 1.00 10.99 ? 470 TRP A CE2 1 
ATOM 3307 C CE3 . TRP A 1 470 ? -39.505 -22.429 33.600 1.00 10.39 ? 470 TRP A CE3 1 
ATOM 3308 C CZ2 . TRP A 1 470 ? -41.967 -23.377 34.861 1.00 12.38 ? 470 TRP A CZ2 1 
ATOM 3309 C CZ3 . TRP A 1 470 ? -39.936 -23.797 33.514 1.00 10.92 ? 470 TRP A CZ3 1 
ATOM 3310 C CH2 . TRP A 1 470 ? -41.114 -24.262 34.172 1.00 12.61 ? 470 TRP A CH2 1 
ATOM 3311 N N   . ILE A 1 471 ? -39.104 -17.331 36.439 1.00 8.86  ? 471 ILE A N   1 
ATOM 3312 C CA  . ILE A 1 471 ? -39.671 -16.838 37.715 1.00 10.93 ? 471 ILE A CA  1 
ATOM 3313 C C   . ILE A 1 471 ? -41.183 -16.936 37.546 1.00 12.27 ? 471 ILE A C   1 
ATOM 3314 O O   . ILE A 1 471 ? -41.730 -16.518 36.529 1.00 10.08 ? 471 ILE A O   1 
ATOM 3315 C CB  . ILE A 1 471 ? -39.210 -15.451 38.058 1.00 13.43 ? 471 ILE A CB  1 
ATOM 3316 C CG1 . ILE A 1 471 ? -37.689 -15.424 38.308 1.00 17.48 ? 471 ILE A CG1 1 
ATOM 3317 C CG2 . ILE A 1 471 ? -40.026 -14.949 39.294 1.00 13.61 ? 471 ILE A CG2 1 
ATOM 3318 C CD1 . ILE A 1 471 ? -37.145 -14.066 38.333 1.00 25.11 ? 471 ILE A CD1 1 
ATOM 3319 N N   . SER A 1 472 ? -41.875 -17.566 38.508 1.00 14.55 ? 472 SER A N   1 
ATOM 3320 C CA  . SER A 1 472 ? -43.339 -17.874 38.263 1.00 18.66 ? 472 SER A CA  1 
ATOM 3321 C C   . SER A 1 472 ? -44.314 -16.748 38.299 1.00 21.59 ? 472 SER A C   1 
ATOM 3322 O O   . SER A 1 472 ? -45.374 -16.769 37.578 1.00 21.93 ? 472 SER A O   1 
ATOM 3323 C CB  . SER A 1 472 ? -43.835 -18.906 39.263 1.00 18.26 ? 472 SER A CB  1 
ATOM 3324 O OG  . SER A 1 472 ? -43.391 -20.204 38.891 1.00 21.09 ? 472 SER A OG  1 
ATOM 3325 N N   . GLY A 1 473 ? -44.021 -15.798 39.184 1.00 23.94 ? 473 GLY A N   1 
ATOM 3326 C CA  . GLY A 1 473 ? -45.039 -14.777 39.562 1.00 27.46 ? 473 GLY A CA  1 
ATOM 3327 C C   . GLY A 1 473 ? -44.351 -13.475 39.979 1.00 30.21 ? 473 GLY A C   1 
ATOM 3328 O O   . GLY A 1 473 ? -43.108 -13.404 40.031 1.00 31.42 ? 473 GLY A O   1 
ATOM 3329 N N   . GLY A 1 474 ? -45.180 -12.528 40.393 1.00 30.93 ? 474 GLY A N   1 
ATOM 3330 C CA  . GLY A 1 474 ? -44.737 -11.250 40.852 1.00 30.94 ? 474 GLY A CA  1 
ATOM 3331 C C   . GLY A 1 474 ? -44.649 -10.499 39.577 1.00 31.55 ? 474 GLY A C   1 
ATOM 3332 O O   . GLY A 1 474 ? -44.859 -11.051 38.524 1.00 28.65 ? 474 GLY A O   1 
ATOM 3333 N N   . LYS A 1 475 ? -44.294 -9.239  39.679 1.00 20.00 ? 475 LYS A N   1 
ATOM 3334 C CA  . LYS A 1 475 ? -43.419 -8.639  38.717 1.00 20.00 ? 475 LYS A CA  1 
ATOM 3335 C C   . LYS A 1 475 ? -42.029 -8.971  39.138 1.00 20.00 ? 475 LYS A C   1 
ATOM 3336 O O   . LYS A 1 475 ? -41.314 -8.104  39.613 1.00 20.00 ? 475 LYS A O   1 
ATOM 3337 C CB  . LYS A 1 475 ? -43.627 -7.126  38.632 1.00 20.00 ? 475 LYS A CB  1 
ATOM 3338 C CG  . LYS A 1 475 ? -44.958 -6.714  38.022 1.00 20.00 ? 475 LYS A CG  1 
ATOM 3339 C CD  . LYS A 1 475 ? -45.108 -5.203  37.990 1.00 20.00 ? 475 LYS A CD  1 
ATOM 3340 C CE  . LYS A 1 475 ? -46.428 -4.791  37.359 1.00 20.00 ? 475 LYS A CE  1 
ATOM 3341 N NZ  . LYS A 1 475 ? -46.599 -3.313  37.343 1.00 20.00 ? 475 LYS A NZ  1 
ATOM 3342 N N   . ASP A 1 476 ? -41.637 -10.229 38.959 1.00 27.99 ? 476 ASP A N   1 
ATOM 3343 C CA  . ASP A 1 476 ? -40.586 -10.555 38.021 1.00 27.20 ? 476 ASP A CA  1 
ATOM 3344 C C   . ASP A 1 476 ? -40.824 -11.679 37.072 1.00 23.50 ? 476 ASP A C   1 
ATOM 3345 O O   . ASP A 1 476 ? -39.935 -12.178 36.455 1.00 24.33 ? 476 ASP A O   1 
ATOM 3346 C CB  . ASP A 1 476 ? -39.278 -10.703 38.744 1.00 28.90 ? 476 ASP A CB  1 
ATOM 3347 C CG  . ASP A 1 476 ? -38.532 -9.430  38.771 1.00 38.05 ? 476 ASP A CG  1 
ATOM 3348 O OD1 . ASP A 1 476 ? -39.186 -8.375  38.799 1.00 45.46 ? 476 ASP A OD1 1 
ATOM 3349 O OD2 . ASP A 1 476 ? -37.300 -9.484  38.727 1.00 47.50 ? 476 ASP A OD2 1 
ATOM 3350 N N   . LYS A 1 477 ? -42.053 -12.069 36.964 1.00 20.38 ? 477 LYS A N   1 
ATOM 3351 C CA  . LYS A 1 477 ? -42.446 -13.299 36.208 1.00 16.58 ? 477 LYS A CA  1 
ATOM 3352 C C   . LYS A 1 477 ? -41.770 -13.283 34.800 1.00 13.22 ? 477 LYS A C   1 
ATOM 3353 O O   . LYS A 1 477 ? -41.840 -12.291 34.018 1.00 16.27 ? 477 LYS A O   1 
ATOM 3354 C CB  . LYS A 1 477 ? -43.940 -13.323 36.027 1.00 17.58 ? 477 LYS A CB  1 
ATOM 3355 C CG  . LYS A 1 477 ? -44.428 -14.511 35.180 1.00 13.24 ? 477 LYS A CG  1 
ATOM 3356 C CD  . LYS A 1 477 ? -45.956 -14.566 35.086 1.00 17.28 ? 477 LYS A CD  1 
ATOM 3357 C CE  . LYS A 1 477 ? -46.245 -15.945 34.425 1.00 13.47 ? 477 LYS A CE  1 
ATOM 3358 N NZ  . LYS A 1 477 ? -47.809 -16.058 34.457 1.00 16.88 ? 477 LYS A NZ  1 
ATOM 3359 N N   . GLY A 1 478 ? -41.201 -14.433 34.458 1.00 8.71  ? 478 GLY A N   1 
ATOM 3360 C CA  . GLY A 1 478 ? -40.686 -14.560 33.094 1.00 10.18 ? 478 GLY A CA  1 
ATOM 3361 C C   . GLY A 1 478 ? -39.378 -15.386 33.106 1.00 7.99  ? 478 GLY A C   1 
ATOM 3362 O O   . GLY A 1 478 ? -38.825 -15.746 34.159 1.00 9.16  ? 478 GLY A O   1 
ATOM 3363 N N   . ALA A 1 479 ? -38.852 -15.639 31.917 1.00 7.35  ? 479 ALA A N   1 
ATOM 3364 C CA  . ALA A 1 479 ? -37.624 -16.464 31.810 1.00 6.56  ? 479 ALA A CA  1 
ATOM 3365 C C   . ALA A 1 479 ? -36.433 -15.734 32.437 1.00 7.30  ? 479 ALA A C   1 
ATOM 3366 O O   . ALA A 1 479 ? -36.350 -14.504 32.392 1.00 7.83  ? 479 ALA A O   1 
ATOM 3367 C CB  . ALA A 1 479 ? -37.351 -16.624 30.298 1.00 9.80  ? 479 ALA A CB  1 
ATOM 3368 N N   . THR A 1 480 ? -35.479 -16.561 32.940 1.00 7.51  ? 480 THR A N   1 
ATOM 3369 C CA  . THR A 1 480 ? -34.275 -15.989 33.588 1.00 7.48  ? 480 THR A CA  1 
ATOM 3370 C C   . THR A 1 480 ? -33.095 -15.934 32.661 1.00 7.44  ? 480 THR A C   1 
ATOM 3371 O O   . THR A 1 480 ? -32.167 -15.089 32.965 1.00 10.54 ? 480 THR A O   1 
ATOM 3372 C CB  . THR A 1 480 ? -33.819 -16.797 34.791 1.00 9.11  ? 480 THR A CB  1 
ATOM 3373 O OG1 . THR A 1 480 ? -33.598 -18.131 34.330 1.00 7.68  ? 480 THR A OG1 1 
ATOM 3374 C CG2 . THR A 1 480 ? -34.906 -16.833 35.900 1.00 10.56 ? 480 THR A CG2 1 
ATOM 3375 N N   . GLY A 1 481 ? -33.047 -16.764 31.620 1.00 7.31  ? 481 GLY A N   1 
ATOM 3376 C CA  . GLY A 1 481 ? -31.842 -16.903 30.831 1.00 7.26  ? 481 GLY A CA  1 
ATOM 3377 C C   . GLY A 1 481 ? -30.852 -17.895 31.391 1.00 9.15  ? 481 GLY A C   1 
ATOM 3378 O O   . GLY A 1 481 ? -29.833 -18.147 30.782 1.00 7.89  ? 481 GLY A O   1 
ATOM 3379 N N   . ARG A 1 482 ? -31.112 -18.454 32.561 1.00 8.18  ? 482 ARG A N   1 
ATOM 3380 C CA  . ARG A 1 482 ? -30.249 -19.541 33.049 1.00 7.71  ? 482 ARG A CA  1 
ATOM 3381 C C   . ARG A 1 482 ? -30.575 -20.808 32.316 1.00 7.70  ? 482 ARG A C   1 
ATOM 3382 O O   . ARG A 1 482 ? -31.759 -21.049 32.052 1.00 9.30  ? 482 ARG A O   1 
ATOM 3383 C CB  . ARG A 1 482 ? -30.455 -19.757 34.562 1.00 7.22  ? 482 ARG A CB  1 
ATOM 3384 C CG  . ARG A 1 482 ? -30.118 -18.433 35.354 1.00 9.99  ? 482 ARG A CG  1 
ATOM 3385 C CD  . ARG A 1 482 ? -30.382 -18.717 36.862 1.00 10.62 ? 482 ARG A CD  1 
ATOM 3386 N NE  . ARG A 1 482 ? -29.492 -19.695 37.444 1.00 12.11 ? 482 ARG A NE  1 
ATOM 3387 C CZ  . ARG A 1 482 ? -29.586 -20.079 38.719 1.00 11.84 ? 482 ARG A CZ  1 
ATOM 3388 N NH1 . ARG A 1 482 ? -30.522 -19.578 39.494 1.00 15.11 ? 482 ARG A NH1 1 
ATOM 3389 N NH2 . ARG A 1 482 ? -28.756 -20.985 39.166 1.00 13.74 ? 482 ARG A NH2 1 
ATOM 3390 N N   . PRO A 1 483 ? -29.607 -21.630 31.990 1.00 6.59  ? 483 PRO A N   1 
ATOM 3391 C CA  . PRO A 1 483 ? -28.209 -21.592 32.471 1.00 6.76  ? 483 PRO A CA  1 
ATOM 3392 C C   . PRO A 1 483 ? -27.217 -21.100 31.371 1.00 6.45  ? 483 PRO A C   1 
ATOM 3393 O O   . PRO A 1 483 ? -26.103 -21.680 31.297 1.00 7.75  ? 483 PRO A O   1 
ATOM 3394 C CB  . PRO A 1 483 ? -27.956 -23.089 32.781 1.00 8.06  ? 483 PRO A CB  1 
ATOM 3395 C CG  . PRO A 1 483 ? -28.733 -23.826 31.688 1.00 6.03  ? 483 PRO A CG  1 
ATOM 3396 C CD  . PRO A 1 483 ? -29.947 -22.989 31.483 1.00 6.98  ? 483 PRO A CD  1 
ATOM 3397 N N   . VAL A 1 484 ? -27.588 -20.077 30.621 1.00 6.13  ? 484 VAL A N   1 
ATOM 3398 C CA  . VAL A 1 484 ? -26.623 -19.586 29.609 1.00 5.86  ? 484 VAL A CA  1 
ATOM 3399 C C   . VAL A 1 484 ? -25.320 -19.184 30.289 1.00 6.39  ? 484 VAL A C   1 
ATOM 3400 O O   . VAL A 1 484 ? -24.258 -19.493 29.707 1.00 6.74  ? 484 VAL A O   1 
ATOM 3401 C CB  . VAL A 1 484 ? -27.231 -18.440 28.887 1.00 5.23  ? 484 VAL A CB  1 
ATOM 3402 C CG1 . VAL A 1 484 ? -26.244 -17.785 27.963 1.00 8.38  ? 484 VAL A CG1 1 
ATOM 3403 C CG2 . VAL A 1 484 ? -28.347 -18.981 27.966 1.00 6.96  ? 484 VAL A CG2 1 
ATOM 3404 N N   . PRO A 1 485 ? -25.261 -18.588 31.519 1.00 5.86  ? 485 PRO A N   1 
ATOM 3405 C CA  . PRO A 1 485 ? -23.904 -18.199 32.058 1.00 5.75  ? 485 PRO A CA  1 
ATOM 3406 C C   . PRO A 1 485 ? -23.130 -19.448 32.366 1.00 5.95  ? 485 PRO A C   1 
ATOM 3407 O O   . PRO A 1 485 ? -21.905 -19.455 32.027 1.00 6.15  ? 485 PRO A O   1 
ATOM 3408 C CB  . PRO A 1 485 ? -24.257 -17.413 33.339 1.00 7.02  ? 485 PRO A CB  1 
ATOM 3409 C CG  . PRO A 1 485 ? -25.672 -16.803 32.994 1.00 8.72  ? 485 PRO A CG  1 
ATOM 3410 C CD  . PRO A 1 485 ? -25.943 -17.315 31.569 1.00 5.20  ? 485 PRO A CD  1 
ATOM 3411 N N   . LEU A 1 486 ? -23.698 -20.507 32.960 1.00 6.22  ? 486 LEU A N   1 
ATOM 3412 C CA  . LEU A 1 486 ? -22.901 -21.680 33.295 1.00 5.99  ? 486 LEU A CA  1 
ATOM 3413 C C   . LEU A 1 486 ? -22.422 -22.337 32.000 1.00 5.21  ? 486 LEU A C   1 
ATOM 3414 O O   . LEU A 1 486 ? -21.214 -22.659 31.911 1.00 5.99  ? 486 LEU A O   1 
ATOM 3415 C CB  . LEU A 1 486 ? -23.779 -22.662 34.146 1.00 6.36  ? 486 LEU A CB  1 
ATOM 3416 C CG  . LEU A 1 486 ? -23.019 -23.962 34.553 1.00 6.22  ? 486 LEU A CG  1 
ATOM 3417 C CD1 . LEU A 1 486 ? -23.833 -24.611 35.723 1.00 8.34  ? 486 LEU A CD1 1 
ATOM 3418 C CD2 . LEU A 1 486 ? -22.976 -25.044 33.425 1.00 9.39  ? 486 LEU A CD2 1 
ATOM 3419 N N   . LEU A 1 487 ? -23.304 -22.508 31.004 1.00 6.65  ? 487 LEU A N   1 
ATOM 3420 C CA  . LEU A 1 487 ? -22.873 -23.215 29.789 1.00 7.79  ? 487 LEU A CA  1 
ATOM 3421 C C   . LEU A 1 487 ? -21.813 -22.427 29.057 1.00 7.05  ? 487 LEU A C   1 
ATOM 3422 O O   . LEU A 1 487 ? -20.849 -23.020 28.557 1.00 7.25  ? 487 LEU A O   1 
ATOM 3423 C CB  . LEU A 1 487 ? -24.087 -23.453 28.844 1.00 6.28  ? 487 LEU A CB  1 
ATOM 3424 C CG  . LEU A 1 487 ? -25.119 -24.433 29.486 1.00 7.31  ? 487 LEU A CG  1 
ATOM 3425 C CD1 . LEU A 1 487 ? -26.399 -24.460 28.620 1.00 8.27  ? 487 LEU A CD1 1 
ATOM 3426 C CD2 . LEU A 1 487 ? -24.546 -25.885 29.553 1.00 11.95 ? 487 LEU A CD2 1 
ATOM 3427 N N   . THR A 1 488 ? -21.967 -21.083 28.988 1.00 7.25  ? 488 THR A N   1 
ATOM 3428 C CA  . THR A 1 488 ? -21.006 -20.266 28.236 1.00 7.43  ? 488 THR A CA  1 
ATOM 3429 C C   . THR A 1 488 ? -19.671 -20.340 29.029 1.00 6.59  ? 488 THR A C   1 
ATOM 3430 O O   . THR A 1 488 ? -18.568 -20.440 28.434 1.00 6.83  ? 488 THR A O   1 
ATOM 3431 C CB  . THR A 1 488 ? -21.453 -18.855 28.153 1.00 7.51  ? 488 THR A CB  1 
ATOM 3432 O OG1 . THR A 1 488 ? -22.737 -18.854 27.427 1.00 7.04  ? 488 THR A OG1 1 
ATOM 3433 C CG2 . THR A 1 488 ? -20.471 -18.052 27.193 1.00 6.79  ? 488 THR A CG2 1 
ATOM 3434 N N   . GLN A 1 489 ? -19.715 -20.261 30.365 1.00 6.31  ? 489 GLN A N   1 
ATOM 3435 C CA  . GLN A 1 489 ? -18.502 -20.373 31.138 1.00 6.50  ? 489 GLN A CA  1 
ATOM 3436 C C   . GLN A 1 489 ? -17.822 -21.697 30.879 1.00 8.47  ? 489 GLN A C   1 
ATOM 3437 O O   . GLN A 1 489 ? -16.565 -21.747 30.748 1.00 6.89  ? 489 GLN A O   1 
ATOM 3438 C CB  . GLN A 1 489 ? -18.828 -20.204 32.635 1.00 6.75  ? 489 GLN A CB  1 
ATOM 3439 C CG  . GLN A 1 489 ? -17.530 -20.277 33.561 1.00 7.95  ? 489 GLN A CG  1 
ATOM 3440 C CD  . GLN A 1 489 ? -16.675 -19.107 33.258 1.00 10.82 ? 489 GLN A CD  1 
ATOM 3441 O OE1 . GLN A 1 489 ? -15.570 -19.220 32.605 1.00 13.61 ? 489 GLN A OE1 1 
ATOM 3442 N NE2 . GLN A 1 489 ? -17.101 -17.981 33.692 1.00 7.57  ? 489 GLN A NE2 1 
ATOM 3443 N N   . TYR A 1 490 ? -18.595 -22.807 30.888 1.00 6.02  ? 490 TYR A N   1 
ATOM 3444 C CA  . TYR A 1 490 ? -17.957 -24.119 30.609 1.00 6.76  ? 490 TYR A CA  1 
ATOM 3445 C C   . TYR A 1 490 ? -17.253 -24.086 29.243 1.00 7.08  ? 490 TYR A C   1 
ATOM 3446 O O   . TYR A 1 490 ? -16.103 -24.575 29.158 1.00 7.87  ? 490 TYR A O   1 
ATOM 3447 C CB  . TYR A 1 490 ? -19.127 -25.162 30.666 1.00 7.60  ? 490 TYR A CB  1 
ATOM 3448 C CG  . TYR A 1 490 ? -18.735 -26.493 30.026 1.00 6.87  ? 490 TYR A CG  1 
ATOM 3449 C CD1 . TYR A 1 490 ? -17.935 -27.379 30.754 1.00 6.87  ? 490 TYR A CD1 1 
ATOM 3450 C CD2 . TYR A 1 490 ? -19.120 -26.809 28.754 1.00 7.35  ? 490 TYR A CD2 1 
ATOM 3451 C CE1 . TYR A 1 490 ? -17.525 -28.657 30.148 1.00 6.87  ? 490 TYR A CE1 1 
ATOM 3452 C CE2 . TYR A 1 490 ? -18.722 -28.020 28.154 1.00 7.39  ? 490 TYR A CE2 1 
ATOM 3453 C CZ  . TYR A 1 490 ? -17.956 -28.915 28.873 1.00 6.86  ? 490 TYR A CZ  1 
ATOM 3454 O OH  . TYR A 1 490 ? -17.577 -30.121 28.245 1.00 8.34  ? 490 TYR A OH  1 
ATOM 3455 N N   . LEU A 1 491 ? -17.862 -23.503 28.255 1.00 6.50  ? 491 LEU A N   1 
ATOM 3456 C CA  . LEU A 1 491 ? -17.208 -23.514 26.901 1.00 7.01  ? 491 LEU A CA  1 
ATOM 3457 C C   . LEU A 1 491 ? -16.021 -22.499 26.913 1.00 7.48  ? 491 LEU A C   1 
ATOM 3458 O O   . LEU A 1 491 ? -15.018 -22.862 26.260 1.00 9.52  ? 491 LEU A O   1 
ATOM 3459 C CB  . LEU A 1 491 ? -18.189 -23.146 25.843 1.00 7.11  ? 491 LEU A CB  1 
ATOM 3460 C CG  . LEU A 1 491 ? -19.271 -24.242 25.677 1.00 7.57  ? 491 LEU A CG  1 
ATOM 3461 C CD1 . LEU A 1 491 ? -20.353 -23.790 24.636 1.00 8.41  ? 491 LEU A CD1 1 
ATOM 3462 C CD2 . LEU A 1 491 ? -18.678 -25.573 25.116 1.00 8.18  ? 491 LEU A CD2 1 
ATOM 3463 N N   . LEU A 1 492 ? -16.078 -21.398 27.619 1.00 7.87  ? 492 LEU A N   1 
ATOM 3464 C CA  . LEU A 1 492 ? -14.867 -20.523 27.787 1.00 7.06  ? 492 LEU A CA  1 
ATOM 3465 C C   . LEU A 1 492 ? -13.767 -21.370 28.411 1.00 8.27  ? 492 LEU A C   1 
ATOM 3466 O O   . LEU A 1 492 ? -12.567 -21.283 27.941 1.00 9.95  ? 492 LEU A O   1 
ATOM 3467 C CB  . LEU A 1 492 ? -15.184 -19.325 28.707 1.00 7.65  ? 492 LEU A CB  1 
ATOM 3468 C CG  . LEU A 1 492 ? -16.031 -18.188 28.046 1.00 9.81  ? 492 LEU A CG  1 
ATOM 3469 C CD1 . LEU A 1 492 ? -16.526 -17.239 29.118 1.00 13.26 ? 492 LEU A CD1 1 
ATOM 3470 C CD2 . LEU A 1 492 ? -15.167 -17.468 26.989 1.00 12.38 ? 492 LEU A CD2 1 
ATOM 3471 N N   . ASP A 1 493 ? -14.072 -22.142 29.453 1.00 7.46  ? 493 ASP A N   1 
ATOM 3472 C CA  . ASP A 1 493 ? -13.055 -22.953 30.125 1.00 6.52  ? 493 ASP A CA  1 
ATOM 3473 C C   . ASP A 1 493 ? -12.471 -23.956 29.133 1.00 7.60  ? 493 ASP A C   1 
ATOM 3474 O O   . ASP A 1 493 ? -11.220 -24.151 29.133 1.00 10.68 ? 493 ASP A O   1 
ATOM 3475 C CB  . ASP A 1 493 ? -13.704 -23.712 31.280 1.00 7.89  ? 493 ASP A CB  1 
ATOM 3476 C CG  . ASP A 1 493 ? -14.196 -22.760 32.407 1.00 10.82 ? 493 ASP A CG  1 
ATOM 3477 O OD1 . ASP A 1 493 ? -13.733 -21.576 32.502 1.00 8.75  ? 493 ASP A OD1 1 
ATOM 3478 O OD2 . ASP A 1 493 ? -15.017 -23.290 33.224 1.00 10.37 ? 493 ASP A OD2 1 
ATOM 3479 N N   . ARG A 1 494 ? -13.278 -24.623 28.311 1.00 7.97  ? 494 ARG A N   1 
ATOM 3480 C CA  . ARG A 1 494 ? -12.723 -25.624 27.380 1.00 8.37  ? 494 ARG A CA  1 
ATOM 3481 C C   . ARG A 1 494 ? -11.945 -24.963 26.277 1.00 12.14 ? 494 ARG A C   1 
ATOM 3482 O O   . ARG A 1 494 ? -11.011 -25.617 25.827 1.00 14.71 ? 494 ARG A O   1 
ATOM 3483 C CB  . ARG A 1 494 ? -13.907 -26.445 26.733 1.00 9.07  ? 494 ARG A CB  1 
ATOM 3484 C CG  . ARG A 1 494 ? -14.804 -27.192 27.778 1.00 9.91  ? 494 ARG A CG  1 
ATOM 3485 C CD  . ARG A 1 494 ? -14.103 -28.373 28.438 1.00 9.96  ? 494 ARG A CD  1 
ATOM 3486 N NE  . ARG A 1 494 ? -13.073 -27.992 29.437 1.00 9.96  ? 494 ARG A NE  1 
ATOM 3487 C CZ  . ARG A 1 494 ? -13.297 -27.485 30.631 1.00 11.68 ? 494 ARG A CZ  1 
ATOM 3488 N NH1 . ARG A 1 494 ? -14.549 -27.250 31.072 1.00 9.21  ? 494 ARG A NH1 1 
ATOM 3489 N NH2 . ARG A 1 494 ? -12.266 -27.210 31.456 1.00 13.68 ? 494 ARG A NH2 1 
ATOM 3490 N N   . ALA A 1 495 ? -12.281 -23.744 25.882 1.00 11.55 ? 495 ALA A N   1 
ATOM 3491 C CA  . ALA A 1 495 ? -11.542 -22.980 24.805 1.00 12.23 ? 495 ALA A CA  1 
ATOM 3492 C C   . ALA A 1 495 ? -10.272 -22.447 25.363 1.00 19.27 ? 495 ALA A C   1 
ATOM 3493 O O   . ALA A 1 495 ? -9.412  -22.046 24.566 1.00 23.72 ? 495 ALA A O   1 
ATOM 3494 C CB  . ALA A 1 495 ? -12.311 -21.831 24.368 1.00 13.46 ? 495 ALA A CB  1 
ATOM 3495 N N   . GLY A 1 496 ? -10.150 -22.345 26.658 1.00 17.20 ? 496 GLY A N   1 
ATOM 3496 C CA  . GLY A 1 496 ? -9.017  -21.651 27.338 1.00 26.98 ? 496 GLY A CA  1 
ATOM 3497 C C   . GLY A 1 496 ? -9.072  -20.130 27.108 1.00 31.32 ? 496 GLY A C   1 
ATOM 3498 O O   . GLY A 1 496 ? -8.048  -19.493 26.760 1.00 32.65 ? 496 GLY A O   1 
ATOM 3499 N N   . ALA A 1 497 ? -10.259 -19.528 27.314 1.00 32.65 ? 497 ALA A N   1 
ATOM 3500 C CA  . ALA A 1 497 ? -10.449 -18.067 27.185 1.00 34.26 ? 497 ALA A CA  1 
ATOM 3501 C C   . ALA A 1 497 ? -10.558 -17.399 28.572 1.00 35.20 ? 497 ALA A C   1 
ATOM 3502 O O   . ALA A 1 497 ? -11.328 -17.870 29.447 1.00 36.55 ? 497 ALA A O   1 
ATOM 3503 C CB  . ALA A 1 497 ? -11.671 -17.757 26.341 1.00 34.05 ? 497 ALA A CB  1 
ATOM 3504 N N   . MET B 1 1   ? -26.599 -66.105 66.798 1.00 32.64 ? 1   MET B N   1 
ATOM 3505 C CA  . MET B 1 1   ? -25.794 -67.008 65.938 1.00 28.80 ? 1   MET B CA  1 
ATOM 3506 C C   . MET B 1 1   ? -24.345 -66.780 66.349 1.00 27.57 ? 1   MET B C   1 
ATOM 3507 O O   . MET B 1 1   ? -23.903 -65.626 66.507 1.00 27.32 ? 1   MET B O   1 
ATOM 3508 C CB  . MET B 1 1   ? -26.004 -66.622 64.473 1.00 31.39 ? 1   MET B CB  1 
ATOM 3509 C CG  . MET B 1 1   ? -25.278 -67.533 63.498 1.00 30.49 ? 1   MET B CG  1 
ATOM 3510 S SD  . MET B 1 1   ? -25.604 -67.167 61.709 1.00 32.69 ? 1   MET B SD  1 
ATOM 3511 C CE  . MET B 1 1   ? -27.174 -67.914 61.589 1.00 42.03 ? 1   MET B CE  1 
ATOM 3512 N N   . GLU B 1 2   ? -23.591 -67.855 66.561 1.00 23.30 ? 2   GLU B N   1 
ATOM 3513 C CA  . GLU B 1 2   ? -22.156 -67.754 66.742 1.00 23.21 ? 2   GLU B CA  1 
ATOM 3514 C C   . GLU B 1 2   ? -21.518 -67.691 65.342 1.00 21.64 ? 2   GLU B C   1 
ATOM 3515 O O   . GLU B 1 2   ? -21.854 -68.505 64.459 1.00 20.45 ? 2   GLU B O   1 
ATOM 3516 C CB  . GLU B 1 2   ? -21.657 -69.031 67.415 1.00 24.47 ? 2   GLU B CB  1 
ATOM 3517 C CG  . GLU B 1 2   ? -20.243 -68.907 67.951 1.00 31.80 ? 2   GLU B CG  1 
ATOM 3518 C CD  . GLU B 1 2   ? -19.684 -70.216 68.615 1.00 37.54 ? 2   GLU B CD  1 
ATOM 3519 O OE1 . GLU B 1 2   ? -20.428 -71.221 68.670 1.00 38.87 ? 2   GLU B OE1 1 
ATOM 3520 O OE2 . GLU B 1 2   ? -18.513 -70.202 69.051 1.00 39.42 ? 2   GLU B OE2 1 
ATOM 3521 N N   . LEU B 1 3   ? -20.589 -66.774 65.153 1.00 19.72 ? 3   LEU B N   1 
ATOM 3522 C CA  . LEU B 1 3   ? -19.908 -66.567 63.864 1.00 18.89 ? 3   LEU B CA  1 
ATOM 3523 C C   . LEU B 1 3   ? -18.432 -66.579 64.169 1.00 18.90 ? 3   LEU B C   1 
ATOM 3524 O O   . LEU B 1 3   ? -17.929 -65.647 64.814 1.00 17.48 ? 3   LEU B O   1 
ATOM 3525 C CB  . LEU B 1 3   ? -20.290 -65.176 63.314 1.00 21.03 ? 3   LEU B CB  1 
ATOM 3526 C CG  . LEU B 1 3   ? -19.697 -64.662 62.051 1.00 26.84 ? 3   LEU B CG  1 
ATOM 3527 C CD1 . LEU B 1 3   ? -20.009 -65.457 60.746 1.00 17.40 ? 3   LEU B CD1 1 
ATOM 3528 C CD2 . LEU B 1 3   ? -19.576 -63.085 61.941 1.00 19.99 ? 3   LEU B CD2 1 
ATOM 3529 N N   . VAL B 1 4   ? -17.708 -67.563 63.610 1.00 16.53 ? 4   VAL B N   1 
ATOM 3530 C CA  . VAL B 1 4   ? -16.254 -67.810 63.824 1.00 18.31 ? 4   VAL B CA  1 
ATOM 3531 C C   . VAL B 1 4   ? -15.572 -67.978 62.521 1.00 17.59 ? 4   VAL B C   1 
ATOM 3532 O O   . VAL B 1 4   ? -16.222 -68.206 61.464 1.00 17.50 ? 4   VAL B O   1 
ATOM 3533 C CB  . VAL B 1 4   ? -16.028 -69.066 64.727 1.00 19.18 ? 4   VAL B CB  1 
ATOM 3534 C CG1 . VAL B 1 4   ? -16.726 -68.871 66.072 1.00 22.83 ? 4   VAL B CG1 1 
ATOM 3535 C CG2 . VAL B 1 4   ? -16.554 -70.338 64.115 1.00 18.32 ? 4   VAL B CG2 1 
ATOM 3536 N N   . VAL B 1 5   ? -14.270 -67.837 62.556 1.00 18.43 ? 5   VAL B N   1 
ATOM 3537 C CA  . VAL B 1 5   ? -13.414 -67.909 61.397 1.00 18.21 ? 5   VAL B CA  1 
ATOM 3538 C C   . VAL B 1 5   ? -12.382 -69.030 61.633 1.00 19.35 ? 5   VAL B C   1 
ATOM 3539 O O   . VAL B 1 5   ? -11.832 -69.134 62.754 1.00 19.22 ? 5   VAL B O   1 
ATOM 3540 C CB  . VAL B 1 5   ? -12.699 -66.591 61.171 1.00 18.35 ? 5   VAL B CB  1 
ATOM 3541 C CG1 . VAL B 1 5   ? -11.833 -66.664 59.902 1.00 17.46 ? 5   VAL B CG1 1 
ATOM 3542 C CG2 . VAL B 1 5   ? -13.746 -65.443 61.113 1.00 19.40 ? 5   VAL B CG2 1 
ATOM 3543 N N   . LYS B 1 6   ? -12.180 -69.855 60.582 1.00 19.06 ? 6   LYS B N   1 
ATOM 3544 C CA  . LYS B 1 6   ? -11.142 -70.900 60.537 1.00 20.36 ? 6   LYS B CA  1 
ATOM 3545 C C   . LYS B 1 6   ? -10.410 -70.861 59.232 1.00 21.79 ? 6   LYS B C   1 
ATOM 3546 O O   . LYS B 1 6   ? -10.785 -70.258 58.227 1.00 22.60 ? 6   LYS B O   1 
ATOM 3547 C CB  . LYS B 1 6   ? -11.765 -72.257 60.741 1.00 21.84 ? 6   LYS B CB  1 
ATOM 3548 C CG  . LYS B 1 6   ? -12.268 -72.507 62.096 1.00 23.95 ? 6   LYS B CG  1 
ATOM 3549 C CD  . LYS B 1 6   ? -12.732 -73.904 62.218 1.00 30.14 ? 6   LYS B CD  1 
ATOM 3550 C CE  . LYS B 1 6   ? -13.233 -74.154 63.624 1.00 35.49 ? 6   LYS B CE  1 
ATOM 3551 N NZ  . LYS B 1 6   ? -14.031 -75.453 63.625 1.00 40.65 ? 6   LYS B NZ  1 
ATOM 3552 N N   . SER B 1 7   ? -9.252  -71.519 59.204 1.00 24.10 ? 7   SER B N   1 
ATOM 3553 C CA  . SER B 1 7   ? -8.500  -71.489 58.005 1.00 26.86 ? 7   SER B CA  1 
ATOM 3554 C C   . SER B 1 7   ? -8.206  -72.924 57.487 1.00 26.83 ? 7   SER B C   1 
ATOM 3555 O O   . SER B 1 7   ? -7.308  -73.094 56.663 1.00 29.62 ? 7   SER B O   1 
ATOM 3556 C CB  . SER B 1 7   ? -7.271  -70.630 58.312 1.00 28.21 ? 7   SER B CB  1 
ATOM 3557 O OG  . SER B 1 7   ? -6.149  -71.045 57.585 1.00 38.00 ? 7   SER B OG  1 
ATOM 3558 N N   . VAL B 1 8   ? -8.961  -73.912 57.994 1.00 25.24 ? 8   VAL B N   1 
ATOM 3559 C CA  . VAL B 1 8   ? -8.958  -75.359 57.569 1.00 26.17 ? 8   VAL B CA  1 
ATOM 3560 C C   . VAL B 1 8   ? -9.485  -75.543 56.134 1.00 26.63 ? 8   VAL B C   1 
ATOM 3561 O O   . VAL B 1 8   ? -10.202 -74.630 55.607 1.00 26.09 ? 8   VAL B O   1 
ATOM 3562 C CB  . VAL B 1 8   ? -9.784  -76.265 58.511 1.00 26.01 ? 8   VAL B CB  1 
ATOM 3563 C CG1 . VAL B 1 8   ? -9.122  -76.427 59.929 1.00 30.05 ? 8   VAL B CG1 1 
ATOM 3564 C CG2 . VAL B 1 8   ? -11.326 -75.934 58.611 1.00 26.07 ? 8   VAL B CG2 1 
ATOM 3565 N N   . ALA B 1 9   ? -9.224  -76.717 55.532 1.00 25.03 ? 9   ALA B N   1 
ATOM 3566 C CA  . ALA B 1 9   ? -9.610  -76.987 54.112 1.00 24.52 ? 9   ALA B CA  1 
ATOM 3567 C C   . ALA B 1 9   ? -11.095 -77.257 54.134 1.00 22.43 ? 9   ALA B C   1 
ATOM 3568 O O   . ALA B 1 9   ? -11.544 -77.916 55.029 1.00 23.69 ? 9   ALA B O   1 
ATOM 3569 C CB  . ALA B 1 9   ? -8.897  -78.218 53.573 1.00 24.81 ? 9   ALA B CB  1 
ATOM 3570 N N   . ALA B 1 10  ? -11.837 -76.734 53.141 1.00 22.94 ? 10  ALA B N   1 
ATOM 3571 C CA  . ALA B 1 10  ? -13.297 -76.919 53.131 1.00 21.23 ? 10  ALA B CA  1 
ATOM 3572 C C   . ALA B 1 10  ? -13.700 -78.402 53.105 1.00 22.41 ? 10  ALA B C   1 
ATOM 3573 O O   . ALA B 1 10  ? -14.703 -78.792 53.743 1.00 20.36 ? 10  ALA B O   1 
ATOM 3574 C CB  . ALA B 1 10  ? -13.868 -76.222 51.939 1.00 18.68 ? 10  ALA B CB  1 
ATOM 3575 N N   . ALA B 1 11  ? -12.933 -79.242 52.353 1.00 22.38 ? 11  ALA B N   1 
ATOM 3576 C CA  . ALA B 1 11  ? -13.353 -80.647 52.198 1.00 25.47 ? 11  ALA B CA  1 
ATOM 3577 C C   . ALA B 1 11  ? -13.173 -81.455 53.486 1.00 26.17 ? 11  ALA B C   1 
ATOM 3578 O O   . ALA B 1 11  ? -13.802 -82.505 53.676 1.00 29.05 ? 11  ALA B O   1 
ATOM 3579 C CB  . ALA B 1 11  ? -12.570 -81.271 51.085 1.00 25.46 ? 11  ALA B CB  1 
ATOM 3580 N N   . SER B 1 12  ? -12.360 -80.912 54.371 1.00 27.43 ? 12  SER B N   1 
ATOM 3581 C CA  . SER B 1 12  ? -11.945 -81.535 55.632 1.00 30.23 ? 12  SER B CA  1 
ATOM 3582 C C   . SER B 1 12  ? -12.912 -81.222 56.758 1.00 29.39 ? 12  SER B C   1 
ATOM 3583 O O   . SER B 1 12  ? -12.843 -81.850 57.810 1.00 31.85 ? 12  SER B O   1 
ATOM 3584 C CB  . SER B 1 12  ? -10.546 -81.001 56.041 1.00 29.84 ? 12  SER B CB  1 
ATOM 3585 O OG  . SER B 1 12  ? -10.629 -79.738 56.842 1.00 33.25 ? 12  SER B OG  1 
ATOM 3586 N N   . VAL B 1 13  ? -13.784 -80.209 56.591 1.00 26.55 ? 13  VAL B N   1 
ATOM 3587 C CA  . VAL B 1 13  ? -14.423 -79.676 57.760 1.00 25.99 ? 13  VAL B CA  1 
ATOM 3588 C C   . VAL B 1 13  ? -15.733 -80.431 58.082 1.00 24.23 ? 13  VAL B C   1 
ATOM 3589 O O   . VAL B 1 13  ? -16.576 -80.572 57.257 1.00 25.59 ? 13  VAL B O   1 
ATOM 3590 C CB  . VAL B 1 13  ? -14.656 -78.077 57.657 1.00 24.36 ? 13  VAL B CB  1 
ATOM 3591 C CG1 . VAL B 1 13  ? -15.777 -77.743 56.683 1.00 31.27 ? 13  VAL B CG1 1 
ATOM 3592 C CG2 . VAL B 1 13  ? -15.005 -77.505 58.994 1.00 28.60 ? 13  VAL B CG2 1 
ATOM 3593 N N   . LYS B 1 14  ? -15.888 -80.887 59.305 1.00 24.09 ? 14  LYS B N   1 
ATOM 3594 C CA  . LYS B 1 14  ? -17.130 -81.482 59.702 1.00 24.56 ? 14  LYS B CA  1 
ATOM 3595 C C   . LYS B 1 14  ? -18.203 -80.420 59.913 1.00 21.80 ? 14  LYS B C   1 
ATOM 3596 O O   . LYS B 1 14  ? -18.063 -79.475 60.714 1.00 22.20 ? 14  LYS B O   1 
ATOM 3597 C CB  . LYS B 1 14  ? -16.918 -82.321 60.965 1.00 25.96 ? 14  LYS B CB  1 
ATOM 3598 C CG  . LYS B 1 14  ? -18.172 -83.051 61.420 1.00 32.91 ? 14  LYS B CG  1 
ATOM 3599 C CD  . LYS B 1 14  ? -17.833 -83.913 62.680 1.00 43.69 ? 14  LYS B CD  1 
ATOM 3600 C CE  . LYS B 1 14  ? -19.069 -84.659 63.204 1.00 50.75 ? 14  LYS B CE  1 
ATOM 3601 N NZ  . LYS B 1 14  ? -18.757 -85.506 64.435 1.00 53.89 ? 14  LYS B NZ  1 
ATOM 3602 N N   . THR B 1 15  ? -19.315 -80.607 59.191 1.00 18.80 ? 15  THR B N   1 
ATOM 3603 C CA  . THR B 1 15  ? -20.400 -79.610 59.305 1.00 16.26 ? 15  THR B CA  1 
ATOM 3604 C C   . THR B 1 15  ? -21.720 -80.124 58.781 1.00 16.38 ? 15  THR B C   1 
ATOM 3605 O O   . THR B 1 15  ? -21.724 -81.073 57.944 1.00 16.24 ? 15  THR B O   1 
ATOM 3606 C CB  . THR B 1 15  ? -19.997 -78.320 58.494 1.00 16.28 ? 15  THR B CB  1 
ATOM 3607 O OG1 . THR B 1 15  ? -21.038 -77.363 58.671 1.00 17.04 ? 15  THR B OG1 1 
ATOM 3608 C CG2 . THR B 1 15  ? -19.948 -78.602 56.984 1.00 18.15 ? 15  THR B CG2 1 
ATOM 3609 N N   . ALA B 1 16  ? -22.869 -79.535 59.198 1.00 14.29 ? 16  ALA B N   1 
ATOM 3610 C CA  . ALA B 1 16  ? -24.152 -79.902 58.585 1.00 14.89 ? 16  ALA B CA  1 
ATOM 3611 C C   . ALA B 1 16  ? -24.241 -79.449 57.129 1.00 14.75 ? 16  ALA B C   1 
ATOM 3612 O O   . ALA B 1 16  ? -24.836 -80.122 56.297 1.00 15.04 ? 16  ALA B O   1 
ATOM 3613 C CB  . ALA B 1 16  ? -25.342 -79.313 59.424 1.00 15.00 ? 16  ALA B CB  1 
ATOM 3614 N N   . THR B 1 17  ? -23.676 -78.283 56.796 1.00 14.18 ? 17  THR B N   1 
ATOM 3615 C CA  . THR B 1 17  ? -23.809 -77.818 55.413 1.00 14.01 ? 17  THR B CA  1 
ATOM 3616 C C   . THR B 1 17  ? -22.566 -77.041 55.062 1.00 14.26 ? 17  THR B C   1 
ATOM 3617 O O   . THR B 1 17  ? -22.253 -76.082 55.750 1.00 13.32 ? 17  THR B O   1 
ATOM 3618 C CB  . THR B 1 17  ? -25.020 -76.855 55.277 1.00 13.06 ? 17  THR B CB  1 
ATOM 3619 O OG1 . THR B 1 17  ? -26.244 -77.471 55.684 1.00 12.71 ? 17  THR B OG1 1 
ATOM 3620 C CG2 . THR B 1 17  ? -25.142 -76.532 53.757 1.00 14.16 ? 17  THR B CG2 1 
ATOM 3621 N N   . LEU B 1 18  ? -21.891 -77.421 53.978 1.00 12.26 ? 18  LEU B N   1 
ATOM 3622 C CA  . LEU B 1 18  ? -20.769 -76.676 53.376 1.00 11.19 ? 18  LEU B CA  1 
ATOM 3623 C C   . LEU B 1 18  ? -21.306 -75.860 52.187 1.00 11.40 ? 18  LEU B C   1 
ATOM 3624 O O   . LEU B 1 18  ? -21.938 -76.399 51.356 1.00 14.39 ? 18  LEU B O   1 
ATOM 3625 C CB  . LEU B 1 18  ? -19.713 -77.654 52.823 1.00 11.63 ? 18  LEU B CB  1 
ATOM 3626 C CG  . LEU B 1 18  ? -18.519 -77.004 52.088 1.00 12.30 ? 18  LEU B CG  1 
ATOM 3627 C CD1 . LEU B 1 18  ? -17.698 -76.049 53.005 1.00 14.10 ? 18  LEU B CD1 1 
ATOM 3628 C CD2 . LEU B 1 18  ? -17.661 -78.231 51.550 1.00 12.90 ? 18  LEU B CD2 1 
ATOM 3629 N N   . VAL B 1 19  ? -21.007 -74.582 52.186 1.00 10.09 ? 19  VAL B N   1 
ATOM 3630 C CA  . VAL B 1 19  ? -21.432 -73.676 51.067 1.00 10.81 ? 19  VAL B CA  1 
ATOM 3631 C C   . VAL B 1 19  ? -20.214 -73.254 50.260 1.00 9.91  ? 19  VAL B C   1 
ATOM 3632 O O   . VAL B 1 19  ? -19.240 -72.697 50.778 1.00 11.46 ? 19  VAL B O   1 
ATOM 3633 C CB  . VAL B 1 19  ? -22.082 -72.442 51.616 1.00 9.42  ? 19  VAL B CB  1 
ATOM 3634 C CG1 . VAL B 1 19  ? -22.706 -71.558 50.476 1.00 12.75 ? 19  VAL B CG1 1 
ATOM 3635 C CG2 . VAL B 1 19  ? -23.204 -72.807 52.632 1.00 10.26 ? 19  VAL B CG2 1 
ATOM 3636 N N   . ILE B 1 20  ? -20.323 -73.482 48.966 1.00 11.47 ? 20  ILE B N   1 
ATOM 3637 C CA  . ILE B 1 20  ? -19.224 -73.112 48.044 1.00 12.32 ? 20  ILE B CA  1 
ATOM 3638 C C   . ILE B 1 20  ? -19.886 -72.442 46.824 1.00 11.00 ? 20  ILE B C   1 
ATOM 3639 O O   . ILE B 1 20  ? -21.061 -72.730 46.450 1.00 12.22 ? 20  ILE B O   1 
ATOM 3640 C CB  . ILE B 1 20  ? -18.411 -74.338 47.556 1.00 12.45 ? 20  ILE B CB  1 
ATOM 3641 C CG1 . ILE B 1 20  ? -19.318 -75.471 46.979 1.00 14.11 ? 20  ILE B CG1 1 
ATOM 3642 C CG2 . ILE B 1 20  ? -17.368 -74.798 48.667 1.00 14.18 ? 20  ILE B CG2 1 
ATOM 3643 C CD1 . ILE B 1 20  ? -18.430 -76.616 46.288 1.00 15.00 ? 20  ILE B CD1 1 
ATOM 3644 N N   . PRO B 1 21  ? -19.146 -71.559 46.114 1.00 12.33 ? 21  PRO B N   1 
ATOM 3645 C CA  . PRO B 1 21  ? -19.660 -70.846 44.970 1.00 12.53 ? 21  PRO B CA  1 
ATOM 3646 C C   . PRO B 1 21  ? -19.337 -71.556 43.626 1.00 12.58 ? 21  PRO B C   1 
ATOM 3647 O O   . PRO B 1 21  ? -18.399 -72.315 43.539 1.00 14.25 ? 21  PRO B O   1 
ATOM 3648 C CB  . PRO B 1 21  ? -18.901 -69.491 45.095 1.00 13.61 ? 21  PRO B CB  1 
ATOM 3649 C CG  . PRO B 1 21  ? -17.495 -69.921 45.666 1.00 14.10 ? 21  PRO B CG  1 
ATOM 3650 C CD  . PRO B 1 21  ? -17.749 -71.130 46.514 1.00 11.97 ? 21  PRO B CD  1 
ATOM 3651 N N   . VAL B 1 22  ? -20.212 -71.379 42.682 1.00 12.49 ? 22  VAL B N   1 
ATOM 3652 C CA  . VAL B 1 22  ? -20.081 -71.932 41.347 1.00 14.62 ? 22  VAL B CA  1 
ATOM 3653 C C   . VAL B 1 22  ? -20.399 -70.745 40.449 1.00 15.63 ? 22  VAL B C   1 
ATOM 3654 O O   . VAL B 1 22  ? -21.430 -70.077 40.554 1.00 16.62 ? 22  VAL B O   1 
ATOM 3655 C CB  . VAL B 1 22  ? -21.125 -73.044 41.197 1.00 13.71 ? 22  VAL B CB  1 
ATOM 3656 C CG1 . VAL B 1 22  ? -21.146 -73.593 39.683 1.00 18.71 ? 22  VAL B CG1 1 
ATOM 3657 C CG2 . VAL B 1 22  ? -20.869 -74.181 42.183 1.00 13.09 ? 22  VAL B CG2 1 
ATOM 3658 N N   . GLY B 1 23  ? -19.521 -70.525 39.460 1.00 16.26 ? 23  GLY B N   1 
ATOM 3659 C CA  . GLY B 1 23  ? -19.827 -69.515 38.446 1.00 17.24 ? 23  GLY B CA  1 
ATOM 3660 C C   . GLY B 1 23  ? -20.726 -69.978 37.325 1.00 18.46 ? 23  GLY B C   1 
ATOM 3661 O O   . GLY B 1 23  ? -21.186 -71.120 37.257 1.00 18.75 ? 23  GLY B O   1 
ATOM 3662 N N   . GLU B 1 24  ? -21.024 -69.057 36.427 1.00 22.83 ? 24  GLU B N   1 
ATOM 3663 C CA  . GLU B 1 24  ? -21.708 -69.453 35.190 1.00 23.42 ? 24  GLU B CA  1 
ATOM 3664 C C   . GLU B 1 24  ? -20.813 -70.403 34.413 1.00 24.65 ? 24  GLU B C   1 
ATOM 3665 O O   . GLU B 1 24  ? -19.596 -70.477 34.634 1.00 23.85 ? 24  GLU B O   1 
ATOM 3666 C CB  . GLU B 1 24  ? -21.979 -68.259 34.298 1.00 22.08 ? 24  GLU B CB  1 
ATOM 3667 C CG  . GLU B 1 24  ? -23.123 -67.421 34.778 1.00 27.70 ? 24  GLU B CG  1 
ATOM 3668 C CD  . GLU B 1 24  ? -23.552 -66.414 33.706 1.00 33.53 ? 24  GLU B CD  1 
ATOM 3669 O OE1 . GLU B 1 24  ? -23.271 -66.640 32.487 1.00 41.28 ? 24  GLU B OE1 1 
ATOM 3670 O OE2 . GLU B 1 24  ? -24.151 -65.418 34.076 1.00 32.64 ? 24  GLU B OE2 1 
ATOM 3671 N N   . ASN B 1 25  ? -21.445 -71.171 33.546 1.00 24.68 ? 25  ASN B N   1 
ATOM 3672 C CA  . ASN B 1 25  ? -20.726 -72.187 32.759 1.00 27.36 ? 25  ASN B CA  1 
ATOM 3673 C C   . ASN B 1 25  ? -19.997 -73.147 33.654 1.00 25.70 ? 25  ASN B C   1 
ATOM 3674 O O   . ASN B 1 25  ? -18.948 -73.668 33.280 1.00 27.02 ? 25  ASN B O   1 
ATOM 3675 C CB  . ASN B 1 25  ? -19.757 -71.557 31.734 1.00 26.93 ? 25  ASN B CB  1 
ATOM 3676 C CG  . ASN B 1 25  ? -20.398 -70.412 30.971 1.00 28.02 ? 25  ASN B CG  1 
ATOM 3677 O OD1 . ASN B 1 25  ? -21.380 -70.599 30.273 1.00 32.88 ? 25  ASN B OD1 1 
ATOM 3678 N ND2 . ASN B 1 25  ? -19.864 -69.199 31.157 1.00 30.92 ? 25  ASN B ND2 1 
ATOM 3679 N N   . ARG B 1 26  ? -20.573 -73.371 34.860 1.00 24.54 ? 26  ARG B N   1 
ATOM 3680 C CA  . ARG B 1 26  ? -20.184 -74.424 35.804 1.00 25.38 ? 26  ARG B CA  1 
ATOM 3681 C C   . ARG B 1 26  ? -18.705 -74.235 36.248 1.00 22.44 ? 26  ARG B C   1 
ATOM 3682 O O   . ARG B 1 26  ? -18.015 -75.204 36.632 1.00 25.24 ? 26  ARG B O   1 
ATOM 3683 C CB  . ARG B 1 26  ? -20.367 -75.824 35.176 1.00 26.45 ? 26  ARG B CB  1 
ATOM 3684 C CG  . ARG B 1 26  ? -21.729 -76.059 34.609 1.00 33.08 ? 26  ARG B CG  1 
ATOM 3685 C CD  . ARG B 1 26  ? -21.820 -77.504 34.098 1.00 43.47 ? 26  ARG B CD  1 
ATOM 3686 N NE  . ARG B 1 26  ? -20.873 -77.854 33.046 1.00 48.18 ? 26  ARG B NE  1 
ATOM 3687 C CZ  . ARG B 1 26  ? -20.854 -77.261 31.855 1.00 50.96 ? 26  ARG B CZ  1 
ATOM 3688 N NH1 . ARG B 1 26  ? -21.699 -76.253 31.594 1.00 49.67 ? 26  ARG B NH1 1 
ATOM 3689 N NH2 . ARG B 1 26  ? -19.975 -77.658 30.930 1.00 52.22 ? 26  ARG B NH2 1 
ATOM 3690 N N   . LYS B 1 27  ? -18.247 -73.006 36.166 1.00 23.55 ? 27  LYS B N   1 
ATOM 3691 C CA  . LYS B 1 27  ? -16.845 -72.703 36.387 1.00 23.85 ? 27  LYS B CA  1 
ATOM 3692 C C   . LYS B 1 27  ? -16.520 -72.753 37.877 1.00 22.79 ? 27  LYS B C   1 
ATOM 3693 O O   . LYS B 1 27  ? -17.194 -72.078 38.658 1.00 21.50 ? 27  LYS B O   1 
ATOM 3694 C CB  . LYS B 1 27  ? -16.517 -71.299 35.867 1.00 23.55 ? 27  LYS B CB  1 
ATOM 3695 C CG  . LYS B 1 27  ? -15.029 -71.043 36.046 1.00 27.65 ? 27  LYS B CG  1 
ATOM 3696 C CD  . LYS B 1 27  ? -14.563 -69.710 35.529 1.00 35.11 ? 27  LYS B CD  1 
ATOM 3697 C CE  . LYS B 1 27  ? -13.061 -69.507 35.762 1.00 42.71 ? 27  LYS B CE  1 
ATOM 3698 N NZ  . LYS B 1 27  ? -12.679 -68.165 35.223 1.00 44.07 ? 27  LYS B NZ  1 
ATOM 3699 N N   . LEU B 1 28  ? -15.506 -73.523 38.290 1.00 22.19 ? 28  LEU B N   1 
ATOM 3700 C CA  . LEU B 1 28  ? -15.176 -73.625 39.701 1.00 19.39 ? 28  LEU B CA  1 
ATOM 3701 C C   . LEU B 1 28  ? -13.887 -72.903 40.014 1.00 20.55 ? 28  LEU B C   1 
ATOM 3702 O O   . LEU B 1 28  ? -12.828 -73.098 39.356 1.00 21.62 ? 28  LEU B O   1 
ATOM 3703 C CB  . LEU B 1 28  ? -15.067 -75.108 40.166 1.00 19.37 ? 28  LEU B CB  1 
ATOM 3704 C CG  . LEU B 1 28  ? -16.250 -76.052 39.869 1.00 18.02 ? 28  LEU B CG  1 
ATOM 3705 C CD1 . LEU B 1 28  ? -15.966 -77.406 40.472 1.00 21.72 ? 28  LEU B CD1 1 
ATOM 3706 C CD2 . LEU B 1 28  ? -17.586 -75.470 40.505 1.00 19.15 ? 28  LEU B CD2 1 
ATOM 3707 N N   . GLY B 1 29  ? -13.931 -72.018 41.003 1.00 18.35 ? 29  GLY B N   1 
ATOM 3708 C CA  . GLY B 1 29  ? -12.706 -71.447 41.523 1.00 18.75 ? 29  GLY B CA  1 
ATOM 3709 C C   . GLY B 1 29  ? -11.871 -72.465 42.300 1.00 18.93 ? 29  GLY B C   1 
ATOM 3710 O O   . GLY B 1 29  ? -12.275 -73.624 42.453 1.00 18.83 ? 29  GLY B O   1 
ATOM 3711 N N   . ALA B 1 30  ? -10.677 -72.065 42.767 1.00 20.57 ? 30  ALA B N   1 
ATOM 3712 C CA  . ALA B 1 30  ? -9.804  -72.964 43.559 1.00 20.73 ? 30  ALA B CA  1 
ATOM 3713 C C   . ALA B 1 30  ? -10.454 -73.701 44.739 1.00 20.45 ? 30  ALA B C   1 
ATOM 3714 O O   . ALA B 1 30  ? -10.287 -74.924 44.907 1.00 19.29 ? 30  ALA B O   1 
ATOM 3715 C CB  . ALA B 1 30  ? -8.531  -72.179 44.049 1.00 21.68 ? 30  ALA B CB  1 
ATOM 3716 N N   . VAL B 1 31  ? -11.246 -72.984 45.530 1.00 20.76 ? 31  VAL B N   1 
ATOM 3717 C CA  . VAL B 1 31  ? -11.883 -73.626 46.698 1.00 18.86 ? 31  VAL B CA  1 
ATOM 3718 C C   . VAL B 1 31  ? -12.887 -74.687 46.294 1.00 17.09 ? 31  VAL B C   1 
ATOM 3719 O O   . VAL B 1 31  ? -12.804 -75.859 46.763 1.00 18.44 ? 31  VAL B O   1 
ATOM 3720 C CB  . VAL B 1 31  ? -12.548 -72.585 47.678 1.00 19.13 ? 31  VAL B CB  1 
ATOM 3721 C CG1 . VAL B 1 31  ? -13.311 -73.296 48.777 1.00 20.18 ? 31  VAL B CG1 1 
ATOM 3722 C CG2 . VAL B 1 31  ? -11.452 -71.781 48.257 1.00 21.21 ? 31  VAL B CG2 1 
ATOM 3723 N N   . ALA B 1 32  ? -13.807 -74.303 45.442 1.00 17.06 ? 32  ALA B N   1 
ATOM 3724 C CA  . ALA B 1 32  ? -14.836 -75.235 44.922 1.00 16.02 ? 32  ALA B CA  1 
ATOM 3725 C C   . ALA B 1 32  ? -14.232 -76.421 44.203 1.00 16.38 ? 32  ALA B C   1 
ATOM 3726 O O   . ALA B 1 32  ? -14.687 -77.571 44.345 1.00 16.09 ? 32  ALA B O   1 
ATOM 3727 C CB  . ALA B 1 32  ? -15.791 -74.462 44.049 1.00 17.16 ? 32  ALA B CB  1 
ATOM 3728 N N   . LYS B 1 33  ? -13.130 -76.152 43.471 1.00 14.88 ? 33  LYS B N   1 
ATOM 3729 C CA  . LYS B 1 33  ? -12.532 -77.245 42.661 1.00 16.62 ? 33  LYS B CA  1 
ATOM 3730 C C   . LYS B 1 33  ? -11.941 -78.310 43.576 1.00 16.17 ? 33  LYS B C   1 
ATOM 3731 O O   . LYS B 1 33  ? -12.118 -79.516 43.357 1.00 17.46 ? 33  LYS B O   1 
ATOM 3732 C CB  . LYS B 1 33  ? -11.425 -76.708 41.735 1.00 13.90 ? 33  LYS B CB  1 
ATOM 3733 C CG  . LYS B 1 33  ? -10.812 -77.785 40.812 1.00 21.67 ? 33  LYS B CG  1 
ATOM 3734 C CD  . LYS B 1 33  ? -9.747  -77.160 39.881 1.00 28.46 ? 33  LYS B CD  1 
ATOM 3735 C CE  . LYS B 1 33  ? -9.213  -78.348 39.046 1.00 34.11 ? 33  LYS B CE  1 
ATOM 3736 N NZ  . LYS B 1 33  ? -8.116  -78.079 37.995 1.00 39.91 ? 33  LYS B NZ  1 
ATOM 3737 N N   . ALA B 1 34  ? -11.349 -77.841 44.678 1.00 16.47 ? 34  ALA B N   1 
ATOM 3738 C CA  . ALA B 1 34  ? -10.786 -78.755 45.661 1.00 16.17 ? 34  ALA B CA  1 
ATOM 3739 C C   . ALA B 1 34  ? -11.844 -79.629 46.274 1.00 16.23 ? 34  ALA B C   1 
ATOM 3740 O O   . ALA B 1 34  ? -11.662 -80.830 46.453 1.00 16.15 ? 34  ALA B O   1 
ATOM 3741 C CB  . ALA B 1 34  ? -9.929  -78.026 46.703 1.00 16.70 ? 34  ALA B CB  1 
ATOM 3742 N N   . VAL B 1 35  ? -13.047 -79.050 46.542 1.00 15.58 ? 35  VAL B N   1 
ATOM 3743 C CA  . VAL B 1 35  ? -14.101 -79.821 47.149 1.00 15.71 ? 35  VAL B CA  1 
ATOM 3744 C C   . VAL B 1 35  ? -14.671 -80.788 46.090 1.00 13.89 ? 35  VAL B C   1 
ATOM 3745 O O   . VAL B 1 35  ? -14.935 -81.921 46.438 1.00 13.74 ? 35  VAL B O   1 
ATOM 3746 C CB  . VAL B 1 35  ? -15.203 -78.832 47.655 1.00 13.38 ? 35  VAL B CB  1 
ATOM 3747 C CG1 . VAL B 1 35  ? -16.537 -79.582 48.130 1.00 18.16 ? 35  VAL B CG1 1 
ATOM 3748 C CG2 . VAL B 1 35  ? -14.624 -77.866 48.717 1.00 15.42 ? 35  VAL B CG2 1 
ATOM 3749 N N   . ASP B 1 36  ? -14.716 -80.368 44.800 1.00 14.13 ? 36  ASP B N   1 
ATOM 3750 C CA  . ASP B 1 36  ? -15.151 -81.276 43.749 1.00 14.56 ? 36  ASP B CA  1 
ATOM 3751 C C   . ASP B 1 36  ? -14.204 -82.487 43.698 1.00 13.75 ? 36  ASP B C   1 
ATOM 3752 O O   . ASP B 1 36  ? -14.648 -83.618 43.656 1.00 13.53 ? 36  ASP B O   1 
ATOM 3753 C CB  . ASP B 1 36  ? -15.059 -80.606 42.371 1.00 15.39 ? 36  ASP B CB  1 
ATOM 3754 C CG  . ASP B 1 36  ? -15.632 -81.465 41.263 1.00 14.68 ? 36  ASP B CG  1 
ATOM 3755 O OD1 . ASP B 1 36  ? -16.645 -82.153 41.449 1.00 15.54 ? 36  ASP B OD1 1 
ATOM 3756 O OD2 . ASP B 1 36  ? -15.100 -81.248 40.124 1.00 19.56 ? 36  ASP B OD2 1 
ATOM 3757 N N   . LEU B 1 37  ? -12.900 -82.231 43.738 1.00 15.55 ? 37  LEU B N   1 
ATOM 3758 C CA  . LEU B 1 37  ? -11.914 -83.308 43.662 1.00 15.38 ? 37  LEU B CA  1 
ATOM 3759 C C   . LEU B 1 37  ? -12.038 -84.275 44.838 1.00 15.15 ? 37  LEU B C   1 
ATOM 3760 O O   . LEU B 1 37  ? -11.939 -85.490 44.667 1.00 14.92 ? 37  LEU B O   1 
ATOM 3761 C CB  . LEU B 1 37  ? -10.497 -82.731 43.602 1.00 18.06 ? 37  LEU B CB  1 
ATOM 3762 C CG  . LEU B 1 37  ? -10.151 -81.910 42.359 1.00 25.69 ? 37  LEU B CG  1 
ATOM 3763 C CD1 . LEU B 1 37  ? -8.774  -81.280 42.498 1.00 24.23 ? 37  LEU B CD1 1 
ATOM 3764 C CD2 . LEU B 1 37  ? -10.228 -82.771 41.108 1.00 26.21 ? 37  LEU B CD2 1 
ATOM 3765 N N   . ALA B 1 38  ? -12.261 -83.729 46.029 1.00 15.76 ? 38  ALA B N   1 
ATOM 3766 C CA  . ALA B 1 38  ? -12.477 -84.533 47.226 1.00 15.36 ? 38  ALA B CA  1 
ATOM 3767 C C   . ALA B 1 38  ? -13.748 -85.391 47.093 1.00 16.13 ? 38  ALA B C   1 
ATOM 3768 O O   . ALA B 1 38  ? -13.809 -86.477 47.605 1.00 17.83 ? 38  ALA B O   1 
ATOM 3769 C CB  . ALA B 1 38  ? -12.524 -83.653 48.492 1.00 16.31 ? 38  ALA B CB  1 
ATOM 3770 N N   . SER B 1 39  ? -14.758 -84.798 46.464 1.00 15.72 ? 39  SER B N   1 
ATOM 3771 C CA  . SER B 1 39  ? -15.993 -85.524 46.183 1.00 15.68 ? 39  SER B CA  1 
ATOM 3772 C C   . SER B 1 39  ? -15.942 -86.519 45.035 1.00 16.39 ? 39  SER B C   1 
ATOM 3773 O O   . SER B 1 39  ? -16.943 -87.079 44.657 1.00 15.92 ? 39  SER B O   1 
ATOM 3774 C CB  . SER B 1 39  ? -17.122 -84.494 45.984 1.00 15.92 ? 39  SER B CB  1 
ATOM 3775 O OG  . SER B 1 39  ? -17.156 -83.988 44.630 1.00 15.72 ? 39  SER B OG  1 
ATOM 3776 N N   . GLU B 1 40  ? -14.721 -86.717 44.483 1.00 16.52 ? 40  GLU B N   1 
ATOM 3777 C CA  . GLU B 1 40  ? -14.574 -87.689 43.411 1.00 17.82 ? 40  GLU B CA  1 
ATOM 3778 C C   . GLU B 1 40  ? -15.340 -87.289 42.159 1.00 13.60 ? 40  GLU B C   1 
ATOM 3779 O O   . GLU B 1 40  ? -15.847 -88.131 41.409 1.00 14.42 ? 40  GLU B O   1 
ATOM 3780 C CB  . GLU B 1 40  ? -14.897 -89.112 43.886 1.00 19.22 ? 40  GLU B CB  1 
ATOM 3781 C CG  . GLU B 1 40  ? -14.123 -89.605 45.116 1.00 24.01 ? 40  GLU B CG  1 
ATOM 3782 C CD  . GLU B 1 40  ? -14.620 -90.969 45.597 1.00 29.98 ? 40  GLU B CD  1 
ATOM 3783 O OE1 . GLU B 1 40  ? -15.682 -91.457 45.223 1.00 29.60 ? 40  GLU B OE1 1 
ATOM 3784 O OE2 . GLU B 1 40  ? -13.955 -91.549 46.396 1.00 32.43 ? 40  GLU B OE2 1 
ATOM 3785 N N   . GLY B 1 41  ? -15.365 -85.968 41.924 1.00 14.24 ? 41  GLY B N   1 
ATOM 3786 C CA  . GLY B 1 41  ? -15.985 -85.351 40.710 1.00 15.61 ? 41  GLY B CA  1 
ATOM 3787 C C   . GLY B 1 41  ? -17.535 -85.350 40.795 1.00 15.89 ? 41  GLY B C   1 
ATOM 3788 O O   . GLY B 1 41  ? -18.199 -85.066 39.806 1.00 18.17 ? 41  GLY B O   1 
ATOM 3789 N N   . ALA B 1 42  ? -18.068 -85.600 41.991 1.00 17.16 ? 42  ALA B N   1 
ATOM 3790 C CA  . ALA B 1 42  ? -19.518 -85.625 42.201 1.00 15.52 ? 42  ALA B CA  1 
ATOM 3791 C C   . ALA B 1 42  ? -20.125 -84.220 41.940 1.00 15.45 ? 42  ALA B C   1 
ATOM 3792 O O   . ALA B 1 42  ? -21.283 -84.135 41.290 1.00 18.40 ? 42  ALA B O   1 
ATOM 3793 C CB  . ALA B 1 42  ? -19.829 -86.160 43.572 1.00 16.65 ? 42  ALA B CB  1 
ATOM 3794 N N   . ILE B 1 43  ? -19.470 -83.177 42.400 1.00 18.25 ? 43  ILE B N   1 
ATOM 3795 C CA  . ILE B 1 43  ? -20.046 -81.852 42.213 1.00 19.37 ? 43  ILE B CA  1 
ATOM 3796 C C   . ILE B 1 43  ? -20.077 -81.444 40.722 1.00 19.95 ? 43  ILE B C   1 
ATOM 3797 O O   . ILE B 1 43  ? -21.102 -81.000 40.184 1.00 19.87 ? 43  ILE B O   1 
ATOM 3798 C CB  . ILE B 1 43  ? -19.325 -80.849 43.111 1.00 19.29 ? 43  ILE B CB  1 
ATOM 3799 C CG1 . ILE B 1 43  ? -19.684 -81.157 44.570 1.00 19.80 ? 43  ILE B CG1 1 
ATOM 3800 C CG2 . ILE B 1 43  ? -19.660 -79.410 42.725 1.00 21.39 ? 43  ILE B CG2 1 
ATOM 3801 C CD1 . ILE B 1 43  ? -18.719 -80.510 45.562 1.00 21.97 ? 43  ILE B CD1 1 
ATOM 3802 N N   . SER B 1 44  ? -18.968 -81.671 39.994 1.00 19.34 ? 44  SER B N   1 
ATOM 3803 C CA  . SER B 1 44  ? -18.922 -81.462 38.528 1.00 18.66 ? 44  SER B CA  1 
ATOM 3804 C C   . SER B 1 44  ? -19.971 -82.267 37.773 1.00 18.34 ? 44  SER B C   1 
ATOM 3805 O O   . SER B 1 44  ? -20.543 -81.772 36.798 1.00 17.74 ? 44  SER B O   1 
ATOM 3806 C CB  . SER B 1 44  ? -17.488 -81.793 37.974 1.00 19.57 ? 44  SER B CB  1 
ATOM 3807 O OG  . SER B 1 44  ? -16.732 -80.628 38.154 1.00 23.69 ? 44  SER B OG  1 
ATOM 3808 N N   . ALA B 1 45  ? -20.135 -83.518 38.133 1.00 17.71 ? 45  ALA B N   1 
ATOM 3809 C CA  . ALA B 1 45  ? -21.072 -84.426 37.514 1.00 18.15 ? 45  ALA B CA  1 
ATOM 3810 C C   . ALA B 1 45  ? -22.493 -83.846 37.639 1.00 19.77 ? 45  ALA B C   1 
ATOM 3811 O O   . ALA B 1 45  ? -23.237 -83.806 36.646 1.00 19.96 ? 45  ALA B O   1 
ATOM 3812 C CB  . ALA B 1 45  ? -20.949 -85.799 38.160 1.00 20.01 ? 45  ALA B CB  1 
ATOM 3813 N N   . VAL B 1 46  ? -22.831 -83.338 38.838 1.00 18.53 ? 46  VAL B N   1 
ATOM 3814 C CA  . VAL B 1 46  ? -24.200 -82.803 38.983 1.00 18.42 ? 46  VAL B CA  1 
ATOM 3815 C C   . VAL B 1 46  ? -24.297 -81.543 38.172 1.00 17.21 ? 46  VAL B C   1 
ATOM 3816 O O   . VAL B 1 46  ? -25.351 -81.282 37.498 1.00 16.83 ? 46  VAL B O   1 
ATOM 3817 C CB  . VAL B 1 46  ? -24.467 -82.449 40.429 1.00 18.39 ? 46  VAL B CB  1 
ATOM 3818 C CG1 . VAL B 1 46  ? -25.844 -81.706 40.563 1.00 22.07 ? 46  VAL B CG1 1 
ATOM 3819 C CG2 . VAL B 1 46  ? -24.655 -83.680 41.310 1.00 22.93 ? 46  VAL B CG2 1 
ATOM 3820 N N   . LEU B 1 47  ? -23.272 -80.677 38.239 1.00 17.24 ? 47  LEU B N   1 
ATOM 3821 C CA  . LEU B 1 47  ? -23.274 -79.417 37.461 1.00 14.33 ? 47  LEU B CA  1 
ATOM 3822 C C   . LEU B 1 47  ? -23.494 -79.690 35.951 1.00 16.40 ? 47  LEU B C   1 
ATOM 3823 O O   . LEU B 1 47  ? -24.194 -78.890 35.276 1.00 18.32 ? 47  LEU B O   1 
ATOM 3824 C CB  . LEU B 1 47  ? -22.049 -78.540 37.739 1.00 16.56 ? 47  LEU B CB  1 
