data_3HCM
# 
_entry.id   3HCM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HCM         
RCSB  RCSB052969   
WWPDB D_1000052969 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3HCM 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mangani, S.' 1 
'Cesari, L.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Fragmenting the S100B-p53 Interaction: Combined Virtual/Biophysical Screening Approaches to Identify Ligands' 
_citation.journal_abbrev            Chemmedchem 
_citation.journal_volume            5 
_citation.page_first                428 
_citation.page_last                 435 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   DE 
_citation.journal_id_ISSN           1860-7179 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20077460 
_citation.pdbx_database_id_DOI      10.1002/cmdc.200900393 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Agamennone, M.' 1 
primary 'Cesari, L.'     2 
primary 'Lalli, D.'      3 
primary 'Turlizzi, E.'   4 
primary 'Del Conte, R.'  5 
primary 'Turano, P.'     6 
primary 'Mangani, S.'    7 
primary 'Padova, A.'     8 
# 
_cell.entry_id           3HCM 
_cell.length_a           35.257 
_cell.length_b           57.797 
_cell.length_c           47.745 
_cell.angle_alpha        90.00 
_cell.angle_beta         111.41 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HCM 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-B'                                             10727.037 2  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                                                40.078    4  ? ? ? ? 
3 non-polymer syn '(3R)-3-[3-(4-chlorophenyl)-1,2,4-oxadiazol-5-yl]piperidine' 263.723   2  ? ? ? ? 
4 non-polymer syn 'ACETATE ION'                                                59.044    1  ? ? ? ? 
5 water       nat water                                                        18.015    96 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S100 calcium-binding protein B, S-100 protein subunit beta, S-100 protein beta chain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  LYS n 
1 7  ALA n 
1 8  MET n 
1 9  VAL n 
1 10 ALA n 
1 11 LEU n 
1 12 ILE n 
1 13 ASP n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 GLN n 
1 18 TYR n 
1 19 SER n 
1 20 GLY n 
1 21 ARG n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 HIS n 
1 27 LYS n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 SER n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 ILE n 
1 38 ASN n 
1 39 ASN n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 HIS n 
1 44 PHE n 
1 45 LEU n 
1 46 GLU n 
1 47 GLU n 
1 48 ILE n 
1 49 LYS n 
1 50 GLU n 
1 51 GLN n 
1 52 GLU n 
1 53 VAL n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 GLU n 
1 60 THR n 
1 61 LEU n 
1 62 ASP n 
1 63 ASN n 
1 64 ASP n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 CYS n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 PHE n 
1 75 MET n 
1 76 ALA n 
1 77 PHE n 
1 78 VAL n 
1 79 ALA n 
1 80 MET n 
1 81 VAL n 
1 82 THR n 
1 83 THR n 
1 84 ALA n 
1 85 CYS n 
1 86 HIS n 
1 87 GLU n 
1 88 PHE n 
1 89 PHE n 
1 90 GLU n 
1 91 HIS n 
1 92 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'The protein was purchased from a commercial source.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S100B_HUMAN 
_struct_ref.pdbx_db_accession          P04271 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HCM A 1 ? 92 ? P04271 1 ? 92 ? 0 91 
2 1 3HCM B 1 ? 92 ? P04271 1 ? 92 ? 0 91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                                                ? 'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE                                                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                              ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                                                ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                                                     ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                ? 'C9 H11 N O2'     165.189 
S45 non-polymer         . '(3R)-3-[3-(4-chlorophenyl)-1,2,4-oxadiazol-5-yl]piperidine' ? 'C13 H14 Cl N3 O' 263.723 
SER 'L-peptide linking' y SERINE                                                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                    ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                                                     ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3HCM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'0.1M sodium acetate, 0.02M calcium chloride, 45% methylpenthanediol, pH4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR555 FLAT PANEL' 
_diffrn_detector.pdbx_collection_date   2006-10-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si [111]' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.814 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.814 
# 
_reflns.entry_id                     3HCM 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             17.68 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   9406 
_reflns.number_all                   12148 
_reflns.percent_possible_obs         81.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.041 
_reflns.pdbx_netI_over_sigmaI        11.5 
_reflns.B_iso_Wilson_estimate        29.93 
_reflns.pdbx_redundancy              4.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.11 
_reflns_shell.percent_possible_all   81.5 
_reflns_shell.Rmerge_I_obs           0.075 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    9.1 
_reflns_shell.pdbx_redundancy        4.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1337 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3HCM 
_refine.ls_number_reflns_obs                     9406 
_refine.ls_number_reflns_all                     9406 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             17.63 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    81.19 
_refine.ls_R_factor_obs                          0.23105 
_refine.ls_R_factor_all                          0.23105 
_refine.ls_R_factor_R_work                       0.22722 
_refine.ls_R_factor_R_free                       0.31149 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  457 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.913 
_refine.correlation_coeff_Fo_to_Fc_free          0.840 
_refine.B_iso_mean                               33.961 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2H61' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.365 
_refine.pdbx_overall_ESU_R_Free                  0.281 
_refine.overall_SU_ML                            0.173 
_refine.overall_SU_B                             5.870 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1471 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               1611 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        17.63 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.016  0.021  ? 1538 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.687  1.978  ? 2057 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.602  5.000  ? 181  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.336 26.506 ? 83   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.147 15.000 ? 294  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       23.357 15.000 ? 2    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.115  0.200  ? 218  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.020  ? 1156 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.250  0.200  ? 834  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.306  0.200  ? 1046 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.214  0.200  ? 98   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.129  0.200  ? 13   'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.279  0.200  ? 47   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.199  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.135  1.500  ? 938  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.678  2.000  ? 1442 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.533  3.000  ? 674  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.645  4.500  ? 614  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.051 
_refine_ls_shell.number_reflns_R_work             736 
_refine_ls_shell.R_factor_R_work                  0.199 
_refine_ls_shell.percent_reflns_obs               86.94 
_refine_ls_shell.R_factor_R_free                  0.327 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HCM 
_struct.title                     'Crystal structure of human S100B in complex with S45' 
_struct.pdbx_descriptor           'Protein S100-B' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HCM 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            
'S100B, calcium binding protein, inhibitor, Calcium, Cytoplasm, Metal-binding, Nucleus, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 5 ? 
K N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 2  ? GLY A 20 ? SER A 1  GLY A 19 1 ? 19 
HELX_P HELX_P2 2 LYS A 29 ? LEU A 41 ? LYS A 28 LEU A 40 1 ? 13 
HELX_P HELX_P3 3 GLU A 50 ? ASP A 62 ? GLU A 49 ASP A 61 1 ? 13 
HELX_P HELX_P4 4 ASP A 70 ? GLU A 87 ? ASP A 69 GLU A 86 1 ? 18 
HELX_P HELX_P5 5 SER B 2  ? GLY B 20 ? SER B 1  GLY B 19 1 ? 19 
HELX_P HELX_P6 6 LYS B 29 ? LEU B 41 ? LYS B 28 LEU B 40 1 ? 13 
HELX_P HELX_P7 7 GLU B 50 ? ASP B 62 ? GLU B 49 ASP B 61 1 ? 13 
HELX_P HELX_P8 8 PHE B 71 ? PHE B 89 ? PHE B 70 PHE B 88 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A SER 19 O   ? ? ? 1_555 C CA  . CA ? ? A SER 18 A CA  92  1_555 ? ? ? ? ? ? ? 2.215 ? 
metalc2  metalc ? ? A GLU 22 O   ? ? ? 1_555 C CA  . CA ? ? A GLU 21 A CA  92  1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc3  metalc ? ? A ASP 24 O   ? ? ? 1_555 C CA  . CA ? ? A ASP 23 A CA  92  1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc4  metalc ? ? A LYS 27 O   ? ? ? 1_555 C CA  . CA ? ? A LYS 26 A CA  92  1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc5  metalc ? ? A GLU 32 OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 31 A CA  92  1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc6  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 31 A CA  92  1_555 ? ? ? ? ? ? ? 2.647 ? 
metalc7  metalc ? ? A ASP 62 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 61 A CA  93  1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc8  metalc ? ? A ASP 64 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 63 A CA  93  1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc9  metalc ? ? A ASP 66 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 65 A CA  93  1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc10 metalc ? ? A GLU 68 O   ? ? ? 1_555 D CA  . CA ? ? A GLU 67 A CA  93  1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc11 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 D CA  . CA ? ? A GLU 72 A CA  93  1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc12 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 D CA  . CA ? ? A GLU 72 A CA  93  1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc13 metalc ? ? B SER 19 O   ? ? ? 1_555 G CA  . CA ? ? B SER 18 B CA  92  1_555 ? ? ? ? ? ? ? 2.329 ? 
metalc14 metalc ? ? B GLU 22 O   ? ? ? 1_555 G CA  . CA ? ? B GLU 21 B CA  92  1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc15 metalc ? ? B ASP 24 O   ? ? ? 1_555 G CA  . CA ? ? B ASP 23 B CA  92  1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc16 metalc ? ? B LYS 27 O   ? ? ? 1_555 G CA  . CA ? ? B LYS 26 B CA  92  1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc17 metalc ? ? B GLU 32 OE1 ? ? ? 1_555 G CA  . CA ? ? B GLU 31 B CA  92  1_555 ? ? ? ? ? ? ? 2.752 ? 
metalc18 metalc ? ? B GLU 32 OE2 ? ? ? 1_555 G CA  . CA ? ? B GLU 31 B CA  92  1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc19 metalc ? ? B ASP 62 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 61 B CA  93  1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc20 metalc ? ? B ASP 64 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 63 B CA  93  1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc21 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 65 B CA  93  1_555 ? ? ? ? ? ? ? 2.657 ? 
metalc22 metalc ? ? B GLU 68 O   ? ? ? 1_555 H CA  . CA ? ? B GLU 67 B CA  93  1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc23 metalc ? ? B GLU 73 OE1 ? ? ? 1_555 H CA  . CA ? ? B GLU 72 B CA  93  1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc24 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 H CA  . CA ? ? B GLU 72 B CA  93  1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc25 metalc ? ? D CA  .  CA  ? ? ? 1_555 J HOH . O  ? ? A CA  93 A HOH 139 1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc26 metalc ? ? G CA  .  CA  ? ? ? 1_555 K HOH . O  ? ? B CA  92 B HOH 123 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc27 metalc ? ? H CA  .  CA  ? ? ? 1_555 K HOH . O  ? ? B CA  93 B HOH 131 1_555 ? ? ? ? ? ? ? 2.274 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS B 27 ? LEU B 28 ? LYS B 26 LEU B 27 
A 2 CYS B 69 ? ASP B 70 ? CYS B 68 ASP B 69 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    28 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     27 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   CYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    69 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    CYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     68 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 92'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 93'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE S45 A 94' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACT A 95' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 92'  
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 93'  
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE S45 B 94' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 SER A 19 ? SER A 18  . ? 1_555 ? 
2  AC1 5 GLU A 22 ? GLU A 21  . ? 1_555 ? 
3  AC1 5 ASP A 24 ? ASP A 23  . ? 1_555 ? 
4  AC1 5 LYS A 27 ? LYS A 26  . ? 1_555 ? 
5  AC1 5 GLU A 32 ? GLU A 31  . ? 1_555 ? 
6  AC2 6 ASP A 62 ? ASP A 61  . ? 1_555 ? 
7  AC2 6 ASP A 64 ? ASP A 63  . ? 1_555 ? 
8  AC2 6 ASP A 66 ? ASP A 65  . ? 1_555 ? 
9  AC2 6 GLU A 68 ? GLU A 67  . ? 1_555 ? 
10 AC2 6 GLU A 73 ? GLU A 72  . ? 1_555 ? 
11 AC2 6 HOH J .  ? HOH A 139 . ? 1_555 ? 
12 AC3 5 LEU A 45 ? LEU A 44  . ? 1_555 ? 
13 AC3 5 LEU A 61 ? LEU A 60  . ? 1_555 ? 
14 AC3 5 PHE A 77 ? PHE A 76  . ? 1_555 ? 
15 AC3 5 MET A 80 ? MET A 79  . ? 1_555 ? 
16 AC3 5 HOH J .  ? HOH A 143 . ? 1_555 ? 
17 AC4 1 GLU A 46 ? GLU A 45  . ? 1_555 ? 
18 AC5 6 SER B 19 ? SER B 18  . ? 1_555 ? 
19 AC5 6 GLU B 22 ? GLU B 21  . ? 1_555 ? 
20 AC5 6 ASP B 24 ? ASP B 23  . ? 1_555 ? 
21 AC5 6 LYS B 27 ? LYS B 26  . ? 1_555 ? 
22 AC5 6 GLU B 32 ? GLU B 31  . ? 1_555 ? 
23 AC5 6 HOH K .  ? HOH B 123 . ? 1_555 ? 
24 AC6 6 ASP B 62 ? ASP B 61  . ? 1_555 ? 
25 AC6 6 ASP B 64 ? ASP B 63  . ? 1_555 ? 
26 AC6 6 ASP B 66 ? ASP B 65  . ? 1_555 ? 
27 AC6 6 GLU B 68 ? GLU B 67  . ? 1_555 ? 
28 AC6 6 GLU B 73 ? GLU B 72  . ? 1_555 ? 
29 AC6 6 HOH K .  ? HOH B 131 . ? 1_555 ? 
30 AC7 6 LEU B 45 ? LEU B 44  . ? 1_555 ? 
31 AC7 6 GLU B 46 ? GLU B 45  . ? 1_555 ? 
32 AC7 6 VAL B 57 ? VAL B 56  . ? 1_555 ? 
33 AC7 6 PHE B 77 ? PHE B 76  . ? 1_555 ? 
34 AC7 6 MET B 80 ? MET B 79  . ? 1_555 ? 
35 AC7 6 HOH K .  ? HOH B 127 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3HCM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3HCM 
_atom_sites.fract_transf_matrix[1][1]   0.028364 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.011123 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017302 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.022498 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1  ? 16.174  -7.193  12.900 1.00 41.62 ? 0   MET A N   1 
ATOM   2    C  CA  . MET A 1 1  ? 14.846  -6.710  13.401 1.00 40.86 ? 0   MET A CA  1 
ATOM   3    C  C   . MET A 1 1  ? 14.733  -5.190  13.305 1.00 39.59 ? 0   MET A C   1 
ATOM   4    O  O   . MET A 1 1  ? 15.691  -4.454  13.590 1.00 40.54 ? 0   MET A O   1 
ATOM   5    C  CB  . MET A 1 1  ? 14.606  -7.195  14.828 1.00 41.52 ? 0   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1  ? 14.203  -8.656  14.947 1.00 44.13 ? 0   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1  ? 12.421  -8.817  15.138 1.00 46.04 ? 0   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1  ? 12.133  -10.518 14.604 1.00 43.75 ? 0   MET A CE  1 
ATOM   9    N  N   . SER A 1 2  ? 13.571  -4.707  12.883 1.00 37.78 ? 1   SER A N   1 
ATOM   10   C  CA  . SER A 1 2  ? 13.389  -3.258  12.700 1.00 36.06 ? 1   SER A CA  1 
ATOM   11   C  C   . SER A 1 2  ? 13.094  -2.597  14.044 1.00 35.55 ? 1   SER A C   1 
ATOM   12   O  O   . SER A 1 2  ? 12.797  -3.284  15.022 1.00 35.10 ? 1   SER A O   1 
ATOM   13   C  CB  . SER A 1 2  ? 12.246  -2.969  11.718 1.00 36.56 ? 1   SER A CB  1 
ATOM   14   O  OG  . SER A 1 2  ? 10.985  -3.224  12.323 1.00 31.21 ? 1   SER A OG  1 
ATOM   15   N  N   . GLU A 1 3  ? 13.169  -1.274  14.078 1.00 34.39 ? 2   GLU A N   1 
ATOM   16   C  CA  . GLU A 1 3  ? 12.928  -0.508  15.296 1.00 34.87 ? 2   GLU A CA  1 
ATOM   17   C  C   . GLU A 1 3  ? 11.516  -0.719  15.845 1.00 33.68 ? 2   GLU A C   1 
ATOM   18   O  O   . GLU A 1 3  ? 11.338  -1.072  17.016 1.00 34.50 ? 2   GLU A O   1 
ATOM   19   C  CB  . GLU A 1 3  ? 13.225  0.975   15.049 1.00 35.68 ? 2   GLU A CB  1 
ATOM   20   C  CG  . GLU A 1 3  ? 14.686  1.198   14.682 1.00 37.62 ? 2   GLU A CG  1 
ATOM   21   C  CD  . GLU A 1 3  ? 15.610  0.293   15.491 1.00 41.37 ? 2   GLU A CD  1 
ATOM   22   O  OE1 . GLU A 1 3  ? 15.666  0.451   16.740 1.00 42.46 ? 2   GLU A OE1 1 
ATOM   23   O  OE2 . GLU A 1 3  ? 16.250  -0.595  14.882 1.00 43.85 ? 2   GLU A OE2 1 
ATOM   24   N  N   . LEU A 1 4  ? 10.528  -0.548  14.976 1.00 32.79 ? 3   LEU A N   1 
ATOM   25   C  CA  . LEU A 1 4  ? 9.135   -0.913  15.278 1.00 29.82 ? 3   LEU A CA  1 
ATOM   26   C  C   . LEU A 1 4  ? 8.986   -2.345  15.848 1.00 29.85 ? 3   LEU A C   1 
ATOM   27   O  O   . LEU A 1 4  ? 8.395   -2.530  16.905 1.00 28.55 ? 3   LEU A O   1 
ATOM   28   C  CB  . LEU A 1 4  ? 8.254   -0.720  14.030 1.00 29.01 ? 3   LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 4  ? 6.750   -0.887  14.240 1.00 27.31 ? 3   LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 4  ? 6.194   0.061   15.338 1.00 23.20 ? 3   LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 4  ? 5.964   -0.719  12.959 1.00 26.77 ? 3   LEU A CD2 1 
ATOM   32   N  N   . GLU A 1 5  ? 9.536   -3.342  15.161 1.00 30.18 ? 4   GLU A N   1 
ATOM   33   C  CA  . GLU A 1 5  ? 9.519   -4.739  15.644 1.00 30.82 ? 4   GLU A CA  1 
ATOM   34   C  C   . GLU A 1 5  ? 10.140  -4.972  17.010 1.00 31.78 ? 4   GLU A C   1 
ATOM   35   O  O   . GLU A 1 5  ? 9.651   -5.809  17.799 1.00 32.29 ? 4   GLU A O   1 
ATOM   36   C  CB  . GLU A 1 5  ? 10.212  -5.654  14.641 1.00 31.05 ? 4   GLU A CB  1 
ATOM   37   C  CG  . GLU A 1 5  ? 9.304   -6.024  13.498 1.00 30.97 ? 4   GLU A CG  1 
ATOM   38   C  CD  . GLU A 1 5  ? 10.064  -6.637  12.364 1.00 33.50 ? 4   GLU A CD  1 
ATOM   39   O  OE1 . GLU A 1 5  ? 11.279  -6.338  12.226 1.00 36.46 ? 4   GLU A OE1 1 
ATOM   40   O  OE2 . GLU A 1 5  ? 9.449   -7.420  11.629 1.00 33.07 ? 4   GLU A OE2 1 
ATOM   41   N  N   . LYS A 1 6  ? 11.243  -4.265  17.248 1.00 31.89 ? 5   LYS A N   1 
ATOM   42   C  CA  . LYS A 1 6  ? 11.907  -4.207  18.551 1.00 32.21 ? 5   LYS A CA  1 
ATOM   43   C  C   . LYS A 1 6  ? 11.024  -3.504  19.580 1.00 31.53 ? 5   LYS A C   1 
ATOM   44   O  O   . LYS A 1 6  ? 11.006  -3.880  20.752 1.00 32.53 ? 5   LYS A O   1 
ATOM   45   C  CB  . LYS A 1 6  ? 13.218  -3.418  18.439 1.00 31.98 ? 5   LYS A CB  1 
ATOM   46   C  CG  . LYS A 1 6  ? 14.357  -4.109  17.697 1.00 31.00 ? 5   LYS A CG  1 
ATOM   47   C  CD  . LYS A 1 6  ? 15.515  -3.151  17.542 1.00 29.46 ? 5   LYS A CD  1 
ATOM   48   C  CE  . LYS A 1 6  ? 16.309  -3.401  16.257 1.00 32.02 ? 5   LYS A CE  1 
ATOM   49   N  NZ  . LYS A 1 6  ? 17.592  -4.134  16.435 1.00 34.69 ? 5   LYS A NZ  1 
ATOM   50   N  N   . ALA A 1 7  ? 10.325  -2.454  19.166 1.00 30.88 ? 6   ALA A N   1 
ATOM   51   C  CA  . ALA A 1 7  ? 9.478   -1.717  20.124 1.00 29.36 ? 6   ALA A CA  1 
ATOM   52   C  C   . ALA A 1 7  ? 8.319   -2.562  20.568 1.00 28.53 ? 6   ALA A C   1 
ATOM   53   O  O   . ALA A 1 7  ? 7.966   -2.550  21.742 1.00 28.44 ? 6   ALA A O   1 
ATOM   54   C  CB  . ALA A 1 7  ? 9.012   -0.361  19.551 1.00 29.23 ? 6   ALA A CB  1 