ATOM 3825 C CG  . LEU B 1 47  ? -21.991 -77.952 39.167 1.00 17.61 ? 47  LEU B CG  1 
ATOM 3826 C CD1 . LEU B 1 47  ? -20.678 -77.328 39.371 1.00 18.72 ? 47  LEU B CD1 1 
ATOM 3827 C CD2 . LEU B 1 47  ? -23.140 -76.836 39.317 1.00 19.01 ? 47  LEU B CD2 1 
ATOM 3828 N N   . LYS B 1 48  ? -22.950 -80.814 35.449 1.00 16.71 ? 48  LYS B N   1 
ATOM 3829 C CA  . LYS B 1 48  ? -23.034 -81.019 34.002 1.00 17.89 ? 48  LYS B CA  1 
ATOM 3830 C C   . LYS B 1 48  ? -24.514 -81.219 33.602 1.00 17.04 ? 48  LYS B C   1 
ATOM 3831 O O   . LYS B 1 48  ? -24.855 -80.953 32.408 1.00 17.58 ? 48  LYS B O   1 
ATOM 3832 C CB  . LYS B 1 48  ? -22.226 -82.292 33.687 1.00 19.33 ? 48  LYS B CB  1 
ATOM 3833 C CG  . LYS B 1 48  ? -22.070 -82.624 32.206 1.00 26.75 ? 48  LYS B CG  1 
ATOM 3834 C CD  . LYS B 1 48  ? -21.082 -83.839 32.102 1.00 36.16 ? 48  LYS B CD  1 
ATOM 3835 C CE  . LYS B 1 48  ? -20.895 -84.292 30.633 1.00 40.50 ? 48  LYS B CE  1 
ATOM 3836 N NZ  . LYS B 1 48  ? -20.458 -83.069 29.823 1.00 43.41 ? 48  LYS B NZ  1 
ATOM 3837 N N   . ARG B 1 49  ? -25.375 -81.623 34.517 1.00 17.93 ? 49  ARG B N   1 
ATOM 3838 C CA  . ARG B 1 49  ? -26.795 -81.772 34.229 1.00 17.44 ? 49  ARG B CA  1 
ATOM 3839 C C   . ARG B 1 49  ? -27.513 -80.428 34.022 1.00 16.94 ? 49  ARG B C   1 
ATOM 3840 O O   . ARG B 1 49  ? -28.656 -80.453 33.477 1.00 18.54 ? 49  ARG B O   1 
ATOM 3841 C CB  . ARG B 1 49  ? -27.542 -82.529 35.320 1.00 18.09 ? 49  ARG B CB  1 
ATOM 3842 C CG  . ARG B 1 49  ? -27.150 -84.027 35.396 1.00 23.13 ? 49  ARG B CG  1 
ATOM 3843 C CD  . ARG B 1 49  ? -28.316 -84.867 36.018 1.00 23.01 ? 49  ARG B CD  1 
ATOM 3844 N NE  . ARG B 1 49  ? -28.286 -84.781 37.483 1.00 25.02 ? 49  ARG B NE  1 
ATOM 3845 C CZ  . ARG B 1 49  ? -27.581 -85.631 38.270 1.00 33.92 ? 49  ARG B CZ  1 
ATOM 3846 N NH1 . ARG B 1 49  ? -26.907 -86.629 37.688 1.00 37.29 ? 49  ARG B NH1 1 
ATOM 3847 N NH2 . ARG B 1 49  ? -27.539 -85.552 39.632 1.00 22.48 ? 49  ARG B NH2 1 
ATOM 3848 N N   . GLY B 1 50  ? -26.888 -79.308 34.423 1.00 14.69 ? 50  GLY B N   1 
ATOM 3849 C CA  . GLY B 1 50  ? -27.371 -77.975 34.097 1.00 14.46 ? 50  GLY B CA  1 
ATOM 3850 C C   . GLY B 1 50  ? -28.481 -77.356 34.960 1.00 14.46 ? 50  GLY B C   1 
ATOM 3851 O O   . GLY B 1 50  ? -29.048 -76.324 34.575 1.00 14.96 ? 50  GLY B O   1 
ATOM 3852 N N   . ASP B 1 51  ? -28.758 -77.926 36.124 1.00 13.88 ? 51  ASP B N   1 
ATOM 3853 C CA  . ASP B 1 51  ? -29.801 -77.309 36.920 1.00 13.02 ? 51  ASP B CA  1 
ATOM 3854 C C   . ASP B 1 51  ? -29.425 -75.972 37.492 1.00 14.59 ? 51  ASP B C   1 
ATOM 3855 O O   . ASP B 1 51  ? -30.345 -75.148 37.764 1.00 15.46 ? 51  ASP B O   1 
ATOM 3856 C CB  . ASP B 1 51  ? -30.244 -78.190 38.063 1.00 12.98 ? 51  ASP B CB  1 
ATOM 3857 C CG  . ASP B 1 51  ? -30.985 -79.450 37.598 1.00 12.63 ? 51  ASP B CG  1 
ATOM 3858 O OD1 . ASP B 1 51  ? -31.381 -79.610 36.420 1.00 11.92 ? 51  ASP B OD1 1 
ATOM 3859 O OD2 . ASP B 1 51  ? -31.076 -80.402 38.401 1.00 13.60 ? 51  ASP B OD2 1 
ATOM 3860 N N   . LEU B 1 52  ? -28.151 -75.742 37.739 1.00 12.93 ? 52  LEU B N   1 
ATOM 3861 C CA  . LEU B 1 52  ? -27.632 -74.525 38.268 1.00 15.38 ? 52  LEU B CA  1 
ATOM 3862 C C   . LEU B 1 52  ? -26.915 -73.725 37.176 1.00 15.11 ? 52  LEU B C   1 
ATOM 3863 O O   . LEU B 1 52  ? -25.809 -74.056 36.778 1.00 18.10 ? 52  LEU B O   1 
ATOM 3864 C CB  . LEU B 1 52  ? -26.729 -74.800 39.470 1.00 14.53 ? 52  LEU B CB  1 
ATOM 3865 C CG  . LEU B 1 52  ? -26.087 -73.558 40.056 1.00 14.85 ? 52  LEU B CG  1 
ATOM 3866 C CD1 . LEU B 1 52  ? -27.233 -72.632 40.608 1.00 16.99 ? 52  LEU B CD1 1 
ATOM 3867 C CD2 . LEU B 1 52  ? -25.182 -73.947 41.218 1.00 14.19 ? 52  LEU B CD2 1 
ATOM 3868 N N   . ALA B 1 53  ? -27.545 -72.620 36.763 1.00 16.62 ? 53  ALA B N   1 
ATOM 3869 C CA  . ALA B 1 53  ? -26.937 -71.749 35.761 1.00 18.17 ? 53  ALA B CA  1 
ATOM 3870 C C   . ALA B 1 53  ? -25.812 -70.877 36.334 1.00 17.63 ? 53  ALA B C   1 
ATOM 3871 O O   . ALA B 1 53  ? -24.953 -70.398 35.571 1.00 18.76 ? 53  ALA B O   1 
ATOM 3872 C CB  . ALA B 1 53  ? -27.969 -70.952 35.124 1.00 19.50 ? 53  ALA B CB  1 
ATOM 3873 N N   . GLY B 1 54  ? -25.746 -70.758 37.670 1.00 16.53 ? 54  GLY B N   1 
ATOM 3874 C CA  . GLY B 1 54  ? -24.709 -69.987 38.309 1.00 16.22 ? 54  GLY B CA  1 
ATOM 3875 C C   . GLY B 1 54  ? -24.835 -68.459 38.329 1.00 16.74 ? 54  GLY B C   1 
ATOM 3876 O O   . GLY B 1 54  ? -23.859 -67.773 38.574 1.00 17.95 ? 54  GLY B O   1 
ATOM 3877 N N   . LYS B 1 55  ? -26.048 -67.978 38.126 1.00 16.44 ? 55  LYS B N   1 
ATOM 3878 C CA  . LYS B 1 55  ? -26.296 -66.560 38.252 1.00 17.61 ? 55  LYS B CA  1 
ATOM 3879 C C   . LYS B 1 55  ? -26.211 -66.288 39.771 1.00 17.84 ? 55  LYS B C   1 
ATOM 3880 O O   . LYS B 1 55  ? -26.516 -67.163 40.583 1.00 16.10 ? 55  LYS B O   1 
ATOM 3881 C CB  . LYS B 1 55  ? -27.632 -66.156 37.642 1.00 18.01 ? 55  LYS B CB  1 
ATOM 3882 C CG  . LYS B 1 55  ? -27.784 -66.516 36.165 1.00 23.88 ? 55  LYS B CG  1 
ATOM 3883 C CD  . LYS B 1 55  ? -29.122 -65.938 35.648 1.00 33.72 ? 55  LYS B CD  1 
ATOM 3884 C CE  . LYS B 1 55  ? -29.361 -66.231 34.168 1.00 36.38 ? 55  LYS B CE  1 
ATOM 3885 N NZ  . LYS B 1 55  ? -28.073 -66.298 33.422 1.00 45.60 ? 55  LYS B NZ  1 
ATOM 3886 N N   . PRO B 1 56  ? -25.854 -65.049 40.163 1.00 19.26 ? 56  PRO B N   1 
ATOM 3887 C CA  . PRO B 1 56  ? -25.626 -64.759 41.588 1.00 17.76 ? 56  PRO B CA  1 
ATOM 3888 C C   . PRO B 1 56  ? -26.772 -65.116 42.495 1.00 16.37 ? 56  PRO B C   1 
ATOM 3889 O O   . PRO B 1 56  ? -27.983 -64.776 42.210 1.00 17.02 ? 56  PRO B O   1 
ATOM 3890 C CB  . PRO B 1 56  ? -25.380 -63.230 41.568 1.00 19.09 ? 56  PRO B CB  1 
ATOM 3891 C CG  . PRO B 1 56  ? -24.694 -63.045 40.220 1.00 19.36 ? 56  PRO B CG  1 
ATOM 3892 C CD  . PRO B 1 56  ? -25.387 -63.939 39.282 1.00 19.31 ? 56  PRO B CD  1 
ATOM 3893 N N   . GLY B 1 57  ? -26.452 -65.892 43.560 1.00 14.51 ? 57  GLY B N   1 
ATOM 3894 C CA  . GLY B 1 57  ? -27.556 -66.311 44.487 1.00 16.14 ? 57  GLY B CA  1 
ATOM 3895 C C   . GLY B 1 57  ? -28.458 -67.454 44.125 1.00 13.82 ? 57  GLY B C   1 
ATOM 3896 O O   . GLY B 1 57  ? -29.239 -67.985 44.957 1.00 15.14 ? 57  GLY B O   1 
ATOM 3897 N N   . GLN B 1 58  ? -28.339 -67.969 42.878 1.00 14.87 ? 58  GLN B N   1 
ATOM 3898 C CA  . GLN B 1 58  ? -29.031 -69.182 42.596 1.00 12.85 ? 58  GLN B CA  1 
ATOM 3899 C C   . GLN B 1 58  ? -28.388 -70.303 43.435 1.00 12.37 ? 58  GLN B C   1 
ATOM 3900 O O   . GLN B 1 58  ? -27.277 -70.255 43.812 1.00 13.94 ? 58  GLN B O   1 
ATOM 3901 C CB  . GLN B 1 58  ? -28.853 -69.578 41.134 1.00 13.39 ? 58  GLN B CB  1 
ATOM 3902 C CG  . GLN B 1 58  ? -29.733 -68.733 40.229 1.00 16.42 ? 58  GLN B CG  1 
ATOM 3903 C CD  . GLN B 1 58  ? -29.510 -69.070 38.736 1.00 14.25 ? 58  GLN B CD  1 
ATOM 3904 O OE1 . GLN B 1 58  ? -28.460 -69.563 38.347 1.00 19.96 ? 58  GLN B OE1 1 
ATOM 3905 N NE2 . GLN B 1 58  ? -30.487 -68.733 37.896 1.00 19.93 ? 58  GLN B NE2 1 
ATOM 3906 N N   . THR B 1 59  ? -29.167 -71.292 43.710 1.00 12.17 ? 59  THR B N   1 
ATOM 3907 C CA  . THR B 1 59  ? -28.691 -72.418 44.601 1.00 12.06 ? 59  THR B CA  1 
ATOM 3908 C C   . THR B 1 59  ? -29.026 -73.806 44.097 1.00 11.22 ? 59  THR B C   1 
ATOM 3909 O O   . THR B 1 59  ? -30.022 -74.033 43.427 1.00 14.56 ? 59  THR B O   1 
ATOM 3910 C CB  . THR B 1 59  ? -29.167 -72.273 46.097 1.00 12.97 ? 59  THR B CB  1 
ATOM 3911 O OG1 . THR B 1 59  ? -30.603 -72.183 46.073 1.00 15.15 ? 59  THR B OG1 1 
ATOM 3912 C CG2 . THR B 1 59  ? -28.568 -71.052 46.827 1.00 15.62 ? 59  THR B CG2 1 
ATOM 3913 N N   . LEU B 1 60  ? -28.188 -74.750 44.541 1.00 12.38 ? 60  LEU B N   1 
ATOM 3914 C CA  . LEU B 1 60  ? -28.467 -76.215 44.342 1.00 12.69 ? 60  LEU B CA  1 
ATOM 3915 C C   . LEU B 1 60  ? -27.922 -76.931 45.542 1.00 12.35 ? 60  LEU B C   1 
ATOM 3916 O O   . LEU B 1 60  ? -26.752 -76.752 45.908 1.00 11.46 ? 60  LEU B O   1 
ATOM 3917 C CB  . LEU B 1 60  ? -27.701 -76.647 43.048 1.00 11.84 ? 60  LEU B CB  1 
ATOM 3918 C CG  . LEU B 1 60  ? -28.072 -78.048 42.517 1.00 13.31 ? 60  LEU B CG  1 
ATOM 3919 C CD1 . LEU B 1 60  ? -27.756 -78.320 41.065 1.00 16.12 ? 60  LEU B CD1 1 
ATOM 3920 C CD2 . LEU B 1 60  ? -27.589 -79.182 43.404 1.00 14.93 ? 60  LEU B CD2 1 
ATOM 3921 N N   . LEU B 1 61  ? -28.804 -77.676 46.208 1.00 11.30 ? 61  LEU B N   1 
ATOM 3922 C CA  . LEU B 1 61  ? -28.453 -78.282 47.501 1.00 12.07 ? 61  LEU B CA  1 
ATOM 3923 C C   . LEU B 1 61  ? -28.236 -79.784 47.271 1.00 12.65 ? 61  LEU B C   1 
ATOM 3924 O O   . LEU B 1 61  ? -29.148 -80.485 46.808 1.00 14.39 ? 61  LEU B O   1 
ATOM 3925 C CB  . LEU B 1 61  ? -29.561 -78.037 48.525 1.00 12.19 ? 61  LEU B CB  1 
ATOM 3926 C CG  . LEU B 1 61  ? -29.312 -78.675 49.892 1.00 14.89 ? 61  LEU B CG  1 
ATOM 3927 C CD1 . LEU B 1 61  ? -28.107 -78.100 50.626 1.00 16.17 ? 61  LEU B CD1 1 
ATOM 3928 C CD2 . LEU B 1 61  ? -30.558 -78.424 50.758 1.00 18.51 ? 61  LEU B CD2 1 
ATOM 3929 N N   . LEU B 1 62  ? -27.060 -80.248 47.670 1.00 11.92 ? 62  LEU B N   1 
ATOM 3930 C CA  . LEU B 1 62  ? -26.716 -81.676 47.664 1.00 12.95 ? 62  LEU B CA  1 
ATOM 3931 C C   . LEU B 1 62  ? -26.715 -82.215 49.064 1.00 12.31 ? 62  LEU B C   1 
ATOM 3932 O O   . LEU B 1 62  ? -26.458 -81.481 50.033 1.00 13.23 ? 62  LEU B O   1 
ATOM 3933 C CB  . LEU B 1 62  ? -25.331 -81.905 46.982 1.00 12.58 ? 62  LEU B CB  1 
ATOM 3934 C CG  . LEU B 1 62  ? -25.279 -81.380 45.590 1.00 14.46 ? 62  LEU B CG  1 
ATOM 3935 C CD1 . LEU B 1 62  ? -23.764 -81.345 45.209 1.00 15.93 ? 62  LEU B CD1 1 
ATOM 3936 C CD2 . LEU B 1 62  ? -26.208 -82.261 44.712 1.00 14.29 ? 62  LEU B CD2 1 
ATOM 3937 N N   . GLN B 1 63  ? -27.016 -83.515 49.119 1.00 13.75 ? 63  GLN B N   1 
ATOM 3938 C CA  . GLN B 1 63  ? -26.939 -84.393 50.286 1.00 14.03 ? 63  GLN B CA  1 
ATOM 3939 C C   . GLN B 1 63  ? -25.564 -85.059 50.406 1.00 16.28 ? 63  GLN B C   1 
ATOM 3940 O O   . GLN B 1 63  ? -24.616 -84.668 49.724 1.00 15.77 ? 63  GLN B O   1 
ATOM 3941 C CB  . GLN B 1 63  ? -28.036 -85.458 50.227 1.00 14.92 ? 63  GLN B CB  1 
ATOM 3942 C CG  . GLN B 1 63  ? -29.429 -84.902 49.983 1.00 14.88 ? 63  GLN B CG  1 
ATOM 3943 C CD  . GLN B 1 63  ? -29.889 -83.976 51.093 1.00 13.66 ? 63  GLN B CD  1 
ATOM 3944 O OE1 . GLN B 1 63  ? -30.476 -82.924 50.837 1.00 20.28 ? 63  GLN B OE1 1 
ATOM 3945 N NE2 . GLN B 1 63  ? -29.624 -84.364 52.335 1.00 14.05 ? 63  GLN B NE2 1 
ATOM 3946 N N   . ASN B 1 64  ? -25.459 -86.052 51.289 1.00 17.73 ? 64  ASN B N   1 
ATOM 3947 C CA  . ASN B 1 64  ? -24.135 -86.601 51.714 1.00 20.28 ? 64  ASN B CA  1 
ATOM 3948 C C   . ASN B 1 64  ? -23.311 -87.005 50.505 1.00 18.61 ? 64  ASN B C   1 
ATOM 3949 O O   . ASN B 1 64  ? -23.827 -87.766 49.681 1.00 22.14 ? 64  ASN B O   1 
ATOM 3950 C CB  . ASN B 1 64  ? -24.292 -87.934 52.483 1.00 23.38 ? 64  ASN B CB  1 
ATOM 3951 C CG  . ASN B 1 64  ? -24.978 -87.804 53.759 1.00 30.48 ? 64  ASN B CG  1 
ATOM 3952 O OD1 . ASN B 1 64  ? -25.383 -86.694 54.174 1.00 38.90 ? 64  ASN B OD1 1 
ATOM 3953 N ND2 . ASN B 1 64  ? -25.141 -88.959 54.455 1.00 35.10 ? 64  ASN B ND2 1 
ATOM 3954 N N   . LEU B 1 65  ? -22.104 -86.477 50.352 1.00 17.48 ? 65  LEU B N   1 
ATOM 3955 C CA  . LEU B 1 65  ? -21.261 -86.919 49.238 1.00 17.74 ? 65  LEU B CA  1 
ATOM 3956 C C   . LEU B 1 65  ? -20.080 -87.688 49.811 1.00 18.50 ? 65  LEU B C   1 
ATOM 3957 O O   . LEU B 1 65  ? -19.456 -87.258 50.810 1.00 19.38 ? 65  LEU B O   1 
ATOM 3958 C CB  . LEU B 1 65  ? -20.810 -85.781 48.369 1.00 18.25 ? 65  LEU B CB  1 
ATOM 3959 C CG  . LEU B 1 65  ? -21.880 -84.853 47.789 1.00 19.59 ? 65  LEU B CG  1 
ATOM 3960 C CD1 . LEU B 1 65  ? -21.184 -83.675 47.095 1.00 21.31 ? 65  LEU B CD1 1 
ATOM 3961 C CD2 . LEU B 1 65  ? -22.843 -85.642 46.937 1.00 20.13 ? 65  LEU B CD2 1 
ATOM 3962 N N   . GLN B 1 66  ? -19.849 -88.870 49.219 1.00 19.08 ? 66  GLN B N   1 
ATOM 3963 C CA  . GLN B 1 66  ? -18.621 -89.628 49.513 1.00 22.73 ? 66  GLN B CA  1 
ATOM 3964 C C   . GLN B 1 66  ? -17.378 -88.791 49.309 1.00 19.91 ? 66  GLN B C   1 
ATOM 3965 O O   . GLN B 1 66  ? -17.226 -88.123 48.265 1.00 20.24 ? 66  GLN B O   1 
ATOM 3966 C CB  . GLN B 1 66  ? -18.566 -90.881 48.635 1.00 24.66 ? 66  GLN B CB  1 
ATOM 3967 C CG  . GLN B 1 66  ? -17.398 -91.756 49.011 1.00 31.20 ? 66  GLN B CG  1 
ATOM 3968 C CD  . GLN B 1 66  ? -17.412 -93.074 48.283 1.00 41.60 ? 66  GLN B CD  1 
ATOM 3969 O OE1 . GLN B 1 66  ? -18.361 -93.385 47.546 1.00 45.59 ? 66  GLN B OE1 1 
ATOM 3970 N NE2 . GLN B 1 66  ? -16.335 -93.848 48.452 1.00 45.83 ? 66  GLN B NE2 1 
ATOM 3971 N N   . GLY B 1 67  ? -16.509 -88.797 50.306 1.00 20.50 ? 67  GLY B N   1 
ATOM 3972 C CA  . GLY B 1 67  ? -15.249 -88.101 50.163 1.00 17.49 ? 67  GLY B CA  1 
ATOM 3973 C C   . GLY B 1 67  ? -15.240 -86.766 50.884 1.00 19.42 ? 67  GLY B C   1 
ATOM 3974 O O   . GLY B 1 67  ? -14.191 -86.222 51.091 1.00 22.02 ? 67  GLY B O   1 
ATOM 3975 N N   . LEU B 1 68  ? -16.439 -86.251 51.268 1.00 19.15 ? 68  LEU B N   1 
ATOM 3976 C CA  . LEU B 1 68  ? -16.496 -85.036 52.087 1.00 17.70 ? 68  LEU B CA  1 
ATOM 3977 C C   . LEU B 1 68  ? -16.959 -85.305 53.538 1.00 21.15 ? 68  LEU B C   1 
ATOM 3978 O O   . LEU B 1 68  ? -17.653 -86.263 53.782 1.00 22.05 ? 68  LEU B O   1 
ATOM 3979 C CB  . LEU B 1 68  ? -17.542 -84.056 51.446 1.00 17.76 ? 68  LEU B CB  1 
ATOM 3980 C CG  . LEU B 1 68  ? -17.293 -83.762 49.929 1.00 13.99 ? 68  LEU B CG  1 
ATOM 3981 C CD1 . LEU B 1 68  ? -18.382 -82.683 49.541 1.00 15.32 ? 68  LEU B CD1 1 
ATOM 3982 C CD2 . LEU B 1 68  ? -15.929 -83.123 49.660 1.00 15.95 ? 68  LEU B CD2 1 
ATOM 3983 N N   . LYS B 1 69  ? -16.678 -84.377 54.433 1.00 17.60 ? 69  LYS B N   1 
ATOM 3984 C CA  . LYS B 1 69  ? -17.164 -84.524 55.818 1.00 18.67 ? 69  LYS B CA  1 
ATOM 3985 C C   . LYS B 1 69  ? -18.448 -83.778 56.076 1.00 19.61 ? 69  LYS B C   1 
ATOM 3986 O O   . LYS B 1 69  ? -19.108 -83.993 57.101 1.00 22.72 ? 69  LYS B O   1 
ATOM 3987 C CB  . LYS B 1 69  ? -16.096 -84.079 56.765 1.00 19.52 ? 69  LYS B CB  1 
ATOM 3988 C CG  . LYS B 1 69  ? -15.007 -85.188 56.842 1.00 28.65 ? 69  LYS B CG  1 
ATOM 3989 C CD  . LYS B 1 69  ? -13.681 -84.642 57.227 1.00 35.72 ? 69  LYS B CD  1 
ATOM 3990 C CE  . LYS B 1 69  ? -13.507 -84.672 58.769 1.00 38.03 ? 69  LYS B CE  1 
ATOM 3991 N NZ  . LYS B 1 69  ? -12.142 -84.174 59.166 1.00 37.71 ? 69  LYS B NZ  1 
ATOM 3992 N N   . ALA B 1 70  ? -18.840 -82.963 55.108 1.00 17.19 ? 70  ALA B N   1 
ATOM 3993 C CA  . ALA B 1 70  ? -20.088 -82.238 55.227 1.00 17.86 ? 70  ALA B CA  1 
ATOM 3994 C C   . ALA B 1 70  ? -21.305 -83.091 54.933 1.00 16.49 ? 70  ALA B C   1 
ATOM 3995 O O   . ALA B 1 70  ? -21.334 -83.935 53.982 1.00 17.46 ? 70  ALA B O   1 
ATOM 3996 C CB  . ALA B 1 70  ? -19.995 -81.049 54.256 1.00 17.03 ? 70  ALA B CB  1 
ATOM 3997 N N   . GLU B 1 71  ? -22.329 -82.945 55.743 1.00 15.80 ? 71  GLU B N   1 
ATOM 3998 C CA  . GLU B 1 71  ? -23.582 -83.678 55.509 1.00 15.36 ? 71  GLU B CA  1 
ATOM 3999 C C   . GLU B 1 71  ? -24.324 -83.241 54.279 1.00 15.18 ? 71  GLU B C   1 
ATOM 4000 O O   . GLU B 1 71  ? -25.088 -84.041 53.736 1.00 16.13 ? 71  GLU B O   1 
ATOM 4001 C CB  . GLU B 1 71  ? -24.489 -83.545 56.691 1.00 15.64 ? 71  GLU B CB  1 
ATOM 4002 C CG  . GLU B 1 71  ? -23.922 -84.248 57.900 1.00 22.62 ? 71  GLU B CG  1 
ATOM 4003 C CD  . GLU B 1 71  ? -24.810 -84.051 59.125 1.00 28.96 ? 71  GLU B CD  1 
ATOM 4004 O OE1 . GLU B 1 71  ? -25.726 -83.215 59.016 1.00 37.04 ? 71  GLU B OE1 1 
ATOM 4005 O OE2 . GLU B 1 71  ? -24.651 -84.789 60.130 1.00 37.40 ? 71  GLU B OE2 1 
ATOM 4006 N N   . ARG B 1 72  ? -24.190 -81.938 53.899 1.00 13.46 ? 72  ARG B N   1 
ATOM 4007 C CA  . ARG B 1 72  ? -24.878 -81.388 52.769 1.00 14.15 ? 72  ARG B CA  1 
ATOM 4008 C C   . ARG B 1 72  ? -23.886 -80.432 52.131 1.00 13.14 ? 72  ARG B C   1 
ATOM 4009 O O   . ARG B 1 72  ? -23.029 -79.905 52.838 1.00 14.69 ? 72  ARG B O   1 
ATOM 4010 C CB  . ARG B 1 72  ? -26.059 -80.512 53.245 1.00 13.88 ? 72  ARG B CB  1 
ATOM 4011 C CG  . ARG B 1 72  ? -27.166 -81.262 54.087 1.00 13.09 ? 72  ARG B CG  1 
ATOM 4012 C CD  . ARG B 1 72  ? -28.030 -80.208 54.771 1.00 14.27 ? 72  ARG B CD  1 
ATOM 4013 N NE  . ARG B 1 72  ? -29.010 -80.723 55.715 1.00 13.31 ? 72  ARG B NE  1 
ATOM 4014 C CZ  . ARG B 1 72  ? -28.763 -81.104 56.961 1.00 16.25 ? 72  ARG B CZ  1 
ATOM 4015 N NH1 . ARG B 1 72  ? -27.499 -81.130 57.391 1.00 17.20 ? 72  ARG B NH1 1 
ATOM 4016 N NH2 . ARG B 1 72  ? -29.774 -81.498 57.726 1.00 16.62 ? 72  ARG B NH2 1 
ATOM 4017 N N   . VAL B 1 73  ? -23.977 -80.224 50.818 1.00 13.27 ? 73  VAL B N   1 
ATOM 4018 C CA  . VAL B 1 73  ? -23.234 -79.145 50.133 1.00 12.83 ? 73  VAL B CA  1 
ATOM 4019 C C   . VAL B 1 73  ? -24.250 -78.257 49.483 1.00 12.78 ? 73  VAL B C   1 
ATOM 4020 O O   . VAL B 1 73  ? -25.017 -78.697 48.656 1.00 13.45 ? 73  VAL B O   1 
ATOM 4021 C CB  . VAL B 1 73  ? -22.268 -79.702 49.113 1.00 13.44 ? 73  VAL B CB  1 
ATOM 4022 C CG1 . VAL B 1 73  ? -21.543 -78.608 48.403 1.00 13.56 ? 73  VAL B CG1 1 
ATOM 4023 C CG2 . VAL B 1 73  ? -21.212 -80.582 49.867 1.00 14.54 ? 73  VAL B CG2 1 
ATOM 4024 N N   . LEU B 1 74  ? -24.171 -76.965 49.799 1.00 13.07 ? 74  LEU B N   1 
ATOM 4025 C CA  . LEU B 1 74  ? -24.981 -76.015 49.054 1.00 11.76 ? 74  LEU B CA  1 
ATOM 4026 C C   . LEU B 1 74  ? -24.048 -75.307 48.052 1.00 11.10 ? 74  LEU B C   1 
ATOM 4027 O O   . LEU B 1 74  ? -23.094 -74.600 48.456 1.00 11.24 ? 74  LEU B O   1 
ATOM 4028 C CB  . LEU B 1 74  ? -25.544 -75.039 50.092 1.00 10.44 ? 74  LEU B CB  1 
ATOM 4029 C CG  . LEU B 1 74  ? -26.373 -73.890 49.463 1.00 12.35 ? 74  LEU B CG  1 
ATOM 4030 C CD1 . LEU B 1 74  ? -27.594 -74.426 48.762 1.00 12.77 ? 74  LEU B CD1 1 
ATOM 4031 C CD2 . LEU B 1 74  ? -26.823 -72.835 50.570 1.00 16.25 ? 74  LEU B CD2 1 
ATOM 4032 N N   . LEU B 1 75  ? -24.389 -75.399 46.750 1.00 11.68 ? 75  LEU B N   1 
ATOM 4033 C CA  . LEU B 1 75  ? -23.753 -74.671 45.678 1.00 11.01 ? 75  LEU B CA  1 
ATOM 4034 C C   . LEU B 1 75  ? -24.488 -73.313 45.546 1.00 11.63 ? 75  LEU B C   1 
ATOM 4035 O O   . LEU B 1 75  ? -25.736 -73.338 45.403 1.00 11.70 ? 75  LEU B O   1 
ATOM 4036 C CB  . LEU B 1 75  ? -23.856 -75.468 44.375 1.00 13.10 ? 75  LEU B CB  1 
ATOM 4037 C CG  . LEU B 1 75  ? -23.370 -76.918 44.544 1.00 13.20 ? 75  LEU B CG  1 
ATOM 4038 C CD1 . LEU B 1 75  ? -23.439 -77.523 43.138 1.00 14.00 ? 75  LEU B CD1 1 
ATOM 4039 C CD2 . LEU B 1 75  ? -21.885 -76.953 45.005 1.00 14.07 ? 75  LEU B CD2 1 
ATOM 4040 N N   . VAL B 1 76  ? -23.748 -72.222 45.460 1.00 10.67 ? 76  VAL B N   1 
ATOM 4041 C CA  . VAL B 1 76  ? -24.419 -70.981 45.188 1.00 12.08 ? 76  VAL B CA  1 
ATOM 4042 C C   . VAL B 1 76  ? -23.769 -70.256 44.038 1.00 11.01 ? 76  VAL B C   1 
ATOM 4043 O O   . VAL B 1 76  ? -22.537 -70.198 43.957 1.00 11.90 ? 76  VAL B O   1 
ATOM 4044 C CB  . VAL B 1 76  ? -24.414 -70.043 46.475 1.00 10.45 ? 76  VAL B CB  1 
ATOM 4045 C CG1 . VAL B 1 76  ? -22.993 -69.727 46.980 1.00 11.73 ? 76  VAL B CG1 1 
ATOM 4046 C CG2 . VAL B 1 76  ? -25.215 -68.743 46.210 1.00 12.96 ? 76  VAL B CG2 1 
ATOM 4047 N N   . GLY B 1 77  ? -24.627 -69.746 43.169 1.00 11.84 ? 77  GLY B N   1 
ATOM 4048 C CA  . GLY B 1 77  ? -24.149 -69.056 41.969 1.00 14.37 ? 77  GLY B CA  1 
ATOM 4049 C C   . GLY B 1 77  ? -23.385 -67.760 42.261 1.00 16.25 ? 77  GLY B C   1 
ATOM 4050 O O   . GLY B 1 77  ? -23.789 -67.013 43.120 1.00 16.01 ? 77  GLY B O   1 
ATOM 4051 N N   . SER B 1 78  ? -22.261 -67.517 41.546 1.00 15.42 ? 78  SER B N   1 
ATOM 4052 C CA  . SER B 1 78  ? -21.463 -66.280 41.866 1.00 18.61 ? 78  SER B CA  1 
ATOM 4053 C C   . SER B 1 78  ? -21.392 -65.399 40.600 1.00 20.15 ? 78  SER B C   1 
ATOM 4054 O O   . SER B 1 78  ? -20.617 -64.414 40.586 1.00 21.34 ? 78  SER B O   1 
ATOM 4055 C CB  . SER B 1 78  ? -20.066 -66.610 42.321 1.00 20.28 ? 78  SER B CB  1 
ATOM 4056 O OG  . SER B 1 78  ? -19.349 -67.498 41.406 1.00 20.35 ? 78  SER B OG  1 
ATOM 4057 N N   . GLY B 1 79  ? -22.080 -65.821 39.542 1.00 21.00 ? 79  GLY B N   1 
ATOM 4058 C CA  . GLY B 1 79  ? -22.154 -65.034 38.269 1.00 23.53 ? 79  GLY B CA  1 
ATOM 4059 C C   . GLY B 1 79  ? -20.972 -65.256 37.374 1.00 26.54 ? 79  GLY B C   1 
ATOM 4060 O O   . GLY B 1 79  ? -20.262 -66.290 37.486 1.00 24.47 ? 79  GLY B O   1 
ATOM 4061 N N   . LYS B 1 80  ? -20.735 -64.277 36.476 1.00 30.50 ? 80  LYS B N   1 
ATOM 4062 C CA  . LYS B 1 80  ? -19.588 -64.374 35.582 1.00 33.95 ? 80  LYS B CA  1 
ATOM 4063 C C   . LYS B 1 80  ? -18.332 -64.094 36.338 1.00 35.85 ? 80  LYS B C   1 
ATOM 4064 O O   . LYS B 1 80  ? -18.340 -63.783 37.563 1.00 34.62 ? 80  LYS B O   1 
ATOM 4065 C CB  . LYS B 1 80  ? -19.657 -63.447 34.356 1.00 35.70 ? 80  LYS B CB  1 
ATOM 4066 C CG  . LYS B 1 80  ? -20.741 -63.897 33.339 1.00 38.60 ? 80  LYS B CG  1 
ATOM 4067 C CD  . LYS B 1 80  ? -21.081 -62.808 32.321 1.00 44.51 ? 80  LYS B CD  1 
ATOM 4068 C CE  . LYS B 1 80  ? -22.437 -63.064 31.699 1.00 47.70 ? 80  LYS B CE  1 
ATOM 4069 N NZ  . LYS B 1 80  ? -22.481 -62.360 30.396 1.00 48.21 ? 80  LYS B NZ  1 
ATOM 4070 N N   . ASP B 1 81  ? -17.260 -64.117 35.555 1.00 36.70 ? 81  ASP B N   1 
ATOM 4071 C CA  . ASP B 1 81  ? -15.912 -64.104 36.017 1.00 39.57 ? 81  ASP B CA  1 
ATOM 4072 C C   . ASP B 1 81  ? -15.385 -62.735 36.403 1.00 40.15 ? 81  ASP B C   1 
ATOM 4073 O O   . ASP B 1 81  ? -14.150 -62.474 36.302 1.00 41.82 ? 81  ASP B O   1 
ATOM 4074 C CB  . ASP B 1 81  ? -15.039 -64.624 34.892 1.00 41.12 ? 81  ASP B CB  1 
ATOM 4075 C CG  . ASP B 1 81  ? -13.996 -65.543 35.381 1.00 46.43 ? 81  ASP B CG  1 
ATOM 4076 O OD1 . ASP B 1 81  ? -13.984 -65.844 36.623 1.00 47.80 ? 81  ASP B OD1 1 
ATOM 4077 O OD2 . ASP B 1 81  ? -13.176 -65.951 34.508 1.00 51.46 ? 81  ASP B OD2 1 
ATOM 4078 N N   . GLU B 1 82  ? -16.300 -61.892 36.850 1.00 37.93 ? 82  GLU B N   1 
ATOM 4079 C CA  . GLU B 1 82  ? -16.006 -60.562 37.271 1.00 36.93 ? 82  GLU B CA  1 
ATOM 4080 C C   . GLU B 1 82  ? -16.496 -60.345 38.693 1.00 34.13 ? 82  GLU B C   1 
ATOM 4081 O O   . GLU B 1 82  ? -17.464 -61.004 39.127 1.00 33.10 ? 82  GLU B O   1 
ATOM 4082 C CB  . GLU B 1 82  ? -16.720 -59.580 36.371 1.00 37.92 ? 82  GLU B CB  1 
ATOM 4083 C CG  . GLU B 1 82  ? -18.107 -59.995 36.032 1.00 44.04 ? 82  GLU B CG  1 
ATOM 4084 C CD  . GLU B 1 82  ? -18.635 -59.192 34.883 1.00 52.83 ? 82  GLU B CD  1 
ATOM 4085 O OE1 . GLU B 1 82  ? -18.106 -58.060 34.692 1.00 54.43 ? 82  GLU B OE1 1 
ATOM 4086 O OE2 . GLU B 1 82  ? -19.562 -59.700 34.178 1.00 55.61 ? 82  GLU B OE2 1 
ATOM 4087 N N   . ALA B 1 83  ? -15.863 -59.383 39.360 1.00 29.89 ? 83  ALA B N   1 
ATOM 4088 C CA  . ALA B 1 83  ? -16.155 -59.025 40.741 1.00 25.92 ? 83  ALA B CA  1 
ATOM 4089 C C   . ALA B 1 83  ? -17.607 -58.543 40.908 1.00 25.01 ? 83  ALA B C   1 
ATOM 4090 O O   . ALA B 1 83  ? -18.216 -57.906 40.003 1.00 23.80 ? 83  ALA B O   1 
ATOM 4091 C CB  . ALA B 1 83  ? -15.117 -57.960 41.208 1.00 26.53 ? 83  ALA B CB  1 
ATOM 4092 N N   . LEU B 1 84  ? -18.222 -58.916 42.047 1.00 19.15 ? 84  LEU B N   1 
ATOM 4093 C CA  . LEU B 1 84  ? -19.596 -58.461 42.354 1.00 17.59 ? 84  LEU B CA  1 
ATOM 4094 C C   . LEU B 1 84  ? -19.634 -57.110 42.989 1.00 16.57 ? 84  LEU B C   1 
ATOM 4095 O O   . LEU B 1 84  ? -18.763 -56.745 43.817 1.00 20.79 ? 84  LEU B O   1 
ATOM 4096 C CB  . LEU B 1 84  ? -20.223 -59.468 43.395 1.00 17.15 ? 84  LEU B CB  1 
ATOM 4097 C CG  . LEU B 1 84  ? -20.238 -60.896 42.850 1.00 19.09 ? 84  LEU B CG  1 
ATOM 4098 C CD1 . LEU B 1 84  ? -20.860 -61.773 43.994 1.00 16.79 ? 84  LEU B CD1 1 
ATOM 4099 C CD2 . LEU B 1 84  ? -20.925 -61.143 41.487 1.00 21.42 ? 84  LEU B CD2 1 
ATOM 4100 N N   . GLY B 1 85  ? -20.702 -56.382 42.732 1.00 16.98 ? 85  GLY B N   1 
ATOM 4101 C CA  . GLY B 1 85  ? -20.900 -55.144 43.497 1.00 16.98 ? 85  GLY B CA  1 
ATOM 4102 C C   . GLY B 1 85  ? -21.444 -55.469 44.879 1.00 14.88 ? 85  GLY B C   1 
ATOM 4103 O O   . GLY B 1 85  ? -21.845 -56.622 45.151 1.00 16.35 ? 85  GLY B O   1 
ATOM 4104 N N   . ASP B 1 86  ? -21.479 -54.486 45.774 1.00 16.17 ? 86  ASP B N   1 
ATOM 4105 C CA  . ASP B 1 86  ? -21.957 -54.724 47.129 1.00 15.33 ? 86  ASP B CA  1 
ATOM 4106 C C   . ASP B 1 86  ? -23.345 -55.295 47.168 1.00 15.73 ? 86  ASP B C   1 
ATOM 4107 O O   . ASP B 1 86  ? -23.612 -56.216 47.935 1.00 14.18 ? 86  ASP B O   1 
ATOM 4108 C CB  . ASP B 1 86  ? -22.016 -53.385 47.831 1.00 15.10 ? 86  ASP B CB  1 
ATOM 4109 C CG  . ASP B 1 86  ? -20.639 -52.878 48.291 1.00 15.28 ? 86  ASP B CG  1 
ATOM 4110 O OD1 . ASP B 1 86  ? -19.600 -53.536 48.171 1.00 16.13 ? 86  ASP B OD1 1 
ATOM 4111 O OD2 . ASP B 1 86  ? -20.577 -51.711 48.824 1.00 15.39 ? 86  ASP B OD2 1 
ATOM 4112 N N   . ARG B 1 87  ? -24.277 -54.761 46.373 1.00 14.82 ? 87  ARG B N   1 
ATOM 4113 C CA  . ARG B 1 87  ? -25.634 -55.211 46.436 1.00 14.03 ? 87  ARG B CA  1 
ATOM 4114 C C   . ARG B 1 87  ? -25.782 -56.706 46.020 1.00 12.94 ? 87  ARG B C   1 
ATOM 4115 O O   . ARG B 1 87  ? -26.470 -57.455 46.714 1.00 12.52 ? 87  ARG B O   1 
ATOM 4116 C CB  . ARG B 1 87  ? -26.542 -54.329 45.600 1.00 15.56 ? 87  ARG B CB  1 
ATOM 4117 C CG  . ARG B 1 87  ? -28.028 -54.405 46.045 1.00 16.18 ? 87  ARG B CG  1 
ATOM 4118 C CD  . ARG B 1 87  ? -28.351 -53.965 47.474 1.00 18.27 ? 87  ARG B CD  1 
ATOM 4119 N NE  . ARG B 1 87  ? -27.681 -52.671 47.649 1.00 14.53 ? 87  ARG B NE  1 
ATOM 4120 C CZ  . ARG B 1 87  ? -26.746 -52.401 48.554 1.00 13.99 ? 87  ARG B CZ  1 
ATOM 4121 N NH1 . ARG B 1 87  ? -26.426 -53.290 49.532 1.00 13.47 ? 87  ARG B NH1 1 
ATOM 4122 N NH2 . ARG B 1 87  ? -26.127 -51.240 48.466 1.00 14.45 ? 87  ARG B NH2 1 
ATOM 4123 N N   . THR B 1 88  ? -25.087 -57.046 44.963 1.00 13.69 ? 88  THR B N   1 
ATOM 4124 C CA  . THR B 1 88  ? -25.156 -58.411 44.459 1.00 13.23 ? 88  THR B CA  1 
ATOM 4125 C C   . THR B 1 88  ? -24.470 -59.361 45.500 1.00 12.69 ? 88  THR B C   1 
ATOM 4126 O O   . THR B 1 88  ? -25.040 -60.437 45.736 1.00 13.04 ? 88  THR B O   1 
ATOM 4127 C CB  . THR B 1 88  ? -24.413 -58.513 43.145 1.00 14.76 ? 88  THR B CB  1 
ATOM 4128 O OG1 . THR B 1 88  ? -25.096 -57.678 42.196 1.00 17.97 ? 88  THR B OG1 1 
ATOM 4129 C CG2 . THR B 1 88  ? -24.440 -59.975 42.635 1.00 15.16 ? 88  THR B CG2 1 
ATOM 4130 N N   . TRP B 1 89  ? -23.371 -58.947 46.099 1.00 13.01 ? 89  TRP B N   1 
ATOM 4131 C CA  . TRP B 1 89  ? -22.695 -59.770 47.088 1.00 10.44 ? 89  TRP B CA  1 
ATOM 4132 C C   . TRP B 1 89  ? -23.615 -59.968 48.311 1.00 10.92 ? 89  TRP B C   1 
ATOM 4133 O O   . TRP B 1 89  ? -23.855 -61.097 48.817 1.00 11.83 ? 89  TRP B O   1 
ATOM 4134 C CB  . TRP B 1 89  ? -21.432 -59.021 47.480 1.00 11.69 ? 89  TRP B CB  1 
ATOM 4135 C CG  . TRP B 1 89  ? -20.706 -59.591 48.718 1.00 10.69 ? 89  TRP B CG  1 
ATOM 4136 C CD1 . TRP B 1 89  ? -20.260 -58.883 49.780 1.00 12.11 ? 89  TRP B CD1 1 
ATOM 4137 C CD2 . TRP B 1 89  ? -20.235 -60.966 48.908 1.00 11.22 ? 89  TRP B CD2 1 
ATOM 4138 N NE1 . TRP B 1 89  ? -19.560 -59.727 50.621 1.00 11.74 ? 89  TRP B NE1 1 
ATOM 4139 C CE2 . TRP B 1 89  ? -19.545 -61.003 50.115 1.00 11.98 ? 89  TRP B CE2 1 
ATOM 4140 C CE3 . TRP B 1 89  ? -20.374 -62.146 48.152 1.00 12.19 ? 89  TRP B CE3 1 
ATOM 4141 C CZ2 . TRP B 1 89  ? -18.945 -62.170 50.624 1.00 12.15 ? 89  TRP B CZ2 1 
ATOM 4142 C CZ3 . TRP B 1 89  ? -19.879 -63.314 48.650 1.00 11.38 ? 89  TRP B CZ3 1 
ATOM 4143 C CH2 . TRP B 1 89  ? -19.127 -63.319 49.876 1.00 11.67 ? 89  TRP B CH2 1 
ATOM 4144 N N   . ARG B 1 90  ? -24.187 -58.854 48.811 1.00 11.03 ? 90  ARG B N   1 
ATOM 4145 C CA  . ARG B 1 90  ? -25.106 -59.020 49.976 1.00 10.73 ? 90  ARG B CA  1 
ATOM 4146 C C   . ARG B 1 90  ? -26.337 -59.870 49.678 1.00 11.42 ? 90  ARG B C   1 
ATOM 4147 O O   . ARG B 1 90  ? -26.803 -60.655 50.535 1.00 12.09 ? 90  ARG B O   1 
ATOM 4148 C CB  . ARG B 1 90  ? -25.466 -57.635 50.611 1.00 10.05 ? 90  ARG B CB  1 
ATOM 4149 C CG  . ARG B 1 90  ? -24.151 -56.953 51.128 1.00 12.19 ? 90  ARG B CG  1 
ATOM 4150 C CD  . ARG B 1 90  ? -24.354 -55.589 51.775 1.00 12.70 ? 90  ARG B CD  1 
ATOM 4151 N NE  . ARG B 1 90  ? -24.727 -55.898 53.161 1.00 15.06 ? 90  ARG B NE  1 
ATOM 4152 C CZ  . ARG B 1 90  ? -24.861 -54.958 54.106 1.00 16.55 ? 90  ARG B CZ  1 
ATOM 4153 N NH1 . ARG B 1 90  ? -24.677 -53.635 53.867 1.00 13.73 ? 90  ARG B NH1 1 
ATOM 4154 N NH2 . ARG B 1 90  ? -25.093 -55.347 55.361 1.00 16.48 ? 90  ARG B NH2 1 
ATOM 4155 N N   . LYS B 1 91  ? -26.941 -59.689 48.491 1.00 11.70 ? 91  LYS B N   1 
ATOM 4156 C CA  . LYS B 1 91  ? -28.014 -60.569 48.061 1.00 11.96 ? 91  LYS B CA  1 
ATOM 4157 C C   . LYS B 1 91  ? -27.640 -62.055 47.955 1.00 10.92 ? 91  LYS B C   1 
ATOM 4158 O O   . LYS B 1 91  ? -28.414 -62.918 48.333 1.00 13.81 ? 91  LYS B O   1 
ATOM 4159 C CB  . LYS B 1 91  ? -28.653 -60.060 46.748 1.00 13.24 ? 91  LYS B CB  1 
ATOM 4160 C CG  . LYS B 1 91  ? -29.518 -58.774 47.012 1.00 16.77 ? 91  LYS B CG  1 
ATOM 4161 C CD  . LYS B 1 91  ? -30.273 -58.395 45.703 1.00 25.05 ? 91  LYS B CD  1 
ATOM 4162 C CE  . LYS B 1 91  ? -30.909 -57.046 45.814 1.00 31.20 ? 91  LYS B CE  1 
ATOM 4163 N NZ  . LYS B 1 91  ? -31.338 -56.657 44.399 1.00 33.28 ? 91  LYS B NZ  1 
ATOM 4164 N N   . LEU B 1 92  ? -26.459 -62.347 47.457 1.00 9.50  ? 92  LEU B N   1 
ATOM 4165 C CA  . LEU B 1 92  ? -25.933 -63.728 47.443 1.00 11.22 ? 92  LEU B CA  1 
ATOM 4166 C C   . LEU B 1 92  ? -25.907 -64.308 48.872 1.00 11.43 ? 92  LEU B C   1 
ATOM 4167 O O   . LEU B 1 92  ? -26.372 -65.405 49.090 1.00 10.81 ? 92  LEU B O   1 
ATOM 4168 C CB  . LEU B 1 92  ? -24.563 -63.690 46.816 1.00 12.98 ? 92  LEU B CB  1 
ATOM 4169 C CG  . LEU B 1 92  ? -23.811 -65.022 46.595 1.00 15.14 ? 92  LEU B CG  1 
ATOM 4170 C CD1 . LEU B 1 92  ? -23.175 -65.520 47.895 1.00 11.52 ? 92  LEU B CD1 1 
ATOM 4171 C CD2 . LEU B 1 92  ? -24.788 -65.962 46.155 1.00 28.42 ? 92  LEU B CD2 1 
ATOM 4172 N N   . VAL B 1 93  ? -25.334 -63.513 49.796 1.00 10.99 ? 93  VAL B N   1 
ATOM 4173 C CA  . VAL B 1 93  ? -25.280 -63.987 51.198 1.00 9.30  ? 93  VAL B CA  1 
ATOM 4174 C C   . VAL B 1 93  ? -26.668 -64.198 51.803 1.00 10.24 ? 93  VAL B C   1 
ATOM 4175 O O   . VAL B 1 93  ? -26.917 -65.204 52.472 1.00 11.39 ? 93  VAL B O   1 
ATOM 4176 C CB  . VAL B 1 93  ? -24.451 -62.962 52.081 1.00 9.92  ? 93  VAL B CB  1 
ATOM 4177 C CG1 . VAL B 1 93  ? -24.389 -63.366 53.578 1.00 12.52 ? 93  VAL B CG1 1 
ATOM 4178 C CG2 . VAL B 1 93  ? -23.033 -62.877 51.548 1.00 10.32 ? 93  VAL B CG2 1 
ATOM 4179 N N   . ALA B 1 94  ? -27.584 -63.246 51.547 1.00 10.16 ? 94  ALA B N   1 
ATOM 4180 C CA  . ALA B 1 94  ? -28.922 -63.426 52.033 1.00 10.22 ? 94  ALA B CA  1 
ATOM 4181 C C   . ALA B 1 94  ? -29.629 -64.653 51.411 1.00 10.76 ? 94  ALA B C   1 
ATOM 4182 O O   . ALA B 1 94  ? -30.413 -65.328 52.113 1.00 11.40 ? 94  ALA B O   1 
ATOM 4183 C CB  . ALA B 1 94  ? -29.713 -62.184 51.753 1.00 12.30 ? 94  ALA B CB  1 
ATOM 4184 N N   . SER B 1 95  ? -29.345 -64.920 50.124 1.00 12.16 ? 95  SER B N   1 
ATOM 4185 C CA  . SER B 1 95  ? -29.860 -66.166 49.485 1.00 11.28 ? 95  SER B CA  1 
ATOM 4186 C C   . SER B 1 95  ? -29.376 -67.400 50.184 1.00 12.48 ? 95  SER B C   1 
ATOM 4187 O O   . SER B 1 95  ? -30.188 -68.325 50.506 1.00 12.91 ? 95  SER B O   1 
ATOM 4188 C CB  . SER B 1 95  ? -29.485 -66.230 47.982 1.00 12.32 ? 95  SER B CB  1 
ATOM 4189 O OG  . SER B 1 95  ? -30.220 -65.106 47.318 1.00 17.21 ? 95  SER B OG  1 
ATOM 4190 N N   . VAL B 1 96  ? -28.102 -67.390 50.501 1.00 10.66 ? 96  VAL B N   1 
ATOM 4191 C CA  . VAL B 1 96  ? -27.511 -68.557 51.189 1.00 12.06 ? 96  VAL B CA  1 
ATOM 4192 C C   . VAL B 1 96  ? -28.166 -68.716 52.580 1.00 12.26 ? 96  VAL B C   1 
ATOM 4193 O O   . VAL B 1 96  ? -28.641 -69.798 52.979 1.00 13.00 ? 96  VAL B O   1 
ATOM 4194 C CB  . VAL B 1 96  ? -25.977 -68.420 51.313 1.00 11.59 ? 96  VAL B CB  1 
ATOM 4195 C CG1 . VAL B 1 96  ? -25.461 -69.452 52.326 1.00 13.08 ? 96  VAL B CG1 1 
ATOM 4196 C CG2 . VAL B 1 96  ? -25.312 -68.652 49.939 1.00 13.65 ? 96  VAL B CG2 1 
ATOM 4197 N N   . ALA B 1 97  ? -28.279 -67.586 53.315 1.00 11.75 ? 97  ALA B N   1 
ATOM 4198 C CA  . ALA B 1 97  ? -28.838 -67.617 54.654 1.00 11.52 ? 97  ALA B CA  1 
ATOM 4199 C C   . ALA B 1 97  ? -30.303 -68.139 54.632 1.00 11.79 ? 97  ALA B C   1 
ATOM 4200 O O   . ALA B 1 97  ? -30.722 -68.856 55.587 1.00 12.72 ? 97  ALA B O   1 
ATOM 4201 C CB  . ALA B 1 97  ? -28.709 -66.181 55.286 1.00 11.99 ? 97  ALA B CB  1 
ATOM 4202 N N   . GLY B 1 98  ? -31.097 -67.758 53.603 1.00 12.24 ? 98  GLY B N   1 
ATOM 4203 C CA  . GLY B 1 98  ? -32.479 -68.158 53.492 1.00 11.18 ? 98  GLY B CA  1 
ATOM 4204 C C   . GLY B 1 98  ? -32.555 -69.684 53.393 1.00 12.87 ? 98  GLY B C   1 
ATOM 4205 O O   . GLY B 1 98  ? -33.436 -70.305 53.952 1.00 16.28 ? 98  GLY B O   1 
ATOM 4206 N N   . VAL B 1 99  ? -31.643 -70.274 52.596 1.00 11.96 ? 99  VAL B N   1 
ATOM 4207 C CA  . VAL B 1 99  ? -31.693 -71.756 52.447 1.00 12.16 ? 99  VAL B CA  1 
ATOM 4208 C C   . VAL B 1 99  ? -31.335 -72.335 53.809 1.00 12.48 ? 99  VAL B C   1 
ATOM 4209 O O   . VAL B 1 99  ? -32.013 -73.273 54.301 1.00 13.16 ? 99  VAL B O   1 
ATOM 4210 C CB  . VAL B 1 99  ? -30.671 -72.250 51.429 1.00 12.52 ? 99  VAL B CB  1 
ATOM 4211 C CG1 . VAL B 1 99  ? -30.649 -73.798 51.432 1.00 13.70 ? 99  VAL B CG1 1 
ATOM 4212 C CG2 . VAL B 1 99  ? -31.147 -71.803 50.049 1.00 17.75 ? 99  VAL B CG2 1 
ATOM 4213 N N   . LEU B 1 100 ? -30.234 -71.862 54.429 1.00 12.54 ? 100 LEU B N   1 
ATOM 4214 C CA  . LEU B 1 100 ? -29.775 -72.457 55.708 1.00 12.53 ? 100 LEU B CA  1 
ATOM 4215 C C   . LEU B 1 100 ? -30.824 -72.360 56.798 1.00 15.31 ? 100 LEU B C   1 
ATOM 4216 O O   . LEU B 1 100 ? -30.974 -73.268 57.600 1.00 17.58 ? 100 LEU B O   1 
ATOM 4217 C CB  . LEU B 1 100 ? -28.436 -71.893 56.199 1.00 13.58 ? 100 LEU B CB  1 
ATOM 4218 C CG  . LEU B 1 100 ? -27.320 -71.874 55.185 1.00 14.16 ? 100 LEU B CG  1 
ATOM 4219 C CD1 . LEU B 1 100 ? -26.134 -71.137 55.826 1.00 14.56 ? 100 LEU B CD1 1 
ATOM 4220 C CD2 . LEU B 1 100 ? -26.909 -73.384 54.863 1.00 18.77 ? 100 LEU B CD2 1 
ATOM 4221 N N   . LYS B 1 101 ? -31.543 -71.233 56.851 1.00 16.59 ? 101 LYS B N   1 
ATOM 4222 C CA  . LYS B 1 101 ? -32.565 -71.115 57.877 1.00 20.39 ? 101 LYS B CA  1 
ATOM 4223 C C   . LYS B 1 101 ? -33.694 -72.071 57.752 1.00 19.29 ? 101 LYS B C   1 
ATOM 4224 O O   . LYS B 1 101 ? -34.281 -72.439 58.787 1.00 21.82 ? 101 LYS B O   1 
ATOM 4225 C CB  . LYS B 1 101 ? -32.993 -69.640 57.975 1.00 21.18 ? 101 LYS B CB  1 
ATOM 4226 C CG  . LYS B 1 101 ? -31.857 -68.863 58.738 1.00 29.36 ? 101 LYS B CG  1 
ATOM 4227 C CD  . LYS B 1 101 ? -32.253 -67.408 59.120 1.00 36.41 ? 101 LYS B CD  1 
ATOM 4228 C CE  . LYS B 1 101 ? -31.738 -66.437 58.077 1.00 36.23 ? 101 LYS B CE  1 
ATOM 4229 N NZ  . LYS B 1 101 ? -32.654 -65.271 57.918 1.00 41.12 ? 101 LYS B NZ  1 
ATOM 4230 N N   . GLY B 1 102 ? -33.922 -72.629 56.588 1.00 18.45 ? 102 GLY B N   1 
ATOM 4231 C CA  . GLY B 1 102 ? -34.993 -73.602 56.366 1.00 16.96 ? 102 GLY B CA  1 
ATOM 4232 C C   . GLY B 1 102 ? -34.561 -75.024 56.605 1.00 18.10 ? 102 GLY B C   1 
ATOM 4233 O O   . GLY B 1 102 ? -35.407 -75.909 56.602 1.00 19.49 ? 102 GLY B O   1 
ATOM 4234 N N   . LEU B 1 103 ? -33.259 -75.240 56.760 1.00 14.19 ? 103 LEU B N   1 
ATOM 4235 C CA  . LEU B 1 103 ? -32.773 -76.602 56.963 1.00 15.14 ? 103 LEU B CA  1 
ATOM 4236 C C   . LEU B 1 103 ? -32.728 -76.925 58.478 1.00 16.20 ? 103 LEU B C   1 
ATOM 4237 O O   . LEU B 1 103 ? -32.697 -76.005 59.315 1.00 20.27 ? 103 LEU B O   1 
ATOM 4238 C CB  . LEU B 1 103 ? -31.360 -76.773 56.378 1.00 15.12 ? 103 LEU B CB  1 
ATOM 4239 C CG  . LEU B 1 103 ? -31.216 -76.406 54.881 1.00 12.58 ? 103 LEU B CG  1 
ATOM 4240 C CD1 . LEU B 1 103 ? -29.701 -76.538 54.672 1.00 14.14 ? 103 LEU B CD1 1 
ATOM 4241 C CD2 . LEU B 1 103 ? -32.019 -77.359 54.121 1.00 16.85 ? 103 LEU B CD2 1 
ATOM 4242 N N   . ASN B 1 104 ? -32.553 -78.202 58.798 1.00 18.33 ? 104 ASN B N   1 
ATOM 4243 C CA  . ASN B 1 104 ? -32.414 -78.623 60.188 1.00 17.81 ? 104 ASN B CA  1 
ATOM 4244 C C   . ASN B 1 104 ? -30.978 -78.833 60.607 1.00 19.43 ? 104 ASN B C   1 
ATOM 4245 O O   . ASN B 1 104 ? -30.667 -79.588 61.525 1.00 22.16 ? 104 ASN B O   1 
ATOM 4246 C CB  . ASN B 1 104 ? -33.275 -79.868 60.375 1.00 18.59 ? 104 ASN B CB  1 
ATOM 4247 C CG  . ASN B 1 104 ? -33.574 -80.153 61.835 1.00 23.68 ? 104 ASN B CG  1 
ATOM 4248 O OD1 . ASN B 1 104 ? -33.909 -79.242 62.596 1.00 26.54 ? 104 ASN B OD1 1 
ATOM 4249 N ND2 . ASN B 1 104 ? -33.434 -81.454 62.237 1.00 21.92 ? 104 ASN B ND2 1 
ATOM 4250 N N   . GLY B 1 105 ? -30.040 -78.095 59.996 1.00 18.12 ? 105 GLY B N   1 
ATOM 4251 C CA  . GLY B 1 105 ? -28.623 -78.187 60.379 1.00 18.85 ? 105 GLY B CA  1 
ATOM 4252 C C   . GLY B 1 105 ? -28.255 -77.231 61.463 1.00 17.45 ? 105 GLY B C   1 
ATOM 4253 O O   . GLY B 1 105 ? -28.646 -76.098 61.405 1.00 17.50 ? 105 GLY B O   1 
ATOM 4254 N N   . ALA B 1 106 ? -27.457 -77.695 62.412 1.00 16.88 ? 106 ALA B N   1 
ATOM 4255 C CA  . ALA B 1 106 ? -27.131 -76.887 63.545 1.00 16.59 ? 106 ALA B CA  1 
ATOM 4256 C C   . ALA B 1 106 ? -25.989 -75.939 63.243 1.00 16.41 ? 106 ALA B C   1 
ATOM 4257 O O   . ALA B 1 106 ? -25.750 -74.951 63.961 1.00 17.74 ? 106 ALA B O   1 
ATOM 4258 C CB  . ALA B 1 106 ? -26.798 -77.768 64.729 1.00 18.00 ? 106 ALA B CB  1 
ATOM 4259 N N   . ASP B 1 107 ? -25.261 -76.163 62.159 1.00 15.54 ? 107 ASP B N   1 
ATOM 4260 C CA  . ASP B 1 107 ? -24.221 -75.223 61.797 1.00 15.19 ? 107 ASP B CA  1 
ATOM 4261 C C   . ASP B 1 107 ? -24.037 -75.193 60.267 1.00 14.76 ? 107 ASP B C   1 
ATOM 4262 O O   . ASP B 1 107 ? -24.677 -75.971 59.548 1.00 14.12 ? 107 ASP B O   1 
ATOM 4263 C CB  . ASP B 1 107 ? -22.848 -75.551 62.462 1.00 14.81 ? 107 ASP B CB  1 
ATOM 4264 C CG  . ASP B 1 107 ? -22.285 -76.898 61.952 1.00 21.14 ? 107 ASP B CG  1 
ATOM 4265 O OD1 . ASP B 1 107 ? -22.845 -77.465 61.000 1.00 20.89 ? 107 ASP B OD1 1 
ATOM 4266 O OD2 . ASP B 1 107 ? -21.251 -77.349 62.500 1.00 26.54 ? 107 ASP B OD2 1 
ATOM 4267 N N   . ALA B 1 108 ? -23.148 -74.325 59.796 1.00 12.90 ? 108 ALA B N   1 
ATOM 4268 C CA  . ALA B 1 108 ? -22.815 -74.300 58.357 1.00 12.51 ? 108 ALA B CA  1 
ATOM 4269 C C   . ALA B 1 108 ? -21.452 -73.688 58.260 1.00 13.35 ? 108 ALA B C   1 
ATOM 4270 O O   . ALA B 1 108 ? -21.003 -72.970 59.162 1.00 14.58 ? 108 ALA B O   1 
ATOM 4271 C CB  . ALA B 1 108 ? -23.880 -73.492 57.524 1.00 14.11 ? 108 ALA B CB  1 
ATOM 4272 N N   . VAL B 1 109 ? -20.779 -74.028 57.179 1.00 12.11 ? 109 VAL B N   1 
ATOM 4273 C CA  . VAL B 1 109 ? -19.500 -73.513 56.859 1.00 12.65 ? 109 VAL B CA  1 
ATOM 4274 C C   . VAL B 1 109 ? -19.580 -72.806 55.519 1.00 14.04 ? 109 VAL B C   1 
ATOM 4275 O O   . VAL B 1 109 ? -20.030 -73.371 54.513 1.00 14.66 ? 109 VAL B O   1 
ATOM 4276 C CB  . VAL B 1 109 ? -18.408 -74.597 56.730 1.00 12.89 ? 109 VAL B CB  1 
ATOM 4277 C CG1 . VAL B 1 109 ? -17.113 -74.002 56.139 1.00 14.95 ? 109 VAL B CG1 1 
ATOM 4278 C CG2 . VAL B 1 109 ? -18.174 -75.235 58.163 1.00 15.36 ? 109 VAL B CG2 1 
ATOM 4279 N N   . LEU B 1 110 ? -19.176 -71.510 55.493 1.00 13.58 ? 110 LEU B N   1 
ATOM 4280 C CA  . LEU B 1 110 ? -19.174 -70.753 54.235 1.00 13.07 ? 110 LEU B CA  1 
ATOM 4281 C C   . LEU B 1 110 ? -17.756 -70.712 53.681 1.00 14.21 ? 110 LEU B C   1 
ATOM 4282 O O   . LEU B 1 110 ? -16.841 -70.165 54.330 1.00 14.79 ? 110 LEU B O   1 
ATOM 4283 C CB  . LEU B 1 110 ? -19.638 -69.270 54.478 1.00 13.56 ? 110 LEU B CB  1 
ATOM 4284 C CG  . LEU B 1 110 ? -21.057 -69.078 54.937 1.00 17.96 ? 110 LEU B CG  1 
ATOM 4285 C CD1 . LEU B 1 110 ? -21.636 -67.817 55.332 1.00 17.99 ? 110 LEU B CD1 1 
ATOM 4286 C CD2 . LEU B 1 110 ? -21.983 -70.134 54.357 1.00 15.69 ? 110 LEU B CD2 1 
ATOM 4287 N N   . ALA B 1 111 ? -17.538 -71.269 52.485 1.00 14.12 ? 111 ALA B N   1 
ATOM 4288 C CA  . ALA B 1 111 ? -16.204 -71.280 51.905 1.00 14.20 ? 111 ALA B CA  1 
ATOM 4289 C C   . ALA B 1 111 ? -16.237 -70.476 50.637 1.00 14.75 ? 111 ALA B C   1 
ATOM 4290 O O   . ALA B 1 111 ? -16.177 -70.992 49.538 1.00 15.90 ? 111 ALA B O   1 
ATOM 4291 C CB  . ALA B 1 111 ? -15.726 -72.797 51.632 1.00 15.10 ? 111 ALA B CB  1 
ATOM 4292 N N   . LEU B 1 112 ? -16.372 -69.152 50.796 1.00 14.29 ? 112 LEU B N   1 
ATOM 4293 C CA  . LEU B 1 112 ? -16.617 -68.288 49.655 1.00 15.67 ? 112 LEU B CA  1 
ATOM 4294 C C   . LEU B 1 112 ? -15.415 -67.368 49.375 1.00 15.66 ? 112 LEU B C   1 
ATOM 4295 O O   . LEU B 1 112 ? -15.575 -66.320 48.778 1.00 15.72 ? 112 LEU B O   1 
ATOM 4296 C CB  . LEU B 1 112 ? -17.857 -67.347 49.923 1.00 13.76 ? 112 LEU B CB  1 
ATOM 4297 C CG  . LEU B 1 112 ? -19.195 -68.132 50.164 1.00 14.94 ? 112 LEU B CG  1 
ATOM 4298 C CD1 . LEU B 1 112 ? -20.345 -67.140 50.677 1.00 14.26 ? 112 LEU B CD1 1 
ATOM 4299 C CD2 . LEU B 1 112 ? -19.633 -68.937 48.914 1.00 17.25 ? 112 LEU B CD2 1 
ATOM 4300 N N   . ASP B 1 113 ? -14.208 -67.843 49.750 1.00 16.36 ? 113 ASP B N   1 
ATOM 4301 C CA  . ASP B 1 113 ? -12.969 -67.036 49.564 1.00 19.00 ? 113 ASP B CA  1 
ATOM 4302 C C   . ASP B 1 113 ? -12.738 -66.610 48.123 1.00 19.57 ? 113 ASP B C   1 
ATOM 4303 O O   . ASP B 1 113 ? -12.213 -65.496 47.840 1.00 22.47 ? 113 ASP B O   1 
ATOM 4304 C CB  . ASP B 1 113 ? -11.742 -67.839 50.030 1.00 19.52 ? 113 ASP B CB  1 
ATOM 4305 C CG  . ASP B 1 113 ? -10.510 -66.952 50.211 1.00 26.27 ? 113 ASP B CG  1 
ATOM 4306 O OD1 . ASP B 1 113 ? -10.493 -66.093 51.134 1.00 26.53 ? 113 ASP B OD1 1 
ATOM 4307 O OD2 . ASP B 1 113 ? -9.522  -67.127 49.416 1.00 33.34 ? 113 ASP B OD2 1 
ATOM 4308 N N   . ASP B 1 114 ? -13.201 -67.419 47.183 1.00 20.97 ? 114 ASP B N   1 
ATOM 4309 C CA  . ASP B 1 114 ? -12.880 -67.061 45.804 1.00 22.75 ? 114 ASP B CA  1 
ATOM 4310 C C   . ASP B 1 114 ? -13.744 -65.980 45.184 1.00 22.48 ? 114 ASP B C   1 
ATOM 4311 O O   . ASP B 1 114 ? -13.432 -65.479 44.083 1.00 23.67 ? 114 ASP B O   1 
ATOM 4312 C CB  . ASP B 1 114 ? -12.898 -68.296 44.916 1.00 24.96 ? 114 ASP B CB  1 
ATOM 4313 C CG  . ASP B 1 114 ? -11.755 -69.268 45.277 1.00 26.08 ? 114 ASP B CG  1 
ATOM 4314 O OD1 . ASP B 1 114 ? -10.624 -68.804 45.738 1.00 27.40 ? 114 ASP B OD1 1 
ATOM 4315 O OD2 . ASP B 1 114 ? -12.023 -70.466 45.075 1.00 23.66 ? 114 ASP B OD2 1 
ATOM 4316 N N   . VAL B 1 115 ? -14.861 -65.648 45.831 1.00 18.02 ? 115 VAL B N   1 
ATOM 4317 C CA  . VAL B 1 115 ? -15.715 -64.576 45.310 1.00 17.75 ? 115 VAL B CA  1 
ATOM 4318 C C   . VAL B 1 115 ? -15.096 -63.148 45.504 1.00 19.10 ? 115 VAL B C   1 
ATOM 4319 O O   . VAL B 1 115 ? -14.857 -62.717 46.600 1.00 21.68 ? 115 VAL B O   1 
ATOM 4320 C CB  . VAL B 1 115 ? -17.113 -64.617 45.975 1.00 17.65 ? 115 VAL B CB  1 
ATOM 4321 C CG1 . VAL B 1 115 ? -17.993 -63.469 45.371 1.00 19.71 ? 115 VAL B CG1 1 
ATOM 4322 C CG2 . VAL B 1 115 ? -17.735 -66.016 45.845 1.00 19.23 ? 115 VAL B CG2 1 
ATOM 4323 N N   . ALA B 1 116 ? -14.771 -62.496 44.416 1.00 18.87 ? 116 ALA B N   1 
ATOM 4324 C CA  . ALA B 1 116 ? -14.257 -61.090 44.496 1.00 21.10 ? 116 ALA B CA  1 
ATOM 4325 C C   . ALA B 1 116 ? -15.413 -60.107 44.568 1.00 19.36 ? 116 ALA B C   1 
ATOM 4326 O O   . ALA B 1 116 ? -16.396 -60.258 43.854 1.00 19.38 ? 116 ALA B O   1 
ATOM 4327 C CB  . ALA B 1 116 ? -13.415 -60.728 43.288 1.00 21.40 ? 116 ALA B CB  1 
ATOM 4328 N N   . VAL B 1 117 ? -15.269 -59.121 45.457 1.00 20.63 ? 117 VAL B N   1 
ATOM 4329 C CA  . VAL B 1 117 ? -16.229 -57.996 45.603 1.00 20.03 ? 117 VAL B CA  1 
ATOM 4330 C C   . VAL B 1 117 ? -15.553 -56.667 45.213 1.00 19.37 ? 117 VAL B C   1 
ATOM 4331 O O   . VAL B 1 117 ? -14.473 -56.341 45.690 1.00 19.77 ? 117 VAL B O   1 
ATOM 4332 C CB  . VAL B 1 117 ? -16.812 -57.938 47.048 1.00 19.84 ? 117 VAL B CB  1 
ATOM 4333 C CG1 . VAL B 1 117 ? -17.833 -56.716 47.235 1.00 17.87 ? 117 VAL B CG1 1 
ATOM 4334 C CG2 . VAL B 1 117 ? -17.406 -59.252 47.508 1.00 22.06 ? 117 VAL B CG2 1 
ATOM 4335 N N   . ASN B 1 118 ? -16.155 -55.982 44.243 1.00 22.77 ? 118 ASN B N   1 
ATOM 4336 C CA  . ASN B 1 118 ? -15.551 -54.783 43.672 1.00 24.31 ? 118 ASN B CA  1 
ATOM 4337 C C   . ASN B 1 118 ? -15.201 -53.728 44.766 1.00 24.50 ? 118 ASN B C   1 
ATOM 4338 O O   . ASN B 1 118 ? -16.014 -53.405 45.596 1.00 23.51 ? 118 ASN B O   1 
ATOM 4339 C CB  . ASN B 1 118 ? -16.490 -54.273 42.596 1.00 24.81 ? 118 ASN B CB  1 
ATOM 4340 C CG  . ASN B 1 118 ? -15.862 -53.197 41.714 1.00 32.14 ? 118 ASN B CG  1 
ATOM 4341 O OD1 . ASN B 1 118 ? -14.653 -53.234 41.512 1.00 35.77 ? 118 ASN B OD1 1 
ATOM 4342 N ND2 . ASN B 1 118 ? -16.665 -52.249 41.186 1.00 33.02 ? 118 ASN B ND2 1 
ATOM 4343 N N   . ASN B 1 119 ? -13.956 -53.226 44.725 1.00 25.21 ? 119 ASN B N   1 
ATOM 4344 C CA  . ASN B 1 119 ? -13.487 -52.185 45.644 1.00 28.34 ? 119 ASN B CA  1 
ATOM 4345 C C   . ASN B 1 119 ? -13.550 -52.556 47.139 1.00 27.75 ? 119 ASN B C   1 
ATOM 4346 O O   . ASN B 1 119 ? -13.663 -51.681 47.966 1.00 30.53 ? 119 ASN B O   1 
ATOM 4347 C CB  . ASN B 1 119 ? -14.216 -50.855 45.379 1.00 28.11 ? 119 ASN B CB  1 
ATOM 4348 C CG  . ASN B 1 119 ? -13.349 -49.627 45.738 1.00 35.27 ? 119 ASN B CG  1 
ATOM 4349 O OD1 . ASN B 1 119 ? -12.188 -49.525 45.281 1.00 39.63 ? 119 ASN B OD1 1 
ATOM 4350 N ND2 . ASN B 1 119 ? -13.901 -48.696 46.580 1.00 38.38 ? 119 ASN B ND2 1 
ATOM 4351 N N   . ARG B 1 120 ? -13.462 -53.843 47.466 1.00 25.70 ? 120 ARG B N   1 
ATOM 4352 C CA  . ARG B 1 120 ? -13.431 -54.313 48.864 1.00 25.12 ? 120 ARG B CA  1 
ATOM 4353 C C   . ARG B 1 120 ? -12.327 -55.344 48.969 1.00 25.55 ? 120 ARG B C   1 
ATOM 4354 O O   . ARG B 1 120 ? -12.343 -56.342 48.233 1.00 26.10 ? 120 ARG B O   1 
ATOM 4355 C CB  . ARG B 1 120 ? -14.732 -55.041 49.257 1.00 23.22 ? 120 ARG B CB  1 
ATOM 4356 C CG  . ARG B 1 120 ? -16.030 -54.231 49.055 1.00 24.56 ? 120 ARG B CG  1 
ATOM 4357 C CD  . ARG B 1 120 ? -16.563 -53.744 50.326 1.00 20.00 ? 120 ARG B CD  1 
ATOM 4358 N NE  . ARG B 1 120 ? -17.729 -52.830 50.191 1.00 17.67 ? 120 ARG B NE  1 
ATOM 4359 C CZ  . ARG B 1 120 ? -17.889 -51.832 51.076 1.00 11.35 ? 120 ARG B CZ  1 
ATOM 4360 N NH1 . ARG B 1 120 ? -17.012 -51.657 52.027 1.00 14.52 ? 120 ARG B NH1 1 
ATOM 4361 N NH2 . ARG B 1 120 ? -18.985 -51.068 50.999 1.00 10.96 ? 120 ARG B NH2 1 
ATOM 4362 N N   . ASP B 1 121 ? -11.450 -55.188 49.964 1.00 24.40 ? 121 ASP B N   1 
ATOM 4363 C CA  . ASP B 1 121 ? -10.370 -56.183 50.105 1.00 25.10 ? 121 ASP B CA  1 
ATOM 4364 C C   . ASP B 1 121 ? -10.989 -57.533 50.465 1.00 25.54 ? 121 ASP B C   1 
ATOM 4365 O O   . ASP B 1 121 ? -12.132 -57.624 51.048 1.00 23.41 ? 121 ASP B O   1 
ATOM 4366 C CB  . ASP B 1 121 ? -9.341  -55.746 51.167 1.00 22.95 ? 121 ASP B CB  1 
ATOM 4367 C CG  . ASP B 1 121 ? -9.912  -55.686 52.531 1.00 24.45 ? 121 ASP B CG  1 
ATOM 4368 O OD1 . ASP B 1 121 ? -11.063 -56.170 52.596 1.00 28.70 ? 121 ASP B OD1 1 
ATOM 4369 O OD2 . ASP B 1 121 ? -9.278  -55.107 53.479 1.00 26.26 ? 121 ASP B OD2 1 
ATOM 4370 N N   . ALA B 1 122 ? -10.227 -58.606 50.224 1.00 25.49 ? 122 ALA B N   1 
ATOM 4371 C CA  . ALA B 1 122 ? -10.771 -59.959 50.322 1.00 24.14 ? 122 ALA B CA  1 
ATOM 4372 C C   . ALA B 1 122 ? -11.005 -60.416 51.766 1.00 23.15 ? 122 ALA B C   1 
ATOM 4373 O O   . ALA B 1 122 ? -11.718 -61.387 51.964 1.00 23.02 ? 122 ALA B O   1 
ATOM 4374 C CB  . ALA B 1 122 ? -9.869  -60.987 49.569 1.00 26.13 ? 122 ALA B CB  1 
ATOM 4375 N N   . HIS B 1 123 ? -10.483 -59.681 52.742 1.00 21.81 ? 123 HIS B N   1 
ATOM 4376 C CA  . HIS B 1 123 ? -10.590 -60.133 54.097 1.00 22.94 ? 123 HIS B CA  1 
ATOM 4377 C C   . HIS B 1 123 ? -11.455 -59.222 54.948 1.00 23.11 ? 123 HIS B C   1 
ATOM 4378 O O   . HIS B 1 123 ? -12.434 -59.743 55.575 1.00 25.37 ? 123 HIS B O   1 
ATOM 4379 C CB  . HIS B 1 123 ? -9.211  -60.340 54.618 1.00 24.47 ? 123 HIS B CB  1 
ATOM 4380 C CG  . HIS B 1 123 ? -8.453  -61.316 53.770 1.00 30.36 ? 123 HIS B CG  1 
ATOM 4381 N ND1 . HIS B 1 123 ? -8.970  -62.562 53.457 1.00 36.25 ? 123 HIS B ND1 1 
ATOM 4382 C CD2 . HIS B 1 123 ? -7.256  -61.228 53.150 1.00 34.52 ? 123 HIS B CD2 1 
ATOM 4383 C CE1 . HIS B 1 123 ? -8.097  -63.217 52.706 1.00 37.52 ? 123 HIS B CE1 1 
ATOM 4384 N NE2 . HIS B 1 123 ? -7.053  -62.429 52.503 1.00 36.67 ? 123 HIS B NE2 1 
ATOM 4385 N N   . TYR B 1 124 ? -11.222 -57.904 54.926 1.00 17.72 ? 124 TYR B N   1 
ATOM 4386 C CA  . TYR B 1 124 ? -11.989 -57.051 55.854 1.00 16.51 ? 124 TYR B CA  1 
ATOM 4387 C C   . TYR B 1 124 ? -13.269 -56.523 55.214 1.00 16.59 ? 124 TYR B C   1 
ATOM 4388 O O   . TYR B 1 124 ? -14.371 -56.792 55.750 1.00 16.66 ? 124 TYR B O   1 
ATOM 4389 C CB  . TYR B 1 124 ? -11.183 -55.864 56.399 1.00 16.40 ? 124 TYR B CB  1 
ATOM 4390 C CG  . TYR B 1 124 ? -11.941 -55.014 57.390 1.00 13.89 ? 124 TYR B CG  1 
ATOM 4391 C CD1 . TYR B 1 124 ? -12.146 -55.494 58.687 1.00 14.18 ? 124 TYR B CD1 1 
ATOM 4392 C CD2 . TYR B 1 124 ? -12.475 -53.772 57.049 1.00 15.55 ? 124 TYR B CD2 1 
ATOM 4393 C CE1 . TYR B 1 124 ? -12.812 -54.715 59.673 1.00 11.82 ? 124 TYR B CE1 1 
ATOM 4394 C CE2 . TYR B 1 124 ? -13.100 -52.990 57.968 1.00 15.11 ? 124 TYR B CE2 1 
ATOM 4395 C CZ  . TYR B 1 124 ? -13.324 -53.468 59.262 1.00 11.32 ? 124 TYR B CZ  1 
ATOM 4396 O OH  . TYR B 1 124 ? -13.992 -52.643 60.163 1.00 13.12 ? 124 TYR B OH  1 
ATOM 4397 N N   . GLY B 1 125 ? -13.212 -55.739 54.136 1.00 16.07 ? 125 GLY B N   1 
ATOM 4398 C CA  . GLY B 1 125 ? -14.447 -55.111 53.585 1.00 14.22 ? 125 GLY B CA  1 
ATOM 4399 C C   . GLY B 1 125 ? -15.425 -56.147 53.095 1.00 14.67 ? 125 GLY B C   1 
ATOM 4400 O O   . GLY B 1 125 ? -16.618 -56.046 53.383 1.00 14.23 ? 125 GLY B O   1 
ATOM 4401 N N   . LYS B 1 126 ? -14.929 -57.198 52.446 1.00 13.73 ? 126 LYS B N   1 
ATOM 4402 C CA  . LYS B 1 126 ? -15.834 -58.212 51.899 1.00 14.35 ? 126 LYS B CA  1 
ATOM 4403 C C   . LYS B 1 126 ? -16.628 -58.821 53.064 1.00 12.84 ? 126 LYS B C   1 
ATOM 4404 O O   . LYS B 1 126 ? -17.870 -59.054 52.893 1.00 12.51 ? 126 LYS B O   1 
ATOM 4405 C CB  . LYS B 1 126 ? -15.011 -59.319 51.263 1.00 14.12 ? 126 LYS B CB  1 
ATOM 4406 C CG  . LYS B 1 126 ? -15.787 -60.569 50.764 1.00 16.56 ? 126 LYS B CG  1 
ATOM 4407 C CD  . LYS B 1 126 ? -14.804 -61.510 50.078 1.00 16.43 ? 126 LYS B CD  1 
ATOM 4408 C CE  . LYS B 1 126 ? -15.424 -62.900 49.873 1.00 15.89 ? 126 LYS B CE  1 
ATOM 4409 N NZ  . LYS B 1 126 ? -14.437 -63.763 49.102 1.00 16.43 ? 126 LYS B NZ  1 
ATOM 4410 N N   . TYR B 1 127 ? -15.953 -59.173 54.164 1.00 12.54 ? 127 TYR B N   1 
ATOM 4411 C CA  . TYR B 1 127 ? -16.624 -59.876 55.214 1.00 11.08 ? 127 TYR B CA  1 
ATOM 4412 C C   . TYR B 1 127 ? -17.351 -58.945 56.178 1.00 12.48 ? 127 TYR B C   1 
ATOM 4413 O O   . TYR B 1 127 ? -18.224 -59.428 56.836 1.00 11.22 ? 127 TYR B O   1 
ATOM 4414 C CB  . TYR B 1 127 ? -15.667 -60.913 55.943 1.00 12.44 ? 127 TYR B CB  1 
ATOM 4415 C CG  . TYR B 1 127 ? -15.387 -62.074 55.064 1.00 13.47 ? 127 TYR B CG  1 
ATOM 4416 C CD1 . TYR B 1 127 ? -16.267 -63.127 55.051 1.00 17.14 ? 127 TYR B CD1 1 
ATOM 4417 C CD2 . TYR B 1 127 ? -14.215 -62.113 54.273 1.00 17.12 ? 127 TYR B CD2 1 
ATOM 4418 C CE1 . TYR B 1 127 ? -16.077 -64.198 54.215 1.00 16.48 ? 127 TYR B CE1 1 
ATOM 4419 C CE2 . TYR B 1 127 ? -13.979 -63.237 53.434 1.00 14.74 ? 127 TYR B CE2 1 
ATOM 4420 C CZ  . TYR B 1 127 ? -14.903 -64.275 53.468 1.00 17.28 ? 127 TYR B CZ  1 
ATOM 4421 O OH  . TYR B 1 127 ? -14.716 -65.392 52.594 1.00 21.47 ? 127 TYR B OH  1 
ATOM 4422 N N   . ARG B 1 128 ? -16.979 -57.654 56.251 1.00 11.82 ? 128 ARG B N   1 
ATOM 4423 C CA  . ARG B 1 128 ? -17.906 -56.728 56.965 1.00 10.83 ? 128 ARG B CA  1 
ATOM 4424 C C   . ARG B 1 128 ? -19.349 -56.857 56.383 1.00 10.21 ? 128 ARG B C   1 
ATOM 4425 O O   . ARG B 1 128 ? -20.323 -56.911 57.154 1.00 10.06 ? 128 ARG B O   1 
ATOM 4426 C CB  . ARG B 1 128 ? -17.479 -55.293 56.792 1.00 9.63  ? 128 ARG B CB  1 
ATOM 4427 C CG  . ARG B 1 128 ? -16.340 -54.711 57.739 1.00 11.67 ? 128 ARG B CG  1 
ATOM 4428 C CD  . ARG B 1 128 ? -16.835 -54.484 59.200 1.00 11.79 ? 128 ARG B CD  1 
ATOM 4429 N NE  . ARG B 1 128 ? -17.927 -53.497 59.083 1.00 12.03 ? 128 ARG B NE  1 
ATOM 4430 C CZ  . ARG B 1 128 ? -17.668 -52.193 58.974 1.00 14.05 ? 128 ARG B CZ  1 
ATOM 4431 N NH1 . ARG B 1 128 ? -16.381 -51.700 59.047 1.00 12.88 ? 128 ARG B NH1 1 
ATOM 4432 N NH2 . ARG B 1 128 ? -18.693 -51.372 58.712 1.00 12.21 ? 128 ARG B NH2 1 
ATOM 4433 N N   . LEU B 1 129 ? -19.438 -56.872 55.043 1.00 10.57 ? 129 LEU B N   1 
ATOM 4434 C CA  . LEU B 1 129 ? -20.772 -56.868 54.391 1.00 10.76 ? 129 LEU B CA  1 
ATOM 4435 C C   . LEU B 1 129 ? -21.424 -58.235 54.577 1.00 10.46 ? 129 LEU B C   1 
ATOM 4436 O O   . LEU B 1 129 ? -22.620 -58.321 54.997 1.00 10.16 ? 129 LEU B O   1 
ATOM 4437 C CB  . LEU B 1 129 ? -20.582 -56.595 52.918 1.00 12.43 ? 129 LEU B CB  1 
ATOM 4438 C CG  . LEU B 1 129 ? -20.663 -55.013 52.691 1.00 16.14 ? 129 LEU B CG  1 
ATOM 4439 C CD1 . LEU B 1 129 ? -19.715 -54.208 53.495 1.00 23.71 ? 129 LEU B CD1 1 
ATOM 4440 C CD2 . LEU B 1 129 ? -20.516 -54.748 51.172 1.00 18.43 ? 129 LEU B CD2 1 
ATOM 4441 N N   . LEU B 1 130 ? -20.651 -59.326 54.399 1.00 10.48 ? 130 LEU B N   1 
ATOM 4442 C CA  . LEU B 1 130 ? -21.241 -60.690 54.593 1.00 10.85 ? 130 LEU B CA  1 
ATOM 4443 C C   . LEU B 1 130 ? -21.701 -60.851 56.028 1.00 10.82 ? 130 LEU B C   1 
ATOM 4444 O O   . LEU B 1 130 ? -22.808 -61.361 56.225 1.00 11.01 ? 130 LEU B O   1 
ATOM 4445 C CB  . LEU B 1 130 ? -20.200 -61.793 54.199 1.00 11.48 ? 130 LEU B CB  1 
ATOM 4446 C CG  . LEU B 1 130 ? -20.689 -63.242 54.420 1.00 11.44 ? 130 LEU B CG  1 
ATOM 4447 C CD1 . LEU B 1 130 ? -19.930 -64.139 53.380 1.00 11.88 ? 130 LEU B CD1 1 
ATOM 4448 C CD2 . LEU B 1 130 ? -20.432 -63.653 55.919 1.00 12.68 ? 130 LEU B CD2 1 
ATOM 4449 N N   . ALA B 1 131 ? -20.834 -60.523 57.003 1.00 9.59  ? 131 ALA B N   1 
ATOM 4450 C CA  . ALA B 1 131 ? -21.195 -60.814 58.375 1.00 9.13  ? 131 ALA B CA  1 
ATOM 4451 C C   . ALA B 1 131 ? -22.397 -59.987 58.876 1.00 9.46  ? 131 ALA B C   1 
ATOM 4452 O O   . ALA B 1 131 ? -23.278 -60.509 59.569 1.00 10.52 ? 131 ALA B O   1 
ATOM 4453 C CB  . ALA B 1 131 ? -19.960 -60.579 59.320 1.00 9.93  ? 131 ALA B CB  1 
ATOM 4454 N N   . GLU B 1 132 ? -22.417 -58.700 58.531 1.00 10.25 ? 132 GLU B N   1 
ATOM 4455 C CA  . GLU B 1 132 ? -23.620 -57.914 58.884 1.00 9.87  ? 132 GLU B CA  1 
ATOM 4456 C C   . GLU B 1 132 ? -24.885 -58.432 58.238 1.00 10.44 ? 132 GLU B C   1 
ATOM 4457 O O   . GLU B 1 132 ? -25.951 -58.470 58.878 1.00 11.79 ? 132 GLU B O   1 
ATOM 4458 C CB  . GLU B 1 132 ? -23.320 -56.474 58.562 1.00 9.33  ? 132 GLU B CB  1 
ATOM 4459 C CG  . GLU B 1 132 ? -24.468 -55.455 58.942 1.00 10.50 ? 132 GLU B CG  1 
ATOM 4460 C CD  . GLU B 1 132 ? -23.991 -54.098 58.606 1.00 15.03 ? 132 GLU B CD  1 
ATOM 4461 O OE1 . GLU B 1 132 ? -22.884 -53.948 58.086 1.00 13.32 ? 132 GLU B OE1 1 
ATOM 4462 O OE2 . GLU B 1 132 ? -24.790 -53.197 58.906 1.00 16.91 ? 132 GLU B OE2 1 
ATOM 4463 N N   . THR B 1 133 ? -24.852 -58.814 56.974 1.00 9.98  ? 133 THR B N   1 
ATOM 4464 C CA  . THR B 1 133 ? -26.049 -59.330 56.337 1.00 9.33  ? 133 THR B CA  1 
ATOM 4465 C C   . THR B 1 133 ? -26.519 -60.622 56.992 1.00 10.76 ? 133 THR B C   1 
ATOM 4466 O O   . THR B 1 133 ? -27.697 -60.827 57.245 1.00 9.44  ? 133 THR B O   1 
ATOM 4467 C CB  . THR B 1 133 ? -25.795 -59.499 54.797 1.00 10.90 ? 133 THR B CB  1 
ATOM 4468 O OG1 . THR B 1 133 ? -25.746 -58.200 54.215 1.00 13.75 ? 133 THR B OG1 1 
ATOM 4469 C CG2 . THR B 1 133 ? -26.919 -60.283 54.110 1.00 10.79 ? 133 THR B CG2 1 
ATOM 4470 N N   . LEU B 1 134 ? -25.562 -61.521 57.241 1.00 10.75 ? 134 LEU B N   1 
ATOM 4471 C CA  . LEU B 1 134 ? -25.890 -62.793 57.903 1.00 12.98 ? 134 LEU B CA  1 
ATOM 4472 C C   . LEU B 1 134 ? -26.509 -62.546 59.291 1.00 9.18  ? 134 LEU B C   1 
ATOM 4473 O O   . LEU B 1 134 ? -27.595 -63.082 59.656 1.00 11.33 ? 134 LEU B O   1 
ATOM 4474 C CB  . LEU B 1 134 ? -24.590 -63.596 58.000 1.00 13.58 ? 134 LEU B CB  1 
ATOM 4475 C CG  . LEU B 1 134 ? -24.777 -64.904 58.703 1.00 15.03 ? 134 LEU B CG  1 
ATOM 4476 C CD1 . LEU B 1 134 ? -25.763 -65.829 57.909 1.00 15.47 ? 134 LEU B CD1 1 
ATOM 4477 C CD2 . LEU B 1 134 ? -23.329 -65.583 58.691 1.00 19.82 ? 134 LEU B CD2 1 
ATOM 4478 N N   . LEU B 1 135 ? -25.867 -61.717 60.097 1.00 9.84  ? 135 LEU B N   1 
ATOM 4479 C CA  . LEU B 1 135 ? -26.309 -61.542 61.509 1.00 10.21 ? 135 LEU B CA  1 
ATOM 4480 C C   . LEU B 1 135 ? -27.603 -60.691 61.656 1.00 12.08 ? 135 LEU B C   1 
ATOM 4481 O O   . LEU B 1 135 ? -28.528 -61.034 62.445 1.00 12.94 ? 135 LEU B O   1 
ATOM 4482 C CB  . LEU B 1 135 ? -25.217 -60.861 62.340 1.00 11.00 ? 135 LEU B CB  1 
ATOM 4483 C CG  . LEU B 1 135 ? -23.991 -61.768 62.605 1.00 12.77 ? 135 LEU B CG  1 
ATOM 4484 C CD1 . LEU B 1 135 ? -22.794 -60.950 63.229 1.00 11.07 ? 135 LEU B CD1 1 
ATOM 4485 C CD2 . LEU B 1 135 ? -24.399 -63.026 63.412 1.00 15.38 ? 135 LEU B CD2 1 
ATOM 4486 N N   . ASP B 1 136 ? -27.691 -59.610 60.900 1.00 11.81 ? 136 ASP B N   1 
ATOM 4487 C CA  . ASP B 1 136 ? -28.928 -58.824 60.854 1.00 9.93  ? 136 ASP B CA  1 
ATOM 4488 C C   . ASP B 1 136 ? -30.048 -59.612 60.249 1.00 12.94 ? 136 ASP B C   1 
ATOM 4489 O O   . ASP B 1 136 ? -31.198 -59.422 60.627 1.00 12.45 ? 136 ASP B O   1 
ATOM 4490 C CB  . ASP B 1 136 ? -28.629 -57.471 60.114 1.00 10.54 ? 136 ASP B CB  1 
ATOM 4491 C CG  . ASP B 1 136 ? -29.857 -56.531 60.059 1.00 12.58 ? 136 ASP B CG  1 
ATOM 4492 O OD1 . ASP B 1 136 ? -30.315 -56.169 61.120 1.00 10.82 ? 136 ASP B OD1 1 
ATOM 4493 O OD2 . ASP B 1 136 ? -30.350 -56.217 58.964 1.00 14.96 ? 136 ASP B OD2 1 
ATOM 4494 N N   . GLY B 1 137 ? -29.742 -60.506 59.353 1.00 10.47 ? 137 GLY B N   1 
ATOM 4495 C CA  . GLY B 1 137 ? -30.781 -61.363 58.733 1.00 13.37 ? 137 GLY B CA  1 
ATOM 4496 C C   . GLY B 1 137 ? -31.413 -62.361 59.693 1.00 14.68 ? 137 GLY B C   1 
ATOM 4497 O O   . GLY B 1 137 ? -32.520 -62.854 59.401 1.00 15.61 ? 137 GLY B O   1 
ATOM 4498 N N   . GLU B 1 138 ? -30.818 -62.560 60.868 1.00 14.32 ? 138 GLU B N   1 
ATOM 4499 C CA  . GLU B 1 138 ? -31.387 -63.420 61.889 1.00 15.68 ? 138 GLU B CA  1 
ATOM 4500 C C   . GLU B 1 138 ? -32.504 -62.751 62.666 1.00 15.33 ? 138 GLU B C   1 
ATOM 4501 O O   . GLU B 1 138 ? -33.188 -63.393 63.533 1.00 14.40 ? 138 GLU B O   1 
ATOM 4502 C CB  . GLU B 1 138 ? -30.291 -63.807 62.857 1.00 16.33 ? 138 GLU B CB  1 
ATOM 4503 C CG  . GLU B 1 138 ? -29.209 -64.754 62.298 1.00 24.70 ? 138 GLU B CG  1 
ATOM 4504 C CD  . GLU B 1 138 ? -29.755 -66.165 62.169 1.00 33.55 ? 138 GLU B CD  1 
ATOM 4505 O OE1 . GLU B 1 138 ? -29.970 -66.790 63.264 1.00 39.77 ? 138 GLU B OE1 1 
ATOM 4506 O OE2 . GLU B 1 138 ? -29.954 -66.606 60.996 1.00 37.79 ? 138 GLU B OE2 1 
ATOM 4507 N N   . TYR B 1 139 ? -32.625 -61.402 62.489 1.00 12.31 ? 139 TYR B N   1 
ATOM 4508 C CA  . TYR B 1 139 ? -33.572 -60.640 63.317 1.00 12.29 ? 139 TYR B CA  1 
ATOM 4509 C C   . TYR B 1 139 ? -35.028 -61.175 63.225 1.00 12.21 ? 139 TYR B C   1 
ATOM 4510 O O   . TYR B 1 139 ? -35.536 -61.420 62.082 1.00 15.06 ? 139 TYR B O   1 
ATOM 4511 C CB  . TYR B 1 139 ? -33.574 -59.174 62.773 1.00 11.74 ? 139 TYR B CB  1 
ATOM 4512 C CG  . TYR B 1 139 ? -34.490 -58.260 63.579 1.00 9.12  ? 139 TYR B CG  1 
ATOM 4513 C CD1 . TYR B 1 139 ? -35.769 -57.913 63.082 1.00 9.96  ? 139 TYR B CD1 1 
ATOM 4514 C CD2 . TYR B 1 139 ? -34.032 -57.769 64.767 1.00 6.96  ? 139 TYR B CD2 1 
ATOM 4515 C CE1 . TYR B 1 139 ? -36.590 -57.163 63.852 1.00 9.57  ? 139 TYR B CE1 1 
ATOM 4516 C CE2 . TYR B 1 139 ? -34.838 -56.923 65.557 1.00 8.74  ? 139 TYR B CE2 1 
ATOM 4517 C CZ  . TYR B 1 139 ? -36.116 -56.607 65.035 1.00 9.17  ? 139 TYR B CZ  1 
ATOM 4518 O OH  . TYR B 1 139 ? -36.920 -55.821 65.825 1.00 8.01  ? 139 TYR B OH  1 
ATOM 4519 N N   . VAL B 1 140 ? -35.592 -61.316 64.408 1.00 13.38 ? 140 VAL B N   1 
ATOM 4520 C CA  . VAL B 1 140 ? -37.031 -61.690 64.557 1.00 16.47 ? 140 VAL B CA  1 
ATOM 4521 C C   . VAL B 1 140 ? -37.681 -60.766 65.521 1.00 14.19 ? 140 VAL B C   1 
ATOM 4522 O O   . VAL B 1 140 ? -37.126 -60.458 66.547 1.00 14.98 ? 140 VAL B O   1 
ATOM 4523 C CB  . VAL B 1 140 ? -37.157 -63.164 65.215 1.00 18.28 ? 140 VAL B CB  1 
ATOM 4524 C CG1 . VAL B 1 140 ? -38.666 -63.482 65.668 1.00 20.71 ? 140 VAL B CG1 1 
ATOM 4525 C CG2 . VAL B 1 140 ? -36.657 -64.199 64.225 1.00 21.48 ? 140 VAL B CG2 1 
ATOM 4526 N N   . PHE B 1 141 ? -38.879 -60.291 65.175 1.00 15.21 ? 141 PHE B N   1 
ATOM 4527 C CA  . PHE B 1 141 ? -39.651 -59.451 66.131 1.00 12.91 ? 141 PHE B CA  1 
ATOM 4528 C C   . PHE B 1 141 ? -41.051 -60.096 66.190 1.00 12.85 ? 141 PHE B C   1 
ATOM 4529 O O   . PHE B 1 141 ? -41.993 -59.704 65.480 1.00 13.62 ? 141 PHE B O   1 
ATOM 4530 C CB  . PHE B 1 141 ? -39.782 -57.985 65.591 1.00 11.48 ? 141 PHE B CB  1 
ATOM 4531 C CG  . PHE B 1 141 ? -40.412 -57.030 66.563 1.00 12.60 ? 141 PHE B CG  1 
ATOM 4532 C CD1 . PHE B 1 141 ? -41.689 -56.543 66.389 1.00 10.77 ? 141 PHE B CD1 1 
ATOM 4533 C CD2 . PHE B 1 141 ? -39.670 -56.601 67.633 1.00 12.08 ? 141 PHE B CD2 1 
ATOM 4534 C CE1 . PHE B 1 141 ? -42.294 -55.674 67.383 1.00 12.67 ? 141 PHE B CE1 1 
ATOM 4535 C CE2 . PHE B 1 141 ? -40.214 -55.632 68.576 1.00 11.63 ? 141 PHE B CE2 1 
ATOM 4536 C CZ  . PHE B 1 141 ? -41.511 -55.245 68.425 1.00 9.24  ? 141 PHE B CZ  1 
ATOM 4537 N N   . ASP B 1 142 ? -41.122 -61.094 67.053 1.00 12.72 ? 142 ASP B N   1 
ATOM 4538 C CA  . ASP B 1 142 ? -42.378 -61.949 67.113 1.00 12.89 ? 142 ASP B CA  1 
ATOM 4539 C C   . ASP B 1 142 ? -43.018 -61.763 68.471 1.00 12.20 ? 142 ASP B C   1 
ATOM 4540 O O   . ASP B 1 142 ? -43.945 -62.518 68.839 1.00 12.23 ? 142 ASP B O   1 
ATOM 4541 C CB  . ASP B 1 142 ? -42.104 -63.402 66.793 1.00 15.50 ? 142 ASP B CB  1 
ATOM 4542 C CG  . ASP B 1 142 ? -41.260 -64.070 67.809 1.00 24.07 ? 142 ASP B CG  1 
ATOM 4543 O OD1 . ASP B 1 142 ? -40.668 -63.448 68.752 1.00 26.29 ? 142 ASP B OD1 1 
ATOM 4544 O OD2 . ASP B 1 142 ? -41.215 -65.330 67.697 1.00 28.35 ? 142 ASP B OD2 1 
ATOM 4545 N N   . ARG B 1 143 ? -42.608 -60.783 69.246 1.00 12.26 ? 143 ARG B N   1 
ATOM 4546 C CA  . ARG B 1 143 ? -43.178 -60.657 70.558 1.00 13.16 ? 143 ARG B CA  1 
ATOM 4547 C C   . ARG B 1 143 ? -44.684 -60.440 70.683 1.00 10.84 ? 143 ARG B C   1 
ATOM 4548 O O   . ARG B 1 143 ? -45.274 -60.737 71.772 1.00 15.43 ? 143 ARG B O   1 
ATOM 4549 C CB  . ARG B 1 143 ? -42.447 -59.675 71.395 1.00 16.89 ? 143 ARG B CB  1 
ATOM 4550 C CG  . ARG B 1 143 ? -42.546 -58.303 70.892 1.00 12.14 ? 143 ARG B CG  1 
ATOM 4551 C CD  . ARG B 1 143 ? -41.728 -57.393 71.797 1.00 21.87 ? 143 ARG B CD  1 
ATOM 4552 N NE  . ARG B 1 143 ? -40.325 -57.584 71.415 1.00 23.41 ? 143 ARG B NE  1 
ATOM 4553 C CZ  . ARG B 1 143 ? -39.331 -56.837 71.941 1.00 26.58 ? 143 ARG B CZ  1 
ATOM 4554 N NH1 . ARG B 1 143 ? -38.077 -57.036 71.510 1.00 24.07 ? 143 ARG B NH1 1 
ATOM 4555 N NH2 . ARG B 1 143 ? -39.640 -55.919 72.884 1.00 22.97 ? 143 ARG B NH2 1 
ATOM 4556 N N   . PHE B 1 144 ? -45.264 -59.889 69.618 1.00 9.42  ? 144 PHE B N   1 
ATOM 4557 C CA  . PHE B 1 144 ? -46.731 -59.673 69.689 1.00 10.33 ? 144 PHE B CA  1 
ATOM 4558 C C   . PHE B 1 144 ? -47.461 -60.753 68.983 1.00 11.85 ? 144 PHE B C   1 
ATOM 4559 O O   . PHE B 1 144 ? -48.651 -60.635 68.820 1.00 15.67 ? 144 PHE B O   1 
ATOM 4560 C CB  . PHE B 1 144 ? -47.153 -58.278 69.117 1.00 11.47 ? 144 PHE B CB  1 
ATOM 4561 C CG  . PHE B 1 144 ? -46.539 -57.171 69.899 1.00 10.84 ? 144 PHE B CG  1 
ATOM 4562 C CD1 . PHE B 1 144 ? -45.339 -56.587 69.476 1.00 10.98 ? 144 PHE B CD1 1 
ATOM 4563 C CD2 . PHE B 1 144 ? -47.121 -56.794 71.038 1.00 14.04 ? 144 PHE B CD2 1 
ATOM 4564 C CE1 . PHE B 1 144 ? -44.735 -55.611 70.187 1.00 12.47 ? 144 PHE B CE1 1 
ATOM 4565 C CE2 . PHE B 1 144 ? -46.529 -55.762 71.836 1.00 14.22 ? 144 PHE B CE2 1 
ATOM 4566 C CZ  . PHE B 1 144 ? -45.292 -55.205 71.393 1.00 10.70 ? 144 PHE B CZ  1 
ATOM 4567 N N   . LYS B 1 145 ? -46.797 -61.766 68.460 1.00 11.52 ? 145 LYS B N   1 
ATOM 4568 C CA  . LYS B 1 145 ? -47.484 -62.902 67.871 1.00 12.06 ? 145 LYS B CA  1 
ATOM 4569 C C   . LYS B 1 145 ? -47.812 -64.001 68.921 1.00 13.52 ? 145 LYS B C   1 
ATOM 4570 O O   . LYS B 1 145 ? -46.980 -64.318 69.782 1.00 14.63 ? 145 LYS B O   1 
ATOM 4571 C CB  . LYS B 1 145 ? -46.583 -63.593 66.869 1.00 12.09 ? 145 LYS B CB  1 
ATOM 4572 C CG  . LYS B 1 145 ? -46.210 -62.787 65.647 1.00 12.01 ? 145 LYS B CG  1 
ATOM 4573 C CD  . LYS B 1 145 ? -47.352 -62.586 64.700 1.00 12.97 ? 145 LYS B CD  1 
ATOM 4574 C CE  . LYS B 1 145 ? -46.854 -61.873 63.359 1.00 14.66 ? 145 LYS B CE  1 
ATOM 4575 N NZ  . LYS B 1 145 ? -47.968 -61.816 62.512 1.00 14.11 ? 145 LYS B NZ  1 
ATOM 4576 N N   . SER B 1 146 ? -48.992 -64.580 68.735 1.00 14.80 ? 146 SER B N   1 
ATOM 4577 C CA  . SER B 1 146 ? -49.426 -65.739 69.583 1.00 18.82 ? 146 SER B CA  1 
ATOM 4578 C C   . SER B 1 146 ? -48.728 -66.950 69.149 1.00 20.59 ? 146 SER B C   1 
ATOM 4579 O O   . SER B 1 146 ? -48.316 -67.751 70.045 1.00 24.29 ? 146 SER B O   1 
ATOM 4580 C CB  . SER B 1 146 ? -50.944 -65.880 69.427 1.00 19.45 ? 146 SER B CB  1 
ATOM 4581 O OG  . SER B 1 146 ? -51.510 -64.847 70.211 1.00 16.24 ? 146 SER B OG  1 
ATOM 4582 N N   . GLU B 1 150 ? -40.933 -70.816 65.295 1.00 46.75 ? 150 GLU B N   1 
ATOM 4583 C CA  . GLU B 1 150 ? -40.237 -72.043 65.738 1.00 47.23 ? 150 GLU B CA  1 
ATOM 4584 C C   . GLU B 1 150 ? -38.764 -71.734 65.613 1.00 45.50 ? 150 GLU B C   1 
ATOM 4585 O O   . GLU B 1 150 ? -38.343 -71.265 64.503 1.00 44.99 ? 150 GLU B O   1 
ATOM 4586 C CB  . GLU B 1 150 ? -40.587 -73.233 64.829 1.00 49.39 ? 150 GLU B CB  1 
ATOM 4587 C CG  . GLU B 1 150 ? -40.625 -72.936 63.291 1.00 52.27 ? 150 GLU B CG  1 
ATOM 4588 C CD  . GLU B 1 150 ? -41.653 -73.835 62.562 1.00 57.43 ? 150 GLU B CD  1 
ATOM 4589 O OE1 . GLU B 1 150 ? -41.754 -75.044 62.913 1.00 58.32 ? 150 GLU B OE1 1 
ATOM 4590 O OE2 . GLU B 1 150 ? -42.373 -73.327 61.655 1.00 60.47 ? 150 GLU B OE2 1 
ATOM 4591 N N   . PRO B 1 151 ? -37.983 -71.914 66.732 1.00 43.38 ? 151 PRO B N   1 
ATOM 4592 C CA  . PRO B 1 151 ? -36.606 -71.428 66.657 1.00 41.38 ? 151 PRO B CA  1 
ATOM 4593 C C   . PRO B 1 151 ? -35.950 -72.214 65.539 1.00 39.15 ? 151 PRO B C   1 
ATOM 4594 O O   . PRO B 1 151 ? -36.465 -73.255 65.059 1.00 38.25 ? 151 PRO B O   1 
ATOM 4595 C CB  . PRO B 1 151 ? -35.985 -71.712 68.053 1.00 41.99 ? 151 PRO B CB  1 
ATOM 4596 C CG  . PRO B 1 151 ? -37.154 -71.881 68.955 1.00 42.79 ? 151 PRO B CG  1 
ATOM 4597 C CD  . PRO B 1 151 ? -38.254 -72.531 68.045 1.00 44.03 ? 151 PRO B CD  1 
ATOM 4598 N N   . ARG B 1 152 ? -34.882 -71.640 65.054 1.00 36.35 ? 152 ARG B N   1 
ATOM 4599 C CA  . ARG B 1 152 ? -34.218 -72.218 63.923 1.00 32.53 ? 152 ARG B CA  1 
ATOM 4600 C C   . ARG B 1 152 ? -33.127 -73.114 64.402 1.00 28.97 ? 152 ARG B C   1 
ATOM 4601 O O   . ARG B 1 152 ? -32.574 -72.946 65.513 1.00 26.33 ? 152 ARG B O   1 
ATOM 4602 C CB  . ARG B 1 152 ? -33.678 -71.084 63.092 1.00 32.87 ? 152 ARG B CB  1 
ATOM 4603 C CG  . ARG B 1 152 ? -34.774 -70.497 62.288 1.00 36.43 ? 152 ARG B CG  1 
ATOM 4604 C CD  . ARG B 1 152 ? -34.227 -69.459 61.414 1.00 35.96 ? 152 ARG B CD  1 
ATOM 4605 N NE  . ARG B 1 152 ? -33.594 -68.395 62.197 1.00 37.03 ? 152 ARG B NE  1 
ATOM 4606 C CZ  . ARG B 1 152 ? -34.024 -67.119 62.255 1.00 38.38 ? 152 ARG B CZ  1 
ATOM 4607 N NH1 . ARG B 1 152 ? -35.095 -66.693 61.587 1.00 35.37 ? 152 ARG B NH1 1 
ATOM 4608 N NH2 . ARG B 1 152 ? -33.337 -66.242 62.979 1.00 34.51 ? 152 ARG B NH2 1 
ATOM 4609 N N   . ALA B 1 153 ? -32.795 -74.082 63.569 1.00 24.97 ? 153 ALA B N   1 
ATOM 4610 C CA  . ALA B 1 153 ? -31.790 -75.034 63.961 1.00 21.59 ? 153 ALA B CA  1 
ATOM 4611 C C   . ALA B 1 153 ? -30.426 -74.383 63.877 1.00 20.82 ? 153 ALA B C   1 
ATOM 4612 O O   . ALA B 1 153 ? -29.503 -74.808 64.567 1.00 19.45 ? 153 ALA B O   1 
ATOM 4613 C CB  . ALA B 1 153 ? -31.804 -76.272 62.974 1.00 24.05 ? 153 ALA B CB  1 
ATOM 4614 N N   . LEU B 1 154 ? -30.252 -73.465 62.904 1.00 18.29 ? 154 LEU B N   1 
ATOM 4615 C CA  . LEU B 1 154 ? -28.922 -72.962 62.625 1.00 19.17 ? 154 LEU B CA  1 
ATOM 4616 C C   . LEU B 1 154 ? -28.434 -72.071 63.775 1.00 18.65 ? 154 LEU B C   1 
ATOM 4617 O O   . LEU B 1 154 ? -29.026 -71.037 64.020 1.00 17.85 ? 154 LEU B O   1 
ATOM 4618 C CB  . LEU B 1 154 ? -28.904 -72.168 61.310 1.00 20.95 ? 154 LEU B CB  1 
ATOM 4619 C CG  . LEU B 1 154 ? -27.516 -71.649 60.945 1.00 20.09 ? 154 LEU B CG  1 
ATOM 4620 C CD1 . LEU B 1 154 ? -26.604 -72.773 60.422 1.00 20.00 ? 154 LEU B CD1 1 
ATOM 4621 C CD2 . LEU B 1 154 ? -27.624 -70.464 59.872 1.00 20.53 ? 154 LEU B CD2 1 
ATOM 4622 N N   . LYS B 1 155 ? -27.376 -72.523 64.430 1.00 17.39 ? 155 LYS B N   1 
ATOM 4623 C CA  . LYS B 1 155 ? -26.807 -71.914 65.647 1.00 20.98 ? 155 LYS B CA  1 
ATOM 4624 C C   . LYS B 1 155 ? -25.402 -71.369 65.429 1.00 18.20 ? 155 LYS B C   1 
ATOM 4625 O O   . LYS B 1 155 ? -24.942 -70.505 66.183 1.00 20.10 ? 155 LYS B O   1 
ATOM 4626 C CB  . LYS B 1 155 ? -26.952 -72.927 66.857 1.00 22.51 ? 155 LYS B CB  1 
ATOM 4627 C CG  . LYS B 1 155 ? -28.528 -73.086 67.184 1.00 29.53 ? 155 LYS B CG  1 
ATOM 4628 C CD  . LYS B 1 155 ? -28.912 -74.032 68.300 1.00 42.28 ? 155 LYS B CD  1 
ATOM 4629 C CE  . LYS B 1 155 ? -30.441 -74.022 68.468 1.00 47.19 ? 155 LYS B CE  1 
ATOM 4630 N NZ  . LYS B 1 155 ? -30.881 -75.011 69.600 1.00 52.90 ? 155 LYS B NZ  1 
ATOM 4631 N N   . LYS B 1 156 ? -24.703 -71.780 64.354 1.00 16.11 ? 156 LYS B N   1 
ATOM 4632 C CA  . LYS B 1 156 ? -23.301 -71.405 64.207 1.00 15.43 ? 156 LYS B CA  1 
ATOM 4633 C C   . LYS B 1 156 ? -22.952 -71.383 62.754 1.00 15.76 ? 156 LYS B C   1 
ATOM 4634 O O   . LYS B 1 156 ? -23.368 -72.276 62.009 1.00 17.16 ? 156 LYS B O   1 
ATOM 4635 C CB  . LYS B 1 156 ? -22.386 -72.399 64.940 1.00 14.40 ? 156 LYS B CB  1 
ATOM 4636 C CG  . LYS B 1 156 ? -20.872 -72.187 64.793 1.00 19.95 ? 156 LYS B CG  1 
ATOM 4637 C CD  . LYS B 1 156 ? -20.202 -73.150 65.798 1.00 30.22 ? 156 LYS B CD  1 
ATOM 4638 C CE  . LYS B 1 156 ? -18.769 -73.483 65.383 1.00 32.26 ? 156 LYS B CE  1 
ATOM 4639 N NZ  . LYS B 1 156 ? -18.354 -74.707 66.151 1.00 36.26 ? 156 LYS B NZ  1 
ATOM 4640 N N   . VAL B 1 157 ? -22.191 -70.387 62.380 1.00 14.83 ? 157 VAL B N   1 
ATOM 4641 C CA  . VAL B 1 157 ? -21.601 -70.341 61.057 1.00 14.94 ? 157 VAL B CA  1 
ATOM 4642 C C   . VAL B 1 157 ? -20.098 -70.132 61.182 1.00 15.83 ? 157 VAL B C   1 
ATOM 4643 O O   . VAL B 1 157 ? -19.631 -69.290 61.972 1.00 15.37 ? 157 VAL B O   1 
ATOM 4644 C CB  . VAL B 1 157 ? -22.224 -69.224 60.200 1.00 13.61 ? 157 VAL B CB  1 
ATOM 4645 C CG1 . VAL B 1 157 ? -21.374 -69.002 58.901 1.00 17.41 ? 157 VAL B CG1 1 
ATOM 4646 C CG2 . VAL B 1 157 ? -23.689 -69.589 59.864 1.00 13.86 ? 157 VAL B CG2 1 
ATOM 4647 N N   . THR B 1 158 ? -19.336 -70.884 60.402 1.00 14.65 ? 158 THR B N   1 
ATOM 4648 C CA  . THR B 1 158 ? -17.889 -70.756 60.351 1.00 15.05 ? 158 THR B CA  1 
ATOM 4649 C C   . THR B 1 158 ? -17.548 -70.181 58.960 1.00 14.41 ? 158 THR B C   1 
ATOM 4650 O O   . THR B 1 158 ? -18.101 -70.719 57.931 1.00 17.04 ? 158 THR B O   1 
ATOM 4651 C CB  . THR B 1 158 ? -17.221 -72.171 60.486 1.00 15.92 ? 158 THR B CB  1 
ATOM 4652 O OG1 . THR B 1 158 ? -17.510 -72.672 61.766 1.00 20.82 ? 158 THR B OG1 1 
ATOM 4653 C CG2 . THR B 1 158 ? -15.671 -72.091 60.248 1.00 16.97 ? 158 THR B CG2 1 
ATOM 4654 N N   . LEU B 1 159 ? -16.721 -69.128 58.885 1.00 14.65 ? 159 LEU B N   1 
ATOM 4655 C CA  . LEU B 1 159 ? -16.244 -68.577 57.605 1.00 13.31 ? 159 LEU B CA  1 
ATOM 4656 C C   . LEU B 1 159 ? -14.822 -69.141 57.399 1.00 15.59 ? 159 LEU B C   1 
ATOM 4657 O O   . LEU B 1 159 ? -14.021 -69.062 58.328 1.00 14.36 ? 159 LEU B O   1 
ATOM 4658 C CB  . LEU B 1 159 ? -16.114 -67.032 57.694 1.00 14.33 ? 159 LEU B CB  1 
ATOM 4659 C CG  . LEU B 1 159 ? -17.408 -66.393 58.162 1.00 12.81 ? 159 LEU B CG  1 
ATOM 4660 C CD1 . LEU B 1 159 ? -17.279 -64.833 58.289 1.00 16.33 ? 159 LEU B CD1 1 
ATOM 4661 C CD2 . LEU B 1 159 ? -18.508 -66.686 57.188 1.00 15.45 ? 159 LEU B CD2 1 
ATOM 4662 N N   . LEU B 1 160 ? -14.522 -69.679 56.210 1.00 14.77 ? 160 LEU B N   1 
ATOM 4663 C CA  . LEU B 1 160 ? -13.150 -70.165 55.910 1.00 16.01 ? 160 LEU B CA  1 
ATOM 4664 C C   . LEU B 1 160 ? -12.426 -69.146 55.119 1.00 18.75 ? 160 LEU B C   1 
ATOM 4665 O O   . LEU B 1 160 ? -12.940 -68.640 54.122 1.00 17.51 ? 160 LEU B O   1 
ATOM 4666 C CB  . LEU B 1 160 ? -13.151 -71.517 55.139 1.00 16.18 ? 160 LEU B CB  1 
ATOM 4667 C CG  . LEU B 1 160 ? -13.755 -72.685 55.894 1.00 16.60 ? 160 LEU B CG  1 
ATOM 4668 C CD1 . LEU B 1 160 ? -13.669 -73.900 54.978 1.00 16.09 ? 160 LEU B CD1 1 
ATOM 4669 C CD2 . LEU B 1 160 ? -13.146 -72.939 57.287 1.00 15.90 ? 160 LEU B CD2 1 
ATOM 4670 N N   . ALA B 1 161 ? -11.180 -68.877 55.540 1.00 20.22 ? 161 ALA B N   1 
ATOM 4671 C CA  . ALA B 1 161 ? -10.326 -67.944 54.850 1.00 23.12 ? 161 ALA B CA  1 
ATOM 4672 C C   . ALA B 1 161 ? -8.932  -68.537 54.921 1.00 26.79 ? 161 ALA B C   1 
ATOM 4673 O O   . ALA B 1 161 ? -8.672  -69.420 55.736 1.00 26.96 ? 161 ALA B O   1 
ATOM 4674 C CB  . ALA B 1 161 ? -10.318 -66.517 55.555 1.00 23.07 ? 161 ALA B CB  1 
ATOM 4675 N N   . ASP B 1 162 ? -8.026  -67.995 54.121 1.00 28.25 ? 162 ASP B N   1 
ATOM 4676 C CA  . ASP B 1 162 ? -6.665  -68.470 54.204 1.00 31.68 ? 162 ASP B CA  1 
ATOM 4677 C C   . ASP B 1 162 ? -6.012  -67.937 55.464 1.00 31.93 ? 162 ASP B C   1 
ATOM 4678 O O   . ASP B 1 162 ? -6.505  -66.963 56.096 1.00 30.65 ? 162 ASP B O   1 
ATOM 4679 C CB  . ASP B 1 162 ? -5.897  -68.136 52.948 1.00 32.44 ? 162 ASP B CB  1 
ATOM 4680 C CG  . ASP B 1 162 ? -5.808  -66.644 52.693 1.00 39.72 ? 162 ASP B CG  1 
ATOM 4681 O OD1 . ASP B 1 162 ? -6.412  -65.825 53.454 1.00 45.10 ? 162 ASP B OD1 1 
ATOM 4682 O OD2 . ASP B 1 162 ? -5.092  -66.285 51.733 1.00 46.72 ? 162 ASP B OD2 1 
ATOM 4683 N N   . LYS B 1 163 ? -4.927  -68.592 55.868 1.00 32.20 ? 163 LYS B N   1 
ATOM 4684 C CA  . LYS B 1 163 ? -4.248  -68.266 57.130 1.00 34.03 ? 163 LYS B CA  1 
ATOM 4685 C C   . LYS B 1 163 ? -3.877  -66.782 57.229 1.00 33.36 ? 163 LYS B C   1 
ATOM 4686 O O   . LYS B 1 163 ? -4.088  -66.173 58.296 1.00 34.81 ? 163 LYS B O   1 
ATOM 4687 C CB  . LYS B 1 163 ? -2.971  -69.137 57.234 1.00 35.52 ? 163 LYS B CB  1 
ATOM 4688 C CG  . LYS B 1 163 ? -3.133  -70.431 58.115 1.00 40.17 ? 163 LYS B CG  1 
ATOM 4689 C CD  . LYS B 1 163 ? -2.109  -71.529 57.657 1.00 49.07 ? 163 LYS B CD  1 
ATOM 4690 C CE  . LYS B 1 163 ? -2.614  -72.963 57.943 1.00 51.57 ? 163 LYS B CE  1 
ATOM 4691 N NZ  . LYS B 1 163 ? -2.432  -73.434 59.376 1.00 54.04 ? 163 LYS B NZ  1 
ATOM 4692 N N   . ALA B 1 164 ? -3.378  -66.231 56.108 1.00 32.32 ? 164 ALA B N   1 
ATOM 4693 C CA  . ALA B 1 164 ? -2.980  -64.817 55.955 1.00 32.50 ? 164 ALA B CA  1 
ATOM 4694 C C   . ALA B 1 164 ? -4.087  -63.800 56.188 1.00 32.47 ? 164 ALA B C   1 
ATOM 4695 O O   . ALA B 1 164 ? -3.833  -62.719 56.758 1.00 32.64 ? 164 ALA B O   1 
ATOM 4696 C CB  . ALA B 1 164 ? -2.392  -64.569 54.555 1.00 34.05 ? 164 ALA B CB  1 
ATOM 4697 N N   . GLY B 1 165 ? -5.297  -64.128 55.748 1.00 30.44 ? 165 GLY B N   1 
ATOM 4698 C CA  . GLY B 1 165 ? -6.395  -63.178 55.951 1.00 28.42 ? 165 GLY B CA  1 
ATOM 4699 C C   . GLY B 1 165 ? -7.206  -63.381 57.222 1.00 27.66 ? 165 GLY B C   1 
ATOM 4700 O O   . GLY B 1 165 ? -8.118  -62.595 57.491 1.00 26.38 ? 165 GLY B O   1 
ATOM 4701 N N   . GLN B 1 166 ? -6.902  -64.384 58.040 1.00 25.17 ? 166 GLN B N   1 
ATOM 4702 C CA  . GLN B 1 166 ? -7.772  -64.789 59.131 1.00 25.63 ? 166 GLN B CA  1 
ATOM 4703 C C   . GLN B 1 166 ? -8.005  -63.675 60.139 1.00 24.53 ? 166 GLN B C   1 
ATOM 4704 O O   . GLN B 1 166 ? -9.151  -63.454 60.580 1.00 21.94 ? 166 GLN B O   1 
ATOM 4705 C CB  . GLN B 1 166 ? -7.234  -66.014 59.891 1.00 27.90 ? 166 GLN B CB  1 
ATOM 4706 C CG  . GLN B 1 166 ? -8.120  -66.461 61.017 1.00 29.87 ? 166 GLN B CG  1 
ATOM 4707 C CD  . GLN B 1 166 ? -7.849  -67.873 61.423 1.00 36.97 ? 166 GLN B CD  1 
ATOM 4708 O OE1 . GLN B 1 166 ? -6.965  -68.536 60.842 1.00 38.58 ? 166 GLN B OE1 1 
ATOM 4709 N NE2 . GLN B 1 166 ? -8.561  -68.338 62.439 1.00 38.30 ? 166 GLN B NE2 1 
ATOM 4710 N N   . ALA B 1 167 ? -6.945  -62.976 60.532 1.00 21.29 ? 167 ALA B N   1 
ATOM 4711 C CA  . ALA B 1 167 ? -7.112  -61.947 61.556 1.00 21.78 ? 167 ALA B CA  1 
ATOM 4712 C C   . ALA B 1 167 ? -8.028  -60.792 61.024 1.00 19.73 ? 167 ALA B C   1 
ATOM 4713 O O   . ALA B 1 167 ? -8.813  -60.233 61.802 1.00 19.48 ? 167 ALA B O   1 
ATOM 4714 C CB  . ALA B 1 167 ? -5.740  -61.355 61.940 1.00 24.92 ? 167 ALA B CB  1 
ATOM 4715 N N   . GLU B 1 168 ? -7.912  -60.467 59.753 1.00 19.09 ? 168 GLU B N   1 
ATOM 4716 C CA  . GLU B 1 168 ? -8.709  -59.378 59.137 1.00 19.02 ? 168 GLU B CA  1 
ATOM 4717 C C   . GLU B 1 168 ? -10.147 -59.850 58.988 1.00 18.42 ? 168 GLU B C   1 
ATOM 4718 O O   . GLU B 1 168 ? -11.086 -59.018 59.234 1.00 16.38 ? 168 GLU B O   1 
ATOM 4719 C CB  . GLU B 1 168 ? -8.110  -58.950 57.792 1.00 18.43 ? 168 GLU B CB  1 
ATOM 4720 C CG  . GLU B 1 168 ? -6.651  -58.289 57.936 1.00 21.40 ? 168 GLU B CG  1 
ATOM 4721 C CD  . GLU B 1 168 ? -6.684  -57.076 58.849 1.00 21.62 ? 168 GLU B CD  1 
ATOM 4722 O OE1 . GLU B 1 168 ? -7.682  -56.276 58.764 1.00 23.82 ? 168 GLU B OE1 1 
ATOM 4723 O OE2 . GLU B 1 168 ? -5.706  -56.975 59.649 1.00 23.38 ? 168 GLU B OE2 1 
ATOM 4724 N N   . VAL B 1 169 ? -10.387 -61.128 58.654 1.00 17.38 ? 169 VAL B N   1 
ATOM 4725 C CA  . VAL B 1 169 ? -11.817 -61.583 58.676 1.00 16.43 ? 169 VAL B CA  1 
ATOM 4726 C C   . VAL B 1 169 ? -12.349 -61.536 60.094 1.00 16.78 ? 169 VAL B C   1 
ATOM 4727 O O   . VAL B 1 169 ? -13.529 -61.158 60.293 1.00 14.58 ? 169 VAL B O   1 
ATOM 4728 C CB  . VAL B 1 169 ? -11.974 -63.007 58.060 1.00 16.37 ? 169 VAL B CB  1 
ATOM 4729 C CG1 . VAL B 1 169 ? -13.436 -63.476 58.145 1.00 17.22 ? 169 VAL B CG1 1 
ATOM 4730 C CG2 . VAL B 1 169 ? -11.436 -62.958 56.624 1.00 17.09 ? 169 VAL B CG2 1 
ATOM 4731 N N   . GLU B 1 170 ? -11.558 -61.873 61.110 1.00 15.93 ? 170 GLU B N   1 
ATOM 4732 C CA  . GLU B 1 170 ? -12.001 -61.834 62.493 1.00 15.69 ? 170 GLU B CA  1 
ATOM 4733 C C   . GLU B 1 170 ? -12.305 -60.388 62.881 1.00 15.18 ? 170 GLU B C   1 
ATOM 4734 O O   . GLU B 1 170 ? -13.263 -60.207 63.613 1.00 12.06 ? 170 GLU B O   1 
ATOM 4735 C CB  . GLU B 1 170 ? -10.966 -62.522 63.482 1.00 18.48 ? 170 GLU B CB  1 
ATOM 4736 C CG  . GLU B 1 170 ? -10.930 -64.060 63.167 1.00 19.79 ? 170 GLU B CG  1 
ATOM 4737 C CD  . GLU B 1 170 ? -10.030 -64.819 64.114 1.00 28.34 ? 170 GLU B CD  1 
ATOM 4738 O OE1 . GLU B 1 170 ? -9.087  -64.206 64.577 1.00 27.78 ? 170 GLU B OE1 1 
ATOM 4739 O OE2 . GLU B 1 170 ? -10.295 -66.028 64.388 1.00 28.43 ? 170 GLU B OE2 1 
ATOM 4740 N N   . ARG B 1 171 ? -11.500 -59.434 62.447 1.00 15.00 ? 171 ARG B N   1 
ATOM 4741 C CA  . ARG B 1 171 ? -11.752 -58.028 62.815 1.00 13.05 ? 171 ARG B CA  1 
ATOM 4742 C C   . ARG B 1 171 ? -13.088 -57.590 62.115 1.00 14.69 ? 171 ARG B C   1 
ATOM 4743 O O   . ARG B 1 171 ? -13.897 -56.880 62.740 1.00 13.85 ? 171 ARG B O   1 
ATOM 4744 C CB  . ARG B 1 171 ? -10.605 -57.165 62.342 1.00 14.42 ? 171 ARG B CB  1 
ATOM 4745 C CG  . ARG B 1 171 ? -10.763 -55.719 62.842 1.00 14.69 ? 171 ARG B CG  1 
ATOM 4746 C CD  . ARG B 1 171 ? -9.464  -54.830 62.570 1.00 20.58 ? 171 ARG B CD  1 
ATOM 4747 N NE  . ARG B 1 171 ? -9.207  -54.611 61.150 1.00 19.60 ? 171 ARG B NE  1 
ATOM 4748 C CZ  . ARG B 1 171 ? -9.576  -53.522 60.493 1.00 19.64 ? 171 ARG B CZ  1 
ATOM 4749 N NH1 . ARG B 1 171 ? -10.197 -52.527 61.150 1.00 23.05 ? 171 ARG B NH1 1 
ATOM 4750 N NH2 . ARG B 1 171 ? -9.351  -53.427 59.175 1.00 17.42 ? 171 ARG B NH2 1 
ATOM 4751 N N   . ALA B 1 172 ? -13.316 -58.021 60.859 1.00 12.80 ? 172 ALA B N   1 
ATOM 4752 C CA  . ALA B 1 172 ? -14.649 -57.718 60.135 1.00 11.09 ? 172 ALA B CA  1 
ATOM 4753 C C   . ALA B 1 172 ? -15.773 -58.333 60.954 1.00 11.55 ? 172 ALA B C   1 
ATOM 4754 O O   . ALA B 1 172 ? -16.832 -57.691 61.182 1.00 11.55 ? 172 ALA B O   1 
ATOM 4755 C CB  . ALA B 1 172 ? -14.627 -58.266 58.765 1.00 11.20 ? 172 ALA B CB  1 
ATOM 4756 N N   . VAL B 1 173 ? -15.669 -59.594 61.392 1.00 11.06 ? 173 VAL B N   1 
ATOM 4757 C CA  . VAL B 1 173 ? -16.748 -60.227 62.226 1.00 11.44 ? 173 VAL B CA  1 
ATOM 4758 C C   . VAL B 1 173 ? -16.948 -59.491 63.547 1.00 12.96 ? 173 VAL B C   1 
ATOM 4759 O O   . VAL B 1 173 ? -18.086 -59.254 63.921 1.00 12.49 ? 173 VAL B O   1 
ATOM 4760 C CB  . VAL B 1 173 ? -16.420 -61.692 62.471 1.00 9.93  ? 173 VAL B CB  1 
ATOM 4761 C CG1 . VAL B 1 173 ? -17.313 -62.290 63.587 1.00 13.65 ? 173 VAL B CG1 1 
ATOM 4762 C CG2 . VAL B 1 173 ? -16.495 -62.454 61.103 1.00 12.45 ? 173 VAL B CG2 1 
ATOM 4763 N N   . LYS B 1 174 ? -15.841 -59.041 64.222 1.00 11.99 ? 174 LYS B N   1 
ATOM 4764 C CA  . LYS B 1 174 ? -16.009 -58.254 65.449 1.00 11.89 ? 174 LYS B CA  1 
ATOM 4765 C C   . LYS B 1 174 ? -16.833 -56.966 65.238 1.00 10.68 ? 174 LYS B C   1 
ATOM 4766 O O   . LYS B 1 174 ? -17.808 -56.675 65.969 1.00 12.96 ? 174 LYS B O   1 
ATOM 4767 C CB  . LYS B 1 174 ? -14.573 -57.899 66.043 1.00 12.49 ? 174 LYS B CB  1 
ATOM 4768 C CG  . LYS B 1 174 ? -14.671 -57.175 67.323 1.00 12.70 ? 174 LYS B CG  1 
ATOM 4769 C CD  . LYS B 1 174 ? -13.192 -56.772 67.676 1.00 18.26 ? 174 LYS B CD  1 
ATOM 4770 C CE  . LYS B 1 174 ? -13.077 -55.776 68.861 1.00 28.33 ? 174 LYS B CE  1 
ATOM 4771 N NZ  . LYS B 1 174 ? -13.566 -56.357 70.116 1.00 32.03 ? 174 LYS B NZ  1 
ATOM 4772 N N   . HIS B 1 175 ? -16.465 -56.237 64.191 1.00 11.68 ? 175 HIS B N   1 
ATOM 4773 C CA  . HIS B 1 175 ? -17.129 -54.946 63.880 1.00 11.25 ? 175 HIS B CA  1 
ATOM 4774 C C   . HIS B 1 175 ? -18.571 -55.212 63.410 1.00 11.82 ? 175 HIS B C   1 
ATOM 4775 O O   . HIS B 1 175 ? -19.509 -54.529 63.872 1.00 11.04 ? 175 HIS B O   1 
ATOM 4776 C CB  . HIS B 1 175 ? -16.339 -54.229 62.861 1.00 10.49 ? 175 HIS B CB  1 
ATOM 4777 C CG  . HIS B 1 175 ? -15.048 -53.718 63.432 1.00 11.51 ? 175 HIS B CG  1 
ATOM 4778 N ND1 . HIS B 1 175 ? -14.062 -53.170 62.653 1.00 11.40 ? 175 HIS B ND1 1 
ATOM 4779 C CD2 . HIS B 1 175 ? -14.584 -53.759 64.699 1.00 13.30 ? 175 HIS B CD2 1 
ATOM 4780 C CE1 . HIS B 1 175 ? -13.055 -52.808 63.450 1.00 12.12 ? 175 HIS B CE1 1 
ATOM 4781 N NE2 . HIS B 1 175 ? -13.329 -53.161 64.687 1.00 13.01 ? 175 HIS B NE2 1 
ATOM 4782 N N   . ALA B 1 176 ? -18.737 -56.160 62.462 1.00 10.44 ? 176 ALA B N   1 
ATOM 4783 C CA  . ALA B 1 176 ? -20.132 -56.452 61.976 1.00 9.70  ? 176 ALA B CA  1 
ATOM 4784 C C   . ALA B 1 176 ? -20.994 -56.902 63.164 1.00 10.91 ? 176 ALA B C   1 
ATOM 4785 O O   . ALA B 1 176 ? -22.232 -56.660 63.184 1.00 10.00 ? 176 ALA B O   1 
ATOM 4786 C CB  . ALA B 1 176 ? -20.076 -57.566 60.874 1.00 10.55 ? 176 ALA B CB  1 
ATOM 4787 N N   . SER B 1 177 ? -20.468 -57.702 64.098 1.00 9.94  ? 177 SER B N   1 
ATOM 4788 C CA  . SER B 1 177 ? -21.306 -58.244 65.184 1.00 9.27  ? 177 SER B CA  1 
ATOM 4789 C C   . SER B 1 177 ? -21.776 -57.088 66.071 1.00 10.66 ? 177 SER B C   1 
ATOM 4790 O O   . SER B 1 177 ? -22.945 -57.093 66.474 1.00 10.75 ? 177 SER B O   1 
ATOM 4791 C CB  . SER B 1 177 ? -20.576 -59.279 66.041 1.00 12.88 ? 177 SER B CB  1 
ATOM 4792 O OG  . SER B 1 177 ? -20.275 -60.383 65.180 1.00 20.02 ? 177 SER B OG  1 
ATOM 4793 N N   . ALA B 1 178 ? -20.901 -56.136 66.349 1.00 9.33  ? 178 ALA B N   1 
ATOM 4794 C CA  . ALA B 1 178 ? -21.325 -54.997 67.155 1.00 8.15  ? 178 ALA B CA  1 
ATOM 4795 C C   . ALA B 1 178 ? -22.376 -54.185 66.404 1.00 9.10  ? 178 ALA B C   1 
ATOM 4796 O O   . ALA B 1 178 ? -23.391 -53.763 67.027 1.00 9.54  ? 178 ALA B O   1 
ATOM 4797 C CB  . ALA B 1 178 ? -20.119 -54.046 67.535 1.00 8.39  ? 178 ALA B CB  1 
ATOM 4798 N N   . ILE B 1 179 ? -22.113 -53.943 65.133 1.00 9.20  ? 179 ILE B N   1 
ATOM 4799 C CA  . ILE B 1 179 ? -23.118 -53.202 64.331 1.00 7.81  ? 179 ILE B CA  1 
ATOM 4800 C C   . ILE B 1 179 ? -24.480 -53.922 64.298 1.00 9.52  ? 179 ILE B C   1 
ATOM 4801 O O   . ILE B 1 179 ? -25.542 -53.291 64.548 1.00 8.44  ? 179 ILE B O   1 
ATOM 4802 C CB  . ILE B 1 179 ? -22.575 -52.947 62.929 1.00 7.72  ? 179 ILE B CB  1 
ATOM 4803 C CG1 . ILE B 1 179 ? -21.425 -51.911 62.986 1.00 11.21 ? 179 ILE B CG1 1 
ATOM 4804 C CG2 . ILE B 1 179 ? -23.669 -52.385 61.952 1.00 10.28 ? 179 ILE B CG2 1 
ATOM 4805 C CD1 . ILE B 1 179 ? -20.513 -51.861 61.719 1.00 10.26 ? 179 ILE B CD1 1 
ATOM 4806 N N   . ALA B 1 180 ? -24.427 -55.250 64.029 1.00 8.81  ? 180 ALA B N   1 
ATOM 4807 C CA  . ALA B 1 180 ? -25.703 -55.967 63.971 1.00 8.61  ? 180 ALA B CA  1 
ATOM 4808 C C   . ALA B 1 180 ? -26.390 -56.004 65.318 1.00 8.52  ? 180 ALA B C   1 
ATOM 4809 O O   . ALA B 1 180 ? -27.682 -55.960 65.331 1.00 9.78  ? 180 ALA B O   1 
ATOM 4810 C CB  . ALA B 1 180 ? -25.503 -57.417 63.414 1.00 11.61 ? 180 ALA B CB  1 
ATOM 4811 N N   . THR B 1 181 ? -25.685 -56.116 66.461 1.00 9.60  ? 181 THR B N   1 
ATOM 4812 C CA  . THR B 1 181 ? -26.338 -56.129 67.763 1.00 8.94  ? 181 THR B CA  1 
ATOM 4813 C C   . THR B 1 181 ? -26.935 -54.710 67.979 1.00 7.87  ? 181 THR B C   1 
ATOM 4814 O O   . THR B 1 181 ? -28.066 -54.596 68.488 1.00 9.33  ? 181 THR B O   1 
ATOM 4815 C CB  . THR B 1 181 ? -25.295 -56.457 68.825 1.00 11.88 ? 181 THR B CB  1 
ATOM 4816 O OG1 . THR B 1 181 ? -24.903 -57.839 68.603 1.00 14.82 ? 181 THR B OG1 1 
ATOM 4817 C CG2 . THR B 1 181 ? -25.823 -56.200 70.288 1.00 15.51 ? 181 THR B CG2 1 
ATOM 4818 N N   . GLY B 1 182 ? -26.224 -53.643 67.647 1.00 7.88  ? 182 GLY B N   1 
ATOM 4819 C CA  . GLY B 1 182 ? -26.824 -52.288 67.725 1.00 8.31  ? 182 GLY B CA  1 
ATOM 4820 C C   . GLY B 1 182 ? -28.055 -52.151 66.838 1.00 7.94  ? 182 GLY B C   1 
ATOM 4821 O O   . GLY B 1 182 ? -29.087 -51.604 67.275 1.00 8.11  ? 182 GLY B O   1 
ATOM 4822 N N   . MET B 1 183 ? -27.987 -52.656 65.623 1.00 7.56  ? 183 MET B N   1 
ATOM 4823 C CA  . MET B 1 183 ? -29.155 -52.585 64.708 1.00 7.82  ? 183 MET B CA  1 
ATOM 4824 C C   . MET B 1 183 ? -30.308 -53.364 65.263 1.00 7.20  ? 183 MET B C   1 
ATOM 4825 O O   . MET B 1 183 ? -31.467 -52.897 65.115 1.00 7.63  ? 183 MET B O   1 
ATOM 4826 C CB  . MET B 1 183 ? -28.833 -53.200 63.340 1.00 8.35  ? 183 MET B CB  1 
ATOM 4827 C CG  . MET B 1 183 ? -27.859 -52.338 62.531 1.00 8.68  ? 183 MET B CG  1 
ATOM 4828 S SD  . MET B 1 183 ? -27.291 -53.108 60.998 1.00 10.76 ? 183 MET B SD  1 
ATOM 4829 C CE  . MET B 1 183 ? -28.819 -52.964 59.976 1.00 12.18 ? 183 MET B CE  1 
ATOM 4830 N N   . ALA B 1 184 ? -30.111 -54.504 65.939 1.00 7.45  ? 184 ALA B N   1 
ATOM 4831 C CA  . ALA B 1 184 ? -31.262 -55.215 66.509 1.00 6.21  ? 184 ALA B CA  1 
ATOM 4832 C C   . ALA B 1 184 ? -31.988 -54.397 67.590 1.00 6.88  ? 184 ALA B C   1 
ATOM 4833 O O   . ALA B 1 184 ? -33.203 -54.440 67.681 1.00 8.19  ? 184 ALA B O   1 
ATOM 4834 C CB  . ALA B 1 184 ? -30.769 -56.589 67.070 1.00 9.28  ? 184 ALA B CB  1 
ATOM 4835 N N   . PHE B 1 185 ? -31.246 -53.668 68.436 1.00 7.31  ? 185 PHE B N   1 
ATOM 4836 C CA  . PHE B 1 185 ? -31.758 -52.853 69.461 1.00 8.37  ? 185 PHE B CA  1 
ATOM 4837 C C   . PHE B 1 185 ? -32.539 -51.727 68.808 1.00 7.16  ? 185 PHE B C   1 
ATOM 4838 O O   . PHE B 1 185 ? -33.669 -51.519 69.165 1.00 6.88  ? 185 PHE B O   1 
ATOM 4839 C CB  . PHE B 1 185 ? -30.557 -52.334 70.250 1.00 7.78  ? 185 PHE B CB  1 
ATOM 4840 C CG  . PHE B 1 185 ? -30.904 -51.378 71.356 1.00 8.26  ? 185 PHE B CG  1 
ATOM 4841 C CD1 . PHE B 1 185 ? -31.379 -51.693 72.626 1.00 9.23  ? 185 PHE B CD1 1 
ATOM 4842 C CD2 . PHE B 1 185 ? -30.670 -50.012 71.077 1.00 9.58  ? 185 PHE B CD2 1 
ATOM 4843 C CE1 . PHE B 1 185 ? -31.605 -50.628 73.687 1.00 11.05 ? 185 PHE B CE1 1 
ATOM 4844 C CE2 . PHE B 1 185 ? -30.886 -49.009 72.034 1.00 11.30 ? 185 PHE B CE2 1 
ATOM 4845 C CZ  . PHE B 1 185 ? -31.372 -49.306 73.371 1.00 11.29 ? 185 PHE B CZ  1 
ATOM 4846 N N   . THR B 1 186 ? -31.955 -51.091 67.779 1.00 7.12  ? 186 THR B N   1 
ATOM 4847 C CA  . THR B 1 186 ? -32.640 -49.995 67.031 1.00 7.02  ? 186 THR B CA  1 
ATOM 4848 C C   . THR B 1 186 ? -33.969 -50.521 66.458 1.00 6.89  ? 186 THR B C   1 
ATOM 4849 O O   . THR B 1 186 ? -35.003 -49.831 66.533 1.00 8.19  ? 186 THR B O   1 
ATOM 4850 C CB  . THR B 1 186 ? -31.732 -49.530 65.898 1.00 6.50  ? 186 THR B CB  1 
ATOM 4851 O OG1 . THR B 1 186 ? -30.609 -48.908 66.549 1.00 8.21  ? 186 THR B OG1 1 
ATOM 4852 C CG2 . THR B 1 186 ? -32.392 -48.506 65.043 1.00 7.42  ? 186 THR B CG2 1 
ATOM 4853 N N   . ARG B 1 187 ? -33.869 -51.720 65.800 1.00 7.38  ? 187 ARG B N   1 
ATOM 4854 C CA  . ARG B 1 187 ? -35.068 -52.170 65.146 1.00 5.90  ? 187 ARG B CA  1 
ATOM 4855 C C   . ARG B 1 187 ? -36.111 -52.550 66.157 1.00 7.69  ? 187 ARG B C   1 
ATOM 4856 O O   . ARG B 1 187 ? -37.324 -52.292 65.869 1.00 7.98  ? 187 ARG B O   1 
ATOM 4857 C CB  . ARG B 1 187 ? -34.724 -53.419 64.257 1.00 7.11  ? 187 ARG B CB  1 
ATOM 4858 C CG  . ARG B 1 187 ? -33.823 -53.039 62.980 1.00 7.34  ? 187 ARG B CG  1 
ATOM 4859 C CD  . ARG B 1 187 ? -33.210 -54.242 62.302 1.00 7.25  ? 187 ARG B CD  1 
ATOM 4860 N NE  . ARG B 1 187 ? -34.310 -54.859 61.563 1.00 10.24 ? 187 ARG B NE  1 
ATOM 4861 C CZ  . ARG B 1 187 ? -34.191 -55.978 60.800 1.00 11.38 ? 187 ARG B CZ  1 