ATOM   55   N  N   . MET A 1 8  ? 7.749   -3.311  19.628 1.00 27.72 ? 7   MET A N   1 
ATOM   56   C  CA  . MET A 1 8  ? 6.669   -4.251  19.912 1.00 28.61 ? 7   MET A CA  1 
ATOM   57   C  C   . MET A 1 8  ? 7.100   -5.341  20.887 1.00 28.63 ? 7   MET A C   1 
ATOM   58   O  O   . MET A 1 8  ? 6.371   -5.679  21.800 1.00 26.37 ? 7   MET A O   1 
ATOM   59   C  CB  . MET A 1 8  ? 6.137   -4.868  18.619 1.00 28.38 ? 7   MET A CB  1 
ATOM   60   C  CG  . MET A 1 8  ? 5.447   -3.831  17.747 1.00 26.56 ? 7   MET A CG  1 
ATOM   61   S  SD  . MET A 1 8  ? 4.991   -4.605  16.194 1.00 29.18 ? 7   MET A SD  1 
ATOM   62   C  CE  . MET A 1 8  ? 4.194   -3.172  15.435 1.00 30.19 ? 7   MET A CE  1 
ATOM   63   N  N   . VAL A 1 9  ? 8.311   -5.850  20.690 1.00 29.59 ? 8   VAL A N   1 
ATOM   64   C  CA  . VAL A 1 9  ? 8.877   -6.884  21.557 1.00 30.78 ? 8   VAL A CA  1 
ATOM   65   C  C   . VAL A 1 9  ? 9.077   -6.393  23.003 1.00 30.42 ? 8   VAL A C   1 
ATOM   66   O  O   . VAL A 1 9  ? 8.658   -7.053  23.957 1.00 30.61 ? 8   VAL A O   1 
ATOM   67   C  CB  . VAL A 1 9  ? 10.189  -7.396  20.932 1.00 31.27 ? 8   VAL A CB  1 
ATOM   68   C  CG1 . VAL A 1 9  ? 11.100  -8.061  21.971 1.00 32.12 ? 8   VAL A CG1 1 
ATOM   69   C  CG2 . VAL A 1 9  ? 9.858   -8.337  19.750 1.00 31.77 ? 8   VAL A CG2 1 
ATOM   70   N  N   . ALA A 1 10 ? 9.699   -5.223  23.134 1.00 30.52 ? 9   ALA A N   1 
ATOM   71   C  CA  . ALA A 1 10 ? 9.910   -4.529  24.405 1.00 30.90 ? 9   ALA A CA  1 
ATOM   72   C  C   . ALA A 1 10 ? 8.625   -4.305  25.199 1.00 30.90 ? 9   ALA A C   1 
ATOM   73   O  O   . ALA A 1 10 ? 8.672   -4.274  26.439 1.00 31.53 ? 9   ALA A O   1 
ATOM   74   C  CB  . ALA A 1 10 ? 10.616  -3.211  24.159 1.00 29.34 ? 9   ALA A CB  1 
ATOM   75   N  N   . LEU A 1 11 ? 7.497   -4.159  24.478 1.00 30.33 ? 10  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 11 ? 6.168   -3.938  25.071 1.00 29.34 ? 10  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 11 ? 5.709   -5.206  25.742 1.00 28.78 ? 10  LEU A C   1 
ATOM   78   O  O   . LEU A 1 11 ? 5.221   -5.158  26.851 1.00 26.04 ? 10  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 11 ? 5.113   -3.524  24.021 1.00 29.36 ? 10  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 11 ? 5.279   -2.155  23.368 1.00 29.48 ? 10  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 11 ? 4.112   -1.818  22.408 1.00 23.72 ? 10  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 11 ? 5.457   -1.064  24.450 1.00 27.49 ? 10  LEU A CD2 1 
ATOM   83   N  N   . ILE A 1 12 ? 5.882   -6.349  25.051 1.00 28.64 ? 11  ILE A N   1 
ATOM   84   C  CA  . ILE A 1 12 ? 5.630   -7.673  25.654 1.00 27.76 ? 11  ILE A CA  1 
ATOM   85   C  C   . ILE A 1 12 ? 6.611   -7.954  26.818 1.00 28.03 ? 11  ILE A C   1 
ATOM   86   O  O   . ILE A 1 12 ? 6.222   -8.390  27.901 1.00 30.05 ? 11  ILE A O   1 
ATOM   87   C  CB  . ILE A 1 12 ? 5.747   -8.777  24.528 1.00 29.14 ? 11  ILE A CB  1 
ATOM   88   C  CG1 . ILE A 1 12 ? 4.642   -8.580  23.468 1.00 27.65 ? 11  ILE A CG1 1 
ATOM   89   C  CG2 . ILE A 1 12 ? 5.616   -10.183 25.097 1.00 25.90 ? 11  ILE A CG2 1 
ATOM   90   C  CD1 . ILE A 1 12 ? 4.922   -9.308  22.123 1.00 26.82 ? 11  ILE A CD1 1 
ATOM   91   N  N   . ASP A 1 13 ? 7.876   -7.649  26.602 1.00 27.59 ? 12  ASP A N   1 
ATOM   92   C  CA  . ASP A 1 13 ? 8.939   -7.891  27.587 1.00 27.59 ? 12  ASP A CA  1 
ATOM   93   C  C   . ASP A 1 13 ? 8.771   -7.084  28.888 1.00 27.01 ? 12  ASP A C   1 
ATOM   94   O  O   . ASP A 1 13 ? 8.915   -7.647  29.964 1.00 25.54 ? 12  ASP A O   1 
ATOM   95   C  CB  . ASP A 1 13 ? 10.294  -7.620  26.934 1.00 28.00 ? 12  ASP A CB  1 
ATOM   96   C  CG  . ASP A 1 13 ? 11.461  -7.718  27.923 1.00 31.51 ? 12  ASP A CG  1 
ATOM   97   O  OD1 . ASP A 1 13 ? 11.498  -8.652  28.760 1.00 37.37 ? 12  ASP A OD1 1 
ATOM   98   O  OD2 . ASP A 1 13 ? 12.359  -6.896  27.828 1.00 27.56 ? 12  ASP A OD2 1 
ATOM   99   N  N   . VAL A 1 14 ? 8.427   -5.793  28.793 1.00 26.53 ? 13  VAL A N   1 
ATOM   100  C  CA  . VAL A 1 14 ? 8.124   -4.999  30.004 1.00 27.35 ? 13  VAL A CA  1 
ATOM   101  C  C   . VAL A 1 14 ? 6.805   -5.442  30.667 1.00 27.68 ? 13  VAL A C   1 
ATOM   102  O  O   . VAL A 1 14 ? 6.744   -5.480  31.901 1.00 28.47 ? 13  VAL A O   1 
ATOM   103  C  CB  . VAL A 1 14 ? 8.230   -3.424  29.797 1.00 27.90 ? 13  VAL A CB  1 
ATOM   104  C  CG1 . VAL A 1 14 ? 7.094   -2.900  28.914 1.00 28.12 ? 13  VAL A CG1 1 
ATOM   105  C  CG2 . VAL A 1 14 ? 8.205   -2.657  31.164 1.00 27.03 ? 13  VAL A CG2 1 
ATOM   106  N  N   . PHE A 1 15 ? 5.772   -5.790  29.884 1.00 28.06 ? 14  PHE A N   1 
ATOM   107  C  CA  . PHE A 1 15 ? 4.540   -6.378  30.471 1.00 29.46 ? 14  PHE A CA  1 
ATOM   108  C  C   . PHE A 1 15 ? 4.842   -7.673  31.249 1.00 30.25 ? 14  PHE A C   1 
ATOM   109  O  O   . PHE A 1 15 ? 4.287   -7.920  32.330 1.00 30.58 ? 14  PHE A O   1 
ATOM   110  C  CB  . PHE A 1 15 ? 3.470   -6.672  29.415 1.00 30.33 ? 14  PHE A CB  1 
ATOM   111  C  CG  . PHE A 1 15 ? 2.188   -7.270  29.991 1.00 32.26 ? 14  PHE A CG  1 
ATOM   112  C  CD1 . PHE A 1 15 ? 1.339   -6.512  30.797 1.00 31.95 ? 14  PHE A CD1 1 
ATOM   113  C  CD2 . PHE A 1 15 ? 1.838   -8.580  29.718 1.00 31.16 ? 14  PHE A CD2 1 
ATOM   114  C  CE1 . PHE A 1 15 ? 0.189   -7.059  31.362 1.00 29.93 ? 14  PHE A CE1 1 
ATOM   115  C  CE2 . PHE A 1 15 ? 0.674   -9.135  30.243 1.00 31.86 ? 14  PHE A CE2 1 
ATOM   116  C  CZ  . PHE A 1 15 ? -0.155  -8.377  31.075 1.00 31.48 ? 14  PHE A CZ  1 
ATOM   117  N  N   . HIS A 1 16 ? 5.728   -8.483  30.700 1.00 31.05 ? 15  HIS A N   1 
ATOM   118  C  CA  . HIS A 1 16 ? 6.002   -9.764  31.327 1.00 32.08 ? 15  HIS A CA  1 
ATOM   119  C  C   . HIS A 1 16 ? 6.867   -9.647  32.566 1.00 30.84 ? 15  HIS A C   1 
ATOM   120  O  O   . HIS A 1 16 ? 6.606   -10.277 33.576 1.00 29.35 ? 15  HIS A O   1 
ATOM   121  C  CB  . HIS A 1 16 ? 6.454   -10.795 30.297 1.00 32.18 ? 15  HIS A CB  1 
ATOM   122  C  CG  . HIS A 1 16 ? 5.302   -11.488 29.651 1.00 37.16 ? 15  HIS A CG  1 
ATOM   123  N  ND1 . HIS A 1 16 ? 4.222   -11.938 30.382 1.00 40.17 ? 15  HIS A ND1 1 
ATOM   124  C  CD2 . HIS A 1 16 ? 5.037   -11.797 28.358 1.00 39.57 ? 15  HIS A CD2 1 
ATOM   125  C  CE1 . HIS A 1 16 ? 3.334   -12.477 29.566 1.00 42.27 ? 15  HIS A CE1 1 
ATOM   126  N  NE2 . HIS A 1 16 ? 3.806   -12.413 28.335 1.00 40.16 ? 15  HIS A NE2 1 
ATOM   127  N  N   . GLN A 1 17 ? 7.845   -8.758  32.491 1.00 32.20 ? 16  GLN A N   1 
ATOM   128  C  CA  . GLN A 1 17 ? 8.661   -8.371  33.633 1.00 33.66 ? 16  GLN A CA  1 
ATOM   129  C  C   . GLN A 1 17 ? 7.810   -8.095  34.860 1.00 33.15 ? 16  GLN A C   1 
ATOM   130  O  O   . GLN A 1 17 ? 7.968   -8.737  35.908 1.00 33.66 ? 16  GLN A O   1 
ATOM   131  C  CB  . GLN A 1 17 ? 9.483   -7.140  33.253 1.00 32.76 ? 16  GLN A CB  1 
ATOM   132  C  CG  . GLN A 1 17 ? 10.391  -6.613  34.353 1.00 36.24 ? 16  GLN A CG  1 
ATOM   133  C  CD  . GLN A 1 17 ? 11.254  -5.420  33.904 1.00 36.41 ? 16  GLN A CD  1 
ATOM   134  O  OE1 . GLN A 1 17 ? 11.509  -5.236  32.703 1.00 41.05 ? 16  GLN A OE1 1 
ATOM   135  N  NE2 . GLN A 1 17 ? 11.718  -4.617  34.873 1.00 37.14 ? 16  GLN A NE2 1 
ATOM   136  N  N   . TYR A 1 18 ? 6.880   -7.148  34.716 1.00 31.80 ? 17  TYR A N   1 
ATOM   137  C  CA  . TYR A 1 18 ? 6.047   -6.741  35.825 1.00 30.57 ? 17  TYR A CA  1 
ATOM   138  C  C   . TYR A 1 18 ? 4.883   -7.710  36.066 1.00 30.60 ? 17  TYR A C   1 
ATOM   139  O  O   . TYR A 1 18 ? 4.570   -7.995  37.185 1.00 30.25 ? 17  TYR A O   1 
ATOM   140  C  CB  . TYR A 1 18 ? 5.651   -5.243  35.706 1.00 29.94 ? 17  TYR A CB  1 
ATOM   141  C  CG  . TYR A 1 18 ? 6.867   -4.353  35.939 1.00 27.38 ? 17  TYR A CG  1 
ATOM   142  C  CD1 . TYR A 1 18 ? 7.674   -3.941  34.898 1.00 28.16 ? 17  TYR A CD1 1 
ATOM   143  C  CD2 . TYR A 1 18 ? 7.225   -3.960  37.225 1.00 30.31 ? 17  TYR A CD2 1 
ATOM   144  C  CE1 . TYR A 1 18 ? 8.835   -3.170  35.120 1.00 25.35 ? 17  TYR A CE1 1 
ATOM   145  C  CE2 . TYR A 1 18 ? 8.377   -3.184  37.447 1.00 26.74 ? 17  TYR A CE2 1 
ATOM   146  C  CZ  . TYR A 1 18 ? 9.156   -2.801  36.410 1.00 28.98 ? 17  TYR A CZ  1 
ATOM   147  O  OH  . TYR A 1 18 ? 10.274  -2.009  36.676 1.00 31.04 ? 17  TYR A OH  1 
ATOM   148  N  N   . SER A 1 19 ? 4.272   -8.267  35.037 1.00 30.99 ? 18  SER A N   1 
ATOM   149  C  CA  . SER A 1 19 ? 3.142   -9.159  35.307 1.00 32.60 ? 18  SER A CA  1 
ATOM   150  C  C   . SER A 1 19 ? 3.519   -10.499 36.017 1.00 33.13 ? 18  SER A C   1 
ATOM   151  O  O   . SER A 1 19 ? 2.686   -11.082 36.709 1.00 34.56 ? 18  SER A O   1 
ATOM   152  C  CB  . SER A 1 19 ? 2.346   -9.436  34.039 1.00 32.03 ? 18  SER A CB  1 
ATOM   153  O  OG  . SER A 1 19 ? 3.060   -10.374 33.264 1.00 34.26 ? 18  SER A OG  1 
ATOM   154  N  N   . GLY A 1 20 ? 4.757   -10.949 35.879 1.00 34.72 ? 19  GLY A N   1 
ATOM   155  C  CA  . GLY A 1 20 ? 5.194   -12.245 36.447 1.00 37.18 ? 19  GLY A CA  1 
ATOM   156  C  C   . GLY A 1 20 ? 5.799   -12.187 37.845 1.00 38.07 ? 19  GLY A C   1 
ATOM   157  O  O   . GLY A 1 20 ? 6.497   -13.105 38.264 1.00 38.77 ? 19  GLY A O   1 
ATOM   158  N  N   . ARG A 1 21 ? 5.533   -11.121 38.581 1.00 38.81 ? 20  ARG A N   1 
ATOM   159  C  CA  . ARG A 1 21 ? 6.148   -10.941 39.886 1.00 40.30 ? 20  ARG A CA  1 
ATOM   160  C  C   . ARG A 1 21 ? 5.337   -11.648 40.956 1.00 40.38 ? 20  ARG A C   1 
ATOM   161  O  O   . ARG A 1 21 ? 5.853   -12.442 41.715 1.00 41.32 ? 20  ARG A O   1 
ATOM   162  C  CB  . ARG A 1 21 ? 6.347   -9.435  40.199 1.00 39.92 ? 20  ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 21 ? 7.404   -8.828  39.284 1.00 40.98 ? 20  ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 21 ? 7.738   -7.347  39.456 1.00 40.68 ? 20  ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 21 ? 8.858   -7.119  38.539 1.00 44.63 ? 20  ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 21 ? 9.679   -6.073  38.516 1.00 45.46 ? 20  ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 21 ? 9.501   -5.060  39.361 1.00 42.70 ? 20  ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 21 ? 10.685  -6.047  37.614 1.00 43.30 ? 20  ARG A NH2 1 
ATOM   169  N  N   . GLU A 1 22 ? 4.051   -11.374 40.976 1.00 41.15 ? 21  GLU A N   1 
ATOM   170  C  CA  . GLU A 1 22 ? 3.199   -11.775 42.048 1.00 42.28 ? 21  GLU A CA  1 
ATOM   171  C  C   . GLU A 1 22 ? 1.943   -12.369 41.431 1.00 42.32 ? 21  GLU A C   1 
ATOM   172  O  O   . GLU A 1 22 ? 1.419   -11.858 40.427 1.00 42.67 ? 21  GLU A O   1 
ATOM   173  C  CB  . GLU A 1 22 ? 2.867   -10.570 42.931 1.00 41.89 ? 21  GLU A CB  1 
ATOM   174  C  CG  . GLU A 1 22 ? 4.007   -9.531  43.059 1.00 42.92 ? 21  GLU A CG  1 
ATOM   175  C  CD  . GLU A 1 22 ? 3.608   -8.325  43.894 1.00 43.96 ? 21  GLU A CD  1 
ATOM   176  O  OE1 . GLU A 1 22 ? 3.026   -8.564  44.976 1.00 43.51 ? 21  GLU A OE1 1 
ATOM   177  O  OE2 . GLU A 1 22 ? 3.863   -7.156  43.462 1.00 43.92 ? 21  GLU A OE2 1 
ATOM   178  N  N   . GLY A 1 23 ? 1.478   -13.469 42.013 1.00 41.78 ? 22  GLY A N   1 
ATOM   179  C  CA  . GLY A 1 23 ? 0.157   -13.995 41.685 1.00 41.68 ? 22  GLY A CA  1 
ATOM   180  C  C   . GLY A 1 23 ? 0.093   -14.449 40.243 1.00 41.26 ? 22  GLY A C   1 
ATOM   181  O  O   . GLY A 1 23 ? 1.023   -15.071 39.744 1.00 41.70 ? 22  GLY A O   1 
ATOM   182  N  N   . ASP A 1 24 ? -1.022  -14.147 39.592 1.00 40.90 ? 23  ASP A N   1 
ATOM   183  C  CA  . ASP A 1 24 ? -1.217  -14.378 38.161 1.00 40.87 ? 23  ASP A CA  1 
ATOM   184  C  C   . ASP A 1 24 ? 0.009   -13.906 37.360 1.00 40.49 ? 23  ASP A C   1 
ATOM   185  O  O   . ASP A 1 24 ? 0.300   -12.703 37.308 1.00 41.29 ? 23  ASP A O   1 
ATOM   186  C  CB  . ASP A 1 24 ? -2.479  -13.604 37.757 1.00 40.75 ? 23  ASP A CB  1 
ATOM   187  C  CG  . ASP A 1 24 ? -3.015  -13.968 36.374 1.00 42.26 ? 23  ASP A CG  1 
ATOM   188  O  OD1 . ASP A 1 24 ? -2.228  -14.244 35.448 1.00 42.65 ? 23  ASP A OD1 1 
ATOM   189  O  OD2 . ASP A 1 24 ? -4.261  -13.926 36.220 1.00 43.98 ? 23  ASP A OD2 1 
ATOM   190  N  N   . LYS A 1 25 ? 0.743   -14.839 36.744 1.00 39.84 ? 24  LYS A N   1 
ATOM   191  C  CA  . LYS A 1 25 ? 1.923   -14.473 35.944 1.00 38.76 ? 24  LYS A CA  1 
ATOM   192  C  C   . LYS A 1 25 ? 1.571   -13.570 34.748 1.00 37.90 ? 24  LYS A C   1 
ATOM   193  O  O   . LYS A 1 25 ? 2.418   -12.812 34.250 1.00 38.99 ? 24  LYS A O   1 
ATOM   194  C  CB  . LYS A 1 25 ? 2.689   -15.725 35.472 1.00 39.56 ? 24  LYS A CB  1 
ATOM   195  C  CG  . LYS A 1 25 ? 3.141   -16.682 36.605 1.00 41.08 ? 24  LYS A CG  1 
ATOM   196  C  CD  . LYS A 1 25 ? 4.607   -16.558 36.953 1.00 41.58 ? 24  LYS A CD  1 
ATOM   197  C  CE  . LYS A 1 25 ? 5.523   -17.486 36.105 1.00 45.00 ? 24  LYS A CE  1 
ATOM   198  N  NZ  . LYS A 1 25 ? 5.388   -18.977 36.404 1.00 45.91 ? 24  LYS A NZ  1 
ATOM   199  N  N   . HIS A 1 26 ? 0.316   -13.636 34.312 1.00 37.52 ? 25  HIS A N   1 
ATOM   200  C  CA  . HIS A 1 26 ? -0.130  -13.059 33.035 1.00 36.14 ? 25  HIS A CA  1 
ATOM   201  C  C   . HIS A 1 26 ? -0.790  -11.706 33.169 1.00 35.04 ? 25  HIS A C   1 
ATOM   202  O  O   . HIS A 1 26 ? -1.162  -11.106 32.158 1.00 35.08 ? 25  HIS A O   1 
ATOM   203  C  CB  . HIS A 1 26 ? -1.167  -13.965 32.385 1.00 36.97 ? 25  HIS A CB  1 
ATOM   204  C  CG  . HIS A 1 26 ? -0.762  -15.405 32.320 1.00 36.60 ? 25  HIS A CG  1 
ATOM   205  N  ND1 . HIS A 1 26 ? 0.119   -15.883 31.375 1.00 37.67 ? 25  HIS A ND1 1 
ATOM   206  C  CD2 . HIS A 1 26 ? -1.112  -16.463 33.085 1.00 38.09 ? 25  HIS A CD2 1 
ATOM   207  C  CE1 . HIS A 1 26 ? 0.289   -17.182 31.558 1.00 38.46 ? 25  HIS A CE1 1 
ATOM   208  N  NE2 . HIS A 1 26 ? -0.437  -17.557 32.595 1.00 36.12 ? 25  HIS A NE2 1 
ATOM   209  N  N   . LYS A 1 27 ? -0.976  -11.252 34.399 1.00 32.94 ? 26  LYS A N   1 
ATOM   210  C  CA  . LYS A 1 27 ? -1.817  -10.097 34.661 1.00 31.91 ? 26  LYS A CA  1 
ATOM   211  C  C   . LYS A 1 27 ? -1.008  -9.137  35.528 1.00 30.68 ? 26  LYS A C   1 
ATOM   212  O  O   . LYS A 1 27 ? -0.092  -9.593  36.235 1.00 28.79 ? 26  LYS A O   1 
ATOM   213  C  CB  . LYS A 1 27 ? -3.105  -10.534 35.380 1.00 32.75 ? 26  LYS A CB  1 
ATOM   214  C  CG  . LYS A 1 27 ? -4.171  -11.161 34.461 1.00 30.44 ? 26  LYS A CG  1 
ATOM   215  C  CD  . LYS A 1 27 ? -5.418  -11.571 35.228 1.00 33.48 ? 26  LYS A CD  1 
ATOM   216  C  CE  . LYS A 1 27 ? -6.435  -12.360 34.354 1.00 35.12 ? 26  LYS A CE  1 
ATOM   217  N  NZ  . LYS A 1 27 ? -7.525  -12.861 35.255 1.00 38.12 ? 26  LYS A NZ  1 
ATOM   218  N  N   . LEU A 1 28 ? -1.308  -7.835  35.437 1.00 27.65 ? 27  LEU A N   1 
ATOM   219  C  CA  . LEU A 1 28 ? -0.742  -6.831  36.365 1.00 26.51 ? 27  LEU A CA  1 
ATOM   220  C  C   . LEU A 1 28 ? -1.712  -6.455  37.482 1.00 25.30 ? 27  LEU A C   1 
ATOM   221  O  O   . LEU A 1 28 ? -2.783  -5.865  37.244 1.00 24.48 ? 27  LEU A O   1 
ATOM   222  C  CB  . LEU A 1 28 ? -0.300  -5.538  35.649 1.00 26.23 ? 27  LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 28 ? 0.702   -5.419  34.520 1.00 26.06 ? 27  LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 28 ? 0.638   -3.939  34.046 1.00 28.46 ? 27  LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 28 ? 2.147   -5.762  34.929 1.00 26.95 ? 27  LEU A CD2 1 
ATOM   226  N  N   . LYS A 1 29 ? -1.361  -6.801  38.714 1.00 24.25 ? 28  LYS A N   1 
ATOM   227  C  CA  . LYS A 1 29 ? -2.148  -6.320  39.817 1.00 25.55 ? 28  LYS A CA  1 
ATOM   228  C  C   . LYS A 1 29 ? -1.774  -4.873  40.045 1.00 23.52 ? 28  LYS A C   1 
ATOM   229  O  O   . LYS A 1 29 ? -0.788  -4.369  39.475 1.00 22.28 ? 28  LYS A O   1 
ATOM   230  C  CB  . LYS A 1 29 ? -1.945  -7.164  41.102 1.00 26.23 ? 28  LYS A CB  1 
ATOM   231  C  CG  . LYS A 1 29 ? -0.493  -7.618  41.397 1.00 27.99 ? 28  LYS A CG  1 
ATOM   232  C  CD  . LYS A 1 29 ? -0.409  -8.589  42.623 1.00 29.14 ? 28  LYS A CD  1 
ATOM   233  C  CE  . LYS A 1 29 ? -1.317  -9.811  42.450 1.00 32.83 ? 28  LYS A CE  1 
ATOM   234  N  NZ  . LYS A 1 29 ? -1.186  -10.913 43.468 1.00 33.02 ? 28  LYS A NZ  1 
ATOM   235  N  N   . LYS A 1 30 ? -2.493  -4.212  40.934 1.00 23.25 ? 29  LYS A N   1 
ATOM   236  C  CA  . LYS A 1 30 ? -2.183  -2.799  41.243 1.00 24.51 ? 29  LYS A CA  1 
ATOM   237  C  C   . LYS A 1 30 ? -0.720  -2.454  41.611 1.00 24.35 ? 29  LYS A C   1 
ATOM   238  O  O   . LYS A 1 30 ? -0.161  -1.440  41.173 1.00 23.79 ? 29  LYS A O   1 
ATOM   239  C  CB  . LYS A 1 30 ? -3.117  -2.358  42.341 1.00 25.01 ? 29  LYS A CB  1 
ATOM   240  C  CG  . LYS A 1 30 ? -4.552  -2.286  41.914 1.00 26.00 ? 29  LYS A CG  1 
ATOM   241  C  CD  . LYS A 1 30 ? -5.259  -1.336  42.901 1.00 30.35 ? 29  LYS A CD  1 
ATOM   242  C  CE  . LYS A 1 30 ? -6.770  -1.412  42.846 1.00 35.44 ? 29  LYS A CE  1 
ATOM   243  N  NZ  . LYS A 1 30 ? -7.358  -0.903  44.158 1.00 37.76 ? 29  LYS A NZ  1 
ATOM   244  N  N   . SER A 1 31 ? -0.114  -3.300  42.430 1.00 25.01 ? 30  SER A N   1 
ATOM   245  C  CA  . SER A 1 31 ? 1.216   -3.053  42.925 1.00 26.06 ? 30  SER A CA  1 
ATOM   246  C  C   . SER A 1 31 ? 2.264   -3.302  41.837 1.00 25.64 ? 30  SER A C   1 
ATOM   247  O  O   . SER A 1 31 ? 3.344   -2.722  41.868 1.00 27.36 ? 30  SER A O   1 
ATOM   248  C  CB  . SER A 1 31 ? 1.456   -3.924  44.146 1.00 26.66 ? 30  SER A CB  1 
ATOM   249  O  OG  . SER A 1 31 ? 1.585   -5.285  43.780 1.00 28.31 ? 30  SER A OG  1 
ATOM   250  N  N   . GLU A 1 32 ? 1.959   -4.189  40.887 1.00 25.85 ? 31  GLU A N   1 
ATOM   251  C  CA  . GLU A 1 32 ? 2.837   -4.437  39.737 1.00 25.83 ? 31  GLU A CA  1 
ATOM   252  C  C   . GLU A 1 32 ? 2.678   -3.294  38.723 1.00 25.19 ? 31  GLU A C   1 
ATOM   253  O  O   . GLU A 1 32 ? 3.655   -2.814  38.118 1.00 24.78 ? 31  GLU A O   1 
ATOM   254  C  CB  . GLU A 1 32 ? 2.471   -5.771  39.093 1.00 25.19 ? 31  GLU A CB  1 
ATOM   255  C  CG  . GLU A 1 32 ? 2.800   -7.006  39.983 1.00 26.21 ? 31  GLU A CG  1 
ATOM   256  C  CD  . GLU A 1 32 ? 2.229   -8.294  39.418 1.00 25.87 ? 31  GLU A CD  1 
ATOM   257  O  OE1 . GLU A 1 32 ? 1.277   -8.223  38.625 1.00 23.72 ? 31  GLU A OE1 1 
ATOM   258  O  OE2 . GLU A 1 32 ? 2.735   -9.396  39.759 1.00 29.58 ? 31  GLU A OE2 1 
ATOM   259  N  N   . LEU A 1 33 ? 1.447   -2.853  38.546 1.00 23.94 ? 32  LEU A N   1 
ATOM   260  C  CA  . LEU A 1 33 ? 1.166   -1.696  37.688 1.00 25.17 ? 32  LEU A CA  1 
ATOM   261  C  C   . LEU A 1 33 ? 1.837   -0.416  38.200 1.00 25.05 ? 32  LEU A C   1 
ATOM   262  O  O   . LEU A 1 33 ? 2.368   0.373   37.416 1.00 26.73 ? 32  LEU A O   1 
ATOM   263  C  CB  . LEU A 1 33 ? -0.361  -1.458  37.615 1.00 24.50 ? 32  LEU A CB  1 
ATOM   264  C  CG  . LEU A 1 33 ? -0.827  -0.251  36.783 1.00 23.87 ? 32  LEU A CG  1 
ATOM   265  C  CD1 . LEU A 1 33 ? -0.350  -0.347  35.325 1.00 23.60 ? 32  LEU A CD1 1 
ATOM   266  C  CD2 . LEU A 1 33 ? -2.324  -0.086  36.845 1.00 26.40 ? 32  LEU A CD2 1 
ATOM   267  N  N   . LYS A 1 34 ? 1.782   -0.189  39.510 1.00 25.74 ? 33  LYS A N   1 
ATOM   268  C  CA  . LYS A 1 34 ? 2.343   1.030   40.103 1.00 26.20 ? 33  LYS A CA  1 
ATOM   269  C  C   . LYS A 1 34 ? 3.891   1.074   39.956 1.00 25.34 ? 33  LYS A C   1 
ATOM   270  O  O   . LYS A 1 34 ? 4.449   2.121   39.628 1.00 26.12 ? 33  LYS A O   1 
ATOM   271  C  CB  . LYS A 1 34 ? 1.896   1.183   41.574 1.00 26.97 ? 33  LYS A CB  1 
ATOM   272  C  CG  . LYS A 1 34 ? 2.402   2.465   42.260 1.00 29.17 ? 33  LYS A CG  1 
ATOM   273  C  CD  . LYS A 1 34 ? 2.454   2.267   43.804 1.00 29.44 ? 33  LYS A CD  1 
ATOM   274  C  CE  . LYS A 1 34 ? 3.098   3.484   44.484 1.00 30.88 ? 33  LYS A CE  1 
ATOM   275  N  NZ  . LYS A 1 34 ? 3.072   3.500   45.984 1.00 37.68 ? 33  LYS A NZ  1 
ATOM   276  N  N   . GLU A 1 35 ? 4.559   -0.076  40.130 1.00 24.76 ? 34  GLU A N   1 
ATOM   277  C  CA  . GLU A 1 35 ? 6.000   -0.173  39.970 1.00 23.96 ? 34  GLU A CA  1 
ATOM   278  C  C   . GLU A 1 35 ? 6.371   -0.065  38.494 1.00 23.52 ? 34  GLU A C   1 
ATOM   279  O  O   . GLU A 1 35 ? 7.410   0.502   38.154 1.00 24.13 ? 34  GLU A O   1 
ATOM   280  C  CB  . GLU A 1 35 ? 6.585   -1.448  40.615 1.00 25.38 ? 34  GLU A CB  1 
ATOM   281  C  CG  . GLU A 1 35 ? 6.225   -1.684  42.116 1.00 25.76 ? 34  GLU A CG  1 
ATOM   282  C  CD  . GLU A 1 35 ? 6.789   -0.611  43.105 1.00 32.65 ? 34  GLU A CD  1 
ATOM   283  O  OE1 . GLU A 1 35 ? 7.408   0.409   42.669 1.00 31.30 ? 34  GLU A OE1 1 
ATOM   284  O  OE2 . GLU A 1 35 ? 6.650   -0.819  44.333 1.00 32.59 ? 34  GLU A OE2 1 
ATOM   285  N  N   . LEU A 1 36 ? 5.527   -0.566  37.595 1.00 21.59 ? 35  LEU A N   1 
ATOM   286  C  CA  . LEU A 1 36 ? 5.778   -0.379  36.160 1.00 22.29 ? 35  LEU A CA  1 
ATOM   287  C  C   . LEU A 1 36 ? 5.782   1.100   35.736 1.00 21.32 ? 35  LEU A C   1 
ATOM   288  O  O   . LEU A 1 36 ? 6.725   1.568   35.028 1.00 22.53 ? 35  LEU A O   1 