ATOM 4862 N NH1 . ARG B 1 187 ? -33.009 -56.577 60.707 1.00 14.39 ? 187 ARG B NH1 1 
ATOM 4863 N NH2 . ARG B 1 187 ? -35.270 -56.496 60.130 1.00 13.55 ? 187 ARG B NH2 1 
ATOM 4864 N N   . ASP B 1 188 ? -35.768 -53.162 67.289 1.00 7.54  ? 188 ASP B N   1 
ATOM 4865 C CA  . ASP B 1 188 ? -36.813 -53.511 68.234 1.00 7.71  ? 188 ASP B CA  1 
ATOM 4866 C C   . ASP B 1 188 ? -37.497 -52.183 68.714 1.00 8.48  ? 188 ASP B C   1 
ATOM 4867 O O   . ASP B 1 188 ? -38.735 -52.135 68.856 1.00 9.43  ? 188 ASP B O   1 
ATOM 4868 C CB  . ASP B 1 188 ? -36.122 -54.093 69.467 1.00 7.33  ? 188 ASP B CB  1 
ATOM 4869 C CG  . ASP B 1 188 ? -35.744 -55.550 69.295 1.00 9.89  ? 188 ASP B CG  1 
ATOM 4870 O OD1 . ASP B 1 188 ? -36.168 -56.193 68.328 1.00 11.36 ? 188 ASP B OD1 1 
ATOM 4871 O OD2 . ASP B 1 188 ? -35.082 -56.050 70.240 1.00 12.45 ? 188 ASP B OD2 1 
ATOM 4872 N N   . LEU B 1 189 ? -36.703 -51.128 69.045 1.00 8.02  ? 189 LEU B N   1 
ATOM 4873 C CA  . LEU B 1 189 ? -37.305 -49.897 69.542 1.00 7.74  ? 189 LEU B CA  1 
ATOM 4874 C C   . LEU B 1 189 ? -38.219 -49.248 68.467 1.00 8.76  ? 189 LEU B C   1 
ATOM 4875 O O   . LEU B 1 189 ? -39.346 -48.801 68.778 1.00 8.32  ? 189 LEU B O   1 
ATOM 4876 C CB  . LEU B 1 189 ? -36.229 -48.895 69.991 1.00 7.83  ? 189 LEU B CB  1 
ATOM 4877 C CG  . LEU B 1 189 ? -35.359 -49.362 71.188 1.00 8.26  ? 189 LEU B CG  1 
ATOM 4878 C CD1 . LEU B 1 189 ? -34.199 -48.339 71.362 1.00 8.36  ? 189 LEU B CD1 1 
ATOM 4879 C CD2 . LEU B 1 189 ? -36.195 -49.502 72.480 1.00 9.96  ? 189 LEU B CD2 1 
ATOM 4880 N N   . GLY B 1 190 ? -37.794 -49.303 67.201 1.00 6.87  ? 190 GLY B N   1 
ATOM 4881 C CA  . GLY B 1 190 ? -38.672 -48.765 66.142 1.00 6.97  ? 190 GLY B CA  1 
ATOM 4882 C C   . GLY B 1 190 ? -39.907 -49.578 65.932 1.00 7.48  ? 190 GLY B C   1 
ATOM 4883 O O   . GLY B 1 190 ? -40.977 -49.036 65.722 1.00 7.69  ? 190 GLY B O   1 
ATOM 4884 N N   . ASN B 1 191 ? -39.723 -50.887 65.969 1.00 6.53  ? 191 ASN B N   1 
ATOM 4885 C CA  . ASN B 1 191 ? -40.942 -51.728 65.647 1.00 7.12  ? 191 ASN B CA  1 
ATOM 4886 C C   . ASN B 1 191 ? -41.936 -51.755 66.818 1.00 6.97  ? 191 ASN B C   1 
ATOM 4887 O O   . ASN B 1 191 ? -43.089 -52.078 66.602 1.00 7.11  ? 191 ASN B O   1 
ATOM 4888 C CB  . ASN B 1 191 ? -40.468 -53.140 65.429 1.00 6.76  ? 191 ASN B CB  1 
ATOM 4889 C CG  . ASN B 1 191 ? -39.808 -53.305 64.074 1.00 5.94  ? 191 ASN B CG  1 
ATOM 4890 O OD1 . ASN B 1 191 ? -40.135 -52.597 63.114 1.00 7.68  ? 191 ASN B OD1 1 
ATOM 4891 N ND2 . ASN B 1 191 ? -38.849 -54.184 63.988 1.00 6.60  ? 191 ASN B ND2 1 
ATOM 4892 N N   . LEU B 1 192 ? -41.529 -51.463 68.083 1.00 6.48  ? 192 LEU B N   1 
ATOM 4893 C CA  . LEU B 1 192 ? -42.485 -51.416 69.216 1.00 6.24  ? 192 LEU B CA  1 
ATOM 4894 C C   . LEU B 1 192 ? -43.572 -50.440 68.926 1.00 7.01  ? 192 LEU B C   1 
ATOM 4895 O O   . LEU B 1 192 ? -43.331 -49.313 68.421 1.00 6.96  ? 192 LEU B O   1 
ATOM 4896 C CB  . LEU B 1 192 ? -41.754 -51.057 70.518 1.00 7.11  ? 192 LEU B CB  1 
ATOM 4897 C CG  . LEU B 1 192 ? -40.936 -52.177 71.111 1.00 10.61 ? 192 LEU B CG  1 
ATOM 4898 C CD1 . LEU B 1 192 ? -40.120 -51.602 72.238 1.00 12.01 ? 192 LEU B CD1 1 
ATOM 4899 C CD2 . LEU B 1 192 ? -41.936 -53.235 71.760 1.00 9.14  ? 192 LEU B CD2 1 
ATOM 4900 N N   . PRO B 1 193 ? -44.803 -50.834 69.272 1.00 6.52  ? 193 PRO B N   1 
ATOM 4901 C CA  . PRO B 1 193 ? -45.939 -49.956 68.961 1.00 6.93  ? 193 PRO B CA  1 
ATOM 4902 C C   . PRO B 1 193 ? -45.960 -48.727 69.906 1.00 5.41  ? 193 PRO B C   1 
ATOM 4903 O O   . PRO B 1 193 ? -45.444 -48.801 71.066 1.00 6.99  ? 193 PRO B O   1 
ATOM 4904 C CB  . PRO B 1 193 ? -47.142 -50.881 69.223 1.00 7.20  ? 193 PRO B CB  1 
ATOM 4905 C CG  . PRO B 1 193 ? -46.632 -51.844 70.340 1.00 7.30  ? 193 PRO B CG  1 
ATOM 4906 C CD  . PRO B 1 193 ? -45.184 -51.299 70.540 1.00 8.67  ? 193 PRO B CD  1 
ATOM 4907 N N   . PRO B 1 194 ? -46.612 -47.649 69.529 1.00 6.97  ? 194 PRO B N   1 
ATOM 4908 C CA  . PRO B 1 194 ? -46.464 -46.384 70.293 1.00 6.19  ? 194 PRO B CA  1 
ATOM 4909 C C   . PRO B 1 194 ? -47.183 -46.333 71.582 1.00 7.13  ? 194 PRO B C   1 
ATOM 4910 O O   . PRO B 1 194 ? -46.871 -45.448 72.405 1.00 8.50  ? 194 PRO B O   1 
ATOM 4911 C CB  . PRO B 1 194 ? -46.894 -45.318 69.250 1.00 6.67  ? 194 PRO B CB  1 
ATOM 4912 C CG  . PRO B 1 194 ? -47.889 -46.077 68.290 1.00 6.92  ? 194 PRO B CG  1 
ATOM 4913 C CD  . PRO B 1 194 ? -47.288 -47.476 68.200 1.00 7.09  ? 194 PRO B CD  1 
ATOM 4914 N N   . ASN B 1 195 ? -48.163 -47.212 71.792 1.00 6.25  ? 195 ASN B N   1 
ATOM 4915 C CA  . ASN B 1 195 ? -48.783 -47.251 73.120 1.00 6.10  ? 195 ASN B CA  1 
ATOM 4916 C C   . ASN B 1 195 ? -47.852 -47.841 74.155 1.00 7.16  ? 195 ASN B C   1 
ATOM 4917 O O   . ASN B 1 195 ? -48.085 -47.581 75.354 1.00 11.04 ? 195 ASN B O   1 
ATOM 4918 C CB  . ASN B 1 195 ? -50.106 -48.094 73.042 1.00 6.35  ? 195 ASN B CB  1 
ATOM 4919 C CG  . ASN B 1 195 ? -49.929 -49.577 72.686 1.00 6.07  ? 195 ASN B CG  1 
ATOM 4920 O OD1 . ASN B 1 195 ? -48.852 -50.233 73.106 1.00 12.15 ? 195 ASN B OD1 1 
ATOM 4921 N ND2 . ASN B 1 195 ? -50.807 -50.192 72.034 1.00 4.53  ? 195 ASN B ND2 1 
ATOM 4922 N N   . LEU B 1 196 ? -46.809 -48.537 73.713 1.00 6.61  ? 196 LEU B N   1 
ATOM 4923 C CA  . LEU B 1 196 ? -45.783 -49.083 74.688 1.00 6.95  ? 196 LEU B CA  1 
ATOM 4924 C C   . LEU B 1 196 ? -44.529 -48.275 74.598 1.00 6.65  ? 196 LEU B C   1 
ATOM 4925 O O   . LEU B 1 196 ? -43.884 -47.952 75.615 1.00 10.53 ? 196 LEU B O   1 
ATOM 4926 C CB  . LEU B 1 196 ? -45.479 -50.532 74.275 1.00 8.55  ? 196 LEU B CB  1 
ATOM 4927 C CG  . LEU B 1 196 ? -46.669 -51.437 74.446 1.00 11.39 ? 196 LEU B CG  1 
ATOM 4928 C CD1 . LEU B 1 196 ? -46.263 -52.880 74.043 1.00 15.86 ? 196 LEU B CD1 1 
ATOM 4929 C CD2 . LEU B 1 196 ? -47.363 -51.324 75.805 1.00 17.44 ? 196 LEU B CD2 1 
ATOM 4930 N N   . CYS B 1 197 ? -44.071 -47.878 73.400 1.00 6.95  ? 197 CYS B N   1 
ATOM 4931 C CA  . CYS B 1 197 ? -42.811 -47.170 73.227 1.00 7.28  ? 197 CYS B CA  1 
ATOM 4932 C C   . CYS B 1 197 ? -43.097 -45.671 73.172 1.00 8.71  ? 197 CYS B C   1 
ATOM 4933 O O   . CYS B 1 197 ? -43.322 -45.099 72.147 1.00 10.97 ? 197 CYS B O   1 
ATOM 4934 C CB  . CYS B 1 197 ? -42.225 -47.668 71.946 1.00 7.03  ? 197 CYS B CB  1 
ATOM 4935 S SG  . CYS B 1 197 ? -40.550 -46.829 71.638 1.00 11.94 ? 197 CYS B SG  1 
ATOM 4936 N N   . HIS B 1 198 ? -43.157 -45.080 74.364 1.00 8.06  ? 198 HIS B N   1 
ATOM 4937 C CA  . HIS B 1 198 ? -43.377 -43.632 74.549 1.00 7.42  ? 198 HIS B CA  1 
ATOM 4938 C C   . HIS B 1 198 ? -42.117 -43.049 75.216 1.00 6.15  ? 198 HIS B C   1 
ATOM 4939 O O   . HIS B 1 198 ? -41.173 -43.780 75.544 1.00 6.75  ? 198 HIS B O   1 
ATOM 4940 C CB  . HIS B 1 198 ? -44.669 -43.389 75.385 1.00 6.45  ? 198 HIS B CB  1 
ATOM 4941 C CG  . HIS B 1 198 ? -44.608 -44.012 76.751 1.00 7.65  ? 198 HIS B CG  1 
ATOM 4942 N ND1 . HIS B 1 198 ? -44.736 -45.367 77.044 1.00 12.55 ? 198 HIS B ND1 1 
ATOM 4943 C CD2 . HIS B 1 198 ? -44.333 -43.399 77.899 1.00 5.59  ? 198 HIS B CD2 1 
ATOM 4944 C CE1 . HIS B 1 198 ? -44.549 -45.535 78.380 1.00 9.12  ? 198 HIS B CE1 1 
ATOM 4945 N NE2 . HIS B 1 198 ? -44.357 -44.325 78.896 1.00 11.80 ? 198 HIS B NE2 1 
ATOM 4946 N N   . PRO B 1 199 ? -42.048 -41.742 75.442 1.00 6.25  ? 199 PRO B N   1 
ATOM 4947 C CA  . PRO B 1 199 ? -40.787 -41.169 75.935 1.00 7.45  ? 199 PRO B CA  1 
ATOM 4948 C C   . PRO B 1 199 ? -40.346 -41.738 77.284 1.00 6.93  ? 199 PRO B C   1 
ATOM 4949 O O   . PRO B 1 199 ? -39.191 -42.014 77.463 1.00 8.09  ? 199 PRO B O   1 
ATOM 4950 C CB  . PRO B 1 199 ? -41.147 -39.653 76.054 1.00 6.33  ? 199 PRO B CB  1 
ATOM 4951 C CG  . PRO B 1 199 ? -42.199 -39.483 74.984 1.00 9.20  ? 199 PRO B CG  1 
ATOM 4952 C CD  . PRO B 1 199 ? -42.335 -40.861 74.380 1.00 7.48  ? 199 PRO B CD  1 
ATOM 4953 N N   . SER B 1 200 ? -41.292 -41.976 78.194 1.00 7.98  ? 200 SER B N   1 
ATOM 4954 C CA  . SER B 1 200 ? -40.929 -42.617 79.502 1.00 8.42  ? 200 SER B CA  1 
ATOM 4955 C C   . SER B 1 200 ? -40.400 -43.987 79.350 1.00 7.47  ? 200 SER B C   1 
ATOM 4956 O O   . SER B 1 200 ? -39.416 -44.365 80.046 1.00 9.14  ? 200 SER B O   1 
ATOM 4957 C CB  . SER B 1 200 ? -42.124 -42.543 80.453 1.00 10.69 ? 200 SER B CB  1 
ATOM 4958 O OG  . SER B 1 200 ? -42.525 -41.218 80.744 1.00 13.25 ? 200 SER B OG  1 
ATOM 4959 N N   . PHE B 1 201 ? -40.943 -44.769 78.422 1.00 8.17  ? 201 PHE B N   1 
ATOM 4960 C CA  . PHE B 1 201 ? -40.311 -46.088 78.137 1.00 6.60  ? 201 PHE B CA  1 
ATOM 4961 C C   . PHE B 1 201 ? -38.883 -45.977 77.689 1.00 8.86  ? 201 PHE B C   1 
ATOM 4962 O O   . PHE B 1 201 ? -38.007 -46.747 78.089 1.00 8.41  ? 201 PHE B O   1 
ATOM 4963 C CB  . PHE B 1 201 ? -41.182 -46.839 77.072 1.00 8.61  ? 201 PHE B CB  1 
ATOM 4964 C CG  . PHE B 1 201 ? -40.564 -48.065 76.553 1.00 8.60  ? 201 PHE B CG  1 
ATOM 4965 C CD1 . PHE B 1 201 ? -40.742 -49.260 77.272 1.00 15.26 ? 201 PHE B CD1 1 
ATOM 4966 C CD2 . PHE B 1 201 ? -39.825 -48.095 75.370 1.00 9.72  ? 201 PHE B CD2 1 
ATOM 4967 C CE1 . PHE B 1 201 ? -40.093 -50.490 76.767 1.00 11.87 ? 201 PHE B CE1 1 
ATOM 4968 C CE2 . PHE B 1 201 ? -39.217 -49.358 74.872 1.00 11.61 ? 201 PHE B CE2 1 
ATOM 4969 C CZ  . PHE B 1 201 ? -39.344 -50.503 75.596 1.00 12.58 ? 201 PHE B CZ  1 
ATOM 4970 N N   . LEU B 1 202 ? -38.635 -45.045 76.738 1.00 7.52  ? 202 LEU B N   1 
ATOM 4971 C CA  . LEU B 1 202 ? -37.237 -44.866 76.310 1.00 8.14  ? 202 LEU B CA  1 
ATOM 4972 C C   . LEU B 1 202 ? -36.333 -44.421 77.404 1.00 7.74  ? 202 LEU B C   1 
ATOM 4973 O O   . LEU B 1 202 ? -35.169 -44.842 77.414 1.00 8.29  ? 202 LEU B O   1 
ATOM 4974 C CB  . LEU B 1 202 ? -37.217 -43.838 75.133 1.00 7.06  ? 202 LEU B CB  1 
ATOM 4975 C CG  . LEU B 1 202 ? -37.919 -44.350 73.793 1.00 6.47  ? 202 LEU B CG  1 
ATOM 4976 C CD1 . LEU B 1 202 ? -37.830 -43.216 72.672 1.00 8.97  ? 202 LEU B CD1 1 
ATOM 4977 C CD2 . LEU B 1 202 ? -37.294 -45.664 73.333 1.00 9.32  ? 202 LEU B CD2 1 
ATOM 4978 N N   . ALA B 1 203 ? -36.847 -43.586 78.323 1.00 9.29  ? 203 ALA B N   1 
ATOM 4979 C CA  . ALA B 1 203 ? -36.032 -43.163 79.539 1.00 7.89  ? 203 ALA B CA  1 
ATOM 4980 C C   . ALA B 1 203 ? -35.699 -44.397 80.352 1.00 11.93 ? 203 ALA B C   1 
ATOM 4981 O O   . ALA B 1 203 ? -34.576 -44.510 80.833 1.00 10.22 ? 203 ALA B O   1 
ATOM 4982 C CB  . ALA B 1 203 ? -36.828 -42.138 80.376 1.00 8.67  ? 203 ALA B CB  1 
ATOM 4983 N N   . GLU B 1 204 ? -36.680 -45.277 80.540 1.00 9.52  ? 204 GLU B N   1 
ATOM 4984 C CA  . GLU B 1 204 ? -36.394 -46.540 81.366 1.00 10.27 ? 204 GLU B CA  1 
ATOM 4985 C C   . GLU B 1 204 ? -35.383 -47.411 80.606 1.00 10.04 ? 204 GLU B C   1 
ATOM 4986 O O   . GLU B 1 204 ? -34.493 -48.004 81.227 1.00 11.88 ? 204 GLU B O   1 
ATOM 4987 C CB  . GLU B 1 204 ? -37.672 -47.398 81.514 1.00 10.43 ? 204 GLU B CB  1 
ATOM 4988 C CG  . GLU B 1 204 ? -38.645 -46.771 82.511 1.00 19.82 ? 204 GLU B CG  1 
ATOM 4989 C CD  . GLU B 1 204 ? -37.988 -46.352 83.909 1.00 27.96 ? 204 GLU B CD  1 
ATOM 4990 O OE1 . GLU B 1 204 ? -37.154 -47.137 84.501 1.00 28.54 ? 204 GLU B OE1 1 
ATOM 4991 O OE2 . GLU B 1 204 ? -38.296 -45.190 84.417 1.00 29.44 ? 204 GLU B OE2 1 
ATOM 4992 N N   . GLN B 1 205 ? -35.430 -47.498 79.257 1.00 9.34  ? 205 GLN B N   1 
ATOM 4993 C CA  . GLN B 1 205 ? -34.435 -48.227 78.466 1.00 9.60  ? 205 GLN B CA  1 
ATOM 4994 C C   . GLN B 1 205 ? -33.042 -47.683 78.725 1.00 8.98  ? 205 GLN B C   1 
ATOM 4995 O O   . GLN B 1 205 ? -32.058 -48.454 78.796 1.00 10.55 ? 205 GLN B O   1 
ATOM 4996 C CB  . GLN B 1 205 ? -34.759 -48.201 76.943 1.00 9.28  ? 205 GLN B CB  1 
ATOM 4997 C CG  . GLN B 1 205 ? -36.008 -49.084 76.588 1.00 11.09 ? 205 GLN B CG  1 
ATOM 4998 C CD  . GLN B 1 205 ? -35.718 -50.545 76.794 1.00 15.61 ? 205 GLN B CD  1 
ATOM 4999 O OE1 . GLN B 1 205 ? -36.386 -51.212 77.653 1.00 17.79 ? 205 GLN B OE1 1 
ATOM 5000 N NE2 . GLN B 1 205 ? -34.769 -51.047 76.094 1.00 12.58 ? 205 GLN B NE2 1 
ATOM 5001 N N   . ALA B 1 206 ? -32.934 -46.339 78.734 1.00 7.35  ? 206 ALA B N   1 
ATOM 5002 C CA  . ALA B 1 206 ? -31.641 -45.708 78.922 1.00 7.56  ? 206 ALA B CA  1 
ATOM 5003 C C   . ALA B 1 206 ? -31.140 -45.982 80.336 1.00 9.64  ? 206 ALA B C   1 
ATOM 5004 O O   . ALA B 1 206 ? -29.941 -46.229 80.506 1.00 9.72  ? 206 ALA B O   1 
ATOM 5005 C CB  . ALA B 1 206 ? -31.865 -44.177 78.677 1.00 7.89  ? 206 ALA B CB  1 
ATOM 5006 N N   . LYS B 1 207 ? -32.026 -45.813 81.296 1.00 9.62  ? 207 LYS B N   1 
ATOM 5007 C CA  . LYS B 1 207 ? -31.561 -46.079 82.711 1.00 11.20 ? 207 LYS B CA  1 
ATOM 5008 C C   . LYS B 1 207 ? -31.108 -47.537 82.871 1.00 12.99 ? 207 LYS B C   1 
ATOM 5009 O O   . LYS B 1 207 ? -30.045 -47.778 83.547 1.00 13.98 ? 207 LYS B O   1 
ATOM 5010 C CB  . LYS B 1 207 ? -32.679 -45.825 83.684 1.00 13.61 ? 207 LYS B CB  1 
ATOM 5011 C CG  . LYS B 1 207 ? -32.878 -44.333 83.797 1.00 19.78 ? 207 LYS B CG  1 
ATOM 5012 C CD  . LYS B 1 207 ? -33.905 -43.963 84.853 1.00 27.51 ? 207 LYS B CD  1 
ATOM 5013 C CE  . LYS B 1 207 ? -35.297 -44.316 84.562 1.00 32.81 ? 207 LYS B CE  1 
ATOM 5014 N NZ  . LYS B 1 207 ? -36.119 -43.733 85.722 1.00 36.29 ? 207 LYS B NZ  1 
ATOM 5015 N N   . GLU B 1 208 ? -31.757 -48.498 82.198 1.00 11.38 ? 208 GLU B N   1 
ATOM 5016 C CA  . GLU B 1 208 ? -31.348 -49.924 82.276 1.00 13.62 ? 208 GLU B CA  1 
ATOM 5017 C C   . GLU B 1 208 ? -30.001 -50.075 81.655 1.00 16.46 ? 208 GLU B C   1 
ATOM 5018 O O   . GLU B 1 208 ? -29.137 -50.791 82.184 1.00 16.71 ? 208 GLU B O   1 
ATOM 5019 C CB  . GLU B 1 208 ? -32.304 -50.814 81.523 1.00 16.64 ? 208 GLU B CB  1 
ATOM 5020 C CG  . GLU B 1 208 ? -33.582 -50.962 82.324 1.00 25.47 ? 208 GLU B CG  1 
ATOM 5021 C CD  . GLU B 1 208 ? -34.665 -51.823 81.573 1.00 40.39 ? 208 GLU B CD  1 
ATOM 5022 O OE1 . GLU B 1 208 ? -34.276 -52.706 80.722 1.00 40.80 ? 208 GLU B OE1 1 
ATOM 5023 O OE2 . GLU B 1 208 ? -35.914 -51.579 81.843 1.00 42.71 ? 208 GLU B OE2 1 
ATOM 5024 N N   . LEU B 1 209 ? -29.786 -49.409 80.518 1.00 13.49 ? 209 LEU B N   1 
ATOM 5025 C CA  . LEU B 1 209 ? -28.468 -49.477 79.847 1.00 13.82 ? 209 LEU B CA  1 
ATOM 5026 C C   . LEU B 1 209 ? -27.357 -48.889 80.702 1.00 15.59 ? 209 LEU B C   1 
ATOM 5027 O O   . LEU B 1 209 ? -26.234 -49.455 80.833 1.00 16.70 ? 209 LEU B O   1 
ATOM 5028 C CB  . LEU B 1 209 ? -28.604 -48.726 78.466 1.00 13.52 ? 209 LEU B CB  1 
ATOM 5029 C CG  . LEU B 1 209 ? -27.464 -48.970 77.509 1.00 18.01 ? 209 LEU B CG  1 
ATOM 5030 C CD1 . LEU B 1 209 ? -27.359 -50.398 77.054 1.00 18.34 ? 209 LEU B CD1 1 
ATOM 5031 C CD2 . LEU B 1 209 ? -27.667 -48.050 76.257 1.00 15.64 ? 209 LEU B CD2 1 
ATOM 5032 N N   . GLY B 1 210 ? -27.591 -47.769 81.348 1.00 13.64 ? 210 GLY B N   1 
ATOM 5033 C CA  . GLY B 1 210 ? -26.662 -47.112 82.279 1.00 16.10 ? 210 GLY B CA  1 
ATOM 5034 C C   . GLY B 1 210 ? -26.310 -48.070 83.434 1.00 19.64 ? 210 GLY B C   1 
ATOM 5035 O O   . GLY B 1 210 ? -25.097 -48.140 83.764 1.00 19.87 ? 210 GLY B O   1 
ATOM 5036 N N   . LYS B 1 211 ? -27.256 -48.821 83.978 1.00 18.61 ? 211 LYS B N   1 
ATOM 5037 C CA  . LYS B 1 211 ? -26.929 -49.769 85.040 1.00 22.14 ? 211 LYS B CA  1 
ATOM 5038 C C   . LYS B 1 211 ? -25.950 -50.840 84.548 1.00 22.98 ? 211 LYS B C   1 
ATOM 5039 O O   . LYS B 1 211 ? -25.046 -51.256 85.273 1.00 24.06 ? 211 LYS B O   1 
ATOM 5040 C CB  . LYS B 1 211 ? -28.200 -50.427 85.582 1.00 21.83 ? 211 LYS B CB  1 
ATOM 5041 C CG  . LYS B 1 211 ? -28.743 -49.778 86.845 1.00 22.54 ? 211 LYS B CG  1 
ATOM 5042 C CD  . LYS B 1 211 ? -30.263 -49.809 86.871 1.00 33.97 ? 211 LYS B CD  1 
ATOM 5043 C CE  . LYS B 1 211 ? -30.799 -51.125 86.331 1.00 41.47 ? 211 LYS B CE  1 
ATOM 5044 N NZ  . LYS B 1 211 ? -32.254 -51.049 86.025 1.00 49.22 ? 211 LYS B NZ  1 
ATOM 5045 N N   . ALA B 1 212 ? -26.152 -51.280 83.311 1.00 23.73 ? 212 ALA B N   1 
ATOM 5046 C CA  . ALA B 1 212 ? -25.392 -52.426 82.688 1.00 23.42 ? 212 ALA B CA  1 
ATOM 5047 C C   . ALA B 1 212 ? -23.945 -52.067 82.328 1.00 22.95 ? 212 ALA B C   1 
ATOM 5048 O O   . ALA B 1 212 ? -23.125 -52.956 82.054 1.00 24.64 ? 212 ALA B O   1 
ATOM 5049 C CB  . ALA B 1 212 ? -26.140 -53.023 81.480 1.00 23.80 ? 212 ALA B CB  1 
ATOM 5050 N N   . HIS B 1 213 ? -23.553 -50.796 82.349 1.00 23.20 ? 213 HIS B N   1 
ATOM 5051 C CA  . HIS B 1 213 ? -22.281 -50.423 81.785 1.00 22.12 ? 213 HIS B CA  1 
ATOM 5052 C C   . HIS B 1 213 ? -21.502 -49.401 82.580 1.00 24.40 ? 213 HIS B C   1 
ATOM 5053 O O   . HIS B 1 213 ? -21.976 -48.283 82.796 1.00 24.49 ? 213 HIS B O   1 
ATOM 5054 C CB  . HIS B 1 213 ? -22.437 -49.880 80.322 1.00 22.06 ? 213 HIS B CB  1 
ATOM 5055 C CG  . HIS B 1 213 ? -23.032 -50.853 79.371 1.00 19.65 ? 213 HIS B CG  1 
ATOM 5056 N ND1 . HIS B 1 213 ? -22.271 -51.787 78.686 1.00 24.03 ? 213 HIS B ND1 1 
ATOM 5057 C CD2 . HIS B 1 213 ? -24.315 -51.083 79.001 1.00 22.82 ? 213 HIS B CD2 1 
ATOM 5058 C CE1 . HIS B 1 213 ? -23.044 -52.517 77.914 1.00 23.31 ? 213 HIS B CE1 1 
ATOM 5059 N NE2 . HIS B 1 213 ? -24.290 -52.101 78.062 1.00 23.77 ? 213 HIS B NE2 1 
ATOM 5060 N N   . LYS B 1 214 ? -20.269 -49.724 82.952 1.00 26.64 ? 214 LYS B N   1 
ATOM 5061 C CA  . LYS B 1 214 ? -19.481 -48.860 83.838 1.00 26.16 ? 214 LYS B CA  1 
ATOM 5062 C C   . LYS B 1 214 ? -19.138 -47.441 83.337 1.00 26.00 ? 214 LYS B C   1 
ATOM 5063 O O   . LYS B 1 214 ? -19.181 -46.487 84.115 1.00 26.26 ? 214 LYS B O   1 
ATOM 5064 C CB  . LYS B 1 214 ? -18.194 -49.577 84.261 1.00 27.69 ? 214 LYS B CB  1 
ATOM 5065 C CG  . LYS B 1 214 ? -18.428 -50.855 85.052 1.00 37.93 ? 214 LYS B CG  1 
ATOM 5066 C CD  . LYS B 1 214 ? -19.020 -50.558 86.419 1.00 46.17 ? 214 LYS B CD  1 
ATOM 5067 C CE  . LYS B 1 214 ? -19.254 -51.834 87.209 1.00 51.72 ? 214 LYS B CE  1 
ATOM 5068 N NZ  . LYS B 1 214 ? -17.977 -52.529 87.534 1.00 52.82 ? 214 LYS B NZ  1 
ATOM 5069 N N   . ALA B 1 215 ? -18.786 -47.300 82.061 1.00 22.07 ? 215 ALA B N   1 
ATOM 5070 C CA  . ALA B 1 215 ? -18.270 -46.057 81.541 1.00 22.08 ? 215 ALA B CA  1 
ATOM 5071 C C   . ALA B 1 215 ? -19.438 -45.203 81.046 1.00 18.46 ? 215 ALA B C   1 
ATOM 5072 O O   . ALA B 1 215 ? -19.209 -44.143 80.460 1.00 18.54 ? 215 ALA B O   1 
ATOM 5073 C CB  . ALA B 1 215 ? -17.325 -46.341 80.330 1.00 23.04 ? 215 ALA B CB  1 
ATOM 5074 N N   . LEU B 1 216 ? -20.667 -45.632 81.374 1.00 18.66 ? 216 LEU B N   1 
ATOM 5075 C CA  . LEU B 1 216 ? -21.887 -44.923 80.878 1.00 15.52 ? 216 LEU B CA  1 
ATOM 5076 C C   . LEU B 1 216 ? -22.665 -44.270 82.058 1.00 13.59 ? 216 LEU B C   1 
ATOM 5077 O O   . LEU B 1 216 ? -23.012 -44.994 83.048 1.00 14.79 ? 216 LEU B O   1 
ATOM 5078 C CB  . LEU B 1 216 ? -22.819 -45.916 80.152 1.00 15.90 ? 216 LEU B CB  1 
ATOM 5079 C CG  . LEU B 1 216 ? -24.054 -45.258 79.448 1.00 12.06 ? 216 LEU B CG  1 
ATOM 5080 C CD1 . LEU B 1 216 ? -23.511 -44.382 78.220 1.00 13.19 ? 216 LEU B CD1 1 
ATOM 5081 C CD2 . LEU B 1 216 ? -24.998 -46.293 78.878 1.00 11.69 ? 216 LEU B CD2 1 
ATOM 5082 N N   . LYS B 1 217 ? -22.947 -42.963 81.969 1.00 11.47 ? 217 LYS B N   1 
ATOM 5083 C CA  . LYS B 1 217 ? -23.732 -42.250 82.964 1.00 13.68 ? 217 LYS B CA  1 
ATOM 5084 C C   . LYS B 1 217 ? -24.976 -41.769 82.232 1.00 13.82 ? 217 LYS B C   1 
ATOM 5085 O O   . LYS B 1 217 ? -24.836 -41.179 81.126 1.00 14.90 ? 217 LYS B O   1 
ATOM 5086 C CB  . LYS B 1 217 ? -22.986 -41.069 83.609 1.00 16.10 ? 217 LYS B CB  1 
ATOM 5087 C CG  . LYS B 1 217 ? -21.888 -41.423 84.705 1.00 23.01 ? 217 LYS B CG  1 
ATOM 5088 C CD  . LYS B 1 217 ? -22.362 -42.328 85.797 1.00 34.86 ? 217 LYS B CD  1 
ATOM 5089 C CE  . LYS B 1 217 ? -21.335 -42.327 86.907 1.00 40.03 ? 217 LYS B CE  1 
ATOM 5090 N NZ  . LYS B 1 217 ? -20.341 -43.374 86.641 1.00 42.30 ? 217 LYS B NZ  1 
ATOM 5091 N N   . VAL B 1 218 ? -26.125 -41.978 82.837 1.00 13.14 ? 218 VAL B N   1 
ATOM 5092 C CA  . VAL B 1 218 ? -27.417 -41.580 82.231 1.00 10.43 ? 218 VAL B CA  1 
ATOM 5093 C C   . VAL B 1 218 ? -28.127 -40.601 83.081 1.00 10.50 ? 218 VAL B C   1 
ATOM 5094 O O   . VAL B 1 218 ? -28.242 -40.765 84.315 1.00 13.80 ? 218 VAL B O   1 
ATOM 5095 C CB  . VAL B 1 218 ? -28.270 -42.867 82.049 1.00 9.92  ? 218 VAL B CB  1 
ATOM 5096 C CG1 . VAL B 1 218 ? -29.689 -42.429 81.563 1.00 12.65 ? 218 VAL B CG1 1 
ATOM 5097 C CG2 . VAL B 1 218 ? -27.634 -43.786 80.993 1.00 14.53 ? 218 VAL B CG2 1 
ATOM 5098 N N   . GLU B 1 219 ? -28.604 -39.505 82.481 1.00 9.27  ? 219 GLU B N   1 
ATOM 5099 C CA  . GLU B 1 219 ? -29.515 -38.549 83.192 1.00 11.65 ? 219 GLU B CA  1 
ATOM 5100 C C   . GLU B 1 219 ? -30.791 -38.360 82.370 1.00 11.04 ? 219 GLU B C   1 
ATOM 5101 O O   . GLU B 1 219 ? -30.687 -38.355 81.149 1.00 12.73 ? 219 GLU B O   1 
ATOM 5102 C CB  . GLU B 1 219 ? -28.804 -37.165 83.234 1.00 15.85 ? 219 GLU B CB  1 
ATOM 5103 C CG  . GLU B 1 219 ? -29.421 -35.933 83.983 1.00 26.91 ? 219 GLU B CG  1 
ATOM 5104 C CD  . GLU B 1 219 ? -28.368 -34.759 84.124 1.00 36.94 ? 219 GLU B CD  1 
ATOM 5105 O OE1 . GLU B 1 219 ? -27.137 -35.025 83.896 1.00 36.49 ? 219 GLU B OE1 1 
ATOM 5106 O OE2 . GLU B 1 219 ? -28.759 -33.593 84.493 1.00 43.11 ? 219 GLU B OE2 1 
ATOM 5107 N N   . VAL B 1 220 ? -31.922 -38.260 83.033 1.00 9.99  ? 220 VAL B N   1 
ATOM 5108 C CA  . VAL B 1 220 ? -33.200 -38.109 82.295 1.00 10.81 ? 220 VAL B CA  1 
ATOM 5109 C C   . VAL B 1 220 ? -33.767 -36.803 82.749 1.00 9.83  ? 220 VAL B C   1 
ATOM 5110 O O   . VAL B 1 220 ? -33.957 -36.542 84.043 1.00 11.41 ? 220 VAL B O   1 
ATOM 5111 C CB  . VAL B 1 220 ? -34.137 -39.241 82.640 1.00 10.51 ? 220 VAL B CB  1 
ATOM 5112 C CG1 . VAL B 1 220 ? -35.481 -39.023 81.952 1.00 13.98 ? 220 VAL B CG1 1 
ATOM 5113 C CG2 . VAL B 1 220 ? -33.583 -40.620 82.182 1.00 13.64 ? 220 VAL B CG2 1 
ATOM 5114 N N   . LEU B 1 221 ? -34.050 -35.879 81.814 1.00 9.21  ? 221 LEU B N   1 
ATOM 5115 C CA  . LEU B 1 221 ? -34.649 -34.569 82.159 1.00 9.16  ? 221 LEU B CA  1 
ATOM 5116 C C   . LEU B 1 221 ? -36.136 -34.670 81.795 1.00 10.91 ? 221 LEU B C   1 
ATOM 5117 O O   . LEU B 1 221 ? -36.510 -35.051 80.653 1.00 9.67  ? 221 LEU B O   1 
ATOM 5118 C CB  . LEU B 1 221 ? -34.031 -33.468 81.293 1.00 12.73 ? 221 LEU B CB  1 
ATOM 5119 C CG  . LEU B 1 221 ? -32.536 -33.207 81.563 1.00 15.35 ? 221 LEU B CG  1 
ATOM 5120 C CD1 . LEU B 1 221 ? -31.627 -34.279 81.358 1.00 25.65 ? 221 LEU B CD1 1 
ATOM 5121 C CD2 . LEU B 1 221 ? -32.089 -32.134 80.673 1.00 19.30 ? 221 LEU B CD2 1 
ATOM 5122 N N   . ASP B 1 222 ? -37.017 -34.393 82.734 1.00 9.28  ? 222 ASP B N   1 
ATOM 5123 C CA  . ASP B 1 222 ? -38.441 -34.516 82.555 1.00 9.94  ? 222 ASP B CA  1 
ATOM 5124 C C   . ASP B 1 222 ? -39.083 -33.189 82.029 1.00 9.52  ? 222 ASP B C   1 
ATOM 5125 O O   . ASP B 1 222 ? -38.375 -32.238 81.647 1.00 9.12  ? 222 ASP B O   1 
ATOM 5126 C CB  . ASP B 1 222 ? -39.074 -34.967 83.880 1.00 9.78  ? 222 ASP B CB  1 
ATOM 5127 C CG  . ASP B 1 222 ? -39.059 -33.908 84.986 1.00 14.82 ? 222 ASP B CG  1 
ATOM 5128 O OD1 . ASP B 1 222 ? -38.696 -32.735 84.832 1.00 13.82 ? 222 ASP B OD1 1 
ATOM 5129 O OD2 . ASP B 1 222 ? -39.534 -34.336 86.118 1.00 20.18 ? 222 ASP B OD2 1 
ATOM 5130 N N   . GLU B 1 223 ? -40.405 -33.155 81.930 1.00 8.87  ? 223 GLU B N   1 
ATOM 5131 C CA  . GLU B 1 223 ? -41.038 -32.015 81.257 1.00 9.25  ? 223 GLU B CA  1 
ATOM 5132 C C   . GLU B 1 223 ? -40.742 -30.685 81.962 1.00 10.03 ? 223 GLU B C   1 
ATOM 5133 O O   . GLU B 1 223 ? -40.590 -29.624 81.316 1.00 10.87 ? 223 GLU B O   1 
ATOM 5134 C CB  . GLU B 1 223 ? -42.547 -32.336 81.066 1.00 11.29 ? 223 GLU B CB  1 
ATOM 5135 C CG  . GLU B 1 223 ? -43.301 -31.264 80.316 1.00 13.75 ? 223 GLU B CG  1 
ATOM 5136 C CD  . GLU B 1 223 ? -44.774 -31.634 80.102 1.00 16.82 ? 223 GLU B CD  1 
ATOM 5137 O OE1 . GLU B 1 223 ? -45.200 -32.738 80.592 1.00 23.23 ? 223 GLU B OE1 1 
ATOM 5138 O OE2 . GLU B 1 223 ? -45.492 -30.838 79.430 1.00 15.28 ? 223 GLU B OE2 1 
ATOM 5139 N N   . LYS B 1 224 ? -40.831 -30.730 83.307 1.00 9.39  ? 224 LYS B N   1 
ATOM 5140 C CA  . LYS B 1 224 ? -40.604 -29.494 84.029 1.00 11.37 ? 224 LYS B CA  1 
ATOM 5141 C C   . LYS B 1 224 ? -39.164 -29.026 83.819 1.00 11.03 ? 224 LYS B C   1 
ATOM 5142 O O   . LYS B 1 224 ? -38.961 -27.804 83.718 1.00 11.69 ? 224 LYS B O   1 
ATOM 5143 C CB  . LYS B 1 224 ? -40.869 -29.726 85.522 1.00 13.49 ? 224 LYS B CB  1 
ATOM 5144 C CG  . LYS B 1 224 ? -40.443 -28.546 86.416 1.00 15.62 ? 224 LYS B CG  1 
ATOM 5145 C CD  . LYS B 1 224 ? -40.975 -28.719 87.870 1.00 22.49 ? 224 LYS B CD  1 
ATOM 5146 C CE  . LYS B 1 224 ? -41.171 -27.357 88.604 1.00 30.78 ? 224 LYS B CE  1 
ATOM 5147 N NZ  . LYS B 1 224 ? -40.341 -26.131 88.307 1.00 35.31 ? 224 LYS B NZ  1 
ATOM 5148 N N   . LYS B 1 225 ? -38.196 -29.903 83.793 1.00 11.10 ? 225 LYS B N   1 
ATOM 5149 C CA  . LYS B 1 225 ? -36.819 -29.515 83.537 1.00 9.34  ? 225 LYS B CA  1 
ATOM 5150 C C   . LYS B 1 225 ? -36.632 -28.905 82.173 1.00 10.46 ? 225 LYS B C   1 
ATOM 5151 O O   . LYS B 1 225 ? -35.958 -27.904 81.993 1.00 11.05 ? 225 LYS B O   1 
ATOM 5152 C CB  . LYS B 1 225 ? -35.861 -30.709 83.740 1.00 10.95 ? 225 LYS B CB  1 
ATOM 5153 C CG  . LYS B 1 225 ? -34.427 -30.296 83.497 1.00 13.74 ? 225 LYS B CG  1 
ATOM 5154 C CD  . LYS B 1 225 ? -33.843 -29.257 84.495 1.00 18.78 ? 225 LYS B CD  1 
ATOM 5155 C CE  . LYS B 1 225 ? -32.262 -29.301 84.316 1.00 16.08 ? 225 LYS B CE  1 
ATOM 5156 N NZ  . LYS B 1 225 ? -31.608 -28.298 85.241 1.00 28.05 ? 225 LYS B NZ  1 
ATOM 5157 N N   . ILE B 1 226 ? -37.271 -29.529 81.182 1.00 9.50  ? 226 ILE B N   1 
ATOM 5158 C CA  . ILE B 1 226 ? -37.143 -28.985 79.848 1.00 9.34  ? 226 ILE B CA  1 
ATOM 5159 C C   . ILE B 1 226 ? -37.748 -27.552 79.803 1.00 10.40 ? 226 ILE B C   1 
ATOM 5160 O O   . ILE B 1 226 ? -37.150 -26.676 79.188 1.00 10.35 ? 226 ILE B O   1 
ATOM 5161 C CB  . ILE B 1 226 ? -37.975 -29.959 78.889 1.00 7.18  ? 226 ILE B CB  1 
ATOM 5162 C CG1 . ILE B 1 226 ? -37.177 -31.287 78.706 1.00 7.75  ? 226 ILE B CG1 1 
ATOM 5163 C CG2 . ILE B 1 226 ? -38.280 -29.357 77.511 1.00 7.38  ? 226 ILE B CG2 1 
ATOM 5164 C CD1 . ILE B 1 226 ? -38.026 -32.432 78.104 1.00 8.80  ? 226 ILE B CD1 1 
ATOM 5165 N N   . LYS B 1 227 ? -38.940 -27.406 80.406 1.00 9.75  ? 227 LYS B N   1 
ATOM 5166 C CA  . LYS B 1 227 ? -39.547 -26.061 80.483 1.00 11.31 ? 227 LYS B CA  1 
ATOM 5167 C C   . LYS B 1 227 ? -38.602 -25.048 81.263 1.00 11.26 ? 227 LYS B C   1 
ATOM 5168 O O   . LYS B 1 227 ? -38.358 -23.940 80.726 1.00 10.76 ? 227 LYS B O   1 
ATOM 5169 C CB  . LYS B 1 227 ? -40.929 -26.112 81.159 1.00 12.90 ? 227 LYS B CB  1 
ATOM 5170 C CG  . LYS B 1 227 ? -41.605 -24.749 81.077 1.00 15.77 ? 227 LYS B CG  1 
ATOM 5171 C CD  . LYS B 1 227 ? -43.026 -24.903 81.745 1.00 22.28 ? 227 LYS B CD  1 
ATOM 5172 C CE  . LYS B 1 227 ? -43.540 -23.560 82.306 1.00 34.46 ? 227 LYS B CE  1 
ATOM 5173 N NZ  . LYS B 1 227 ? -44.830 -23.759 83.062 1.00 35.36 ? 227 LYS B NZ  1 
ATOM 5174 N N   . ASP B 1 228 ? -38.091 -25.492 82.412 1.00 11.33 ? 228 ASP B N   1 
ATOM 5175 C CA  . ASP B 1 228 ? -37.240 -24.619 83.261 1.00 13.42 ? 228 ASP B CA  1 
ATOM 5176 C C   . ASP B 1 228 ? -35.909 -24.271 82.657 1.00 12.07 ? 228 ASP B C   1 
ATOM 5177 O O   . ASP B 1 228 ? -35.307 -23.190 83.002 1.00 15.24 ? 228 ASP B O   1 
ATOM 5178 C CB  . ASP B 1 228 ? -37.059 -25.288 84.595 1.00 12.53 ? 228 ASP B CB  1 
ATOM 5179 C CG  . ASP B 1 228 ? -38.355 -25.186 85.461 1.00 15.49 ? 228 ASP B CG  1 
ATOM 5180 O OD1 . ASP B 1 228 ? -39.380 -24.547 85.129 1.00 18.99 ? 228 ASP B OD1 1 
ATOM 5181 O OD2 . ASP B 1 228 ? -38.289 -25.842 86.545 1.00 21.29 ? 228 ASP B OD2 1 
ATOM 5182 N N   . LEU B 1 229 ? -35.396 -25.094 81.743 1.00 9.75  ? 229 LEU B N   1 
ATOM 5183 C CA  . LEU B 1 229 ? -34.177 -24.722 81.026 1.00 9.92  ? 229 LEU B CA  1 
ATOM 5184 C C   . LEU B 1 229 ? -34.441 -23.676 79.944 1.00 10.20 ? 229 LEU B C   1 
ATOM 5185 O O   . LEU B 1 229 ? -33.497 -23.205 79.323 1.00 10.87 ? 229 LEU B O   1 
ATOM 5186 C CB  . LEU B 1 229 ? -33.580 -25.954 80.355 1.00 11.68 ? 229 LEU B CB  1 
ATOM 5187 C CG  . LEU B 1 229 ? -32.904 -27.030 81.260 1.00 13.60 ? 229 LEU B CG  1 
ATOM 5188 C CD1 . LEU B 1 229 ? -32.687 -28.332 80.385 1.00 15.90 ? 229 LEU B CD1 1 
ATOM 5189 C CD2 . LEU B 1 229 ? -31.529 -26.348 81.649 1.00 18.42 ? 229 LEU B CD2 1 
ATOM 5190 N N   . GLY B 1 230 ? -35.739 -23.413 79.648 1.00 8.47  ? 230 GLY B N   1 
ATOM 5191 C CA  . GLY B 1 230 ? -36.126 -22.418 78.618 1.00 9.71  ? 230 GLY B CA  1 
ATOM 5192 C C   . GLY B 1 230 ? -36.326 -23.034 77.244 1.00 7.80  ? 230 GLY B C   1 
ATOM 5193 O O   . GLY B 1 230 ? -36.294 -22.319 76.229 1.00 7.89  ? 230 GLY B O   1 
ATOM 5194 N N   . MET B 1 231 ? -36.505 -24.387 77.219 1.00 8.35  ? 231 MET B N   1 
ATOM 5195 C CA  . MET B 1 231 ? -36.627 -25.109 75.889 1.00 5.78  ? 231 MET B CA  1 
ATOM 5196 C C   . MET B 1 231 ? -38.083 -25.002 75.427 1.00 7.70  ? 231 MET B C   1 
ATOM 5197 O O   . MET B 1 231 ? -38.852 -25.952 75.430 1.00 7.27  ? 231 MET B O   1 
ATOM 5198 C CB  . MET B 1 231 ? -36.252 -26.582 76.041 1.00 7.83  ? 231 MET B CB  1 
ATOM 5199 C CG  . MET B 1 231 ? -34.784 -26.740 76.468 1.00 8.59  ? 231 MET B CG  1 
ATOM 5200 S SD  . MET B 1 231 ? -34.474 -28.526 76.544 1.00 11.61 ? 231 MET B SD  1 
ATOM 5201 C CE  . MET B 1 231 ? -32.692 -28.496 76.515 1.00 15.29 ? 231 MET B CE  1 
ATOM 5202 N N   . GLY B 1 232 ? -38.425 -23.818 74.954 1.00 6.21  ? 232 GLY B N   1 
ATOM 5203 C CA  . GLY B 1 232 ? -39.785 -23.478 74.602 1.00 6.96  ? 232 GLY B CA  1 
ATOM 5204 C C   . GLY B 1 232 ? -40.287 -24.274 73.388 1.00 6.89  ? 232 GLY B C   1 
ATOM 5205 O O   . GLY B 1 232 ? -41.531 -24.534 73.309 1.00 6.83  ? 232 GLY B O   1 
ATOM 5206 N N   . ALA B 1 233 ? -39.395 -24.588 72.455 1.00 6.04  ? 233 ALA B N   1 
ATOM 5207 C CA  . ALA B 1 233 ? -39.869 -25.307 71.272 1.00 5.55  ? 233 ALA B CA  1 
ATOM 5208 C C   . ALA B 1 233 ? -40.048 -26.792 71.598 1.00 7.24  ? 233 ALA B C   1 
ATOM 5209 O O   . ALA B 1 233 ? -41.108 -27.389 71.204 1.00 6.43  ? 233 ALA B O   1 
ATOM 5210 C CB  . ALA B 1 233 ? -38.794 -25.160 70.192 1.00 7.02  ? 233 ALA B CB  1 
ATOM 5211 N N   . PHE B 1 234 ? -39.112 -27.420 72.346 1.00 6.03  ? 234 PHE B N   1 
ATOM 5212 C CA  . PHE B 1 234 ? -39.316 -28.792 72.753 1.00 4.93  ? 234 PHE B CA  1 
ATOM 5213 C C   . PHE B 1 234 ? -40.566 -28.897 73.630 1.00 5.64  ? 234 PHE B C   1 
ATOM 5214 O O   . PHE B 1 234 ? -41.435 -29.812 73.388 1.00 7.09  ? 234 PHE B O   1 
ATOM 5215 C CB  . PHE B 1 234 ? -38.010 -29.129 73.557 1.00 7.15  ? 234 PHE B CB  1 
ATOM 5216 C CG  . PHE B 1 234 ? -37.945 -30.512 74.192 1.00 6.64  ? 234 PHE B CG  1 
ATOM 5217 C CD1 . PHE B 1 234 ? -37.603 -31.596 73.378 1.00 6.55  ? 234 PHE B CD1 1 
ATOM 5218 C CD2 . PHE B 1 234 ? -38.252 -30.769 75.591 1.00 6.60  ? 234 PHE B CD2 1 
ATOM 5219 C CE1 . PHE B 1 234 ? -37.470 -32.882 73.929 1.00 8.55  ? 234 PHE B CE1 1 
ATOM 5220 C CE2 . PHE B 1 234 ? -38.142 -32.073 76.156 1.00 6.78  ? 234 PHE B CE2 1 
ATOM 5221 C CZ  . PHE B 1 234 ? -37.696 -33.132 75.334 1.00 7.98  ? 234 PHE B CZ  1 
ATOM 5222 N N   . TYR B 1 235 ? -40.730 -28.008 74.618 1.00 6.61  ? 235 TYR B N   1 
ATOM 5223 C CA  . TYR B 1 235 ? -41.948 -28.072 75.455 1.00 7.40  ? 235 TYR B CA  1 
ATOM 5224 C C   . TYR B 1 235 ? -43.238 -27.985 74.610 1.00 7.39  ? 235 TYR B C   1 
ATOM 5225 O O   . TYR B 1 235 ? -44.230 -28.705 74.886 1.00 6.63  ? 235 TYR B O   1 
ATOM 5226 C CB  . TYR B 1 235 ? -41.929 -26.944 76.521 1.00 7.88  ? 235 TYR B CB  1 
ATOM 5227 C CG  . TYR B 1 235 ? -43.046 -27.041 77.462 1.00 10.42 ? 235 TYR B CG  1 
ATOM 5228 C CD1 . TYR B 1 235 ? -43.013 -27.871 78.580 1.00 14.70 ? 235 TYR B CD1 1 
ATOM 5229 C CD2 . TYR B 1 235 ? -44.206 -26.307 77.137 1.00 16.34 ? 235 TYR B CD2 1 
ATOM 5230 C CE1 . TYR B 1 235 ? -44.208 -27.831 79.479 1.00 15.88 ? 235 TYR B CE1 1 
ATOM 5231 C CE2 . TYR B 1 235 ? -45.321 -26.321 77.958 1.00 19.79 ? 235 TYR B CE2 1 
ATOM 5232 C CZ  . TYR B 1 235 ? -45.312 -27.080 79.022 1.00 18.49 ? 235 TYR B CZ  1 
ATOM 5233 O OH  . TYR B 1 235 ? -46.574 -26.956 79.762 1.00 22.28 ? 235 TYR B OH  1 
ATOM 5234 N N   . ALA B 1 236 ? -43.187 -27.088 73.601 1.00 6.17  ? 236 ALA B N   1 
ATOM 5235 C CA  . ALA B 1 236 ? -44.427 -26.904 72.830 1.00 6.43  ? 236 ALA B CA  1 
ATOM 5236 C C   . ALA B 1 236 ? -44.823 -28.214 72.112 1.00 6.76  ? 236 ALA B C   1 
ATOM 5237 O O   . ALA B 1 236 ? -46.047 -28.471 71.969 1.00 6.71  ? 236 ALA B O   1 
ATOM 5238 C CB  . ALA B 1 236 ? -44.197 -25.795 71.745 1.00 6.61  ? 236 ALA B CB  1 
ATOM 5239 N N   . VAL B 1 237 ? -43.845 -28.988 71.632 1.00 5.77  ? 237 VAL B N   1 
ATOM 5240 C CA  . VAL B 1 237 ? -44.235 -30.214 70.913 1.00 7.52  ? 237 VAL B CA  1 
ATOM 5241 C C   . VAL B 1 237 ? -44.924 -31.183 71.878 1.00 8.56  ? 237 VAL B C   1 
ATOM 5242 O O   . VAL B 1 237 ? -45.942 -31.784 71.471 1.00 8.54  ? 237 VAL B O   1 
ATOM 5243 C CB  . VAL B 1 237 ? -42.993 -30.859 70.352 1.00 7.09  ? 237 VAL B CB  1 
ATOM 5244 C CG1 . VAL B 1 237 ? -43.341 -32.271 69.671 1.00 6.41  ? 237 VAL B CG1 1 
ATOM 5245 C CG2 . VAL B 1 237 ? -42.396 -29.929 69.271 1.00 7.24  ? 237 VAL B CG2 1 
ATOM 5246 N N   . GLY B 1 238 ? -44.391 -31.332 73.080 1.00 8.77  ? 238 GLY B N   1 
ATOM 5247 C CA  . GLY B 1 238 ? -44.866 -32.428 73.943 1.00 9.44  ? 238 GLY B CA  1 
ATOM 5248 C C   . GLY B 1 238 ? -46.126 -32.154 74.642 1.00 8.27  ? 238 GLY B C   1 
ATOM 5249 O O   . GLY B 1 238 ? -46.695 -33.074 75.204 1.00 8.61  ? 238 GLY B O   1 
ATOM 5250 N N   . GLN B 1 239 ? -46.500 -30.875 74.734 1.00 8.11  ? 239 GLN B N   1 
ATOM 5251 C CA  . GLN B 1 239 ? -47.561 -30.510 75.748 1.00 8.61  ? 239 GLN B CA  1 
ATOM 5252 C C   . GLN B 1 239 ? -48.934 -31.046 75.451 1.00 7.98  ? 239 GLN B C   1 
ATOM 5253 O O   . GLN B 1 239 ? -49.764 -31.217 76.376 1.00 8.74  ? 239 GLN B O   1 
ATOM 5254 C CB  . GLN B 1 239 ? -47.557 -28.958 75.941 1.00 9.22  ? 239 GLN B CB  1 
ATOM 5255 C CG  . GLN B 1 239 ? -48.084 -28.173 74.751 1.00 7.18  ? 239 GLN B CG  1 
ATOM 5256 C CD  . GLN B 1 239 ? -48.370 -26.706 75.199 1.00 16.51 ? 239 GLN B CD  1 
ATOM 5257 O OE1 . GLN B 1 239 ? -48.212 -26.418 76.384 1.00 29.60 ? 239 GLN B OE1 1 
ATOM 5258 N NE2 . GLN B 1 239 ? -49.064 -25.998 74.481 1.00 17.99 ? 239 GLN B NE2 1 
ATOM 5259 N N   . GLY B 1 240 ? -49.219 -31.301 74.182 1.00 6.73  ? 240 GLY B N   1 
ATOM 5260 C CA  . GLY B 1 240 ? -50.550 -31.832 73.768 1.00 6.95  ? 240 GLY B CA  1 
ATOM 5261 C C   . GLY B 1 240 ? -50.793 -33.252 74.195 1.00 8.90  ? 240 GLY B C   1 
ATOM 5262 O O   . GLY B 1 240 ? -51.968 -33.649 74.201 1.00 10.89 ? 240 GLY B O   1 
ATOM 5263 N N   . SER B 1 241 ? -49.788 -34.018 74.538 1.00 7.88  ? 241 SER B N   1 
ATOM 5264 C CA  . SER B 1 241 ? -49.988 -35.419 74.855 1.00 6.74  ? 241 SER B CA  1 
ATOM 5265 C C   . SER B 1 241 ? -50.150 -35.655 76.338 1.00 7.23  ? 241 SER B C   1 
ATOM 5266 O O   . SER B 1 241 ? -49.578 -34.979 77.210 1.00 9.29  ? 241 SER B O   1 
ATOM 5267 C CB  . SER B 1 241 ? -48.777 -36.216 74.377 1.00 6.30  ? 241 SER B CB  1 
ATOM 5268 O OG  . SER B 1 241 ? -48.993 -37.597 74.770 1.00 8.85  ? 241 SER B OG  1 
ATOM 5269 N N   . ASP B 1 242 ? -50.858 -36.771 76.677 1.00 7.16  ? 242 ASP B N   1 
ATOM 5270 C CA  . ASP B 1 242 ? -50.850 -37.232 78.059 1.00 8.08  ? 242 ASP B CA  1 
ATOM 5271 C C   . ASP B 1 242 ? -49.514 -37.916 78.453 1.00 9.26  ? 242 ASP B C   1 
ATOM 5272 O O   . ASP B 1 242 ? -49.227 -38.128 79.658 1.00 11.09 ? 242 ASP B O   1 
ATOM 5273 C CB  . ASP B 1 242 ? -51.950 -38.283 78.243 1.00 7.87  ? 242 ASP B CB  1 
ATOM 5274 C CG  . ASP B 1 242 ? -53.359 -37.653 78.318 1.00 10.22 ? 242 ASP B CG  1 
ATOM 5275 O OD1 . ASP B 1 242 ? -53.496 -36.418 78.233 1.00 14.80 ? 242 ASP B OD1 1 
ATOM 5276 O OD2 . ASP B 1 242 ? -54.320 -38.497 78.457 1.00 11.07 ? 242 ASP B OD2 1 
ATOM 5277 N N   . GLN B 1 243 ? -48.719 -38.387 77.472 1.00 7.84  ? 243 GLN B N   1 
ATOM 5278 C CA  . GLN B 1 243 ? -47.359 -38.889 77.719 1.00 8.15  ? 243 GLN B CA  1 
ATOM 5279 C C   . GLN B 1 243 ? -46.347 -37.786 77.698 1.00 8.09  ? 243 GLN B C   1 
ATOM 5280 O O   . GLN B 1 243 ? -46.190 -37.119 76.666 1.00 9.56  ? 243 GLN B O   1 
ATOM 5281 C CB  . GLN B 1 243 ? -46.967 -39.876 76.664 1.00 9.28  ? 243 GLN B CB  1 
ATOM 5282 C CG  . GLN B 1 243 ? -47.629 -41.264 76.830 1.00 11.46 ? 243 GLN B CG  1 
ATOM 5283 C CD  . GLN B 1 243 ? -47.199 -41.970 78.185 1.00 13.96 ? 243 GLN B CD  1 
ATOM 5284 O OE1 . GLN B 1 243 ? -46.242 -41.569 78.849 1.00 12.59 ? 243 GLN B OE1 1 
ATOM 5285 N NE2 . GLN B 1 243 ? -47.984 -43.037 78.584 1.00 17.64 ? 243 GLN B NE2 1 
ATOM 5286 N N   . PRO B 1 244 ? -45.702 -37.478 78.828 1.00 6.85  ? 244 PRO B N   1 
ATOM 5287 C CA  . PRO B 1 244 ? -44.808 -36.267 78.757 1.00 8.53  ? 244 PRO B CA  1 
ATOM 5288 C C   . PRO B 1 244 ? -43.481 -36.520 78.068 1.00 8.74  ? 244 PRO B C   1 
ATOM 5289 O O   . PRO B 1 244 ? -43.060 -37.686 77.925 1.00 8.37  ? 244 PRO B O   1 
ATOM 5290 C CB  . PRO B 1 244 ? -44.520 -36.013 80.256 1.00 8.65  ? 244 PRO B CB  1 
ATOM 5291 C CG  . PRO B 1 244 ? -44.580 -37.438 80.945 1.00 9.61  ? 244 PRO B CG  1 
ATOM 5292 C CD  . PRO B 1 244 ? -44.910 -38.324 79.661 1.00 8.20  ? 244 PRO B CD  1 
ATOM 5293 N N   . PRO B 1 245 ? -42.838 -35.423 77.659 1.00 7.45  ? 245 PRO B N   1 
ATOM 5294 C CA  . PRO B 1 245 ? -41.565 -35.546 76.966 1.00 7.67  ? 245 PRO B CA  1 
ATOM 5295 C C   . PRO B 1 245 ? -40.378 -35.869 77.888 1.00 8.89  ? 245 PRO B C   1 
ATOM 5296 O O   . PRO B 1 245 ? -40.515 -35.788 79.157 1.00 8.64  ? 245 PRO B O   1 
ATOM 5297 C CB  . PRO B 1 245 ? -41.363 -34.165 76.378 1.00 8.78  ? 245 PRO B CB  1 
ATOM 5298 C CG  . PRO B 1 245 ? -42.113 -33.239 77.430 1.00 9.13  ? 245 PRO B CG  1 
ATOM 5299 C CD  . PRO B 1 245 ? -42.608 -34.321 78.442 1.00 7.80  ? 245 PRO B CD  1 
ATOM 5300 N N   . ARG B 1 246 ? -39.310 -36.380 77.302 1.00 7.55  ? 246 ARG B N   1 
ATOM 5301 C CA  . ARG B 1 246 ? -38.067 -36.622 78.051 1.00 7.19  ? 246 ARG B CA  1 
ATOM 5302 C C   . ARG B 1 246 ? -36.915 -36.244 77.223 1.00 6.28  ? 246 ARG B C   1 
ATOM 5303 O O   . ARG B 1 246 ? -36.852 -36.566 76.009 1.00 7.32  ? 246 ARG B O   1 
ATOM 5304 C CB  . ARG B 1 246 ? -37.937 -38.149 78.364 1.00 8.59  ? 246 ARG B CB  1 
ATOM 5305 C CG  . ARG B 1 246 ? -39.084 -38.686 79.271 1.00 12.23 ? 246 ARG B CG  1 
ATOM 5306 C CD  . ARG B 1 246 ? -38.793 -38.301 80.677 1.00 9.69  ? 246 ARG B CD  1 
ATOM 5307 N NE  . ARG B 1 246 ? -39.841 -38.825 81.629 1.00 13.12 ? 246 ARG B NE  1 
ATOM 5308 C CZ  . ARG B 1 246 ? -40.866 -38.109 82.085 1.00 11.09 ? 246 ARG B CZ  1 
ATOM 5309 N NH1 . ARG B 1 246 ? -41.185 -36.900 81.707 1.00 9.17  ? 246 ARG B NH1 1 
ATOM 5310 N NH2 . ARG B 1 246 ? -41.624 -38.624 83.091 1.00 15.24 ? 246 ARG B NH2 1 
ATOM 5311 N N   . LEU B 1 247 ? -35.921 -35.589 77.819 1.00 7.14  ? 247 LEU B N   1 
ATOM 5312 C CA  . LEU B 1 247 ? -34.620 -35.394 77.108 1.00 6.65  ? 247 LEU B CA  1 
ATOM 5313 C C   . LEU B 1 247 ? -33.667 -36.338 77.837 1.00 8.09  ? 247 LEU B C   1 
ATOM 5314 O O   . LEU B 1 247 ? -33.460 -36.207 79.077 1.00 8.03  ? 247 LEU B O   1 
ATOM 5315 C CB  . LEU B 1 247 ? -34.186 -33.926 77.216 1.00 7.55  ? 247 LEU B CB  1 
ATOM 5316 C CG  . LEU B 1 247 ? -32.745 -33.726 76.742 1.00 11.25 ? 247 LEU B CG  1 
ATOM 5317 C CD1 . LEU B 1 247 ? -32.466 -34.210 75.420 1.00 14.60 ? 247 LEU B CD1 1 
ATOM 5318 C CD2 . LEU B 1 247 ? -32.490 -32.157 76.834 1.00 14.64 ? 247 LEU B CD2 1 
ATOM 5319 N N   . ILE B 1 248 ? -33.142 -37.309 77.124 1.00 7.26  ? 248 ILE B N   1 
ATOM 5320 C CA  . ILE B 1 248 ? -32.353 -38.400 77.770 1.00 6.99  ? 248 ILE B CA  1 
ATOM 5321 C C   . ILE B 1 248 ? -30.887 -38.188 77.404 1.00 7.07  ? 248 ILE B C   1 
ATOM 5322 O O   . ILE B 1 248 ? -30.542 -38.017 76.215 1.00 7.78  ? 248 ILE B O   1 
ATOM 5323 C CB  . ILE B 1 248 ? -32.772 -39.778 77.229 1.00 7.16  ? 248 ILE B CB  1 
ATOM 5324 C CG1 . ILE B 1 248 ? -34.277 -39.985 77.588 1.00 8.50  ? 248 ILE B CG1 1 
ATOM 5325 C CG2 . ILE B 1 248 ? -31.946 -40.888 77.936 1.00 9.48  ? 248 ILE B CG2 1 
ATOM 5326 C CD1 . ILE B 1 248 ? -34.889 -41.177 76.750 1.00 9.41  ? 248 ILE B CD1 1 
ATOM 5327 N N   . VAL B 1 249 ? -29.995 -38.167 78.396 1.00 7.78  ? 249 VAL B N   1 
ATOM 5328 C CA  . VAL B 1 249 ? -28.543 -37.913 78.146 1.00 7.56  ? 249 VAL B CA  1 
ATOM 5329 C C   . VAL B 1 249 ? -27.810 -39.178 78.490 1.00 9.29  ? 249 VAL B C   1 
ATOM 5330 O O   . VAL B 1 249 ? -27.936 -39.680 79.632 1.00 11.24 ? 249 VAL B O   1 
ATOM 5331 C CB  . VAL B 1 249 ? -28.038 -36.793 79.085 1.00 7.45  ? 249 VAL B CB  1 
ATOM 5332 C CG1 . VAL B 1 249 ? -26.555 -36.543 78.751 1.00 8.45  ? 249 VAL B CG1 1 
ATOM 5333 C CG2 . VAL B 1 249 ? -28.876 -35.562 78.941 1.00 7.91  ? 249 VAL B CG2 1 
ATOM 5334 N N   . LEU B 1 250 ? -27.059 -39.737 77.563 1.00 7.76  ? 250 LEU B N   1 
ATOM 5335 C CA  . LEU B 1 250 ? -26.231 -40.915 77.900 1.00 8.51  ? 250 LEU B CA  1 
ATOM 5336 C C   . LEU B 1 250 ? -24.805 -40.524 77.574 1.00 10.49 ? 250 LEU B C   1 
ATOM 5337 O O   . LEU B 1 250 ? -24.449 -40.266 76.428 1.00 9.99  ? 250 LEU B O   1 
ATOM 5338 C CB  . LEU B 1 250 ? -26.637 -42.143 77.109 1.00 9.91  ? 250 LEU B CB  1 
ATOM 5339 C CG  . LEU B 1 250 ? -28.048 -42.689 77.394 1.00 9.20  ? 250 LEU B CG  1 
ATOM 5340 C CD1 . LEU B 1 250 ? -29.158 -41.579 77.211 1.00 10.26 ? 250 LEU B CD1 1 
ATOM 5341 C CD2 . LEU B 1 250 ? -28.419 -43.833 76.447 1.00 11.83 ? 250 LEU B CD2 1 
ATOM 5342 N N   . ASN B 1 251 ? -23.958 -40.572 78.627 1.00 8.97  ? 251 ASN B N   1 
ATOM 5343 C CA  . ASN B 1 251 ? -22.601 -40.066 78.429 1.00 9.57  ? 251 ASN B CA  1 
ATOM 5344 C C   . ASN B 1 251 ? -21.578 -41.179 78.630 1.00 8.46  ? 251 ASN B C   1 
ATOM 5345 O O   . ASN B 1 251 ? -21.528 -41.794 79.733 1.00 10.97 ? 251 ASN B O   1 
ATOM 5346 C CB  . ASN B 1 251 ? -22.393 -38.953 79.480 1.00 9.75  ? 251 ASN B CB  1 
ATOM 5347 C CG  . ASN B 1 251 ? -21.095 -38.196 79.278 1.00 12.99 ? 251 ASN B CG  1 
ATOM 5348 O OD1 . ASN B 1 251 ? -20.188 -38.723 78.702 1.00 12.26 ? 251 ASN B OD1 1 
ATOM 5349 N ND2 . ASN B 1 251 ? -21.077 -36.913 79.693 1.00 15.92 ? 251 ASN B ND2 1 
ATOM 5350 N N   . TYR B 1 252 ? -20.947 -41.556 77.568 1.00 8.80  ? 252 TYR B N   1 
ATOM 5351 C CA  . TYR B 1 252 ? -19.934 -42.624 77.561 1.00 7.94  ? 252 TYR B CA  1 
ATOM 5352 C C   . TYR B 1 252 ? -18.550 -41.999 77.513 1.00 9.64  ? 252 TYR B C   1 
ATOM 5353 O O   . TYR B 1 252 ? -18.199 -41.349 76.576 1.00 9.78  ? 252 TYR B O   1 
ATOM 5354 C CB  . TYR B 1 252 ? -20.151 -43.561 76.338 1.00 9.29  ? 252 TYR B CB  1 
ATOM 5355 C CG  . TYR B 1 252 ? -18.993 -44.526 76.066 1.00 9.67  ? 252 TYR B CG  1 
ATOM 5356 C CD1 . TYR B 1 252 ? -18.772 -45.606 76.906 1.00 12.81 ? 252 TYR B CD1 1 
ATOM 5357 C CD2 . TYR B 1 252 ? -18.127 -44.307 74.973 1.00 9.03  ? 252 TYR B CD2 1 
ATOM 5358 C CE1 . TYR B 1 252 ? -17.708 -46.506 76.610 1.00 10.65 ? 252 TYR B CE1 1 
ATOM 5359 C CE2 . TYR B 1 252 ? -17.092 -45.190 74.663 1.00 9.62  ? 252 TYR B CE2 1 
ATOM 5360 C CZ  . TYR B 1 252 ? -16.917 -46.264 75.512 1.00 12.55 ? 252 TYR B CZ  1 
ATOM 5361 O OH  . TYR B 1 252 ? -15.882 -47.136 75.220 1.00 14.56 ? 252 TYR B OH  1 
ATOM 5362 N N   . GLN B 1 253 ? -17.753 -42.252 78.567 1.00 10.97 ? 253 GLN B N   1 
ATOM 5363 C CA  . GLN B 1 253 ? -16.397 -41.543 78.637 1.00 11.06 ? 253 GLN B CA  1 
ATOM 5364 C C   . GLN B 1 253 ? -15.325 -42.598 78.343 1.00 13.65 ? 253 GLN B C   1 
ATOM 5365 O O   . GLN B 1 253 ? -14.636 -43.110 79.299 1.00 17.71 ? 253 GLN B O   1 
ATOM 5366 C CB  . GLN B 1 253 ? -16.267 -40.898 80.037 1.00 11.57 ? 253 GLN B CB  1 
ATOM 5367 C CG  . GLN B 1 253 ? -17.159 -39.752 80.134 1.00 11.92 ? 253 GLN B CG  1 
ATOM 5368 C CD  . GLN B 1 253 ? -16.607 -38.544 79.389 1.00 14.76 ? 253 GLN B CD  1 
ATOM 5369 O OE1 . GLN B 1 253 ? -15.391 -38.195 79.593 1.00 16.84 ? 253 GLN B OE1 1 
ATOM 5370 N NE2 . GLN B 1 253 ? -17.408 -37.864 78.572 1.00 13.66 ? 253 GLN B NE2 1 
ATOM 5371 N N   . GLY B 1 254 ? -15.212 -42.991 77.094 1.00 11.09 ? 254 GLY B N   1 
ATOM 5372 C CA  . GLY B 1 254 ? -14.223 -43.960 76.686 1.00 11.28 ? 254 GLY B CA  1 
ATOM 5373 C C   . GLY B 1 254 ? -12.889 -43.336 76.291 1.00 12.93 ? 254 GLY B C   1 
ATOM 5374 O O   . GLY B 1 254 ? -11.936 -44.092 76.035 1.00 15.16 ? 254 GLY B O   1 
ATOM 5375 N N   . GLY B 1 255 ? -12.872 -42.022 76.116 1.00 11.44 ? 255 GLY B N   1 
ATOM 5376 C CA  . GLY B 1 255 ? -11.622 -41.344 75.609 1.00 10.79 ? 255 GLY B CA  1 
ATOM 5377 C C   . GLY B 1 255 ? -10.804 -40.813 76.774 1.00 10.87 ? 255 GLY B C   1 
ATOM 5378 O O   . GLY B 1 255 ? -11.175 -40.965 77.913 1.00 12.26 ? 255 GLY B O   1 
ATOM 5379 N N   . LYS B 1 256 ? -9.768  -40.044 76.392 1.00 11.43 ? 256 LYS B N   1 
ATOM 5380 C CA  . LYS B 1 256 ? -9.059  -39.294 77.426 1.00 11.69 ? 256 LYS B CA  1 
ATOM 5381 C C   . LYS B 1 256 ? -9.888  -38.206 78.023 1.00 11.94 ? 256 LYS B C   1 
ATOM 5382 O O   . LYS B 1 256 ? -10.871 -37.666 77.385 1.00 11.71 ? 256 LYS B O   1 
ATOM 5383 C CB  . LYS B 1 256 ? -7.780  -38.711 76.782 1.00 13.43 ? 256 LYS B CB  1 
ATOM 5384 C CG  . LYS B 1 256 ? -6.797  -39.788 76.444 1.00 14.97 ? 256 LYS B CG  1 
ATOM 5385 C CD  . LYS B 1 256 ? -5.571  -39.115 75.835 1.00 24.61 ? 256 LYS B CD  1 
ATOM 5386 C CE  . LYS B 1 256 ? -4.677  -40.183 75.257 1.00 24.68 ? 256 LYS B CE  1 
ATOM 5387 N NZ  . LYS B 1 256 ? -3.491  -39.552 74.678 1.00 37.34 ? 256 LYS B NZ  1 
ATOM 5388 N N   . LYS B 1 257 ? -9.638  -37.838 79.274 1.00 11.96 ? 257 LYS B N   1 
ATOM 5389 C CA  . LYS B 1 257 ? -10.491 -36.894 79.919 1.00 13.27 ? 257 LYS B CA  1 
ATOM 5390 C C   . LYS B 1 257 ? -10.650 -35.552 79.150 1.00 11.74 ? 257 LYS B C   1 
ATOM 5391 O O   . LYS B 1 257 ? -11.715 -34.880 79.174 1.00 14.41 ? 257 LYS B O   1 
ATOM 5392 C CB  . LYS B 1 257 ? -9.933  -36.591 81.333 1.00 15.62 ? 257 LYS B CB  1 
ATOM 5393 C CG  . LYS B 1 257 ? -10.676 -35.607 82.036 1.00 24.97 ? 257 LYS B CG  1 
ATOM 5394 C CD  . LYS B 1 257 ? -11.863 -36.249 82.675 1.00 36.09 ? 257 LYS B CD  1 
ATOM 5395 C CE  . LYS B 1 257 ? -12.473 -35.317 83.750 1.00 41.39 ? 257 LYS B CE  1 
ATOM 5396 N NZ  . LYS B 1 257 ? -13.568 -36.039 84.459 1.00 43.17 ? 257 LYS B NZ  1 
ATOM 5397 N N   . ALA B 1 258 ? -9.553  -35.068 78.556 1.00 9.81  ? 258 ALA B N   1 
ATOM 5398 C CA  . ALA B 1 258 ? -9.580  -33.789 77.859 1.00 10.85 ? 258 ALA B CA  1 
ATOM 5399 C C   . ALA B 1 258 ? -9.860  -33.902 76.352 1.00 10.78 ? 258 ALA B C   1 
ATOM 5400 O O   . ALA B 1 258 ? -9.793  -32.921 75.629 1.00 13.15 ? 258 ALA B O   1 
ATOM 5401 C CB  . ALA B 1 258 ? -8.244  -32.976 78.032 1.00 11.92 ? 258 ALA B CB  1 
ATOM 5402 N N   . ASP B 1 259 ? -10.229 -35.141 75.903 1.00 9.73  ? 259 ASP B N   1 
ATOM 5403 C CA  . ASP B 1 259 ? -10.666 -35.263 74.503 1.00 10.30 ? 259 ASP B CA  1 
ATOM 5404 C C   . ASP B 1 259 ? -12.085 -34.714 74.338 1.00 9.00  ? 259 ASP B C   1 
ATOM 5405 O O   . ASP B 1 259 ? -12.979 -35.023 75.171 1.00 9.43  ? 259 ASP B O   1 
ATOM 5406 C CB  . ASP B 1 259 ? -10.671 -36.727 74.061 1.00 8.74  ? 259 ASP B CB  1 
ATOM 5407 C CG  . ASP B 1 259 ? -9.296  -37.316 73.884 1.00 11.62 ? 259 ASP B CG  1 
ATOM 5408 O OD1 . ASP B 1 259 ? -8.274  -36.606 73.722 1.00 13.28 ? 259 ASP B OD1 1 
ATOM 5409 O OD2 . ASP B 1 259 ? -9.272  -38.599 73.783 1.00 15.60 ? 259 ASP B OD2 1 
ATOM 5410 N N   . LYS B 1 260 ? -12.283 -33.889 73.295 1.00 9.26  ? 260 LYS B N   1 
ATOM 5411 C CA  . LYS B 1 260 ? -13.694 -33.363 73.130 1.00 9.44  ? 260 LYS B CA  1 
ATOM 5412 C C   . LYS B 1 260 ? -14.552 -34.536 72.696 1.00 9.56  ? 260 LYS B C   1 
ATOM 5413 O O   . LYS B 1 260 ? -14.154 -35.414 71.929 1.00 8.28  ? 260 LYS B O   1 
ATOM 5414 C CB  . LYS B 1 260 ? -13.703 -32.351 72.005 1.00 9.13  ? 260 LYS B CB  1 
ATOM 5415 C CG  . LYS B 1 260 ? -12.920 -31.078 72.501 1.00 12.36 ? 260 LYS B CG  1 
ATOM 5416 C CD  . LYS B 1 260 ? -12.988 -30.032 71.397 1.00 17.30 ? 260 LYS B CD  1 
ATOM 5417 C CE  . LYS B 1 260 ? -12.450 -28.633 71.825 1.00 24.50 ? 260 LYS B CE  1 
ATOM 5418 N NZ  . LYS B 1 260 ? -13.650 -28.125 72.468 1.00 31.05 ? 260 LYS B NZ  1 
ATOM 5419 N N   . PRO B 1 261 ? -15.820 -34.544 73.135 1.00 9.48  ? 261 PRO B N   1 
ATOM 5420 C CA  . PRO B 1 261 ? -16.726 -35.621 72.767 1.00 7.81  ? 261 PRO B CA  1 
ATOM 5421 C C   . PRO B 1 261 ? -17.355 -35.449 71.412 1.00 7.71  ? 261 PRO B C   1 
ATOM 5422 O O   . PRO B 1 261 ? -17.370 -34.346 70.828 1.00 9.32  ? 261 PRO B O   1 
ATOM 5423 C CB  . PRO B 1 261 ? -17.848 -35.516 73.836 1.00 8.52  ? 261 PRO B CB  1 
ATOM 5424 C CG  . PRO B 1 261 ? -17.840 -34.043 74.146 1.00 8.63  ? 261 PRO B CG  1 
ATOM 5425 C CD  . PRO B 1 261 ? -16.731 -33.476 73.234 1.00 8.35  ? 261 PRO B CD  1 
ATOM 5426 N N   . PHE B 1 262 ? -17.811 -36.586 70.894 1.00 8.29  ? 262 PHE B N   1 
ATOM 5427 C CA  . PHE B 1 262 ? -18.718 -36.615 69.709 1.00 7.51  ? 262 PHE B CA  1 
ATOM 5428 C C   . PHE B 1 262 ? -20.117 -36.611 70.352 1.00 8.17  ? 262 PHE B C   1 
ATOM 5429 O O   . PHE B 1 262 ? -20.344 -37.397 71.276 1.00 8.78  ? 262 PHE B O   1 
ATOM 5430 C CB  . PHE B 1 262 ? -18.455 -37.914 68.991 1.00 9.48  ? 262 PHE B CB  1 
ATOM 5431 C CG  . PHE B 1 262 ? -17.046 -37.957 68.440 1.00 9.26  ? 262 PHE B CG  1 
ATOM 5432 C CD1 . PHE B 1 262 ? -16.722 -37.375 67.249 1.00 10.07 ? 262 PHE B CD1 1 
ATOM 5433 C CD2 . PHE B 1 262 ? -16.043 -38.561 69.229 1.00 12.03 ? 262 PHE B CD2 1 
ATOM 5434 C CE1 . PHE B 1 262 ? -15.365 -37.383 66.787 1.00 9.69  ? 262 PHE B CE1 1 
ATOM 5435 C CE2 . PHE B 1 262 ? -14.703 -38.589 68.775 1.00 11.34 ? 262 PHE B CE2 1 
ATOM 5436 C CZ  . PHE B 1 262 ? -14.384 -37.962 67.621 1.00 8.42  ? 262 PHE B CZ  1 
ATOM 5437 N N   . VAL B 1 263 ? -21.012 -35.804 69.829 1.00 8.07  ? 263 VAL B N   1 
ATOM 5438 C CA  . VAL B 1 263 ? -22.396 -35.789 70.337 1.00 8.47  ? 263 VAL B CA  1 
ATOM 5439 C C   . VAL B 1 263 ? -23.316 -36.325 69.259 1.00 8.49  ? 263 VAL B C   1 
ATOM 5440 O O   . VAL B 1 263 ? -23.238 -35.835 68.107 1.00 7.54  ? 263 VAL B O   1 
ATOM 5441 C CB  . VAL B 1 263 ? -22.777 -34.342 70.714 1.00 7.78  ? 263 VAL B CB  1 
ATOM 5442 C CG1 . VAL B 1 263 ? -24.250 -34.235 71.222 1.00 9.51  ? 263 VAL B CG1 1 
ATOM 5443 C CG2 . VAL B 1 263 ? -21.967 -33.855 71.915 1.00 10.37 ? 263 VAL B CG2 1 
ATOM 5444 N N   . LEU B 1 264 ? -24.148 -37.305 69.633 1.00 6.18  ? 264 LEU B N   1 
ATOM 5445 C CA  . LEU B 1 264 ? -25.208 -37.715 68.680 1.00 5.41  ? 264 LEU B CA  1 
ATOM 5446 C C   . LEU B 1 264 ? -26.561 -37.283 69.231 1.00 7.39  ? 264 LEU B C   1 
ATOM 5447 O O   . LEU B 1 264 ? -26.836 -37.562 70.406 1.00 8.55  ? 264 LEU B O   1 
ATOM 5448 C CB  . LEU B 1 264 ? -25.225 -39.247 68.564 1.00 7.32  ? 264 LEU B CB  1 
ATOM 5449 C CG  . LEU B 1 264 ? -23.898 -39.868 68.062 1.00 8.85  ? 264 LEU B CG  1 
ATOM 5450 C CD1 . LEU B 1 264 ? -24.081 -41.402 67.960 1.00 11.50 ? 264 LEU B CD1 1 
ATOM 5451 C CD2 . LEU B 1 264 ? -23.587 -39.288 66.599 1.00 11.87 ? 264 LEU B CD2 1 
ATOM 5452 N N   . VAL B 1 265 ? -27.376 -36.581 68.417 1.00 7.29  ? 265 VAL B N   1 
ATOM 5453 C CA  . VAL B 1 265 ? -28.687 -36.079 68.844 1.00 6.98  ? 265 VAL B CA  1 
ATOM 5454 C C   . VAL B 1 265 ? -29.731 -36.806 68.051 1.00 7.38  ? 265 VAL B C   1 
ATOM 5455 O O   . VAL B 1 265 ? -29.690 -36.741 66.849 1.00 8.43  ? 265 VAL B O   1 
ATOM 5456 C CB  . VAL B 1 265 ? -28.779 -34.593 68.513 1.00 5.29  ? 265 VAL B CB  1 
ATOM 5457 C CG1 . VAL B 1 265 ? -30.190 -34.080 68.962 1.00 8.36  ? 265 VAL B CG1 1 
ATOM 5458 C CG2 . VAL B 1 265 ? -27.679 -33.880 69.293 1.00 7.58  ? 265 VAL B CG2 1 
ATOM 5459 N N   . GLY B 1 266 ? -30.624 -37.514 68.728 1.00 6.37  ? 266 GLY B N   1 
ATOM 5460 C CA  . GLY B 1 266 ? -31.645 -38.237 67.965 1.00 5.18  ? 266 GLY B CA  1 
ATOM 5461 C C   . GLY B 1 266 ? -33.040 -37.744 68.180 1.00 6.45  ? 266 GLY B C   1 
ATOM 5462 O O   . GLY B 1 266 ? -33.427 -37.525 69.327 1.00 8.02  ? 266 GLY B O   1 
ATOM 5463 N N   . LYS B 1 267 ? -33.794 -37.601 67.071 1.00 5.41  ? 267 LYS B N   1 
ATOM 5464 C CA  . LYS B 1 267 ? -35.227 -37.248 67.208 1.00 5.29  ? 267 LYS B CA  1 
ATOM 5465 C C   . LYS B 1 267 ? -35.978 -38.457 67.699 1.00 6.58  ? 267 LYS B C   1 
ATOM 5466 O O   . LYS B 1 267 ? -35.957 -39.552 67.096 1.00 6.53  ? 267 LYS B O   1 
ATOM 5467 C CB  . LYS B 1 267 ? -35.696 -36.899 65.765 1.00 6.46  ? 267 LYS B CB  1 
ATOM 5468 C CG  . LYS B 1 267 ? -37.290 -36.675 65.766 1.00 8.10  ? 267 LYS B CG  1 
ATOM 5469 C CD  . LYS B 1 267 ? -37.729 -36.348 64.272 1.00 7.01  ? 267 LYS B CD  1 
ATOM 5470 C CE  . LYS B 1 267 ? -39.243 -36.304 64.298 1.00 6.47  ? 267 LYS B CE  1 
ATOM 5471 N NZ  . LYS B 1 267 ? -39.862 -35.896 62.930 1.00 7.44  ? 267 LYS B NZ  1 
ATOM 5472 N N   . GLY B 1 268 ? -36.644 -38.289 68.835 1.00 5.73  ? 268 GLY B N   1 
ATOM 5473 C CA  . GLY B 1 268 ? -37.333 -39.348 69.469 1.00 5.95  ? 268 GLY B CA  1 
ATOM 5474 C C   . GLY B 1 268 ? -38.857 -39.027 69.560 1.00 5.68  ? 268 GLY B C   1 
ATOM 5475 O O   . GLY B 1 268 ? -39.465 -39.138 70.634 1.00 5.17  ? 268 GLY B O   1 
ATOM 5476 N N   . ILE B 1 269 ? -39.504 -38.729 68.412 1.00 6.31  ? 269 ILE B N   1 
ATOM 5477 C CA  . ILE B 1 269 ? -40.969 -38.510 68.429 1.00 5.66  ? 269 ILE B CA  1 
ATOM 5478 C C   . ILE B 1 269 ? -41.602 -39.880 68.375 1.00 5.80  ? 269 ILE B C   1 
ATOM 5479 O O   . ILE B 1 269 ? -41.555 -40.589 67.322 1.00 7.06  ? 269 ILE B O   1 
ATOM 5480 C CB  . ILE B 1 269 ? -41.385 -37.605 67.296 1.00 4.47  ? 269 ILE B CB  1 
ATOM 5481 C CG1 . ILE B 1 269 ? -40.793 -36.180 67.392 1.00 6.12  ? 269 ILE B CG1 1 
ATOM 5482 C CG2 . ILE B 1 269 ? -42.914 -37.560 67.251 1.00 7.10  ? 269 ILE B CG2 1 
ATOM 5483 C CD1 . ILE B 1 269 ? -41.157 -35.444 68.730 1.00 6.05  ? 269 ILE B CD1 1 
ATOM 5484 N N   . MET B 1 291 ? -39.368 -42.145 65.907 1.00 6.12  ? 291 MET B N   1 
ATOM 5485 C CA  . MET B 1 291 ? -38.331 -42.170 66.934 1.00 6.53  ? 291 MET B CA  1 
ATOM 5486 C C   . MET B 1 291 ? -37.096 -42.956 66.475 1.00 7.83  ? 291 MET B C   1 
ATOM 5487 O O   . MET B 1 291 ? -36.235 -43.243 67.333 1.00 7.91  ? 291 MET B O   1 
ATOM 5488 C CB  . MET B 1 291 ? -38.855 -42.611 68.340 1.00 6.53  ? 291 MET B CB  1 
ATOM 5489 C CG  . MET B 1 291 ? -39.307 -44.054 68.412 1.00 6.35  ? 291 MET B CG  1 
ATOM 5490 S SD  . MET B 1 291 ? -39.746 -44.612 70.042 1.00 7.76  ? 291 MET B SD  1 
ATOM 5491 C CE  . MET B 1 291 ? -38.053 -44.884 70.753 1.00 7.65  ? 291 MET B CE  1 
ATOM 5492 N N   . CYS B 1 292 ? -36.989 -43.249 65.162 1.00 7.29  ? 292 CYS B N   1 
ATOM 5493 C CA  . CYS B 1 292 ? -35.837 -44.035 64.718 1.00 8.06  ? 292 CYS B CA  1 
ATOM 5494 C C   . CYS B 1 292 ? -34.536 -43.293 64.746 1.00 10.63 ? 292 CYS B C   1 
ATOM 5495 O O   . CYS B 1 292 ? -33.489 -43.935 64.760 1.00 9.77  ? 292 CYS B O   1 
ATOM 5496 C CB  . CYS B 1 292 ? -36.064 -44.448 63.288 1.00 9.30  ? 292 CYS B CB  1 
ATOM 5497 S SG  . CYS B 1 292 ? -37.217 -45.950 63.171 1.00 12.45 ? 292 CYS B SG  1 
ATOM 5498 N N   . GLY B 1 293 ? -34.581 -41.933 64.727 1.00 9.80  ? 293 GLY B N   1 
ATOM 5499 C CA  . GLY B 1 293 ? -33.332 -41.166 65.049 1.00 7.28  ? 293 GLY B CA  1 
ATOM 5500 C C   . GLY B 1 293 ? -32.800 -41.500 66.407 1.00 7.80  ? 293 GLY B C   1 
ATOM 5501 O O   . GLY B 1 293 ? -31.634 -41.965 66.548 1.00 7.83  ? 293 GLY B O   1 
ATOM 5502 N N   . ALA B 1 294 ? -33.636 -41.345 67.421 1.00 7.58  ? 294 ALA B N   1 
ATOM 5503 C CA  . ALA B 1 294 ? -33.251 -41.733 68.744 1.00 7.91  ? 294 ALA B CA  1 
ATOM 5504 C C   . ALA B 1 294 ? -32.909 -43.219 68.838 1.00 9.40  ? 294 ALA B C   1 
ATOM 5505 O O   . ALA B 1 294 ? -31.938 -43.575 69.559 1.00 8.60  ? 294 ALA B O   1 
ATOM 5506 C CB  . ALA B 1 294 ? -34.358 -41.374 69.782 1.00 7.65  ? 294 ALA B CB  1 
ATOM 5507 N N   . ALA B 1 295 ? -33.684 -44.095 68.184 1.00 7.44  ? 295 ALA B N   1 
ATOM 5508 C CA  . ALA B 1 295 ? -33.317 -45.519 68.221 1.00 7.30  ? 295 ALA B CA  1 
ATOM 5509 C C   . ALA B 1 295 ? -31.971 -45.771 67.589 1.00 6.11  ? 295 ALA B C   1 
ATOM 5510 O O   . ALA B 1 295 ? -31.282 -46.683 68.078 1.00 7.64  ? 295 ALA B O   1 
ATOM 5511 C CB  . ALA B 1 295 ? -34.435 -46.322 67.417 1.00 7.80  ? 295 ALA B CB  1 
ATOM 5512 N N   . SER B 1 296 ? -31.630 -45.121 66.473 1.00 7.40  ? 296 SER B N   1 
ATOM 5513 C CA  . SER B 1 296 ? -30.295 -45.374 65.893 1.00 8.65  ? 296 SER B CA  1 
ATOM 5514 C C   . SER B 1 296 ? -29.165 -44.877 66.812 1.00 7.65  ? 296 SER B C   1 
ATOM 5515 O O   . SER B 1 296 ? -28.078 -45.424 66.755 1.00 7.99  ? 296 SER B O   1 
ATOM 5516 C CB  . SER B 1 296 ? -30.234 -44.791 64.497 1.00 8.66  ? 296 SER B CB  1 
ATOM 5517 O OG  . SER B 1 296 ? -30.147 -43.348 64.545 1.00 11.05 ? 296 SER B OG  1 
ATOM 5518 N N   . VAL B 1 297 ? -29.396 -43.818 67.598 1.00 6.83  ? 297 VAL B N   1 
ATOM 5519 C CA  . VAL B 1 297 ? -28.398 -43.377 68.573 1.00 6.98  ? 297 VAL B CA  1 
ATOM 5520 C C   . VAL B 1 297 ? -28.227 -44.476 69.678 1.00 9.12  ? 297 VAL B C   1 
ATOM 5521 O O   . VAL B 1 297 ? -27.084 -44.857 69.997 1.00 8.61  ? 297 VAL B O   1 
ATOM 5522 C CB  . VAL B 1 297 ? -28.785 -42.017 69.114 1.00 8.72  ? 297 VAL B CB  1 
ATOM 5523 C CG1 . VAL B 1 297 ? -27.804 -41.616 70.189 1.00 8.72  ? 297 VAL B CG1 1 
ATOM 5524 C CG2 . VAL B 1 297 ? -28.704 -40.937 68.026 1.00 7.00  ? 297 VAL B CG2 1 
ATOM 5525 N N   . PHE B 1 298 ? -29.331 -45.003 70.236 1.00 7.43  ? 298 PHE B N   1 
ATOM 5526 C CA  . PHE B 1 298 ? -29.244 -46.107 71.178 1.00 7.63  ? 298 PHE B CA  1 
ATOM 5527 C C   . PHE B 1 298 ? -28.472 -47.264 70.543 1.00 7.25  ? 298 PHE B C   1 
ATOM 5528 O O   . PHE B 1 298 ? -27.632 -47.880 71.194 1.00 8.60  ? 298 PHE B O   1 
ATOM 5529 C CB  . PHE B 1 298 ? -30.670 -46.622 71.449 1.00 8.51  ? 298 PHE B CB  1 
ATOM 5530 C CG  . PHE B 1 298 ? -31.313 -46.117 72.709 1.00 7.54  ? 298 PHE B CG  1 
ATOM 5531 C CD1 . PHE B 1 298 ? -32.515 -45.472 72.585 1.00 8.58  ? 298 PHE B CD1 1 
ATOM 5532 C CD2 . PHE B 1 298 ? -30.767 -46.357 73.975 1.00 12.22 ? 298 PHE B CD2 1 
ATOM 5533 C CE1 . PHE B 1 298 ? -33.238 -45.072 73.716 1.00 12.63 ? 298 PHE B CE1 1 
ATOM 5534 C CE2 . PHE B 1 298 ? -31.506 -45.964 75.177 1.00 12.34 ? 298 PHE B CE2 1 
ATOM 5535 C CZ  . PHE B 1 298 ? -32.758 -45.280 74.992 1.00 13.15 ? 298 PHE B CZ  1 
ATOM 5536 N N   . GLY B 1 299 ? -28.736 -47.624 69.249 1.00 7.23  ? 299 GLY B N   1 
ATOM 5537 C CA  . GLY B 1 299 ? -28.054 -48.758 68.686 1.00 8.72  ? 299 GLY B CA  1 
ATOM 5538 C C   . GLY B 1 299 ? -26.579 -48.515 68.368 1.00 6.49  ? 299 GLY B C   1 
ATOM 5539 O O   . GLY B 1 299 ? -25.768 -49.396 68.588 1.00 8.03  ? 299 GLY B O   1 
ATOM 5540 N N   . THR B 1 300 ? -26.266 -47.275 67.903 1.00 9.04  ? 300 THR B N   1 
ATOM 5541 C CA  . THR B 1 300 ? -24.803 -46.913 67.756 1.00 8.76  ? 300 THR B CA  1 
ATOM 5542 C C   . THR B 1 300 ? -24.120 -46.972 69.144 1.00 7.94  ? 300 THR B C   1 
ATOM 5543 O O   . THR B 1 300 ? -23.026 -47.540 69.266 1.00 7.92  ? 300 THR B O   1 
ATOM 5544 C CB  . THR B 1 300 ? -24.742 -45.524 67.142 1.00 8.64  ? 300 THR B CB  1 
ATOM 5545 O OG1 . THR B 1 300 ? -25.405 -45.539 65.885 1.00 9.14  ? 300 THR B OG1 1 
ATOM 5546 C CG2 . THR B 1 300 ? -23.256 -45.122 66.975 1.00 10.06 ? 300 THR B CG2 1 
ATOM 5547 N N   . LEU B 1 301 ? -24.754 -46.395 70.138 1.00 7.99  ? 301 LEU B N   1 
ATOM 5548 C CA  . LEU B 1 301 ? -24.148 -46.498 71.518 1.00 8.07  ? 301 LEU B CA  1 
ATOM 5549 C C   . LEU B 1 301 ? -23.977 -47.936 71.924 1.00 8.64  ? 301 LEU B C   1 
ATOM 5550 O O   . LEU B 1 301 ? -22.909 -48.267 72.452 1.00 9.33  ? 301 LEU B O   1 
ATOM 5551 C CB  . LEU B 1 301 ? -24.974 -45.744 72.539 1.00 9.76  ? 301 LEU B CB  1 
ATOM 5552 C CG  . LEU B 1 301 ? -24.587 -45.928 73.995 1.00 9.59  ? 301 LEU B CG  1 
ATOM 5553 C CD1 . LEU B 1 301 ? -23.168 -45.327 74.151 1.00 10.08 ? 301 LEU B CD1 1 
ATOM 5554 C CD2 . LEU B 1 301 ? -25.604 -45.138 74.759 1.00 9.96  ? 301 LEU B CD2 1 
ATOM 5555 N N   . ARG B 1 302 ? -24.966 -48.834 71.688 1.00 6.85  ? 302 ARG B N   1 
ATOM 5556 C CA  . ARG B 1 302 ? -24.751 -50.216 72.087 1.00 8.69  ? 302 ARG B CA  1 
ATOM 5557 C C   . ARG B 1 302 ? -23.564 -50.806 71.291 1.00 8.00  ? 302 ARG B C   1 
ATOM 5558 O O   . ARG B 1 302 ? -22.793 -51.583 71.885 1.00 10.53 ? 302 ARG B O   1 
ATOM 5559 C CB  . ARG B 1 302 ? -26.036 -51.058 71.738 1.00 10.45 ? 302 ARG B CB  1 
ATOM 5560 C CG  . ARG B 1 302 ? -25.846 -52.554 71.843 1.00 14.92 ? 302 ARG B CG  1 
ATOM 5561 C CD  . ARG B 1 302 ? -27.134 -53.382 72.084 1.00 24.55 ? 302 ARG B CD  1 
ATOM 5562 N NE  . ARG B 1 302 ? -27.558 -53.183 73.500 1.00 28.98 ? 302 ARG B NE  1 
ATOM 5563 C CZ  . ARG B 1 302 ? -28.723 -53.634 74.021 1.00 31.55 ? 302 ARG B CZ  1 
ATOM 5564 N NH1 . ARG B 1 302 ? -29.535 -54.371 73.290 1.00 26.57 ? 302 ARG B NH1 1 
ATOM 5565 N NH2 . ARG B 1 302 ? -29.048 -53.400 75.301 1.00 29.87 ? 302 ARG B NH2 1 
ATOM 5566 N N   . ALA B 1 303 ? -23.369 -50.538 70.006 1.00 8.60  ? 303 ALA B N   1 
ATOM 5567 C CA  . ALA B 1 303 ? -22.198 -51.034 69.273 1.00 8.58  ? 303 ALA B CA  1 
ATOM 5568 C C   . ALA B 1 303 ? -20.908 -50.484 69.805 1.00 9.68  ? 303 ALA B C   1 
ATOM 5569 O O   . ALA B 1 303 ? -19.919 -51.232 69.920 1.00 10.49 ? 303 ALA B O   1 
ATOM 5570 C CB  . ALA B 1 303 ? -22.357 -50.588 67.816 1.00 8.26  ? 303 ALA B CB  1 
ATOM 5571 N N   . VAL B 1 304 ? -20.876 -49.191 70.135 1.00 9.21  ? 304 VAL B N   1 
ATOM 5572 C CA  . VAL B 1 304 ? -19.645 -48.586 70.763 1.00 8.57  ? 304 VAL B CA  1 
ATOM 5573 C C   . VAL B 1 304 ? -19.328 -49.235 72.086 1.00 10.82 ? 304 VAL B C   1 
ATOM 5574 O O   . VAL B 1 304 ? -18.152 -49.435 72.370 1.00 11.81 ? 304 VAL B O   1 
ATOM 5575 C CB  . VAL B 1 304 ? -19.899 -47.036 70.899 1.00 9.12  ? 304 VAL B CB  1 
ATOM 5576 C CG1 . VAL B 1 304 ? -18.738 -46.349 71.725 1.00 12.44 ? 304 VAL B CG1 1 
ATOM 5577 C CG2 . VAL B 1 304 ? -20.004 -46.398 69.519 1.00 10.44 ? 304 VAL B CG2 1 
ATOM 5578 N N   . LEU B 1 305 ? -20.327 -49.472 72.892 1.00 9.07  ? 305 LEU B N   1 
ATOM 5579 C CA  . LEU B 1 305 ? -20.087 -50.191 74.163 1.00 9.68  ? 305 LEU B CA  1 
ATOM 5580 C C   . LEU B 1 305 ? -19.539 -51.588 73.905 1.00 10.66 ? 305 LEU B C   1 
ATOM 5581 O O   . LEU B 1 305 ? -18.585 -51.975 74.749 1.00 11.49 ? 305 LEU B O   1 
ATOM 5582 C CB  . LEU B 1 305 ? -21.354 -50.293 75.037 1.00 10.11 ? 305 LEU B CB  1 
ATOM 5583 C CG  . LEU B 1 305 ? -21.897 -48.918 75.538 1.00 10.26 ? 305 LEU B CG  1 
ATOM 5584 C CD1 . LEU B 1 305 ? -23.345 -48.976 76.017 1.00 12.48 ? 305 LEU B CD1 1 
ATOM 5585 C CD2 . LEU B 1 305 ? -21.078 -48.451 76.727 1.00 16.58 ? 305 LEU B CD2 1 
ATOM 5586 N N   . GLU B 1 306 ? -20.092 -52.316 72.935 1.00 10.34 ? 306 GLU B N   1 
ATOM 5587 C CA  . GLU B 1 306 ? -19.585 -53.646 72.696 1.00 9.46  ? 306 GLU B CA  1 
ATOM 5588 C C   . GLU B 1 306 ? -18.097 -53.587 72.259 1.00 12.47 ? 306 GLU B C   1 
ATOM 5589 O O   . GLU B 1 306 ? -17.252 -54.470 72.674 1.00 14.88 ? 306 GLU B O   1 
ATOM 5590 C CB  . GLU B 1 306 ? -20.430 -54.314 71.593 1.00 12.30 ? 306 GLU B CB  1 
ATOM 5591 C CG  . GLU B 1 306 ? -19.978 -55.758 71.354 1.00 15.15 ? 306 GLU B CG  1 
ATOM 5592 C CD  . GLU B 1 306 ? -20.831 -56.445 70.305 1.00 22.66 ? 306 GLU B CD  1 
ATOM 5593 O OE1 . GLU B 1 306 ? -21.752 -55.763 69.745 1.00 24.30 ? 306 GLU B OE1 1 
ATOM 5594 O OE2 . GLU B 1 306 ? -20.626 -57.622 70.002 1.00 20.97 ? 306 GLU B OE2 1 
ATOM 5595 N N   . LEU B 1 307 ? -17.763 -52.639 71.420 1.00 11.12 ? 307 LEU B N   1 
ATOM 5596 C CA  . LEU B 1 307 ? -16.375 -52.442 70.952 1.00 11.18 ? 307 LEU B CA  1 
ATOM 5597 C C   . LEU B 1 307 ? -15.451 -51.752 71.951 1.00 11.95 ? 307 LEU B C   1 
ATOM 5598 O O   . LEU B 1 307 ? -14.210 -51.762 71.703 1.00 13.55 ? 307 LEU B O   1 
ATOM 5599 C CB  . LEU B 1 307 ? -16.447 -51.607 69.644 1.00 11.61 ? 307 LEU B CB  1 
ATOM 5600 C CG  . LEU B 1 307 ? -17.184 -52.375 68.492 1.00 13.07 ? 307 LEU B CG  1 
ATOM 5601 C CD1 . LEU B 1 307 ? -17.319 -51.463 67.360 1.00 15.98 ? 307 LEU B CD1 1 
ATOM 5602 C CD2 . LEU B 1 307 ? -16.389 -53.586 68.074 1.00 18.27 ? 307 LEU B CD2 1 
ATOM 5603 N N   . GLN B 1 308 ? -15.996 -51.170 72.998 1.00 11.79 ? 308 GLN B N   1 
ATOM 5604 C CA  . GLN B 1 308 ? -15.242 -50.344 73.921 1.00 12.71 ? 308 GLN B CA  1 
ATOM 5605 C C   . GLN B 1 308 ? -14.373 -49.332 73.196 1.00 12.82 ? 308 GLN B C   1 
ATOM 5606 O O   . GLN B 1 308 ? -13.134 -49.172 73.474 1.00 12.58 ? 308 GLN B O   1 
ATOM 5607 C CB  . GLN B 1 308 ? -14.367 -51.264 74.845 1.00 13.74 ? 308 GLN B CB  1 
ATOM 5608 C CG  . GLN B 1 308 ? -15.288 -52.113 75.784 1.00 18.47 ? 308 GLN B CG  1 
ATOM 5609 C CD  . GLN B 1 308 ? -14.458 -53.096 76.666 1.00 35.81 ? 308 GLN B CD  1 
ATOM 5610 O OE1 . GLN B 1 308 ? -13.333 -53.502 76.313 1.00 43.17 ? 308 GLN B OE1 1 
ATOM 5611 N NE2 . GLN B 1 308 ? -15.026 -53.479 77.802 1.00 43.17 ? 308 GLN B NE2 1 
ATOM 5612 N N   . LEU B 1 309 ? -14.941 -48.589 72.216 1.00 12.05 ? 309 LEU B N   1 
ATOM 5613 C CA  . LEU B 1 309 ? -14.091 -47.624 71.563 1.00 11.70 ? 309 LEU B CA  1 
ATOM 5614 C C   . LEU B 1 309 ? -13.542 -46.553 72.467 1.00 11.54 ? 309 LEU B C   1 
ATOM 5615 O O   . LEU B 1 309 ? -14.282 -46.058 73.358 1.00 12.29 ? 309 LEU B O   1 
ATOM 5616 C CB  . LEU B 1 309 ? -14.876 -46.918 70.387 1.00 12.95 ? 309 LEU B CB  1 
ATOM 5617 C CG  . LEU B 1 309 ? -15.428 -47.812 69.306 1.00 14.47 ? 309 LEU B CG  1 
ATOM 5618 C CD1 . LEU B 1 309 ? -16.067 -46.870 68.253 1.00 14.93 ? 309 LEU B CD1 1 
ATOM 5619 C CD2 . LEU B 1 309 ? -14.277 -48.705 68.724 1.00 14.55 ? 309 LEU B CD2 1 
ATOM 5620 N N   . PRO B 1 310 ? -12.324 -46.045 72.160 1.00 11.76 ? 310 PRO B N   1 
ATOM 5621 C CA  . PRO B 1 310 ? -11.710 -45.095 73.130 1.00 13.40 ? 310 PRO B CA  1 
ATOM 5622 C C   . PRO B 1 310 ? -12.048 -43.649 72.671 1.00 13.07 ? 310 PRO B C   1 
ATOM 5623 O O   . PRO B 1 310 ? -11.170 -42.826 72.301 1.00 14.47 ? 310 PRO B O   1 
ATOM 5624 C CB  . PRO B 1 310 ? -10.220 -45.378 72.933 1.00 11.67 ? 310 PRO B CB  1 
ATOM 5625 C CG  . PRO B 1 310 ? -10.106 -45.902 71.478 1.00 15.28 ? 310 PRO B CG  1 
ATOM 5626 C CD  . PRO B 1 310 ? -11.334 -46.718 71.290 1.00 13.47 ? 310 PRO B CD  1 
ATOM 5627 N N   . VAL B 1 311 ? -13.364 -43.340 72.731 1.00 11.92 ? 311 VAL B N   1 
ATOM 5628 C CA  . VAL B 1 311 ? -13.870 -41.993 72.449 1.00 12.36 ? 311 VAL B CA  1 
ATOM 5629 C C   . VAL B 1 311 ? -14.852 -41.595 73.496 1.00 9.36  ? 311 VAL B C   1 
ATOM 5630 O O   . VAL B 1 311 ? -15.424 -42.460 74.153 1.00 10.62 ? 311 VAL B O   1 
ATOM 5631 C CB  . VAL B 1 311 ? -14.684 -41.937 71.073 1.00 12.91 ? 311 VAL B CB  1 
ATOM 5632 C CG1 . VAL B 1 311 ? -13.679 -42.242 69.940 1.00 15.73 ? 311 VAL B CG1 1 
ATOM 5633 C CG2 . VAL B 1 311 ? -15.857 -42.866 71.076 1.00 10.97 ? 311 VAL B CG2 1 
ATOM 5634 N N   . ASN B 1 312 ? -15.006 -40.262 73.710 1.00 9.33  ? 312 ASN B N   1 
ATOM 5635 C CA  . ASN B 1 312 ? -16.035 -39.744 74.540 1.00 8.15  ? 312 ASN B CA  1 
ATOM 5636 C C   . ASN B 1 312 ? -17.283 -39.480 73.635 1.00 8.62  ? 312 ASN B C   1 
ATOM 5637 O O   . ASN B 1 312 ? -17.155 -38.829 72.618 1.00 9.72  ? 312 ASN B O   1 
ATOM 5638 C CB  . ASN B 1 312 ? -15.606 -38.424 75.195 1.00 7.62  ? 312 ASN B CB  1 
ATOM 5639 C CG  . ASN B 1 312 ? -14.443 -38.632 76.138 1.00 10.84 ? 312 ASN B CG  1 
ATOM 5640 O OD1 . ASN B 1 312 ? -13.586 -37.712 76.276 1.00 14.90 ? 312 ASN B OD1 1 
ATOM 5641 N ND2 . ASN B 1 312 ? -14.423 -39.705 76.793 1.00 7.35  ? 312 ASN B ND2 1 
ATOM 5642 N N   . LEU B 1 313 ? -18.406 -40.126 74.014 1.00 8.77  ? 313 LEU B N   1 
ATOM 5643 C CA  . LEU B 1 313 ? -19.640 -40.067 73.187 1.00 8.43  ? 313 LEU B CA  1 
ATOM 5644 C C   . LEU B 1 313 ? -20.763 -39.667 74.055 1.00 8.25  ? 313 LEU B C   1 
ATOM 5645 O O   . LEU B 1 313 ? -21.111 -40.362 75.032 1.00 10.76 ? 313 LEU B O   1 
ATOM 5646 C CB  . LEU B 1 313 ? -19.907 -41.483 72.603 1.00 9.02  ? 313 LEU B CB  1 
ATOM 5647 C CG  . LEU B 1 313 ? -21.186 -41.582 71.772 1.00 8.67  ? 313 LEU B CG  1 
ATOM 5648 C CD1 . LEU B 1 313 ? -21.055 -40.741 70.529 1.00 11.07 ? 313 LEU B CD1 1 
ATOM 5649 C CD2 . LEU B 1 313 ? -21.369 -43.061 71.319 1.00 9.69  ? 313 LEU B CD2 1 
ATOM 5650 N N   . VAL B 1 314 ? -21.384 -38.541 73.733 1.00 7.56  ? 314 VAL B N   1 
ATOM 5651 C CA  . VAL B 1 314 ? -22.581 -38.061 74.485 1.00 6.99  ? 314 VAL B CA  1 
ATOM 5652 C C   . VAL B 1 314 ? -23.796 -38.195 73.554 1.00 7.83  ? 314 VAL B C   1 
ATOM 5653 O O   . VAL B 1 314 ? -23.809 -37.619 72.424 1.00 8.71  ? 314 VAL B O   1 
ATOM 5654 C CB  . VAL B 1 314 ? -22.423 -36.587 74.865 1.00 7.34  ? 314 VAL B CB  1 
ATOM 5655 C CG1 . VAL B 1 314 ? -23.691 -36.105 75.625 1.00 11.28 ? 314 VAL B CG1 1 
ATOM 5656 C CG2 . VAL B 1 314 ? -21.176 -36.422 75.817 1.00 9.33  ? 314 VAL B CG2 1 
ATOM 5657 N N   . CYS B 1 315 ? -24.756 -38.937 74.033 1.00 7.18  ? 315 CYS B N   1 
ATOM 5658 C CA  . CYS B 1 315 ? -26.028 -39.163 73.231 1.00 7.04  ? 315 CYS B CA  1 
ATOM 5659 C C   . CYS B 1 315 ? -27.142 -38.399 73.874 1.00 6.02  ? 315 CYS B C   1 
ATOM 5660 O O   . CYS B 1 315 ? -27.367 -38.420 75.070 1.00 8.85  ? 315 CYS B O   1 
ATOM 5661 C CB  . CYS B 1 315 ? -26.416 -40.666 73.255 1.00 8.43  ? 315 CYS B CB  1 
ATOM 5662 S SG  . CYS B 1 315 ? -25.061 -41.683 72.532 1.00 10.39 ? 315 CYS B SG  1 
ATOM 5663 N N   . LEU B 1 316 ? -27.857 -37.613 73.039 1.00 7.21  ? 316 LEU B N   1 
ATOM 5664 C CA  . LEU B 1 316 ? -28.993 -36.790 73.522 1.00 7.21  ? 316 LEU B CA  1 
ATOM 5665 C C   . LEU B 1 316 ? -30.211 -37.222 72.773 1.00 8.34  ? 316 LEU B C   1 
ATOM 5666 O O   . LEU B 1 316 ? -30.224 -37.120 71.540 1.00 7.65  ? 316 LEU B O   1 
ATOM 5667 C CB  . LEU B 1 316 ? -28.726 -35.299 73.290 1.00 7.38  ? 316 LEU B CB  1 
ATOM 5668 C CG  . LEU B 1 316 ? -27.387 -34.755 73.863 1.00 8.79  ? 316 LEU B CG  1 
ATOM 5669 C CD1 . LEU B 1 316 ? -27.156 -33.315 73.409 1.00 8.92  ? 316 LEU B CD1 1 
ATOM 5670 C CD2 . LEU B 1 316 ? -27.563 -34.842 75.448 1.00 9.55  ? 316 LEU B CD2 1 
ATOM 5671 N N   . LEU B 1 317 ? -31.193 -37.776 73.490 1.00 6.55  ? 317 LEU B N   1 
ATOM 5672 C CA  . LEU B 1 317 ? -32.419 -38.301 72.807 1.00 6.53  ? 317 LEU B CA  1 
ATOM 5673 C C   . LEU B 1 317 ? -33.525 -37.347 73.146 1.00 7.09  ? 317 LEU B C   1 
ATOM 5674 O O   . LEU B 1 317 ? -33.956 -37.168 74.259 1.00 7.82  ? 317 LEU B O   1 
ATOM 5675 C CB  . LEU B 1 317 ? -32.774 -39.711 73.348 1.00 7.49  ? 317 LEU B CB  1 
ATOM 5676 C CG  . LEU B 1 317 ? -31.562 -40.660 73.343 1.00 6.28  ? 317 LEU B CG  1 
ATOM 5677 C CD1 . LEU B 1 317 ? -32.065 -42.066 73.730 1.00 7.85  ? 317 LEU B CD1 1 
ATOM 5678 C CD2 . LEU B 1 317 ? -30.889 -40.742 71.942 1.00 8.71  ? 317 LEU B CD2 1 
ATOM 5679 N N   . ALA B 1 318 ? -34.070 -36.664 72.116 1.00 6.48  ? 318 ALA B N   1 
ATOM 5680 C CA  . ALA B 1 318 ? -35.140 -35.674 72.300 1.00 6.28  ? 318 ALA B CA  1 
ATOM 5681 C C   . ALA B 1 318 ? -36.493 -36.318 72.042 1.00 6.75  ? 318 ALA B C   1 
ATOM 5682 O O   . ALA B 1 318 ? -36.940 -36.454 70.922 1.00 7.74  ? 318 ALA B O   1 
ATOM 5683 C CB  . ALA B 1 318 ? -34.905 -34.509 71.283 1.00 7.72  ? 318 ALA B CB  1 
ATOM 5684 N N   . CYS B 1 319 ? -37.147 -36.665 73.129 1.00 7.16  ? 319 CYS B N   1 
ATOM 5685 C CA  . CYS B 1 319 ? -38.326 -37.561 73.016 1.00 7.35  ? 319 CYS B CA  1 
ATOM 5686 C C   . CYS B 1 319 ? -39.617 -36.875 73.407 1.00 8.12  ? 319 CYS B C   1 
ATOM 5687 O O   . CYS B 1 319 ? -39.696 -36.211 74.476 1.00 8.36  ? 319 CYS B O   1 
ATOM 5688 C CB  . CYS B 1 319 ? -38.162 -38.790 73.923 1.00 7.88  ? 319 CYS B CB  1 
ATOM 5689 S SG  . CYS B 1 319 ? -36.615 -39.742 73.537 1.00 8.98  ? 319 CYS B SG  1 
ATOM 5690 N N   . ALA B 1 320 ? -40.647 -37.001 72.550 1.00 6.25  ? 320 ALA B N   1 
ATOM 5691 C CA  . ALA B 1 320 ? -41.945 -36.427 72.849 1.00 5.84  ? 320 ALA B CA  1 
ATOM 5692 C C   . ALA B 1 320 ? -42.971 -37.191 72.008 1.00 6.67  ? 320 ALA B C   1 
ATOM 5693 O O   . ALA B 1 320 ? -42.579 -37.921 71.111 1.00 6.54  ? 320 ALA B O   1 
ATOM 5694 C CB  . ALA B 1 320 ? -42.003 -34.931 72.488 1.00 6.43  ? 320 ALA B CB  1 
ATOM 5695 N N   . GLU B 1 321 ? -44.258 -37.012 72.326 1.00 5.91  ? 321 GLU B N   1 
ATOM 5696 C CA  . GLU B 1 321 ? -45.331 -37.630 71.521 1.00 5.28  ? 321 GLU B CA  1 
ATOM 5697 C C   . GLU B 1 321 ? -46.181 -36.486 71.057 1.00 6.79  ? 321 GLU B C   1 
ATOM 5698 O O   . GLU B 1 321 ? -46.582 -35.660 71.891 1.00 8.11  ? 321 GLU B O   1 
ATOM 5699 C CB  . GLU B 1 321 ? -46.119 -38.589 72.418 1.00 6.81  ? 321 GLU B CB  1 
ATOM 5700 C CG  . GLU B 1 321 ? -47.245 -39.340 71.564 1.00 7.12  ? 321 GLU B CG  1 
ATOM 5701 C CD  . GLU B 1 321 ? -47.970 -40.319 72.485 1.00 10.34 ? 321 GLU B CD  1 
ATOM 5702 O OE1 . GLU B 1 321 ? -47.676 -40.400 73.681 1.00 10.42 ? 321 GLU B OE1 1 
ATOM 5703 O OE2 . GLU B 1 321 ? -48.889 -41.007 71.975 1.00 8.65  ? 321 GLU B OE2 1 
ATOM 5704 N N   . ASN B 1 322 ? -46.404 -36.430 69.746 1.00 5.86  ? 322 ASN B N   1 
ATOM 5705 C CA  . ASN B 1 322 ? -47.119 -35.218 69.138 1.00 4.89  ? 322 ASN B CA  1 
ATOM 5706 C C   . ASN B 1 322 ? -48.583 -35.576 68.915 1.00 6.53  ? 322 ASN B C   1 
ATOM 5707 O O   . ASN B 1 322 ? -48.906 -36.342 67.996 1.00 7.13  ? 322 ASN B O   1 
ATOM 5708 C CB  . ASN B 1 322 ? -46.449 -34.875 67.785 1.00 5.98  ? 322 ASN B CB  1 
ATOM 5709 C CG  . ASN B 1 322 ? -46.910 -33.577 67.248 1.00 6.58  ? 322 ASN B CG  1 
ATOM 5710 O OD1 . ASN B 1 322 ? -47.454 -32.707 67.918 1.00 8.33  ? 322 ASN B OD1 1 
ATOM 5711 N ND2 . ASN B 1 322 ? -46.646 -33.380 65.946 1.00 6.79  ? 322 ASN B ND2 1 
ATOM 5712 N N   . MET B 1 323 ? -49.438 -35.075 69.807 1.00 5.61  ? 323 MET B N   1 
ATOM 5713 C CA  . MET B 1 323 ? -50.882 -35.445 69.811 1.00 5.04  ? 323 MET B CA  1 
ATOM 5714 C C   . MET B 1 323 ? -51.753 -34.215 69.710 1.00 7.07  ? 323 MET B C   1 
ATOM 5715 O O   . MET B 1 323 ? -51.407 -33.129 70.240 1.00 7.38  ? 323 MET B O   1 
ATOM 5716 C CB  . MET B 1 323 ? -51.199 -36.103 71.196 1.00 6.33  ? 323 MET B CB  1 
ATOM 5717 C CG  . MET B 1 323 ? -50.423 -37.433 71.412 1.00 8.79  ? 323 MET B CG  1 
ATOM 5718 S SD  . MET B 1 323 ? -50.980 -38.829 70.339 1.00 8.19  ? 323 MET B SD  1 
ATOM 5719 C CE  . MET B 1 323 ? -52.404 -39.421 71.258 1.00 9.66  ? 323 MET B CE  1 
ATOM 5720 N N   . PRO B 1 324 ? -52.984 -34.330 69.172 1.00 5.98  ? 324 PRO B N   1 
ATOM 5721 C CA  . PRO B 1 324 ? -53.973 -33.208 69.198 1.00 7.61  ? 324 PRO B CA  1 
ATOM 5722 C C   . PRO B 1 324 ? -54.746 -33.286 70.500 1.00 7.90  ? 324 PRO B C   1 
ATOM 5723 O O   . PRO B 1 324 ? -55.039 -34.391 70.971 1.00 9.66  ? 324 PRO B O   1 
ATOM 5724 C CB  . PRO B 1 324 ? -54.852 -33.518 67.960 1.00 8.25  ? 324 PRO B CB  1 
ATOM 5725 C CG  . PRO B 1 324 ? -54.739 -35.110 67.921 1.00 8.85  ? 324 PRO B CG  1 
ATOM 5726 C CD  . PRO B 1 324 ? -53.798 -35.437 69.166 1.00 7.00  ? 324 PRO B CD  1 
ATOM 5727 N N   . SER B 1 325 ? -55.086 -32.169 71.088 1.00 6.07  ? 325 SER B N   1 
ATOM 5728 C CA  . SER B 1 325 ? -55.849 -32.107 72.351 1.00 7.41  ? 325 SER B CA  1 
ATOM 5729 C C   . SER B 1 325 ? -56.249 -30.641 72.605 1.00 7.57  ? 325 SER B C   1 
ATOM 5730 O O   . SER B 1 325 ? -55.839 -29.706 71.894 1.00 8.24  ? 325 SER B O   1 
ATOM 5731 C CB  . SER B 1 325 ? -55.028 -32.656 73.532 1.00 7.77  ? 325 SER B CB  1 
ATOM 5732 O OG  . SER B 1 325 ? -54.051 -31.698 73.925 1.00 9.06  ? 325 SER B OG  1 
ATOM 5733 N N   . GLY B 1 326 ? -56.950 -30.429 73.743 1.00 7.33  ? 326 GLY B N   1 
ATOM 5734 C CA  . GLY B 1 326 ? -57.366 -29.082 74.100 1.00 6.86  ? 326 GLY B CA  1 
ATOM 5735 C C   . GLY B 1 326 ? -56.272 -28.249 74.725 1.00 7.32  ? 326 GLY B C   1 
ATOM 5736 O O   . GLY B 1 326 ? -56.519 -27.099 74.891 1.00 7.84  ? 326 GLY B O   1 
ATOM 5737 N N   . GLY B 1 327 ? -55.138 -28.855 74.926 1.00 7.69  ? 327 GLY B N   1 
ATOM 5738 C CA  . GLY B 1 327 ? -53.964 -28.072 75.410 1.00 9.06  ? 327 GLY B CA  1 
ATOM 5739 C C   . GLY B 1 327 ? -52.788 -28.177 74.473 1.00 8.49  ? 327 GLY B C   1 
ATOM 5740 O O   . GLY B 1 327 ? -51.659 -27.827 74.881 1.00 10.48 ? 327 GLY B O   1 
ATOM 5741 N N   . ALA B 1 328 ? -52.952 -28.622 73.241 1.00 7.16  ? 328 ALA B N   1 
ATOM 5742 C CA  . ALA B 1 328 ? -51.834 -28.739 72.316 1.00 6.59  ? 328 ALA B CA  1 
ATOM 5743 C C   . ALA B 1 328 ? -51.407 -27.411 71.755 1.00 7.30  ? 328 ALA B C   1 
ATOM 5744 O O   . ALA B 1 328 ? -52.245 -26.473 71.685 1.00 8.71  ? 328 ALA B O   1 
ATOM 5745 C CB  . ALA B 1 328 ? -52.277 -29.683 71.094 1.00 7.48  ? 328 ALA B CB  1 
ATOM 5746 N N   . THR B 1 329 ? -50.194 -27.398 71.250 1.00 5.40  ? 329 THR B N   1 
ATOM 5747 C CA  . THR B 1 329 ? -49.756 -26.208 70.475 1.00 6.47  ? 329 THR B CA  1 
ATOM 5748 C C   . THR B 1 329 ? -50.614 -25.984 69.257 1.00 6.10  ? 329 THR B C   1 
ATOM 5749 O O   . THR B 1 329 ? -51.055 -26.936 68.554 1.00 7.84  ? 329 THR B O   1 
ATOM 5750 C CB  . THR B 1 329 ? -48.339 -26.445 70.079 1.00 8.19  ? 329 THR B CB  1 
ATOM 5751 O OG1 . THR B 1 329 ? -47.623 -26.339 71.365 1.00 10.41 ? 329 THR B OG1 1 
ATOM 5752 C CG2 . THR B 1 329 ? -47.780 -25.430 69.099 1.00 8.93  ? 329 THR B CG2 1 
ATOM 5753 N N   . ARG B 1 330 ? -50.838 -24.715 68.923 1.00 5.63  ? 330 ARG B N   1 
ATOM 5754 C CA  . ARG B 1 330 ? -51.639 -24.366 67.743 1.00 6.16  ? 330 ARG B CA  1 
ATOM 5755 C C   . ARG B 1 330 ? -50.899 -23.503 66.708 1.00 6.87  ? 330 ARG B C   1 
ATOM 5756 O O   . ARG B 1 330 ? -50.256 -22.516 67.065 1.00 7.09  ? 330 ARG B O   1 
ATOM 5757 C CB  . ARG B 1 330 ? -52.936 -23.671 68.167 1.00 5.34  ? 330 ARG B CB  1 
ATOM 5758 C CG  . ARG B 1 330 ? -53.501 -24.164 69.490 1.00 7.98  ? 330 ARG B CG  1 
ATOM 5759 C CD  . ARG B 1 330 ? -53.972 -23.006 70.354 1.00 9.08  ? 330 ARG B CD  1 
ATOM 5760 N NE  . ARG B 1 330 ? -52.883 -22.429 71.137 1.00 8.98  ? 330 ARG B NE  1 
ATOM 5761 C CZ  . ARG B 1 330 ? -52.564 -22.813 72.369 1.00 10.61 ? 330 ARG B CZ  1 
ATOM 5762 N NH1 . ARG B 1 330 ? -53.251 -23.778 72.964 1.00 9.85  ? 330 ARG B NH1 1 
ATOM 5763 N NH2 . ARG B 1 330 ? -51.557 -22.232 73.006 1.00 9.82  ? 330 ARG B NH2 1 
ATOM 5764 N N   . PRO B 1 331 ? -50.997 -23.877 65.431 1.00 6.70  ? 331 PRO B N   1 
ATOM 5765 C CA  . PRO B 1 331 ? -50.370 -23.105 64.345 1.00 5.92  ? 331 PRO B CA  1 
ATOM 5766 C C   . PRO B 1 331 ? -50.490 -21.604 64.670 1.00 6.69  ? 331 PRO B C   1 
ATOM 5767 O O   . PRO B 1 331 ? -51.563 -21.130 65.092 1.00 7.26  ? 331 PRO B O   1 
ATOM 5768 C CB  . PRO B 1 331 ? -51.284 -23.438 63.094 1.00 5.82  ? 331 PRO B CB  1 
ATOM 5769 C CG  . PRO B 1 331 ? -51.788 -24.838 63.438 1.00 7.56  ? 331 PRO B CG  1 
ATOM 5770 C CD  . PRO B 1 331 ? -51.123 -25.144 64.815 1.00 6.75  ? 331 PRO B CD  1 
ATOM 5771 N N   . GLY B 1 332 ? -49.383 -20.897 64.482 1.00 6.61  ? 332 GLY B N   1 
ATOM 5772 C CA  . GLY B 1 332 ? -49.358 -19.475 64.877 1.00 7.05  ? 332 GLY B CA  1 
ATOM 5773 C C   . GLY B 1 332 ? -48.818 -19.204 66.293 1.00 6.94  ? 332 GLY B C   1 
ATOM 5774 O O   . GLY B 1 332 ? -48.473 -18.051 66.642 1.00 6.92  ? 332 GLY B O   1 
ATOM 5775 N N   . ASP B 1 333 ? -48.629 -20.247 67.104 1.00 6.16  ? 333 ASP B N   1 
ATOM 5776 C CA  . ASP B 1 333 ? -48.009 -19.979 68.424 1.00 6.44  ? 333 ASP B CA  1 
ATOM 5777 C C   . ASP B 1 333 ? -46.552 -19.525 68.248 1.00 5.98  ? 333 ASP B C   1 
ATOM 5778 O O   . ASP B 1 333 ? -45.898 -19.906 67.231 1.00 7.59  ? 333 ASP B O   1 
ATOM 5779 C CB  . ASP B 1 333 ? -47.961 -21.266 69.308 1.00 7.58  ? 333 ASP B CB  1 
ATOM 5780 C CG  . ASP B 1 333 ? -49.258 -21.675 69.952 1.00 6.89  ? 333 ASP B CG  1 
ATOM 5781 O OD1 . ASP B 1 333 ? -50.268 -20.983 69.764 1.00 7.12  ? 333 ASP B OD1 1 
ATOM 5782 O OD2 . ASP B 1 333 ? -49.251 -22.765 70.627 1.00 7.50  ? 333 ASP B OD2 1 
ATOM 5783 N N   . ILE B 1 334 ? -46.114 -18.680 69.127 1.00 4.94  ? 334 ILE B N   1 
ATOM 5784 C CA  . ILE B 1 334 ? -44.693 -18.231 69.092 1.00 5.67  ? 334 ILE B CA  1 
ATOM 5785 C C   . ILE B 1 334 ? -44.062 -18.549 70.419 1.00 5.79  ? 334 ILE B C   1 
ATOM 5786 O O   . ILE B 1 334 ? -44.663 -18.347 71.506 1.00 7.73  ? 334 ILE B O   1 
ATOM 5787 C CB  . ILE B 1 334 ? -44.568 -16.683 68.843 1.00 6.29  ? 334 ILE B CB  1 
ATOM 5788 C CG1 . ILE B 1 334 ? -45.078 -16.342 67.464 1.00 7.62  ? 334 ILE B CG1 1 
ATOM 5789 C CG2 . ILE B 1 334 ? -43.032 -16.303 68.982 1.00 7.50  ? 334 ILE B CG2 1 
ATOM 5790 C CD1 . ILE B 1 334 ? -45.273 -14.845 67.297 1.00 6.19  ? 334 ILE B CD1 1 
ATOM 5791 N N   . VAL B 1 335 ? -42.925 -19.217 70.361 1.00 6.34  ? 335 VAL B N   1 
ATOM 5792 C CA  . VAL B 1 335 ? -42.238 -19.714 71.560 1.00 7.30  ? 335 VAL B CA  1 
ATOM 5793 C C   . VAL B 1 335 ? -40.800 -19.177 71.588 1.00 5.60  ? 335 VAL B C   1 
ATOM 5794 O O   . VAL B 1 335 ? -40.230 -18.870 70.537 1.00 7.09  ? 335 VAL B O   1 
ATOM 5795 C CB  . VAL B 1 335 ? -42.208 -21.260 71.597 1.00 8.23  ? 335 VAL B CB  1 
ATOM 5796 C CG1 . VAL B 1 335 ? -43.698 -21.775 71.636 1.00 9.63  ? 335 VAL B CG1 1 
ATOM 5797 C CG2 . VAL B 1 335 ? -41.468 -21.875 70.420 1.00 9.94  ? 335 VAL B CG2 1 
ATOM 5798 N N   . THR B 1 336 ? -40.257 -19.087 72.800 1.00 7.41  ? 336 THR B N   1 
ATOM 5799 C CA  . THR B 1 336 ? -38.838 -18.741 72.959 1.00 6.87  ? 336 THR B CA  1 
ATOM 5800 C C   . THR B 1 336 ? -38.046 -20.019 73.166 1.00 5.63  ? 336 THR B C   1 
ATOM 5801 O O   . THR B 1 336 ? -38.300 -20.810 74.076 1.00 8.39  ? 336 THR B O   1 
ATOM 5802 C CB  . THR B 1 336 ? -38.658 -17.836 74.202 1.00 9.18  ? 336 THR B CB  1 
ATOM 5803 O OG1 . THR B 1 336 ? -39.472 -16.672 73.947 1.00 10.71 ? 336 THR B OG1 1 
ATOM 5804 C CG2 . THR B 1 336 ? -37.210 -17.407 74.287 1.00 8.48  ? 336 THR B CG2 1 
ATOM 5805 N N   . THR B 1 337 ? -37.113 -20.253 72.264 1.00 6.01  ? 337 THR B N   1 
ATOM 5806 C CA  . THR B 1 337 ? -36.220 -21.434 72.360 1.00 6.19  ? 337 THR B CA  1 
ATOM 5807 C C   . THR B 1 337 ? -35.180 -21.250 73.434 1.00 5.92  ? 337 THR B C   1 
ATOM 5808 O O   . THR B 1 337 ? -34.999 -20.088 73.948 1.00 7.44  ? 337 THR B O   1 
ATOM 5809 C CB  . THR B 1 337 ? -35.512 -21.702 71.046 1.00 6.49  ? 337 THR B CB  1 
ATOM 5810 O OG1 . THR B 1 337 ? -34.596 -20.651 70.689 1.00 8.42  ? 337 THR B OG1 1 
ATOM 5811 C CG2 . THR B 1 337 ? -36.533 -21.812 69.867 1.00 7.90  ? 337 THR B CG2 1 
ATOM 5812 N N   . MET B 1 338 ? -34.471 -22.355 73.805 1.00 6.89  ? 338 MET B N   1 
ATOM 5813 C CA  . MET B 1 338 ? -33.469 -22.255 74.882 1.00 6.12  ? 338 MET B CA  1 
ATOM 5814 C C   . MET B 1 338 ? -32.418 -21.181 74.459 1.00 8.19  ? 338 MET B C   1 
ATOM 5815 O O   . MET B 1 338 ? -31.903 -20.500 75.379 1.00 9.52  ? 338 MET B O   1 
ATOM 5816 C CB  . MET B 1 338 ? -32.760 -23.642 74.996 1.00 9.83  ? 338 MET B CB  1 
ATOM 5817 C CG  . MET B 1 338 ? -31.790 -23.662 76.163 1.00 8.67  ? 338 MET B CG  1 
ATOM 5818 S SD  . MET B 1 338 ? -31.097 -25.298 76.239 1.00 10.64 ? 338 MET B SD  1 
ATOM 5819 C CE  . MET B 1 338 ? -30.185 -25.103 77.776 1.00 14.83 ? 338 MET B CE  1 
ATOM 5820 N N   . SER B 1 339 ? -32.072 -21.078 73.170 1.00 6.73  ? 339 SER B N   1 
ATOM 5821 C CA  . SER B 1 339 ? -31.017 -20.151 72.676 1.00 7.64  ? 339 SER B CA  1 
ATOM 5822 C C   . SER B 1 339 ? -31.459 -18.672 72.810 1.00 7.32  ? 339 SER B C   1 
ATOM 5823 O O   . SER B 1 339 ? -30.600 -17.796 72.609 1.00 10.10 ? 339 SER B O   1 
ATOM 5824 C CB  . SER B 1 339 ? -30.777 -20.486 71.181 1.00 8.46  ? 339 SER B CB  1 
ATOM 5825 O OG  . SER B 1 339 ? -31.904 -20.056 70.379 1.00 8.64  ? 339 SER B OG  1 
ATOM 5826 N N   . GLY B 1 340 ? -32.762 -18.436 73.008 1.00 7.50  ? 340 GLY B N   1 
ATOM 5827 C CA  . GLY B 1 340 ? -33.354 -17.090 73.076 1.00 8.03  ? 340 GLY B CA  1 
ATOM 5828 C C   . GLY B 1 340 ? -33.944 -16.715 71.760 1.00 8.18  ? 340 GLY B C   1 
ATOM 5829 O O   . GLY B 1 340 ? -34.697 -15.739 71.656 1.00 8.67  ? 340 GLY B O   1 
ATOM 5830 N N   . GLN B 1 341 ? -33.648 -17.444 70.705 1.00 7.25  ? 341 GLN B N   1 
ATOM 5831 C CA  . GLN B 1 341 ? -34.294 -17.149 69.403 1.00 7.85  ? 341 GLN B CA  1 
ATOM 5832 C C   . GLN B 1 341 ? -35.773 -17.521 69.489 1.00 6.44  ? 341 GLN B C   1 
ATOM 5833 O O   . GLN B 1 341 ? -36.120 -18.538 70.093 1.00 7.35  ? 341 GLN B O   1 
ATOM 5834 C CB  . GLN B 1 341 ? -33.675 -17.991 68.270 1.00 7.91  ? 341 GLN B CB  1 
ATOM 5835 C CG  . GLN B 1 341 ? -32.174 -17.580 67.986 1.00 6.94  ? 341 GLN B CG  1 
ATOM 5836 C CD  . GLN B 1 341 ? -31.510 -18.421 66.940 1.00 10.06 ? 341 GLN B CD  1 
ATOM 5837 O OE1 . GLN B 1 341 ? -31.890 -19.571 66.700 1.00 14.65 ? 341 GLN B OE1 1 
ATOM 5838 N NE2 . GLN B 1 341 ? -30.469 -17.862 66.324 1.00 10.78 ? 341 GLN B NE2 1 
ATOM 5839 N N   . THR B 1 342 ? -36.648 -16.706 68.901 1.00 6.50  ? 342 THR B N   1 
ATOM 5840 C CA  . THR B 1 342 ? -38.109 -17.036 68.846 1.00 7.26  ? 342 THR B CA  1 
ATOM 5841 C C   . THR B 1 342 ? -38.508 -17.745 67.582 1.00 7.06  ? 342 THR B C   1 
ATOM 5842 O O   . THR B 1 342 ? -37.909 -17.490 66.513 1.00 7.37  ? 342 THR B O   1 
ATOM 5843 C CB  . THR B 1 342 ? -38.959 -15.763 69.040 1.00 8.53  ? 342 THR B CB  1 
ATOM 5844 O OG1 . THR B 1 342 ? -38.589 -14.790 68.072 1.00 9.53  ? 342 THR B OG1 1 
ATOM 5845 C CG2 . THR B 1 342 ? -38.640 -15.130 70.357 1.00 10.87 ? 342 THR B CG2 1 
ATOM 5846 N N   . VAL B 1 343 ? -39.445 -18.672 67.709 1.00 6.05  ? 343 VAL B N   1 
ATOM 5847 C CA  . VAL B 1 343 ? -39.911 -19.453 66.566 1.00 6.11  ? 343 VAL B CA  1 
ATOM 5848 C C   . VAL B 1 343 ? -41.438 -19.358 66.495 1.00 5.56  ? 343 VAL B C   1 
ATOM 5849 O O   . VAL B 1 343 ? -42.125 -19.566 67.517 1.00 6.75  ? 343 VAL B O   1 
ATOM 5850 C CB  . VAL B 1 343 ? -39.501 -20.902 66.712 1.00 5.56  ? 343 VAL B CB  1 
ATOM 5851 C CG1 . VAL B 1 343 ? -40.181 -21.784 65.606 1.00 8.96  ? 343 VAL B CG1 1 
ATOM 5852 C CG2 . VAL B 1 343 ? -37.993 -21.031 66.702 1.00 6.44  ? 343 VAL B CG2 1 
ATOM 5853 N N   . GLU B 1 344 ? -41.912 -19.006 65.319 1.00 6.52  ? 344 GLU B N   1 
ATOM 5854 C CA  . GLU B 1 344 ? -43.370 -19.077 65.049 1.00 5.01  ? 344 GLU B CA  1 
ATOM 5855 C C   . GLU B 1 344 ? -43.649 -20.492 64.518 1.00 5.59  ? 344 GLU B C   1 
ATOM 5856 O O   . GLU B 1 344 ? -43.079 -20.903 63.471 1.00 6.09  ? 344 GLU B O   1 
ATOM 5857 C CB  . GLU B 1 344 ? -43.710 -17.991 63.992 1.00 5.54  ? 344 GLU B CB  1 
ATOM 5858 C CG  . GLU B 1 344 ? -45.218 -17.961 63.773 1.00 7.86  ? 344 GLU B CG  1 
ATOM 5859 C CD  . GLU B 1 344 ? -45.631 -16.896 62.779 1.00 9.46  ? 344 GLU B CD  1 
ATOM 5860 O OE1 . GLU B 1 344 ? -44.839 -16.501 61.882 1.00 10.88 ? 344 GLU B OE1 1 
ATOM 5861 O OE2 . GLU B 1 344 ? -46.838 -16.502 62.847 1.00 13.27 ? 344 GLU B OE2 1 
ATOM 5862 N N   . ILE B 1 345 ? -44.492 -21.230 65.226 1.00 6.51  ? 345 ILE B N   1 
ATOM 5863 C CA  . ILE B 1 345 ? -44.852 -22.612 64.926 1.00 6.09  ? 345 ILE B CA  1 
ATOM 5864 C C   . ILE B 1 345 ? -45.994 -22.500 63.931 1.00 6.62  ? 345 ILE B C   1 
ATOM 5865 O O   . ILE B 1 345 ? -47.140 -22.505 64.337 1.00 8.09  ? 345 ILE B O   1 
ATOM 5866 C CB  . ILE B 1 345 ? -45.139 -23.393 66.179 1.00 5.22  ? 345 ILE B CB  1 
ATOM 5867 C CG1 . ILE B 1 345 ? -43.915 -23.407 67.055 1.00 6.36  ? 345 ILE B CG1 1 
ATOM 5868 C CG2 . ILE B 1 345 ? -45.518 -24.877 65.708 1.00 7.98  ? 345 ILE B CG2 1 
ATOM 5869 C CD1 . ILE B 1 345 ? -44.213 -24.078 68.434 1.00 6.83  ? 345 ILE B CD1 1 
ATOM 5870 N N   . LEU B 1 346 ? -45.694 -22.427 62.647 1.00 6.31  ? 346 LEU B N   1 
ATOM 5871 C CA  . LEU B 1 346 ? -46.733 -22.279 61.584 1.00 6.33  ? 346 LEU B CA  1 
ATOM 5872 C C   . LEU B 1 346 ? -47.417 -23.599 61.332 1.00 6.03  ? 346 LEU B C   1 
ATOM 5873 O O   . LEU B 1 346 ? -48.597 -23.618 60.892 1.00 7.55  ? 346 LEU B O   1 
ATOM 5874 C CB  . LEU B 1 346 ? -46.089 -21.788 60.278 1.00 7.76  ? 346 LEU B CB  1 
ATOM 5875 C CG  . LEU B 1 346 ? -45.682 -20.297 60.463 1.00 9.68  ? 346 LEU B CG  1 
ATOM 5876 C CD1 . LEU B 1 346 ? -44.819 -20.042 59.208 1.00 15.53 ? 346 LEU B CD1 1 
ATOM 5877 C CD2 . LEU B 1 346 ? -46.913 -19.418 60.553 1.00 11.02 ? 346 LEU B CD2 1 
ATOM 5878 N N   . ASN B 1 347 ? -46.677 -24.690 61.471 1.00 6.43  ? 347 ASN B N   1 
ATOM 5879 C CA  . ASN B 1 347 ? -47.243 -26.020 61.324 1.00 6.45  ? 347 ASN B CA  1 
ATOM 5880 C C   . ASN B 1 347 ? -46.842 -26.828 62.536 1.00 6.27  ? 347 ASN B C   1 
ATOM 5881 O O   . ASN B 1 347 ? -45.672 -26.824 62.918 1.00 6.51  ? 347 ASN B O   1 
ATOM 5882 C CB  . ASN B 1 347 ? -46.732 -26.687 60.046 1.00 6.86  ? 347 ASN B CB  1 
ATOM 5883 C CG  . ASN B 1 347 ? -47.505 -27.943 59.696 1.00 10.71 ? 347 ASN B CG  1 
ATOM 5884 O OD1 . ASN B 1 347 ? -48.695 -28.054 59.988 1.00 15.51 ? 347 ASN B OD1 1 
ATOM 5885 N ND2 . ASN B 1 347 ? -46.829 -28.897 59.067 1.00 5.79  ? 347 ASN B ND2 1 
ATOM 5886 N N   . THR B 1 348 ? -47.787 -27.522 63.158 1.00 6.56  ? 348 THR B N   1 
ATOM 5887 C CA  . THR B 1 348 ? -47.392 -28.292 64.379 1.00 5.22  ? 348 THR B CA  1 
ATOM 5888 C C   . THR B 1 348 ? -46.869 -29.671 63.953 1.00 5.09  ? 348 THR B C   1 
ATOM 5889 O O   . THR B 1 348 ? -46.355 -30.435 64.801 1.00 6.02  ? 348 THR B O   1 
ATOM 5890 C CB  . THR B 1 348 ? -48.556 -28.416 65.356 1.00 4.96  ? 348 THR B CB  1 
ATOM 5891 O OG1 . THR B 1 348 ? -49.600 -29.181 64.706 1.00 6.02  ? 348 THR B OG1 1 
ATOM 5892 C CG2 . THR B 1 348 ? -49.122 -27.111 65.709 1.00 5.70  ? 348 THR B CG2 1 
ATOM 5893 N N   . ASP B 1 349 ? -46.982 -30.014 62.616 1.00 4.37  ? 349 ASP B N   1 
ATOM 5894 C CA  . ASP B 1 349 ? -46.382 -31.234 62.143 1.00 6.16  ? 349 ASP B CA  1 
ATOM 5895 C C   . ASP B 1 349 ? -44.923 -31.109 61.664 1.00 3.89  ? 349 ASP B C   1 
ATOM 5896 O O   . ASP B 1 349 ? -44.262 -32.072 61.306 1.00 6.49  ? 349 ASP B O   1 
ATOM 5897 C CB  . ASP B 1 349 ? -47.293 -31.791 60.977 1.00 6.26  ? 349 ASP B CB  1 
ATOM 5898 C CG  . ASP B 1 349 ? -47.014 -33.200 60.648 1.00 6.02  ? 349 ASP B CG  1 