ATOM   289  C  CB  . LEU A 1 36 ? 4.734   -1.160  35.334 1.00 21.38 ? 35  LEU A CB  1 
ATOM   290  C  CG  . LEU A 1 36 ? 4.939   -1.073  33.821 1.00 21.07 ? 35  LEU A CG  1 
ATOM   291  C  CD1 . LEU A 1 36 ? 4.359   -2.391  33.278 1.00 25.34 ? 35  LEU A CD1 1 
ATOM   292  C  CD2 . LEU A 1 36 ? 4.253   0.166   33.178 1.00 22.09 ? 35  LEU A CD2 1 
ATOM   293  N  N   . ILE A 1 37 ? 4.766   1.845   36.185 1.00 21.05 ? 36  ILE A N   1 
ATOM   294  C  CA  . ILE A 1 37 ? 4.630   3.337   35.869 1.00 22.08 ? 36  ILE A CA  1 
ATOM   295  C  C   . ILE A 1 37 ? 5.813   4.068   36.462 1.00 23.26 ? 36  ILE A C   1 
ATOM   296  O  O   . ILE A 1 37 ? 6.457   4.858   35.789 1.00 23.86 ? 36  ILE A O   1 
ATOM   297  C  CB  . ILE A 1 37 ? 3.261   3.956   36.316 1.00 21.02 ? 36  ILE A CB  1 
ATOM   298  C  CG1 . ILE A 1 37 ? 2.136   3.379   35.443 1.00 20.70 ? 36  ILE A CG1 1 
ATOM   299  C  CG2 . ILE A 1 37 ? 3.244   5.601   36.314 1.00 21.35 ? 36  ILE A CG2 1 
ATOM   300  C  CD1 . ILE A 1 37 ? 0.769   3.536   35.964 1.00 18.08 ? 36  ILE A CD1 1 
ATOM   301  N  N   . ASN A 1 38 ? 6.127   3.741   37.712 1.00 25.10 ? 37  ASN A N   1 
ATOM   302  C  CA  . ASN A 1 38 ? 7.101   4.496   38.510 1.00 25.78 ? 37  ASN A CA  1 
ATOM   303  C  C   . ASN A 1 38 ? 8.550   4.266   38.102 1.00 26.78 ? 37  ASN A C   1 
ATOM   304  O  O   . ASN A 1 38 ? 9.374   5.156   38.244 1.00 26.63 ? 37  ASN A O   1 
ATOM   305  C  CB  . ASN A 1 38 ? 6.934   4.196   40.006 1.00 26.37 ? 37  ASN A CB  1 
ATOM   306  C  CG  . ASN A 1 38 ? 5.799   4.954   40.644 1.00 27.22 ? 37  ASN A CG  1 
ATOM   307  O  OD1 . ASN A 1 38 ? 5.588   4.846   41.875 1.00 31.38 ? 37  ASN A OD1 1 
ATOM   308  N  ND2 . ASN A 1 38 ? 5.082   5.763   39.855 1.00 27.02 ? 37  ASN A ND2 1 
ATOM   309  N  N   . ASN A 1 39 ? 8.836   3.082   37.581 1.00 26.28 ? 38  ASN A N   1 
ATOM   310  C  CA  . ASN A 1 39 ? 10.170  2.662   37.234 1.00 27.07 ? 38  ASN A CA  1 
ATOM   311  C  C   . ASN A 1 39 ? 10.427  2.826   35.756 1.00 26.07 ? 38  ASN A C   1 
ATOM   312  O  O   . ASN A 1 39 ? 11.576  2.959   35.311 1.00 25.84 ? 38  ASN A O   1 
ATOM   313  C  CB  . ASN A 1 39 ? 10.366  1.174   37.602 1.00 27.60 ? 38  ASN A CB  1 
ATOM   314  C  CG  . ASN A 1 39 ? 10.346  0.929   39.106 1.00 30.28 ? 38  ASN A CG  1 
ATOM   315  O  OD1 . ASN A 1 39 ? 10.453  1.861   39.912 1.00 30.93 ? 38  ASN A OD1 1 
ATOM   316  N  ND2 . ASN A 1 39 ? 10.249  -0.325  39.488 1.00 30.81 ? 38  ASN A ND2 1 
ATOM   317  N  N   . GLU A 1 40 ? 9.365   2.767   34.979 1.00 25.05 ? 39  GLU A N   1 
ATOM   318  C  CA  . GLU A 1 40 ? 9.565   2.655   33.542 1.00 25.89 ? 39  GLU A CA  1 
ATOM   319  C  C   . GLU A 1 40 ? 8.944   3.790   32.733 1.00 25.25 ? 39  GLU A C   1 
ATOM   320  O  O   . GLU A 1 40 ? 9.184   3.877   31.552 1.00 25.09 ? 39  GLU A O   1 
ATOM   321  C  CB  . GLU A 1 40 ? 9.123   1.280   33.029 1.00 25.48 ? 39  GLU A CB  1 
ATOM   322  C  CG  . GLU A 1 40 ? 9.430   0.055   33.974 1.00 27.66 ? 39  GLU A CG  1 
ATOM   323  C  CD  . GLU A 1 40 ? 10.935  -0.232  34.151 1.00 28.35 ? 39  GLU A CD  1 
ATOM   324  O  OE1 . GLU A 1 40 ? 11.736  0.320   33.410 1.00 28.29 ? 39  GLU A OE1 1 
ATOM   325  O  OE2 . GLU A 1 40 ? 11.305  -1.014  35.046 1.00 30.92 ? 39  GLU A OE2 1 
ATOM   326  N  N   . LEU A 1 41 ? 8.165   4.653   33.392 1.00 25.67 ? 40  LEU A N   1 
ATOM   327  C  CA  . LEU A 1 41 ? 7.512   5.807   32.748 1.00 25.39 ? 40  LEU A CA  1 
ATOM   328  C  C   . LEU A 1 41 ? 7.776   7.101   33.530 1.00 27.09 ? 40  LEU A C   1 
ATOM   329  O  O   . LEU A 1 41 ? 7.031   8.062   33.397 1.00 28.11 ? 40  LEU A O   1 
ATOM   330  C  CB  . LEU A 1 41 ? 5.988   5.572   32.566 1.00 24.09 ? 40  LEU A CB  1 
ATOM   331  C  CG  . LEU A 1 41 ? 5.594   4.421   31.621 1.00 18.88 ? 40  LEU A CG  1 
ATOM   332  C  CD1 . LEU A 1 41 ? 4.083   4.162   31.678 1.00 15.38 ? 40  LEU A CD1 1 
ATOM   333  C  CD2 . LEU A 1 41 ? 6.097   4.708   30.175 1.00 17.83 ? 40  LEU A CD2 1 
ATOM   334  N  N   . SER A 1 42 ? 8.891   7.109   34.267 1.00 29.69 ? 41  SER A N   1 
ATOM   335  C  CA  . SER A 1 42 ? 9.390   8.210   35.075 1.00 31.32 ? 41  SER A CA  1 
ATOM   336  C  C   . SER A 1 42 ? 9.592   9.507   34.314 1.00 33.00 ? 41  SER A C   1 
ATOM   337  O  O   . SER A 1 42 ? 9.516   10.604  34.894 1.00 33.93 ? 41  SER A O   1 
ATOM   338  C  CB  . SER A 1 42 ? 10.745  7.815   35.670 1.00 31.27 ? 41  SER A CB  1 
ATOM   339  O  OG  . SER A 1 42 ? 11.766  8.046   34.704 1.00 32.75 ? 41  SER A OG  1 
ATOM   340  N  N   . HIS A 1 43 ? 9.899   9.380   33.030 1.00 33.38 ? 42  HIS A N   1 
ATOM   341  C  CA  . HIS A 1 43 ? 10.140  10.530  32.202 1.00 34.28 ? 42  HIS A CA  1 
ATOM   342  C  C   . HIS A 1 43 ? 8.842   10.989  31.565 1.00 34.02 ? 42  HIS A C   1 
ATOM   343  O  O   . HIS A 1 43 ? 8.720   12.139  31.148 1.00 35.57 ? 42  HIS A O   1 
ATOM   344  C  CB  . HIS A 1 43 ? 11.253  10.258  31.186 1.00 35.14 ? 42  HIS A CB  1 
ATOM   345  C  CG  . HIS A 1 43 ? 12.590  10.009  31.815 1.00 37.38 ? 42  HIS A CG  1 
ATOM   346  N  ND1 . HIS A 1 43 ? 13.117  8.745   31.969 1.00 39.98 ? 42  HIS A ND1 1 
ATOM   347  C  CD2 . HIS A 1 43 ? 13.512  10.860  32.323 1.00 39.58 ? 42  HIS A CD2 1 
ATOM   348  C  CE1 . HIS A 1 43 ? 14.299  8.824   32.553 1.00 38.24 ? 42  HIS A CE1 1 
ATOM   349  N  NE2 . HIS A 1 43 ? 14.559  10.097  32.783 1.00 39.95 ? 42  HIS A NE2 1 
ATOM   350  N  N   . PHE A 1 44 ? 7.846   10.108  31.541 1.00 33.00 ? 43  PHE A N   1 
ATOM   351  C  CA  . PHE A 1 44 ? 6.544   10.458  30.975 1.00 31.40 ? 43  PHE A CA  1 
ATOM   352  C  C   . PHE A 1 44 ? 5.433   10.832  31.970 1.00 31.28 ? 43  PHE A C   1 
ATOM   353  O  O   . PHE A 1 44 ? 4.798   11.854  31.817 1.00 32.40 ? 43  PHE A O   1 
ATOM   354  C  CB  . PHE A 1 44 ? 6.081   9.375   30.006 1.00 30.68 ? 43  PHE A CB  1 
ATOM   355  C  CG  . PHE A 1 44 ? 6.993   9.192   28.816 1.00 29.58 ? 43  PHE A CG  1 
ATOM   356  C  CD1 . PHE A 1 44 ? 8.085   10.041  28.591 1.00 30.16 ? 43  PHE A CD1 1 
ATOM   357  C  CD2 . PHE A 1 44 ? 6.716   8.215   27.880 1.00 28.63 ? 43  PHE A CD2 1 
ATOM   358  C  CE1 . PHE A 1 44 ? 8.932   9.864   27.482 1.00 30.04 ? 43  PHE A CE1 1 
ATOM   359  C  CE2 . PHE A 1 44 ? 7.527   8.036   26.771 1.00 28.77 ? 43  PHE A CE2 1 
ATOM   360  C  CZ  . PHE A 1 44 ? 8.652   8.862   26.572 1.00 28.93 ? 43  PHE A CZ  1 
ATOM   361  N  N   . LEU A 1 45 ? 5.168   10.000  32.966 1.00 31.07 ? 44  LEU A N   1 
ATOM   362  C  CA  . LEU A 1 45 ? 4.072   10.268  33.919 1.00 29.89 ? 44  LEU A CA  1 
ATOM   363  C  C   . LEU A 1 45 ? 4.627   10.629  35.276 1.00 30.65 ? 44  LEU A C   1 
ATOM   364  O  O   . LEU A 1 45 ? 5.745   10.234  35.585 1.00 30.66 ? 44  LEU A O   1 
ATOM   365  C  CB  . LEU A 1 45 ? 3.196   9.019   34.084 1.00 29.13 ? 44  LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 45 ? 2.755   8.298   32.802 1.00 28.58 ? 44  LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 45 ? 2.104   6.957   33.159 1.00 26.47 ? 44  LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 45 ? 1.816   9.153   31.948 1.00 27.79 ? 44  LEU A CD2 1 
ATOM   369  N  N   . GLU A 1 46 ? 3.813   11.312  36.092 1.00 31.92 ? 45  GLU A N   1 
ATOM   370  C  CA  . GLU A 1 46 ? 4.155   11.690  37.476 1.00 33.68 ? 45  GLU A CA  1 
ATOM   371  C  C   . GLU A 1 46 ? 4.308   10.449  38.364 1.00 32.88 ? 45  GLU A C   1 
ATOM   372  O  O   . GLU A 1 46 ? 3.481   9.548   38.295 1.00 33.92 ? 45  GLU A O   1 
ATOM   373  C  CB  . GLU A 1 46 ? 3.074   12.627  38.060 1.00 33.42 ? 45  GLU A CB  1 
ATOM   374  C  CG  . GLU A 1 46 ? 2.788   13.865  37.191 1.00 36.12 ? 45  GLU A CG  1 
ATOM   375  C  CD  . GLU A 1 46 ? 2.241   15.084  37.940 1.00 37.23 ? 45  GLU A CD  1 
ATOM   376  O  OE1 . GLU A 1 46 ? 1.176   14.972  38.605 1.00 40.67 ? 45  GLU A OE1 1 
ATOM   377  O  OE2 . GLU A 1 46 ? 2.858   16.188  37.818 1.00 44.42 ? 45  GLU A OE2 1 
ATOM   378  N  N   . GLU A 1 47 ? 5.360   10.386  39.177 1.00 32.16 ? 46  GLU A N   1 
ATOM   379  C  CA  . GLU A 1 47 ? 5.509   9.302   40.154 1.00 32.63 ? 46  GLU A CA  1 
ATOM   380  C  C   . GLU A 1 47 ? 4.212   9.117   40.950 1.00 32.47 ? 46  GLU A C   1 
ATOM   381  O  O   . GLU A 1 47 ? 3.611   10.094  41.427 1.00 31.42 ? 46  GLU A O   1 
ATOM   382  C  CB  . GLU A 1 47 ? 6.679   9.564   41.122 1.00 32.61 ? 46  GLU A CB  1 
ATOM   383  C  CG  . GLU A 1 47 ? 7.237   8.253   41.727 1.00 33.32 ? 46  GLU A CG  1 
ATOM   384  C  CD  . GLU A 1 47 ? 8.182   8.416   42.909 1.00 35.22 ? 46  GLU A CD  1 
ATOM   385  O  OE1 . GLU A 1 47 ? 8.957   9.400   42.974 1.00 39.28 ? 46  GLU A OE1 1 
ATOM   386  O  OE2 . GLU A 1 47 ? 8.187   7.509   43.775 1.00 40.27 ? 46  GLU A OE2 1 
ATOM   387  N  N   . ILE A 1 48 ? 3.781   7.869   41.094 1.00 32.17 ? 47  ILE A N   1 
ATOM   388  C  CA  . ILE A 1 48 ? 2.606   7.565   41.909 1.00 31.06 ? 47  ILE A CA  1 
ATOM   389  C  C   . ILE A 1 48 ? 3.079   7.367   43.340 1.00 30.91 ? 47  ILE A C   1 
ATOM   390  O  O   . ILE A 1 48 ? 3.919   6.548   43.616 1.00 30.77 ? 47  ILE A O   1 
ATOM   391  C  CB  . ILE A 1 48 ? 1.840   6.303   41.423 1.00 30.75 ? 47  ILE A CB  1 
ATOM   392  C  CG1 . ILE A 1 48 ? 1.396   6.442   39.974 1.00 30.08 ? 47  ILE A CG1 1 
ATOM   393  C  CG2 . ILE A 1 48 ? 0.636   5.992   42.317 1.00 30.62 ? 47  ILE A CG2 1 
ATOM   394  C  CD1 . ILE A 1 48 ? 1.133   5.108   39.348 1.00 26.05 ? 47  ILE A CD1 1 
ATOM   395  N  N   . LYS A 1 49 ? 2.537   8.154   44.254 1.00 32.07 ? 48  LYS A N   1 
ATOM   396  C  CA  . LYS A 1 49 ? 2.820   7.976   45.672 1.00 32.74 ? 48  LYS A CA  1 
ATOM   397  C  C   . LYS A 1 49 ? 1.560   8.000   46.530 1.00 33.33 ? 48  LYS A C   1 
ATOM   398  O  O   . LYS A 1 49 ? 1.656   8.100   47.752 1.00 34.17 ? 48  LYS A O   1 
ATOM   399  C  CB  . LYS A 1 49 ? 3.781   9.064   46.137 1.00 33.66 ? 48  LYS A CB  1 
ATOM   400  C  CG  . LYS A 1 49 ? 5.078   9.061   45.340 1.00 31.14 ? 48  LYS A CG  1 
ATOM   401  C  CD  . LYS A 1 49 ? 4.990   9.995   44.152 1.00 33.83 ? 48  LYS A CD  1 
ATOM   402  C  CE  . LYS A 1 49 ? 5.731   11.289  44.464 1.00 36.04 ? 48  LYS A CE  1 
ATOM   403  N  NZ  . LYS A 1 49 ? 6.032   11.258  45.917 1.00 35.93 ? 48  LYS A NZ  1 
ATOM   404  N  N   . GLU A 1 50 ? 0.393   7.914   45.886 1.00 33.59 ? 49  GLU A N   1 
ATOM   405  C  CA  . GLU A 1 50 ? -0.913  7.981   46.546 1.00 32.08 ? 49  GLU A CA  1 
ATOM   406  C  C   . GLU A 1 50 ? -1.745  6.788   46.120 1.00 32.55 ? 49  GLU A C   1 
ATOM   407  O  O   . GLU A 1 50 ? -1.899  6.549   44.918 1.00 31.05 ? 49  GLU A O   1 
ATOM   408  C  CB  . GLU A 1 50 ? -1.624  9.261   46.135 1.00 33.42 ? 49  GLU A CB  1 
ATOM   409  C  CG  . GLU A 1 50 ? -1.161  10.481  46.891 1.00 32.49 ? 49  GLU A CG  1 
ATOM   410  C  CD  . GLU A 1 50 ? -0.940  11.661  45.979 1.00 39.18 ? 49  GLU A CD  1 
ATOM   411  O  OE1 . GLU A 1 50 ? -1.854  12.514  45.888 1.00 43.28 ? 49  GLU A OE1 1 
ATOM   412  O  OE2 . GLU A 1 50 ? 0.145   11.743  45.349 1.00 41.82 ? 49  GLU A OE2 1 
ATOM   413  N  N   . GLN A 1 51 ? -2.259  6.017   47.095 1.00 31.74 ? 50  GLN A N   1 
ATOM   414  C  CA  . GLN A 1 51 ? -3.098  4.855   46.791 1.00 31.75 ? 50  GLN A CA  1 
ATOM   415  C  C   . GLN A 1 51 ? -4.273  5.246   45.904 1.00 31.28 ? 50  GLN A C   1 
ATOM   416  O  O   . GLN A 1 51 ? -4.650  4.515   44.995 1.00 32.99 ? 50  GLN A O   1 
ATOM   417  C  CB  . GLN A 1 51 ? -3.683  4.221   48.070 1.00 31.45 ? 50  GLN A CB  1 
ATOM   418  C  CG  . GLN A 1 51 ? -4.557  2.988   47.763 1.00 32.00 ? 50  GLN A CG  1 
ATOM   419  C  CD  . GLN A 1 51 ? -3.738  1.793   47.287 1.00 34.07 ? 50  GLN A CD  1 
ATOM   420  O  OE1 . GLN A 1 51 ? -2.614  1.583   47.747 1.00 35.27 ? 50  GLN A OE1 1 
ATOM   421  N  NE2 . GLN A 1 51 ? -4.292  1.008   46.352 1.00 34.24 ? 50  GLN A NE2 1 
ATOM   422  N  N   . GLU A 1 52 ? -4.877  6.384   46.209 1.00 30.36 ? 51  GLU A N   1 
ATOM   423  C  CA  . GLU A 1 52 ? -5.978  6.885   45.428 1.00 30.12 ? 51  GLU A CA  1 
ATOM   424  C  C   . GLU A 1 52 ? -5.605  6.900   43.915 1.00 29.58 ? 51  GLU A C   1 
ATOM   425  O  O   . GLU A 1 52 ? -6.435  6.660   43.041 1.00 27.67 ? 51  GLU A O   1 
ATOM   426  C  CB  . GLU A 1 52 ? -6.341  8.278   45.945 1.00 30.43 ? 51  GLU A CB  1 
ATOM   427  C  CG  . GLU A 1 52 ? -6.867  8.360   47.423 1.00 33.70 ? 51  GLU A CG  1 
ATOM   428  C  CD  . GLU A 1 52 ? -5.963  7.763   48.524 1.00 38.46 ? 51  GLU A CD  1 
ATOM   429  O  OE1 . GLU A 1 52 ? -4.750  8.113   48.564 1.00 34.01 ? 51  GLU A OE1 1 
ATOM   430  O  OE2 . GLU A 1 52 ? -6.493  6.963   49.369 1.00 39.55 ? 51  GLU A OE2 1 
ATOM   431  N  N   . VAL A 1 53 ? -4.334  7.163   43.631 1.00 28.06 ? 52  VAL A N   1 
ATOM   432  C  CA  . VAL A 1 53 ? -3.862  7.282   42.243 1.00 27.99 ? 52  VAL A CA  1 
ATOM   433  C  C   . VAL A 1 53 ? -3.647  5.896   41.594 1.00 27.35 ? 52  VAL A C   1 
ATOM   434  O  O   . VAL A 1 53 ? -4.024  5.690   40.439 1.00 26.79 ? 52  VAL A O   1 
ATOM   435  C  CB  . VAL A 1 53 ? -2.611  8.187   42.166 1.00 27.81 ? 52  VAL A CB  1 
ATOM   436  C  CG1 . VAL A 1 53 ? -2.005  8.160   40.767 1.00 28.27 ? 52  VAL A CG1 1 
ATOM   437  C  CG2 . VAL A 1 53 ? -3.015  9.638   42.559 1.00 27.76 ? 52  VAL A CG2 1 
ATOM   438  N  N   . VAL A 1 54 ? -3.054  4.975   42.343 1.00 27.01 ? 53  VAL A N   1 
ATOM   439  C  CA  . VAL A 1 54 ? -3.055  3.539   42.010 1.00 28.87 ? 53  VAL A CA  1 
ATOM   440  C  C   . VAL A 1 54 ? -4.471  3.035   41.613 1.00 28.34 ? 53  VAL A C   1 
ATOM   441  O  O   . VAL A 1 54 ? -4.659  2.384   40.566 1.00 28.32 ? 53  VAL A O   1 
ATOM   442  C  CB  . VAL A 1 54 ? -2.484  2.692   43.198 1.00 28.42 ? 53  VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 54 ? -2.449  1.192   42.874 1.00 30.65 ? 53  VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 54 ? -1.063  3.179   43.597 1.00 32.55 ? 53  VAL A CG2 1 
ATOM   445  N  N   . ASP A 1 55 ? -5.461  3.342   42.453 1.00 29.22 ? 54  ASP A N   1 
ATOM   446  C  CA  . ASP A 1 55 ? -6.844  2.885   42.259 1.00 28.93 ? 54  ASP A CA  1 
ATOM   447  C  C   . ASP A 1 55 ? -7.447  3.545   41.014 1.00 28.72 ? 54  ASP A C   1 
ATOM   448  O  O   . ASP A 1 55 ? -8.037  2.880   40.179 1.00 28.07 ? 54  ASP A O   1 
ATOM   449  C  CB  . ASP A 1 55 ? -7.743  3.253   43.462 1.00 29.46 ? 54  ASP A CB  1 
ATOM   450  C  CG  . ASP A 1 55 ? -7.301  2.608   44.785 1.00 31.43 ? 54  ASP A CG  1 
ATOM   451  O  OD1 . ASP A 1 55 ? -6.672  1.537   44.792 1.00 32.23 ? 54  ASP A OD1 1 
ATOM   452  O  OD2 . ASP A 1 55 ? -7.634  3.170   45.859 1.00 34.07 ? 54  ASP A OD2 1 
ATOM   453  N  N   . LYS A 1 56 ? -7.346  4.864   40.904 1.00 28.40 ? 55  LYS A N   1 
ATOM   454  C  CA  . LYS A 1 56 ? -7.918  5.510   39.725 1.00 29.28 ? 55  LYS A CA  1 
ATOM   455  C  C   . LYS A 1 56 ? -7.357  5.017   38.397 1.00 28.07 ? 55  LYS A C   1 
ATOM   456  O  O   . LYS A 1 56 ? -8.103  4.820   37.435 1.00 27.56 ? 55  LYS A O   1 
ATOM   457  C  CB  . LYS A 1 56 ? -7.932  7.033   39.815 1.00 29.37 ? 55  LYS A CB  1 
ATOM   458  C  CG  . LYS A 1 56 ? -8.914  7.522   40.866 1.00 32.39 ? 55  LYS A CG  1 
ATOM   459  C  CD  . LYS A 1 56 ? -10.346 7.103   40.544 1.00 34.87 ? 55  LYS A CD  1 
ATOM   460  C  CE  . LYS A 1 56 ? -11.233 7.158   41.774 1.00 35.95 ? 55  LYS A CE  1 
ATOM   461  N  NZ  . LYS A 1 56 ? -12.475 6.333   41.644 1.00 37.96 ? 55  LYS A NZ  1 
ATOM   462  N  N   . VAL A 1 57 ? -6.055  4.831   38.346 1.00 28.18 ? 56  VAL A N   1 
ATOM   463  C  CA  . VAL A 1 57 ? -5.413  4.348   37.132 1.00 27.70 ? 56  VAL A CA  1 
ATOM   464  C  C   . VAL A 1 57 ? -5.898  2.946   36.814 1.00 28.45 ? 56  VAL A C   1 
ATOM   465  O  O   . VAL A 1 57 ? -6.262  2.692   35.670 1.00 29.23 ? 56  VAL A O   1 
ATOM   466  C  CB  . VAL A 1 57 ? -3.870  4.488   37.214 1.00 27.91 ? 56  VAL A CB  1 
ATOM   467  C  CG1 . VAL A 1 57 ? -3.133  3.582   36.174 1.00 25.81 ? 56  VAL A CG1 1 
ATOM   468  C  CG2 . VAL A 1 57 ? -3.511  5.962   37.012 1.00 24.56 ? 56  VAL A CG2 1 
ATOM   469  N  N   . MET A 1 58 ? -5.973  2.064   37.820 1.00 28.66 ? 57  MET A N   1 
ATOM   470  C  CA  . MET A 1 58 ? -6.434  0.689   37.594 1.00 28.54 ? 57  MET A CA  1 
ATOM   471  C  C   . MET A 1 58 ? -7.886  0.624   37.161 1.00 29.55 ? 57  MET A C   1 
ATOM   472  O  O   . MET A 1 58 ? -8.241  -0.200  36.296 1.00 26.87 ? 57  MET A O   1 
ATOM   473  C  CB  . MET A 1 58 ? -6.262  -0.209  38.806 1.00 29.42 ? 57  MET A CB  1 
ATOM   474  C  CG  . MET A 1 58 ? -6.649  -1.717  38.554 1.00 28.40 ? 57  MET A CG  1 
ATOM   475  S  SD  . MET A 1 58 ? -5.741  -2.665  37.286 1.00 29.13 ? 57  MET A SD  1 
ATOM   476  C  CE  . MET A 1 58 ? -4.171  -2.940  38.080 1.00 31.67 ? 57  MET A CE  1 
ATOM   477  N  N   . GLU A 1 59 ? -8.715  1.445   37.815 1.00 30.28 ? 58  GLU A N   1 
ATOM   478  C  CA  . GLU A 1 59 ? -10.121 1.525   37.493 1.00 32.96 ? 58  GLU A CA  1 
ATOM   479  C  C   . GLU A 1 59 ? -10.238 1.955   36.014 1.00 32.96 ? 58  GLU A C   1 
ATOM   480  O  O   . GLU A 1 59 ? -10.994 1.365   35.271 1.00 33.58 ? 58  GLU A O   1 
ATOM   481  C  CB  . GLU A 1 59 ? -10.820 2.549   38.377 1.00 32.73 ? 58  GLU A CB  1 
ATOM   482  C  CG  . GLU A 1 59 ? -11.058 2.102   39.833 1.00 34.14 ? 58  GLU A CG  1 
ATOM   483  C  CD  . GLU A 1 59 ? -12.027 3.014   40.589 1.00 37.23 ? 58  GLU A CD  1 
ATOM   484  O  OE1 . GLU A 1 59 ? -12.593 3.982   39.981 1.00 38.50 ? 58  GLU A OE1 1 
ATOM   485  O  OE2 . GLU A 1 59 ? -12.217 2.748   41.808 1.00 42.19 ? 58  GLU A OE2 1 
ATOM   486  N  N   . THR A 1 60 ? -9.523  3.011   35.633 1.00 33.01 ? 59  THR A N   1 
ATOM   487  C  CA  . THR A 1 60 ? -9.430  3.456   34.231 1.00 32.86 ? 59  THR A CA  1 
ATOM   488  C  C   . THR A 1 60 ? -9.024  2.367   33.220 1.00 31.87 ? 59  THR A C   1 
ATOM   489  O  O   . THR A 1 60 ? -9.590  2.294   32.128 1.00 32.09 ? 59  THR A O   1 
ATOM   490  C  CB  . THR A 1 60 ? -8.440  4.605   34.083 1.00 33.18 ? 59  THR A CB  1 
ATOM   491  O  OG1 . THR A 1 60 ? -8.678  5.572   35.101 1.00 34.70 ? 59  THR A OG1 1 
ATOM   492  C  CG2 . THR A 1 60 ? -8.560  5.253   32.710 1.00 33.51 ? 59  THR A CG2 1 
ATOM   493  N  N   . LEU A 1 61 ? -8.043  1.539   33.567 1.00 31.51 ? 60  LEU A N   1 
ATOM   494  C  CA  . LEU A 1 61 ? -7.524  0.510   32.639 1.00 31.20 ? 60  LEU A CA  1 
ATOM   495  C  C   . LEU A 1 61 ? -8.287  -0.800  32.600 1.00 30.84 ? 60  LEU A C   1 
ATOM   496  O  O   . LEU A 1 61 ? -8.290  -1.492  31.589 1.00 26.41 ? 60  LEU A O   1 
ATOM   497  C  CB  . LEU A 1 61 ? -6.047  0.188   32.943 1.00 30.64 ? 60  LEU A CB  1 
ATOM   498  C  CG  . LEU A 1 61 ? -5.130  1.394   32.901 1.00 29.23 ? 60  LEU A CG  1 
ATOM   499  C  CD1 . LEU A 1 61 ? -3.688  0.973   33.240 1.00 27.95 ? 60  LEU A CD1 1 
ATOM   500  C  CD2 . LEU A 1 61 ? -5.235  2.095   31.543 1.00 28.97 ? 60  LEU A CD2 1 
ATOM   501  N  N   . ASP A 1 62 ? -8.873  -1.172  33.733 1.00 32.29 ? 61  ASP A N   1 
ATOM   502  C  CA  . ASP A 1 62 ? -9.526  -2.466  33.844 1.00 34.30 ? 61  ASP A CA  1 
ATOM   503  C  C   . ASP A 1 62 ? -10.924 -2.481  33.208 1.00 36.32 ? 61  ASP A C   1 
ATOM   504  O  O   . ASP A 1 62 ? -11.888 -2.021  33.820 1.00 37.43 ? 61  ASP A O   1 
ATOM   505  C  CB  . ASP A 1 62 ? -9.644  -2.861  35.319 1.00 34.42 ? 61  ASP A CB  1 
ATOM   506  C  CG  . ASP A 1 62 ? -10.049 -4.302  35.513 1.00 31.94 ? 61  ASP A CG  1 
ATOM   507  O  OD1 . ASP A 1 62 ? -9.829  -5.162  34.603 1.00 34.42 ? 61  ASP A OD1 1 
ATOM   508  O  OD2 . ASP A 1 62 ? -10.525 -4.597  36.626 1.00 31.04 ? 61  ASP A OD2 1 
ATOM   509  N  N   . ASN A 1 63 ? -11.023 -3.033  32.000 1.00 37.96 ? 62  ASN A N   1 
ATOM   510  C  CA  . ASN A 1 63 ? -12.273 -3.052  31.232 1.00 39.21 ? 62  ASN A CA  1 
ATOM   511  C  C   . ASN A 1 63 ? -13.167 -4.259  31.479 1.00 39.94 ? 62  ASN A C   1 
ATOM   512  O  O   . ASN A 1 63 ? -14.361 -4.232  31.171 1.00 40.27 ? 62  ASN A O   1 
ATOM   513  C  CB  . ASN A 1 63 ? -11.943 -3.028  29.744 1.00 40.20 ? 62  ASN A CB  1 
ATOM   514  C  CG  . ASN A 1 63 ? -11.736 -1.654  29.229 1.00 40.45 ? 62  ASN A CG  1 
ATOM   515  O  OD1 . ASN A 1 63 ? -12.087 -0.675  29.881 1.00 42.26 ? 62  ASN A OD1 1 
ATOM   516  N  ND2 . ASN A 1 63 ? -11.179 -1.559  28.028 1.00 43.87 ? 62  ASN A ND2 1 
ATOM   517  N  N   . ASP A 1 64 ? -12.589 -5.342  31.968 1.00 40.18 ? 63  ASP A N   1 
ATOM   518  C  CA  . ASP A 1 64 ? -13.415 -6.489  32.318 1.00 41.58 ? 63  ASP A CA  1 
ATOM   519  C  C   . ASP A 1 64 ? -13.751 -6.526  33.821 1.00 41.16 ? 63  ASP A C   1 
ATOM   520  O  O   . ASP A 1 64 ? -14.484 -7.384  34.264 1.00 42.37 ? 63  ASP A O   1 
ATOM   521  C  CB  . ASP A 1 64 ? -12.840 -7.818  31.778 1.00 41.37 ? 63  ASP A CB  1 
ATOM   522  C  CG  . ASP A 1 64 ? -11.360 -8.022  32.102 1.00 42.19 ? 63  ASP A CG  1 
ATOM   523  O  OD1 . ASP A 1 64 ? -10.856 -7.463  33.090 1.00 39.90 ? 63  ASP A OD1 1 
ATOM   524  O  OD2 . ASP A 1 64 ? -10.697 -8.782  31.373 1.00 46.73 ? 63  ASP A OD2 1 