ATOM 5899 O OD1 . ASP B 1 349 ? -46.443 -34.006 61.390 1.00 5.78  ? 349 ASP B OD1 1 
ATOM 5900 O OD2 . ASP B 1 349 ? -47.503 -33.570 59.541 1.00 7.95  ? 349 ASP B OD2 1 
ATOM 5901 N N   . ALA B 1 350 ? -44.395 -29.883 61.840 1.00 4.85  ? 350 ALA B N   1 
ATOM 5902 C CA  . ALA B 1 350 ? -42.919 -29.704 61.684 1.00 6.07  ? 350 ALA B CA  1 
ATOM 5903 C C   . ALA B 1 350 ? -42.324 -29.657 63.130 1.00 5.85  ? 350 ALA B C   1 
ATOM 5904 O O   . ALA B 1 350 ? -41.726 -28.661 63.564 1.00 6.50  ? 350 ALA B O   1 
ATOM 5905 C CB  . ALA B 1 350 ? -42.644 -28.414 60.867 1.00 7.87  ? 350 ALA B CB  1 
ATOM 5906 N N   . GLU B 1 351 ? -42.495 -30.811 63.787 1.00 5.37  ? 351 GLU B N   1 
ATOM 5907 C CA  . GLU B 1 351 ? -42.211 -30.849 65.239 1.00 4.85  ? 351 GLU B CA  1 
ATOM 5908 C C   . GLU B 1 351 ? -40.852 -31.399 65.559 1.00 6.08  ? 351 GLU B C   1 
ATOM 5909 O O   . GLU B 1 351 ? -40.318 -31.050 66.656 1.00 6.10  ? 351 GLU B O   1 
ATOM 5910 C CB  . GLU B 1 351 ? -43.294 -31.714 65.955 1.00 7.24  ? 351 GLU B CB  1 
ATOM 5911 C CG  . GLU B 1 351 ? -43.232 -33.240 65.700 1.00 4.85  ? 351 GLU B CG  1 
ATOM 5912 C CD  . GLU B 1 351 ? -43.827 -33.624 64.371 1.00 4.19  ? 351 GLU B CD  1 
ATOM 5913 O OE1 . GLU B 1 351 ? -44.203 -32.683 63.601 1.00 6.13  ? 351 GLU B OE1 1 
ATOM 5914 O OE2 . GLU B 1 351 ? -43.803 -34.851 64.014 1.00 6.40  ? 351 GLU B OE2 1 
ATOM 5915 N N   . GLY B 1 352 ? -40.278 -32.267 64.742 1.00 5.83  ? 352 GLY B N   1 
ATOM 5916 C CA  . GLY B 1 352 ? -38.961 -32.869 65.015 1.00 5.40  ? 352 GLY B CA  1 
ATOM 5917 C C   . GLY B 1 352 ? -37.938 -31.735 65.092 1.00 6.44  ? 352 GLY B C   1 
ATOM 5918 O O   . GLY B 1 352 ? -37.081 -31.776 65.948 1.00 6.76  ? 352 GLY B O   1 
ATOM 5919 N N   . ARG B 1 353 ? -38.001 -30.747 64.190 1.00 6.94  ? 353 ARG B N   1 
ATOM 5920 C CA  . ARG B 1 353 ? -37.005 -29.653 64.247 1.00 7.52  ? 353 ARG B CA  1 
ATOM 5921 C C   . ARG B 1 353 ? -37.141 -28.832 65.500 1.00 6.31  ? 353 ARG B C   1 
ATOM 5922 O O   . ARG B 1 353 ? -36.155 -28.220 65.918 1.00 6.43  ? 353 ARG B O   1 
ATOM 5923 C CB  . ARG B 1 353 ? -37.060 -28.853 62.921 1.00 5.89  ? 353 ARG B CB  1 
ATOM 5924 C CG  . ARG B 1 353 ? -38.339 -28.025 62.839 1.00 6.16  ? 353 ARG B CG  1 
ATOM 5925 C CD  . ARG B 1 353 ? -38.658 -27.510 61.397 1.00 7.31  ? 353 ARG B CD  1 
ATOM 5926 N NE  . ARG B 1 353 ? -39.023 -28.692 60.575 1.00 6.81  ? 353 ARG B NE  1 
ATOM 5927 C CZ  . ARG B 1 353 ? -39.231 -28.602 59.266 1.00 6.96  ? 353 ARG B CZ  1 
ATOM 5928 N NH1 . ARG B 1 353 ? -38.981 -27.423 58.650 1.00 9.12  ? 353 ARG B NH1 1 
ATOM 5929 N NH2 . ARG B 1 353 ? -39.542 -29.692 58.579 1.00 7.50  ? 353 ARG B NH2 1 
ATOM 5930 N N   . LEU B 1 354 ? -38.338 -28.834 66.140 1.00 6.08  ? 354 LEU B N   1 
ATOM 5931 C CA  . LEU B 1 354 ? -38.538 -28.052 67.344 1.00 7.22  ? 354 LEU B CA  1 
ATOM 5932 C C   . LEU B 1 354 ? -37.909 -28.742 68.531 1.00 6.87  ? 354 LEU B C   1 
ATOM 5933 O O   . LEU B 1 354 ? -37.200 -28.104 69.349 1.00 6.51  ? 354 LEU B O   1 
ATOM 5934 C CB  . LEU B 1 354 ? -40.052 -27.853 67.578 1.00 5.49  ? 354 LEU B CB  1 
ATOM 5935 C CG  . LEU B 1 354 ? -40.752 -27.066 66.462 1.00 5.93  ? 354 LEU B CG  1 
ATOM 5936 C CD1 . LEU B 1 354 ? -42.230 -27.028 66.798 1.00 6.77  ? 354 LEU B CD1 1 
ATOM 5937 C CD2 . LEU B 1 354 ? -40.152 -25.658 66.311 1.00 9.08  ? 354 LEU B CD2 1 
ATOM 5938 N N   . VAL B 1 355 ? -38.085 -30.068 68.655 1.00 6.66  ? 355 VAL B N   1 
ATOM 5939 C CA  . VAL B 1 355 ? -37.408 -30.746 69.824 1.00 5.68  ? 355 VAL B CA  1 
ATOM 5940 C C   . VAL B 1 355 ? -35.880 -30.746 69.559 1.00 6.85  ? 355 VAL B C   1 
ATOM 5941 O O   . VAL B 1 355 ? -35.030 -30.602 70.494 1.00 6.81  ? 355 VAL B O   1 
ATOM 5942 C CB  . VAL B 1 355 ? -37.901 -32.169 70.101 1.00 7.00  ? 355 VAL B CB  1 
ATOM 5943 C CG1 . VAL B 1 355 ? -39.448 -32.152 70.319 1.00 7.67  ? 355 VAL B CG1 1 
ATOM 5944 C CG2 . VAL B 1 355 ? -37.572 -33.224 69.047 1.00 7.86  ? 355 VAL B CG2 1 
ATOM 5945 N N   . LEU B 1 356 ? -35.460 -30.827 68.301 1.00 6.88  ? 356 LEU B N   1 
ATOM 5946 C CA  . LEU B 1 356 ? -34.028 -30.861 67.935 1.00 5.98  ? 356 LEU B CA  1 
ATOM 5947 C C   . LEU B 1 356 ? -33.371 -29.556 68.230 1.00 6.11  ? 356 LEU B C   1 
ATOM 5948 O O   . LEU B 1 356 ? -32.265 -29.541 68.721 1.00 8.05  ? 356 LEU B O   1 
ATOM 5949 C CB  . LEU B 1 356 ? -33.788 -31.287 66.484 1.00 6.31  ? 356 LEU B CB  1 
ATOM 5950 C CG  . LEU B 1 356 ? -34.157 -32.765 66.199 1.00 5.87  ? 356 LEU B CG  1 
ATOM 5951 C CD1 . LEU B 1 356 ? -34.117 -32.943 64.644 1.00 8.64  ? 356 LEU B CD1 1 
ATOM 5952 C CD2 . LEU B 1 356 ? -33.120 -33.675 66.865 1.00 7.17  ? 356 LEU B CD2 1 
ATOM 5953 N N   . CYS B 1 357 ? -34.019 -28.418 67.916 1.00 5.72  ? 357 CYS B N   1 
ATOM 5954 C CA  . CYS B 1 357 ? -33.262 -27.138 68.009 1.00 6.30  ? 357 CYS B CA  1 
ATOM 5955 C C   . CYS B 1 357 ? -32.898 -26.861 69.486 1.00 8.04  ? 357 CYS B C   1 
ATOM 5956 O O   . CYS B 1 357 ? -31.731 -26.443 69.669 1.00 7.23  ? 357 CYS B O   1 
ATOM 5957 C CB  . CYS B 1 357 ? -34.049 -25.978 67.320 1.00 7.30  ? 357 CYS B CB  1 
ATOM 5958 S SG  . CYS B 1 357 ? -35.539 -25.364 68.248 1.00 8.18  ? 357 CYS B SG  1 
ATOM 5959 N N   . ASP B 1 358 ? -33.801 -27.172 70.415 1.00 6.79  ? 358 ASP B N   1 
ATOM 5960 C CA  . ASP B 1 358 ? -33.471 -26.959 71.803 1.00 7.48  ? 358 ASP B CA  1 
ATOM 5961 C C   . ASP B 1 358 ? -32.402 -27.920 72.261 1.00 6.56  ? 358 ASP B C   1 
ATOM 5962 O O   . ASP B 1 358 ? -31.582 -27.543 73.137 1.00 8.13  ? 358 ASP B O   1 
ATOM 5963 C CB  . ASP B 1 358 ? -34.737 -27.051 72.613 1.00 6.10  ? 358 ASP B CB  1 
ATOM 5964 C CG  . ASP B 1 358 ? -35.542 -25.764 72.549 1.00 8.22  ? 358 ASP B CG  1 
ATOM 5965 O OD1 . ASP B 1 358 ? -34.917 -24.678 72.427 1.00 7.83  ? 358 ASP B OD1 1 
ATOM 5966 O OD2 . ASP B 1 358 ? -36.752 -25.767 72.820 1.00 6.00  ? 358 ASP B OD2 1 
ATOM 5967 N N   . THR B 1 359 ? -32.420 -29.130 71.765 1.00 5.75  ? 359 THR B N   1 
ATOM 5968 C CA  . THR B 1 359 ? -31.402 -30.104 72.139 1.00 7.00  ? 359 THR B CA  1 
ATOM 5969 C C   . THR B 1 359 ? -30.054 -29.750 71.551 1.00 5.80  ? 359 THR B C   1 
ATOM 5970 O O   . THR B 1 359 ? -29.028 -29.995 72.195 1.00 6.22  ? 359 THR B O   1 
ATOM 5971 C CB  . THR B 1 359 ? -31.865 -31.525 71.734 1.00 6.23  ? 359 THR B CB  1 
ATOM 5972 O OG1 . THR B 1 359 ? -33.158 -31.770 72.330 1.00 6.67  ? 359 THR B OG1 1 
ATOM 5973 C CG2 . THR B 1 359 ? -30.848 -32.545 72.224 1.00 8.24  ? 359 THR B CG2 1 
ATOM 5974 N N   . LEU B 1 360 ? -30.034 -29.146 70.372 1.00 6.26  ? 360 LEU B N   1 
ATOM 5975 C CA  . LEU B 1 360 ? -28.738 -28.622 69.804 1.00 5.61  ? 360 LEU B CA  1 
ATOM 5976 C C   . LEU B 1 360 ? -28.234 -27.512 70.705 1.00 5.73  ? 360 LEU B C   1 
ATOM 5977 O O   . LEU B 1 360 ? -26.944 -27.487 70.914 1.00 6.76  ? 360 LEU B O   1 
ATOM 5978 C CB  . LEU B 1 360 ? -28.933 -28.113 68.335 1.00 6.39  ? 360 LEU B CB  1 
ATOM 5979 C CG  . LEU B 1 360 ? -29.174 -29.251 67.370 1.00 6.65  ? 360 LEU B CG  1 
ATOM 5980 C CD1 . LEU B 1 360 ? -29.677 -28.725 65.968 1.00 8.96  ? 360 LEU B CD1 1 
ATOM 5981 C CD2 . LEU B 1 360 ? -27.932 -30.115 67.134 1.00 7.87  ? 360 LEU B CD2 1 
ATOM 5982 N N   . THR B 1 361 ? -29.096 -26.649 71.263 1.00 6.70  ? 361 THR B N   1 
ATOM 5983 C CA  . THR B 1 361 ? -28.527 -25.601 72.168 1.00 6.62  ? 361 THR B CA  1 
ATOM 5984 C C   . THR B 1 361 ? -27.989 -26.340 73.406 1.00 6.78  ? 361 THR B C   1 
ATOM 5985 O O   . THR B 1 361 ? -26.892 -25.961 73.949 1.00 8.10  ? 361 THR B O   1 
ATOM 5986 C CB  . THR B 1 361 ? -29.619 -24.679 72.526 1.00 8.03  ? 361 THR B CB  1 
ATOM 5987 O OG1 . THR B 1 361 ? -30.096 -24.059 71.327 1.00 7.70  ? 361 THR B OG1 1 
ATOM 5988 C CG2 . THR B 1 361 ? -29.004 -23.538 73.387 1.00 8.72  ? 361 THR B CG2 1 
ATOM 5989 N N   . TYR B 1 362 ? -28.713 -27.326 73.940 1.00 7.22  ? 362 TYR B N   1 
ATOM 5990 C CA  . TYR B 1 362 ? -28.279 -28.032 75.142 1.00 7.62  ? 362 TYR B CA  1 
ATOM 5991 C C   . TYR B 1 362 ? -26.915 -28.667 74.911 1.00 9.49  ? 362 TYR B C   1 
ATOM 5992 O O   . TYR B 1 362 ? -26.033 -28.678 75.846 1.00 8.33  ? 362 TYR B O   1 
ATOM 5993 C CB  . TYR B 1 362 ? -29.303 -29.144 75.492 1.00 7.43  ? 362 TYR B CB  1 
ATOM 5994 C CG  . TYR B 1 362 ? -29.077 -29.865 76.795 1.00 7.93  ? 362 TYR B CG  1 
ATOM 5995 C CD1 . TYR B 1 362 ? -28.295 -31.035 76.808 1.00 8.27  ? 362 TYR B CD1 1 
ATOM 5996 C CD2 . TYR B 1 362 ? -29.503 -29.300 77.957 1.00 11.82 ? 362 TYR B CD2 1 
ATOM 5997 C CE1 . TYR B 1 362 ? -28.046 -31.705 78.065 1.00 8.25  ? 362 TYR B CE1 1 
ATOM 5998 C CE2 . TYR B 1 362 ? -29.276 -29.907 79.187 1.00 10.42 ? 362 TYR B CE2 1 
ATOM 5999 C CZ  . TYR B 1 362 ? -28.560 -31.054 79.227 1.00 7.52  ? 362 TYR B CZ  1 
ATOM 6000 O OH  . TYR B 1 362 ? -28.288 -31.686 80.477 1.00 13.69 ? 362 TYR B OH  1 
ATOM 6001 N N   . ALA B 1 363 ? -26.624 -29.128 73.697 1.00 7.25  ? 363 ALA B N   1 
ATOM 6002 C CA  . ALA B 1 363 ? -25.359 -29.805 73.397 1.00 7.69  ? 363 ALA B CA  1 
ATOM 6003 C C   . ALA B 1 363 ? -24.149 -28.915 73.518 1.00 7.72  ? 363 ALA B C   1 
ATOM 6004 O O   . ALA B 1 363 ? -23.036 -29.486 73.622 1.00 8.61  ? 363 ALA B O   1 
ATOM 6005 C CB  . ALA B 1 363 ? -25.411 -30.419 71.993 1.00 9.85  ? 363 ALA B CB  1 
ATOM 6006 N N   . GLU B 1 364 ? -24.317 -27.600 73.445 1.00 7.56  ? 364 GLU B N   1 
ATOM 6007 C CA  . GLU B 1 364 ? -23.136 -26.659 73.558 1.00 8.10  ? 364 GLU B CA  1 
ATOM 6008 C C   . GLU B 1 364 ? -22.369 -26.947 74.856 1.00 9.07  ? 364 GLU B C   1 
ATOM 6009 O O   . GLU B 1 364 ? -21.110 -26.806 74.760 1.00 9.84  ? 364 GLU B O   1 
ATOM 6010 C CB  . GLU B 1 364 ? -23.621 -25.226 73.561 1.00 8.58  ? 364 GLU B CB  1 
ATOM 6011 C CG  . GLU B 1 364 ? -24.197 -24.823 72.258 1.00 8.89  ? 364 GLU B CG  1 
ATOM 6012 C CD  . GLU B 1 364 ? -24.696 -23.399 72.195 1.00 16.12 ? 364 GLU B CD  1 
ATOM 6013 O OE1 . GLU B 1 364 ? -24.517 -22.608 73.162 1.00 18.66 ? 364 GLU B OE1 1 
ATOM 6014 O OE2 . GLU B 1 364 ? -25.178 -22.983 71.104 1.00 12.44 ? 364 GLU B OE2 1 
ATOM 6015 N N   . ARG B 1 365 ? -23.006 -27.330 75.918 1.00 8.65  ? 365 ARG B N   1 
ATOM 6016 C CA  . ARG B 1 365 ? -22.276 -27.505 77.236 1.00 8.88  ? 365 ARG B CA  1 
ATOM 6017 C C   . ARG B 1 365 ? -21.170 -28.528 77.162 1.00 10.69 ? 365 ARG B C   1 
ATOM 6018 O O   . ARG B 1 365 ? -20.259 -28.522 78.045 1.00 11.46 ? 365 ARG B O   1 
ATOM 6019 C CB  . ARG B 1 365 ? -23.246 -27.848 78.336 1.00 9.75  ? 365 ARG B CB  1 
ATOM 6020 C CG  . ARG B 1 365 ? -23.914 -29.263 78.271 1.00 8.29  ? 365 ARG B CG  1 
ATOM 6021 C CD  . ARG B 1 365 ? -25.103 -29.412 79.183 1.00 8.46  ? 365 ARG B CD  1 
ATOM 6022 N NE  . ARG B 1 365 ? -26.078 -28.428 78.780 1.00 10.23 ? 365 ARG B NE  1 
ATOM 6023 C CZ  . ARG B 1 365 ? -26.745 -27.618 79.589 1.00 10.11 ? 365 ARG B CZ  1 
ATOM 6024 N NH1 . ARG B 1 365 ? -26.758 -27.916 80.923 1.00 12.87 ? 365 ARG B NH1 1 
ATOM 6025 N NH2 . ARG B 1 365 ? -27.503 -26.617 79.156 1.00 11.31 ? 365 ARG B NH2 1 
ATOM 6026 N N   . PHE B 1 366 ? -21.259 -29.483 76.250 1.00 9.13  ? 366 PHE B N   1 
ATOM 6027 C CA  . PHE B 1 366 ? -20.248 -30.570 76.191 1.00 8.32  ? 366 PHE B CA  1 
ATOM 6028 C C   . PHE B 1 366 ? -18.984 -30.170 75.467 1.00 9.03  ? 366 PHE B C   1 
ATOM 6029 O O   . PHE B 1 366 ? -18.060 -30.989 75.434 1.00 11.35 ? 366 PHE B O   1 
ATOM 6030 C CB  . PHE B 1 366 ? -20.917 -31.839 75.560 1.00 8.77  ? 366 PHE B CB  1 
ATOM 6031 C CG  . PHE B 1 366 ? -22.066 -32.290 76.340 1.00 9.25  ? 366 PHE B CG  1 
ATOM 6032 C CD1 . PHE B 1 366 ? -21.836 -33.002 77.573 1.00 9.73  ? 366 PHE B CD1 1 
ATOM 6033 C CD2 . PHE B 1 366 ? -23.408 -32.032 75.889 1.00 9.72  ? 366 PHE B CD2 1 
ATOM 6034 C CE1 . PHE B 1 366 ? -22.898 -33.431 78.325 1.00 9.25  ? 366 PHE B CE1 1 
ATOM 6035 C CE2 . PHE B 1 366 ? -24.464 -32.502 76.673 1.00 12.47 ? 366 PHE B CE2 1 
ATOM 6036 C CZ  . PHE B 1 366 ? -24.227 -33.141 77.924 1.00 9.99  ? 366 PHE B CZ  1 
ATOM 6037 N N   . LYS B 1 367 ? -18.941 -28.962 74.868 1.00 9.92  ? 367 LYS B N   1 
ATOM 6038 C CA  . LYS B 1 367 ? -17.806 -28.489 74.042 1.00 9.74  ? 367 LYS B CA  1 
ATOM 6039 C C   . LYS B 1 367 ? -17.341 -29.555 73.107 1.00 10.24 ? 367 LYS B C   1 
ATOM 6040 O O   . LYS B 1 367 ? -16.199 -30.038 73.100 1.00 10.81 ? 367 LYS B O   1 
ATOM 6041 C CB  . LYS B 1 367 ? -16.652 -28.021 74.999 1.00 12.50 ? 367 LYS B CB  1 
ATOM 6042 C CG  . LYS B 1 367 ? -17.128 -26.957 75.998 1.00 15.29 ? 367 LYS B CG  1 
ATOM 6043 C CD  . LYS B 1 367 ? -17.384 -25.669 75.300 1.00 24.06 ? 367 LYS B CD  1 
ATOM 6044 C CE  . LYS B 1 367 ? -16.849 -24.517 76.232 1.00 35.06 ? 367 LYS B CE  1 
ATOM 6045 N NZ  . LYS B 1 367 ? -17.777 -24.370 77.419 1.00 36.18 ? 367 LYS B NZ  1 
ATOM 6046 N N   . PRO B 1 368 ? -18.229 -30.009 72.238 1.00 8.16  ? 368 PRO B N   1 
ATOM 6047 C CA  . PRO B 1 368 ? -17.982 -31.107 71.356 1.00 8.15  ? 368 PRO B CA  1 
ATOM 6048 C C   . PRO B 1 368 ? -17.063 -30.830 70.182 1.00 8.36  ? 368 PRO B C   1 
ATOM 6049 O O   . PRO B 1 368 ? -16.978 -29.644 69.723 1.00 10.33 ? 368 PRO B O   1 
ATOM 6050 C CB  . PRO B 1 368 ? -19.388 -31.437 70.883 1.00 10.22 ? 368 PRO B CB  1 
ATOM 6051 C CG  . PRO B 1 368 ? -20.113 -30.151 70.830 1.00 9.37  ? 368 PRO B CG  1 
ATOM 6052 C CD  . PRO B 1 368 ? -19.563 -29.394 72.061 1.00 10.16 ? 368 PRO B CD  1 
ATOM 6053 N N   . GLN B 1 369 ? -16.420 -31.872 69.663 1.00 8.09  ? 369 GLN B N   1 
ATOM 6054 C CA  . GLN B 1 369 ? -15.688 -31.763 68.394 1.00 7.53  ? 369 GLN B CA  1 
ATOM 6055 C C   . GLN B 1 369 ? -16.550 -32.026 67.169 1.00 7.67  ? 369 GLN B C   1 
ATOM 6056 O O   . GLN B 1 369 ? -16.194 -31.672 66.017 1.00 9.45  ? 369 GLN B O   1 
ATOM 6057 C CB  . GLN B 1 369 ? -14.466 -32.653 68.351 1.00 7.99  ? 369 GLN B CB  1 
ATOM 6058 C CG  . GLN B 1 369 ? -14.686 -34.134 68.413 1.00 7.39  ? 369 GLN B CG  1 
ATOM 6059 C CD  . GLN B 1 369 ? -13.290 -34.788 68.352 1.00 11.02 ? 369 GLN B CD  1 
ATOM 6060 O OE1 . GLN B 1 369 ? -12.239 -34.161 68.632 1.00 13.12 ? 369 GLN B OE1 1 
ATOM 6061 N NE2 . GLN B 1 369 ? -13.246 -36.069 67.955 1.00 12.05 ? 369 GLN B NE2 1 
ATOM 6062 N N   . ALA B 1 370 ? -17.725 -32.652 67.403 1.00 7.21  ? 370 ALA B N   1 
ATOM 6063 C CA  . ALA B 1 370 ? -18.715 -32.920 66.293 1.00 7.25  ? 370 ALA B CA  1 
ATOM 6064 C C   . ALA B 1 370 ? -20.049 -33.127 66.926 1.00 7.77  ? 370 ALA B C   1 
ATOM 6065 O O   . ALA B 1 370 ? -20.096 -33.778 68.002 1.00 7.51  ? 370 ALA B O   1 
ATOM 6066 C CB  . ALA B 1 370 ? -18.331 -34.221 65.538 1.00 9.65  ? 370 ALA B CB  1 
ATOM 6067 N N   . VAL B 1 371 ? -21.097 -32.581 66.290 1.00 7.21  ? 371 VAL B N   1 
ATOM 6068 C CA  . VAL B 1 371 ? -22.518 -32.829 66.787 1.00 7.49  ? 371 VAL B CA  1 
ATOM 6069 C C   . VAL B 1 371 ? -23.220 -33.300 65.515 1.00 6.32  ? 371 VAL B C   1 
ATOM 6070 O O   . VAL B 1 371 ? -23.221 -32.624 64.524 1.00 8.63  ? 371 VAL B O   1 
ATOM 6071 C CB  . VAL B 1 371 ? -23.138 -31.535 67.296 1.00 6.81  ? 371 VAL B CB  1 
ATOM 6072 C CG1 . VAL B 1 371 ? -24.614 -31.811 67.714 1.00 8.12  ? 371 VAL B CG1 1 
ATOM 6073 C CG2 . VAL B 1 371 ? -22.324 -31.037 68.548 1.00 9.76  ? 371 VAL B CG2 1 
ATOM 6074 N N   . ILE B 1 372 ? -23.831 -34.497 65.598 1.00 6.13  ? 372 ILE B N   1 
ATOM 6075 C CA  . ILE B 1 372 ? -24.582 -35.051 64.445 1.00 7.23  ? 372 ILE B CA  1 
ATOM 6076 C C   . ILE B 1 372 ? -25.992 -35.293 64.957 1.00 8.08  ? 372 ILE B C   1 
ATOM 6077 O O   . ILE B 1 372 ? -26.175 -36.046 65.936 1.00 6.71  ? 372 ILE B O   1 
ATOM 6078 C CB  . ILE B 1 372 ? -23.969 -36.373 64.004 1.00 8.25  ? 372 ILE B CB  1 
ATOM 6079 C CG1 . ILE B 1 372 ? -22.495 -36.219 63.616 1.00 9.61  ? 372 ILE B CG1 1 
ATOM 6080 C CG2 . ILE B 1 372 ? -24.764 -36.896 62.757 1.00 10.73 ? 372 ILE B CG2 1 
ATOM 6081 C CD1 . ILE B 1 372 ? -21.758 -37.578 63.519 1.00 14.32 ? 372 ILE B CD1 1 
ATOM 6082 N N   . ASP B 1 373 ? -26.971 -34.675 64.290 1.00 6.20  ? 373 ASP B N   1 
ATOM 6083 C CA  . ASP B 1 373 ? -28.371 -35.019 64.605 1.00 6.40  ? 373 ASP B CA  1 
ATOM 6084 C C   . ASP B 1 373 ? -28.913 -36.023 63.568 1.00 5.40  ? 373 ASP B C   1 
ATOM 6085 O O   . ASP B 1 373 ? -28.479 -35.948 62.393 1.00 6.48  ? 373 ASP B O   1 
ATOM 6086 C CB  . ASP B 1 373 ? -29.210 -33.764 64.773 1.00 6.94  ? 373 ASP B CB  1 
ATOM 6087 C CG  . ASP B 1 373 ? -29.243 -32.930 63.517 1.00 8.11  ? 373 ASP B CG  1 
ATOM 6088 O OD1 . ASP B 1 373 ? -28.527 -33.334 62.557 1.00 8.35  ? 373 ASP B OD1 1 
ATOM 6089 O OD2 . ASP B 1 373 ? -30.035 -32.007 63.488 1.00 8.20  ? 373 ASP B OD2 1 
ATOM 6090 N N   . ILE B 1 374 ? -29.741 -36.921 64.030 1.00 6.26  ? 374 ILE B N   1 
ATOM 6091 C CA  . ILE B 1 374 ? -30.301 -37.976 63.161 1.00 6.34  ? 374 ILE B CA  1 
ATOM 6092 C C   . ILE B 1 374 ? -31.788 -37.923 63.365 1.00 6.94  ? 374 ILE B C   1 
ATOM 6093 O O   . ILE B 1 374 ? -32.291 -38.005 64.512 1.00 7.48  ? 374 ILE B O   1 
ATOM 6094 C CB  . ILE B 1 374 ? -29.699 -39.362 63.524 1.00 7.67  ? 374 ILE B CB  1 
ATOM 6095 C CG1 . ILE B 1 374 ? -28.175 -39.293 63.364 1.00 9.57  ? 374 ILE B CG1 1 
ATOM 6096 C CG2 . ILE B 1 374 ? -30.266 -40.409 62.568 1.00 7.77  ? 374 ILE B CG2 1 
ATOM 6097 C CD1 . ILE B 1 374 ? -27.467 -39.186 64.752 1.00 11.96 ? 374 ILE B CD1 1 
ATOM 6098 N N   . ALA B 1 375 ? -32.532 -37.816 62.229 1.00 5.80  ? 375 ALA B N   1 
ATOM 6099 C CA  . ALA B 1 375 ? -33.954 -37.611 62.359 1.00 7.80  ? 375 ALA B CA  1 
ATOM 6100 C C   . ALA B 1 375 ? -34.728 -38.034 61.154 1.00 8.73  ? 375 ALA B C   1 
ATOM 6101 O O   . ALA B 1 375 ? -34.271 -37.836 60.052 1.00 7.46  ? 375 ALA B O   1 
ATOM 6102 C CB  . ALA B 1 375 ? -34.213 -36.092 62.617 1.00 9.41  ? 375 ALA B CB  1 
ATOM 6103 N N   . THR B 1 376 ? -35.922 -38.637 61.394 1.00 8.12  ? 376 THR B N   1 
ATOM 6104 C CA  . THR B 1 376 ? -36.883 -38.969 60.301 1.00 8.78  ? 376 THR B CA  1 
ATOM 6105 C C   . THR B 1 376 ? -37.637 -37.675 60.006 1.00 9.54  ? 376 THR B C   1 
ATOM 6106 O O   . THR B 1 376 ? -38.835 -37.489 60.391 1.00 9.09  ? 376 THR B O   1 
ATOM 6107 C CB  . THR B 1 376 ? -37.791 -40.093 60.806 1.00 6.98  ? 376 THR B CB  1 
ATOM 6108 O OG1 . THR B 1 376 ? -38.211 -39.792 62.162 1.00 9.03  ? 376 THR B OG1 1 
ATOM 6109 C CG2 . THR B 1 376 ? -36.995 -41.356 60.910 1.00 9.43  ? 376 THR B CG2 1 
ATOM 6110 N N   . LEU B 1 377 ? -37.006 -36.739 59.272 1.00 8.47  ? 377 LEU B N   1 
ATOM 6111 C CA  . LEU B 1 377 ? -37.470 -35.385 59.428 1.00 8.09  ? 377 LEU B CA  1 
ATOM 6112 C C   . LEU B 1 377 ? -38.401 -34.885 58.326 1.00 11.06 ? 377 LEU B C   1 
ATOM 6113 O O   . LEU B 1 377 ? -39.338 -34.153 58.672 1.00 11.80 ? 377 LEU B O   1 
ATOM 6114 C CB  . LEU B 1 377 ? -36.197 -34.425 59.585 1.00 8.75  ? 377 LEU B CB  1 
ATOM 6115 C CG  . LEU B 1 377 ? -36.575 -33.006 59.947 1.00 9.97  ? 377 LEU B CG  1 
ATOM 6116 C CD1 . LEU B 1 377 ? -37.987 -32.807 60.497 1.00 10.68 ? 377 LEU B CD1 1 
ATOM 6117 C CD2 . LEU B 1 377 ? -35.527 -32.370 60.830 1.00 10.52 ? 377 LEU B CD2 1 
ATOM 6118 N N   . THR B 1 378 ? -38.196 -35.278 57.053 1.00 9.52  ? 378 THR B N   1 
ATOM 6119 C CA  . THR B 1 378 ? -38.988 -34.727 55.959 1.00 10.84 ? 378 THR B CA  1 
ATOM 6120 C C   . THR B 1 378 ? -39.432 -35.747 54.930 1.00 10.89 ? 378 THR B C   1 
ATOM 6121 O O   . THR B 1 378 ? -38.654 -36.609 54.473 1.00 11.92 ? 378 THR B O   1 
ATOM 6122 C CB  . THR B 1 378 ? -38.277 -33.551 55.179 1.00 11.48 ? 378 THR B CB  1 
ATOM 6123 O OG1 . THR B 1 378 ? -37.083 -34.068 54.560 1.00 11.29 ? 378 THR B OG1 1 
ATOM 6124 C CG2 . THR B 1 378 ? -37.839 -32.429 56.140 1.00 14.29 ? 378 THR B CG2 1 
ATOM 6125 N N   . GLY B 1 379 ? -40.728 -35.698 54.606 1.00 12.37 ? 379 GLY B N   1 
ATOM 6126 C CA  . GLY B 1 379 ? -41.195 -36.456 53.433 1.00 14.98 ? 379 GLY B CA  1 
ATOM 6127 C C   . GLY B 1 379 ? -40.449 -35.966 52.224 1.00 14.09 ? 379 GLY B C   1 
ATOM 6128 O O   . GLY B 1 379 ? -40.246 -36.760 51.273 1.00 12.87 ? 379 GLY B O   1 
ATOM 6129 N N   . ALA B 1 380 ? -40.058 -34.673 52.165 1.00 13.75 ? 380 ALA B N   1 
ATOM 6130 C CA  . ALA B 1 380 ? -39.285 -34.223 51.023 1.00 13.21 ? 380 ALA B CA  1 
ATOM 6131 C C   . ALA B 1 380 ? -37.975 -34.980 50.787 1.00 13.66 ? 380 ALA B C   1 
ATOM 6132 O O   . ALA B 1 380 ? -37.498 -35.055 49.703 1.00 13.62 ? 380 ALA B O   1 
ATOM 6133 C CB  . ALA B 1 380 ? -39.002 -32.621 51.048 1.00 15.58 ? 380 ALA B CB  1 
ATOM 6134 N N   . CYS B 1 381 ? -37.343 -35.488 51.817 1.00 11.88 ? 381 CYS B N   1 
ATOM 6135 C CA  . CYS B 1 381 ? -36.056 -36.262 51.626 1.00 12.11 ? 381 CYS B CA  1 
ATOM 6136 C C   . CYS B 1 381 ? -36.349 -37.621 50.891 1.00 12.34 ? 381 CYS B C   1 
ATOM 6137 O O   . CYS B 1 381 ? -35.541 -38.082 50.076 1.00 12.47 ? 381 CYS B O   1 
ATOM 6138 C CB  . CYS B 1 381 ? -35.454 -36.563 53.009 1.00 12.45 ? 381 CYS B CB  1 
ATOM 6139 S SG  . CYS B 1 381 ? -33.725 -37.120 52.739 1.00 13.45 ? 381 CYS B SG  1 
ATOM 6140 N N   . ILE B 1 382 ? -37.548 -38.129 51.020 1.00 9.30  ? 382 ILE B N   1 
ATOM 6141 C CA  . ILE B 1 382 ? -37.982 -39.360 50.283 1.00 11.53 ? 382 ILE B CA  1 
ATOM 6142 C C   . ILE B 1 382 ? -38.197 -38.985 48.824 1.00 13.55 ? 382 ILE B C   1 
ATOM 6143 O O   . ILE B 1 382 ? -37.748 -39.697 47.938 1.00 12.35 ? 382 ILE B O   1 
ATOM 6144 C CB  . ILE B 1 382 ? -39.247 -39.990 50.885 1.00 13.27 ? 382 ILE B CB  1 
ATOM 6145 C CG1 . ILE B 1 382 ? -39.066 -40.127 52.422 1.00 13.04 ? 382 ILE B CG1 1 
ATOM 6146 C CG2 . ILE B 1 382 ? -39.452 -41.384 50.198 1.00 16.96 ? 382 ILE B CG2 1 
ATOM 6147 C CD1 . ILE B 1 382 ? -40.287 -40.602 53.131 1.00 15.72 ? 382 ILE B CD1 1 
ATOM 6148 N N   . VAL B 1 383 ? -38.827 -37.818 48.575 1.00 10.96 ? 383 VAL B N   1 
ATOM 6149 C CA  . VAL B 1 383 ? -38.889 -37.324 47.191 1.00 13.43 ? 383 VAL B CA  1 
ATOM 6150 C C   . VAL B 1 383 ? -37.493 -37.115 46.571 1.00 11.72 ? 383 VAL B C   1 
ATOM 6151 O O   . VAL B 1 383 ? -37.243 -37.448 45.387 1.00 13.65 ? 383 VAL B O   1 
ATOM 6152 C CB  . VAL B 1 383 ? -39.700 -36.000 47.170 1.00 13.31 ? 383 VAL B CB  1 
ATOM 6153 C CG1 . VAL B 1 383 ? -39.728 -35.455 45.726 1.00 15.73 ? 383 VAL B CG1 1 
ATOM 6154 C CG2 . VAL B 1 383 ? -41.130 -36.381 47.565 1.00 13.62 ? 383 VAL B CG2 1 
ATOM 6155 N N   . ALA B 1 384 ? -36.556 -36.583 47.354 1.00 13.46 ? 384 ALA B N   1 
ATOM 6156 C CA  . ALA B 1 384 ? -35.245 -36.290 46.811 1.00 12.18 ? 384 ALA B CA  1 
ATOM 6157 C C   . ALA B 1 384 ? -34.359 -37.501 46.658 1.00 13.64 ? 384 ALA B C   1 
ATOM 6158 O O   . ALA B 1 384 ? -33.582 -37.579 45.675 1.00 13.58 ? 384 ALA B O   1 
ATOM 6159 C CB  . ALA B 1 384 ? -34.492 -35.276 47.697 1.00 12.39 ? 384 ALA B CB  1 
ATOM 6160 N N   . LEU B 1 385 ? -34.302 -38.372 47.668 1.00 10.82 ? 385 LEU B N   1 
ATOM 6161 C CA  . LEU B 1 385 ? -33.240 -39.431 47.688 1.00 9.89  ? 385 LEU B CA  1 
ATOM 6162 C C   . LEU B 1 385 ? -33.862 -40.794 47.918 1.00 9.03  ? 385 LEU B C   1 
ATOM 6163 O O   . LEU B 1 385 ? -33.134 -41.837 47.902 1.00 10.98 ? 385 LEU B O   1 
ATOM 6164 C CB  . LEU B 1 385 ? -32.197 -39.141 48.760 1.00 10.26 ? 385 LEU B CB  1 
ATOM 6165 C CG  . LEU B 1 385 ? -31.272 -38.000 48.483 1.00 10.56 ? 385 LEU B CG  1 
ATOM 6166 C CD1 . LEU B 1 385 ? -30.609 -37.536 49.730 1.00 12.56 ? 385 LEU B CD1 1 
ATOM 6167 C CD2 . LEU B 1 385 ? -30.291 -38.337 47.409 1.00 13.82 ? 385 LEU B CD2 1 
ATOM 6168 N N   . GLY B 1 386 ? -35.192 -40.850 48.094 1.00 9.90  ? 386 GLY B N   1 
ATOM 6169 C CA  . GLY B 1 386 ? -35.848 -42.166 48.149 1.00 10.51 ? 386 GLY B CA  1 
ATOM 6170 C C   . GLY B 1 386 ? -35.499 -43.058 49.308 1.00 10.51 ? 386 GLY B C   1 
ATOM 6171 O O   . GLY B 1 386 ? -35.205 -42.547 50.411 1.00 11.67 ? 386 GLY B O   1 
ATOM 6172 N N   . SER B 1 387 ? -35.547 -44.353 49.080 1.00 12.14 ? 387 SER B N   1 
ATOM 6173 C CA  . SER B 1 387 ? -35.362 -45.318 50.191 1.00 14.55 ? 387 SER B CA  1 
ATOM 6174 C C   . SER B 1 387 ? -33.967 -45.758 50.404 1.00 13.28 ? 387 SER B C   1 
ATOM 6175 O O   . SER B 1 387 ? -33.671 -46.397 51.466 1.00 13.86 ? 387 SER B O   1 
ATOM 6176 C CB  . SER B 1 387 ? -36.143 -46.601 49.854 1.00 15.94 ? 387 SER B CB  1 
ATOM 6177 O OG  . SER B 1 387 ? -37.531 -46.357 49.940 1.00 27.76 ? 387 SER B OG  1 
ATOM 6178 N N   . HIS B 1 388 ? -33.048 -45.367 49.531 1.00 9.82  ? 388 HIS B N   1 
ATOM 6179 C CA  . HIS B 1 388 ? -31.722 -45.950 49.477 1.00 11.28 ? 388 HIS B CA  1 
ATOM 6180 C C   . HIS B 1 388 ? -30.608 -45.155 50.155 1.00 10.70 ? 388 HIS B C   1 
ATOM 6181 O O   . HIS B 1 388 ? -29.583 -45.747 50.483 1.00 11.91 ? 388 HIS B O   1 
ATOM 6182 C CB  . HIS B 1 388 ? -31.296 -46.323 48.035 1.00 12.03 ? 388 HIS B CB  1 
ATOM 6183 C CG  . HIS B 1 388 ? -32.257 -47.281 47.459 1.00 15.30 ? 388 HIS B CG  1 
ATOM 6184 N ND1 . HIS B 1 388 ? -32.426 -48.549 48.017 1.00 19.01 ? 388 HIS B ND1 1 
ATOM 6185 C CD2 . HIS B 1 388 ? -33.146 -47.173 46.428 1.00 16.86 ? 388 HIS B CD2 1 
ATOM 6186 C CE1 . HIS B 1 388 ? -33.409 -49.161 47.360 1.00 21.93 ? 388 HIS B CE1 1 
ATOM 6187 N NE2 . HIS B 1 388 ? -33.847 -48.364 46.377 1.00 18.89 ? 388 HIS B NE2 1 
ATOM 6188 N N   . THR B 1 389 ? -30.812 -43.860 50.238 1.00 8.79  ? 389 THR B N   1 
ATOM 6189 C CA  . THR B 1 389 ? -29.685 -42.959 50.572 1.00 7.36  ? 389 THR B CA  1 
ATOM 6190 C C   . THR B 1 389 ? -30.106 -41.940 51.549 1.00 8.07  ? 389 THR B C   1 
ATOM 6191 O O   . THR B 1 389 ? -31.157 -41.231 51.347 1.00 8.38  ? 389 THR B O   1 
ATOM 6192 C CB  . THR B 1 389 ? -29.206 -42.225 49.252 1.00 8.88  ? 389 THR B CB  1 
ATOM 6193 O OG1 . THR B 1 389 ? -28.945 -43.248 48.261 1.00 9.75  ? 389 THR B OG1 1 
ATOM 6194 C CG2 . THR B 1 389 ? -27.957 -41.496 49.467 1.00 10.21 ? 389 THR B CG2 1 
ATOM 6195 N N   . THR B 1 390 ? -29.411 -41.833 52.684 1.00 7.67  ? 390 THR B N   1 
ATOM 6196 C CA  . THR B 1 390 ? -29.769 -40.843 53.709 1.00 6.39  ? 390 THR B CA  1 
ATOM 6197 C C   . THR B 1 390 ? -29.390 -39.421 53.321 1.00 7.17  ? 390 THR B C   1 
ATOM 6198 O O   . THR B 1 390 ? -28.335 -39.237 52.675 1.00 8.20  ? 390 THR B O   1 
ATOM 6199 C CB  . THR B 1 390 ? -28.998 -41.217 54.946 1.00 6.62  ? 390 THR B CB  1 
ATOM 6200 O OG1 . THR B 1 390 ? -29.608 -42.460 55.474 1.00 9.44  ? 390 THR B OG1 1 
ATOM 6201 C CG2 . THR B 1 390 ? -29.078 -40.106 56.038 1.00 7.65  ? 390 THR B CG2 1 
ATOM 6202 N N   . GLY B 1 391 ? -30.266 -38.457 53.532 1.00 6.34  ? 391 GLY B N   1 
ATOM 6203 C CA  . GLY B 1 391 ? -29.929 -37.046 53.235 1.00 7.32  ? 391 GLY B CA  1 
ATOM 6204 C C   . GLY B 1 391 ? -28.945 -36.482 54.266 1.00 7.88  ? 391 GLY B C   1 
ATOM 6205 O O   . GLY B 1 391 ? -29.150 -36.687 55.471 1.00 7.71  ? 391 GLY B O   1 
ATOM 6206 N N   . LEU B 1 392 ? -27.929 -35.739 53.849 1.00 6.77  ? 392 LEU B N   1 
ATOM 6207 C CA  . LEU B 1 392 ? -26.921 -35.244 54.798 1.00 6.32  ? 392 LEU B CA  1 
ATOM 6208 C C   . LEU B 1 392 ? -26.654 -33.761 54.562 1.00 6.46  ? 392 LEU B C   1 
ATOM 6209 O O   . LEU B 1 392 ? -26.436 -33.387 53.390 1.00 8.03  ? 392 LEU B O   1 
ATOM 6210 C CB  . LEU B 1 392 ? -25.643 -36.071 54.603 1.00 7.14  ? 392 LEU B CB  1 
ATOM 6211 C CG  . LEU B 1 392 ? -24.423 -35.543 55.419 1.00 7.18  ? 392 LEU B CG  1 
ATOM 6212 C CD1 . LEU B 1 392 ? -24.676 -35.720 56.942 1.00 7.87  ? 392 LEU B CD1 1 
ATOM 6213 C CD2 . LEU B 1 392 ? -23.246 -36.399 55.028 1.00 8.66  ? 392 LEU B CD2 1 
ATOM 6214 N N   . MET B 1 393 ? -26.645 -32.957 55.593 1.00 6.76  ? 393 MET B N   1 
ATOM 6215 C CA  . MET B 1 393 ? -26.339 -31.505 55.471 1.00 7.22  ? 393 MET B CA  1 
ATOM 6216 C C   . MET B 1 393 ? -25.434 -31.161 56.611 1.00 8.61  ? 393 MET B C   1 
ATOM 6217 O O   . MET B 1 393 ? -25.341 -31.895 57.603 1.00 8.42  ? 393 MET B O   1 
ATOM 6218 C CB  . MET B 1 393 ? -27.644 -30.703 55.526 1.00 8.13  ? 393 MET B CB  1 
ATOM 6219 C CG  . MET B 1 393 ? -28.566 -30.928 54.318 1.00 7.38  ? 393 MET B CG  1 
ATOM 6220 S SD  . MET B 1 393 ? -30.054 -29.908 54.366 1.00 9.78  ? 393 MET B SD  1 
ATOM 6221 C CE  . MET B 1 393 ? -31.008 -30.814 55.617 1.00 8.97  ? 393 MET B CE  1 
ATOM 6222 N N   . GLY B 1 394 ? -24.714 -30.024 56.526 1.00 6.90  ? 394 GLY B N   1 
ATOM 6223 C CA  . GLY B 1 394 ? -23.898 -29.661 57.728 1.00 8.47  ? 394 GLY B CA  1 
ATOM 6224 C C   . GLY B 1 394 ? -23.285 -28.333 57.547 1.00 8.56  ? 394 GLY B C   1 
ATOM 6225 O O   . GLY B 1 394 ? -23.389 -27.636 56.525 1.00 10.60 ? 394 GLY B O   1 
ATOM 6226 N N   . ASN B 1 395 ? -22.584 -27.968 58.641 1.00 7.75  ? 395 ASN B N   1 
ATOM 6227 C CA  . ASN B 1 395 ? -21.894 -26.626 58.625 1.00 9.09  ? 395 ASN B CA  1 
ATOM 6228 C C   . ASN B 1 395 ? -20.346 -26.727 58.481 1.00 10.61 ? 395 ASN B C   1 
ATOM 6229 O O   . ASN B 1 395 ? -19.668 -25.724 58.687 1.00 10.88 ? 395 ASN B O   1 
ATOM 6230 C CB  . ASN B 1 395 ? -22.303 -25.767 59.789 1.00 8.06  ? 395 ASN B CB  1 
ATOM 6231 C CG  . ASN B 1 395 ? -21.789 -26.274 61.101 1.00 8.77  ? 395 ASN B CG  1 
ATOM 6232 O OD1 . ASN B 1 395 ? -20.943 -27.132 61.189 1.00 7.22  ? 395 ASN B OD1 1 
ATOM 6233 N ND2 . ASN B 1 395 ? -22.361 -25.707 62.176 1.00 9.08  ? 395 ASN B ND2 1 
ATOM 6234 N N   . ASN B 1 396 ? -19.861 -27.951 58.374 1.00 7.97  ? 396 ASN B N   1 
ATOM 6235 C CA  . ASN B 1 396 ? -18.434 -28.225 58.355 1.00 9.82  ? 396 ASN B CA  1 
ATOM 6236 C C   . ASN B 1 396 ? -18.163 -29.263 57.295 1.00 12.35 ? 396 ASN B C   1 
ATOM 6237 O O   . ASN B 1 396 ? -18.663 -30.395 57.345 1.00 10.17 ? 396 ASN B O   1 
ATOM 6238 C CB  . ASN B 1 396 ? -18.004 -28.747 59.701 1.00 9.44  ? 396 ASN B CB  1 
ATOM 6239 C CG  . ASN B 1 396 ? -16.520 -28.791 59.878 1.00 11.00 ? 396 ASN B CG  1 
ATOM 6240 O OD1 . ASN B 1 396 ? -15.774 -27.910 59.270 1.00 18.60 ? 396 ASN B OD1 1 
ATOM 6241 N ND2 . ASN B 1 396 ? -16.047 -29.727 60.538 1.00 7.84  ? 396 ASN B ND2 1 
ATOM 6242 N N   . ASP B 1 397 ? -17.326 -28.885 56.319 1.00 11.70 ? 397 ASP B N   1 
ATOM 6243 C CA  . ASP B 1 397 ? -17.111 -29.763 55.188 1.00 12.66 ? 397 ASP B CA  1 
ATOM 6244 C C   . ASP B 1 397 ? -16.374 -31.000 55.593 1.00 10.77 ? 397 ASP B C   1 
ATOM 6245 O O   . ASP B 1 397 ? -16.620 -32.097 55.034 1.00 11.48 ? 397 ASP B O   1 
ATOM 6246 C CB  . ASP B 1 397 ? -16.236 -29.038 54.132 1.00 14.07 ? 397 ASP B CB  1 
ATOM 6247 C CG  . ASP B 1 397 ? -16.991 -27.968 53.341 1.00 25.82 ? 397 ASP B CG  1 
ATOM 6248 O OD1 . ASP B 1 397 ? -18.243 -27.871 53.437 1.00 34.24 ? 397 ASP B OD1 1 
ATOM 6249 O OD2 . ASP B 1 397 ? -16.279 -27.194 52.599 1.00 35.29 ? 397 ASP B OD2 1 
ATOM 6250 N N   . ASP B 1 398 ? -15.390 -30.868 56.491 1.00 10.92 ? 398 ASP B N   1 
ATOM 6251 C CA  . ASP B 1 398 ? -14.641 -32.042 56.887 1.00 11.90 ? 398 ASP B CA  1 
ATOM 6252 C C   . ASP B 1 398 ? -15.532 -33.095 57.527 1.00 8.80  ? 398 ASP B C   1 
ATOM 6253 O O   . ASP B 1 398 ? -15.425 -34.289 57.281 1.00 10.43 ? 398 ASP B O   1 
ATOM 6254 C CB  . ASP B 1 398 ? -13.517 -31.708 57.890 1.00 13.10 ? 398 ASP B CB  1 
ATOM 6255 C CG  . ASP B 1 398 ? -12.305 -31.059 57.181 1.00 22.80 ? 398 ASP B CG  1 
ATOM 6256 O OD1 . ASP B 1 398 ? -12.255 -30.983 55.940 1.00 25.28 ? 398 ASP B OD1 1 
ATOM 6257 O OD2 . ASP B 1 398 ? -11.402 -30.662 57.955 1.00 27.95 ? 398 ASP B OD2 1 
ATOM 6258 N N   . LEU B 1 399 ? -16.427 -32.658 58.414 1.00 9.50  ? 399 LEU B N   1 
ATOM 6259 C CA  . LEU B 1 399 ? -17.331 -33.599 59.086 1.00 9.19  ? 399 LEU B CA  1 
ATOM 6260 C C   . LEU B 1 399 ? -18.292 -34.258 58.081 1.00 8.18  ? 399 LEU B C   1 
ATOM 6261 O O   . LEU B 1 399 ? -18.467 -35.487 58.113 1.00 8.43  ? 399 LEU B O   1 
ATOM 6262 C CB  . LEU B 1 399 ? -18.147 -32.864 60.142 1.00 7.95  ? 399 LEU B CB  1 
ATOM 6263 C CG  . LEU B 1 399 ? -19.238 -33.672 60.891 1.00 6.73  ? 399 LEU B CG  1 
ATOM 6264 C CD1 . LEU B 1 399 ? -18.672 -34.978 61.499 1.00 8.45  ? 399 LEU B CD1 1 
ATOM 6265 C CD2 . LEU B 1 399 ? -19.858 -32.730 61.948 1.00 7.27  ? 399 LEU B CD2 1 
ATOM 6266 N N   . VAL B 1 400 ? -18.866 -33.427 57.217 1.00 8.25  ? 400 VAL B N   1 
ATOM 6267 C CA  . VAL B 1 400 ? -19.740 -34.010 56.199 1.00 7.42  ? 400 VAL B CA  1 
ATOM 6268 C C   . VAL B 1 400 ? -18.992 -35.051 55.391 1.00 6.90  ? 400 VAL B C   1 
ATOM 6269 O O   . VAL B 1 400 ? -19.487 -36.135 55.091 1.00 7.28  ? 400 VAL B O   1 
ATOM 6270 C CB  . VAL B 1 400 ? -20.344 -32.849 55.301 1.00 10.24 ? 400 VAL B CB  1 
ATOM 6271 C CG1 . VAL B 1 400 ? -21.044 -33.417 54.060 1.00 11.13 ? 400 VAL B CG1 1 
ATOM 6272 C CG2 . VAL B 1 400 ? -21.378 -32.090 56.119 1.00 10.06 ? 400 VAL B CG2 1 
ATOM 6273 N N   . GLY B 1 401 ? -17.730 -34.709 55.000 1.00 9.80  ? 401 GLY B N   1 
ATOM 6274 C CA  . GLY B 1 401 ? -17.007 -35.660 54.179 1.00 8.43  ? 401 GLY B CA  1 
ATOM 6275 C C   . GLY B 1 401 ? -16.669 -36.937 54.921 1.00 7.88  ? 401 GLY B C   1 
ATOM 6276 O O   . GLY B 1 401 ? -16.695 -38.003 54.310 1.00 9.52  ? 401 GLY B O   1 
ATOM 6277 N N   . GLN B 1 402 ? -16.411 -36.871 56.224 1.00 8.49  ? 402 GLN B N   1 
ATOM 6278 C CA  . GLN B 1 402 ? -16.084 -38.046 57.087 1.00 8.09  ? 402 GLN B CA  1 
ATOM 6279 C C   . GLN B 1 402 ? -17.363 -38.940 57.102 1.00 7.21  ? 402 GLN B C   1 
ATOM 6280 O O   . GLN B 1 402 ? -17.266 -40.159 57.087 1.00 7.79  ? 402 GLN B O   1 
ATOM 6281 C CB  . GLN B 1 402 ? -15.787 -37.563 58.462 1.00 8.74  ? 402 GLN B CB  1 
ATOM 6282 C CG  . GLN B 1 402 ? -14.327 -37.016 58.510 1.00 7.99  ? 402 GLN B CG  1 
ATOM 6283 C CD  . GLN B 1 402 ? -14.036 -36.406 59.823 1.00 12.50 ? 402 GLN B CD  1 
ATOM 6284 O OE1 . GLN B 1 402 ? -14.911 -36.121 60.611 1.00 11.86 ? 402 GLN B OE1 1 
ATOM 6285 N NE2 . GLN B 1 402 ? -12.752 -36.145 60.056 1.00 18.90 ? 402 GLN B NE2 1 
ATOM 6286 N N   . LEU B 1 403 ? -18.549 -38.328 57.182 1.00 7.94  ? 403 LEU B N   1 
ATOM 6287 C CA  . LEU B 1 403 ? -19.805 -39.125 57.305 1.00 8.43  ? 403 LEU B CA  1 
ATOM 6288 C C   . LEU B 1 403 ? -20.137 -39.789 55.937 1.00 7.06  ? 403 LEU B C   1 
ATOM 6289 O O   . LEU B 1 403 ? -20.519 -40.977 55.879 1.00 8.81  ? 403 LEU B O   1 
ATOM 6290 C CB  . LEU B 1 403 ? -20.937 -38.162 57.722 1.00 8.22  ? 403 LEU B CB  1 
ATOM 6291 C CG  . LEU B 1 403 ? -20.775 -37.806 59.213 1.00 6.32  ? 403 LEU B CG  1 
ATOM 6292 C CD1 . LEU B 1 403 ? -21.718 -36.631 59.585 1.00 8.85  ? 403 LEU B CD1 1 
ATOM 6293 C CD2 . LEU B 1 403 ? -21.052 -38.964 60.225 1.00 9.86  ? 403 LEU B CD2 1 
ATOM 6294 N N   . LEU B 1 404 ? -19.916 -39.041 54.859 1.00 6.77  ? 404 LEU B N   1 
ATOM 6295 C CA  . LEU B 1 404 ? -20.053 -39.651 53.525 1.00 8.17  ? 404 LEU B CA  1 
ATOM 6296 C C   . LEU B 1 404 ? -19.129 -40.847 53.328 1.00 7.60  ? 404 LEU B C   1 
ATOM 6297 O O   . LEU B 1 404 ? -19.533 -41.892 52.836 1.00 8.95  ? 404 LEU B O   1 
ATOM 6298 C CB  . LEU B 1 404 ? -19.840 -38.651 52.409 1.00 6.86  ? 404 LEU B CB  1 
ATOM 6299 C CG  . LEU B 1 404 ? -20.869 -37.553 52.360 1.00 8.31  ? 404 LEU B CG  1 
ATOM 6300 C CD1 . LEU B 1 404 ? -20.397 -36.393 51.454 1.00 8.50  ? 404 LEU B CD1 1 
ATOM 6301 C CD2 . LEU B 1 404 ? -22.254 -38.183 51.903 1.00 9.30  ? 404 LEU B CD2 1 
ATOM 6302 N N   . ASP B 1 405 ? -17.851 -40.626 53.741 1.00 7.75  ? 405 ASP B N   1 
ATOM 6303 C CA  . ASP B 1 405 ? -16.907 -41.723 53.526 1.00 9.03  ? 405 ASP B CA  1 
ATOM 6304 C C   . ASP B 1 405 ? -17.237 -42.916 54.389 1.00 8.13  ? 405 ASP B C   1 
ATOM 6305 O O   . ASP B 1 405 ? -17.176 -44.060 53.901 1.00 9.87  ? 405 ASP B O   1 
ATOM 6306 C CB  . ASP B 1 405 ? -15.474 -41.219 53.836 1.00 10.60 ? 405 ASP B CB  1 
ATOM 6307 C CG  . ASP B 1 405 ? -14.445 -42.173 53.189 1.00 17.79 ? 405 ASP B CG  1 
ATOM 6308 O OD1 . ASP B 1 405 ? -14.481 -42.244 51.909 1.00 23.35 ? 405 ASP B OD1 1 
ATOM 6309 O OD2 . ASP B 1 405 ? -13.676 -42.770 53.931 1.00 24.88 ? 405 ASP B OD2 1 
ATOM 6310 N N   . ALA B 1 406 ? -17.629 -42.680 55.654 1.00 9.53  ? 406 ALA B N   1 
ATOM 6311 C CA  . ALA B 1 406 ? -18.061 -43.752 56.523 1.00 9.16  ? 406 ALA B CA  1 
ATOM 6312 C C   . ALA B 1 406 ? -19.264 -44.529 55.827 1.00 8.73  ? 406 ALA B C   1 
ATOM 6313 O O   . ALA B 1 406 ? -19.323 -45.781 55.885 1.00 8.56  ? 406 ALA B O   1 
ATOM 6314 C CB  . ALA B 1 406 ? -18.474 -43.165 57.869 1.00 9.47  ? 406 ALA B CB  1 
ATOM 6315 N N   . GLY B 1 407 ? -20.215 -43.769 55.277 1.00 7.87  ? 407 GLY B N   1 
ATOM 6316 C CA  . GLY B 1 407 ? -21.326 -44.450 54.643 1.00 8.40  ? 407 GLY B CA  1 
ATOM 6317 C C   . GLY B 1 407 ? -20.955 -45.303 53.481 1.00 8.06  ? 407 GLY B C   1 
ATOM 6318 O O   . GLY B 1 407 ? -21.540 -46.367 53.265 1.00 9.55  ? 407 GLY B O   1 
ATOM 6319 N N   . LYS B 1 408 ? -20.013 -44.835 52.671 1.00 8.26  ? 408 LYS B N   1 
ATOM 6320 C CA  . LYS B 1 408 ? -19.593 -45.678 51.567 1.00 8.92  ? 408 LYS B CA  1 
ATOM 6321 C C   . LYS B 1 408 ? -18.940 -46.955 52.067 1.00 9.95  ? 408 LYS B C   1 
ATOM 6322 O O   . LYS B 1 408 ? -19.235 -48.048 51.569 1.00 11.61 ? 408 LYS B O   1 
ATOM 6323 C CB  . LYS B 1 408 ? -18.586 -44.880 50.722 1.00 8.85  ? 408 LYS B CB  1 
ATOM 6324 C CG  . LYS B 1 408 ? -19.251 -43.680 50.007 1.00 11.58 ? 408 LYS B CG  1 
ATOM 6325 C CD  . LYS B 1 408 ? -18.201 -43.025 49.086 1.00 19.24 ? 408 LYS B CD  1 
ATOM 6326 C CE  . LYS B 1 408 ? -18.454 -41.553 48.988 1.00 27.03 ? 408 LYS B CE  1 
ATOM 6327 N NZ  . LYS B 1 408 ? -17.374 -40.965 48.066 1.00 27.75 ? 408 LYS B NZ  1 
ATOM 6328 N N   . ARG B 1 409 ? -18.061 -46.844 53.045 1.00 9.25  ? 409 ARG B N   1 
ATOM 6329 C CA  . ARG B 1 409 ? -17.331 -48.032 53.518 1.00 9.65  ? 409 ARG B CA  1 
ATOM 6330 C C   . ARG B 1 409 ? -18.264 -48.982 54.246 1.00 9.94  ? 409 ARG B C   1 
ATOM 6331 O O   . ARG B 1 409 ? -18.056 -50.185 54.233 1.00 11.86 ? 409 ARG B O   1 
ATOM 6332 C CB  . ARG B 1 409 ? -16.121 -47.649 54.341 1.00 10.74 ? 409 ARG B CB  1 
ATOM 6333 C CG  . ARG B 1 409 ? -14.964 -47.394 53.320 1.00 14.44 ? 409 ARG B CG  1 
ATOM 6334 C CD  . ARG B 1 409 ? -13.655 -47.022 54.066 1.00 14.97 ? 409 ARG B CD  1 
ATOM 6335 N NE  . ARG B 1 409 ? -13.819 -45.687 54.595 1.00 19.06 ? 409 ARG B NE  1 
ATOM 6336 C CZ  . ARG B 1 409 ? -14.025 -45.423 55.883 1.00 11.66 ? 409 ARG B CZ  1 
ATOM 6337 N NH1 . ARG B 1 409 ? -14.066 -46.374 56.837 1.00 15.98 ? 409 ARG B NH1 1 
ATOM 6338 N NH2 . ARG B 1 409 ? -14.180 -44.160 56.275 1.00 15.04 ? 409 ARG B NH2 1 
ATOM 6339 N N   . ALA B 1 410 ? -19.318 -48.475 54.918 1.00 8.84  ? 410 ALA B N   1 
ATOM 6340 C CA  . ALA B 1 410 ? -20.236 -49.335 55.637 1.00 8.62  ? 410 ALA B CA  1 
ATOM 6341 C C   . ALA B 1 410 ? -21.338 -49.825 54.703 1.00 9.85  ? 410 ALA B C   1 
ATOM 6342 O O   . ALA B 1 410 ? -22.143 -50.608 55.189 1.00 10.88 ? 410 ALA B O   1 
ATOM 6343 C CB  . ALA B 1 410 ? -20.819 -48.565 56.838 1.00 9.46  ? 410 ALA B CB  1 
ATOM 6344 N N   . ASP B 1 411 ? -21.409 -49.344 53.476 1.00 9.83  ? 411 ASP B N   1 
ATOM 6345 C CA  . ASP B 1 411 ? -22.574 -49.683 52.662 1.00 8.66  ? 411 ASP B CA  1 
ATOM 6346 C C   . ASP B 1 411 ? -23.865 -49.277 53.316 1.00 9.86  ? 411 ASP B C   1 
ATOM 6347 O O   . ASP B 1 411 ? -24.865 -50.018 53.375 1.00 10.45 ? 411 ASP B O   1 
ATOM 6348 C CB  . ASP B 1 411 ? -22.589 -51.134 52.172 1.00 7.76  ? 411 ASP B CB  1 
ATOM 6349 C CG  . ASP B 1 411 ? -23.749 -51.390 51.215 1.00 12.21 ? 411 ASP B CG  1 
ATOM 6350 O OD1 . ASP B 1 411 ? -24.133 -50.433 50.468 1.00 12.51 ? 411 ASP B OD1 1 
ATOM 6351 O OD2 . ASP B 1 411 ? -24.309 -52.508 51.162 1.00 12.07 ? 411 ASP B OD2 1 
ATOM 6352 N N   . ASP B 1 412 ? -23.840 -48.023 53.800 1.00 8.84  ? 412 ASP B N   1 
ATOM 6353 C CA  . ASP B 1 412 ? -25.047 -47.394 54.399 1.00 10.18 ? 412 ASP B CA  1 
ATOM 6354 C C   . ASP B 1 412 ? -24.965 -45.925 53.984 1.00 8.31  ? 412 ASP B C   1 
ATOM 6355 O O   . ASP B 1 412 ? -24.650 -45.007 54.751 1.00 9.75  ? 412 ASP B O   1 
ATOM 6356 C CB  . ASP B 1 412 ? -24.973 -47.630 55.901 1.00 11.63 ? 412 ASP B CB  1 
ATOM 6357 C CG  . ASP B 1 412 ? -26.057 -46.931 56.681 1.00 13.07 ? 412 ASP B CG  1 
ATOM 6358 O OD1 . ASP B 1 412 ? -27.053 -46.437 56.054 1.00 13.10 ? 412 ASP B OD1 1 
ATOM 6359 O OD2 . ASP B 1 412 ? -26.073 -46.846 57.964 1.00 12.02 ? 412 ASP B OD2 1 
ATOM 6360 N N   . ARG B 1 413 ? -25.230 -45.717 52.716 1.00 9.01  ? 413 ARG B N   1 
ATOM 6361 C CA  . ARG B 1 413 ? -24.808 -44.428 52.075 1.00 7.81  ? 413 ARG B CA  1 
ATOM 6362 C C   . ARG B 1 413 ? -25.649 -43.245 52.438 1.00 7.90  ? 413 ARG B C   1 
ATOM 6363 O O   . ARG B 1 413 ? -26.890 -43.382 52.669 1.00 8.67  ? 413 ARG B O   1 
ATOM 6364 C CB  . ARG B 1 413 ? -24.740 -44.572 50.564 1.00 8.50  ? 413 ARG B CB  1 
ATOM 6365 C CG  . ARG B 1 413 ? -23.456 -45.373 50.204 1.00 9.09  ? 413 ARG B CG  1 
ATOM 6366 C CD  . ARG B 1 413 ? -23.431 -45.789 48.737 1.00 11.20 ? 413 ARG B CD  1 
ATOM 6367 N NE  . ARG B 1 413 ? -24.573 -46.657 48.397 1.00 9.93  ? 413 ARG B NE  1 
ATOM 6368 C CZ  . ARG B 1 413 ? -24.917 -47.059 47.173 1.00 12.35 ? 413 ARG B CZ  1 
ATOM 6369 N NH1 . ARG B 1 413 ? -24.156 -46.738 46.091 1.00 12.24 ? 413 ARG B NH1 1 
ATOM 6370 N NH2 . ARG B 1 413 ? -25.983 -47.799 47.102 1.00 12.99 ? 413 ARG B NH2 1 
ATOM 6371 N N   . ALA B 1 414 ? -25.005 -42.093 52.443 1.00 6.90  ? 414 ALA B N   1 
ATOM 6372 C CA  . ALA B 1 414 ? -25.688 -40.814 52.487 1.00 6.76  ? 414 ALA B CA  1 
ATOM 6373 C C   . ALA B 1 414 ? -25.285 -39.994 51.303 1.00 8.74  ? 414 ALA B C   1 
ATOM 6374 O O   . ALA B 1 414 ? -24.490 -40.396 50.478 1.00 8.80  ? 414 ALA B O   1 
ATOM 6375 C CB  . ALA B 1 414 ? -25.249 -40.156 53.801 1.00 8.24  ? 414 ALA B CB  1 
ATOM 6376 N N   . TRP B 1 415 ? -25.882 -38.790 51.233 1.00 7.12  ? 415 TRP B N   1 
ATOM 6377 C CA  . TRP B 1 415 ? -25.577 -37.934 50.072 1.00 5.41  ? 415 TRP B CA  1 
ATOM 6378 C C   . TRP B 1 415 ? -25.801 -36.487 50.595 1.00 6.61  ? 415 TRP B C   1 
ATOM 6379 O O   . TRP B 1 415 ? -26.857 -36.203 51.145 1.00 6.18  ? 415 TRP B O   1 
ATOM 6380 C CB  . TRP B 1 415 ? -26.568 -38.298 48.911 1.00 7.52  ? 415 TRP B CB  1 
ATOM 6381 C CG  . TRP B 1 415 ? -26.146 -37.580 47.629 1.00 6.35  ? 415 TRP B CG  1 
ATOM 6382 C CD1 . TRP B 1 415 ? -26.585 -36.363 47.158 1.00 7.23  ? 415 TRP B CD1 1 
ATOM 6383 C CD2 . TRP B 1 415 ? -25.134 -38.037 46.734 1.00 9.36  ? 415 TRP B CD2 1 
ATOM 6384 N NE1 . TRP B 1 415 ? -25.911 -36.027 45.955 1.00 7.89  ? 415 TRP B NE1 1 
ATOM 6385 C CE2 . TRP B 1 415 ? -25.025 -37.047 45.700 1.00 7.93  ? 415 TRP B CE2 1 
ATOM 6386 C CE3 . TRP B 1 415 ? -24.311 -39.220 46.650 1.00 8.10  ? 415 TRP B CE3 1 
ATOM 6387 C CZ2 . TRP B 1 415 ? -24.130 -37.180 44.581 1.00 11.20 ? 415 TRP B CZ2 1 
ATOM 6388 C CZ3 . TRP B 1 415 ? -23.426 -39.309 45.574 1.00 10.72 ? 415 TRP B CZ3 1 
ATOM 6389 C CH2 . TRP B 1 415 ? -23.384 -38.346 44.536 1.00 10.36 ? 415 TRP B CH2 1 
ATOM 6390 N N   . GLN B 1 416 ? -24.882 -35.599 50.277 1.00 7.16  ? 416 GLN B N   1 
ATOM 6391 C CA  . GLN B 1 416 ? -25.038 -34.238 50.778 1.00 6.03  ? 416 GLN B CA  1 
ATOM 6392 C C   . GLN B 1 416 ? -26.060 -33.419 49.963 1.00 7.15  ? 416 GLN B C   1 
ATOM 6393 O O   . GLN B 1 416 ? -26.093 -33.563 48.700 1.00 9.21  ? 416 GLN B O   1 
ATOM 6394 C CB  . GLN B 1 416 ? -23.659 -33.527 50.736 1.00 8.98  ? 416 GLN B CB  1 
ATOM 6395 C CG  . GLN B 1 416 ? -23.684 -32.172 51.433 1.00 8.87  ? 416 GLN B CG  1 
ATOM 6396 C CD  . GLN B 1 416 ? -22.357 -31.453 51.345 1.00 9.66  ? 416 GLN B CD  1 
ATOM 6397 O OE1 . GLN B 1 416 ? -21.466 -31.841 50.576 1.00 13.05 ? 416 GLN B OE1 1 
ATOM 6398 N NE2 . GLN B 1 416 ? -22.239 -30.361 52.142 1.00 10.54 ? 416 GLN B NE2 1 
ATOM 6399 N N   . LEU B 1 417 ? -26.783 -32.540 50.674 1.00 7.42  ? 417 LEU B N   1 
ATOM 6400 C CA  . LEU B 1 417 ? -27.602 -31.506 50.055 1.00 8.05  ? 417 LEU B CA  1 
ATOM 6401 C C   . LEU B 1 417 ? -27.100 -30.176 50.597 1.00 8.28  ? 417 LEU B C   1 
ATOM 6402 O O   . LEU B 1 417 ? -26.578 -30.117 51.690 1.00 8.38  ? 417 LEU B O   1 
ATOM 6403 C CB  . LEU B 1 417 ? -29.073 -31.726 50.394 1.00 8.61  ? 417 LEU B CB  1 
ATOM 6404 C CG  . LEU B 1 417 ? -29.656 -32.994 49.860 1.00 8.09  ? 417 LEU B CG  1 
ATOM 6405 C CD1 . LEU B 1 417 ? -31.092 -33.248 50.471 1.00 9.89  ? 417 LEU B CD1 1 
ATOM 6406 C CD2 . LEU B 1 417 ? -29.745 -32.951 48.293 1.00 12.91 ? 417 LEU B CD2 1 
ATOM 6407 N N   . PRO B 1 418 ? -27.192 -29.120 49.803 1.00 7.04  ? 418 PRO B N   1 
ATOM 6408 C CA  . PRO B 1 418 ? -26.560 -27.824 50.167 1.00 9.03  ? 418 PRO B CA  1 
ATOM 6409 C C   . PRO B 1 418 ? -27.450 -27.027 51.107 1.00 10.62 ? 418 PRO B C   1 
ATOM 6410 O O   . PRO B 1 418 ? -28.675 -26.966 50.955 1.00 13.93 ? 418 PRO B O   1 
ATOM 6411 C CB  . PRO B 1 418 ? -26.355 -27.126 48.790 1.00 8.87  ? 418 PRO B CB  1 
ATOM 6412 C CG  . PRO B 1 418 ? -27.605 -27.588 47.981 1.00 9.26  ? 418 PRO B CG  1 
ATOM 6413 C CD  . PRO B 1 418 ? -27.790 -29.124 48.426 1.00 7.87  ? 418 PRO B CD  1 
ATOM 6414 N N   . LEU B 1 419 ? -26.849 -26.328 52.010 1.00 9.60  ? 419 LEU B N   1 
ATOM 6415 C CA  . LEU B 1 419 ? -27.553 -25.347 52.838 1.00 9.55  ? 419 LEU B CA  1 
ATOM 6416 C C   . LEU B 1 419 ? -27.151 -23.913 52.417 1.00 11.49 ? 419 LEU B C   1 