ATOM   525  N  N   . GLY A 1 65 ? -13.218 -5.572  34.589 1.00 41.70 ? 64  GLY A N   1 
ATOM   526  C  CA  . GLY A 1 65 ? -13.467 -5.476  36.041 1.00 40.96 ? 64  GLY A CA  1 
ATOM   527  C  C   . GLY A 1 65 ? -13.089 -6.675  36.904 1.00 41.11 ? 64  GLY A C   1 
ATOM   528  O  O   . GLY A 1 65 ? -13.786 -6.977  37.891 1.00 40.92 ? 64  GLY A O   1 
ATOM   529  N  N   . ASP A 1 66 ? -11.982 -7.334  36.542 1.00 40.43 ? 65  ASP A N   1 
ATOM   530  C  CA  . ASP A 1 66 ? -11.345 -8.379  37.340 1.00 40.21 ? 65  ASP A CA  1 
ATOM   531  C  C   . ASP A 1 66 ? -10.246 -7.830  38.262 1.00 39.84 ? 65  ASP A C   1 
ATOM   532  O  O   . ASP A 1 66 ? -9.489  -8.594  38.864 1.00 40.53 ? 65  ASP A O   1 
ATOM   533  C  CB  . ASP A 1 66 ? -10.777 -9.508  36.447 1.00 39.66 ? 65  ASP A CB  1 
ATOM   534  C  CG  . ASP A 1 66 ? -9.477  -9.116  35.683 1.00 40.25 ? 65  ASP A CG  1 
ATOM   535  O  OD1 . ASP A 1 66 ? -8.974  -7.976  35.797 1.00 39.69 ? 65  ASP A OD1 1 
ATOM   536  O  OD2 . ASP A 1 66 ? -8.956  -9.968  34.937 1.00 38.53 ? 65  ASP A OD2 1 
ATOM   537  N  N   . GLY A 1 67 ? -10.138 -6.506  38.314 1.00 39.47 ? 66  GLY A N   1 
ATOM   538  C  CA  . GLY A 1 67 ? -9.200  -5.819  39.208 1.00 37.94 ? 66  GLY A CA  1 
ATOM   539  C  C   . GLY A 1 67 ? -7.726  -5.925  38.827 1.00 36.84 ? 66  GLY A C   1 
ATOM   540  O  O   . GLY A 1 67 ? -6.862  -5.463  39.586 1.00 36.80 ? 66  GLY A O   1 
ATOM   541  N  N   . GLU A 1 68 ? -7.443  -6.556  37.677 1.00 35.21 ? 67  GLU A N   1 
ATOM   542  C  CA  . GLU A 1 68 ? -6.080  -6.675  37.121 1.00 32.53 ? 67  GLU A CA  1 
ATOM   543  C  C   . GLU A 1 68 ? -6.013  -6.069  35.714 1.00 31.58 ? 67  GLU A C   1 
ATOM   544  O  O   . GLU A 1 68 ? -7.052  -5.729  35.123 1.00 30.49 ? 67  GLU A O   1 
ATOM   545  C  CB  . GLU A 1 68 ? -5.557  -8.132  37.154 1.00 33.26 ? 67  GLU A CB  1 
ATOM   546  C  CG  . GLU A 1 68 ? -5.613  -8.742  38.550 1.00 33.18 ? 67  GLU A CG  1 
ATOM   547  C  CD  . GLU A 1 68 ? -4.453  -9.652  38.941 1.00 34.82 ? 67  GLU A CD  1 
ATOM   548  O  OE1 . GLU A 1 68 ? -3.445  -9.818  38.224 1.00 38.19 ? 67  GLU A OE1 1 
ATOM   549  O  OE2 . GLU A 1 68 ? -4.538  -10.215 40.036 1.00 39.09 ? 67  GLU A OE2 1 
ATOM   550  N  N   . CYS A 1 69 ? -4.799  -5.856  35.224 1.00 28.94 ? 68  CYS A N   1 
ATOM   551  C  CA  . CYS A 1 69 ? -4.587  -5.284  33.898 1.00 29.27 ? 68  CYS A CA  1 
ATOM   552  C  C   . CYS A 1 69 ? -3.931  -6.394  33.111 1.00 29.59 ? 68  CYS A C   1 
ATOM   553  O  O   . CYS A 1 69 ? -2.813  -6.836  33.421 1.00 28.43 ? 68  CYS A O   1 
ATOM   554  C  CB  . CYS A 1 69 ? -3.727  -3.988  33.948 1.00 29.60 ? 68  CYS A CB  1 
ATOM   555  S  SG  . CYS A 1 69 ? -3.418  -3.173  32.328 1.00 27.50 ? 68  CYS A SG  1 
ATOM   556  N  N   . ASP A 1 70 ? -4.673  -6.939  32.155 1.00 30.69 ? 69  ASP A N   1 
ATOM   557  C  CA  . ASP A 1 70 ? -4.140  -7.987  31.308 1.00 31.91 ? 69  ASP A CA  1 
ATOM   558  C  C   . ASP A 1 70 ? -3.479  -7.355  30.073 1.00 31.08 ? 69  ASP A C   1 
ATOM   559  O  O   . ASP A 1 70 ? -3.443  -6.121  29.969 1.00 29.78 ? 69  ASP A O   1 
ATOM   560  C  CB  . ASP A 1 70 ? -5.255  -8.977  30.937 1.00 33.84 ? 69  ASP A CB  1 
ATOM   561  C  CG  . ASP A 1 70 ? -6.022  -8.557  29.702 1.00 37.26 ? 69  ASP A CG  1 
ATOM   562  O  OD1 . ASP A 1 70 ? -5.511  -8.775  28.582 1.00 44.29 ? 69  ASP A OD1 1 
ATOM   563  O  OD2 . ASP A 1 70 ? -7.150  -8.062  29.840 1.00 42.94 ? 69  ASP A OD2 1 
ATOM   564  N  N   . PHE A 1 71 ? -2.969  -8.185  29.148 1.00 30.30 ? 70  PHE A N   1 
ATOM   565  C  CA  . PHE A 1 71 ? -2.176  -7.671  28.024 1.00 31.18 ? 70  PHE A CA  1 
ATOM   566  C  C   . PHE A 1 71 ? -2.881  -6.685  27.094 1.00 30.17 ? 70  PHE A C   1 
ATOM   567  O  O   . PHE A 1 71 ? -2.264  -5.719  26.648 1.00 28.12 ? 70  PHE A O   1 
ATOM   568  C  CB  . PHE A 1 71 ? -1.398  -8.749  27.217 1.00 32.40 ? 70  PHE A CB  1 
ATOM   569  C  CG  . PHE A 1 71 ? -0.319  -8.148  26.351 1.00 33.10 ? 70  PHE A CG  1 
ATOM   570  C  CD1 . PHE A 1 71 ? 0.794   -7.545  26.928 1.00 34.63 ? 70  PHE A CD1 1 
ATOM   571  C  CD2 . PHE A 1 71 ? -0.460  -8.090  24.971 1.00 34.80 ? 70  PHE A CD2 1 
ATOM   572  C  CE1 . PHE A 1 71 ? 1.750   -6.944  26.160 1.00 36.56 ? 70  PHE A CE1 1 
ATOM   573  C  CE2 . PHE A 1 71 ? 0.508   -7.483  24.184 1.00 34.52 ? 70  PHE A CE2 1 
ATOM   574  C  CZ  . PHE A 1 71 ? 1.609   -6.907  24.773 1.00 36.06 ? 70  PHE A CZ  1 
ATOM   575  N  N   . GLN A 1 72 ? -4.173  -6.911  26.841 1.00 29.42 ? 71  GLN A N   1 
ATOM   576  C  CA  . GLN A 1 72 ? -4.936  -6.012  25.984 1.00 28.93 ? 71  GLN A CA  1 
ATOM   577  C  C   . GLN A 1 72 ? -5.124  -4.662  26.636 1.00 27.63 ? 71  GLN A C   1 
ATOM   578  O  O   . GLN A 1 72 ? -5.115  -3.608  25.978 1.00 26.25 ? 71  GLN A O   1 
ATOM   579  C  CB  . GLN A 1 72 ? -6.307  -6.596  25.698 1.00 30.61 ? 71  GLN A CB  1 
ATOM   580  C  CG  . GLN A 1 72 ? -7.189  -5.651  24.917 1.00 33.54 ? 71  GLN A CG  1 
ATOM   581  C  CD  . GLN A 1 72 ? -8.615  -6.114  24.884 1.00 39.54 ? 71  GLN A CD  1 
ATOM   582  O  OE1 . GLN A 1 72 ? -9.001  -7.032  25.618 1.00 43.15 ? 71  GLN A OE1 1 
ATOM   583  N  NE2 . GLN A 1 72 ? -9.414  -5.492  24.026 1.00 41.34 ? 71  GLN A NE2 1 
ATOM   584  N  N   . GLU A 1 73 ? -5.293  -4.705  27.938 1.00 25.11 ? 72  GLU A N   1 
ATOM   585  C  CA  . GLU A 1 73 ? -5.544  -3.509  28.728 1.00 26.11 ? 72  GLU A CA  1 
ATOM   586  C  C   . GLU A 1 73 ? -4.290  -2.695  28.898 1.00 24.61 ? 72  GLU A C   1 
ATOM   587  O  O   . GLU A 1 73 ? -4.336  -1.441  28.986 1.00 26.38 ? 72  GLU A O   1 
ATOM   588  C  CB  . GLU A 1 73 ? -6.104  -3.917  30.095 1.00 25.65 ? 72  GLU A CB  1 
ATOM   589  C  CG  . GLU A 1 73 ? -7.584  -4.307  30.022 1.00 28.27 ? 72  GLU A CG  1 
ATOM   590  C  CD  . GLU A 1 73 ? -7.993  -5.286  31.105 1.00 30.04 ? 72  GLU A CD  1 
ATOM   591  O  OE1 . GLU A 1 73 ? -7.170  -5.639  31.987 1.00 29.81 ? 72  GLU A OE1 1 
ATOM   592  O  OE2 . GLU A 1 73 ? -9.138  -5.738  31.074 1.00 32.83 ? 72  GLU A OE2 1 
ATOM   593  N  N   . PHE A 1 74 ? -3.160  -3.393  28.928 1.00 24.56 ? 73  PHE A N   1 
ATOM   594  C  CA  . PHE A 1 74 ? -1.858  -2.741  29.023 1.00 23.77 ? 73  PHE A CA  1 
ATOM   595  C  C   . PHE A 1 74 ? -1.562  -2.057  27.693 1.00 23.50 ? 73  PHE A C   1 
ATOM   596  O  O   . PHE A 1 74 ? -1.116  -0.914  27.660 1.00 22.90 ? 73  PHE A O   1 
ATOM   597  C  CB  . PHE A 1 74 ? -0.756  -3.721  29.447 1.00 23.47 ? 73  PHE A CB  1 
ATOM   598  C  CG  . PHE A 1 74 ? 0.598   -3.133  29.364 1.00 25.51 ? 73  PHE A CG  1 
ATOM   599  C  CD1 . PHE A 1 74 ? 0.970   -2.087  30.225 1.00 24.48 ? 73  PHE A CD1 1 
ATOM   600  C  CD2 . PHE A 1 74 ? 1.509   -3.571  28.371 1.00 24.24 ? 73  PHE A CD2 1 
ATOM   601  C  CE1 . PHE A 1 74 ? 2.240   -1.518  30.121 1.00 20.17 ? 73  PHE A CE1 1 
ATOM   602  C  CE2 . PHE A 1 74 ? 2.761   -3.015  28.282 1.00 24.64 ? 73  PHE A CE2 1 
ATOM   603  C  CZ  . PHE A 1 74 ? 3.112   -1.953  29.150 1.00 23.19 ? 73  PHE A CZ  1 
ATOM   604  N  N   . MET A 1 75 ? -1.935  -2.699  26.595 1.00 23.61 ? 74  MET A N   1 
ATOM   605  C  CA  . MET A 1 75 ? -1.848  -2.065  25.244 1.00 23.78 ? 74  MET A CA  1 
ATOM   606  C  C   . MET A 1 75 ? -2.678  -0.764  25.065 1.00 23.31 ? 74  MET A C   1 
ATOM   607  O  O   . MET A 1 75 ? -2.229  0.206   24.397 1.00 22.00 ? 74  MET A O   1 
ATOM   608  C  CB  . MET A 1 75 ? -2.160  -3.112  24.139 1.00 25.66 ? 74  MET A CB  1 
ATOM   609  C  CG  . MET A 1 75 ? -0.920  -3.975  23.673 1.00 27.92 ? 74  MET A CG  1 
ATOM   610  S  SD  . MET A 1 75 ? 0.698   -3.198  23.416 1.00 38.06 ? 74  MET A SD  1 
ATOM   611  C  CE  . MET A 1 75 ? 0.341   -1.879  22.227 1.00 38.02 ? 74  MET A CE  1 
ATOM   612  N  N   . ALA A 1 76 ? -3.890  -0.718  25.629 1.00 22.64 ? 75  ALA A N   1 
ATOM   613  C  CA  . ALA A 1 76 ? -4.680  0.498   25.548 1.00 22.82 ? 75  ALA A CA  1 
ATOM   614  C  C   . ALA A 1 76 ? -3.992  1.595   26.375 1.00 22.80 ? 75  ALA A C   1 
ATOM   615  O  O   . ALA A 1 76 ? -3.929  2.761   25.975 1.00 23.21 ? 75  ALA A O   1 
ATOM   616  C  CB  . ALA A 1 76 ? -6.124  0.273   26.017 1.00 23.21 ? 75  ALA A CB  1 
ATOM   617  N  N   . PHE A 1 77 ? -3.439  1.198   27.505 1.00 22.81 ? 76  PHE A N   1 
ATOM   618  C  CA  . PHE A 1 77 ? -2.601  2.103   28.315 1.00 23.52 ? 76  PHE A CA  1 
ATOM   619  C  C   . PHE A 1 77 ? -1.420  2.643   27.501 1.00 22.78 ? 76  PHE A C   1 
ATOM   620  O  O   . PHE A 1 77 ? -1.223  3.866   27.416 1.00 22.39 ? 76  PHE A O   1 
ATOM   621  C  CB  . PHE A 1 77 ? -2.166  1.435   29.638 1.00 21.37 ? 76  PHE A CB  1 
ATOM   622  C  CG  . PHE A 1 77 ? -1.292  2.318   30.543 1.00 21.98 ? 76  PHE A CG  1 
ATOM   623  C  CD1 . PHE A 1 77 ? -1.722  3.581   30.934 1.00 17.06 ? 76  PHE A CD1 1 
ATOM   624  C  CD2 . PHE A 1 77 ? -0.068  1.844   31.041 1.00 23.83 ? 76  PHE A CD2 1 
ATOM   625  C  CE1 . PHE A 1 77 ? -0.945  4.402   31.770 1.00 22.75 ? 76  PHE A CE1 1 
ATOM   626  C  CE2 . PHE A 1 77 ? 0.728   2.627   31.914 1.00 19.46 ? 76  PHE A CE2 1 
ATOM   627  C  CZ  . PHE A 1 77 ? 0.321   3.910   32.250 1.00 22.37 ? 76  PHE A CZ  1 
ATOM   628  N  N   . VAL A 1 78 ? -0.670  1.750   26.857 1.00 22.99 ? 77  VAL A N   1 
ATOM   629  C  CA  . VAL A 1 78 ? 0.489   2.152   26.057 1.00 24.34 ? 77  VAL A CA  1 
ATOM   630  C  C   . VAL A 1 78 ? 0.107   3.236   25.018 1.00 25.53 ? 77  VAL A C   1 
ATOM   631  O  O   . VAL A 1 78 ? 0.803   4.261   24.881 1.00 27.52 ? 77  VAL A O   1 
ATOM   632  C  CB  . VAL A 1 78 ? 1.151   0.941   25.292 1.00 23.46 ? 77  VAL A CB  1 
ATOM   633  C  CG1 . VAL A 1 78 ? 2.213   1.452   24.352 1.00 23.91 ? 77  VAL A CG1 1 
ATOM   634  C  CG2 . VAL A 1 78 ? 1.782   -0.037  26.273 1.00 23.23 ? 77  VAL A CG2 1 
ATOM   635  N  N   . ALA A 1 79 ? -0.992  2.990   24.312 1.00 25.97 ? 78  ALA A N   1 
ATOM   636  C  CA  . ALA A 1 79 ? -1.493  3.845   23.252 1.00 27.21 ? 78  ALA A CA  1 
ATOM   637  C  C   . ALA A 1 79 ? -1.956  5.192   23.818 1.00 27.50 ? 78  ALA A C   1 
ATOM   638  O  O   . ALA A 1 79 ? -1.684  6.230   23.251 1.00 26.95 ? 78  ALA A O   1 
ATOM   639  C  CB  . ALA A 1 79 ? -2.647  3.117   22.501 1.00 27.75 ? 78  ALA A CB  1 
ATOM   640  N  N   . MET A 1 80 ? -2.589  5.196   24.982 1.00 28.79 ? 79  MET A N   1 
ATOM   641  C  CA  . MET A 1 80 ? -2.941  6.482   25.580 1.00 31.58 ? 79  MET A CA  1 
ATOM   642  C  C   . MET A 1 80 ? -1.763  7.291   26.093 1.00 29.77 ? 79  MET A C   1 
ATOM   643  O  O   . MET A 1 80 ? -1.798  8.511   26.021 1.00 30.36 ? 79  MET A O   1 
ATOM   644  C  CB  . MET A 1 80 ? -4.005  6.331   26.652 1.00 32.02 ? 79  MET A CB  1 
ATOM   645  C  CG  . MET A 1 80 ? -5.423  6.308   26.114 1.00 32.46 ? 79  MET A CG  1 
ATOM   646  S  SD  . MET A 1 80 ? -6.562  7.259   27.137 1.00 40.82 ? 79  MET A SD  1 
ATOM   647  C  CE  . MET A 1 80 ? -6.449  8.918   26.438 1.00 38.79 ? 79  MET A CE  1 
ATOM   648  N  N   . VAL A 1 81 ? -0.714  6.652   26.612 1.00 28.97 ? 80  VAL A N   1 
ATOM   649  C  CA  . VAL A 1 81 ? 0.453   7.446   26.996 1.00 27.88 ? 80  VAL A CA  1 
ATOM   650  C  C   . VAL A 1 81 ? 1.141   7.982   25.732 1.00 28.38 ? 80  VAL A C   1 
ATOM   651  O  O   . VAL A 1 81 ? 1.422   9.174   25.633 1.00 28.17 ? 80  VAL A O   1 
ATOM   652  C  CB  . VAL A 1 81 ? 1.445   6.689   27.899 1.00 27.42 ? 80  VAL A CB  1 
ATOM   653  C  CG1 . VAL A 1 81 ? 2.595   7.600   28.292 1.00 25.77 ? 80  VAL A CG1 1 
ATOM   654  C  CG2 . VAL A 1 81 ? 0.740   6.185   29.160 1.00 27.24 ? 80  VAL A CG2 1 
ATOM   655  N  N   . THR A 1 82 ? 1.404   7.080   24.783 1.00 28.75 ? 81  THR A N   1 
ATOM   656  C  CA  . THR A 1 82 ? 2.002   7.395   23.479 1.00 30.71 ? 81  THR A CA  1 
ATOM   657  C  C   . THR A 1 82 ? 1.296   8.572   22.792 1.00 32.86 ? 81  THR A C   1 
ATOM   658  O  O   . THR A 1 82 ? 1.944   9.510   22.324 1.00 34.12 ? 81  THR A O   1 
ATOM   659  C  CB  . THR A 1 82 ? 2.023   6.126   22.595 1.00 29.14 ? 81  THR A CB  1 
ATOM   660  O  OG1 . THR A 1 82 ? 2.618   5.058   23.352 1.00 27.18 ? 81  THR A OG1 1 
ATOM   661  C  CG2 . THR A 1 82 ? 2.836   6.317   21.347 1.00 29.16 ? 81  THR A CG2 1 
ATOM   662  N  N   . THR A 1 83 ? -0.022  8.529   22.758 1.00 35.45 ? 82  THR A N   1 
ATOM   663  C  CA  . THR A 1 83 ? -0.826  9.663   22.262 1.00 38.24 ? 82  THR A CA  1 
ATOM   664  C  C   . THR A 1 83 ? -0.593  10.967  23.059 1.00 39.24 ? 82  THR A C   1 
ATOM   665  O  O   . THR A 1 83 ? -0.256  11.992  22.450 1.00 39.65 ? 82  THR A O   1 
ATOM   666  C  CB  . THR A 1 83 ? -2.322  9.319   22.154 1.00 38.00 ? 82  THR A CB  1 
ATOM   667  O  OG1 . THR A 1 83 ? -2.465  8.052   21.498 1.00 38.88 ? 82  THR A OG1 1 
ATOM   668  C  CG2 . THR A 1 83 ? -3.051  10.398  21.335 1.00 38.54 ? 82  THR A CG2 1 
ATOM   669  N  N   . ALA A 1 84 ? -0.707  10.933  24.392 1.00 40.55 ? 83  ALA A N   1 
ATOM   670  C  CA  . ALA A 1 84 ? -0.383  12.132  25.211 1.00 41.45 ? 83  ALA A CA  1 
ATOM   671  C  C   . ALA A 1 84 ? 1.078   12.602  25.083 1.00 42.87 ? 83  ALA A C   1 
ATOM   672  O  O   . ALA A 1 84 ? 1.394   13.760  25.392 1.00 42.87 ? 83  ALA A O   1 
ATOM   673  C  CB  . ALA A 1 84 ? -0.758  11.941  26.684 1.00 41.57 ? 83  ALA A CB  1 
ATOM   674  N  N   . CYS A 1 85 ? 1.959   11.712  24.635 1.00 44.13 ? 84  CYS A N   1 
ATOM   675  C  CA  . CYS A 1 85 ? 3.278   12.110  24.158 1.00 45.67 ? 84  CYS A CA  1 
ATOM   676  C  C   . CYS A 1 85 ? 3.220   12.693  22.736 1.00 46.84 ? 84  CYS A C   1 
ATOM   677  O  O   . CYS A 1 85 ? 3.814   13.726  22.481 1.00 46.87 ? 84  CYS A O   1 
ATOM   678  C  CB  . CYS A 1 85 ? 4.281   10.942  24.226 1.00 45.50 ? 84  CYS A CB  1 
ATOM   679  S  SG  . CYS A 1 85 ? 5.844   11.335  23.448 0.75 45.74 ? 84  CYS A SG  1 
ATOM   680  N  N   . HIS A 1 86 ? 2.512   12.030  21.820 1.00 48.96 ? 85  HIS A N   1 
ATOM   681  C  CA  . HIS A 1 86 ? 2.431   12.488  20.422 1.00 50.83 ? 85  HIS A CA  1 
ATOM   682  C  C   . HIS A 1 86 ? 1.938   13.927  20.339 1.00 52.08 ? 85  HIS A C   1 
ATOM   683  O  O   . HIS A 1 86 ? 2.490   14.707  19.579 1.00 52.52 ? 85  HIS A O   1 
ATOM   684  C  CB  . HIS A 1 86 ? 1.597   11.543  19.535 1.00 50.98 ? 85  HIS A CB  1 
ATOM   685  C  CG  . HIS A 1 86 ? 1.473   11.989  18.106 1.00 51.09 ? 85  HIS A CG  1 
ATOM   686  N  ND1 . HIS A 1 86 ? 0.260   12.070  17.453 1.00 51.59 ? 85  HIS A ND1 1 
ATOM   687  C  CD2 . HIS A 1 86 ? 2.408   12.389  17.210 1.00 51.98 ? 85  HIS A CD2 1 
ATOM   688  C  CE1 . HIS A 1 86 ? 0.452   12.498  16.218 1.00 51.41 ? 85  HIS A CE1 1 
ATOM   689  N  NE2 . HIS A 1 86 ? 1.745   12.713  16.049 1.00 53.05 ? 85  HIS A NE2 1 
ATOM   690  N  N   . GLU A 1 87 ? 0.938   14.281  21.145 1.00 53.37 ? 86  GLU A N   1 
ATOM   691  C  CA  . GLU A 1 87 ? 0.475   15.679  21.270 1.00 54.72 ? 86  GLU A CA  1 
ATOM   692  C  C   . GLU A 1 87 ? 1.598   16.696  21.595 1.00 55.33 ? 86  GLU A C   1 
ATOM   693  O  O   . GLU A 1 87 ? 1.336   17.896  21.726 1.00 55.36 ? 86  GLU A O   1 
ATOM   694  C  CB  . GLU A 1 87 ? -0.632  15.792  22.334 1.00 54.60 ? 86  GLU A CB  1 
ATOM   695  C  CG  . GLU A 1 87 ? -1.823  14.882  22.131 1.00 55.38 ? 86  GLU A CG  1 
ATOM   696  C  CD  . GLU A 1 87 ? -2.816  15.393  21.106 1.00 56.84 ? 86  GLU A CD  1 
ATOM   697  O  OE1 . GLU A 1 87 ? -3.486  14.539  20.483 1.00 57.91 ? 86  GLU A OE1 1 
ATOM   698  O  OE2 . GLU A 1 87 ? -2.943  16.633  20.936 1.00 57.13 ? 86  GLU A OE2 1 
ATOM   699  N  N   . PHE A 1 88 ? 2.828   16.196  21.743 1.00 56.23 ? 87  PHE A N   1 
ATOM   700  C  CA  . PHE A 1 88 ? 4.030   17.007  22.013 1.00 56.71 ? 87  PHE A CA  1 
ATOM   701  C  C   . PHE A 1 88 ? 4.797   17.241  20.715 1.00 56.92 ? 87  PHE A C   1 
ATOM   702  O  O   . PHE A 1 88 ? 5.530   18.234  20.566 1.00 57.15 ? 87  PHE A O   1 
ATOM   703  C  CB  . PHE A 1 88 ? 4.896   16.346  23.120 1.00 56.94 ? 87  PHE A CB  1 
ATOM   704  C  CG  . PHE A 1 88 ? 6.393   16.380  22.865 1.00 56.88 ? 87  PHE A CG  1 
ATOM   705  C  CD1 . PHE A 1 88 ? 7.142   17.519  23.149 1.00 56.60 ? 87  PHE A CD1 1 
ATOM   706  C  CD2 . PHE A 1 88 ? 7.049   15.259  22.368 1.00 56.35 ? 87  PHE A CD2 1 
ATOM   707  C  CE1 . PHE A 1 88 ? 8.517   17.551  22.917 1.00 56.75 ? 87  PHE A CE1 1 
ATOM   708  C  CE2 . PHE A 1 88 ? 8.413   15.276  22.131 1.00 57.30 ? 87  PHE A CE2 1 
ATOM   709  C  CZ  . PHE A 1 88 ? 9.155   16.429  22.403 1.00 57.76 ? 87  PHE A CZ  1 
ATOM   710  N  N   . PHE A 1 89 ? 4.621   16.310  19.781 1.00 57.38 ? 88  PHE A N   1 
ATOM   711  C  CA  . PHE A 1 89 ? 5.038   16.495  18.400 1.00 57.55 ? 88  PHE A CA  1 
ATOM   712  C  C   . PHE A 1 89 ? 3.902   17.201  17.666 1.00 57.45 ? 88  PHE A C   1 
ATOM   713  O  O   . PHE A 1 89 ? 3.692   16.956  16.482 1.00 57.97 ? 88  PHE A O   1 
ATOM   714  C  CB  . PHE A 1 89 ? 5.316   15.142  17.723 1.00 57.81 ? 88  PHE A CB  1 
ATOM   715  C  CG  . PHE A 1 89 ? 6.461   14.363  18.324 1.00 57.77 ? 88  PHE A CG  1 
ATOM   716  C  CD1 . PHE A 1 89 ? 6.253   13.518  19.407 1.00 57.24 ? 88  PHE A CD1 1 
ATOM   717  C  CD2 . PHE A 1 89 ? 7.746   14.465  17.790 1.00 57.66 ? 88  PHE A CD2 1 
ATOM   718  C  CE1 . PHE A 1 89 ? 7.310   12.788  19.962 1.00 58.10 ? 88  PHE A CE1 1 
ATOM   719  C  CE2 . PHE A 1 89 ? 8.815   13.737  18.332 1.00 58.87 ? 88  PHE A CE2 1 
ATOM   720  C  CZ  . PHE A 1 89 ? 8.596   12.894  19.419 1.00 58.31 ? 88  PHE A CZ  1 
ATOM   721  N  N   . GLU A 1 90 ? 3.164   18.063  18.370 1.00 57.33 ? 89  GLU A N   1 
ATOM   722  C  CA  . GLU A 1 90 ? 2.051   18.815  17.773 1.00 57.09 ? 89  GLU A CA  1 
ATOM   723  C  C   . GLU A 1 90 ? 2.494   20.130  17.139 1.00 56.81 ? 89  GLU A C   1 
ATOM   724  O  O   . GLU A 1 90 ? 1.745   21.116  17.151 1.00 56.84 ? 89  GLU A O   1 
ATOM   725  C  CB  . GLU A 1 90 ? 0.957   19.099  18.802 1.00 56.95 ? 89  GLU A CB  1 
ATOM   726  C  CG  . GLU A 1 90 ? -0.226  18.128  18.789 1.00 57.40 ? 89  GLU A CG  1 
ATOM   727  C  CD  . GLU A 1 90 ? -1.025  18.143  17.497 1.00 57.51 ? 89  GLU A CD  1 
ATOM   728  O  OE1 . GLU A 1 90 ? -1.020  19.158  16.768 1.00 58.44 ? 89  GLU A OE1 1 
ATOM   729  O  OE2 . GLU A 1 90 ? -1.670  17.121  17.217 1.00 57.56 ? 89  GLU A OE2 1 
ATOM   730  N  N   . MET B 1 1  ? 16.320  6.762   28.255 1.00 38.18 ? 0   MET B N   1 
ATOM   731  C  CA  . MET B 1 1  ? 14.901  6.403   28.464 1.00 37.49 ? 0   MET B CA  1 
ATOM   732  C  C   . MET B 1 1  ? 14.858  4.919   28.835 1.00 35.68 ? 0   MET B C   1 
ATOM   733  O  O   . MET B 1 1  ? 15.815  4.183   28.569 1.00 34.46 ? 0   MET B O   1 
ATOM   734  C  CB  . MET B 1 1  ? 14.053  6.653   27.196 1.00 37.63 ? 0   MET B CB  1 
ATOM   735  C  CG  . MET B 1 1  ? 14.704  7.391   25.998 1.00 39.22 ? 0   MET B CG  1 
ATOM   736  S  SD  . MET B 1 1  ? 13.649  7.426   24.502 1.00 42.62 ? 0   MET B SD  1 
ATOM   737  C  CE  . MET B 1 1  ? 12.155  8.149   25.150 1.00 40.66 ? 0   MET B CE  1 
ATOM   738  N  N   . SER B 1 2  ? 13.751  4.468   29.437 1.00 33.54 ? 1   SER B N   1 
ATOM   739  C  CA  . SER B 1 2  ? 13.653  3.053   29.803 1.00 31.36 ? 1   SER B CA  1 
ATOM   740  C  C   . SER B 1 2  ? 13.379  2.238   28.550 1.00 30.40 ? 1   SER B C   1 
ATOM   741  O  O   . SER B 1 2  ? 13.276  2.782   27.457 1.00 29.65 ? 1   SER B O   1 
ATOM   742  C  CB  . SER B 1 2  ? 12.614  2.798   30.907 1.00 30.46 ? 1   SER B CB  1 
ATOM   743  O  OG  . SER B 1 2  ? 11.265  3.005   30.465 1.00 30.87 ? 1   SER B OG  1 
ATOM   744  N  N   . GLU B 1 3  ? 13.287  0.929   28.706 1.00 30.49 ? 2   GLU B N   1 
ATOM   745  C  CA  . GLU B 1 3  ? 12.997  0.062   27.570 1.00 30.18 ? 2   GLU B CA  1 
ATOM   746  C  C   . GLU B 1 3  ? 11.574  0.306   27.028 1.00 28.10 ? 2   GLU B C   1 
ATOM   747  O  O   . GLU B 1 3  ? 11.351  0.249   25.821 1.00 30.66 ? 2   GLU B O   1 
ATOM   748  C  CB  . GLU B 1 3  ? 13.288  -1.398  27.932 1.00 30.50 ? 2   GLU B CB  1 
ATOM   749  C  CG  . GLU B 1 3  ? 14.590  -2.013  27.327 1.00 34.98 ? 2   GLU B CG  1 
ATOM   750  C  CD  . GLU B 1 3  ? 15.755  -1.042  27.111 1.00 41.98 ? 2   GLU B CD  1 
ATOM   751  O  OE1 . GLU B 1 3  ? 16.572  -1.331  26.203 1.00 44.53 ? 2   GLU B OE1 1 
ATOM   752  O  OE2 . GLU B 1 3  ? 15.871  -0.006  27.823 1.00 42.49 ? 2   GLU B OE2 1 
ATOM   753  N  N   . LEU B 1 4  ? 10.640  0.668   27.901 1.00 26.63 ? 3   LEU B N   1 
ATOM   754  C  CA  . LEU B 1 4  ? 9.283   1.073   27.495 1.00 23.47 ? 3   LEU B CA  1 
ATOM   755  C  C   . LEU B 1 4  ? 9.216   2.452   26.844 1.00 22.65 ? 3   LEU B C   1 
ATOM   756  O  O   . LEU B 1 4  ? 8.547   2.634   25.818 1.00 18.64 ? 3   LEU B O   1 
ATOM   757  C  CB  . LEU B 1 4  ? 8.320   1.028   28.709 1.00 22.43 ? 3   LEU B CB  1 
ATOM   758  C  CG  . LEU B 1 4  ? 6.866   1.417   28.439 1.00 22.46 ? 3   LEU B CG  1 
ATOM   759  C  CD1 . LEU B 1 4  ? 6.264   0.640   27.242 1.00 24.39 ? 3   LEU B CD1 1 
ATOM   760  C  CD2 . LEU B 1 4  ? 6.044   1.116   29.684 1.00 24.35 ? 3   LEU B CD2 1 
ATOM   761  N  N   . GLU B 1 5  ? 9.915   3.429   27.440 1.00 22.08 ? 4   GLU B N   1 