ATOM 6417 O O   . LEU B 1 419 ? -26.763 -23.044 53.242 1.00 12.98 ? 419 LEU B O   1 
ATOM 6418 C CB  . LEU B 1 419 ? -27.223 -25.485 54.369 1.00 9.00  ? 419 LEU B CB  1 
ATOM 6419 C CG  . LEU B 1 419 ? -27.584 -26.910 54.928 1.00 9.56  ? 419 LEU B CG  1 
ATOM 6420 C CD1 . LEU B 1 419 ? -27.308 -26.831 56.459 1.00 11.71 ? 419 LEU B CD1 1 
ATOM 6421 C CD2 . LEU B 1 419 ? -29.086 -27.175 54.596 1.00 12.15 ? 419 LEU B CD2 1 
ATOM 6422 N N   . PHE B 1 420 ? -27.331 -23.682 51.116 1.00 10.44 ? 420 PHE B N   1 
ATOM 6423 C CA  . PHE B 1 420 ? -27.020 -22.356 50.603 1.00 11.98 ? 420 PHE B CA  1 
ATOM 6424 C C   . PHE B 1 420 ? -27.826 -21.272 51.344 1.00 10.23 ? 420 PHE B C   1 
ATOM 6425 O O   . PHE B 1 420 ? -28.972 -21.436 51.682 1.00 9.05  ? 420 PHE B O   1 
ATOM 6426 C CB  . PHE B 1 420 ? -27.242 -22.247 49.096 1.00 10.09 ? 420 PHE B CB  1 
ATOM 6427 C CG  . PHE B 1 420 ? -26.396 -23.141 48.262 1.00 10.51 ? 420 PHE B CG  1 
ATOM 6428 C CD1 . PHE B 1 420 ? -25.078 -23.499 48.645 1.00 10.18 ? 420 PHE B CD1 1 
ATOM 6429 C CD2 . PHE B 1 420 ? -26.899 -23.512 47.006 1.00 10.00 ? 420 PHE B CD2 1 
ATOM 6430 C CE1 . PHE B 1 420 ? -24.328 -24.316 47.790 1.00 8.41  ? 420 PHE B CE1 1 
ATOM 6431 C CE2 . PHE B 1 420 ? -26.116 -24.335 46.153 1.00 11.36 ? 420 PHE B CE2 1 
ATOM 6432 C CZ  . PHE B 1 420 ? -24.854 -24.715 46.539 1.00 9.62  ? 420 PHE B CZ  1 
ATOM 6433 N N   . ASP B 1 421 ? -27.219 -20.067 51.469 1.00 11.22 ? 421 ASP B N   1 
ATOM 6434 C CA  . ASP B 1 421 ? -27.894 -19.006 52.238 1.00 13.48 ? 421 ASP B CA  1 
ATOM 6435 C C   . ASP B 1 421 ? -29.210 -18.554 51.595 1.00 10.64 ? 421 ASP B C   1 
ATOM 6436 O O   . ASP B 1 421 ? -30.136 -18.080 52.302 1.00 10.84 ? 421 ASP B O   1 
ATOM 6437 C CB  . ASP B 1 421 ? -26.939 -17.805 52.306 1.00 13.44 ? 421 ASP B CB  1 
ATOM 6438 C CG  . ASP B 1 421 ? -27.420 -16.741 53.355 1.00 20.96 ? 421 ASP B CG  1 
ATOM 6439 O OD1 . ASP B 1 421 ? -27.570 -17.090 54.580 1.00 27.58 ? 421 ASP B OD1 1 
ATOM 6440 O OD2 . ASP B 1 421 ? -27.781 -15.603 52.951 1.00 23.35 ? 421 ASP B OD2 1 
ATOM 6441 N N   . GLU B 1 422 ? -29.334 -18.700 50.274 1.00 11.76 ? 422 GLU B N   1 
ATOM 6442 C CA  . GLU B 1 422 ? -30.536 -18.320 49.584 1.00 12.53 ? 422 GLU B CA  1 
ATOM 6443 C C   . GLU B 1 422 ? -31.778 -19.058 50.069 1.00 11.95 ? 422 GLU B C   1 
ATOM 6444 O O   . GLU B 1 422 ? -32.845 -18.511 50.029 1.00 13.15 ? 422 GLU B O   1 
ATOM 6445 C CB  . GLU B 1 422 ? -30.380 -18.650 48.083 1.00 15.02 ? 422 GLU B CB  1 
ATOM 6446 C CG  . GLU B 1 422 ? -29.419 -17.669 47.280 1.00 12.36 ? 422 GLU B CG  1 
ATOM 6447 C CD  . GLU B 1 422 ? -27.961 -17.888 47.526 1.00 18.00 ? 422 GLU B CD  1 
ATOM 6448 O OE1 . GLU B 1 422 ? -27.563 -18.889 48.157 1.00 13.15 ? 422 GLU B OE1 1 
ATOM 6449 O OE2 . GLU B 1 422 ? -27.105 -17.132 46.999 1.00 19.28 ? 422 GLU B OE2 1 
ATOM 6450 N N   . TYR B 1 423 ? -31.616 -20.288 50.626 1.00 9.79  ? 423 TYR B N   1 
ATOM 6451 C CA  . TYR B 1 423 ? -32.782 -20.974 51.179 1.00 9.92  ? 423 TYR B CA  1 
ATOM 6452 C C   . TYR B 1 423 ? -33.251 -20.405 52.537 1.00 10.77 ? 423 TYR B C   1 
ATOM 6453 O O   . TYR B 1 423 ? -34.405 -20.694 52.894 1.00 11.62 ? 423 TYR B O   1 
ATOM 6454 C CB  . TYR B 1 423 ? -32.416 -22.500 51.368 1.00 9.63  ? 423 TYR B CB  1 
ATOM 6455 C CG  . TYR B 1 423 ? -32.096 -23.174 50.042 1.00 9.58  ? 423 TYR B CG  1 
ATOM 6456 C CD1 . TYR B 1 423 ? -30.752 -23.488 49.682 1.00 7.57  ? 423 TYR B CD1 1 
ATOM 6457 C CD2 . TYR B 1 423 ? -33.108 -23.478 49.135 1.00 10.25 ? 423 TYR B CD2 1 
ATOM 6458 C CE1 . TYR B 1 423 ? -30.443 -24.146 48.484 1.00 8.98  ? 423 TYR B CE1 1 
ATOM 6459 C CE2 . TYR B 1 423 ? -32.781 -24.122 47.908 1.00 12.74 ? 423 TYR B CE2 1 
ATOM 6460 C CZ  . TYR B 1 423 ? -31.470 -24.450 47.606 1.00 10.49 ? 423 TYR B CZ  1 
ATOM 6461 O OH  . TYR B 1 423 ? -31.183 -25.085 46.391 1.00 12.79 ? 423 TYR B OH  1 
ATOM 6462 N N   . GLN B 1 424 ? -32.373 -19.686 53.257 1.00 10.56 ? 424 GLN B N   1 
ATOM 6463 C CA  . GLN B 1 424 ? -32.729 -19.280 54.662 1.00 8.67  ? 424 GLN B CA  1 
ATOM 6464 C C   . GLN B 1 424 ? -33.906 -18.372 54.657 1.00 10.87 ? 424 GLN B C   1 
ATOM 6465 O O   . GLN B 1 424 ? -34.707 -18.455 55.596 1.00 11.17 ? 424 GLN B O   1 
ATOM 6466 C CB  . GLN B 1 424 ? -31.518 -18.573 55.276 1.00 10.26 ? 424 GLN B CB  1 
ATOM 6467 C CG  . GLN B 1 424 ? -30.365 -19.594 55.424 1.00 10.25 ? 424 GLN B CG  1 
ATOM 6468 C CD  . GLN B 1 424 ? -30.778 -20.789 56.350 1.00 10.99 ? 424 GLN B CD  1 
ATOM 6469 O OE1 . GLN B 1 424 ? -31.438 -20.565 57.351 1.00 12.37 ? 424 GLN B OE1 1 
ATOM 6470 N NE2 . GLN B 1 424 ? -30.399 -21.997 55.982 1.00 12.45 ? 424 GLN B NE2 1 
ATOM 6471 N N   . GLU B 1 425 ? -34.126 -17.496 53.639 1.00 11.14 ? 425 GLU B N   1 
ATOM 6472 C CA  . GLU B 1 425 ? -35.270 -16.539 53.714 1.00 11.70 ? 425 GLU B CA  1 
ATOM 6473 C C   . GLU B 1 425 ? -36.607 -17.196 53.720 1.00 10.94 ? 425 GLU B C   1 
ATOM 6474 O O   . GLU B 1 425 ? -37.621 -16.581 54.071 1.00 10.86 ? 425 GLU B O   1 
ATOM 6475 C CB  . GLU B 1 425 ? -35.154 -15.497 52.597 1.00 15.41 ? 425 GLU B CB  1 
ATOM 6476 C CG  . GLU B 1 425 ? -35.227 -16.007 51.233 1.00 19.29 ? 425 GLU B CG  1 
ATOM 6477 C CD  . GLU B 1 425 ? -34.972 -14.878 50.178 1.00 34.68 ? 425 GLU B CD  1 
ATOM 6478 O OE1 . GLU B 1 425 ? -35.073 -13.647 50.496 1.00 37.52 ? 425 GLU B OE1 1 
ATOM 6479 O OE2 . GLU B 1 425 ? -34.717 -15.251 48.995 1.00 39.78 ? 425 GLU B OE2 1 
ATOM 6480 N N   . GLN B 1 426 ? -36.617 -18.460 53.247 1.00 10.55 ? 426 GLN B N   1 
ATOM 6481 C CA  . GLN B 1 426 ? -37.883 -19.178 53.207 1.00 10.08 ? 426 GLN B CA  1 
ATOM 6482 C C   . GLN B 1 426 ? -38.409 -19.385 54.604 1.00 10.70 ? 426 GLN B C   1 
ATOM 6483 O O   . GLN B 1 426 ? -39.645 -19.621 54.759 1.00 12.01 ? 426 GLN B O   1 
ATOM 6484 C CB  . GLN B 1 426 ? -37.714 -20.536 52.552 1.00 10.02 ? 426 GLN B CB  1 
ATOM 6485 C CG  . GLN B 1 426 ? -37.367 -20.356 51.031 1.00 13.12 ? 426 GLN B CG  1 
ATOM 6486 C CD  . GLN B 1 426 ? -37.110 -21.702 50.324 1.00 12.62 ? 426 GLN B CD  1 
ATOM 6487 O OE1 . GLN B 1 426 ? -36.709 -22.738 51.023 1.00 16.89 ? 426 GLN B OE1 1 
ATOM 6488 N NE2 . GLN B 1 426 ? -37.475 -21.760 49.036 1.00 10.93 ? 426 GLN B NE2 1 
ATOM 6489 N N   . LEU B 1 427 ? -37.547 -19.275 55.604 1.00 9.29  ? 427 LEU B N   1 
ATOM 6490 C CA  . LEU B 1 427 ? -37.994 -19.389 57.013 1.00 9.93  ? 427 LEU B CA  1 
ATOM 6491 C C   . LEU B 1 427 ? -38.404 -18.064 57.636 1.00 11.85 ? 427 LEU B C   1 
ATOM 6492 O O   . LEU B 1 427 ? -38.810 -18.025 58.802 1.00 15.21 ? 427 LEU B O   1 
ATOM 6493 C CB  . LEU B 1 427 ? -36.871 -20.020 57.863 1.00 10.18 ? 427 LEU B CB  1 
ATOM 6494 C CG  . LEU B 1 427 ? -36.458 -21.441 57.427 1.00 9.73  ? 427 LEU B CG  1 
ATOM 6495 C CD1 . LEU B 1 427 ? -35.235 -21.874 58.213 1.00 14.20 ? 427 LEU B CD1 1 
ATOM 6496 C CD2 . LEU B 1 427 ? -37.572 -22.497 57.628 1.00 10.85 ? 427 LEU B CD2 1 
ATOM 6497 N N   . ASP B 1 428 ? -38.303 -16.913 56.987 1.00 11.18 ? 428 ASP B N   1 
ATOM 6498 C CA  . ASP B 1 428 ? -38.624 -15.655 57.595 1.00 12.92 ? 428 ASP B CA  1 
ATOM 6499 C C   . ASP B 1 428 ? -40.082 -15.580 58.076 1.00 12.43 ? 428 ASP B C   1 
ATOM 6500 O O   . ASP B 1 428 ? -41.057 -16.109 57.435 1.00 13.71 ? 428 ASP B O   1 
ATOM 6501 C CB  . ASP B 1 428 ? -38.389 -14.559 56.549 1.00 12.33 ? 428 ASP B CB  1 
ATOM 6502 C CG  . ASP B 1 428 ? -36.873 -14.331 56.304 1.00 16.47 ? 428 ASP B CG  1 
ATOM 6503 O OD1 . ASP B 1 428 ? -35.985 -14.876 57.060 1.00 16.70 ? 428 ASP B OD1 1 
ATOM 6504 O OD2 . ASP B 1 428 ? -36.602 -13.524 55.307 1.00 17.59 ? 428 ASP B OD2 1 
ATOM 6505 N N   . SER B 1 429 ? -40.234 -14.900 59.220 1.00 10.72 ? 429 SER B N   1 
ATOM 6506 C CA  . SER B 1 429 ? -41.531 -14.660 59.807 1.00 12.10 ? 429 SER B CA  1 
ATOM 6507 C C   . SER B 1 429 ? -41.624 -13.200 60.006 1.00 10.34 ? 429 SER B C   1 
ATOM 6508 O O   . SER B 1 429 ? -40.697 -12.561 60.442 1.00 13.46 ? 429 SER B O   1 
ATOM 6509 C CB  . SER B 1 429 ? -41.600 -15.382 61.154 1.00 10.93 ? 429 SER B CB  1 
ATOM 6510 O OG  . SER B 1 429 ? -42.711 -14.881 61.967 1.00 9.84  ? 429 SER B OG  1 
ATOM 6511 N N   . PRO B 1 430 ? -42.812 -12.633 59.789 1.00 10.60 ? 430 PRO B N   1 
ATOM 6512 C CA  . PRO B 1 430 ? -42.989 -11.201 60.120 1.00 10.94 ? 430 PRO B CA  1 
ATOM 6513 C C   . PRO B 1 430 ? -43.028 -10.939 61.586 1.00 10.05 ? 430 PRO B C   1 
ATOM 6514 O O   . PRO B 1 430 ? -42.946 -9.722  62.043 1.00 13.45 ? 430 PRO B O   1 
ATOM 6515 C CB  . PRO B 1 430 ? -44.368 -10.812 59.533 1.00 13.81 ? 430 PRO B CB  1 
ATOM 6516 C CG  . PRO B 1 430 ? -44.984 -12.011 59.140 1.00 15.47 ? 430 PRO B CG  1 
ATOM 6517 C CD  . PRO B 1 430 ? -44.000 -13.203 59.101 1.00 11.68 ? 430 PRO B CD  1 
ATOM 6518 N N   . PHE B 1 431 ? -43.197 -11.984 62.419 1.00 10.35 ? 431 PHE B N   1 
ATOM 6519 C CA  . PHE B 1 431 ? -43.454 -11.778 63.869 1.00 10.94 ? 431 PHE B CA  1 
ATOM 6520 C C   . PHE B 1 431 ? -42.228 -12.238 64.694 1.00 12.92 ? 431 PHE B C   1 
ATOM 6521 O O   . PHE B 1 431 ? -41.758 -11.529 65.530 1.00 13.51 ? 431 PHE B O   1 
ATOM 6522 C CB  . PHE B 1 431 ? -44.740 -12.511 64.296 1.00 12.25 ? 431 PHE B CB  1 
ATOM 6523 C CG  . PHE B 1 431 ? -45.916 -12.139 63.425 1.00 13.32 ? 431 PHE B CG  1 
ATOM 6524 C CD1 . PHE B 1 431 ? -46.331 -10.817 63.437 1.00 15.11 ? 431 PHE B CD1 1 
ATOM 6525 C CD2 . PHE B 1 431 ? -46.467 -13.077 62.604 1.00 13.47 ? 431 PHE B CD2 1 
ATOM 6526 C CE1 . PHE B 1 431 ? -47.476 -10.402 62.595 1.00 18.25 ? 431 PHE B CE1 1 
ATOM 6527 C CE2 . PHE B 1 431 ? -47.573 -12.720 61.784 1.00 15.37 ? 431 PHE B CE2 1 
ATOM 6528 C CZ  . PHE B 1 431 ? -47.988 -11.368 61.797 1.00 15.11 ? 431 PHE B CZ  1 
ATOM 6529 N N   . ALA B 1 432 ? -41.723 -13.403 64.347 1.00 11.27 ? 432 ALA B N   1 
ATOM 6530 C CA  . ALA B 1 432 ? -40.718 -14.029 65.239 1.00 10.21 ? 432 ALA B CA  1 
ATOM 6531 C C   . ALA B 1 432 ? -39.386 -13.994 64.506 1.00 7.77  ? 432 ALA B C   1 
ATOM 6532 O O   . ALA B 1 432 ? -39.265 -13.608 63.330 1.00 9.98  ? 432 ALA B O   1 
ATOM 6533 C CB  . ALA B 1 432 ? -41.091 -15.513 65.503 1.00 9.22  ? 432 ALA B CB  1 
ATOM 6534 N N   . ASP B 1 433 ? -38.339 -14.505 65.176 1.00 7.62  ? 433 ASP B N   1 
ATOM 6535 C CA  . ASP B 1 433 ? -37.004 -14.566 64.498 1.00 8.01  ? 433 ASP B CA  1 
ATOM 6536 C C   . ASP B 1 433 ? -36.986 -15.516 63.329 1.00 10.50 ? 433 ASP B C   1 
ATOM 6537 O O   . ASP B 1 433 ? -36.174 -15.386 62.385 1.00 12.98 ? 433 ASP B O   1 
ATOM 6538 C CB  . ASP B 1 433 ? -35.938 -15.046 65.527 1.00 8.76  ? 433 ASP B CB  1 
ATOM 6539 C CG  . ASP B 1 433 ? -35.745 -14.012 66.616 1.00 7.98  ? 433 ASP B CG  1 
ATOM 6540 O OD1 . ASP B 1 433 ? -35.924 -12.764 66.415 1.00 10.51 ? 433 ASP B OD1 1 
ATOM 6541 O OD2 . ASP B 1 433 ? -35.277 -14.445 67.722 1.00 10.96 ? 433 ASP B OD2 1 
ATOM 6542 N N   . MET B 1 434 ? -37.840 -16.541 63.360 1.00 7.82  ? 434 MET B N   1 
ATOM 6543 C CA  . MET B 1 434 ? -37.979 -17.449 62.212 1.00 7.77  ? 434 MET B CA  1 
ATOM 6544 C C   . MET B 1 434 ? -39.299 -18.139 62.355 1.00 7.61  ? 434 MET B C   1 
ATOM 6545 O O   . MET B 1 434 ? -39.847 -18.224 63.448 1.00 6.76  ? 434 MET B O   1 
ATOM 6546 C CB  . MET B 1 434 ? -36.928 -18.558 62.171 1.00 8.27  ? 434 MET B CB  1 
ATOM 6547 C CG  . MET B 1 434 ? -36.932 -19.525 63.412 1.00 7.61  ? 434 MET B CG  1 
ATOM 6548 S SD  . MET B 1 434 ? -35.374 -20.397 63.648 1.00 9.94  ? 434 MET B SD  1 
ATOM 6549 C CE  . MET B 1 434 ? -34.526 -19.093 64.584 1.00 9.81  ? 434 MET B CE  1 
ATOM 6550 N N   . GLY B 1 435 ? -39.795 -18.694 61.258 1.00 6.36  ? 435 GLY B N   1 
ATOM 6551 C CA  . GLY B 1 435 ? -40.875 -19.677 61.304 1.00 6.55  ? 435 GLY B CA  1 
ATOM 6552 C C   . GLY B 1 435 ? -40.309 -21.066 61.219 1.00 7.65  ? 435 GLY B C   1 
ATOM 6553 O O   . GLY B 1 435 ? -39.121 -21.261 60.934 1.00 8.47  ? 435 GLY B O   1 
ATOM 6554 N N   . ASN B 1 436 ? -41.137 -22.087 61.421 1.00 7.16  ? 436 ASN B N   1 
ATOM 6555 C CA  . ASN B 1 436 ? -40.600 -23.457 61.441 1.00 7.35  ? 436 ASN B CA  1 
ATOM 6556 C C   . ASN B 1 436 ? -40.779 -24.174 60.110 1.00 8.00  ? 436 ASN B C   1 
ATOM 6557 O O   . ASN B 1 436 ? -40.498 -25.380 60.042 1.00 10.51 ? 436 ASN B O   1 
ATOM 6558 C CB  . ASN B 1 436 ? -41.156 -24.290 62.647 1.00 7.16  ? 436 ASN B CB  1 
ATOM 6559 C CG  . ASN B 1 436 ? -42.593 -24.727 62.463 1.00 7.36  ? 436 ASN B CG  1 
ATOM 6560 O OD1 . ASN B 1 436 ? -43.436 -24.005 61.862 1.00 6.40  ? 436 ASN B OD1 1 
ATOM 6561 N ND2 . ASN B 1 436 ? -42.922 -25.882 63.052 1.00 7.12  ? 436 ASN B ND2 1 
ATOM 6562 N N   . ILE B 1 437 ? -41.386 -23.513 59.088 1.00 7.21  ? 437 ILE B N   1 
ATOM 6563 C CA  . ILE B 1 437 ? -41.508 -24.106 57.762 1.00 8.05  ? 437 ILE B CA  1 
ATOM 6564 C C   . ILE B 1 437 ? -41.046 -23.164 56.736 1.00 10.79 ? 437 ILE B C   1 
ATOM 6565 O O   . ILE B 1 437 ? -41.165 -21.952 56.917 1.00 11.64 ? 437 ILE B O   1 
ATOM 6566 C CB  . ILE B 1 437 ? -42.985 -24.530 57.439 1.00 8.83  ? 437 ILE B CB  1 
ATOM 6567 C CG1 . ILE B 1 437 ? -43.954 -23.318 57.546 1.00 11.56 ? 437 ILE B CG1 1 
ATOM 6568 C CG2 . ILE B 1 437 ? -43.443 -25.592 58.501 1.00 12.02 ? 437 ILE B CG2 1 
ATOM 6569 C CD1 . ILE B 1 437 ? -45.469 -23.584 57.174 1.00 12.95 ? 437 ILE B CD1 1 
ATOM 6570 N N   . GLY B 1 438 ? -40.673 -23.812 55.625 1.00 11.58 ? 438 GLY B N   1 
ATOM 6571 C CA  . GLY B 1 438 ? -40.170 -23.026 54.404 1.00 13.78 ? 438 GLY B CA  1 
ATOM 6572 C C   . GLY B 1 438 ? -41.006 -23.130 53.123 1.00 14.73 ? 438 GLY B C   1 
ATOM 6573 O O   . GLY B 1 438 ? -40.575 -22.646 52.065 1.00 15.51 ? 438 GLY B O   1 
ATOM 6574 N N   . GLY B 1 439 ? -42.198 -23.732 53.206 1.00 15.52 ? 439 GLY B N   1 
ATOM 6575 C CA  . GLY B 1 439 ? -43.012 -23.899 51.992 1.00 15.76 ? 439 GLY B CA  1 
ATOM 6576 C C   . GLY B 1 439 ? -42.600 -25.138 51.244 1.00 14.54 ? 439 GLY B C   1 
ATOM 6577 O O   . GLY B 1 439 ? -41.804 -25.973 51.697 1.00 15.56 ? 439 GLY B O   1 
ATOM 6578 N N   . PRO B 1 440 ? -43.246 -25.356 50.067 1.00 15.49 ? 440 PRO B N   1 
ATOM 6579 C CA  . PRO B 1 440 ? -43.144 -26.552 49.290 1.00 15.23 ? 440 PRO B CA  1 
ATOM 6580 C C   . PRO B 1 440 ? -41.841 -26.785 48.485 1.00 13.46 ? 440 PRO B C   1 
ATOM 6581 O O   . PRO B 1 440 ? -41.600 -27.939 48.027 1.00 17.56 ? 440 PRO B O   1 
ATOM 6582 C CB  . PRO B 1 440 ? -44.365 -26.430 48.371 1.00 15.87 ? 440 PRO B CB  1 
ATOM 6583 C CG  . PRO B 1 440 ? -44.549 -25.021 48.183 1.00 17.60 ? 440 PRO B CG  1 
ATOM 6584 C CD  . PRO B 1 440 ? -44.083 -24.307 49.440 1.00 18.80 ? 440 PRO B CD  1 
ATOM 6585 N N   . LYS B 1 441 ? -41.003 -25.761 48.426 1.00 12.54 ? 441 LYS B N   1 
ATOM 6586 C CA  . LYS B 1 441 ? -39.743 -25.875 47.694 1.00 12.69 ? 441 LYS B CA  1 
ATOM 6587 C C   . LYS B 1 441 ? -38.599 -26.188 48.654 1.00 12.83 ? 441 LYS B C   1 
ATOM 6588 O O   . LYS B 1 441 ? -38.457 -25.531 49.706 1.00 13.93 ? 441 LYS B O   1 
ATOM 6589 C CB  . LYS B 1 441 ? -39.429 -24.559 46.953 1.00 12.74 ? 441 LYS B CB  1 
ATOM 6590 C CG  . LYS B 1 441 ? -40.659 -24.171 45.987 1.00 14.61 ? 441 LYS B CG  1 
ATOM 6591 C CD  . LYS B 1 441 ? -40.229 -23.004 45.179 1.00 21.31 ? 441 LYS B CD  1 
ATOM 6592 C CE  . LYS B 1 441 ? -41.292 -22.687 44.083 1.00 20.19 ? 441 LYS B CE  1 
ATOM 6593 N NZ  . LYS B 1 441 ? -40.671 -21.600 43.221 1.00 28.86 ? 441 LYS B NZ  1 
ATOM 6594 N N   . ALA B 1 442 ? -37.825 -27.190 48.288 1.00 12.04 ? 442 ALA B N   1 
ATOM 6595 C CA  . ALA B 1 442 ? -36.573 -27.476 49.053 1.00 9.93  ? 442 ALA B CA  1 
ATOM 6596 C C   . ALA B 1 442 ? -36.871 -27.832 50.524 1.00 10.74 ? 442 ALA B C   1 
ATOM 6597 O O   . ALA B 1 442 ? -36.150 -27.365 51.353 1.00 9.21  ? 442 ALA B O   1 
ATOM 6598 C CB  . ALA B 1 442 ? -35.579 -26.345 48.895 1.00 13.31 ? 442 ALA B CB  1 
ATOM 6599 N N   . GLY B 1 443 ? -37.830 -28.709 50.786 1.00 9.21  ? 443 GLY B N   1 
ATOM 6600 C CA  . GLY B 1 443 ? -38.222 -28.919 52.168 1.00 8.65  ? 443 GLY B CA  1 
ATOM 6601 C C   . GLY B 1 443 ? -37.174 -29.629 53.015 1.00 7.62  ? 443 GLY B C   1 
ATOM 6602 O O   . GLY B 1 443 ? -37.060 -29.306 54.220 1.00 8.31  ? 443 GLY B O   1 
ATOM 6603 N N   . THR B 1 444 ? -36.399 -30.563 52.470 1.00 8.82  ? 444 THR B N   1 
ATOM 6604 C CA  . THR B 1 444 ? -35.355 -31.187 53.277 1.00 7.64  ? 444 THR B CA  1 
ATOM 6605 C C   . THR B 1 444 ? -34.264 -30.138 53.641 1.00 8.39  ? 444 THR B C   1 
ATOM 6606 O O   . THR B 1 444 ? -33.796 -30.091 54.788 1.00 7.17  ? 444 THR B O   1 
ATOM 6607 C CB  . THR B 1 444 ? -34.703 -32.306 52.474 1.00 10.10 ? 444 THR B CB  1 
ATOM 6608 O OG1 . THR B 1 444 ? -35.777 -33.229 52.116 1.00 11.27 ? 444 THR B OG1 1 
ATOM 6609 C CG2 . THR B 1 444 ? -33.604 -32.969 53.216 1.00 8.09  ? 444 THR B CG2 1 
ATOM 6610 N N   . ILE B 1 445 ? -33.928 -29.293 52.674 1.00 7.88  ? 445 ILE B N   1 
ATOM 6611 C CA  . ILE B 1 445 ? -32.891 -28.243 52.859 1.00 6.89  ? 445 ILE B CA  1 
ATOM 6612 C C   . ILE B 1 445 ? -33.406 -27.199 53.821 1.00 8.54  ? 445 ILE B C   1 
ATOM 6613 O O   . ILE B 1 445 ? -32.671 -26.797 54.661 1.00 8.19  ? 445 ILE B O   1 
ATOM 6614 C CB  . ILE B 1 445 ? -32.508 -27.593 51.502 1.00 7.03  ? 445 ILE B CB  1 
ATOM 6615 C CG1 . ILE B 1 445 ? -31.692 -28.651 50.761 1.00 10.80 ? 445 ILE B CG1 1 
ATOM 6616 C CG2 . ILE B 1 445 ? -31.823 -26.272 51.744 1.00 8.35  ? 445 ILE B CG2 1 
ATOM 6617 C CD1 . ILE B 1 445 ? -31.552 -28.160 49.319 1.00 10.44 ? 445 ILE B CD1 1 
ATOM 6618 N N   . THR B 1 446 ? -34.690 -26.792 53.771 1.00 9.32  ? 446 THR B N   1 
ATOM 6619 C CA  . THR B 1 446 ? -35.087 -25.687 54.637 1.00 8.23  ? 446 THR B CA  1 
ATOM 6620 C C   . THR B 1 446 ? -35.183 -26.200 56.089 1.00 6.86  ? 446 THR B C   1 
ATOM 6621 O O   . THR B 1 446 ? -34.928 -25.441 57.040 1.00 8.19  ? 446 THR B O   1 
ATOM 6622 C CB  . THR B 1 446 ? -36.351 -25.008 54.317 1.00 8.31  ? 446 THR B CB  1 
ATOM 6623 O OG1 . THR B 1 446 ? -37.346 -25.945 54.189 1.00 9.67  ? 446 THR B OG1 1 
ATOM 6624 C CG2 . THR B 1 446 ? -36.171 -24.332 52.954 1.00 11.38 ? 446 THR B CG2 1 
ATOM 6625 N N   . ALA B 1 447 ? -35.481 -27.489 56.270 1.00 6.95  ? 447 ALA B N   1 
ATOM 6626 C CA  . ALA B 1 447 ? -35.415 -28.054 57.645 1.00 6.22  ? 447 ALA B CA  1 
ATOM 6627 C C   . ALA B 1 447 ? -33.959 -28.038 58.112 1.00 6.60  ? 447 ALA B C   1 
ATOM 6628 O O   . ALA B 1 447 ? -33.713 -27.707 59.313 1.00 7.74  ? 447 ALA B O   1 
ATOM 6629 C CB  . ALA B 1 447 ? -36.008 -29.466 57.685 1.00 7.57  ? 447 ALA B CB  1 
ATOM 6630 N N   . GLY B 1 448 ? -33.020 -28.433 57.256 1.00 7.77  ? 448 GLY B N   1 
ATOM 6631 C CA  . GLY B 1 448 ? -31.603 -28.312 57.650 1.00 6.50  ? 448 GLY B CA  1 
ATOM 6632 C C   . GLY B 1 448 ? -31.233 -26.910 57.983 1.00 6.67  ? 448 GLY B C   1 
ATOM 6633 O O   . GLY B 1 448 ? -30.467 -26.646 58.930 1.00 7.42  ? 448 GLY B O   1 
ATOM 6634 N N   . CYS B 1 449 ? -31.699 -25.935 57.190 1.00 6.44  ? 449 CYS B N   1 
ATOM 6635 C CA  . CYS B 1 449 ? -31.381 -24.552 57.420 1.00 8.51  ? 449 CYS B CA  1 
ATOM 6636 C C   . CYS B 1 449 ? -31.907 -24.128 58.767 1.00 7.45  ? 449 CYS B C   1 
ATOM 6637 O O   . CYS B 1 449 ? -31.210 -23.335 59.524 1.00 8.80  ? 449 CYS B O   1 
ATOM 6638 C CB  . CYS B 1 449 ? -32.025 -23.661 56.352 1.00 7.26  ? 449 CYS B CB  1 
ATOM 6639 S SG  . CYS B 1 449 ? -31.145 -23.655 54.760 1.00 10.52 ? 449 CYS B SG  1 
ATOM 6640 N N   . PHE B 1 450 ? -33.158 -24.526 59.067 1.00 6.44  ? 450 PHE B N   1 
ATOM 6641 C CA  . PHE B 1 450 ? -33.683 -24.175 60.388 1.00 5.76  ? 450 PHE B CA  1 
ATOM 6642 C C   . PHE B 1 450 ? -32.778 -24.681 61.508 1.00 7.77  ? 450 PHE B C   1 
ATOM 6643 O O   . PHE B 1 450 ? -32.431 -23.918 62.475 1.00 7.48  ? 450 PHE B O   1 
ATOM 6644 C CB  . PHE B 1 450 ? -35.100 -24.826 60.545 1.00 6.85  ? 450 PHE B CB  1 
ATOM 6645 C CG  . PHE B 1 450 ? -35.762 -24.596 61.849 1.00 5.87  ? 450 PHE B CG  1 
ATOM 6646 C CD1 . PHE B 1 450 ? -35.562 -25.432 62.907 1.00 4.54  ? 450 PHE B CD1 1 
ATOM 6647 C CD2 . PHE B 1 450 ? -36.644 -23.534 61.998 1.00 7.90  ? 450 PHE B CD2 1 
ATOM 6648 C CE1 . PHE B 1 450 ? -36.185 -25.192 64.170 1.00 7.63  ? 450 PHE B CE1 1 
ATOM 6649 C CE2 . PHE B 1 450 ? -37.333 -23.332 63.265 1.00 7.37  ? 450 PHE B CE2 1 
ATOM 6650 C CZ  . PHE B 1 450 ? -37.071 -24.137 64.321 1.00 7.28  ? 450 PHE B CZ  1 
ATOM 6651 N N   . LEU B 1 451 ? -32.376 -25.943 61.457 1.00 6.81  ? 451 LEU B N   1 
ATOM 6652 C CA  . LEU B 1 451 ? -31.534 -26.494 62.516 1.00 6.06  ? 451 LEU B CA  1 
ATOM 6653 C C   . LEU B 1 451 ? -30.159 -25.830 62.535 1.00 7.03  ? 451 LEU B C   1 
ATOM 6654 O O   . LEU B 1 451 ? -29.610 -25.682 63.628 1.00 6.99  ? 451 LEU B O   1 
ATOM 6655 C CB  . LEU B 1 451 ? -31.340 -28.010 62.293 1.00 6.02  ? 451 LEU B CB  1 
ATOM 6656 C CG  . LEU B 1 451 ? -32.611 -28.889 62.399 1.00 6.95  ? 451 LEU B CG  1 
ATOM 6657 C CD1 . LEU B 1 451 ? -32.270 -30.323 61.918 1.00 8.68  ? 451 LEU B CD1 1 
ATOM 6658 C CD2 . LEU B 1 451 ? -33.077 -28.801 63.919 1.00 7.57  ? 451 LEU B CD2 1 
ATOM 6659 N N   . SER B 1 452 ? -29.632 -25.454 61.357 1.00 6.30  ? 452 SER B N   1 
ATOM 6660 C CA  . SER B 1 452 ? -28.270 -24.823 61.353 1.00 6.91  ? 452 SER B CA  1 
ATOM 6661 C C   . SER B 1 452 ? -28.237 -23.542 62.211 1.00 8.07  ? 452 SER B C   1 
ATOM 6662 O O   . SER B 1 452 ? -27.139 -23.172 62.659 1.00 8.56  ? 452 SER B O   1 
ATOM 6663 C CB  . SER B 1 452 ? -27.903 -24.470 59.893 1.00 8.37  ? 452 SER B CB  1 
ATOM 6664 O OG  . SER B 1 452 ? -28.604 -23.301 59.423 1.00 8.70  ? 452 SER B OG  1 
ATOM 6665 N N   . ARG B 1 453 ? -29.366 -22.828 62.402 1.00 6.81  ? 453 ARG B N   1 
ATOM 6666 C CA  . ARG B 1 453 ? -29.373 -21.617 63.220 1.00 7.62  ? 453 ARG B CA  1 
ATOM 6667 C C   . ARG B 1 453 ? -29.150 -21.932 64.678 1.00 8.72  ? 453 ARG B C   1 
ATOM 6668 O O   . ARG B 1 453 ? -28.970 -20.955 65.456 1.00 11.23 ? 453 ARG B O   1 
ATOM 6669 C CB  . ARG B 1 453 ? -30.750 -20.945 63.072 1.00 7.96  ? 453 ARG B CB  1 
ATOM 6670 C CG  . ARG B 1 453 ? -30.959 -20.526 61.610 1.00 10.10 ? 453 ARG B CG  1 
ATOM 6671 C CD  . ARG B 1 453 ? -32.181 -19.687 61.529 1.00 12.31 ? 453 ARG B CD  1 
ATOM 6672 N NE  . ARG B 1 453 ? -32.489 -19.397 60.095 1.00 10.60 ? 453 ARG B NE  1 
ATOM 6673 C CZ  . ARG B 1 453 ? -33.160 -18.310 59.717 1.00 11.55 ? 453 ARG B CZ  1 
ATOM 6674 N NH1 . ARG B 1 453 ? -33.652 -17.454 60.591 1.00 13.97 ? 453 ARG B NH1 1 
ATOM 6675 N NH2 . ARG B 1 453 ? -33.470 -18.211 58.384 1.00 12.88 ? 453 ARG B NH2 1 
ATOM 6676 N N   . PHE B 1 454 ? -29.135 -23.189 65.061 1.00 7.57  ? 454 PHE B N   1 
ATOM 6677 C CA  . PHE B 1 454 ? -28.896 -23.565 66.439 1.00 7.39  ? 454 PHE B CA  1 
ATOM 6678 C C   . PHE B 1 454 ? -27.600 -24.296 66.619 1.00 7.37  ? 454 PHE B C   1 
ATOM 6679 O O   . PHE B 1 454 ? -27.270 -24.644 67.775 1.00 10.13 ? 454 PHE B O   1 
ATOM 6680 C CB  . PHE B 1 454 ? -30.085 -24.469 66.928 1.00 7.21  ? 454 PHE B CB  1 
ATOM 6681 C CG  . PHE B 1 454 ? -31.385 -23.712 66.839 1.00 5.85  ? 454 PHE B CG  1 
ATOM 6682 C CD1 . PHE B 1 454 ? -32.083 -23.663 65.616 1.00 8.20  ? 454 PHE B CD1 1 
ATOM 6683 C CD2 . PHE B 1 454 ? -31.973 -23.102 67.984 1.00 7.83  ? 454 PHE B CD2 1 
ATOM 6684 C CE1 . PHE B 1 454 ? -33.361 -22.987 65.529 1.00 7.03  ? 454 PHE B CE1 1 
ATOM 6685 C CE2 . PHE B 1 454 ? -33.204 -22.401 67.879 1.00 7.71  ? 454 PHE B CE2 1 
ATOM 6686 C CZ  . PHE B 1 454 ? -33.894 -22.351 66.677 1.00 7.60  ? 454 PHE B CZ  1 
ATOM 6687 N N   . ALA B 1 455 ? -26.808 -24.469 65.547 1.00 6.43  ? 455 ALA B N   1 
ATOM 6688 C CA  . ALA B 1 455 ? -25.600 -25.269 65.550 1.00 7.76  ? 455 ALA B CA  1 
ATOM 6689 C C   . ALA B 1 455 ? -24.323 -24.479 65.338 1.00 8.77  ? 455 ALA B C   1 
ATOM 6690 O O   . ALA B 1 455 ? -23.309 -25.053 65.003 1.00 10.56 ? 455 ALA B O   1 
ATOM 6691 C CB  . ALA B 1 455 ? -25.740 -26.397 64.473 1.00 8.28  ? 455 ALA B CB  1 
ATOM 6692 N N   . LYS B 1 456 ? -24.408 -23.152 65.452 1.00 8.60  ? 456 LYS B N   1 
ATOM 6693 C CA  . LYS B 1 456 ? -23.260 -22.316 64.984 1.00 9.37  ? 456 LYS B CA  1 
ATOM 6694 C C   . LYS B 1 456 ? -22.065 -22.459 65.962 1.00 10.89 ? 456 LYS B C   1 
ATOM 6695 O O   . LYS B 1 456 ? -20.983 -22.097 65.540 1.00 11.81 ? 456 LYS B O   1 
ATOM 6696 C CB  . LYS B 1 456 ? -23.685 -20.833 64.884 1.00 10.66 ? 456 LYS B CB  1 
ATOM 6697 C CG  . LYS B 1 456 ? -24.639 -20.613 63.738 1.00 14.26 ? 456 LYS B CG  1 
ATOM 6698 C CD  . LYS B 1 456 ? -25.155 -19.166 63.688 1.00 23.23 ? 456 LYS B CD  1 
ATOM 6699 C CE  . LYS B 1 456 ? -26.127 -19.078 62.509 1.00 27.74 ? 456 LYS B CE  1 
ATOM 6700 N NZ  . LYS B 1 456 ? -26.773 -17.699 62.531 1.00 31.46 ? 456 LYS B NZ  1 
ATOM 6701 N N   . ALA B 1 457 ? -22.252 -22.991 67.158 1.00 11.08 ? 457 ALA B N   1 
ATOM 6702 C CA  . ALA B 1 457 ? -21.159 -23.040 68.156 1.00 11.83 ? 457 ALA B CA  1 
ATOM 6703 C C   . ALA B 1 457 ? -20.159 -24.173 67.888 1.00 10.91 ? 457 ALA B C   1 
ATOM 6704 O O   . ALA B 1 457 ? -19.157 -24.269 68.601 1.00 12.55 ? 457 ALA B O   1 
ATOM 6705 C CB  . ALA B 1 457 ? -21.759 -23.172 69.619 1.00 13.95 ? 457 ALA B CB  1 
ATOM 6706 N N   . TYR B 1 458 ? -20.438 -25.078 66.932 1.00 8.24  ? 458 TYR B N   1 
ATOM 6707 C CA  . TYR B 1 458 ? -19.667 -26.303 66.838 1.00 7.54  ? 458 TYR B CA  1 
ATOM 6708 C C   . TYR B 1 458 ? -19.759 -26.864 65.463 1.00 6.42  ? 458 TYR B C   1 
ATOM 6709 O O   . TYR B 1 458 ? -20.553 -26.387 64.601 1.00 8.75  ? 458 TYR B O   1 
ATOM 6710 C CB  . TYR B 1 458 ? -20.034 -27.368 67.913 1.00 8.14  ? 458 TYR B CB  1 
ATOM 6711 C CG  . TYR B 1 458 ? -21.567 -27.530 68.088 1.00 7.29  ? 458 TYR B CG  1 
ATOM 6712 C CD1 . TYR B 1 458 ? -22.352 -27.951 67.026 1.00 7.59  ? 458 TYR B CD1 1 
ATOM 6713 C CD2 . TYR B 1 458 ? -22.120 -27.289 69.329 1.00 8.60  ? 458 TYR B CD2 1 
ATOM 6714 C CE1 . TYR B 1 458 ? -23.748 -28.116 67.229 1.00 7.25  ? 458 TYR B CE1 1 
ATOM 6715 C CE2 . TYR B 1 458 ? -23.531 -27.441 69.572 1.00 8.42  ? 458 TYR B CE2 1 
ATOM 6716 C CZ  . TYR B 1 458 ? -24.256 -27.870 68.473 1.00 7.54  ? 458 TYR B CZ  1 
ATOM 6717 O OH  . TYR B 1 458 ? -25.630 -28.045 68.600 1.00 8.26  ? 458 TYR B OH  1 
ATOM 6718 N N   . ASN B 1 459 ? -18.942 -27.874 65.204 1.00 7.20  ? 459 ASN B N   1 
ATOM 6719 C CA  . ASN B 1 459 ? -19.000 -28.576 63.877 1.00 8.04  ? 459 ASN B CA  1 
ATOM 6720 C C   . ASN B 1 459 ? -20.187 -29.529 63.925 1.00 6.73  ? 459 ASN B C   1 
ATOM 6721 O O   . ASN B 1 459 ? -20.275 -30.375 64.832 1.00 6.55  ? 459 ASN B O   1 
ATOM 6722 C CB  . ASN B 1 459 ? -17.736 -29.454 63.673 1.00 8.72  ? 459 ASN B CB  1 
ATOM 6723 C CG  . ASN B 1 459 ? -16.444 -28.626 63.537 1.00 14.02 ? 459 ASN B CG  1 
ATOM 6724 O OD1 . ASN B 1 459 ? -15.418 -29.044 64.179 1.00 21.40 ? 459 ASN B OD1 1 
ATOM 6725 N ND2 . ASN B 1 459 ? -16.550 -27.482 63.075 1.00 12.20 ? 459 ASN B ND2 1 
ATOM 6726 N N   . TRP B 1 460 ? -21.091 -29.349 62.935 1.00 6.53  ? 460 TRP B N   1 
ATOM 6727 C CA  . TRP B 1 460 ? -22.421 -30.033 63.003 1.00 6.94  ? 460 TRP B CA  1 
ATOM 6728 C C   . TRP B 1 460 ? -22.830 -30.602 61.668 1.00 7.59  ? 460 TRP B C   1 
ATOM 6729 O O   . TRP B 1 460 ? -22.503 -30.040 60.573 1.00 7.42  ? 460 TRP B O   1 
ATOM 6730 C CB  . TRP B 1 460 ? -23.440 -29.024 63.510 1.00 8.22  ? 460 TRP B CB  1 
ATOM 6731 C CG  . TRP B 1 460 ? -24.891 -29.417 63.162 1.00 7.02  ? 460 TRP B CG  1 
ATOM 6732 C CD1 . TRP B 1 460 ? -25.704 -30.236 63.896 1.00 9.28  ? 460 TRP B CD1 1 
ATOM 6733 C CD2 . TRP B 1 460 ? -25.651 -28.855 62.100 1.00 7.33  ? 460 TRP B CD2 1 
ATOM 6734 N NE1 . TRP B 1 460 ? -26.972 -30.229 63.275 1.00 7.47  ? 460 TRP B NE1 1 
ATOM 6735 C CE2 . TRP B 1 460 ? -26.946 -29.383 62.184 1.00 6.47  ? 460 TRP B CE2 1 
ATOM 6736 C CE3 . TRP B 1 460 ? -25.352 -27.964 61.050 1.00 9.07  ? 460 TRP B CE3 1 
ATOM 6737 C CZ2 . TRP B 1 460 ? -27.956 -29.037 61.257 1.00 8.03  ? 460 TRP B CZ2 1 
ATOM 6738 C CZ3 . TRP B 1 460 ? -26.336 -27.620 60.119 1.00 9.54  ? 460 TRP B CZ3 1 
ATOM 6739 C CH2 . TRP B 1 460 ? -27.613 -28.180 60.233 1.00 8.60  ? 460 TRP B CH2 1 
ATOM 6740 N N   . ALA B 1 461 ? -23.484 -31.758 61.742 1.00 7.35  ? 461 ALA B N   1 
ATOM 6741 C CA  . ALA B 1 461 ? -24.118 -32.315 60.538 1.00 6.19  ? 461 ALA B CA  1 
ATOM 6742 C C   . ALA B 1 461 ? -25.509 -32.836 60.965 1.00 7.08  ? 461 ALA B C   1 
ATOM 6743 O O   . ALA B 1 461 ? -25.746 -33.144 62.161 1.00 7.26  ? 461 ALA B O   1 
ATOM 6744 C CB  . ALA B 1 461 ? -23.289 -33.449 60.015 1.00 8.61  ? 461 ALA B CB  1 
ATOM 6745 N N   . HIS B 1 462 ? -26.360 -32.939 59.965 1.00 6.43  ? 462 HIS B N   1 
ATOM 6746 C CA  . HIS B 1 462 ? -27.764 -33.398 60.144 1.00 4.88  ? 462 HIS B CA  1 
ATOM 6747 C C   . HIS B 1 462 ? -28.051 -34.477 59.119 1.00 5.86  ? 462 HIS B C   1 
ATOM 6748 O O   . HIS B 1 462 ? -27.763 -34.342 57.899 1.00 5.25  ? 462 HIS B O   1 
ATOM 6749 C CB  . HIS B 1 462 ? -28.587 -32.130 59.844 1.00 6.38  ? 462 HIS B CB  1 
ATOM 6750 C CG  . HIS B 1 462 ? -30.018 -32.446 59.589 1.00 6.75  ? 462 HIS B CG  1 
ATOM 6751 N ND1 . HIS B 1 462 ? -30.762 -32.101 58.441 1.00 13.39 ? 462 HIS B ND1 1 
ATOM 6752 C CD2 . HIS B 1 462 ? -30.877 -33.097 60.421 1.00 5.03  ? 462 HIS B CD2 1 
ATOM 6753 C CE1 . HIS B 1 462 ? -32.014 -32.557 58.567 1.00 6.62  ? 462 HIS B CE1 1 
ATOM 6754 N NE2 . HIS B 1 462 ? -32.071 -33.215 59.733 1.00 11.36 ? 462 HIS B NE2 1 
ATOM 6755 N N   . MET B 1 463 ? -28.607 -35.583 59.594 1.00 6.84  ? 463 MET B N   1 
ATOM 6756 C CA  . MET B 1 463 ? -28.959 -36.727 58.763 1.00 6.72  ? 463 MET B CA  1 
ATOM 6757 C C   . MET B 1 463 ? -30.445 -36.912 58.771 1.00 6.88  ? 463 MET B C   1 
ATOM 6758 O O   . MET B 1 463 ? -31.048 -37.159 59.818 1.00 7.77  ? 463 MET B O   1 
ATOM 6759 C CB  . MET B 1 463 ? -28.245 -38.007 59.267 1.00 8.55  ? 463 MET B CB  1 
ATOM 6760 C CG  . MET B 1 463 ? -26.732 -37.853 59.159 1.00 9.37  ? 463 MET B CG  1 
ATOM 6761 S SD  . MET B 1 463 ? -25.828 -39.278 59.945 1.00 12.78 ? 463 MET B SD  1 
ATOM 6762 C CE  . MET B 1 463 ? -26.416 -40.616 59.007 1.00 13.47 ? 463 MET B CE  1 
ATOM 6763 N N   . ASP B 1 464 ? -31.054 -36.829 57.602 1.00 6.62  ? 464 ASP B N   1 
ATOM 6764 C CA  . ASP B 1 464 ? -32.490 -36.995 57.388 1.00 7.09  ? 464 ASP B CA  1 
ATOM 6765 C C   . ASP B 1 464 ? -32.707 -38.410 56.899 1.00 6.14  ? 464 ASP B C   1 
ATOM 6766 O O   . ASP B 1 464 ? -32.367 -38.777 55.761 1.00 7.33  ? 464 ASP B O   1 
ATOM 6767 C CB  . ASP B 1 464 ? -33.037 -35.972 56.440 1.00 6.79  ? 464 ASP B CB  1 
ATOM 6768 C CG  . ASP B 1 464 ? -34.543 -35.868 56.430 1.00 9.68  ? 464 ASP B CG  1 
ATOM 6769 O OD1 . ASP B 1 464 ? -35.247 -36.873 56.793 1.00 9.99  ? 464 ASP B OD1 1 
ATOM 6770 O OD2 . ASP B 1 464 ? -35.066 -34.759 56.036 1.00 9.14  ? 464 ASP B OD2 1 
ATOM 6771 N N   . ILE B 1 465 ? -33.189 -39.230 57.839 1.00 7.20  ? 465 ILE B N   1 
ATOM 6772 C CA  . ILE B 1 465 ? -33.367 -40.669 57.588 1.00 5.85  ? 465 ILE B CA  1 
ATOM 6773 C C   . ILE B 1 465 ? -34.870 -41.061 57.402 1.00 7.93  ? 465 ILE B C   1 
ATOM 6774 O O   . ILE B 1 465 ? -35.214 -42.233 57.469 1.00 8.78  ? 465 ILE B O   1 
ATOM 6775 C CB  . ILE B 1 465 ? -32.765 -41.567 58.754 1.00 6.56  ? 465 ILE B CB  1 
ATOM 6776 C CG1 . ILE B 1 465 ? -33.388 -41.143 60.118 1.00 6.72  ? 465 ILE B CG1 1 
ATOM 6777 C CG2 . ILE B 1 465 ? -31.227 -41.323 58.747 1.00 7.95  ? 465 ILE B CG2 1 
ATOM 6778 C CD1 . ILE B 1 465 ? -33.108 -42.226 61.224 1.00 7.98  ? 465 ILE B CD1 1 
ATOM 6779 N N   . ALA B 1 466 ? -35.644 -40.060 57.000 1.00 6.92  ? 466 ALA B N   1 
ATOM 6780 C CA  . ALA B 1 466 ? -37.059 -40.365 56.720 1.00 8.98  ? 466 ALA B CA  1 
ATOM 6781 C C   . ALA B 1 466 ? -37.225 -41.466 55.682 1.00 8.13  ? 466 ALA B C   1 
ATOM 6782 O O   . ALA B 1 466 ? -38.268 -42.151 55.760 1.00 10.71 ? 466 ALA B O   1 
ATOM 6783 C CB  . ALA B 1 466 ? -37.792 -39.042 56.187 1.00 9.57  ? 466 ALA B CB  1 
ATOM 6784 N N   . GLY B 1 467 ? -36.318 -41.608 54.689 1.00 8.36  ? 467 GLY B N   1 
ATOM 6785 C CA  . GLY B 1 467 ? -36.432 -42.664 53.656 1.00 7.64  ? 467 GLY B CA  1 
ATOM 6786 C C   . GLY B 1 467 ? -35.733 -43.936 53.950 1.00 8.50  ? 467 GLY B C   1 
ATOM 6787 O O   . GLY B 1 467 ? -36.092 -45.014 53.342 1.00 11.20 ? 467 GLY B O   1 
ATOM 6788 N N   . THR B 1 468 ? -34.732 -43.913 54.845 1.00 6.57  ? 468 THR B N   1 
ATOM 6789 C CA  . THR B 1 468 ? -33.866 -45.103 55.018 1.00 7.44  ? 468 THR B CA  1 
ATOM 6790 C C   . THR B 1 468 ? -34.088 -45.820 56.343 1.00 7.84  ? 468 THR B C   1 
ATOM 6791 O O   . THR B 1 468 ? -33.582 -46.922 56.492 1.00 9.91  ? 468 THR B O   1 
ATOM 6792 C CB  . THR B 1 468 ? -32.395 -44.685 54.990 1.00 6.49  ? 468 THR B CB  1 
ATOM 6793 O OG1 . THR B 1 468 ? -32.154 -43.597 55.910 1.00 8.84  ? 468 THR B OG1 1 
ATOM 6794 C CG2 . THR B 1 468 ? -31.982 -44.149 53.615 1.00 10.54 ? 468 THR B CG2 1 
ATOM 6795 N N   . ALA B 1 469 ? -34.909 -45.258 57.256 1.00 7.69  ? 469 ALA B N   1 
ATOM 6796 C CA  . ALA B 1 469 ? -35.041 -45.856 58.600 1.00 8.44  ? 469 ALA B CA  1 
ATOM 6797 C C   . ALA B 1 469 ? -36.061 -46.981 58.672 1.00 8.36  ? 469 ALA B C   1 
ATOM 6798 O O   . ALA B 1 469 ? -36.015 -47.787 59.669 1.00 7.94  ? 469 ALA B O   1 
ATOM 6799 C CB  . ALA B 1 469 ? -35.432 -44.768 59.531 1.00 9.10  ? 469 ALA B CB  1 
ATOM 6800 N N   . TRP B 1 470 ? -36.959 -47.114 57.722 1.00 8.22  ? 470 TRP B N   1 
ATOM 6801 C CA  . TRP B 1 470 ? -37.885 -48.253 57.762 1.00 9.10  ? 470 TRP B CA  1 
ATOM 6802 C C   . TRP B 1 470 ? -38.376 -48.605 56.376 1.00 9.75  ? 470 TRP B C   1 
ATOM 6803 O O   . TRP B 1 470 ? -38.258 -47.786 55.432 1.00 12.26 ? 470 TRP B O   1 
ATOM 6804 C CB  . TRP B 1 470 ? -39.085 -47.986 58.716 1.00 10.05 ? 470 TRP B CB  1 
ATOM 6805 C CG  . TRP B 1 470 ? -40.160 -47.018 58.244 1.00 9.09  ? 470 TRP B CG  1 
ATOM 6806 C CD1 . TRP B 1 470 ? -41.316 -47.358 57.606 1.00 9.88  ? 470 TRP B CD1 1 
ATOM 6807 C CD2 . TRP B 1 470 ? -40.233 -45.633 58.504 1.00 10.55 ? 470 TRP B CD2 1 
ATOM 6808 N NE1 . TRP B 1 470 ? -42.060 -46.229 57.340 1.00 11.27 ? 470 TRP B NE1 1 
ATOM 6809 C CE2 . TRP B 1 470 ? -41.454 -45.156 57.937 1.00 13.70 ? 470 TRP B CE2 1 
ATOM 6810 C CE3 . TRP B 1 470 ? -39.358 -44.704 59.141 1.00 10.90 ? 470 TRP B CE3 1 
ATOM 6811 C CZ2 . TRP B 1 470 ? -41.854 -43.805 58.008 1.00 12.67 ? 470 TRP B CZ2 1 
ATOM 6812 C CZ3 . TRP B 1 470 ? -39.759 -43.382 59.212 1.00 10.83 ? 470 TRP B CZ3 1 
ATOM 6813 C CH2 . TRP B 1 470 ? -41.001 -42.946 58.636 1.00 14.07 ? 470 TRP B CH2 1 
ATOM 6814 N N   . ILE B 1 471 ? -38.929 -49.796 56.265 1.00 9.96  ? 471 ILE B N   1 
ATOM 6815 C CA  . ILE B 1 471 ? -39.563 -50.245 55.038 1.00 12.40 ? 471 ILE B CA  1 
ATOM 6816 C C   . ILE B 1 471 ? -41.084 -50.193 55.250 1.00 11.97 ? 471 ILE B C   1 
ATOM 6817 O O   . ILE B 1 471 ? -41.629 -50.622 56.262 1.00 11.68 ? 471 ILE B O   1 
ATOM 6818 C CB  . ILE B 1 471 ? -39.064 -51.613 54.653 1.00 14.04 ? 471 ILE B CB  1 
ATOM 6819 C CG1 . ILE B 1 471 ? -37.550 -51.531 54.362 1.00 16.97 ? 471 ILE B CG1 1 
ATOM 6820 C CG2 . ILE B 1 471 ? -39.946 -52.162 53.465 1.00 14.20 ? 471 ILE B CG2 1 
ATOM 6821 C CD1 . ILE B 1 471 ? -36.958 -52.889 54.556 1.00 20.97 ? 471 ILE B CD1 1 
ATOM 6822 N N   . SER B 1 472 ? -41.797 -49.653 54.268 1.00 15.93 ? 472 SER B N   1 
ATOM 6823 C CA  . SER B 1 472 ? -43.114 -49.011 54.531 1.00 19.82 ? 472 SER B CA  1 
ATOM 6824 C C   . SER B 1 472 ? -44.383 -49.339 53.657 1.00 23.48 ? 472 SER B C   1 
ATOM 6825 O O   . SER B 1 472 ? -44.882 -48.493 52.921 1.00 24.34 ? 472 SER B O   1 
ATOM 6826 C CB  . SER B 1 472 ? -42.960 -47.490 54.679 1.00 18.74 ? 472 SER B CB  1 
ATOM 6827 O OG  . SER B 1 472 ? -42.420 -46.872 53.533 1.00 21.24 ? 472 SER B OG  1 
ATOM 6828 N N   . GLY B 1 473 ? -44.919 -50.542 53.812 1.00 24.90 ? 473 GLY B N   1 
ATOM 6829 C CA  . GLY B 1 473 ? -44.011 -51.610 54.077 1.00 27.50 ? 473 GLY B CA  1 
ATOM 6830 C C   . GLY B 1 473 ? -43.149 -51.671 52.852 1.00 29.02 ? 473 GLY B C   1 
ATOM 6831 O O   . GLY B 1 473 ? -41.937 -51.547 52.977 1.00 29.85 ? 473 GLY B O   1 
ATOM 6832 N N   . GLY B 1 474 ? -43.731 -51.981 51.689 1.00 20.00 ? 474 GLY B N   1 
ATOM 6833 C CA  . GLY B 1 474 ? -43.523 -53.269 51.039 1.00 20.00 ? 474 GLY B CA  1 
ATOM 6834 C C   . GLY B 1 474 ? -44.486 -54.341 51.520 1.00 20.00 ? 474 GLY B C   1 
ATOM 6835 O O   . GLY B 1 474 ? -45.458 -54.028 52.160 1.00 20.00 ? 474 GLY B O   1 
ATOM 6836 N N   . LYS B 1 475 ? -44.294 -55.605 51.194 1.00 20.00 ? 475 LYS B N   1 
ATOM 6837 C CA  . LYS B 1 475 ? -44.823 -56.629 52.089 1.00 20.00 ? 475 LYS B CA  1 
ATOM 6838 C C   . LYS B 1 475 ? -43.924 -57.234 53.191 1.00 20.00 ? 475 LYS B C   1 
ATOM 6839 O O   . LYS B 1 475 ? -44.414 -57.949 54.030 1.00 20.00 ? 475 LYS B O   1 
ATOM 6840 C CB  . LYS B 1 475 ? -45.550 -57.716 51.307 1.00 20.00 ? 475 LYS B CB  1 
ATOM 6841 C CG  . LYS B 1 475 ? -46.396 -57.200 50.161 1.00 20.00 ? 475 LYS B CG  1 
ATOM 6842 C CD  . LYS B 1 475 ? -47.052 -58.367 49.397 1.00 20.00 ? 475 LYS B CD  1 
ATOM 6843 C CE  . LYS B 1 475 ? -47.933 -57.905 48.251 1.00 20.00 ? 475 LYS B CE  1 
ATOM 6844 N NZ  . LYS B 1 475 ? -48.594 -58.995 47.476 1.00 20.00 ? 475 LYS B NZ  1 
ATOM 6845 N N   . ASP B 1 476 ? -42.638 -56.941 53.235 1.00 20.00 ? 476 ASP B N   1 
ATOM 6846 C CA  . ASP B 1 476 ? -41.912 -57.127 54.486 1.00 20.00 ? 476 ASP B CA  1 
ATOM 6847 C C   . ASP B 1 476 ? -41.141 -55.889 54.928 1.00 20.00 ? 476 ASP B C   1 
ATOM 6848 O O   . ASP B 1 476 ? -40.314 -55.398 54.211 1.00 20.00 ? 476 ASP B O   1 
ATOM 6849 C CB  . ASP B 1 476 ? -40.956 -58.320 54.399 1.00 20.00 ? 476 ASP B CB  1 
ATOM 6850 C CG  . ASP B 1 476 ? -41.618 -59.571 53.873 1.00 20.00 ? 476 ASP B CG  1 
ATOM 6851 O OD1 . ASP B 1 476 ? -42.807 -59.475 53.570 1.00 20.00 ? 476 ASP B OD1 1 
ATOM 6852 O OD2 . ASP B 1 476 ? -40.960 -60.628 53.773 1.00 20.00 ? 476 ASP B OD2 1 
ATOM 6853 N N   . LYS B 1 477 ? -41.372 -55.457 56.148 1.00 17.02 ? 477 LYS B N   1 
ATOM 6854 C CA  . LYS B 1 477 ? -41.848 -54.133 56.476 1.00 15.41 ? 477 LYS B CA  1 
ATOM 6855 C C   . LYS B 1 477 ? -41.485 -53.887 57.936 1.00 13.39 ? 477 LYS B C   1 
ATOM 6856 O O   . LYS B 1 477 ? -41.690 -54.732 58.768 1.00 15.49 ? 477 LYS B O   1 
ATOM 6857 C CB  . LYS B 1 477 ? -43.349 -54.123 56.260 1.00 17.08 ? 477 LYS B CB  1 
ATOM 6858 C CG  . LYS B 1 477 ? -43.940 -52.814 55.924 1.00 14.27 ? 477 LYS B CG  1 
ATOM 6859 C CD  . LYS B 1 477 ? -45.452 -52.810 56.089 1.00 18.72 ? 477 LYS B CD  1 
ATOM 6860 C CE  . LYS B 1 477 ? -45.928 -52.393 57.492 1.00 16.12 ? 477 LYS B CE  1 
ATOM 6861 N NZ  . LYS B 1 477 ? -47.420 -52.399 57.641 1.00 16.58 ? 477 LYS B NZ  1 
ATOM 6862 N N   . GLY B 1 478 ? -40.932 -52.746 58.273 1.00 10.46 ? 478 GLY B N   1 
ATOM 6863 C CA  . GLY B 1 478 ? -40.448 -52.547 59.631 1.00 10.87 ? 478 GLY B CA  1 
ATOM 6864 C C   . GLY B 1 478 ? -39.120 -51.774 59.562 1.00 7.91  ? 478 GLY B C   1 
ATOM 6865 O O   . GLY B 1 478 ? -38.600 -51.372 58.496 1.00 9.65  ? 478 GLY B O   1 
ATOM 6866 N N   . ALA B 1 479 ? -38.581 -51.507 60.770 1.00 7.73  ? 479 ALA B N   1 
ATOM 6867 C CA  . ALA B 1 479 ? -37.365 -50.699 60.888 1.00 7.13  ? 479 ALA B CA  1 
ATOM 6868 C C   . ALA B 1 479 ? -36.195 -51.368 60.203 1.00 6.46  ? 479 ALA B C   1 
ATOM 6869 O O   . ALA B 1 479 ? -36.083 -52.618 60.219 1.00 8.32  ? 479 ALA B O   1 
ATOM 6870 C CB  . ALA B 1 479 ? -37.023 -50.518 62.378 1.00 10.76 ? 479 ALA B CB  1 
ATOM 6871 N N   . THR B 1 480 ? -35.391 -50.530 59.560 1.00 6.68  ? 480 THR B N   1 
ATOM 6872 C CA  . THR B 1 480 ? -34.063 -50.849 59.077 1.00 7.55  ? 480 THR B CA  1 
ATOM 6873 C C   . THR B 1 480 ? -33.046 -50.687 60.203 1.00 8.57  ? 480 THR B C   1 
ATOM 6874 O O   . THR B 1 480 ? -33.356 -50.162 61.272 1.00 10.67 ? 480 THR B O   1 
ATOM 6875 C CB  . THR B 1 480 ? -33.659 -49.946 57.897 1.00 8.85  ? 480 THR B CB  1 
ATOM 6876 O OG1 . THR B 1 480 ? -33.547 -48.590 58.345 1.00 7.97  ? 480 THR B OG1 1 
ATOM 6877 C CG2 . THR B 1 480 ? -34.696 -50.025 56.786 1.00 11.09 ? 480 THR B CG2 1 
ATOM 6878 N N   . GLY B 1 481 ? -31.830 -51.143 59.940 1.00 6.83  ? 481 GLY B N   1 
ATOM 6879 C CA  . GLY B 1 481 ? -30.709 -51.018 60.852 1.00 8.27  ? 481 GLY B CA  1 
ATOM 6880 C C   . GLY B 1 481 ? -29.932 -49.771 60.484 1.00 8.64  ? 481 GLY B C   1 
ATOM 6881 O O   . GLY B 1 481 ? -28.828 -49.532 60.975 1.00 9.22  ? 481 GLY B O   1 
ATOM 6882 N N   . ARG B 1 482 ? -30.519 -48.985 59.587 1.00 8.21  ? 482 ARG B N   1 
ATOM 6883 C CA  . ARG B 1 482 ? -29.816 -48.064 58.707 1.00 9.86  ? 482 ARG B CA  1 
ATOM 6884 C C   . ARG B 1 482 ? -28.956 -46.955 59.323 1.00 20.04 ? 482 ARG B C   1 
ATOM 6885 O O   . ARG B 1 482 ? -27.859 -46.721 58.816 1.00 25.30 ? 482 ARG B O   1 
ATOM 6886 C CB  . ARG B 1 482 ? -30.803 -47.443 57.711 1.00 9.76  ? 482 ARG B CB  1 
ATOM 6887 C CG  . ARG B 1 482 ? -31.151 -48.343 56.537 1.00 11.72 ? 482 ARG B CG  1 
ATOM 6888 C CD  . ARG B 1 482 ? -31.214 -47.558 55.238 1.00 11.65 ? 482 ARG B CD  1 
ATOM 6889 N NE  . ARG B 1 482 ? -29.908 -47.025 54.857 1.00 12.73 ? 482 ARG B NE  1 
ATOM 6890 C CZ  . ARG B 1 482 ? -29.529 -46.802 53.604 1.00 12.56 ? 482 ARG B CZ  1 
ATOM 6891 N NH1 . ARG B 1 482 ? -30.356 -47.066 52.602 1.00 14.69 ? 482 ARG B NH1 1 
ATOM 6892 N NH2 . ARG B 1 482 ? -28.322 -46.315 53.350 1.00 15.29 ? 482 ARG B NH2 1 
ATOM 6893 N N   . PRO B 1 483 ? -29.380 -46.260 60.379 1.00 9.57  ? 483 PRO B N   1 
ATOM 6894 C CA  . PRO B 1 483 ? -28.433 -45.255 60.861 1.00 8.83  ? 483 PRO B CA  1 
ATOM 6895 C C   . PRO B 1 483 ? -27.169 -45.924 61.379 1.00 7.58  ? 483 PRO B C   1 
ATOM 6896 O O   . PRO B 1 483 ? -26.068 -45.401 61.209 1.00 7.71  ? 483 PRO B O   1 
ATOM 6897 C CB  . PRO B 1 483 ? -29.188 -44.591 62.012 1.00 9.62  ? 483 PRO B CB  1 
ATOM 6898 C CG  . PRO B 1 483 ? -30.621 -44.726 61.641 1.00 9.95  ? 483 PRO B CG  1 
ATOM 6899 C CD  . PRO B 1 483 ? -30.637 -45.445 60.322 1.00 10.78 ? 483 PRO B CD  1 
ATOM 6900 N N   . VAL B 1 484 ? -27.343 -47.070 62.027 1.00 7.12  ? 484 VAL B N   1 
ATOM 6901 C CA  . VAL B 1 484 ? -26.278 -47.688 62.807 1.00 7.52  ? 484 VAL B CA  1 
ATOM 6902 C C   . VAL B 1 484 ? -24.964 -48.037 62.086 1.00 7.26  ? 484 VAL B C   1 
ATOM 6903 O O   . VAL B 1 484 ? -23.900 -47.817 62.665 1.00 7.57  ? 484 VAL B O   1 
ATOM 6904 C CB  . VAL B 1 484 ? -26.785 -48.960 63.524 1.00 7.62  ? 484 VAL B CB  1 
ATOM 6905 C CG1 . VAL B 1 484 ? -25.694 -49.542 64.409 1.00 8.79  ? 484 VAL B CG1 1 
ATOM 6906 C CG2 . VAL B 1 484 ? -28.032 -48.648 64.338 1.00 8.70  ? 484 VAL B CG2 1 
ATOM 6907 N N   . PRO B 1 485 ? -24.985 -48.568 60.863 1.00 8.09  ? 485 PRO B N   1 
ATOM 6908 C CA  . PRO B 1 485 ? -23.678 -48.898 60.271 1.00 6.82  ? 485 PRO B CA  1 
ATOM 6909 C C   . PRO B 1 485 ? -22.896 -47.655 59.957 1.00 7.89  ? 485 PRO B C   1 
ATOM 6910 O O   . PRO B 1 485 ? -21.677 -47.618 60.282 1.00 8.52  ? 485 PRO B O   1 
ATOM 6911 C CB  . PRO B 1 485 ? -24.080 -49.679 58.971 1.00 8.08  ? 485 PRO B CB  1 
ATOM 6912 C CG  . PRO B 1 485 ? -25.474 -50.279 59.354 1.00 9.24  ? 485 PRO B CG  1 
ATOM 6913 C CD  . PRO B 1 485 ? -26.110 -49.195 60.122 1.00 6.81  ? 485 PRO B CD  1 
ATOM 6914 N N   . LEU B 1 486 ? -23.487 -46.617 59.348 1.00 6.79  ? 486 LEU B N   1 
ATOM 6915 C CA  . LEU B 1 486 ? -22.706 -45.410 59.029 1.00 8.10  ? 486 LEU B CA  1 
ATOM 6916 C C   . LEU B 1 486 ? -22.148 -44.804 60.290 1.00 6.58  ? 486 LEU B C   1 
ATOM 6917 O O   . LEU B 1 486 ? -20.943 -44.420 60.351 1.00 7.23  ? 486 LEU B O   1 
ATOM 6918 C CB  . LEU B 1 486 ? -23.618 -44.369 58.289 1.00 9.21  ? 486 LEU B CB  1 
ATOM 6919 C CG  . LEU B 1 486 ? -22.902 -43.140 57.742 1.00 7.90  ? 486 LEU B CG  1 
ATOM 6920 C CD1 . LEU B 1 486 ? -23.775 -42.504 56.662 1.00 9.87  ? 486 LEU B CD1 1 
ATOM 6921 C CD2 . LEU B 1 486 ? -22.648 -42.134 58.895 1.00 9.08  ? 486 LEU B CD2 1 
ATOM 6922 N N   . LEU B 1 487 ? -23.038 -44.565 61.278 1.00 7.92  ? 487 LEU B N   1 
ATOM 6923 C CA  . LEU B 1 487 ? -22.595 -43.855 62.521 1.00 7.88  ? 487 LEU B CA  1 
ATOM 6924 C C   . LEU B 1 487 ? -21.496 -44.665 63.240 1.00 9.39  ? 487 LEU B C   1 
ATOM 6925 O O   . LEU B 1 487 ? -20.476 -44.086 63.694 1.00 7.67  ? 487 LEU B O   1 
ATOM 6926 C CB  . LEU B 1 487 ? -23.756 -43.646 63.473 1.00 9.81  ? 487 LEU B CB  1 
ATOM 6927 C CG  . LEU B 1 487 ? -24.816 -42.672 62.934 1.00 7.59  ? 487 LEU B CG  1 
ATOM 6928 C CD1 . LEU B 1 487 ? -26.007 -42.750 63.775 1.00 9.80  ? 487 LEU B CD1 1 
ATOM 6929 C CD2 . LEU B 1 487 ? -24.270 -41.180 62.865 1.00 10.09 ? 487 LEU B CD2 1 
ATOM 6930 N N   . THR B 1 488 ? -21.666 -45.984 63.355 1.00 8.53  ? 488 THR B N   1 
ATOM 6931 C CA  . THR B 1 488 ? -20.650 -46.816 63.960 1.00 7.75  ? 488 THR B CA  1 
ATOM 6932 C C   . THR B 1 488 ? -19.347 -46.737 63.159 1.00 7.95  ? 488 THR B C   1 
ATOM 6933 O O   . THR B 1 488 ? -18.257 -46.615 63.754 1.00 8.59  ? 488 THR B O   1 
ATOM 6934 C CB  . THR B 1 488 ? -21.140 -48.275 64.125 1.00 9.89  ? 488 THR B CB  1 