ATOM   762  C  CA  . GLU B 1 5  ? 9.906   4.785   26.887 1.00 24.25 ? 4   GLU B CA  1 
ATOM   763  C  C   . GLU B 1 5  ? 10.520  4.824   25.489 1.00 25.11 ? 4   GLU B C   1 
ATOM   764  O  O   . GLU B 1 5  ? 9.983   5.476   24.594 1.00 25.18 ? 4   GLU B O   1 
ATOM   765  C  CB  . GLU B 1 5  ? 10.579  5.802   27.833 1.00 21.36 ? 4   GLU B CB  1 
ATOM   766  C  CG  . GLU B 1 5  ? 9.757   6.041   29.050 1.00 20.10 ? 4   GLU B CG  1 
ATOM   767  C  CD  . GLU B 1 5  ? 10.525  6.744   30.172 1.00 23.83 ? 4   GLU B CD  1 
ATOM   768  O  OE1 . GLU B 1 5  ? 11.749  6.594   30.247 1.00 23.22 ? 4   GLU B OE1 1 
ATOM   769  O  OE2 . GLU B 1 5  ? 9.890   7.452   30.977 1.00 19.24 ? 4   GLU B OE2 1 
ATOM   770  N  N   . LYS B 1 6  ? 11.624  4.113   25.308 1.00 27.76 ? 5   LYS B N   1 
ATOM   771  C  CA  . LYS B 1 6  ? 12.284  4.049   24.004 1.00 29.29 ? 5   LYS B CA  1 
ATOM   772  C  C   . LYS B 1 6  ? 11.327  3.441   22.954 1.00 29.55 ? 5   LYS B C   1 
ATOM   773  O  O   . LYS B 1 6  ? 11.169  3.998   21.873 1.00 29.81 ? 5   LYS B O   1 
ATOM   774  C  CB  . LYS B 1 6  ? 13.616  3.313   24.086 1.00 29.11 ? 5   LYS B CB  1 
ATOM   775  C  CG  . LYS B 1 6  ? 14.692  4.052   24.877 1.00 28.79 ? 5   LYS B CG  1 
ATOM   776  C  CD  . LYS B 1 6  ? 16.119  3.584   24.555 1.00 32.04 ? 5   LYS B CD  1 
ATOM   777  C  CE  . LYS B 1 6  ? 16.429  2.183   25.035 1.00 34.86 ? 5   LYS B CE  1 
ATOM   778  N  NZ  . LYS B 1 6  ? 17.924  1.924   25.024 1.00 37.77 ? 5   LYS B NZ  1 
ATOM   779  N  N   . ALA B 1 7  ? 10.656  2.349   23.327 1.00 30.92 ? 6   ALA B N   1 
ATOM   780  C  CA  . ALA B 1 7  ? 9.623   1.678   22.499 1.00 29.89 ? 6   ALA B CA  1 
ATOM   781  C  C   . ALA B 1 7  ? 8.490   2.619   22.097 1.00 29.81 ? 6   ALA B C   1 
ATOM   782  O  O   . ALA B 1 7  ? 8.066   2.624   20.935 1.00 30.61 ? 6   ALA B O   1 
ATOM   783  C  CB  . ALA B 1 7  ? 9.090   0.444   23.208 1.00 29.94 ? 6   ALA B CB  1 
ATOM   784  N  N   . MET B 1 8  ? 8.013   3.438   23.037 1.00 29.14 ? 7   MET B N   1 
ATOM   785  C  CA  . MET B 1 8  ? 6.949   4.395   22.754 1.00 27.94 ? 7   MET B CA  1 
ATOM   786  C  C   . MET B 1 8  ? 7.367   5.482   21.770 1.00 28.82 ? 7   MET B C   1 
ATOM   787  O  O   . MET B 1 8  ? 6.550   5.945   20.961 1.00 25.77 ? 7   MET B O   1 
ATOM   788  C  CB  . MET B 1 8  ? 6.470   5.060   24.039 1.00 28.85 ? 7   MET B CB  1 
ATOM   789  C  CG  . MET B 1 8  ? 5.460   4.219   24.801 1.00 25.28 ? 7   MET B CG  1 
ATOM   790  S  SD  . MET B 1 8  ? 5.266   4.820   26.489 1.00 28.77 ? 7   MET B SD  1 
ATOM   791  C  CE  . MET B 1 8  ? 4.596   6.441   26.228 1.00 26.22 ? 7   MET B CE  1 
ATOM   792  N  N   . VAL B 1 9  ? 8.633   5.910   21.893 1.00 28.87 ? 8   VAL B N   1 
ATOM   793  C  CA  . VAL B 1 9  ? 9.185   6.959   21.062 1.00 29.54 ? 8   VAL B CA  1 
ATOM   794  C  C   . VAL B 1 9  ? 9.423   6.438   19.641 1.00 29.42 ? 8   VAL B C   1 
ATOM   795  O  O   . VAL B 1 9  ? 9.222   7.191   18.700 1.00 30.77 ? 8   VAL B O   1 
ATOM   796  C  CB  . VAL B 1 9  ? 10.464  7.608   21.703 1.00 30.17 ? 8   VAL B CB  1 
ATOM   797  C  CG1 . VAL B 1 9  ? 11.354  8.223   20.640 1.00 29.96 ? 8   VAL B CG1 1 
ATOM   798  C  CG2 . VAL B 1 9  ? 10.036  8.690   22.686 1.00 30.14 ? 8   VAL B CG2 1 
ATOM   799  N  N   . ALA B 1 10 ? 9.814   5.154   19.520 1.00 28.05 ? 9   ALA B N   1 
ATOM   800  C  CA  . ALA B 1 10 ? 9.977   4.446   18.242 1.00 27.53 ? 9   ALA B CA  1 
ATOM   801  C  C   . ALA B 1 10 ? 8.660   4.298   17.458 1.00 26.23 ? 9   ALA B C   1 
ATOM   802  O  O   . ALA B 1 10 ? 8.674   4.411   16.211 1.00 25.72 ? 9   ALA B O   1 
ATOM   803  C  CB  . ALA B 1 10 ? 10.653  3.067   18.447 1.00 27.29 ? 9   ALA B CB  1 
ATOM   804  N  N   . LEU B 1 11 ? 7.530   4.105   18.159 1.00 23.74 ? 10  LEU B N   1 
ATOM   805  C  CA  . LEU B 1 11 ? 6.223   4.047   17.494 1.00 22.80 ? 10  LEU B CA  1 
ATOM   806  C  C   . LEU B 1 11 ? 5.887   5.418   16.871 1.00 23.83 ? 10  LEU B C   1 
ATOM   807  O  O   . LEU B 1 11 ? 5.454   5.518   15.696 1.00 22.21 ? 10  LEU B O   1 
ATOM   808  C  CB  . LEU B 1 11 ? 5.080   3.647   18.460 1.00 23.62 ? 10  LEU B CB  1 
ATOM   809  C  CG  . LEU B 1 11 ? 5.264   2.376   19.277 1.00 23.07 ? 10  LEU B CG  1 
ATOM   810  C  CD1 . LEU B 1 11 ? 4.153   2.156   20.279 1.00 21.54 ? 10  LEU B CD1 1 
ATOM   811  C  CD2 . LEU B 1 11 ? 5.347   1.194   18.334 1.00 24.27 ? 10  LEU B CD2 1 
ATOM   812  N  N   . ILE B 1 12 ? 6.068   6.468   17.677 1.00 23.38 ? 11  ILE B N   1 
ATOM   813  C  CA  . ILE B 1 12 ? 5.956   7.857   17.183 1.00 25.71 ? 11  ILE B CA  1 
ATOM   814  C  C   . ILE B 1 12 ? 6.855   8.148   15.981 1.00 26.00 ? 11  ILE B C   1 
ATOM   815  O  O   . ILE B 1 12 ? 6.377   8.675   14.944 1.00 26.97 ? 11  ILE B O   1 
ATOM   816  C  CB  . ILE B 1 12 ? 6.216   8.909   18.318 1.00 26.06 ? 11  ILE B CB  1 
ATOM   817  C  CG1 . ILE B 1 12 ? 5.370   8.542   19.556 1.00 26.67 ? 11  ILE B CG1 1 
ATOM   818  C  CG2 . ILE B 1 12 ? 5.939   10.350  17.771 1.00 28.65 ? 11  ILE B CG2 1 
ATOM   819  C  CD1 . ILE B 1 12 ? 4.868   9.706   20.451 1.00 26.45 ? 11  ILE B CD1 1 
ATOM   820  N  N   . ASP B 1 13 ? 8.144   7.834   16.132 1.00 26.51 ? 12  ASP B N   1 
ATOM   821  C  CA  . ASP B 1 13 ? 9.133   8.042   15.072 1.00 27.81 ? 12  ASP B CA  1 
ATOM   822  C  C   . ASP B 1 13 ? 8.809   7.282   13.793 1.00 27.12 ? 12  ASP B C   1 
ATOM   823  O  O   . ASP B 1 13 ? 8.923   7.830   12.706 1.00 26.08 ? 12  ASP B O   1 
ATOM   824  C  CB  . ASP B 1 13 ? 10.536  7.687   15.540 1.00 27.93 ? 12  ASP B CB  1 
ATOM   825  C  CG  . ASP B 1 13 ? 11.601  8.191   14.590 1.00 32.99 ? 12  ASP B CG  1 
ATOM   826  O  OD1 . ASP B 1 13 ? 11.499  9.366   14.188 1.00 35.31 ? 12  ASP B OD1 1 
ATOM   827  O  OD2 . ASP B 1 13 ? 12.529  7.412   14.244 1.00 36.20 ? 12  ASP B OD2 1 
ATOM   828  N  N   . VAL B 1 14 ? 8.402   6.023   13.917 1.00 26.94 ? 13  VAL B N   1 
ATOM   829  C  CA  . VAL B 1 14 ? 8.108   5.216   12.721 1.00 27.53 ? 13  VAL B CA  1 
ATOM   830  C  C   . VAL B 1 14 ? 6.854   5.674   11.976 1.00 27.06 ? 13  VAL B C   1 
ATOM   831  O  O   . VAL B 1 14 ? 6.833   5.629   10.758 1.00 26.58 ? 13  VAL B O   1 
ATOM   832  C  CB  . VAL B 1 14 ? 8.033   3.690   12.981 1.00 26.57 ? 13  VAL B CB  1 
ATOM   833  C  CG1 . VAL B 1 14 ? 6.651   3.275   13.493 1.00 29.98 ? 13  VAL B CG1 1 
ATOM   834  C  CG2 . VAL B 1 14 ? 8.288   2.955   11.712 1.00 26.55 ? 13  VAL B CG2 1 
ATOM   835  N  N   . PHE B 1 15 ? 5.819   6.064   12.716 1.00 26.79 ? 14  PHE B N   1 
ATOM   836  C  CA  . PHE B 1 15 ? 4.606   6.583   12.138 1.00 27.11 ? 14  PHE B CA  1 
ATOM   837  C  C   . PHE B 1 15 ? 4.915   7.872   11.336 1.00 29.02 ? 14  PHE B C   1 
ATOM   838  O  O   . PHE B 1 15 ? 4.369   8.083   10.251 1.00 28.12 ? 14  PHE B O   1 
ATOM   839  C  CB  . PHE B 1 15 ? 3.584   6.902   13.234 1.00 26.79 ? 14  PHE B CB  1 
ATOM   840  C  CG  . PHE B 1 15 ? 2.345   7.584   12.717 1.00 26.09 ? 14  PHE B CG  1 
ATOM   841  C  CD1 . PHE B 1 15 ? 1.316   6.836   12.118 1.00 25.90 ? 14  PHE B CD1 1 
ATOM   842  C  CD2 . PHE B 1 15 ? 2.215   8.970   12.804 1.00 25.71 ? 14  PHE B CD2 1 
ATOM   843  C  CE1 . PHE B 1 15 ? 0.217   7.459   11.638 1.00 22.77 ? 14  PHE B CE1 1 
ATOM   844  C  CE2 . PHE B 1 15 ? 1.121   9.603   12.289 1.00 26.86 ? 14  PHE B CE2 1 
ATOM   845  C  CZ  . PHE B 1 15 ? 0.114   8.853   11.706 1.00 26.04 ? 14  PHE B CZ  1 
ATOM   846  N  N   . HIS B 1 16 ? 5.801   8.703   11.890 1.00 30.03 ? 15  HIS B N   1 
ATOM   847  C  CA  . HIS B 1 16 ? 6.202   9.950   11.245 1.00 30.94 ? 15  HIS B CA  1 
ATOM   848  C  C   . HIS B 1 16 ? 7.065   9.743   10.031 1.00 30.87 ? 15  HIS B C   1 
ATOM   849  O  O   . HIS B 1 16 ? 6.888   10.456  9.037  1.00 31.13 ? 15  HIS B O   1 
ATOM   850  C  CB  . HIS B 1 16 ? 6.901   10.864  12.241 1.00 30.50 ? 15  HIS B CB  1 
ATOM   851  C  CG  . HIS B 1 16 ? 5.967   11.566  13.164 1.00 32.28 ? 15  HIS B CG  1 
ATOM   852  N  ND1 . HIS B 1 16 ? 4.781   12.121  12.737 1.00 34.82 ? 15  HIS B ND1 1 
ATOM   853  C  CD2 . HIS B 1 16 ? 6.067   11.862  14.482 1.00 35.57 ? 15  HIS B CD2 1 
ATOM   854  C  CE1 . HIS B 1 16 ? 4.169   12.696  13.761 1.00 37.15 ? 15  HIS B CE1 1 
ATOM   855  N  NE2 . HIS B 1 16 ? 4.935   12.567  14.828 1.00 36.69 ? 15  HIS B NE2 1 
ATOM   856  N  N   . GLN B 1 17 ? 8.023   8.812   10.109 1.00 32.10 ? 16  GLN B N   1 
ATOM   857  C  CA  . GLN B 1 17 ? 8.831   8.443   8.938  1.00 32.57 ? 16  GLN B CA  1 
ATOM   858  C  C   . GLN B 1 17 ? 7.934   8.212   7.721  1.00 32.74 ? 16  GLN B C   1 
ATOM   859  O  O   . GLN B 1 17 ? 8.155   8.822   6.654  1.00 32.68 ? 16  GLN B O   1 
ATOM   860  C  CB  . GLN B 1 17 ? 9.649   7.176   9.186  1.00 32.60 ? 16  GLN B CB  1 
ATOM   861  C  CG  . GLN B 1 17 ? 10.919  7.346   10.028 1.00 33.98 ? 16  GLN B CG  1 
ATOM   862  C  CD  . GLN B 1 17 ? 11.558  6.013   10.410 1.00 35.56 ? 16  GLN B CD  1 
ATOM   863  O  OE1 . GLN B 1 17 ? 11.803  5.745   11.587 1.00 38.43 ? 16  GLN B OE1 1 
ATOM   864  N  NE2 . GLN B 1 17 ? 11.862  5.180   9.405  1.00 39.14 ? 16  GLN B NE2 1 
ATOM   865  N  N   . TYR B 1 18 ? 6.956   7.306   7.870  1.00 31.03 ? 17  TYR B N   1 
ATOM   866  C  CA  . TYR B 1 18 ? 6.058   6.911   6.757  1.00 31.00 ? 17  TYR B CA  1 
ATOM   867  C  C   . TYR B 1 18 ? 4.936   7.903   6.467  1.00 31.67 ? 17  TYR B C   1 
ATOM   868  O  O   . TYR B 1 18 ? 4.586   8.078   5.303  1.00 32.66 ? 17  TYR B O   1 
ATOM   869  C  CB  . TYR B 1 18 ? 5.519   5.459   6.913  1.00 29.82 ? 17  TYR B CB  1 
ATOM   870  C  CG  . TYR B 1 18 ? 6.652   4.509   6.733  1.00 27.82 ? 17  TYR B CG  1 
ATOM   871  C  CD1 . TYR B 1 18 ? 7.468   4.183   7.794  1.00 29.49 ? 17  TYR B CD1 1 
ATOM   872  C  CD2 . TYR B 1 18 ? 6.970   4.015   5.477  1.00 24.58 ? 17  TYR B CD2 1 
ATOM   873  C  CE1 . TYR B 1 18 ? 8.561   3.389   7.628  1.00 29.97 ? 17  TYR B CE1 1 
ATOM   874  C  CE2 . TYR B 1 18 ? 8.053   3.201   5.302  1.00 26.07 ? 17  TYR B CE2 1 
ATOM   875  C  CZ  . TYR B 1 18 ? 8.857   2.914   6.372  1.00 29.91 ? 17  TYR B CZ  1 
ATOM   876  O  OH  . TYR B 1 18 ? 9.936   2.123   6.221  1.00 28.85 ? 17  TYR B OH  1 
ATOM   877  N  N   . SER B 1 19 ? 4.387   8.576   7.480  1.00 31.76 ? 18  SER B N   1 
ATOM   878  C  CA  . SER B 1 19 ? 3.244   9.477   7.208  1.00 32.38 ? 18  SER B CA  1 
ATOM   879  C  C   . SER B 1 19 ? 3.606   10.837  6.581  1.00 32.66 ? 18  SER B C   1 
ATOM   880  O  O   . SER B 1 19 ? 2.784   11.447  5.872  1.00 32.43 ? 18  SER B O   1 
ATOM   881  C  CB  . SER B 1 19 ? 2.344   9.668   8.433  1.00 32.75 ? 18  SER B CB  1 
ATOM   882  O  OG  . SER B 1 19 ? 2.880   10.595  9.355  1.00 33.94 ? 18  SER B OG  1 
ATOM   883  N  N   . GLY B 1 20 ? 4.816   11.316  6.844  1.00 32.52 ? 19  GLY B N   1 
ATOM   884  C  CA  . GLY B 1 20 ? 5.227   12.599  6.287  1.00 33.20 ? 19  GLY B CA  1 
ATOM   885  C  C   . GLY B 1 20 ? 5.658   12.518  4.836  1.00 33.15 ? 19  GLY B C   1 
ATOM   886  O  O   . GLY B 1 20 ? 6.067   13.520  4.266  1.00 32.39 ? 19  GLY B O   1 
ATOM   887  N  N   . ARG B 1 21 ? 5.559   11.332  4.229  1.00 34.15 ? 20  ARG B N   1 
ATOM   888  C  CA  . ARG B 1 21 ? 6.031   11.116  2.848  1.00 34.20 ? 20  ARG B CA  1 
ATOM   889  C  C   . ARG B 1 21 ? 5.154   11.853  1.832  1.00 35.53 ? 20  ARG B C   1 
ATOM   890  O  O   . ARG B 1 21 ? 5.655   12.611  0.996  1.00 35.80 ? 20  ARG B O   1 
ATOM   891  C  CB  . ARG B 1 21 ? 6.138   9.613   2.496  1.00 33.32 ? 20  ARG B CB  1 
ATOM   892  C  CG  . ARG B 1 21 ? 7.276   8.871   3.194  1.00 31.37 ? 20  ARG B CG  1 
ATOM   893  C  CD  . ARG B 1 21 ? 7.179   7.388   2.970  1.00 31.89 ? 20  ARG B CD  1 
ATOM   894  N  NE  . ARG B 1 21 ? 8.372   6.681   3.437  1.00 28.68 ? 20  ARG B NE  1 
ATOM   895  C  CZ  . ARG B 1 21 ? 8.828   5.546   2.910  1.00 33.68 ? 20  ARG B CZ  1 
ATOM   896  N  NH1 . ARG B 1 21 ? 8.181   4.962   1.910  1.00 34.60 ? 20  ARG B NH1 1 
ATOM   897  N  NH2 . ARG B 1 21 ? 9.916   4.966   3.390  1.00 31.49 ? 20  ARG B NH2 1 
ATOM   898  N  N   . GLU B 1 22 ? 3.847   11.638  1.884  1.00 36.53 ? 21  GLU B N   1 
ATOM   899  C  CA  . GLU B 1 22 ? 2.981   12.222  0.867  1.00 38.21 ? 21  GLU B CA  1 
ATOM   900  C  C   . GLU B 1 22 ? 1.753   12.831  1.462  1.00 38.02 ? 21  GLU B C   1 
ATOM   901  O  O   . GLU B 1 22 ? 1.273   12.377  2.498  1.00 38.39 ? 21  GLU B O   1 
ATOM   902  C  CB  . GLU B 1 22 ? 2.567   11.171  -0.168 1.00 37.89 ? 21  GLU B CB  1 
ATOM   903  C  CG  . GLU B 1 22 ? 3.739   10.446  -0.814 1.00 41.19 ? 21  GLU B CG  1 
ATOM   904  C  CD  . GLU B 1 22 ? 3.372   9.760   -2.113 1.00 44.08 ? 21  GLU B CD  1 
ATOM   905  O  OE1 . GLU B 1 22 ? 2.175   9.472   -2.340 1.00 45.75 ? 21  GLU B OE1 1 
ATOM   906  O  OE2 . GLU B 1 22 ? 4.299   9.506   -2.911 1.00 47.80 ? 21  GLU B OE2 1 
ATOM   907  N  N   . GLY B 1 23 ? 1.230   13.861  0.802  1.00 38.11 ? 22  GLY B N   1 
ATOM   908  C  CA  . GLY B 1 23 ? -0.047  14.456  1.199  1.00 38.33 ? 22  GLY B CA  1 
ATOM   909  C  C   . GLY B 1 23 ? -0.013  14.885  2.651  1.00 38.71 ? 22  GLY B C   1 
ATOM   910  O  O   . GLY B 1 23 ? 0.979   15.463  3.093  1.00 39.74 ? 22  GLY B O   1 
ATOM   911  N  N   . ASP B 1 24 ? -1.093  14.569  3.372  1.00 38.89 ? 23  ASP B N   1 
ATOM   912  C  CA  . ASP B 1 24 ? -1.222  14.708  4.830  1.00 38.71 ? 23  ASP B CA  1 
ATOM   913  C  C   . ASP B 1 24 ? -0.057  14.065  5.556  1.00 38.38 ? 23  ASP B C   1 
ATOM   914  O  O   . ASP B 1 24 ? 0.120   12.822  5.573  1.00 37.98 ? 23  ASP B O   1 
ATOM   915  C  CB  . ASP B 1 24 ? -2.543  14.084  5.300  1.00 39.71 ? 23  ASP B CB  1 
ATOM   916  C  CG  . ASP B 1 24 ? -3.002  14.592  6.674  1.00 41.03 ? 23  ASP B CG  1 
ATOM   917  O  OD1 . ASP B 1 24 ? -2.171  14.770  7.597  1.00 42.80 ? 23  ASP B OD1 1 
ATOM   918  O  OD2 . ASP B 1 24 ? -4.221  14.814  6.833  1.00 42.86 ? 23  ASP B OD2 1 
ATOM   919  N  N   . LYS B 1 25 ? 0.751   14.930  6.150  1.00 36.79 ? 24  LYS B N   1 
ATOM   920  C  CA  . LYS B 1 25 ? 1.959   14.509  6.819  1.00 36.29 ? 24  LYS B CA  1 
ATOM   921  C  C   . LYS B 1 25 ? 1.710   13.799  8.152  1.00 35.29 ? 24  LYS B C   1 
ATOM   922  O  O   . LYS B 1 25 ? 2.630   13.282  8.733  1.00 35.49 ? 24  LYS B O   1 
ATOM   923  C  CB  . LYS B 1 25 ? 2.892   15.714  7.002  1.00 35.28 ? 24  LYS B CB  1 
ATOM   924  C  CG  . LYS B 1 25 ? 3.423   16.225  5.660  1.00 36.16 ? 24  LYS B CG  1 
ATOM   925  C  CD  . LYS B 1 25 ? 4.703   16.997  5.793  1.00 38.88 ? 24  LYS B CD  1 
ATOM   926  C  CE  . LYS B 1 25 ? 5.280   17.320  4.420  1.00 42.85 ? 24  LYS B CE  1 
ATOM   927  N  NZ  . LYS B 1 25 ? 4.232   17.610  3.402  1.00 43.27 ? 24  LYS B NZ  1 
ATOM   928  N  N   . HIS B 1 26 ? 0.480   13.800  8.642  1.00 35.63 ? 25  HIS B N   1 
ATOM   929  C  CA  . HIS B 1 26 ? 0.191   13.107  9.918  1.00 35.86 ? 25  HIS B CA  1 
ATOM   930  C  C   . HIS B 1 26 ? -0.845  12.016  9.771  1.00 34.17 ? 25  HIS B C   1 
ATOM   931  O  O   . HIS B 1 26 ? -1.444  11.575  10.748 1.00 33.77 ? 25  HIS B O   1 
ATOM   932  C  CB  . HIS B 1 26 ? -0.181  14.104  11.026 1.00 36.93 ? 25  HIS B CB  1 
ATOM   933  C  CG  . HIS B 1 26 ? 0.802   15.231  11.155 1.00 39.43 ? 25  HIS B CG  1 
ATOM   934  N  ND1 . HIS B 1 26 ? 2.144   15.019  11.393 1.00 40.52 ? 25  HIS B ND1 1 
ATOM   935  C  CD2 . HIS B 1 26 ? 0.644   16.572  11.052 1.00 40.10 ? 25  HIS B CD2 1 
ATOM   936  C  CE1 . HIS B 1 26 ? 2.769   16.183  11.435 1.00 39.25 ? 25  HIS B CE1 1 
ATOM   937  N  NE2 . HIS B 1 26 ? 1.881   17.140  11.238 1.00 39.70 ? 25  HIS B NE2 1 
ATOM   938  N  N   . LYS B 1 27 ? -1.034  11.569  8.530  1.00 33.27 ? 26  LYS B N   1 
ATOM   939  C  CA  . LYS B 1 27 ? -1.840  10.377  8.246  1.00 31.81 ? 26  LYS B CA  1 
ATOM   940  C  C   . LYS B 1 27 ? -1.149  9.506   7.212  1.00 31.30 ? 26  LYS B C   1 
ATOM   941  O  O   . LYS B 1 27 ? -0.467  10.034  6.334  1.00 30.61 ? 26  LYS B O   1 
ATOM   942  C  CB  . LYS B 1 27 ? -3.265  10.723  7.806  1.00 31.63 ? 26  LYS B CB  1 
ATOM   943  C  CG  . LYS B 1 27 ? -3.976  11.586  8.782  1.00 31.66 ? 26  LYS B CG  1 
ATOM   944  C  CD  . LYS B 1 27 ? -5.370  11.140  9.072  1.00 33.52 ? 26  LYS B CD  1 
ATOM   945  C  CE  . LYS B 1 27 ? -5.909  11.894  10.309 1.00 36.68 ? 26  LYS B CE  1 
ATOM   946  N  NZ  . LYS B 1 27 ? -7.086  12.770  10.060 1.00 39.75 ? 26  LYS B NZ  1 
ATOM   947  N  N   . LEU B 1 28 ? -1.313  8.183   7.363  1.00 29.41 ? 27  LEU B N   1 
ATOM   948  C  CA  . LEU B 1 28 ? -0.788  7.164   6.444  1.00 29.09 ? 27  LEU B CA  1 
ATOM   949  C  C   . LEU B 1 28 ? -1.786  6.862   5.329  1.00 29.07 ? 27  LEU B C   1 
ATOM   950  O  O   . LEU B 1 28 ? -2.910  6.424   5.583  1.00 27.84 ? 27  LEU B O   1 
ATOM   951  C  CB  . LEU B 1 28 ? -0.497  5.837   7.189  1.00 28.89 ? 27  LEU B CB  1 
ATOM   952  C  CG  . LEU B 1 28 ? 0.573   5.739   8.293  1.00 26.47 ? 27  LEU B CG  1 
ATOM   953  C  CD1 . LEU B 1 28 ? 0.462   4.386   8.996  1.00 30.45 ? 27  LEU B CD1 1 
ATOM   954  C  CD2 . LEU B 1 28 ? 1.947   5.884   7.668  1.00 25.21 ? 27  LEU B CD2 1 
ATOM   955  N  N   . LYS B 1 29 ? -1.352  7.055   4.091  1.00 29.32 ? 28  LYS B N   1 
ATOM   956  C  CA  . LYS B 1 29 ? -2.155  6.696   2.942  1.00 30.91 ? 28  LYS B CA  1 
ATOM   957  C  C   . LYS B 1 29 ? -1.848  5.241   2.603  1.00 30.76 ? 28  LYS B C   1 
ATOM   958  O  O   . LYS B 1 29 ? -0.915  4.664   3.148  1.00 31.22 ? 28  LYS B O   1 
ATOM   959  C  CB  . LYS B 1 29 ? -1.917  7.687   1.765  1.00 30.50 ? 28  LYS B CB  1 
ATOM   960  C  CG  . LYS B 1 29 ? -0.534  7.630   1.122  1.00 31.42 ? 28  LYS B CG  1 
ATOM   961  C  CD  . LYS B 1 29 ? -0.455  8.353   -0.252 1.00 33.26 ? 28  LYS B CD  1 
ATOM   962  C  CE  . LYS B 1 29 ? -1.845  8.478   -0.933 1.00 37.99 ? 28  LYS B CE  1 
ATOM   963  N  NZ  . LYS B 1 29 ? -2.634  7.198   -0.994 1.00 42.23 ? 28  LYS B NZ  1 
ATOM   964  N  N   . LYS B 1 30 ? -2.660  4.614   1.760  1.00 31.26 ? 29  LYS B N   1 
ATOM   965  C  CA  . LYS B 1 30 ? -2.403  3.244   1.356  1.00 31.87 ? 29  LYS B CA  1 
ATOM   966  C  C   . LYS B 1 30 ? -0.929  2.941   1.011  1.00 31.28 ? 29  LYS B C   1 
ATOM   967  O  O   . LYS B 1 30 ? -0.348  1.999   1.558  1.00 32.37 ? 29  LYS B O   1 
ATOM   968  C  CB  . LYS B 1 30 ? -3.341  2.825   0.204  1.00 32.78 ? 29  LYS B CB  1 
ATOM   969  C  CG  . LYS B 1 30 ? -4.791  2.688   0.631  1.00 32.91 ? 29  LYS B CG  1 
ATOM   970  C  CD  . LYS B 1 30 ? -5.571  1.989   -0.495 1.00 33.99 ? 29  LYS B CD  1 
ATOM   971  C  CE  . LYS B 1 30 ? -7.061  1.960   -0.211 1.00 34.84 ? 29  LYS B CE  1 
ATOM   972  N  NZ  . LYS B 1 30 ? -7.774  1.826   -1.523 1.00 36.93 ? 29  LYS B NZ  1 
ATOM   973  N  N   . SER B 1 31 ? -0.328  3.735   0.132  1.00 30.60 ? 30  SER B N   1 
ATOM   974  C  CA  . SER B 1 31 ? 1.086   3.552   -0.275 1.00 29.35 ? 30  SER B CA  1 
ATOM   975  C  C   . SER B 1 31 ? 2.047   3.654   0.918  1.00 28.56 ? 30  SER B C   1 
ATOM   976  O  O   . SER B 1 31 ? 2.941   2.818   1.049  1.00 28.81 ? 30  SER B O   1 
ATOM   977  C  CB  . SER B 1 31 ? 1.522   4.548   -1.384 1.00 29.15 ? 30  SER B CB  1 
ATOM   978  O  OG  . SER B 1 31 ? 1.212   5.877   -1.013 1.00 27.20 ? 30  SER B OG  1 
ATOM   979  N  N   . GLU B 1 32 ? 1.831   4.633   1.798  1.00 26.60 ? 31  GLU B N   1 
ATOM   980  C  CA  . GLU B 1 32 ? 2.666   4.771   2.996  1.00 25.44 ? 31  GLU B CA  1 
ATOM   981  C  C   . GLU B 1 32 ? 2.585   3.563   3.963  1.00 23.26 ? 31  GLU B C   1 
ATOM   982  O  O   . GLU B 1 32 ? 3.587   3.101   4.513  1.00 21.96 ? 31  GLU B O   1 
ATOM   983  C  CB  . GLU B 1 32 ? 2.277   6.029   3.740  1.00 25.92 ? 31  GLU B CB  1 
ATOM   984  C  CG  . GLU B 1 32 ? 2.954   7.283   3.173  1.00 27.55 ? 31  GLU B CG  1 
ATOM   985  C  CD  . GLU B 1 32 ? 2.144   8.487   3.444  1.00 30.12 ? 31  GLU B CD  1 
ATOM   986  O  OE1 . GLU B 1 32 ? 1.183   8.351   4.218  1.00 29.89 ? 31  GLU B OE1 1 
ATOM   987  O  OE2 . GLU B 1 32 ? 2.445   9.579   2.897  1.00 34.09 ? 31  GLU B OE2 1 
ATOM   988  N  N   . LEU B 1 33 ? 1.382   3.073   4.147  1.00 22.68 ? 32  LEU B N   1 
ATOM   989  C  CA  . LEU B 1 33 ? 1.115   1.958   5.052  1.00 21.49 ? 32  LEU B CA  1 
ATOM   990  C  C   . LEU B 1 33 ? 1.718   0.652   4.530  1.00 22.11 ? 32  LEU B C   1 
ATOM   991  O  O   . LEU B 1 33 ? 2.220   -0.167  5.303  1.00 23.17 ? 32  LEU B O   1 
ATOM   992  C  CB  . LEU B 1 33 ? -0.389  1.820   5.213  1.00 21.05 ? 32  LEU B CB  1 
ATOM   993  C  CG  . LEU B 1 33 ? -0.836  0.642   6.088  1.00 20.18 ? 32  LEU B CG  1 
ATOM   994  C  CD1 . LEU B 1 33 ? -0.438  0.914   7.579  1.00 18.69 ? 32  LEU B CD1 1 
ATOM   995  C  CD2 . LEU B 1 33 ? -2.351  0.577   5.969  1.00 23.05 ? 32  LEU B CD2 1 
ATOM   996  N  N   . LYS B 1 34 ? 1.592   0.425   3.222  1.00 24.37 ? 33  LYS B N   1 
ATOM   997  C  CA  . LYS B 1 34 ? 2.232   -0.741  2.552  1.00 25.03 ? 33  LYS B CA  1 
ATOM   998  C  C   . LYS B 1 34 ? 3.747   -0.762  2.771  1.00 24.68 ? 33  LYS B C   1 
ATOM   999  O  O   . LYS B 1 34 ? 4.254   -1.752  3.257  1.00 25.10 ? 33  LYS B O   1 
ATOM   1000 C  CB  . LYS B 1 34 ? 1.881   -0.806  1.065  1.00 25.64 ? 33  LYS B CB  1 
ATOM   1001 C  CG  . LYS B 1 34 ? 2.559   -1.964  0.370  1.00 27.84 ? 33  LYS B CG  1 
ATOM   1002 C  CD  . LYS B 1 34 ? 2.260   -2.016  -1.112 1.00 31.67 ? 33  LYS B CD  1 
ATOM   1003 C  CE  . LYS B 1 34 ? 2.997   -3.191  -1.735 1.00 34.31 ? 33  LYS B CE  1 
ATOM   1004 N  NZ  . LYS B 1 34 ? 4.461   -3.003  -1.582 1.00 37.68 ? 33  LYS B NZ  1 
ATOM   1005 N  N   . GLU B 1 35 ? 4.442   0.349   2.488  1.00 25.20 ? 34  GLU B N   1 
ATOM   1006 C  CA  . GLU B 1 35 ? 5.897   0.529   2.770  1.00 24.59 ? 34  GLU B CA  1 
ATOM   1007 C  C   . GLU B 1 35 ? 6.235   0.345   4.255  1.00 23.30 ? 34  GLU B C   1 
ATOM   1008 O  O   . GLU B 1 35 ? 7.277   -0.256  4.619  1.00 22.28 ? 34  GLU B O   1 
ATOM   1009 C  CB  . GLU B 1 35 ? 6.394   1.958   2.374  1.00 24.95 ? 34  GLU B CB  1 
ATOM   1010 C  CG  . GLU B 1 35 ? 5.953   2.549   0.989  1.00 29.44 ? 34  GLU B CG  1 
ATOM   1011 C  CD  . GLU B 1 35 ? 5.865   4.109   0.991  1.00 29.03 ? 34  GLU B CD  1 
ATOM   1012 O  OE1 . GLU B 1 35 ? 6.691   4.807   0.360  1.00 37.66 ? 34  GLU B OE1 1 
ATOM   1013 O  OE2 . GLU B 1 35 ? 4.989   4.664   1.661  1.00 38.48 ? 34  GLU B OE2 1 
ATOM   1014 N  N   . LEU B 1 36 ? 5.378   0.853   5.134  1.00 22.41 ? 35  LEU B N   1 
ATOM   1015 C  CA  . LEU B 1 36 ? 5.642   0.709   6.581  1.00 22.56 ? 35  LEU B CA  1 
ATOM   1016 C  C   . LEU B 1 36 ? 5.636   -0.749  6.937  1.00 22.46 ? 35  LEU B C   1 
ATOM   1017 O  O   . LEU B 1 36 ? 6.603   -1.254  7.530  1.00 23.02 ? 35  LEU B O   1 
ATOM   1018 C  CB  . LEU B 1 36 ? 4.611   1.470   7.438  1.00 23.55 ? 35  LEU B CB  1 
ATOM   1019 C  CG  . LEU B 1 36 ? 4.835   1.561   8.950  1.00 20.00 ? 35  LEU B CG  1 
ATOM   1020 C  CD1 . LEU B 1 36 ? 4.207   2.856   9.491  1.00 20.46 ? 35  LEU B CD1 1 
ATOM   1021 C  CD2 . LEU B 1 36 ? 4.193   0.298   9.639  1.00 21.12 ? 35  LEU B CD2 1 
ATOM   1022 N  N   . ILE B 1 37 ? 4.569   -1.444  6.560  1.00 22.85 ? 36  ILE B N   1 
ATOM   1023 C  CA  . ILE B 1 37 ? 4.472   -2.913  6.772  1.00 21.80 ? 36  ILE B CA  1 
ATOM   1024 C  C   . ILE B 1 37 ? 5.585   -3.742  6.106  1.00 23.42 ? 36  ILE B C   1 
ATOM   1025 O  O   . ILE B 1 37 ? 6.184   -4.668  6.734  1.00 21.52 ? 36  ILE B O   1 
ATOM   1026 C  CB  . ILE B 1 37 ? 3.023   -3.485  6.407  1.00 22.91 ? 36  ILE B CB  1 
ATOM   1027 C  CG1 . ILE B 1 37 ? 1.965   -3.039  7.447  1.00 20.35 ? 36  ILE B CG1 1 
ATOM   1028 C  CG2 . ILE B 1 37 ? 3.020   -5.056  6.352  1.00 22.40 ? 36  ILE B CG2 1 
ATOM   1029 C  CD1 . ILE B 1 37 ? 0.574   -2.897  6.929  1.00 21.26 ? 36  ILE B CD1 1 
ATOM   1030 N  N   . ASN B 1 38 ? 5.831   -3.467  4.829  1.00 23.89 ? 37  ASN B N   1 
ATOM   1031 C  CA  . ASN B 1 38 ? 6.781   -4.249  4.080  1.00 25.95 ? 37  ASN B CA  1 
ATOM   1032 C  C   . ASN B 1 38 ? 8.219   -4.022  4.580  1.00 26.48 ? 37  ASN B C   1 
ATOM   1033 O  O   . ASN B 1 38 ? 9.020   -4.944  4.660  1.00 26.97 ? 37  ASN B O   1 
ATOM   1034 C  CB  . ASN B 1 38 ? 6.640   -3.982  2.569  1.00 26.47 ? 37  ASN B CB  1 
ATOM   1035 C  CG  . ASN B 1 38 ? 5.544   -4.848  1.909  1.00 27.84 ? 37  ASN B CG  1 
ATOM   1036 O  OD1 . ASN B 1 38 ? 4.881   -5.659  2.569  1.00 25.44 ? 37  ASN B OD1 1 
ATOM   1037 N  ND2 . ASN B 1 38 ? 5.361   -4.669  0.588  1.00 27.32 ? 37  ASN B ND2 1 
ATOM   1038 N  N   . ASN B 1 39 ? 8.531   -2.792  4.952  1.00 28.62 ? 38  ASN B N   1 
ATOM   1039 C  CA  . ASN B 1 39 ? 9.883   -2.459  5.407  1.00 29.17 ? 38  ASN B CA  1 
ATOM   1040 C  C   . ASN B 1 39 ? 10.130  -2.766  6.874  1.00 29.06 ? 38  ASN B C   1 
ATOM   1041 O  O   . ASN B 1 39 ? 11.208  -3.277  7.230  1.00 29.02 ? 38  ASN B O   1 
ATOM   1042 C  CB  . ASN B 1 39 ? 10.161  -0.987  5.122  1.00 29.08 ? 38  ASN B CB  1 
ATOM   1043 C  CG  . ASN B 1 39 ? 10.321  -0.719  3.625  1.00 32.54 ? 38  ASN B CG  1 
ATOM   1044 O  OD1 . ASN B 1 39 ? 10.591  -1.640  2.847  1.00 35.19 ? 38  ASN B OD1 1 
ATOM   1045 N  ND2 . ASN B 1 39 ? 10.170  0.537   3.226  1.00 32.38 ? 38  ASN B ND2 1 
ATOM   1046 N  N   . GLU B 1 40 ? 9.133   -2.446  7.710  1.00 28.35 ? 39  GLU B N   1 
ATOM   1047 C  CA  . GLU B 1 40 ? 9.312   -2.408  9.145  1.00 28.40 ? 39  GLU B CA  1 
ATOM   1048 C  C   . GLU B 1 40 ? 8.697   -3.560  9.931  1.00 28.62 ? 39  GLU B C   1 
ATOM   1049 O  O   . GLU B 1 40 ? 8.939   -3.621  11.104 1.00 28.26 ? 39  GLU B O   1 
ATOM   1050 C  CB  . GLU B 1 40 ? 8.886   -1.050  9.761  1.00 28.32 ? 39  GLU B CB  1 
ATOM   1051 C  CG  . GLU B 1 40 ? 9.375   0.219   8.994  1.00 26.98 ? 39  GLU B CG  1 
ATOM   1052 C  CD  . GLU B 1 40 ? 10.895  0.289   8.798  1.00 27.72 ? 39  GLU B CD  1 
ATOM   1053 O  OE1 . GLU B 1 40 ? 11.627  -0.392  9.557  1.00 28.73 ? 39  GLU B OE1 1 
ATOM   1054 O  OE2 . GLU B 1 40 ? 11.354  1.043   7.870  1.00 25.90 ? 39  GLU B OE2 1 
ATOM   1055 N  N   . LEU B 1 41 ? 7.961   -4.470  9.274  1.00 29.40 ? 40  LEU B N   1 
ATOM   1056 C  CA  . LEU B 1 41 ? 7.336   -5.644  9.910  1.00 29.46 ? 40  LEU B CA  1 
ATOM   1057 C  C   . LEU B 1 41 ? 7.528   -6.972  9.150  1.00 30.70 ? 40  LEU B C   1 
ATOM   1058 O  O   . LEU B 1 41 ? 6.665   -7.877  9.201  1.00 29.52 ? 40  LEU B O   1 
ATOM   1059 C  CB  . LEU B 1 41 ? 5.837   -5.398  10.167 1.00 29.22 ? 40  LEU B CB  1 
ATOM   1060 C  CG  . LEU B 1 41 ? 5.468   -4.303  11.192 1.00 28.64 ? 40  LEU B CG  1 
ATOM   1061 C  CD1 . LEU B 1 41 ? 4.040   -3.879  11.042 1.00 26.85 ? 40  LEU B CD1 1 
ATOM   1062 C  CD2 . LEU B 1 41 ? 5.752   -4.816  12.604 1.00 27.79 ? 40  LEU B CD2 1 
ATOM   1063 N  N   . SER B 1 42 ? 8.685   -7.085  8.498  1.00 32.10 ? 41  SER B N   1 
ATOM   1064 C  CA  . SER B 1 42 ? 9.082   -8.250  7.697  1.00 33.86 ? 41  SER B CA  1 
ATOM   1065 C  C   . SER B 1 42 ? 9.236   -9.553  8.497  1.00 35.93 ? 41  SER B C   1 
ATOM   1066 O  O   . SER B 1 42 ? 9.090   -10.655 7.947  1.00 37.09 ? 41  SER B O   1 
ATOM   1067 C  CB  . SER B 1 42 ? 10.387  -7.927  6.942  1.00 33.37 ? 41  SER B CB  1 
ATOM   1068 O  OG  . SER B 1 42 ? 11.481  -7.968  7.837  1.00 33.33 ? 41  SER B OG  1 
ATOM   1069 N  N   . HIS B 1 43 ? 9.516   -9.428  9.790  1.00 36.71 ? 42  HIS B N   1 
ATOM   1070 C  CA  . HIS B 1 43 ? 9.721   -10.588 10.639 1.00 37.74 ? 42  HIS B CA  1 
ATOM   1071 C  C   . HIS B 1 43 ? 8.502   -10.836 11.495 1.00 37.38 ? 42  HIS B C   1 
ATOM   1072 O  O   . HIS B 1 43 ? 8.544   -11.669 12.390 1.00 39.01 ? 42  HIS B O   1 
ATOM   1073 C  CB  . HIS B 1 43 ? 10.945  -10.403 11.533 1.00 38.13 ? 42  HIS B CB  1 
ATOM   1074 C  CG  . HIS B 1 43 ? 12.176  -9.980  10.796 1.00 39.37 ? 42  HIS B CG  1 
ATOM   1075 N  ND1 . HIS B 1 43 ? 13.068  -10.882 10.250 1.00 40.07 ? 42  HIS B ND1 1 
ATOM   1076 C  CD2 . HIS B 1 43 ? 12.673  -8.749  10.526 1.00 38.27 ? 42  HIS B CD2 1 
ATOM   1077 C  CE1 . HIS B 1 43 ? 14.055  -10.222 9.673  1.00 38.84 ? 42  HIS B CE1 1 
ATOM   1078 N  NE2 . HIS B 1 43 ? 13.831  -8.927  9.812  1.00 36.50 ? 42  HIS B NE2 1 
ATOM   1079 N  N   . PHE B 1 44 ? 7.411   -10.121 11.217 1.00 36.26 ? 43  PHE B N   1 
ATOM   1080 C  CA  . PHE B 1 44 ? 6.170   -10.293 11.968 1.00 35.14 ? 43  PHE B CA  1 
ATOM   1081 C  C   . PHE B 1 44 ? 4.950   -10.571 11.074 1.00 35.04 ? 43  PHE B C   1 
ATOM   1082 O  O   . PHE B 1 44 ? 3.993   -11.224 11.502 1.00 34.36 ? 43  PHE B O   1 
ATOM   1083 C  CB  . PHE B 1 44 ? 5.871   -9.074  12.856 1.00 34.63 ? 43  PHE B CB  1 
ATOM   1084 C  CG  . PHE B 1 44 ? 6.662   -9.021  14.147 1.00 34.23 ? 43  PHE B CG  1 
ATOM   1085 C  CD1 . PHE B 1 44 ? 7.491   -10.078 14.556 1.00 35.43 ? 43  PHE B CD1 1 
ATOM   1086 C  CD2 . PHE B 1 44 ? 6.566   -7.920  14.960 1.00 32.22 ? 43  PHE B CD2 1 
ATOM   1087 C  CE1 . PHE B 1 44 ? 8.203   -10.009 15.771 1.00 35.43 ? 43  PHE B CE1 1 
ATOM   1088 C  CE2 . PHE B 1 44 ? 7.259   -7.843  16.168 1.00 31.34 ? 43  PHE B CE2 1 
ATOM   1089 C  CZ  . PHE B 1 44 ? 8.084   -8.879  16.571 1.00 33.59 ? 43  PHE B CZ  1 
ATOM   1090 N  N   . LEU B 1 45 ? 4.972   -10.013 9.868  1.00 34.94 ? 44  LEU B N   1 
ATOM   1091 C  CA  . LEU B 1 45 ? 3.884   -10.163 8.905  1.00 34.39 ? 44  LEU B CA  1 
ATOM   1092 C  C   . LEU B 1 45 ? 4.441   -10.505 7.521  1.00 34.86 ? 44  LEU B C   1 
ATOM   1093 O  O   . LEU B 1 45 ? 5.504   -10.045 7.139  1.00 33.95 ? 44  LEU B O   1 
ATOM   1094 C  CB  . LEU B 1 45 ? 3.100   -8.857  8.786  1.00 34.67 ? 44  LEU B CB  1 
ATOM   1095 C  CG  . LEU B 1 45 ? 2.748   -7.919  9.970  1.00 33.50 ? 44  LEU B CG  1 
ATOM   1096 C  CD1 . LEU B 1 45 ? 1.846   -6.726  9.519  1.00 32.42 ? 44  LEU B CD1 1 
ATOM   1097 C  CD2 . LEU B 1 45 ? 2.068   -8.675  11.091 1.00 32.84 ? 44  LEU B CD2 1 
ATOM   1098 N  N   . GLU B 1 46 ? 3.692   -11.301 6.779  1.00 35.86 ? 45  GLU B N   1 
ATOM   1099 C  CA  . GLU B 1 46 ? 3.934   -11.547 5.356  1.00 37.26 ? 45  GLU B CA  1 
ATOM   1100 C  C   . GLU B 1 46 ? 4.029   -10.234 4.554  1.00 37.23 ? 45  GLU B C   1 
ATOM   1101 O  O   . GLU B 1 46 ? 3.179   -9.359  4.716  1.00 36.07 ? 45  GLU B O   1 
ATOM   1102 C  CB  . GLU B 1 46 ? 2.768   -12.390 4.831  1.00 37.60 ? 45  GLU B CB  1 
ATOM   1103 C  CG  . GLU B 1 46 ? 2.854   -12.781 3.366  1.00 41.43 ? 45  GLU B CG  1 
ATOM   1104 C  CD  . GLU B 1 46 ? 2.125   -14.071 3.080  1.00 44.19 ? 45  GLU B CD  1 
ATOM   1105 O  OE1 . GLU B 1 46 ? 2.816   -15.082 2.898  1.00 46.72 ? 45  GLU B OE1 1 
ATOM   1106 O  OE2 . GLU B 1 46 ? 0.869   -14.085 3.053  1.00 46.01 ? 45  GLU B OE2 1 
ATOM   1107 N  N   . GLU B 1 47 ? 5.057   -10.095 3.704  1.00 36.74 ? 46  GLU B N   1 
ATOM   1108 C  CA  . GLU B 1 47 ? 5.142   -8.951  2.757  1.00 37.08 ? 46  GLU B CA  1 
ATOM   1109 C  C   . GLU B 1 47 ? 3.816   -8.780  1.984  1.00 36.21 ? 46  GLU B C   1 
ATOM   1110 O  O   . GLU B 1 47 ? 3.221   -9.765  1.563  1.00 37.21 ? 46  GLU B O   1 
ATOM   1111 C  CB  . GLU B 1 47 ? 6.250   -9.212  1.732  1.00 37.47 ? 46  GLU B CB  1 
ATOM   1112 C  CG  . GLU B 1 47 ? 6.569   -8.017  0.810  1.00 39.76 ? 46  GLU B CG  1 
ATOM   1113 C  CD  . GLU B 1 47 ? 6.931   -8.439  -0.604 1.00 44.34 ? 46  GLU B CD  1 
ATOM   1114 O  OE1 . GLU B 1 47 ? 6.606   -9.585  -0.984 1.00 45.37 ? 46  GLU B OE1 1 
ATOM   1115 O  OE2 . GLU B 1 47 ? 7.565   -7.631  -1.320 1.00 44.97 ? 46  GLU B OE2 1 
ATOM   1116 N  N   . ILE B 1 48 ? 3.358   -7.554  1.784  1.00 35.02 ? 47  ILE B N   1 
ATOM   1117 C  CA  . ILE B 1 48 ? 2.189   -7.322  0.919  1.00 33.79 ? 47  ILE B CA  1 
ATOM   1118 C  C   . ILE B 1 48 ? 2.644   -7.286  -0.537 1.00 33.79 ? 47  ILE B C   1 
ATOM   1119 O  O   . ILE B 1 48 ? 3.489   -6.478  -0.911 1.00 34.25 ? 47  ILE B O   1 
ATOM   1120 C  CB  . ILE B 1 48 ? 1.409   -6.007  1.216  1.00 33.06 ? 47  ILE B CB  1 
ATOM   1121 C  CG1 . ILE B 1 48 ? 1.070   -5.866  2.707  1.00 32.10 ? 47  ILE B CG1 1 
ATOM   1122 C  CG2 . ILE B 1 48 ? 0.122   -6.011  0.413  1.00 33.13 ? 47  ILE B CG2 1 
ATOM   1123 C  CD1 . ILE B 1 48 ? 0.554   -4.515  3.139  1.00 33.60 ? 47  ILE B CD1 1 
ATOM   1124 N  N   . LYS B 1 49 ? 2.055   -8.150  -1.349 1.00 34.07 ? 48  LYS B N   1 
ATOM   1125 C  CA  . LYS B 1 49 ? 2.381   -8.227  -2.762 1.00 35.23 ? 48  LYS B CA  1 
ATOM   1126 C  C   . LYS B 1 49 ? 1.191   -7.966  -3.639 1.00 35.17 ? 48  LYS B C   1 
ATOM   1127 O  O   . LYS B 1 49 ? 1.315   -8.045  -4.862 1.00 36.40 ? 48  LYS B O   1 
ATOM   1128 C  CB  . LYS B 1 49 ? 2.895   -9.615  -3.101 1.00 35.79 ? 48  LYS B CB  1 
ATOM   1129 C  CG  . LYS B 1 49 ? 4.345   -9.695  -3.419 1.00 37.65 ? 48  LYS B CG  1 
ATOM   1130 C  CD  . LYS B 1 49 ? 4.594   -11.108 -3.991 1.00 38.08 ? 48  LYS B CD  1 
ATOM   1131 C  CE  . LYS B 1 49 ? 5.755   -11.816 -3.331 1.00 39.33 ? 48  LYS B CE  1 
ATOM   1132 N  NZ  . LYS B 1 49 ? 5.686   -13.316 -3.611 1.00 36.44 ? 48  LYS B NZ  1 
ATOM   1133 N  N   . GLU B 1 50 ? 0.041   -7.688  -3.022 1.00 34.13 ? 49  GLU B N   1 
ATOM   1134 C  CA  . GLU B 1 50 ? -1.213  -7.493  -3.735 1.00 32.91 ? 49  GLU B CA  1 
ATOM   1135 C  C   . GLU B 1 50 ? -1.992  -6.276  -3.231 1.00 32.34 ? 49  GLU B C   1 
ATOM   1136 O  O   . GLU B 1 50 ? -2.129  -6.090  -2.008 1.00 30.90 ? 49  GLU B O   1 
ATOM   1137 C  CB  . GLU B 1 50 ? -2.109  -8.724  -3.594 1.00 33.42 ? 49  GLU B CB  1 
ATOM   1138 C  CG  . GLU B 1 50 ? -1.577  -10.032 -4.209 1.00 33.40 ? 49  GLU B CG  1 
ATOM   1139 C  CD  . GLU B 1 50 ? -1.279  -9.967  -5.714 1.00 38.83 ? 49  GLU B CD  1 
ATOM   1140 O  OE1 . GLU B 1 50 ? -1.829  -9.074  -6.417 1.00 39.86 ? 49  GLU B OE1 1 
ATOM   1141 O  OE2 . GLU B 1 50 ? -0.481  -10.828 -6.194 1.00 37.25 ? 49  GLU B OE2 1 
ATOM   1142 N  N   . GLN B 1 51 ? -2.525  -5.495  -4.184 1.00 30.84 ? 50  GLN B N   1 
ATOM   1143 C  CA  . GLN B 1 51 ? -3.461  -4.381  -3.932 1.00 29.74 ? 50  GLN B CA  1 
ATOM   1144 C  C   . GLN B 1 51 ? -4.621  -4.740  -3.018 1.00 29.23 ? 50  GLN B C   1 
ATOM   1145 O  O   . GLN B 1 51 ? -5.039  -3.919  -2.162 1.00 27.46 ? 50  GLN B O   1 
ATOM   1146 C  CB  . GLN B 1 51 ? -4.026  -3.826  -5.251 1.00 30.29 ? 50  GLN B CB  1 
ATOM   1147 C  CG  . GLN B 1 51 ? -4.864  -2.523  -5.097 1.00 32.02 ? 50  GLN B CG  1 
ATOM   1148 C  CD  . GLN B 1 51 ? -3.994  -1.317  -4.763 1.00 34.38 ? 50  GLN B CD  1 
ATOM   1149 O  OE1 . GLN B 1 51 ? -3.010  -1.047  -5.458 1.00 38.33 ? 50  GLN B OE1 1 
ATOM   1150 N  NE2 . GLN B 1 51 ? -4.340  -0.597  -3.688 1.00 33.85 ? 50  GLN B NE2 1 
ATOM   1151 N  N   . GLU B 1 52 ? -5.176  -5.940  -3.206 1.00 27.75 ? 51  GLU B N   1 
ATOM   1152 C  CA  . GLU B 1 52 ? -6.330  -6.354  -2.411 1.00 28.70 ? 51  GLU B CA  1 
ATOM   1153 C  C   . GLU B 1 52 ? -6.040  -6.333  -0.914 1.00 26.65 ? 51  GLU B C   1 
ATOM   1154 O  O   . GLU B 1 52 ? -6.888  -5.976  -0.095 1.00 26.48 ? 51  GLU B O   1 
ATOM   1155 C  CB  . GLU B 1 52 ? -6.776  -7.759  -2.824 1.00 29.18 ? 51  GLU B CB  1 
ATOM   1156 C  CG  . GLU B 1 52 ? -8.139  -8.110  -2.258 1.00 32.91 ? 51  GLU B CG  1 
ATOM   1157 C  CD  . GLU B 1 52 ? -8.400  -9.606  -2.300 1.00 34.60 ? 51  GLU B CD  1 
ATOM   1158 O  OE1 . GLU B 1 52 ? -8.999  -10.120 -1.344 1.00 34.77 ? 51  GLU B OE1 1 
ATOM   1159 O  OE2 . GLU B 1 52 ? -7.990  -10.240 -3.294 1.00 36.00 ? 51  GLU B OE2 1 
ATOM   1160 N  N   . VAL B 1 53 ? -4.823  -6.733  -0.575 1.00 26.95 ? 52  VAL B N   1 
ATOM   1161 C  CA  . VAL B 1 53 ? -4.366  -6.778  0.794  1.00 26.65 ? 52  VAL B CA  1 
ATOM   1162 C  C   . VAL B 1 53 ? -4.071  -5.401  1.343  1.00 26.07 ? 52  VAL B C   1 
ATOM   1163 O  O   . VAL B 1 53 ? -4.395  -5.114  2.476  1.00 26.30 ? 52  VAL B O   1 
ATOM   1164 C  CB  . VAL B 1 53 ? -3.181  -7.756  0.956  1.00 26.55 ? 52  VAL B CB  1 
ATOM   1165 C  CG1 . VAL B 1 53 ? -2.415  -7.502  2.302  1.00 27.13 ? 52  VAL B CG1 1 
ATOM   1166 C  CG2 . VAL B 1 53 ? -3.719  -9.235  0.862  1.00 27.79 ? 52  VAL B CG2 1 
ATOM   1167 N  N   . VAL B 1 54 ? -3.461  -4.531  0.554  1.00 26.42 ? 53  VAL B N   1 
ATOM   1168 C  CA  . VAL B 1 54 ? -3.385  -3.087  0.976  1.00 26.14 ? 53  VAL B CA  1 
ATOM   1169 C  C   . VAL B 1 54 ? -4.779  -2.489  1.269  1.00 26.43 ? 53  VAL B C   1 
ATOM   1170 O  O   . VAL B 1 54 ? -4.997  -1.818  2.315  1.00 26.46 ? 53  VAL B O   1 
ATOM   1171 C  CB  . VAL B 1 54 ? -2.664  -2.255  -0.069 1.00 26.46 ? 53  VAL B CB  1 
ATOM   1172 C  CG1 . VAL B 1 54 ? -2.536  -0.771  0.404  1.00 26.45 ? 53  VAL B CG1 1 
ATOM   1173 C  CG2 . VAL B 1 54 ? -1.311  -2.850  -0.319 1.00 24.82 ? 53  VAL B CG2 1 
ATOM   1174 N  N   . ASP B 1 55 ? -5.728  -2.762  0.368  1.00 27.02 ? 54  ASP B N   1 
ATOM   1175 C  CA  . ASP B 1 55 ? -7.111  -2.311  0.523  1.00 27.83 ? 54  ASP B CA  1 
ATOM   1176 C  C   . ASP B 1 55 ? -7.744  -2.794  1.834  1.00 27.87 ? 54  ASP B C   1 
ATOM   1177 O  O   . ASP B 1 55 ? -8.375  -2.035  2.586  1.00 26.83 ? 54  ASP B O   1 
ATOM   1178 C  CB  . ASP B 1 55 ? -7.953  -2.796  -0.680 1.00 28.41 ? 54  ASP B CB  1 
ATOM   1179 C  CG  . ASP B 1 55 ? -7.529  -2.147  -2.031 1.00 30.00 ? 54  ASP B CG  1 
ATOM   1180 O  OD1 . ASP B 1 55 ? -6.685  -1.199  -2.066 1.00 30.03 ? 54  ASP B OD1 1 
ATOM   1181 O  OD2 . ASP B 1 55 ? -8.037  -2.602  -3.071 1.00 30.55 ? 54  ASP B OD2 1 
ATOM   1182 N  N   . LYS B 1 56 ? -7.567  -4.077  2.104  1.00 28.11 ? 55  LYS B N   1 
ATOM   1183 C  CA  . LYS B 1 56 ? -8.183  -4.706  3.254  1.00 28.75 ? 55  LYS B CA  1 
ATOM   1184 C  C   . LYS B 1 56 ? -7.608  -4.234  4.561  1.00 28.23 ? 55  LYS B C   1 
ATOM   1185 O  O   . LYS B 1 56 ? -8.337  -4.086  5.514  1.00 28.06 ? 55  LYS B O   1 
ATOM   1186 C  CB  . LYS B 1 56 ? -8.113  -6.269  3.173  1.00 29.20 ? 55  LYS B CB  1 
ATOM   1187 C  CG  . LYS B 1 56 ? -9.072  -6.891  2.163  1.00 30.89 ? 55  LYS B CG  1 
ATOM   1188 C  CD  . LYS B 1 56 ? -10.527 -6.735  2.607  1.00 34.26 ? 55  LYS B CD  1 
ATOM   1189 C  CE  . LYS B 1 56 ? -11.032 -5.294  2.416  1.00 36.46 ? 55  LYS B CE  1 
ATOM   1190 N  NZ  . LYS B 1 56 ? -10.471 -4.639  1.178  1.00 32.89 ? 55  LYS B NZ  1 
ATOM   1191 N  N   . VAL B 1 57 ? -6.298  -4.049  4.631  1.00 28.58 ? 56  VAL B N   1 
ATOM   1192 C  CA  . VAL B 1 57 ? -5.695  -3.592  5.883  1.00 28.15 ? 56  VAL B CA  1 
ATOM   1193 C  C   . VAL B 1 57 ? -6.226  -2.190  6.144  1.00 27.80 ? 56  VAL B C   1 
ATOM   1194 O  O   . VAL B 1 57 ? -6.711  -1.885  7.235  1.00 27.60 ? 56  VAL B O   1 
ATOM   1195 C  CB  . VAL B 1 57 ? -4.110  -3.627  5.831  1.00 28.18 ? 56  VAL B CB  1 
ATOM   1196 C  CG1 . VAL B 1 57 ? -3.523  -3.063  7.128  1.00 29.57 ? 56  VAL B CG1 1 
ATOM   1197 C  CG2 . VAL B 1 57 ? -3.601  -5.046  5.606  1.00 28.68 ? 56  VAL B CG2 1 
ATOM   1198 N  N   . MET B 1 58 ? -6.173  -1.327  5.127  1.00 27.46 ? 57  MET B N   1 
ATOM   1199 C  CA  . MET B 1 58 ? -6.706  0.024   5.275  1.00 27.10 ? 57  MET B CA  1 
ATOM   1200 C  C   . MET B 1 58 ? -8.161  0.041   5.742  1.00 27.92 ? 57  MET B C   1 
ATOM   1201 O  O   . MET B 1 58 ? -8.499  0.722   6.716  1.00 27.08 ? 57  MET B O   1 
ATOM   1202 C  CB  . MET B 1 58 ? -6.497  0.880   4.003  1.00 27.36 ? 57  MET B CB  1 
ATOM   1203 C  CG  . MET B 1 58 ? -6.833  2.379   4.234  1.00 27.71 ? 57  MET B CG  1 
ATOM   1204 S  SD  . MET B 1 58 ? -5.843  3.200   5.548  1.00 27.70 ? 57  MET B SD  1 
ATOM   1205 C  CE  . MET B 1 58 ? -4.331  3.518   4.650  1.00 24.81 ? 57  MET B CE  1 
ATOM   1206 N  N   . GLU B 1 59 ? -9.022  -0.715  5.074  1.00 28.57 ? 58  GLU B N   1 
ATOM   1207 C  CA  . GLU B 1 59 ? -10.421 -0.831  5.541  1.00 30.42 ? 58  GLU B CA  1 
ATOM   1208 C  C   . GLU B 1 59 ? -10.548 -1.276  7.023  1.00 29.44 ? 58  GLU B C   1 
ATOM   1209 O  O   . GLU B 1 59 ? -11.282 -0.702  7.779  1.00 30.56 ? 58  GLU B O   1 
ATOM   1210 C  CB  . GLU B 1 59 ? -11.228 -1.713  4.586  1.00 30.30 ? 58  GLU B CB  1 
ATOM   1211 C  CG  . GLU B 1 59 ? -12.703 -1.879  4.960  1.00 35.38 ? 58  GLU B CG  1 
ATOM   1212 C  CD  . GLU B 1 59 ? -13.626 -0.746  4.481  1.00 38.78 ? 58  GLU B CD  1 
ATOM   1213 O  OE1 . GLU B 1 59 ? -13.192 0.135   3.701  1.00 42.44 ? 58  GLU B OE1 1 
ATOM   1214 O  OE2 . GLU B 1 59 ? -14.831 -0.763  4.875  1.00 43.86 ? 58  GLU B OE2 1 
ATOM   1215 N  N   . THR B 1 60 ? -9.773  -2.262  7.439  1.00 30.76 ? 59  THR B N   1 
ATOM   1216 C  CA  . THR B 1 60 ? -9.729  -2.689  8.834  1.00 30.23 ? 59  THR B CA  1 
ATOM   1217 C  C   . THR B 1 60 ? -9.329  -1.568  9.782  1.00 29.42 ? 59  THR B C   1 
ATOM   1218 O  O   . THR B 1 60 ? -9.857  -1.458  10.883 1.00 29.12 ? 59  THR B O   1 
ATOM   1219 C  CB  . THR B 1 60 ? -8.705  -3.830  8.975  1.00 31.21 ? 59  THR B CB  1 
ATOM   1220 O  OG1 . THR B 1 60 ? -8.942  -4.777  7.935  1.00 33.30 ? 59  THR B OG1 1 
ATOM   1221 C  CG2 . THR B 1 60 ? -8.818  -4.522  10.324 1.00 30.85 ? 59  THR B CG2 1 
ATOM   1222 N  N   . LEU B 1 61 ? -8.376  -0.748  9.355  1.00 28.39 ? 60  LEU B N   1 
ATOM   1223 C  CA  . LEU B 1 61 ? -7.727  0.190   10.235 1.00 28.88 ? 60  LEU B CA  1 
ATOM   1224 C  C   . LEU B 1 61 ? -8.419  1.520   10.211 1.00 28.57 ? 60  LEU B C   1 
ATOM   1225 O  O   . LEU B 1 61 ? -8.417  2.240   11.215 1.00 28.44 ? 60  LEU B O   1 
ATOM   1226 C  CB  . LEU B 1 61 ? -6.223  0.329   9.886  1.00 28.39 ? 60  LEU B CB  1 
ATOM   1227 C  CG  . LEU B 1 61 ? -5.399  -0.859  10.385 1.00 29.76 ? 60  LEU B CG  1 
ATOM   1228 C  CD1 . LEU B 1 61 ? -3.931  -0.738  9.904  1.00 28.78 ? 60  LEU B CD1 1 
ATOM   1229 C  CD2 . LEU B 1 61 ? -5.536  -0.952  11.948 1.00 25.22 ? 60  LEU B CD2 1 
ATOM   1230 N  N   . ASP B 1 62 ? -9.077  1.819   9.095  1.00 29.61 ? 61  ASP B N   1 
ATOM   1231 C  CA  . ASP B 1 62 ? -9.703  3.138   8.921  1.00 31.22 ? 61  ASP B CA  1 
ATOM   1232 C  C   . ASP B 1 62 ? -11.046 3.239   9.647  1.00 32.19 ? 61  ASP B C   1 
ATOM   1233 O  O   . ASP B 1 62 ? -12.092 2.914   9.083  1.00 31.49 ? 61  ASP B O   1 
ATOM   1234 C  CB  . ASP B 1 62 ? -9.827  3.504   7.436  1.00 29.74 ? 61  ASP B CB  1 
ATOM   1235 C  CG  . ASP B 1 62 ? -10.433 4.879   7.212  1.00 31.14 ? 61  ASP B CG  1 