ATOM 6935 O OG1 . THR B 1 488 ? -22.371 -48.243 64.879 1.00 8.27  ? 488 THR B OG1 1 
ATOM 6936 C CG2 . THR B 1 488 ? -20.040 -49.076 64.983 1.00 11.33 ? 488 THR B CG2 1 
ATOM 6937 N N   . GLN B 1 489 ? -19.449 -46.821 61.841 1.00 7.44  ? 489 GLN B N   1 
ATOM 6938 C CA  . GLN B 1 489 ? -18.226 -46.693 61.025 1.00 7.65  ? 489 GLN B CA  1 
ATOM 6939 C C   . GLN B 1 489 ? -17.540 -45.346 61.241 1.00 8.45  ? 489 GLN B C   1 
ATOM 6940 O O   . GLN B 1 489 ? -16.290 -45.274 61.344 1.00 8.87  ? 489 GLN B O   1 
ATOM 6941 C CB  . GLN B 1 489 ? -18.618 -46.895 59.537 1.00 9.29  ? 489 GLN B CB  1 
ATOM 6942 C CG  . GLN B 1 489 ? -17.389 -46.759 58.559 1.00 8.76  ? 489 GLN B CG  1 
ATOM 6943 C CD  . GLN B 1 489 ? -16.447 -47.929 58.812 1.00 11.07 ? 489 GLN B CD  1 
ATOM 6944 O OE1 . GLN B 1 489 ? -15.314 -47.803 59.483 1.00 13.69 ? 489 GLN B OE1 1 
ATOM 6945 N NE2 . GLN B 1 489 ? -16.913 -49.052 58.470 1.00 9.38  ? 489 GLN B NE2 1 
ATOM 6946 N N   . TYR B 1 490 ? -18.318 -44.240 61.332 1.00 8.19  ? 490 TYR B N   1 
ATOM 6947 C CA  . TYR B 1 490 ? -17.684 -42.950 61.630 1.00 7.69  ? 490 TYR B CA  1 
ATOM 6948 C C   . TYR B 1 490 ? -16.972 -42.924 62.948 1.00 8.32  ? 490 TYR B C   1 
ATOM 6949 O O   . TYR B 1 490 ? -15.808 -42.453 62.988 1.00 7.89  ? 490 TYR B O   1 
ATOM 6950 C CB  . TYR B 1 490 ? -18.828 -41.897 61.522 1.00 9.15  ? 490 TYR B CB  1 
ATOM 6951 C CG  . TYR B 1 490 ? -18.402 -40.597 62.150 1.00 7.14  ? 490 TYR B CG  1 
ATOM 6952 C CD1 . TYR B 1 490 ? -17.657 -39.617 61.432 1.00 6.73  ? 490 TYR B CD1 1 
ATOM 6953 C CD2 . TYR B 1 490 ? -18.758 -40.326 63.431 1.00 8.58  ? 490 TYR B CD2 1 
ATOM 6954 C CE1 . TYR B 1 490 ? -17.306 -38.351 62.062 1.00 7.91  ? 490 TYR B CE1 1 
ATOM 6955 C CE2 . TYR B 1 490 ? -18.415 -39.076 64.062 1.00 9.55  ? 490 TYR B CE2 1 
ATOM 6956 C CZ  . TYR B 1 490 ? -17.715 -38.093 63.372 1.00 9.16  ? 490 TYR B CZ  1 
ATOM 6957 O OH  . TYR B 1 490 ? -17.358 -36.927 63.997 1.00 9.25  ? 490 TYR B OH  1 
ATOM 6958 N N   . LEU B 1 491 ? -17.507 -43.568 63.935 1.00 8.28  ? 491 LEU B N   1 
ATOM 6959 C CA  . LEU B 1 491 ? -16.834 -43.565 65.260 1.00 9.61  ? 491 LEU B CA  1 
ATOM 6960 C C   . LEU B 1 491 ? -15.661 -44.575 65.229 1.00 9.34  ? 491 LEU B C   1 
ATOM 6961 O O   . LEU B 1 491 ? -14.649 -44.212 65.857 1.00 11.14 ? 491 LEU B O   1 
ATOM 6962 C CB  . LEU B 1 491 ? -17.816 -43.876 66.398 1.00 8.33  ? 491 LEU B CB  1 
ATOM 6963 C CG  . LEU B 1 491 ? -18.860 -42.797 66.600 1.00 6.92  ? 491 LEU B CG  1 
ATOM 6964 C CD1 . LEU B 1 491 ? -19.977 -43.245 67.571 1.00 10.26 ? 491 LEU B CD1 1 
ATOM 6965 C CD2 . LEU B 1 491 ? -18.232 -41.486 67.191 1.00 9.29  ? 491 LEU B CD2 1 
ATOM 6966 N N   . LEU B 1 492 ? -15.686 -45.666 64.514 1.00 8.82  ? 492 LEU B N   1 
ATOM 6967 C CA  . LEU B 1 492 ? -14.494 -46.537 64.343 1.00 10.39 ? 492 LEU B CA  1 
ATOM 6968 C C   . LEU B 1 492 ? -13.426 -45.678 63.667 1.00 10.50 ? 492 LEU B C   1 
ATOM 6969 O O   . LEU B 1 492 ? -12.244 -45.747 64.057 1.00 10.49 ? 492 LEU B O   1 
ATOM 6970 C CB  . LEU B 1 492 ? -14.794 -47.721 63.412 1.00 10.65 ? 492 LEU B CB  1 
ATOM 6971 C CG  . LEU B 1 492 ? -15.651 -48.858 64.035 1.00 12.92 ? 492 LEU B CG  1 
ATOM 6972 C CD1 . LEU B 1 492 ? -16.128 -49.819 62.989 1.00 14.76 ? 492 LEU B CD1 1 
ATOM 6973 C CD2 . LEU B 1 492 ? -14.660 -49.597 65.004 1.00 16.16 ? 492 LEU B CD2 1 
ATOM 6974 N N   . ASP B 1 493 ? -13.783 -44.860 62.676 1.00 9.43  ? 493 ASP B N   1 
ATOM 6975 C CA  . ASP B 1 493 ? -12.792 -44.077 61.942 1.00 9.80  ? 493 ASP B CA  1 
ATOM 6976 C C   . ASP B 1 493 ? -12.175 -43.079 62.884 1.00 11.25 ? 493 ASP B C   1 
ATOM 6977 O O   . ASP B 1 493 ? -10.914 -42.888 62.822 1.00 13.24 ? 493 ASP B O   1 
ATOM 6978 C CB  . ASP B 1 493 ? -13.494 -43.332 60.758 1.00 9.23  ? 493 ASP B CB  1 
ATOM 6979 C CG  . ASP B 1 493 ? -14.039 -44.232 59.674 1.00 12.01 ? 493 ASP B CG  1 
ATOM 6980 O OD1 . ASP B 1 493 ? -13.574 -45.394 59.536 1.00 11.63 ? 493 ASP B OD1 1 
ATOM 6981 O OD2 . ASP B 1 493 ? -14.871 -43.726 58.855 1.00 13.91 ? 493 ASP B OD2 1 
ATOM 6982 N N   . ARG B 1 494 ? -12.979 -42.426 63.717 1.00 9.38  ? 494 ARG B N   1 
ATOM 6983 C CA  . ARG B 1 494 ? -12.423 -41.391 64.658 1.00 10.76 ? 494 ARG B CA  1 
ATOM 6984 C C   . ARG B 1 494 ? -11.591 -42.056 65.720 1.00 13.41 ? 494 ARG B C   1 
ATOM 6985 O O   . ARG B 1 494 ? -10.536 -41.453 66.109 1.00 14.80 ? 494 ARG B O   1 
ATOM 6986 C CB  . ARG B 1 494 ? -13.551 -40.545 65.299 1.00 12.02 ? 494 ARG B CB  1 
ATOM 6987 C CG  . ARG B 1 494 ? -14.487 -39.864 64.291 1.00 13.68 ? 494 ARG B CG  1 
ATOM 6988 C CD  . ARG B 1 494 ? -13.844 -38.686 63.697 1.00 13.54 ? 494 ARG B CD  1 
ATOM 6989 N NE  . ARG B 1 494 ? -12.801 -39.012 62.689 1.00 13.77 ? 494 ARG B NE  1 
ATOM 6990 C CZ  . ARG B 1 494 ? -13.039 -39.503 61.479 1.00 14.00 ? 494 ARG B CZ  1 
ATOM 6991 N NH1 . ARG B 1 494 ? -14.286 -39.781 61.052 1.00 11.42 ? 494 ARG B NH1 1 
ATOM 6992 N NH2 . ARG B 1 494 ? -12.033 -39.709 60.625 1.00 14.93 ? 494 ARG B NH2 1 
ATOM 6993 N N   . ALA B 1 495 ? -11.998 -43.230 66.191 1.00 12.25 ? 495 ALA B N   1 
ATOM 6994 C CA  . ALA B 1 495 ? -11.250 -43.944 67.219 1.00 13.99 ? 495 ALA B CA  1 
ATOM 6995 C C   . ALA B 1 495 ? -10.043 -44.661 66.625 1.00 19.31 ? 495 ALA B C   1 
ATOM 6996 O O   . ALA B 1 495 ? -9.287  -45.321 67.338 1.00 23.32 ? 495 ALA B O   1 
ATOM 6997 C CB  . ALA B 1 495 ? -12.153 -44.932 67.942 1.00 15.56 ? 495 ALA B CB  1 
ATOM 6998 N N   . GLY B 1 496 ? -9.867  -44.525 65.315 1.00 20.83 ? 496 GLY B N   1 
ATOM 6999 C CA  . GLY B 1 496 ? -8.756  -45.156 64.625 1.00 27.14 ? 496 GLY B CA  1 
ATOM 7000 C C   . GLY B 1 496 ? -8.742  -46.662 64.802 1.00 31.14 ? 496 GLY B C   1 
ATOM 7001 O O   . GLY B 1 496 ? -7.681  -47.269 64.940 1.00 33.50 ? 496 GLY B O   1 
ATOM 7002 N N   . ALA B 1 497 ? -9.927  -47.264 64.801 1.00 34.16 ? 497 ALA B N   1 
ATOM 7003 C CA  . ALA B 1 497 ? -10.053 -48.708 64.962 1.00 35.85 ? 497 ALA B CA  1 
ATOM 7004 C C   . ALA B 1 497 ? -10.066 -49.415 63.611 1.00 36.95 ? 497 ALA B C   1 
ATOM 7005 O O   . ALA B 1 497 ? -10.132 -50.642 63.544 1.00 37.66 ? 497 ALA B O   1 
ATOM 7006 C CB  . ALA B 1 497 ? -11.308 -49.045 65.752 1.00 35.95 ? 497 ALA B CB  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ASP 36  36  36  ASP ASP A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  ILE 43  43  43  ILE ILE A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  TRP 89  89  89  TRP TRP A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ASN 104 104 104 ASN ASN A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 VAL 109 109 109 VAL VAL A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 HIS 123 123 123 HIS HIS A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 VAL 140 140 140 VAL VAL A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 GLN 147 147 ?   ?   ?   A . n 
A 1 148 LYS 148 148 ?   ?   ?   A . n 
A 1 149 VAL 149 149 ?   ?   ?   A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 ASP 162 162 162 ASP ASP A . n 
A 1 163 LYS 163 163 163 LYS LYS A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 GLN 166 166 166 GLN GLN A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 GLU 170 170 170 GLU GLU A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 HIS 175 175 175 HIS HIS A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 ASN 195 195 195 ASN ASN A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 CYS 197 197 197 CYS CYS A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 LEU 202 202 202 LEU LEU A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 GLN 205 205 205 GLN GLN A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 LYS 207 207 207 LYS LYS A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 HIS 213 213 213 HIS HIS A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 LYS 217 217 217 LYS LYS A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 ASP 222 222 222 ASP ASP A . n 
A 1 223 GLU 223 223 223 GLU GLU A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 LYS 225 225 225 LYS LYS A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 PHE 234 234 234 PHE PHE A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 PRO 244 244 244 PRO PRO A . n 
A 1 245 PRO 245 245 245 PRO PRO A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 TYR 252 252 252 TYR TYR A . n 
A 1 253 GLN 253 253 253 GLN GLN A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LYS 256 256 256 LYS LYS A . n 
A 1 257 LYS 257 257 257 LYS LYS A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 PRO 261 261 261 PRO PRO A . n 
A 1 262 PHE 262 262 262 PHE PHE A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 VAL 265 265 265 VAL VAL A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 THR 270 270 ?   ?   ?   A . n 
A 1 271 PHE 271 271 ?   ?   ?   A . n 
A 1 272 ASP 272 272 ?   ?   ?   A . n 
A 1 273 THR 273 273 ?   ?   ?   A . n 
A 1 274 GLY 274 274 ?   ?   ?   A . n 
A 1 275 GLY 275 275 ?   ?   ?   A . n 
A 1 276 ILE 276 276 ?   ?   ?   A . n 
A 1 277 SER 277 277 ?   ?   ?   A . n 
A 1 278 LEU 278 278 ?   ?   ?   A . n 
A 1 279 LYS 279 279 ?   ?   ?   A . n 
A 1 280 PRO 280 280 ?   ?   ?   A . n 
A 1 281 GLY 281 281 ?   ?   ?   A . n 
A 1 282 ALA 282 282 ?   ?   ?   A . n 
A 1 283 GLY 283 283 ?   ?   ?   A . n 
A 1 284 MET 284 284 ?   ?   ?   A . n 
A 1 285 ASP 285 285 ?   ?   ?   A . n 
A 1 286 GLU 286 286 ?   ?   ?   A . n 
A 1 287 MET 287 287 ?   ?   ?   A . n 
A 1 288 LYS 288 288 ?   ?   ?   A . n 
A 1 289 TYR 289 289 ?   ?   ?   A . n 
A 1 290 ASP 290 290 ?   ?   ?   A . n 
A 1 291 MET 291 291 291 MET MET A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 ARG 302 302 302 ARG ARG A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 GLN 308 308 308 GLN GLN A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 PRO 310 310 310 PRO PRO A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASN 312 312 312 ASN ASN A . n 
A 1 313 LEU 313 313 313 LEU LEU A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 CYS 315 315 315 CYS CYS A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 LEU 317 317 317 LEU LEU A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 CYS 319 319 319 CYS CYS A . n 
A 1 320 ALA 320 320 320 ALA ALA A . n 
A 1 321 GLU 321 321 321 GLU GLU A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 MET 323 323 323 MET MET A . n 
A 1 324 PRO 324 324 324 PRO PRO A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 GLY 327 327 327 GLY GLY A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 ILE 334 334 334 ILE ILE A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 THR 336 336 336 THR THR A . n 
A 1 337 THR 337 337 337 THR THR A . n 
A 1 338 MET 338 338 338 MET MET A . n 
A 1 339 SER 339 339 339 SER SER A . n 
A 1 340 GLY 340 340 340 GLY GLY A . n 
A 1 341 GLN 341 341 341 GLN GLN A . n 
A 1 342 THR 342 342 342 THR THR A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 LEU 346 346 346 LEU LEU A . n 
A 1 347 ASN 347 347 347 ASN ASN A . n 
A 1 348 THR 348 348 348 THR THR A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 VAL 355 355 355 VAL VAL A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 CYS 357 357 357 CYS CYS A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 THR 361 361 361 THR THR A . n 
A 1 362 TYR 362 362 362 TYR TYR A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 PHE 366 366 366 PHE PHE A . n 
A 1 367 LYS 367 367 367 LYS LYS A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 ASP 373 373 373 ASP ASP A . n 
A 1 374 ILE 374 374 374 ILE ILE A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 THR 378 378 378 THR THR A . n 
A 1 379 GLY 379 379 379 GLY GLY A . n 
A 1 380 ALA 380 380 380 ALA ALA A . n 
A 1 381 CYS 381 381 381 CYS CYS A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 LEU 385 385 385 LEU LEU A . n 
A 1 386 GLY 386 386 386 GLY GLY A . n 
A 1 387 SER 387 387 387 SER SER A . n 
A 1 388 HIS 388 388 388 HIS HIS A . n 
A 1 389 THR 389 389 389 THR THR A . n 
A 1 390 THR 390 390 390 THR THR A . n 
A 1 391 GLY 391 391 391 GLY GLY A . n 
A 1 392 LEU 392 392 392 LEU LEU A . n 
A 1 393 MET 393 393 393 MET MET A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 ASN 395 395 395 ASN ASN A . n 
A 1 396 ASN 396 396 396 ASN ASN A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 ASP 398 398 398 ASP ASP A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 GLY 401 401 401 GLY GLY A . n 
A 1 402 GLN 402 402 402 GLN GLN A . n 
A 1 403 LEU 403 403 403 LEU LEU A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 ASP 405 405 405 ASP ASP A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 ARG 409 409 409 ARG ARG A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 ASP 412 412 412 ASP ASP A . n 
A 1 413 ARG 413 413 413 ARG ARG A . n 
A 1 414 ALA 414 414 414 ALA ALA A . n 
A 1 415 TRP 415 415 415 TRP TRP A . n 
A 1 416 GLN 416 416 416 GLN GLN A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 PRO 418 418 418 PRO PRO A . n 
A 1 419 LEU 419 419 419 LEU LEU A . n 
A 1 420 PHE 420 420 420 PHE PHE A . n 
A 1 421 ASP 421 421 421 ASP ASP A . n 
A 1 422 GLU 422 422 422 GLU GLU A . n 
A 1 423 TYR 423 423 423 TYR TYR A . n 
A 1 424 GLN 424 424 424 GLN GLN A . n 
A 1 425 GLU 425 425 425 GLU GLU A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 LEU 427 427 427 LEU LEU A . n 
A 1 428 ASP 428 428 428 ASP ASP A . n 
A 1 429 SER 429 429 429 SER SER A . n 
A 1 430 PRO 430 430 430 PRO PRO A . n 
A 1 431 PHE 431 431 431 PHE PHE A . n 
A 1 432 ALA 432 432 432 ALA ALA A . n 
A 1 433 ASP 433 433 433 ASP ASP A . n 
A 1 434 MET 434 434 434 MET MET A . n 
A 1 435 GLY 435 435 435 GLY GLY A . n 
A 1 436 ASN 436 436 436 ASN ASN A . n 
A 1 437 ILE 437 437 437 ILE ILE A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LYS 441 441 441 LYS LYS A . n 
A 1 442 ALA 442 442 442 ALA ALA A . n 
A 1 443 GLY 443 443 443 GLY GLY A . n 
A 1 444 THR 444 444 444 THR THR A . n 
A 1 445 ILE 445 445 445 ILE ILE A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 ALA 447 447 447 ALA ALA A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 CYS 449 449 449 CYS CYS A . n 
A 1 450 PHE 450 450 450 PHE PHE A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 SER 452 452 452 SER SER A . n 
A 1 453 ARG 453 453 453 ARG ARG A . n 
A 1 454 PHE 454 454 454 PHE PHE A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 LYS 456 456 456 LYS LYS A . n 
A 1 457 ALA 457 457 457 ALA ALA A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 ASN 459 459 459 ASN ASN A . n 
A 1 460 TRP 460 460 460 TRP TRP A . n 
A 1 461 ALA 461 461 461 ALA ALA A . n 
A 1 462 HIS 462 462 462 HIS HIS A . n 
A 1 463 MET 463 463 463 MET MET A . n 
A 1 464 ASP 464 464 464 ASP ASP A . n 
A 1 465 ILE 465 465 465 ILE ILE A . n 
A 1 466 ALA 466 466 466 ALA ALA A . n 
A 1 467 GLY 467 467 467 GLY GLY A . n 
A 1 468 THR 468 468 468 THR THR A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 SER 472 472 472 SER SER A . n 
A 1 473 GLY 473 473 473 GLY GLY A . n 
A 1 474 GLY 474 474 474 GLY GLY A . n 
A 1 475 LYS 475 475 475 LYS LYS A . n 
A 1 476 ASP 476 476 476 ASP ASP A . n 
A 1 477 LYS 477 477 477 LYS LYS A . n 
A 1 478 GLY 478 478 478 GLY GLY A . n 
A 1 479 ALA 479 479 479 ALA ALA A . n 
A 1 480 THR 480 480 480 THR THR A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 PRO 483 483 483 PRO PRO A . n 
A 1 484 VAL 484 484 484 VAL VAL A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 LEU 487 487 487 LEU LEU A . n 
A 1 488 THR 488 488 488 THR THR A . n 
A 1 489 GLN 489 489 489 GLN GLN A . n 
A 1 490 TYR 490 490 490 TYR TYR A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 ASP 493 493 493 ASP ASP A . n 
A 1 494 ARG 494 494 494 ARG ARG A . n 
A 1 495 ALA 495 495 495 ALA ALA A . n 
A 1 496 GLY 496 496 496 GLY GLY A . n 
A 1 497 ALA 497 497 497 ALA ALA A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   LEU 3   3   3   LEU LEU B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   SER 7   7   7   SER SER B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   ALA 9   9   9   ALA ALA B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  ALA 11  11  11  ALA ALA B . n 
B 1 12  SER 12  12  12  SER SER B . n 
B 1 13  VAL 13  13  13  VAL VAL B . n 
B 1 14  LYS 14  14  14  LYS LYS B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  THR 17  17  17  THR THR B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  GLU 24  24  24  GLU GLU B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLY 29  29  29  GLY GLY B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  ALA 32  32  32  ALA ALA B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  ASP 36  36  36  ASP ASP B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  SER 39  39  39  SER SER B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  ALA 42  42  42  ALA ALA B . n 
B 1 43  ILE 43  43  43  ILE ILE B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  ASP 51  51  51  ASP ASP B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  ALA 53  53  53  ALA ALA B . n 
B 1 54  GLY 54  54  54  GLY GLY B . n 
B 1 55  LYS 55  55  55  LYS LYS B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  GLN 58  58  58  GLN GLN B . n 
B 1 59  THR 59  59  59  THR THR B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  LEU 61  61  61  LEU LEU B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  LEU 65  65  65  LEU LEU B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  LYS 69  69  69  LYS LYS B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  GLU 71  71  71  GLU GLU B . n 
B 1 72  ARG 72  72  72  ARG ARG B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  SER 78  78  78  SER SER B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  LYS 80  80  80  LYS LYS B . n 
B 1 81  ASP 81  81  81  ASP ASP B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  LEU 84  84  84  LEU LEU B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  ARG 87  87  87  ARG ARG B . n 
B 1 88  THR 88  88  88  THR THR B . n 
B 1 89  TRP 89  89  89  TRP TRP B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  LYS 91  91  91  LYS LYS B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  SER 95  95  95  SER SER B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  ALA 97  97  97  ALA ALA B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 LEU 100 100 100 LEU LEU B . n 
B 1 101 LYS 101 101 101 LYS LYS B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 ASN 104 104 104 ASN ASN B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 VAL 109 109 109 VAL VAL B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 LEU 112 112 112 LEU LEU B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 ASP 114 114 114 ASP ASP B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 ASN 119 119 119 ASN ASN B . n 
B 1 120 ARG 120 120 120 ARG ARG B . n 
B 1 121 ASP 121 121 121 ASP ASP B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 HIS 123 123 123 HIS HIS B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 GLY 125 125 125 GLY GLY B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 TYR 127 127 127 TYR TYR B . n 
B 1 128 ARG 128 128 128 ARG ARG B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ALA 131 131 131 ALA ALA B . n 
B 1 132 GLU 132 132 132 GLU GLU B . n 
B 1 133 THR 133 133 133 THR THR B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 TYR 139 139 139 TYR TYR B . n 
B 1 140 VAL 140 140 140 VAL VAL B . n 
B 1 141 PHE 141 141 141 PHE PHE B . n 
B 1 142 ASP 142 142 142 ASP ASP B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 LYS 145 145 145 LYS LYS B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 GLN 147 147 ?   ?   ?   B . n 
B 1 148 LYS 148 148 ?   ?   ?   B . n 
B 1 149 VAL 149 149 ?   ?   ?   B . n 
B 1 150 GLU 150 150 150 GLU GLU B . n 
B 1 151 PRO 151 151 151 PRO PRO B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 LEU 154 154 154 LEU LEU B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 ASP 162 162 162 ASP ASP B . n 
B 1 163 LYS 163 163 163 LYS LYS B . n 
B 1 164 ALA 164 164 164 ALA ALA B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 GLN 166 166 166 GLN GLN B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 GLU 168 168 168 GLU GLU B . n 
B 1 169 VAL 169 169 169 VAL VAL B . n 
B 1 170 GLU 170 170 170 GLU GLU B . n 
B 1 171 ARG 171 171 171 ARG ARG B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 VAL 173 173 173 VAL VAL B . n 
B 1 174 LYS 174 174 174 LYS LYS B . n 
B 1 175 HIS 175 175 175 HIS HIS B . n 
B 1 176 ALA 176 176 176 ALA ALA B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 ILE 179 179 179 ILE ILE B . n 
B 1 180 ALA 180 180 180 ALA ALA B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 GLY 182 182 182 GLY GLY B . n 
B 1 183 MET 183 183 183 MET MET B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 PHE 185 185 185 PHE PHE B . n 
B 1 186 THR 186 186 186 THR THR B . n 
B 1 187 ARG 187 187 187 ARG ARG B . n 
B 1 188 ASP 188 188 188 ASP ASP B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 GLY 190 190 190 GLY GLY B . n 
B 1 191 ASN 191 191 191 ASN ASN B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 PRO 193 193 193 PRO PRO B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 ASN 195 195 195 ASN ASN B . n 
B 1 196 LEU 196 196 196 LEU LEU B . n 
B 1 197 CYS 197 197 197 CYS CYS B . n 
B 1 198 HIS 198 198 198 HIS HIS B . n 
B 1 199 PRO 199 199 199 PRO PRO B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 PHE 201 201 201 PHE PHE B . n 
B 1 202 LEU 202 202 202 LEU LEU B . n 
B 1 203 ALA 203 203 203 ALA ALA B . n 
B 1 204 GLU 204 204 204 GLU GLU B . n 
B 1 205 GLN 205 205 205 GLN GLN B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 LYS 207 207 207 LYS LYS B . n 
B 1 208 GLU 208 208 208 GLU GLU B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 HIS 213 213 213 HIS HIS B . n 
B 1 214 LYS 214 214 214 LYS LYS B . n 
B 1 215 ALA 215 215 215 ALA ALA B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 LYS 217 217 217 LYS LYS B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 GLU 219 219 219 GLU GLU B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 ASP 222 222 222 ASP ASP B . n 
B 1 223 GLU 223 223 223 GLU GLU B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 LYS 225 225 225 LYS LYS B . n 
B 1 226 ILE 226 226 226 ILE ILE B . n 
B 1 227 LYS 227 227 227 LYS LYS B . n 
B 1 228 ASP 228 228 228 ASP ASP B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 MET 231 231 231 MET MET B . n 
B 1 232 GLY 232 232 232 GLY GLY B . n 
B 1 233 ALA 233 233 233 ALA ALA B . n 
B 1 234 PHE 234 234 234 PHE PHE B . n 
B 1 235 TYR 235 235 235 TYR TYR B . n 
B 1 236 ALA 236 236 236 ALA ALA B . n 
B 1 237 VAL 237 237 237 VAL VAL B . n 
B 1 238 GLY 238 238 238 GLY GLY B . n 
B 1 239 GLN 239 239 239 GLN GLN B . n 
B 1 240 GLY 240 240 240 GLY GLY B . n 
B 1 241 SER 241 241 241 SER SER B . n 
B 1 242 ASP 242 242 242 ASP ASP B . n 
B 1 243 GLN 243 243 243 GLN GLN B . n 
B 1 244 PRO 244 244 244 PRO PRO B . n 
B 1 245 PRO 245 245 245 PRO PRO B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 ILE 248 248 248 ILE ILE B . n 
B 1 249 VAL 249 249 249 VAL VAL B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 ASN 251 251 251 ASN ASN B . n 
B 1 252 TYR 252 252 252 TYR TYR B . n 
B 1 253 GLN 253 253 253 GLN GLN B . n 
B 1 254 GLY 254 254 254 GLY GLY B . n 
B 1 255 GLY 255 255 255 GLY GLY B . n 
B 1 256 LYS 256 256 256 LYS LYS B . n 
B 1 257 LYS 257 257 257 LYS LYS B . n 
B 1 258 ALA 258 258 258 ALA ALA B . n 
B 1 259 ASP 259 259 259 ASP ASP B . n 
B 1 260 LYS 260 260 260 LYS LYS B . n 
B 1 261 PRO 261 261 261 PRO PRO B . n 
B 1 262 PHE 262 262 262 PHE PHE B . n 
B 1 263 VAL 263 263 263 VAL VAL B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 VAL 265 265 265 VAL VAL B . n 
B 1 266 GLY 266 266 266 GLY GLY B . n 
B 1 267 LYS 267 267 267 LYS LYS B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 ILE 269 269 269 ILE ILE B . n 
B 1 270 THR 270 270 ?   ?   ?   B . n 
B 1 271 PHE 271 271 ?   ?   ?   B . n 
B 1 272 ASP 272 272 ?   ?   ?   B . n 
B 1 273 THR 273 273 ?   ?   ?   B . n 
B 1 274 GLY 274 274 ?   ?   ?   B . n 
B 1 275 GLY 275 275 ?   ?   ?   B . n 
B 1 276 ILE 276 276 ?   ?   ?   B . n 
B 1 277 SER 277 277 ?   ?   ?   B . n 
B 1 278 LEU 278 278 ?   ?   ?   B . n 
B 1 279 LYS 279 279 ?   ?   ?   B . n 
B 1 280 PRO 280 280 ?   ?   ?   B . n 
B 1 281 GLY 281 281 ?   ?   ?   B . n 
B 1 282 ALA 282 282 ?   ?   ?   B . n 
B 1 283 GLY 283 283 ?   ?   ?   B . n 
B 1 284 MET 284 284 ?   ?   ?   B . n 
B 1 285 ASP 285 285 ?   ?   ?   B . n 
B 1 286 GLU 286 286 ?   ?   ?   B . n 
B 1 287 MET 287 287 ?   ?   ?   B . n 
B 1 288 LYS 288 288 ?   ?   ?   B . n 
B 1 289 TYR 289 289 ?   ?   ?   B . n 
B 1 290 ASP 290 290 ?   ?   ?   B . n 
B 1 291 MET 291 291 291 MET MET B . n 
B 1 292 CYS 292 292 292 CYS CYS B . n 
B 1 293 GLY 293 293 293 GLY GLY B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 ALA 295 295 295 ALA ALA B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 VAL 297 297 297 VAL VAL B . n 
B 1 298 PHE 298 298 298 PHE PHE B . n 
B 1 299 GLY 299 299 299 GLY GLY B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 ARG 302 302 302 ARG ARG B . n 
B 1 303 ALA 303 303 303 ALA ALA B . n 
B 1 304 VAL 304 304 304 VAL VAL B . n 
B 1 305 LEU 305 305 305 LEU LEU B . n 
B 1 306 GLU 306 306 306 GLU GLU B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 GLN 308 308 308 GLN GLN B . n 
B 1 309 LEU 309 309 309 LEU LEU B . n 
B 1 310 PRO 310 310 310 PRO PRO B . n 
B 1 311 VAL 311 311 311 VAL VAL B . n 
B 1 312 ASN 312 312 312 ASN ASN B . n 
B 1 313 LEU 313 313 313 LEU LEU B . n 
B 1 314 VAL 314 314 314 VAL VAL B . n 
B 1 315 CYS 315 315 315 CYS CYS B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 LEU 317 317 317 LEU LEU B . n 
B 1 318 ALA 318 318 318 ALA ALA B . n 
B 1 319 CYS 319 319 319 CYS CYS B . n 
B 1 320 ALA 320 320 320 ALA ALA B . n 
B 1 321 GLU 321 321 321 GLU GLU B . n 
B 1 322 ASN 322 322 322 ASN ASN B . n 
B 1 323 MET 323 323 323 MET MET B . n 
B 1 324 PRO 324 324 324 PRO PRO B . n 
B 1 325 SER 325 325 325 SER SER B . n 
B 1 326 GLY 326 326 326 GLY GLY B . n 
B 1 327 GLY 327 327 327 GLY GLY B . n 
B 1 328 ALA 328 328 328 ALA ALA B . n 
B 1 329 THR 329 329 329 THR THR B . n 
B 1 330 ARG 330 330 330 ARG ARG B . n 
B 1 331 PRO 331 331 331 PRO PRO B . n 
B 1 332 GLY 332 332 332 GLY GLY B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 ILE 334 334 334 ILE ILE B . n 
B 1 335 VAL 335 335 335 VAL VAL B . n 
B 1 336 THR 336 336 336 THR THR B . n 
B 1 337 THR 337 337 337 THR THR B . n 
B 1 338 MET 338 338 338 MET MET B . n 
B 1 339 SER 339 339 339 SER SER B . n 
B 1 340 GLY 340 340 340 GLY GLY B . n 
B 1 341 GLN 341 341 341 GLN GLN B . n 
B 1 342 THR 342 342 342 THR THR B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 GLU 344 344 344 GLU GLU B . n 
B 1 345 ILE 345 345 345 ILE ILE B . n 
B 1 346 LEU 346 346 346 LEU LEU B . n 
B 1 347 ASN 347 347 347 ASN ASN B . n 
B 1 348 THR 348 348 348 THR THR B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 GLY 352 352 352 GLY GLY B . n 
B 1 353 ARG 353 353 353 ARG ARG B . n 
B 1 354 LEU 354 354 354 LEU LEU B . n 
B 1 355 VAL 355 355 355 VAL VAL B . n 
B 1 356 LEU 356 356 356 LEU LEU B . n 
B 1 357 CYS 357 357 357 CYS CYS B . n 
B 1 358 ASP 358 358 358 ASP ASP B . n 
B 1 359 THR 359 359 359 THR THR B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 THR 361 361 361 THR THR B . n 
B 1 362 TYR 362 362 362 TYR TYR B . n 
B 1 363 ALA 363 363 363 ALA ALA B . n 
B 1 364 GLU 364 364 364 GLU GLU B . n 
B 1 365 ARG 365 365 365 ARG ARG B . n 
B 1 366 PHE 366 366 366 PHE PHE B . n 
B 1 367 LYS 367 367 367 LYS LYS B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 VAL 371 371 371 VAL VAL B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 ASP 373 373 373 ASP ASP B . n 
B 1 374 ILE 374 374 374 ILE ILE B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 THR 376 376 376 THR THR B . n 
B 1 377 LEU 377 377 377 LEU LEU B . n 
B 1 378 THR 378 378 378 THR THR B . n 
B 1 379 GLY 379 379 379 GLY GLY B . n 
B 1 380 ALA 380 380 380 ALA ALA B . n 
B 1 381 CYS 381 381 381 CYS CYS B . n 
B 1 382 ILE 382 382 382 ILE ILE B . n 
B 1 383 VAL 383 383 383 VAL VAL B . n 
B 1 384 ALA 384 384 384 ALA ALA B . n 
B 1 385 LEU 385 385 385 LEU LEU B . n 
B 1 386 GLY 386 386 386 GLY GLY B . n 
B 1 387 SER 387 387 387 SER SER B . n 
B 1 388 HIS 388 388 388 HIS HIS B . n 
B 1 389 THR 389 389 389 THR THR B . n 
B 1 390 THR 390 390 390 THR THR B . n 
B 1 391 GLY 391 391 391 GLY GLY B . n 
B 1 392 LEU 392 392 392 LEU LEU B . n 
B 1 393 MET 393 393 393 MET MET B . n 
B 1 394 GLY 394 394 394 GLY GLY B . n 
B 1 395 ASN 395 395 395 ASN ASN B . n 
B 1 396 ASN 396 396 396 ASN ASN B . n 
B 1 397 ASP 397 397 397 ASP ASP B . n 
B 1 398 ASP 398 398 398 ASP ASP B . n 
B 1 399 LEU 399 399 399 LEU LEU B . n 
B 1 400 VAL 400 400 400 VAL VAL B . n 
B 1 401 GLY 401 401 401 GLY GLY B . n 
B 1 402 GLN 402 402 402 GLN GLN B . n 
B 1 403 LEU 403 403 403 LEU LEU B . n 
B 1 404 LEU 404 404 404 LEU LEU B . n 
B 1 405 ASP 405 405 405 ASP ASP B . n 
B 1 406 ALA 406 406 406 ALA ALA B . n 
B 1 407 GLY 407 407 407 GLY GLY B . n 
B 1 408 LYS 408 408 408 LYS LYS B . n 
B 1 409 ARG 409 409 409 ARG ARG B . n 
B 1 410 ALA 410 410 410 ALA ALA B . n 
B 1 411 ASP 411 411 411 ASP ASP B . n 
B 1 412 ASP 412 412 412 ASP ASP B . n 
B 1 413 ARG 413 413 413 ARG ARG B . n 
B 1 414 ALA 414 414 414 ALA ALA B . n 
B 1 415 TRP 415 415 415 TRP TRP B . n 
B 1 416 GLN 416 416 416 GLN GLN B . n 
B 1 417 LEU 417 417 417 LEU LEU B . n 
B 1 418 PRO 418 418 418 PRO PRO B . n 
B 1 419 LEU 419 419 419 LEU LEU B . n 
B 1 420 PHE 420 420 420 PHE PHE B . n 
B 1 421 ASP 421 421 421 ASP ASP B . n 
B 1 422 GLU 422 422 422 GLU GLU B . n 
B 1 423 TYR 423 423 423 TYR TYR B . n 
B 1 424 GLN 424 424 424 GLN GLN B . n 
B 1 425 GLU 425 425 425 GLU GLU B . n 
B 1 426 GLN 426 426 426 GLN GLN B . n 
B 1 427 LEU 427 427 427 LEU LEU B . n 
B 1 428 ASP 428 428 428 ASP ASP B . n 
B 1 429 SER 429 429 429 SER SER B . n 
B 1 430 PRO 430 430 430 PRO PRO B . n 
B 1 431 PHE 431 431 431 PHE PHE B . n 
B 1 432 ALA 432 432 432 ALA ALA B . n 
B 1 433 ASP 433 433 433 ASP ASP B . n 
B 1 434 MET 434 434 434 MET MET B . n 
B 1 435 GLY 435 435 435 GLY GLY B . n 
B 1 436 ASN 436 436 436 ASN ASN B . n 
B 1 437 ILE 437 437 437 ILE ILE B . n 
B 1 438 GLY 438 438 438 GLY GLY B . n 
B 1 439 GLY 439 439 439 GLY GLY B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LYS 441 441 441 LYS LYS B . n 
B 1 442 ALA 442 442 442 ALA ALA B . n 
B 1 443 GLY 443 443 443 GLY GLY B . n 
B 1 444 THR 444 444 444 THR THR B . n 
B 1 445 ILE 445 445 445 ILE ILE B . n 
B 1 446 THR 446 446 446 THR THR B . n 
B 1 447 ALA 447 447 447 ALA ALA B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 CYS 449 449 449 CYS CYS B . n 
B 1 450 PHE 450 450 450 PHE PHE B . n 
B 1 451 LEU 451 451 451 LEU LEU B . n 
B 1 452 SER 452 452 452 SER SER B . n 
B 1 453 ARG 453 453 453 ARG ARG B . n 
B 1 454 PHE 454 454 454 PHE PHE B . n 
B 1 455 ALA 455 455 455 ALA ALA B . n 
B 1 456 LYS 456 456 456 LYS LYS B . n 
B 1 457 ALA 457 457 457 ALA ALA B . n 
B 1 458 TYR 458 458 458 TYR TYR B . n 
B 1 459 ASN 459 459 459 ASN ASN B . n 
B 1 460 TRP 460 460 460 TRP TRP B . n 
B 1 461 ALA 461 461 461 ALA ALA B . n 
B 1 462 HIS 462 462 462 HIS HIS B . n 
B 1 463 MET 463 463 463 MET MET B . n 
B 1 464 ASP 464 464 464 ASP ASP B . n 
B 1 465 ILE 465 465 465 ILE ILE B . n 
B 1 466 ALA 466 466 466 ALA ALA B . n 
B 1 467 GLY 467 467 467 GLY GLY B . n 
B 1 468 THR 468 468 468 THR THR B . n 
B 1 469 ALA 469 469 469 ALA ALA B . n 
B 1 470 TRP 470 470 470 TRP TRP B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 SER 472 472 472 SER SER B . n 
B 1 473 GLY 473 473 473 GLY GLY B . n 
B 1 474 GLY 474 474 474 GLY GLY B . n 
B 1 475 LYS 475 475 475 LYS LYS B . n 
B 1 476 ASP 476 476 476 ASP ASP B . n 
B 1 477 LYS 477 477 477 LYS LYS B . n 
B 1 478 GLY 478 478 478 GLY GLY B . n 
B 1 479 ALA 479 479 479 ALA ALA B . n 
B 1 480 THR 480 480 480 THR THR B . n 
B 1 481 GLY 481 481 481 GLY GLY B . n 
B 1 482 ARG 482 482 482 ARG ARG B . n 
B 1 483 PRO 483 483 483 PRO PRO B . n 
B 1 484 VAL 484 484 484 VAL VAL B . n 
B 1 485 PRO 485 485 485 PRO PRO B . n 
B 1 486 LEU 486 486 486 LEU LEU B . n 
B 1 487 LEU 487 487 487 LEU LEU B . n 
B 1 488 THR 488 488 488 THR THR B . n 
B 1 489 GLN 489 489 489 GLN GLN B . n 
B 1 490 TYR 490 490 490 TYR TYR B . n 
B 1 491 LEU 491 491 491 LEU LEU B . n 
B 1 492 LEU 492 492 492 LEU LEU B . n 
B 1 493 ASP 493 493 493 ASP ASP B . n 
B 1 494 ARG 494 494 494 ARG ARG B . n 
B 1 495 ALA 495 495 495 ALA ALA B . n 
B 1 496 GLY 496 496 496 GLY GLY B . n 
B 1 497 ALA 497 497 497 ALA ALA B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA hexameric 6 
2 software_defined_assembly            PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3 A,B 
2 1     A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 18580  ? 
1 MORE         -43    ? 
1 'SSA (A^2)'  102490 ? 
2 'ABSA (A^2)' 2350   ? 
2 MORE         -10    ? 
2 'SSA (A^2)'  38000  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000    0.0000000000  
1.0000000000  0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_455 -y-1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 -116.9460000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_445 -x+y-1,-x-1,z -0.5000000000 0.8660254038  0.0000000000 -58.4730000000  -0.8660254038 
-0.5000000000 0.0000000000 -101.2782068710 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-04-14 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Structure summary'         
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            audit_author 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_audit_author.name' 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             2.750 
_diffrn_reflns.pdbx_d_res_low              101.535 
_diffrn_reflns.pdbx_number_obs             27855 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.080 
_diffrn_reflns.pdbx_Rsym_value             0.080 
_diffrn_reflns.pdbx_chi_squared            ? 
_diffrn_reflns.av_sigmaI_over_netI         8.60 
_diffrn_reflns.pdbx_redundancy             4.00 
_diffrn_reflns.pdbx_percent_possible_obs   100.00 
_diffrn_reflns.number                      111116 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 8.70 58.52 ? ? 0.033 0.033 ? 3.90 99.50  
1 6.15 8.70  ? ? 0.038 0.038 ? 4.00 100.00 
1 5.02 6.15  ? ? 0.045 0.045 ? 4.00 100.00 
1 4.35 5.02  ? ? 0.045 0.045 ? 4.00 100.00 
1 3.89 4.35  ? ? 0.055 0.055 ? 4.00 100.00 
1 3.55 3.89  ? ? 0.075 0.075 ? 4.00 100.00 
1 3.29 3.55  ? ? 0.113 0.113 ? 4.00 100.00 
1 3.07 3.29  ? ? 0.162 0.162 ? 4.00 100.00 
1 2.90 3.07  ? ? 0.242 0.242 ? 4.00 100.00 
1 2.75 2.90  ? ? 0.353 0.353 ? 3.90 100.00 
# 
_pdbx_phasing_MR.entry_id                     3H8E 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.750 
_pdbx_phasing_MR.d_res_low_rotation           58.470 
_pdbx_phasing_MR.d_res_high_translation       2.750 
_pdbx_phasing_MR.d_res_low_translation        58.470 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
SCALA       .       ?                other   'Phil Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/INDEX.html  Fortran_77 ? 1 
PHASER      .       ?                other   'R. J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 2 
CNS         .       ?                package 'Axel T. Brunger' axel.brunger@yale.edu       refinement        
http://cns.csb.yale.edu/v1.1/               Fortran_77 ? 3 
PDB_EXTRACT 2.000   'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/            C++        ? 4 
ADSC        Quantum ?                ?       ?                 ?                           'data collection' ? ?          ? 5 
MOSFLM      .       ?                ?       ?                 ?                           'data reduction'  ? ?          ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CD1 A LEU 202 ? ? CE  A MET 291 ? ? 0.93 
2 1 CD1 A LEU 202 ? ? SD  A MET 291 ? ? 1.80 
3 1 OD2 B ASP 412 ? ? O   B ARG 482 ? ? 1.98 
4 1 CD1 B ILE 226 ? ? CE2 B PHE 234 ? ? 1.98 
5 1 CZ  A PHE 262 ? ? NE2 A GLN 369 ? ? 2.09 
6 1 CG2 B ILE 471 ? ? O   B GLY 473 ? ? 2.14 
7 1 CD1 A ILE 226 ? ? CE2 A PHE 234 ? ? 2.15 
8 1 NE2 B GLN 424 ? ? SG  B CYS 449 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 CB  A THR 336 ? ? 1_555 CE  B LYS 214 ? ? 4_444 0.56 
2  1 CE  B LYS 163 ? ? 1_555 O   B ALA 164 ? ? 2_445 1.27 
3  1 CB  A THR 336 ? ? 1_555 NZ  B LYS 214 ? ? 4_444 1.56 
4  1 OG1 A THR 336 ? ? 1_555 CE  B LYS 214 ? ? 4_444 1.60 
5  1 NE2 A GLN 63  ? ? 1_555 NH2 B ARG 49  ? ? 2_455 1.64 
6  1 CG2 A THR 336 ? ? 1_555 CE  B LYS 214 ? ? 4_444 1.65 
7  1 OG1 A THR 336 ? ? 1_555 CD  B LYS 214 ? ? 4_444 1.69 
8  1 N   A THR 336 ? ? 1_555 NZ  B LYS 214 ? ? 4_444 1.81 
9  1 CB  A THR 336 ? ? 1_555 CD  B LYS 214 ? ? 4_444 1.89 
10 1 CA  A THR 336 ? ? 1_555 NZ  B LYS 214 ? ? 4_444 1.94 
11 1 OG1 A THR 336 ? ? 1_555 NZ  B LYS 214 ? ? 4_444 2.02 
12 1 CA  A THR 336 ? ? 1_555 CE  B LYS 214 ? ? 4_444 2.03 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD  A PRO 151 ? ? N   A PRO 151 ? ? 1.385 1.474 -0.089 0.014 N 
2 1 CD1 A TYR 235 ? ? CE1 A TYR 235 ? ? 1.553 1.389 0.164  0.015 N 
3 1 CD  A PRO 310 ? ? N   A PRO 310 ? ? 1.326 1.474 -0.148 0.014 N 
4 1 CB  B SER 12  ? ? OG  B SER 12  ? ? 1.498 1.418 0.080  0.013 N 
5 1 CB  B SER 95  ? ? OG  B SER 95  ? ? 1.498 1.418 0.080  0.013 N 
6 1 CD1 B PHE 185 ? ? CE1 B PHE 185 ? ? 1.520 1.388 0.132  0.020 N 
7 1 CD1 B TYR 235 ? ? CE1 B TYR 235 ? ? 1.496 1.389 0.107  0.015 N 
8 1 CD  B PRO 245 ? ? N   B PRO 245 ? ? 1.371 1.474 -0.103 0.014 N 
9 1 CD  B PRO 324 ? ? N   B PRO 324 ? ? 1.374 1.474 -0.100 0.014 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG A MET 1   ? ? SD  A MET 1   ? ? CE  A MET 1   ? ? 109.81 100.20 9.61   1.60 N 
2  1 NE A ARG 49  ? ? CZ  A ARG 49  ? ? NH2 A ARG 49  ? ? 123.50 120.30 3.20   0.50 N 
3  1 NE A ARG 90  ? ? CZ  A ARG 90  ? ? NH2 A ARG 90  ? ? 116.45 120.30 -3.85  0.50 N 
4  1 CB A ASP 114 ? ? CG  A ASP 114 ? ? OD1 A ASP 114 ? ? 124.96 118.30 6.66   0.90 N 
5  1 NE A ARG 120 ? ? CZ  A ARG 120 ? ? NH2 A ARG 120 ? ? 117.24 120.30 -3.06  0.50 N 
6  1 CB A TYR 139 ? ? CG  A TYR 139 ? ? CD1 A TYR 139 ? ? 116.81 121.00 -4.19  0.60 N 
7  1 CA A PRO 151 ? ? N   A PRO 151 ? ? CD  A PRO 151 ? ? 99.62  111.70 -12.08 1.40 N 
8  1 CB A PHE 185 ? ? CG  A PHE 185 ? ? CD2 A PHE 185 ? ? 115.82 120.80 -4.98  0.70 N 
9  1 CB A PHE 185 ? ? CG  A PHE 185 ? ? CD1 A PHE 185 ? ? 126.13 120.80 5.33   0.70 N 
10 1 CA A PRO 199 ? ? N   A PRO 199 ? ? CD  A PRO 199 ? ? 100.29 111.70 -11.41 1.40 N 
11 1 CB A ASP 222 ? ? CG  A ASP 222 ? ? OD1 A ASP 222 ? ? 125.70 118.30 7.40   0.90 N 
12 1 CB A ASP 228 ? ? CG  A ASP 228 ? ? OD2 A ASP 228 ? ? 111.13 118.30 -7.17  0.90 N 
13 1 CB A PHE 234 ? ? CG  A PHE 234 ? ? CD1 A PHE 234 ? ? 116.06 120.80 -4.74  0.70 N 
14 1 CB A TYR 235 ? ? CG  A TYR 235 ? ? CD2 A TYR 235 ? ? 116.01 121.00 -4.99  0.60 N 
15 1 CG A TYR 235 ? ? CD1 A TYR 235 ? ? CE1 A TYR 235 ? ? 113.71 121.30 -7.59  0.80 N 
16 1 CA A PRO 244 ? ? N   A PRO 244 ? ? CD  A PRO 244 ? ? 101.04 111.70 -10.66 1.40 N 
17 1 CA A PRO 245 ? ? N   A PRO 245 ? ? CD  A PRO 245 ? ? 100.62 111.70 -11.08 1.40 N 
18 1 NE A ARG 246 ? ? CZ  A ARG 246 ? ? NH1 A ARG 246 ? ? 124.57 120.30 4.27   0.50 N 
19 1 CA A PRO 310 ? ? N   A PRO 310 ? ? CD  A PRO 310 ? ? 98.02  111.70 -13.68 1.40 N 
20 1 CA A PRO 331 ? ? N   A PRO 331 ? ? CD  A PRO 331 ? ? 101.80 111.70 -9.90  1.40 N 
21 1 NE A ARG 409 ? ? CZ  A ARG 409 ? ? NH2 A ARG 409 ? ? 116.98 120.30 -3.32  0.50 N 
22 1 CB A ASP 412 ? ? CG  A ASP 412 ? ? OD1 A ASP 412 ? ? 125.48 118.30 7.18   0.90 N 
23 1 NE A ARG 453 ? ? CZ  A ARG 453 ? ? NH1 A ARG 453 ? ? 123.51 120.30 3.21   0.50 N 
24 1 C  A VAL 484 ? ? N   A PRO 485 ? ? CD  A PRO 485 ? ? 113.24 128.40 -15.16 2.10 Y 
25 1 CA A PRO 485 ? ? N   A PRO 485 ? ? CD  A PRO 485 ? ? 100.64 111.70 -11.06 1.40 N 
26 1 NE B ARG 49  ? ? CZ  B ARG 49  ? ? NH2 B ARG 49  ? ? 123.97 120.30 3.67   0.50 N 
27 1 CB B LEU 110 ? ? CG  B LEU 110 ? ? CD1 B LEU 110 ? ? 125.02 111.00 14.02  1.70 N 
28 1 CB B ASP 121 ? ? CG  B ASP 121 ? ? OD1 B ASP 121 ? ? 112.79 118.30 -5.51  0.90 N 
29 1 CB B PHE 185 ? ? CG  B PHE 185 ? ? CD2 B PHE 185 ? ? 115.55 120.80 -5.25  0.70 N 
30 1 CB B PHE 185 ? ? CG  B PHE 185 ? ? CD1 B PHE 185 ? ? 127.33 120.80 6.53   0.70 N 
31 1 CA B PRO 193 ? ? N   B PRO 193 ? ? CD  B PRO 193 ? ? 100.33 111.70 -11.37 1.40 N 
32 1 CA B PRO 199 ? ? N   B PRO 199 ? ? CD  B PRO 199 ? ? 100.59 111.70 -11.11 1.40 N 
33 1 CB B ASP 222 ? ? CG  B ASP 222 ? ? OD1 B ASP 222 ? ? 124.65 118.30 6.35   0.90 N 
34 1 CB B ASP 228 ? ? CG  B ASP 228 ? ? OD1 B ASP 228 ? ? 124.42 118.30 6.12   0.90 N 
35 1 CB B TYR 235 ? ? CG  B TYR 235 ? ? CD2 B TYR 235 ? ? 116.42 121.00 -4.58  0.60 N 
36 1 CA B PRO 244 ? ? N   B PRO 244 ? ? CD  B PRO 244 ? ? 100.06 111.70 -11.64 1.40 N 
37 1 CA B PRO 245 ? ? N   B PRO 245 ? ? CD  B PRO 245 ? ? 101.14 111.70 -10.56 1.40 N 
38 1 NE B ARG 246 ? ? CZ  B ARG 246 ? ? NH1 B ARG 246 ? ? 125.94 120.30 5.64   0.50 N 
39 1 CA B PRO 261 ? ? N   B PRO 261 ? ? CD  B PRO 261 ? ? 100.17 111.70 -11.53 1.40 N 
40 1 CA B PRO 324 ? ? N   B PRO 324 ? ? CD  B PRO 324 ? ? 102.28 111.70 -9.42  1.40 N 
41 1 CA B PRO 331 ? ? N   B PRO 331 ? ? CD  B PRO 331 ? ? 100.74 111.70 -10.96 1.40 N 
42 1 CB B ASP 349 ? ? CG  B ASP 349 ? ? OD1 B ASP 349 ? ? 125.26 118.30 6.96   0.90 N 
43 1 NE B ARG 409 ? ? CZ  B ARG 409 ? ? NH1 B ARG 409 ? ? 123.36 120.30 3.06   0.50 N 
44 1 CB B ASP 412 ? ? CG  B ASP 412 ? ? OD2 B ASP 412 ? ? 123.77 118.30 5.47   0.90 N 
45 1 NE B ARG 413 ? ? CZ  B ARG 413 ? ? NH2 B ARG 413 ? ? 115.68 120.30 -4.62  0.50 N 
46 1 NE B ARG 453 ? ? CZ  B ARG 453 ? ? NH2 B ARG 453 ? ? 116.64 120.30 -3.66  0.50 N 
47 1 CZ B TYR 458 ? ? CE2 B TYR 458 ? ? CD2 B TYR 458 ? ? 114.32 119.80 -5.48  0.90 N 
48 1 CA B PRO 483 ? ? N   B PRO 483 ? ? CD  B PRO 483 ? ? 100.48 111.70 -11.22 1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 111 ? ? -119.29 68.31   
2  1 HIS A 123 ? ? -124.05 -50.24  
3  1 SER A 325 ? ? -173.19 -177.76 
4  1 LEU A 419 ? ? -104.67 59.99   
5  1 PRO A 483 ? ? -107.20 42.17   
6  1 ALA B 111 ? ? -116.87 70.81   
7  1 TYR B 124 ? ? -91.90  -61.70  
8  1 GLN B 253 ? ? -107.65 73.94   
9  1 SER B 325 ? ? -171.02 -179.49 
10 1 PRO B 331 ? ? -37.36  134.64  
11 1 ALA B 350 ? ? -101.04 64.10   
12 1 LEU B 419 ? ? -108.32 54.32   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLY A 474 ? ? LYS A 475 ? ? 141.28  
2 1 LYS A 475 ? ? ASP A 476 ? ? 114.23  
3 1 SER B 472 ? ? GLY B 473 ? ? -34.55  
4 1 GLY B 473 ? ? GLY B 474 ? ? -108.15 
5 1 ASP B 476 ? ? LYS B 477 ? ? -121.94 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLN 147 ? A GLN 147 
2  1 Y 1 A LYS 148 ? A LYS 148 
3  1 Y 1 A VAL 149 ? A VAL 149 
4  1 Y 1 A THR 270 ? A THR 270 
5  1 Y 1 A PHE 271 ? A PHE 271 
6  1 Y 1 A ASP 272 ? A ASP 272 
7  1 Y 1 A THR 273 ? A THR 273 
8  1 Y 1 A GLY 274 ? A GLY 274 
9  1 Y 1 A GLY 275 ? A GLY 275 
10 1 Y 1 A ILE 276 ? A ILE 276 
11 1 Y 1 A SER 277 ? A SER 277 
12 1 Y 1 A LEU 278 ? A LEU 278 
13 1 Y 1 A LYS 279 ? A LYS 279 
14 1 Y 1 A PRO 280 ? A PRO 280 
15 1 Y 1 A GLY 281 ? A GLY 281 
16 1 Y 1 A ALA 282 ? A ALA 282 
17 1 Y 1 A GLY 283 ? A GLY 283 
18 1 Y 1 A MET 284 ? A MET 284 
19 1 Y 1 A ASP 285 ? A ASP 285 
20 1 Y 1 A GLU 286 ? A GLU 286 
21 1 Y 1 A MET 287 ? A MET 287 
22 1 Y 1 A LYS 288 ? A LYS 288 
23 1 Y 1 A TYR 289 ? A TYR 289 
24 1 Y 1 A ASP 290 ? A ASP 290 
25 1 Y 1 B GLN 147 ? B GLN 147 
26 1 Y 1 B LYS 148 ? B LYS 148 
27 1 Y 1 B VAL 149 ? B VAL 149 
28 1 Y 1 B THR 270 ? B THR 270 
29 1 Y 1 B PHE 271 ? B PHE 271 
30 1 Y 1 B ASP 272 ? B ASP 272 
31 1 Y 1 B THR 273 ? B THR 273 
32 1 Y 1 B GLY 274 ? B GLY 274 
33 1 Y 1 B GLY 275 ? B GLY 275 
34 1 Y 1 B ILE 276 ? B ILE 276 
35 1 Y 1 B SER 277 ? B SER 277 
36 1 Y 1 B LEU 278 ? B LEU 278 
37 1 Y 1 B LYS 279 ? B LYS 279 
38 1 Y 1 B PRO 280 ? B PRO 280 
39 1 Y 1 B GLY 281 ? B GLY 281 
40 1 Y 1 B ALA 282 ? B ALA 282 
41 1 Y 1 B GLY 283 ? B GLY 283 
42 1 Y 1 B MET 284 ? B MET 284 
43 1 Y 1 B ASP 285 ? B ASP 285 
44 1 Y 1 B GLU 286 ? B GLU 286 
45 1 Y 1 B MET 287 ? B MET 287 
46 1 Y 1 B LYS 288 ? B LYS 288 
47 1 Y 1 B TYR 289 ? B TYR 289 
48 1 Y 1 B ASP 290 ? B ASP 290 
# 
_pdbx_reflns_twin.type         hemihedral 
_pdbx_reflns_twin.operator     h,-h-k,-l 
_pdbx_reflns_twin.fraction     0.500 
_pdbx_reflns_twin.domain_id    ? 
_pdbx_reflns_twin.crystal_id   1 
_pdbx_reflns_twin.diffrn_id    1 
#