ATOM   1236 O  OD1 . ASP B 1 62 ? -10.249 5.790   8.069  1.00 32.05 ? 61  ASP B OD1 1 
ATOM   1237 O  OD2 . ASP B 1 62 ? -11.083 5.051   6.162  1.00 26.60 ? 61  ASP B OD2 1 
ATOM   1238 N  N   . ASN B 1 63 ? -10.989 3.708   10.898 1.00 33.89 ? 62  ASN B N   1 
ATOM   1239 C  CA  . ASN B 1 63 ? -12.154 3.799   11.770 1.00 36.08 ? 62  ASN B CA  1 
ATOM   1240 C  C   . ASN B 1 63 ? -12.997 5.085   11.541 1.00 36.76 ? 62  ASN B C   1 
ATOM   1241 O  O   . ASN B 1 63 ? -14.209 5.082   11.665 1.00 38.09 ? 62  ASN B O   1 
ATOM   1242 C  CB  . ASN B 1 63 ? -11.688 3.768   13.234 1.00 36.05 ? 62  ASN B CB  1 
ATOM   1243 C  CG  . ASN B 1 63 ? -11.539 2.377   13.803 1.00 37.86 ? 62  ASN B CG  1 
ATOM   1244 O  OD1 . ASN B 1 63 ? -11.535 1.361   13.094 1.00 39.85 ? 62  ASN B OD1 1 
ATOM   1245 N  ND2 . ASN B 1 63 ? -11.433 2.321   15.129 1.00 38.54 ? 62  ASN B ND2 1 
ATOM   1246 N  N   . ASP B 1 64 ? -12.372 6.207   11.233 1.00 38.39 ? 63  ASP B N   1 
ATOM   1247 C  CA  . ASP B 1 64 ? -13.195 7.411   11.030 1.00 38.21 ? 63  ASP B CA  1 
ATOM   1248 C  C   . ASP B 1 64 ? -13.766 7.527   9.605  1.00 38.30 ? 63  ASP B C   1 
ATOM   1249 O  O   . ASP B 1 64 ? -14.606 8.386   9.339  1.00 39.58 ? 63  ASP B O   1 
ATOM   1250 C  CB  . ASP B 1 64 ? -12.481 8.677   11.502 1.00 38.19 ? 63  ASP B CB  1 
ATOM   1251 C  CG  . ASP B 1 64 ? -11.173 8.935   10.772 1.00 37.80 ? 63  ASP B CG  1 
ATOM   1252 O  OD1 . ASP B 1 64 ? -10.951 8.295   9.725  1.00 38.49 ? 63  ASP B OD1 1 
ATOM   1253 O  OD2 . ASP B 1 64 ? -10.372 9.781   11.242 1.00 35.22 ? 63  ASP B OD2 1 
ATOM   1254 N  N   . GLY B 1 65 ? -13.317 6.658   8.701  1.00 38.30 ? 64  GLY B N   1 
ATOM   1255 C  CA  . GLY B 1 65 ? -13.782 6.674   7.313  1.00 37.79 ? 64  GLY B CA  1 
ATOM   1256 C  C   . GLY B 1 65 ? -13.182 7.636   6.291  1.00 37.56 ? 64  GLY B C   1 
ATOM   1257 O  O   . GLY B 1 65 ? -13.679 7.704   5.160  1.00 38.57 ? 64  GLY B O   1 
ATOM   1258 N  N   . ASP B 1 66 ? -12.111 8.353   6.635  1.00 36.45 ? 65  ASP B N   1 
ATOM   1259 C  CA  . ASP B 1 66 ? -11.411 9.206   5.646  1.00 34.61 ? 65  ASP B CA  1 
ATOM   1260 C  C   . ASP B 1 66 ? -10.496 8.472   4.621  1.00 32.91 ? 65  ASP B C   1 
ATOM   1261 O  O   . ASP B 1 66 ? -9.830  9.099   3.792  1.00 32.20 ? 65  ASP B O   1 
ATOM   1262 C  CB  . ASP B 1 66 ? -10.658 10.357  6.332  1.00 34.00 ? 65  ASP B CB  1 
ATOM   1263 C  CG  . ASP B 1 66 ? -9.460  9.890   7.169  1.00 34.75 ? 65  ASP B CG  1 
ATOM   1264 O  OD1 . ASP B 1 66 ? -9.091  8.684   7.167  1.00 34.11 ? 65  ASP B OD1 1 
ATOM   1265 O  OD2 . ASP B 1 66 ? -8.893  10.740  7.866  1.00 30.79 ? 65  ASP B OD2 1 
ATOM   1266 N  N   . GLY B 1 67 ? -10.455 7.151   4.660  1.00 32.73 ? 66  GLY B N   1 
ATOM   1267 C  CA  . GLY B 1 67 ? -9.565  6.415   3.736  1.00 30.35 ? 66  GLY B CA  1 
ATOM   1268 C  C   . GLY B 1 67 ? -8.066  6.491   4.050  1.00 30.09 ? 66  GLY B C   1 
ATOM   1269 O  O   . GLY B 1 67 ? -7.222  5.975   3.294  1.00 28.99 ? 66  GLY B O   1 
ATOM   1270 N  N   . GLU B 1 68 ? -7.729  7.085   5.186  1.00 29.15 ? 67  GLU B N   1 
ATOM   1271 C  CA  . GLU B 1 68 ? -6.349  7.025   5.687  1.00 28.82 ? 67  GLU B CA  1 
ATOM   1272 C  C   . GLU B 1 68 ? -6.223  6.440   7.105  1.00 27.97 ? 67  GLU B C   1 
ATOM   1273 O  O   . GLU B 1 68 ? -7.218  6.277   7.830  1.00 26.92 ? 67  GLU B O   1 
ATOM   1274 C  CB  . GLU B 1 68 ? -5.678  8.388   5.595  1.00 28.59 ? 67  GLU B CB  1 
ATOM   1275 C  CG  . GLU B 1 68 ? -4.916  8.625   4.269  1.00 32.36 ? 67  GLU B CG  1 
ATOM   1276 C  CD  . GLU B 1 68 ? -4.148  9.895   4.261  1.00 35.25 ? 67  GLU B CD  1 
ATOM   1277 O  OE1 . GLU B 1 68 ? -2.924  9.871   4.521  1.00 40.45 ? 67  GLU B OE1 1 
ATOM   1278 O  OE2 . GLU B 1 68 ? -4.741  10.948  4.000  1.00 41.02 ? 67  GLU B OE2 1 
ATOM   1279 N  N   . CYS B 1 69 ? -4.989  6.128   7.485  1.00 27.71 ? 68  CYS B N   1 
ATOM   1280 C  CA  . CYS B 1 69 ? -4.676  5.684   8.844  1.00 28.25 ? 68  CYS B CA  1 
ATOM   1281 C  C   . CYS B 1 69 ? -3.958  6.786   9.623  1.00 26.33 ? 68  CYS B C   1 
ATOM   1282 O  O   . CYS B 1 69 ? -2.774  7.093   9.348  1.00 27.57 ? 68  CYS B O   1 
ATOM   1283 C  CB  . CYS B 1 69 ? -3.810  4.406   8.809  1.00 27.10 ? 68  CYS B CB  1 
ATOM   1284 S  SG  . CYS B 1 69 ? -3.487  3.620   10.480 1.00 28.03 ? 68  CYS B SG  1 
ATOM   1285 N  N   . ASP B 1 70 ? -4.645  7.343   10.621 1.00 26.85 ? 69  ASP B N   1 
ATOM   1286 C  CA  . ASP B 1 70 ? -4.044  8.385   11.472 1.00 26.69 ? 69  ASP B CA  1 
ATOM   1287 C  C   . ASP B 1 70 ? -3.352  7.747   12.687 1.00 27.30 ? 69  ASP B C   1 
ATOM   1288 O  O   . ASP B 1 70 ? -3.335  6.514   12.817 1.00 25.66 ? 69  ASP B O   1 
ATOM   1289 C  CB  . ASP B 1 70 ? -5.087  9.434   11.915 1.00 26.38 ? 69  ASP B CB  1 
ATOM   1290 C  CG  . ASP B 1 70 ? -6.173  8.875   12.840 1.00 28.74 ? 69  ASP B CG  1 
ATOM   1291 O  OD1 . ASP B 1 70 ? -5.958  7.896   13.588 1.00 29.89 ? 69  ASP B OD1 1 
ATOM   1292 O  OD2 . ASP B 1 70 ? -7.278  9.450   12.842 1.00 34.21 ? 69  ASP B OD2 1 
ATOM   1293 N  N   . PHE B 1 71 ? -2.828  8.578   13.590 1.00 26.65 ? 70  PHE B N   1 
ATOM   1294 C  CA  . PHE B 1 71 ? -1.984  8.043   14.655 1.00 28.30 ? 70  PHE B CA  1 
ATOM   1295 C  C   . PHE B 1 71 ? -2.767  7.152   15.622 1.00 27.35 ? 70  PHE B C   1 
ATOM   1296 O  O   . PHE B 1 71 ? -2.252  6.116   16.071 1.00 28.05 ? 70  PHE B O   1 
ATOM   1297 C  CB  . PHE B 1 71 ? -1.223  9.123   15.433 1.00 28.60 ? 70  PHE B CB  1 
ATOM   1298 C  CG  . PHE B 1 71 ? -0.226  8.544   16.382 1.00 31.51 ? 70  PHE B CG  1 
ATOM   1299 C  CD1 . PHE B 1 71 ? 0.941   7.948   15.892 1.00 32.93 ? 70  PHE B CD1 1 
ATOM   1300 C  CD2 . PHE B 1 71 ? -0.486  8.505   17.745 1.00 32.39 ? 70  PHE B CD2 1 
ATOM   1301 C  CE1 . PHE B 1 71 ? 1.845   7.385   16.748 1.00 36.86 ? 70  PHE B CE1 1 
ATOM   1302 C  CE2 . PHE B 1 71 ? 0.414   7.936   18.619 1.00 32.59 ? 70  PHE B CE2 1 
ATOM   1303 C  CZ  . PHE B 1 71 ? 1.578   7.370   18.125 1.00 33.67 ? 70  PHE B CZ  1 
ATOM   1304 N  N   . GLN B 1 72 ? -4.006  7.543   15.922 1.00 27.25 ? 71  GLN B N   1 
ATOM   1305 C  CA  . GLN B 1 72 ? -4.922  6.687   16.731 1.00 28.57 ? 71  GLN B CA  1 
ATOM   1306 C  C   . GLN B 1 72 ? -5.154  5.308   16.091 1.00 27.17 ? 71  GLN B C   1 
ATOM   1307 O  O   . GLN B 1 72 ? -5.115  4.233   16.753 1.00 27.40 ? 71  GLN B O   1 
ATOM   1308 C  CB  . GLN B 1 72 ? -6.257  7.431   16.993 1.00 28.06 ? 71  GLN B CB  1 
ATOM   1309 C  CG  . GLN B 1 72 ? -7.576  6.660   16.588 1.00 29.60 ? 71  GLN B CG  1 
ATOM   1310 C  CD  . GLN B 1 72 ? -8.832  7.117   17.344 1.00 31.79 ? 71  GLN B CD  1 
ATOM   1311 O  OE1 . GLN B 1 72 ? -9.470  6.313   18.035 1.00 39.03 ? 71  GLN B OE1 1 
ATOM   1312 N  NE2 . GLN B 1 72 ? -9.186  8.410   17.233 1.00 32.64 ? 71  GLN B NE2 1 
ATOM   1313 N  N   . GLU B 1 73 ? -5.404  5.338   14.787 1.00 26.47 ? 72  GLU B N   1 
ATOM   1314 C  CA  . GLU B 1 73 ? -5.664  4.121   14.045 1.00 25.36 ? 72  GLU B CA  1 
ATOM   1315 C  C   . GLU B 1 73 ? -4.404  3.271   13.900 1.00 24.93 ? 72  GLU B C   1 
ATOM   1316 O  O   . GLU B 1 73 ? -4.499  2.064   13.834 1.00 24.48 ? 72  GLU B O   1 
ATOM   1317 C  CB  . GLU B 1 73 ? -6.236  4.474   12.675 1.00 24.94 ? 72  GLU B CB  1 
ATOM   1318 C  CG  . GLU B 1 73 ? -7.702  4.923   12.769 1.00 26.31 ? 72  GLU B CG  1 
ATOM   1319 C  CD  . GLU B 1 73 ? -8.118  5.758   11.613 1.00 21.64 ? 72  GLU B CD  1 
ATOM   1320 O  OE1 . GLU B 1 73 ? -7.252  6.163   10.798 1.00 25.63 ? 72  GLU B OE1 1 
ATOM   1321 O  OE2 . GLU B 1 73 ? -9.316  6.056   11.508 1.00 24.29 ? 72  GLU B OE2 1 
ATOM   1322 N  N   . PHE B 1 74 ? -3.250  3.928   13.840 1.00 24.16 ? 73  PHE B N   1 
ATOM   1323 C  CA  . PHE B 1 74 ? -1.931  3.275   13.845 1.00 23.72 ? 73  PHE B CA  1 
ATOM   1324 C  C   . PHE B 1 74 ? -1.630  2.579   15.150 1.00 23.35 ? 73  PHE B C   1 
ATOM   1325 O  O   . PHE B 1 74 ? -1.225  1.425   15.130 1.00 22.85 ? 73  PHE B O   1 
ATOM   1326 C  CB  . PHE B 1 74 ? -0.790  4.249   13.522 1.00 22.91 ? 73  PHE B CB  1 
ATOM   1327 C  CG  . PHE B 1 74 ? 0.586   3.597   13.565 1.00 21.66 ? 73  PHE B CG  1 
ATOM   1328 C  CD1 . PHE B 1 74 ? 0.911   2.585   12.668 1.00 21.65 ? 73  PHE B CD1 1 
ATOM   1329 C  CD2 . PHE B 1 74 ? 1.523   3.956   14.526 1.00 20.86 ? 73  PHE B CD2 1 
ATOM   1330 C  CE1 . PHE B 1 74 ? 2.191   1.966   12.688 1.00 22.17 ? 73  PHE B CE1 1 
ATOM   1331 C  CE2 . PHE B 1 74 ? 2.773   3.340   14.568 1.00 19.56 ? 73  PHE B CE2 1 
ATOM   1332 C  CZ  . PHE B 1 74 ? 3.111   2.350   13.647 1.00 21.52 ? 73  PHE B CZ  1 
ATOM   1333 N  N   . MET B 1 75 ? -1.828  3.266   16.273 1.00 22.93 ? 74  MET B N   1 
ATOM   1334 C  CA  . MET B 1 75 ? -1.680  2.619   17.607 1.00 23.57 ? 74  MET B CA  1 
ATOM   1335 C  C   . MET B 1 75 ? -2.594  1.392   17.789 1.00 22.18 ? 74  MET B C   1 
ATOM   1336 O  O   . MET B 1 75 ? -2.195  0.392   18.380 1.00 20.87 ? 74  MET B O   1 
ATOM   1337 C  CB  . MET B 1 75 ? -1.911  3.637   18.770 1.00 23.95 ? 74  MET B CB  1 
ATOM   1338 C  CG  . MET B 1 75 ? -0.645  4.493   19.184 1.00 27.16 ? 74  MET B CG  1 
ATOM   1339 S  SD  . MET B 1 75 ? 0.910   3.565   19.027 1.00 37.65 ? 74  MET B SD  1 
ATOM   1340 C  CE  . MET B 1 75 ? 0.807   2.510   20.467 1.00 31.70 ? 74  MET B CE  1 
ATOM   1341 N  N   . ALA B 1 76 ? -3.832  1.467   17.296 1.00 21.82 ? 75  ALA B N   1 
ATOM   1342 C  CA  . ALA B 1 76 ? -4.681  0.260   17.200 1.00 21.18 ? 75  ALA B CA  1 
ATOM   1343 C  C   . ALA B 1 76 ? -4.116  -0.895  16.353 1.00 21.42 ? 75  ALA B C   1 
ATOM   1344 O  O   . ALA B 1 76 ? -4.236  -2.080  16.743 1.00 20.85 ? 75  ALA B O   1 
ATOM   1345 C  CB  . ALA B 1 76 ? -6.138  0.654   16.743 1.00 23.34 ? 75  ALA B CB  1 
ATOM   1346 N  N   . PHE B 1 77 ? -3.521  -0.593  15.187 1.00 19.58 ? 76  PHE B N   1 
ATOM   1347 C  CA  . PHE B 1 77 ? -2.839  -1.664  14.391 1.00 20.79 ? 76  PHE B CA  1 
ATOM   1348 C  C   . PHE B 1 77 ? -1.668  -2.204  15.195 1.00 19.11 ? 76  PHE B C   1 
ATOM   1349 O  O   . PHE B 1 77 ? -1.474  -3.409  15.274 1.00 19.90 ? 76  PHE B O   1 
ATOM   1350 C  CB  . PHE B 1 77 ? -2.376  -1.134  13.009 1.00 19.46 ? 76  PHE B CB  1 
ATOM   1351 C  CG  . PHE B 1 77 ? -1.480  -2.057  12.217 1.00 21.28 ? 76  PHE B CG  1 
ATOM   1352 C  CD1 . PHE B 1 77 ? -1.892  -3.312  11.810 1.00 19.70 ? 76  PHE B CD1 1 
ATOM   1353 C  CD2 . PHE B 1 77 ? -0.219  -1.615  11.802 1.00 22.54 ? 76  PHE B CD2 1 
ATOM   1354 C  CE1 . PHE B 1 77 ? -1.075  -4.117  11.033 1.00 19.50 ? 76  PHE B CE1 1 
ATOM   1355 C  CE2 . PHE B 1 77 ? 0.588   -2.383  11.036 1.00 24.86 ? 76  PHE B CE2 1 
ATOM   1356 C  CZ  . PHE B 1 77 ? 0.168   -3.668  10.653 1.00 22.54 ? 76  PHE B CZ  1 
ATOM   1357 N  N   . VAL B 1 78 ? -0.911  -1.307  15.827 1.00 20.79 ? 77  VAL B N   1 
ATOM   1358 C  CA  . VAL B 1 78 ? 0.235   -1.728  16.664 1.00 20.87 ? 77  VAL B CA  1 
ATOM   1359 C  C   . VAL B 1 78 ? -0.281  -2.728  17.746 1.00 22.09 ? 77  VAL B C   1 
ATOM   1360 O  O   . VAL B 1 78 ? 0.326   -3.781  17.929 1.00 22.36 ? 77  VAL B O   1 
ATOM   1361 C  CB  . VAL B 1 78 ? 1.010   -0.508  17.286 1.00 20.77 ? 77  VAL B CB  1 
ATOM   1362 C  CG1 . VAL B 1 78 ? 1.998   -0.977  18.397 1.00 19.96 ? 77  VAL B CG1 1 
ATOM   1363 C  CG2 . VAL B 1 78 ? 1.813   0.243   16.221 1.00 23.22 ? 77  VAL B CG2 1 
ATOM   1364 N  N   . ALA B 1 79 ? -1.428  -2.438  18.385 1.00 21.99 ? 78  ALA B N   1 
ATOM   1365 C  CA  . ALA B 1 79 ? -1.945  -3.324  19.455 1.00 23.25 ? 78  ALA B CA  1 
ATOM   1366 C  C   . ALA B 1 79 ? -2.312  -4.708  18.916 1.00 24.27 ? 78  ALA B C   1 
ATOM   1367 O  O   . ALA B 1 79 ? -2.015  -5.748  19.522 1.00 23.11 ? 78  ALA B O   1 
ATOM   1368 C  CB  . ALA B 1 79 ? -3.129  -2.683  20.210 1.00 22.43 ? 78  ALA B CB  1 
ATOM   1369 N  N   . MET B 1 80 ? -2.877  -4.723  17.723 1.00 25.27 ? 79  MET B N   1 
ATOM   1370 C  CA  . MET B 1 80 ? -3.301  -5.973  17.146 1.00 28.24 ? 79  MET B CA  1 
ATOM   1371 C  C   . MET B 1 80 ? -2.164  -6.825  16.579 1.00 27.46 ? 79  MET B C   1 
ATOM   1372 O  O   . MET B 1 80 ? -2.281  -8.036  16.565 1.00 28.62 ? 79  MET B O   1 
ATOM   1373 C  CB  . MET B 1 80 ? -4.449  -5.764  16.151 1.00 29.68 ? 79  MET B CB  1 
ATOM   1374 C  CG  . MET B 1 80 ? -5.860  -6.247  16.675 1.00 34.76 ? 79  MET B CG  1 
ATOM   1375 S  SD  . MET B 1 80 ? -6.061  -7.811  17.649 1.00 46.50 ? 79  MET B SD  1 
ATOM   1376 C  CE  . MET B 1 80 ? -4.826  -8.924  16.942 1.00 35.55 ? 79  MET B CE  1 
ATOM   1377 N  N   . VAL B 1 81 ? -1.051  -6.223  16.160 1.00 26.83 ? 80  VAL B N   1 
ATOM   1378 C  CA  . VAL B 1 81 ? 0.144   -7.025  15.800 1.00 26.16 ? 80  VAL B CA  1 
ATOM   1379 C  C   . VAL B 1 81 ? 0.806   -7.488  17.101 1.00 27.15 ? 80  VAL B C   1 
ATOM   1380 O  O   . VAL B 1 81 ? 1.074   -8.677  17.280 1.00 26.89 ? 80  VAL B O   1 
ATOM   1381 C  CB  . VAL B 1 81 ? 1.127   -6.249  14.882 1.00 26.21 ? 80  VAL B CB  1 
ATOM   1382 C  CG1 . VAL B 1 81 ? 2.492   -6.988  14.649 1.00 24.94 ? 80  VAL B CG1 1 
ATOM   1383 C  CG2 . VAL B 1 81 ? 0.493   -6.000  13.548 1.00 23.39 ? 80  VAL B CG2 1 
ATOM   1384 N  N   . THR B 1 82 ? 1.011   -6.561  18.034 1.00 26.31 ? 81  THR B N   1 
ATOM   1385 C  CA  . THR B 1 82 ? 1.654   -6.898  19.287 1.00 27.49 ? 81  THR B CA  1 
ATOM   1386 C  C   . THR B 1 82 ? 0.844   -8.004  19.985 1.00 28.63 ? 81  THR B C   1 
ATOM   1387 O  O   . THR B 1 82 ? 1.423   -8.996  20.421 1.00 28.87 ? 81  THR B O   1 
ATOM   1388 C  CB  . THR B 1 82 ? 1.864   -5.652  20.172 1.00 28.46 ? 81  THR B CB  1 
ATOM   1389 O  OG1 . THR B 1 82 ? 2.486   -4.606  19.380 1.00 27.51 ? 81  THR B OG1 1 
ATOM   1390 C  CG2 . THR B 1 82 ? 2.731   -6.005  21.364 1.00 27.34 ? 81  THR B CG2 1 
ATOM   1391 N  N   . THR B 1 83 ? -0.489  -7.864  20.033 1.00 29.90 ? 82  THR B N   1 
ATOM   1392 C  CA  . THR B 1 83 ? -1.379  -8.920  20.581 1.00 30.37 ? 82  THR B CA  1 
ATOM   1393 C  C   . THR B 1 83 ? -1.241  -10.236 19.826 1.00 32.39 ? 82  THR B C   1 
ATOM   1394 O  O   . THR B 1 83 ? -1.050  -11.284 20.455 1.00 33.21 ? 82  THR B O   1 
ATOM   1395 C  CB  . THR B 1 83 ? -2.828  -8.503  20.575 1.00 30.41 ? 82  THR B CB  1 
ATOM   1396 O  OG1 . THR B 1 83 ? -2.924  -7.261  21.269 1.00 29.76 ? 82  THR B OG1 1 
ATOM   1397 C  CG2 . THR B 1 83 ? -3.730  -9.598  21.280 1.00 30.99 ? 82  THR B CG2 1 
ATOM   1398 N  N   . ALA B 1 84 ? -1.323  -10.186 18.492 1.00 34.09 ? 83  ALA B N   1 
ATOM   1399 C  CA  . ALA B 1 84 ? -0.994  -11.349 17.656 1.00 35.89 ? 83  ALA B CA  1 
ATOM   1400 C  C   . ALA B 1 84 ? 0.297   -12.056 18.061 1.00 37.11 ? 83  ALA B C   1 
ATOM   1401 O  O   . ALA B 1 84 ? 0.306   -13.278 18.228 1.00 36.89 ? 83  ALA B O   1 
ATOM   1402 C  CB  . ALA B 1 84 ? -0.955  -10.963 16.173 1.00 35.63 ? 83  ALA B CB  1 
ATOM   1403 N  N   . CYS B 1 85 ? 1.397   -11.309 18.209 1.00 38.37 ? 84  CYS B N   1 
ATOM   1404 C  CA  A CYS B 1 85 ? 2.686   -11.897 18.593 0.50 38.89 ? 84  CYS B CA  1 
ATOM   1405 C  CA  B CYS B 1 85 ? 2.673   -11.911 18.585 0.50 39.14 ? 84  CYS B CA  1 
ATOM   1406 C  C   . CYS B 1 85 ? 2.644   -12.519 19.988 1.00 39.87 ? 84  CYS B C   1 
ATOM   1407 O  O   . CYS B 1 85 ? 3.279   -13.535 20.235 1.00 39.69 ? 84  CYS B O   1 
ATOM   1408 C  CB  A CYS B 1 85 ? 3.810   -10.859 18.528 0.50 39.02 ? 84  CYS B CB  1 
ATOM   1409 C  CB  B CYS B 1 85 ? 3.804   -10.894 18.480 0.50 39.32 ? 84  CYS B CB  1 
ATOM   1410 S  SG  A CYS B 1 85 ? 4.263   -10.325 16.862 0.50 36.32 ? 84  CYS B SG  1 
ATOM   1411 S  SG  B CYS B 1 85 ? 5.370   -11.536 19.059 0.50 38.18 ? 84  CYS B SG  1 
ATOM   1412 N  N   . HIS B 1 86 ? 1.910   -11.874 20.889 1.00 41.00 ? 85  HIS B N   1 
ATOM   1413 C  CA  . HIS B 1 86 ? 1.688   -12.329 22.265 1.00 43.01 ? 85  HIS B CA  1 
ATOM   1414 C  C   . HIS B 1 86 ? 0.789   -13.572 22.260 1.00 44.07 ? 85  HIS B C   1 
ATOM   1415 O  O   . HIS B 1 86 ? 1.158   -14.623 22.826 1.00 44.15 ? 85  HIS B O   1 
ATOM   1416 C  CB  . HIS B 1 86 ? 1.043   -11.181 23.070 1.00 42.93 ? 85  HIS B CB  1 
ATOM   1417 C  CG  . HIS B 1 86 ? 0.985   -11.411 24.546 1.00 43.31 ? 85  HIS B CG  1 
ATOM   1418 N  ND1 . HIS B 1 86 ? 2.111   -11.444 25.339 1.00 43.62 ? 85  HIS B ND1 1 
ATOM   1419 C  CD2 . HIS B 1 86 ? -0.068  -11.589 25.382 1.00 44.36 ? 85  HIS B CD2 1 
ATOM   1420 C  CE1 . HIS B 1 86 ? 1.759   -11.658 26.593 1.00 42.09 ? 85  HIS B CE1 1 
ATOM   1421 N  NE2 . HIS B 1 86 ? 0.444   -11.747 26.648 1.00 42.77 ? 85  HIS B NE2 1 
ATOM   1422 N  N   . GLU B 1 87 ? -0.379  -13.455 21.615 1.00 45.50 ? 86  GLU B N   1 
ATOM   1423 C  CA  . GLU B 1 87 ? -1.294  -14.586 21.402 1.00 47.31 ? 86  GLU B CA  1 
ATOM   1424 C  C   . GLU B 1 87 ? -0.484  -15.784 20.915 1.00 47.88 ? 86  GLU B C   1 
ATOM   1425 O  O   . GLU B 1 87 ? -0.631  -16.888 21.442 1.00 48.17 ? 86  GLU B O   1 
ATOM   1426 C  CB  . GLU B 1 87 ? -2.398  -14.258 20.369 1.00 47.78 ? 86  GLU B CB  1 
ATOM   1427 C  CG  . GLU B 1 87 ? -3.614  -13.491 20.878 1.00 48.29 ? 86  GLU B CG  1 
ATOM   1428 C  CD  . GLU B 1 87 ? -4.708  -13.345 19.802 1.00 48.80 ? 86  GLU B CD  1 
ATOM   1429 O  OE1 . GLU B 1 87 ? -4.471  -12.639 18.791 1.00 50.06 ? 86  GLU B OE1 1 
ATOM   1430 O  OE2 . GLU B 1 87 ? -5.803  -13.937 19.962 1.00 47.80 ? 86  GLU B OE2 1 
ATOM   1431 N  N   . PHE B 1 88 ? 0.402   -15.545 19.941 1.00 48.68 ? 87  PHE B N   1 
ATOM   1432 C  CA  . PHE B 1 88 ? 1.244   -16.598 19.343 1.00 49.67 ? 87  PHE B CA  1 
ATOM   1433 C  C   . PHE B 1 88 ? 1.949   -17.487 20.377 1.00 50.49 ? 87  PHE B C   1 
ATOM   1434 O  O   . PHE B 1 88 ? 1.659   -18.686 20.465 1.00 51.06 ? 87  PHE B O   1 
ATOM   1435 C  CB  . PHE B 1 88 ? 2.276   -15.999 18.376 1.00 49.49 ? 87  PHE B CB  1 
ATOM   1436 C  CG  . PHE B 1 88 ? 3.076   -17.038 17.610 1.00 49.46 ? 87  PHE B CG  1 
ATOM   1437 C  CD1 . PHE B 1 88 ? 2.647   -17.479 16.371 1.00 49.13 ? 87  PHE B CD1 1 
ATOM   1438 C  CD2 . PHE B 1 88 ? 4.261   -17.553 18.128 1.00 48.57 ? 87  PHE B CD2 1 
ATOM   1439 C  CE1 . PHE B 1 88 ? 3.386   -18.430 15.655 1.00 50.26 ? 87  PHE B CE1 1 
ATOM   1440 C  CE2 . PHE B 1 88 ? 5.009   -18.500 17.426 1.00 48.96 ? 87  PHE B CE2 1 
ATOM   1441 C  CZ  . PHE B 1 88 ? 4.571   -18.943 16.190 1.00 48.84 ? 87  PHE B CZ  1 
ATOM   1442 N  N   . PHE B 1 89 ? 2.849   -16.882 21.154 1.00 51.43 ? 88  PHE B N   1 
ATOM   1443 C  CA  . PHE B 1 89 ? 3.676   -17.572 22.143 1.00 52.53 ? 88  PHE B CA  1 
ATOM   1444 C  C   . PHE B 1 89 ? 2.929   -17.969 23.412 1.00 53.32 ? 88  PHE B C   1 
ATOM   1445 O  O   . PHE B 1 89 ? 2.149   -17.185 23.942 1.00 53.70 ? 88  PHE B O   1 
ATOM   1446 C  CB  . PHE B 1 89 ? 4.854   -16.682 22.565 1.00 52.35 ? 88  PHE B CB  1 
ATOM   1447 C  CG  . PHE B 1 89 ? 5.754   -16.272 21.435 1.00 52.84 ? 88  PHE B CG  1 
ATOM   1448 C  CD1 . PHE B 1 89 ? 6.463   -17.220 20.711 1.00 52.57 ? 88  PHE B CD1 1 
ATOM   1449 C  CD2 . PHE B 1 89 ? 5.924   -14.930 21.123 1.00 52.63 ? 88  PHE B CD2 1 
ATOM   1450 C  CE1 . PHE B 1 89 ? 7.303   -16.841 19.671 1.00 52.52 ? 88  PHE B CE1 1 
ATOM   1451 C  CE2 . PHE B 1 89 ? 6.769   -14.541 20.084 1.00 52.49 ? 88  PHE B CE2 1 
ATOM   1452 C  CZ  . PHE B 1 89 ? 7.455   -15.498 19.356 1.00 52.20 ? 88  PHE B CZ  1 
ATOM   1453 N  N   . GLU B 1 90 ? 3.195   -19.180 23.901 1.00 54.17 ? 89  GLU B N   1 
ATOM   1454 C  CA  . GLU B 1 90 ? 2.760   -19.608 25.232 1.00 55.24 ? 89  GLU B CA  1 
ATOM   1455 C  C   . GLU B 1 90 ? 3.712   -19.012 26.287 1.00 55.97 ? 89  GLU B C   1 
ATOM   1456 O  O   . GLU B 1 90 ? 4.900   -19.350 26.329 1.00 56.31 ? 89  GLU B O   1 
ATOM   1457 C  CB  . GLU B 1 90 ? 2.707   -21.144 25.323 1.00 55.28 ? 89  GLU B CB  1 
ATOM   1458 C  CG  . GLU B 1 90 ? 3.938   -21.788 25.938 1.00 55.37 ? 89  GLU B CG  1 
ATOM   1459 C  CD  . GLU B 1 90 ? 4.077   -23.246 25.608 1.00 55.06 ? 89  GLU B CD  1 
ATOM   1460 O  OE1 . GLU B 1 90 ? 3.853   -24.065 26.530 1.00 55.84 ? 89  GLU B OE1 1 
ATOM   1461 O  OE2 . GLU B 1 90 ? 4.414   -23.570 24.440 1.00 53.00 ? 89  GLU B OE2 1 
ATOM   1462 N  N   . HIS B 1 91 ? 3.195   -18.102 27.112 1.00 56.74 ? 90  HIS B N   1 
ATOM   1463 C  CA  . HIS B 1 91 ? 4.018   -17.380 28.101 1.00 57.08 ? 90  HIS B CA  1 
ATOM   1464 C  C   . HIS B 1 91 ? 3.590   -17.698 29.538 1.00 57.14 ? 90  HIS B C   1 
ATOM   1465 O  O   . HIS B 1 91 ? 2.434   -18.071 29.790 1.00 56.80 ? 90  HIS B O   1 
ATOM   1466 C  CB  . HIS B 1 91 ? 3.944   -15.874 27.847 1.00 57.21 ? 90  HIS B CB  1 
ATOM   1467 C  CG  . HIS B 1 91 ? 2.581   -15.405 27.443 1.00 58.43 ? 90  HIS B CG  1 
ATOM   1468 N  ND1 . HIS B 1 91 ? 1.647   -14.955 28.352 1.00 59.01 ? 90  HIS B ND1 1 
ATOM   1469 C  CD2 . HIS B 1 91 ? 1.985   -15.346 26.229 1.00 58.34 ? 90  HIS B CD2 1 
ATOM   1470 C  CE1 . HIS B 1 91 ? 0.538   -14.627 27.713 1.00 60.15 ? 90  HIS B CE1 1 
ATOM   1471 N  NE2 . HIS B 1 91 ? 0.716   -14.858 26.423 1.00 59.52 ? 90  HIS B NE2 1 
HETATM 1472 CA CA  . CA  C 2 .  ? 1.033   -10.520 38.072 1.00 34.90 ? 92  CA  A CA  1 
HETATM 1473 CA CA  . CA  D 2 .  ? -8.704  -6.679  33.564 1.00 36.96 ? 93  CA  A CA  1 
HETATM 1474 CL CL1 . S45 E 3 .  ? -5.498  4.817   29.104 1.00 48.87 ? 94  S45 A CL1 1 
HETATM 1475 C  C7  . S45 E 3 .  ? -4.650  6.283   29.706 1.00 51.34 ? 94  S45 A C7  1 
HETATM 1476 C  C10 . S45 E 3 .  ? -5.358  7.279   30.388 1.00 53.08 ? 94  S45 A C10 1 
HETATM 1477 C  C6  . S45 E 3 .  ? -4.697  8.424   30.842 1.00 50.65 ? 94  S45 A C6  1 
HETATM 1478 C  C4  . S45 E 3 .  ? -3.332  8.596   30.621 1.00 52.41 ? 94  S45 A C4  1 
HETATM 1479 C  C5  . S45 E 3 .  ? -2.621  7.611   29.940 1.00 52.04 ? 94  S45 A C5  1 
HETATM 1480 C  C9  . S45 E 3 .  ? -3.278  6.457   29.492 1.00 52.65 ? 94  S45 A C9  1 
HETATM 1481 C  C1  . S45 E 3 .  ? -2.660  9.847   31.104 1.00 52.78 ? 94  S45 A C1  1 
HETATM 1482 N  N1  . S45 E 3 .  ? -3.152  11.090  30.826 1.00 54.63 ? 94  S45 A N1  1 
HETATM 1483 C  C2  . S45 E 3 .  ? -2.361  12.030  31.367 1.00 55.10 ? 94  S45 A C2  1 
HETATM 1484 O  O1  . S45 E 3 .  ? -1.342  11.391  32.009 1.00 55.39 ? 94  S45 A O1  1 
HETATM 1485 N  N2  . S45 E 3 .  ? -1.522  9.969   31.851 1.00 55.28 ? 94  S45 A N2  1 
HETATM 1486 C  C3  . S45 E 3 .  ? -2.432  13.517  31.376 1.00 55.24 ? 94  S45 A C3  1 
HETATM 1487 C  C11 . S45 E 3 .  ? -3.521  13.957  30.378 1.00 56.37 ? 94  S45 A C11 1 
HETATM 1488 C  C13 . S45 E 3 .  ? -3.055  14.031  28.911 1.00 56.61 ? 94  S45 A C13 1 
HETATM 1489 C  C12 . S45 E 3 .  ? -1.823  14.934  28.767 1.00 57.44 ? 94  S45 A C12 1 
HETATM 1490 N  N3  . S45 E 3 .  ? -1.235  15.234  30.071 1.00 57.84 ? 94  S45 A N3  1 
HETATM 1491 C  C8  . S45 E 3 .  ? -1.081  14.168  31.055 1.00 55.42 ? 94  S45 A C8  1 
HETATM 1492 C  C   . ACT F 4 .  ? -0.216  9.063   36.899 1.00 40.91 ? 95  ACT A C   1 
HETATM 1493 O  O   . ACT F 4 .  ? 0.421   9.801   37.690 1.00 40.18 ? 95  ACT A O   1 
HETATM 1494 O  OXT . ACT F 4 .  ? 0.236   7.901   36.699 1.00 40.43 ? 95  ACT A OXT 1 
HETATM 1495 C  CH3 . ACT F 4 .  ? -1.464  9.551   36.228 1.00 40.74 ? 95  ACT A CH3 1 
HETATM 1496 CA CA  . CA  G 2 .  ? 0.939   11.078  4.499  1.00 35.72 ? 92  CA  B CA  1 
HETATM 1497 CA CA  . CA  H 2 .  ? -8.763  7.191   9.340  1.00 32.93 ? 93  CA  B CA  1 
HETATM 1498 CL CL1 . S45 I 3 .  ? -5.913  -4.411  13.898 1.00 47.48 ? 94  S45 B CL1 1 
HETATM 1499 C  C7  . S45 I 3 .  ? -5.193  -5.390  12.581 1.00 48.56 ? 94  S45 B C7  1 
HETATM 1500 C  C10 . S45 I 3 .  ? -5.216  -6.797  12.578 1.00 49.67 ? 94  S45 B C10 1 
HETATM 1501 C  C6  . S45 I 3 .  ? -4.638  -7.525  11.519 1.00 47.75 ? 94  S45 B C6  1 
HETATM 1502 C  C4  . S45 I 3 .  ? -4.052  -6.839  10.456 1.00 50.11 ? 94  S45 B C4  1 
HETATM 1503 C  C5  . S45 I 3 .  ? -4.039  -5.447  10.468 1.00 48.50 ? 94  S45 B C5  1 
HETATM 1504 C  C9  . S45 I 3 .  ? -4.600  -4.717  11.513 1.00 48.86 ? 94  S45 B C9  1 
HETATM 1505 C  C1  . S45 I 3 .  ? -3.401  -7.531  9.295  1.00 50.88 ? 94  S45 B C1  1 
HETATM 1506 N  N1  . S45 I 3 .  ? -2.787  -8.764  9.305  1.00 54.47 ? 94  S45 B N1  1 
HETATM 1507 C  C2  . S45 I 3 .  ? -2.300  -9.031  8.063  1.00 53.99 ? 94  S45 B C2  1 
HETATM 1508 O  O1  . S45 I 3 .  ? -2.581  -7.969  7.269  1.00 54.06 ? 94  S45 B O1  1 
HETATM 1509 N  N2  . S45 I 3 .  ? -3.285  -6.990  8.051  1.00 53.13 ? 94  S45 B N2  1 
HETATM 1510 C  C3  . S45 I 3 .  ? -1.568  -10.144 7.419  1.00 54.45 ? 94  S45 B C3  1 
HETATM 1511 C  C11 . S45 I 3 .  ? -0.103  -9.691  7.288  1.00 54.51 ? 94  S45 B C11 1 
HETATM 1512 C  C13 . S45 I 3 .  ? 0.616   -9.894  5.950  1.00 54.17 ? 94  S45 B C13 1 
HETATM 1513 C  C12 . S45 I 3 .  ? -0.289  -9.771  4.730  1.00 54.96 ? 94  S45 B C12 1 
HETATM 1514 N  N3  . S45 I 3 .  ? -1.437  -10.645 4.923  1.00 56.47 ? 94  S45 B N3  1 
HETATM 1515 C  C8  . S45 I 3 .  ? -2.288  -10.512 6.102  1.00 55.76 ? 94  S45 B C8  1 
HETATM 1516 O  O   . HOH J 5 .  ? 2.725   12.993  28.119 1.00 57.17 ? 96  HOH A O   1 
HETATM 1517 O  O   . HOH J 5 .  ? -2.556  -13.008 28.084 1.00 33.63 ? 97  HOH A O   1 
HETATM 1518 O  O   . HOH J 5 .  ? -9.713  -8.347  29.139 1.00 45.47 ? 98  HOH A O   1 
HETATM 1519 O  O   . HOH J 5 .  ? 0.361   10.035  43.248 1.00 27.69 ? 99  HOH A O   1 
HETATM 1520 O  O   . HOH J 5 .  ? -2.892  12.797  43.462 1.00 58.12 ? 100 HOH A O   1 
HETATM 1521 O  O   . HOH J 5 .  ? 17.743  -0.014  19.038 1.00 39.36 ? 101 HOH A O   1 
HETATM 1522 O  O   . HOH J 5 .  ? -10.181 0.102   44.419 1.00 36.13 ? 102 HOH A O   1 
HETATM 1523 O  O   . HOH J 5 .  ? -9.046  1.411   28.280 1.00 39.99 ? 103 HOH A O   1 
HETATM 1524 O  O   . HOH J 5 .  ? 5.794   5.829   45.498 1.00 36.77 ? 104 HOH A O   1 
HETATM 1525 O  O   . HOH J 5 .  ? 8.822   7.681   38.532 1.00 32.45 ? 105 HOH A O   1 
HETATM 1526 O  O   . HOH J 5 .  ? -4.947  -9.300  43.133 1.00 43.90 ? 106 HOH A O   1 
HETATM 1527 O  O   . HOH J 5 .  ? -1.539  15.149  40.243 1.00 59.52 ? 107 HOH A O   1 
HETATM 1528 O  O   . HOH J 5 .  ? 9.948   10.893  45.892 1.00 41.61 ? 108 HOH A O   1 
HETATM 1529 O  O   . HOH J 5 .  ? 14.263  -1.778  35.898 1.00 46.58 ? 109 HOH A O   1 
HETATM 1530 O  O   . HOH J 5 .  ? -1.467  16.718  38.163 1.00 34.05 ? 110 HOH A O   1 
HETATM 1531 O  O   . HOH J 5 .  ? 4.808   20.825  20.070 1.00 43.09 ? 111 HOH A O   1 
HETATM 1532 O  O   . HOH J 5 .  ? 4.676   15.083  41.909 1.00 46.05 ? 112 HOH A O   1 
HETATM 1533 O  O   . HOH J 5 .  ? 14.093  1.012   33.651 1.00 42.17 ? 113 HOH A O   1 
HETATM 1534 O  O   . HOH J 5 .  ? 6.670   -15.378 40.839 1.00 38.85 ? 114 HOH A O   1 
HETATM 1535 O  O   . HOH J 5 .  ? 8.175   11.743  47.166 1.00 42.69 ? 115 HOH A O   1 
HETATM 1536 O  O   . HOH J 5 .  ? 14.259  4.435   33.753 1.00 44.39 ? 116 HOH A O   1 
HETATM 1537 O  O   . HOH J 5 .  ? -13.072 -0.202  35.869 1.00 60.04 ? 117 HOH A O   1 
HETATM 1538 O  O   . HOH J 5 .  ? 7.989   -13.039 42.241 1.00 35.65 ? 118 HOH A O   1 
HETATM 1539 O  O   . HOH J 5 .  ? -8.720  -10.304 25.143 1.00 53.05 ? 119 HOH A O   1 
HETATM 1540 O  O   . HOH J 5 .  ? -2.783  -10.856 29.500 1.00 53.44 ? 120 HOH A O   1 
HETATM 1541 O  O   . HOH J 5 .  ? 9.597   -11.182 37.082 1.00 41.13 ? 121 HOH A O   1 
HETATM 1542 O  O   . HOH J 5 .  ? -10.927 -8.515  24.756 1.00 42.47 ? 122 HOH A O   1 
HETATM 1543 O  O   . HOH J 5 .  ? 0.832   7.799   50.281 1.00 29.09 ? 123 HOH A O   1 
HETATM 1544 O  O   . HOH J 5 .  ? -14.478 -2.044  34.422 1.00 52.14 ? 124 HOH A O   1 
HETATM 1545 O  O   . HOH J 5 .  ? -3.818  10.128  25.939 1.00 23.72 ? 125 HOH A O   1 
HETATM 1546 O  O   . HOH J 5 .  ? 7.857   10.960  36.823 1.00 31.48 ? 126 HOH A O   1 
HETATM 1547 O  O   . HOH J 5 .  ? 2.238   13.049  44.874 1.00 37.56 ? 127 HOH A O   1 
HETATM 1548 O  O   . HOH J 5 .  ? 0.415   15.772  26.415 1.00 47.91 ? 128 HOH A O   1 
HETATM 1549 O  O   . HOH J 5 .  ? 1.937   11.198  48.374 1.00 39.82 ? 129 HOH A O   1 
HETATM 1550 O  O   . HOH J 5 .  ? 8.470   -15.818 32.396 1.00 52.40 ? 130 HOH A O   1 
HETATM 1551 O  O   . HOH J 5 .  ? -12.640 2.535   33.349 1.00 52.78 ? 131 HOH A O   1 
HETATM 1552 O  O   . HOH J 5 .  ? 17.267  2.764   14.004 1.00 48.46 ? 132 HOH A O   1 
HETATM 1553 O  O   . HOH J 5 .  ? 4.017   18.981  24.178 1.00 51.31 ? 133 HOH A O   1 
HETATM 1554 O  O   . HOH J 5 .  ? 2.779   13.861  40.848 1.00 64.52 ? 134 HOH A O   1 
HETATM 1555 O  O   . HOH J 5 .  ? 0.566   4.319   46.331 1.00 50.99 ? 135 HOH A O   1 
HETATM 1556 O  O   . HOH J 5 .  ? 6.521   7.994   36.886 1.00 29.61 ? 136 HOH A O   1 
HETATM 1557 O  O   . HOH J 5 .  ? 14.174  -6.649  17.835 1.00 50.13 ? 137 HOH A O   1 
HETATM 1558 O  O   . HOH J 5 .  ? 11.732  5.369   33.566 1.00 33.86 ? 138 HOH A O   1 
HETATM 1559 O  O   . HOH J 5 .  ? -7.666  -8.740  32.994 1.00 34.48 ? 139 HOH A O   1 
HETATM 1560 O  O   . HOH J 5 .  ? 11.288  -7.701  31.657 1.00 46.52 ? 140 HOH A O   1 
HETATM 1561 O  O   . HOH J 5 .  ? 0.618   12.268  34.819 1.00 39.02 ? 141 HOH A O   1 
HETATM 1562 O  O   . HOH J 5 .  ? 13.790  -4.274  22.142 1.00 53.78 ? 142 HOH A O   1 
HETATM 1563 O  O   . HOH J 5 .  ? -2.095  7.733   33.276 1.00 51.12 ? 143 HOH A O   1 
HETATM 1564 O  O   . HOH J 5 .  ? 11.093  -0.146  30.939 1.00 39.14 ? 144 HOH A O   1 
HETATM 1565 O  O   . HOH J 5 .  ? -1.621  6.568   49.829 1.00 37.19 ? 145 HOH A O   1 
HETATM 1566 O  O   . HOH J 5 .  ? 13.596  -4.282  25.219 1.00 55.04 ? 146 HOH A O   1 
HETATM 1567 O  O   . HOH J 5 .  ? 2.493   13.727  30.948 1.00 58.13 ? 147 HOH A O   1 
HETATM 1568 O  O   . HOH J 5 .  ? 5.523   14.584  46.640 1.00 50.40 ? 148 HOH A O   1 
HETATM 1569 O  O   . HOH K 5 .  ? 19.999  1.750   27.448 1.00 51.93 ? 95  HOH B O   1 
HETATM 1570 O  O   . HOH K 5 .  ? -1.087  -19.829 23.567 1.00 47.41 ? 96  HOH B O   1 
HETATM 1571 O  O   . HOH K 5 .  ? -0.053  -4.932  -6.760 1.00 37.23 ? 97  HOH B O   1 
HETATM 1572 O  O   . HOH K 5 .  ? -2.793  1.612   -2.887 1.00 31.39 ? 98  HOH B O   1 
HETATM 1573 O  O   . HOH K 5 .  ? 6.066   14.073  -1.511 1.00 47.09 ? 99  HOH B O   1 
HETATM 1574 O  O   . HOH K 5 .  ? 2.597   -12.044 0.100  1.00 41.98 ? 100 HOH B O   1 
HETATM 1575 O  O   . HOH K 5 .  ? -12.417 0.101   10.290 1.00 45.53 ? 101 HOH B O   1 
HETATM 1576 O  O   . HOH K 5 .  ? 9.387   10.850  6.096  1.00 40.38 ? 102 HOH B O   1 
HETATM 1577 O  O   . HOH K 5 .  ? -2.846  11.229  13.239 1.00 31.34 ? 103 HOH B O   1 
HETATM 1578 O  O   . HOH K 5 .  ? 17.555  8.771   26.324 1.00 35.99 ? 104 HOH B O   1 
HETATM 1579 O  O   . HOH K 5 .  ? -12.880 1.018   7.665  1.00 40.66 ? 105 HOH B O   1 
HETATM 1580 O  O   . HOH K 5 .  ? -9.860  10.137  14.062 1.00 52.70 ? 106 HOH B O   1 
HETATM 1581 O  O   . HOH K 5 .  ? -5.921  -5.203  20.370 1.00 49.00 ? 107 HOH B O   1 
HETATM 1582 O  O   . HOH K 5 .  ? 13.768  1.927   6.799  1.00 52.12 ? 108 HOH B O   1 
HETATM 1583 O  O   . HOH K 5 .  ? -5.275  3.567   19.716 1.00 40.89 ? 109 HOH B O   1 
HETATM 1584 O  O   . HOH K 5 .  ? 2.311   16.583  -0.432 1.00 52.93 ? 110 HOH B O   1 
HETATM 1585 O  O   . HOH K 5 .  ? 6.265   15.252  1.921  1.00 41.42 ? 111 HOH B O   1 
HETATM 1586 O  O   . HOH K 5 .  ? -4.910  -7.934  -5.717 1.00 32.87 ? 112 HOH B O   1 
HETATM 1587 O  O   . HOH K 5 .  ? 9.530   -9.429  -2.689 1.00 38.52 ? 113 HOH B O   1 
HETATM 1588 O  O   . HOH K 5 .  ? 1.113   6.829   -3.892 1.00 44.43 ? 114 HOH B O   1 
HETATM 1589 O  O   . HOH K 5 .  ? 11.147  0.646   12.167 1.00 36.67 ? 115 HOH B O   1 
HETATM 1590 O  O   . HOH K 5 .  ? 18.198  -2.906  24.873 1.00 46.78 ? 116 HOH B O   1 
HETATM 1591 O  O   . HOH K 5 .  ? -0.186  -3.402  -4.641 1.00 43.38 ? 117 HOH B O   1 
HETATM 1592 O  O   . HOH K 5 .  ? -1.666  -8.332  12.834 1.00 47.53 ? 118 HOH B O   1 
HETATM 1593 O  O   . HOH K 5 .  ? 13.940  -1.436  8.927  1.00 41.53 ? 119 HOH B O   1 
HETATM 1594 O  O   . HOH K 5 .  ? 16.724  -9.068  8.518  1.00 58.85 ? 120 HOH B O   1 
HETATM 1595 O  O   . HOH K 5 .  ? 15.670  -1.751  7.067  1.00 46.34 ? 121 HOH B O   1 
HETATM 1596 O  O   . HOH K 5 .  ? -13.086 -5.092  0.701  1.00 53.65 ? 122 HOH B O   1 
HETATM 1597 O  O   . HOH K 5 .  ? -1.337  10.865  3.620  1.00 31.74 ? 123 HOH B O   1 
HETATM 1598 O  O   . HOH K 5 .  ? -4.621  -7.900  23.695 1.00 66.53 ? 124 HOH B O   1 
HETATM 1599 O  O   . HOH K 5 .  ? -5.077  5.888   0.248  1.00 33.98 ? 125 HOH B O   1 
HETATM 1600 O  O   . HOH K 5 .  ? -1.871  5.317   -1.977 1.00 35.99 ? 126 HOH B O   1 
HETATM 1601 O  O   . HOH K 5 .  ? 0.027   -6.970  6.314  1.00 39.08 ? 127 HOH B O   1 
HETATM 1602 O  O   . HOH K 5 .  ? 6.435   -7.058  5.839  1.00 32.92 ? 128 HOH B O   1 
HETATM 1603 O  O   . HOH K 5 .  ? 12.759  -0.387  23.689 1.00 30.55 ? 129 HOH B O   1 
HETATM 1604 O  O   . HOH K 5 .  ? 7.901   -8.102  4.427  1.00 40.21 ? 130 HOH B O   1 
HETATM 1605 O  O   . HOH K 5 .  ? -8.035  9.266   9.921  1.00 38.98 ? 131 HOH B O   1 
HETATM 1606 O  O   . HOH K 5 .  ? 4.495   -13.581 1.474  1.00 55.41 ? 132 HOH B O   1 
HETATM 1607 O  O   . HOH K 5 .  ? -0.135  -16.295 24.042 1.00 57.45 ? 133 HOH B O   1 
HETATM 1608 O  O   . HOH K 5 .  ? -14.724 10.823  7.874  1.00 42.34 ? 134 HOH B O   1 
HETATM 1609 O  O   . HOH K 5 .  ? 11.612  -6.001  9.393  1.00 37.14 ? 135 HOH B O   1 
HETATM 1610 O  O   . HOH K 5 .  ? -15.373 -1.274  1.186  1.00 48.50 ? 136 HOH B O   1 
HETATM 1611 O  O   . HOH K 5 .  ? 17.782  -0.728  29.483 1.00 47.28 ? 137 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  0  0  MET MET A . n 
A 1 2  SER 2  1  1  SER SER A . n 
A 1 3  GLU 3  2  2  GLU GLU A . n 
A 1 4  LEU 4  3  3  LEU LEU A . n 
A 1 5  GLU 5  4  4  GLU GLU A . n 
A 1 6  LYS 6  5  5  LYS LYS A . n 
A 1 7  ALA 7  6  6  ALA ALA A . n 
A 1 8  MET 8  7  7  MET MET A . n 
A 1 9  VAL 9  8  8  VAL VAL A . n 
A 1 10 ALA 10 9  9  ALA ALA A . n 
A 1 11 LEU 11 10 10 LEU LEU A . n 
A 1 12 ILE 12 11 11 ILE ILE A . n 
A 1 13 ASP 13 12 12 ASP ASP A . n 
A 1 14 VAL 14 13 13 VAL VAL A . n 
A 1 15 PHE 15 14 14 PHE PHE A . n 
A 1 16 HIS 16 15 15 HIS HIS A . n 
A 1 17 GLN 17 16 16 GLN GLN A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 SER 19 18 18 SER SER A . n 
A 1 20 GLY 20 19 19 GLY GLY A . n 
A 1 21 ARG 21 20 20 ARG ARG A . n 
A 1 22 GLU 22 21 21 GLU GLU A . n 
A 1 23 GLY 23 22 22 GLY GLY A . n 
A 1 24 ASP 24 23 23 ASP ASP A . n 
A 1 25 LYS 25 24 24 LYS LYS A . n 
A 1 26 HIS 26 25 25 HIS HIS A . n 
A 1 27 LYS 27 26 26 LYS LYS A . n 
A 1 28 LEU 28 27 27 LEU LEU A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LYS 30 29 29 LYS LYS A . n 
A 1 31 SER 31 30 30 SER SER A . n 
A 1 32 GLU 32 31 31 GLU GLU A . n 
A 1 33 LEU 33 32 32 LEU LEU A . n 
A 1 34 LYS 34 33 33 LYS LYS A . n 
A 1 35 GLU 35 34 34 GLU GLU A . n 
A 1 36 LEU 36 35 35 LEU LEU A . n 
A 1 37 ILE 37 36 36 ILE ILE A . n 
A 1 38 ASN 38 37 37 ASN ASN A . n 
A 1 39 ASN 39 38 38 ASN ASN A . n 
A 1 40 GLU 40 39 39 GLU GLU A . n 
A 1 41 LEU 41 40 40 LEU LEU A . n 
A 1 42 SER 42 41 41 SER SER A . n 
A 1 43 HIS 43 42 42 HIS HIS A . n 
A 1 44 PHE 44 43 43 PHE PHE A . n 
A 1 45 LEU 45 44 44 LEU LEU A . n 
A 1 46 GLU 46 45 45 GLU GLU A . n 
A 1 47 GLU 47 46 46 GLU GLU A . n 
A 1 48 ILE 48 47 47 ILE ILE A . n 
A 1 49 LYS 49 48 48 LYS LYS A . n 
A 1 50 GLU 50 49 49 GLU GLU A . n 
A 1 51 GLN 51 50 50 GLN GLN A . n 
A 1 52 GLU 52 51 51 GLU GLU A . n 
A 1 53 VAL 53 52 52 VAL VAL A . n 
A 1 54 VAL 54 53 53 VAL VAL A . n 
A 1 55 ASP 55 54 54 ASP ASP A . n 
A 1 56 LYS 56 55 55 LYS LYS A . n 
A 1 57 VAL 57 56 56 VAL VAL A . n 
A 1 58 MET 58 57 57 MET MET A . n 
A 1 59 GLU 59 58 58 GLU GLU A . n 
A 1 60 THR 60 59 59 THR THR A . n 
A 1 61 LEU 61 60 60 LEU LEU A . n 
A 1 62 ASP 62 61 61 ASP ASP A . n 
A 1 63 ASN 63 62 62 ASN ASN A . n 
A 1 64 ASP 64 63 63 ASP ASP A . n 
A 1 65 GLY 65 64 64 GLY GLY A . n 
A 1 66 ASP 66 65 65 ASP ASP A . n 
A 1 67 GLY 67 66 66 GLY GLY A . n 
A 1 68 GLU 68 67 67 GLU GLU A . n 
A 1 69 CYS 69 68 68 CYS CYS A . n 
A 1 70 ASP 70 69 69 ASP ASP A . n 
A 1 71 PHE 71 70 70 PHE PHE A . n 
A 1 72 GLN 72 71 71 GLN GLN A . n 
A 1 73 GLU 73 72 72 GLU GLU A . n 
A 1 74 PHE 74 73 73 PHE PHE A . n 
A 1 75 MET 75 74 74 MET MET A . n 
A 1 76 ALA 76 75 75 ALA ALA A . n 
A 1 77 PHE 77 76 76 PHE PHE A . n 
A 1 78 VAL 78 77 77 VAL VAL A . n 
A 1 79 ALA 79 78 78 ALA ALA A . n 
A 1 80 MET 80 79 79 MET MET A . n 
A 1 81 VAL 81 80 80 VAL VAL A . n 
A 1 82 THR 82 81 81 THR THR A . n 
A 1 83 THR 83 82 82 THR THR A . n 
A 1 84 ALA 84 83 83 ALA ALA A . n 
A 1 85 CYS 85 84 84 CYS CYS A . n 
A 1 86 HIS 86 85 85 HIS HIS A . n 
A 1 87 GLU 87 86 86 GLU GLU A . n 
A 1 88 PHE 88 87 87 PHE PHE A . n 
A 1 89 PHE 89 88 88 PHE PHE A . n 
A 1 90 GLU 90 89 89 GLU GLU A . n 
A 1 91 HIS 91 90 ?  ?   ?   A . n 
A 1 92 GLU 92 91 ?  ?   ?   A . n 
B 1 1  MET 1  0  0  MET MET B . n 
B 1 2  SER 2  1  1  SER SER B . n 
B 1 3  GLU 3  2  2  GLU GLU B . n 
B 1 4  LEU 4  3  3  LEU LEU B . n 
B 1 5  GLU 5  4  4  GLU GLU B . n 
B 1 6  LYS 6  5  5  LYS LYS B . n 
B 1 7  ALA 7  6  6  ALA ALA B . n 
B 1 8  MET 8  7  7  MET MET B . n 
B 1 9  VAL 9  8  8  VAL VAL B . n 
B 1 10 ALA 10 9  9  ALA ALA B . n 
B 1 11 LEU 11 10 10 LEU LEU B . n 
B 1 12 ILE 12 11 11 ILE ILE B . n 
B 1 13 ASP 13 12 12 ASP ASP B . n 
B 1 14 VAL 14 13 13 VAL VAL B . n 
B 1 15 PHE 15 14 14 PHE PHE B . n 
B 1 16 HIS 16 15 15 HIS HIS B . n 
B 1 17 GLN 17 16 16 GLN GLN B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 SER 19 18 18 SER SER B . n 
B 1 20 GLY 20 19 19 GLY GLY B . n 
B 1 21 ARG 21 20 20 ARG ARG B . n 
B 1 22 GLU 22 21 21 GLU GLU B . n 
B 1 23 GLY 23 22 22 GLY GLY B . n 
B 1 24 ASP 24 23 23 ASP ASP B . n 
B 1 25 LYS 25 24 24 LYS LYS B . n 
B 1 26 HIS 26 25 25 HIS HIS B . n 
B 1 27 LYS 27 26 26 LYS LYS B . n 
B 1 28 LEU 28 27 27 LEU LEU B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LYS 30 29 29 LYS LYS B . n 
B 1 31 SER 31 30 30 SER SER B . n 
B 1 32 GLU 32 31 31 GLU GLU B . n 
B 1 33 LEU 33 32 32 LEU LEU B . n 
B 1 34 LYS 34 33 33 LYS LYS B . n 
B 1 35 GLU 35 34 34 GLU GLU B . n 
B 1 36 LEU 36 35 35 LEU LEU B . n 
B 1 37 ILE 37 36 36 ILE ILE B . n 
B 1 38 ASN 38 37 37 ASN ASN B . n 
B 1 39 ASN 39 38 38 ASN ASN B . n 
B 1 40 GLU 40 39 39 GLU GLU B . n 
B 1 41 LEU 41 40 40 LEU LEU B . n 
B 1 42 SER 42 41 41 SER SER B . n 
B 1 43 HIS 43 42 42 HIS HIS B . n 
B 1 44 PHE 44 43 43 PHE PHE B . n 
B 1 45 LEU 45 44 44 LEU LEU B . n 
B 1 46 GLU 46 45 45 GLU GLU B . n 
B 1 47 GLU 47 46 46 GLU GLU B . n 
B 1 48 ILE 48 47 47 ILE ILE B . n 
B 1 49 LYS 49 48 48 LYS LYS B . n 
B 1 50 GLU 50 49 49 GLU GLU B . n 
B 1 51 GLN 51 50 50 GLN GLN B . n 
B 1 52 GLU 52 51 51 GLU GLU B . n 
B 1 53 VAL 53 52 52 VAL VAL B . n 
B 1 54 VAL 54 53 53 VAL VAL B . n 
B 1 55 ASP 55 54 54 ASP ASP B . n 
B 1 56 LYS 56 55 55 LYS LYS B . n 
B 1 57 VAL 57 56 56 VAL VAL B . n 
B 1 58 MET 58 57 57 MET MET B . n 
B 1 59 GLU 59 58 58 GLU GLU B . n 
B 1 60 THR 60 59 59 THR THR B . n 
B 1 61 LEU 61 60 60 LEU LEU B . n 
B 1 62 ASP 62 61 61 ASP ASP B . n 
B 1 63 ASN 63 62 62 ASN ASN B . n 
B 1 64 ASP 64 63 63 ASP ASP B . n 
B 1 65 GLY 65 64 64 GLY GLY B . n 
B 1 66 ASP 66 65 65 ASP ASP B . n 
B 1 67 GLY 67 66 66 GLY GLY B . n 
B 1 68 GLU 68 67 67 GLU GLU B . n 
B 1 69 CYS 69 68 68 CYS CYS B . n 
B 1 70 ASP 70 69 69 ASP ASP B . n 
B 1 71 PHE 71 70 70 PHE PHE B . n 
B 1 72 GLN 72 71 71 GLN GLN B . n 
B 1 73 GLU 73 72 72 GLU GLU B . n 
B 1 74 PHE 74 73 73 PHE PHE B . n 
B 1 75 MET 75 74 74 MET MET B . n 
B 1 76 ALA 76 75 75 ALA ALA B . n 
B 1 77 PHE 77 76 76 PHE PHE B . n 
B 1 78 VAL 78 77 77 VAL VAL B . n 
B 1 79 ALA 79 78 78 ALA ALA B . n 
B 1 80 MET 80 79 79 MET MET B . n 
B 1 81 VAL 81 80 80 VAL VAL B . n 
B 1 82 THR 82 81 81 THR THR B . n 
B 1 83 THR 83 82 82 THR THR B . n 
B 1 84 ALA 84 83 83 ALA ALA B . n 
B 1 85 CYS 85 84 84 CYS CYS B . n 
B 1 86 HIS 86 85 85 HIS HIS B . n 
B 1 87 GLU 87 86 86 GLU GLU B . n 
B 1 88 PHE 88 87 87 PHE PHE B . n 
B 1 89 PHE 89 88 88 PHE PHE B . n 
B 1 90 GLU 90 89 89 GLU GLU B . n 
B 1 91 HIS 91 90 90 HIS HIS B . n 
B 1 92 GLU 92 91 ?  ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA  1  92  90 CA  CA  A . 
D 2 CA  1  93  91 CA  CA  A . 
E 3 S45 1  94  1  S45 S45 A . 
F 4 ACT 1  95  1  ACT ACT A . 
G 2 CA  1  92  91 CA  CA  B . 
H 2 CA  1  93  92 CA  CA  B . 
I 3 S45 1  94  1  S45 S45 B . 
J 5 HOH 1  96  96 HOH HOH A . 
J 5 HOH 2  97  1  HOH HOH A . 
J 5 HOH 3  98  5  HOH HOH A . 
J 5 HOH 4  99  7  HOH HOH A . 
J 5 HOH 5  100 10 HOH HOH A . 
J 5 HOH 6  101 11 HOH HOH A . 
J 5 HOH 7  102 18 HOH HOH A . 
J 5 HOH 8  103 21 HOH HOH A . 
J 5 HOH 9  104 22 HOH HOH A . 
J 5 HOH 10 105 23 HOH HOH A . 
J 5 HOH 11 106 26 HOH HOH A . 
J 5 HOH 12 107 30 HOH HOH A . 
J 5 HOH 13 108 31 HOH HOH A . 
J 5 HOH 14 109 32 HOH HOH A . 
J 5 HOH 15 110 33 HOH HOH A . 
J 5 HOH 16 111 35 HOH HOH A . 
J 5 HOH 17 112 36 HOH HOH A . 
J 5 HOH 18 113 37 HOH HOH A . 
J 5 HOH 19 114 38 HOH HOH A . 
J 5 HOH 20 115 39 HOH HOH A . 
J 5 HOH 21 116 40 HOH HOH A . 
J 5 HOH 22 117 41 HOH HOH A . 
J 5 HOH 23 118 42 HOH HOH A . 
J 5 HOH 24 119 44 HOH HOH A . 
J 5 HOH 25 120 45 HOH HOH A . 
J 5 HOH 26 121 46 HOH HOH A . 
J 5 HOH 27 122 47 HOH HOH A . 
J 5 HOH 28 123 48 HOH HOH A . 
J 5 HOH 29 124 49 HOH HOH A . 
J 5 HOH 30 125 50 HOH HOH A . 
J 5 HOH 31 126 52 HOH HOH A . 
J 5 HOH 32 127 53 HOH HOH A . 
J 5 HOH 33 128 54 HOH HOH A . 
J 5 HOH 34 129 56 HOH HOH A . 
J 5 HOH 35 130 57 HOH HOH A . 
J 5 HOH 36 131 60 HOH HOH A . 
J 5 HOH 37 132 61 HOH HOH A . 
J 5 HOH 38 133 63 HOH HOH A . 
J 5 HOH 39 134 64 HOH HOH A . 
J 5 HOH 40 135 65 HOH HOH A . 
J 5 HOH 41 136 66 HOH HOH A . 
J 5 HOH 42 137 68 HOH HOH A . 
J 5 HOH 43 138 69 HOH HOH A . 
J 5 HOH 44 139 71 HOH HOH A . 
J 5 HOH 45 140 72 HOH HOH A . 
J 5 HOH 46 141 82 HOH HOH A . 
J 5 HOH 47 142 85 HOH HOH A . 
J 5 HOH 48 143 87 HOH HOH A . 
J 5 HOH 49 144 89 HOH HOH A . 
J 5 HOH 50 145 90 HOH HOH A . 
J 5 HOH 51 146 91 HOH HOH A . 
J 5 HOH 52 147 92 HOH HOH A . 
J 5 HOH 53 148 93 HOH HOH A . 
K 5 HOH 1  95  95 HOH HOH B . 
K 5 HOH 2  96  2  HOH HOH B . 
K 5 HOH 3  97  3  HOH HOH B . 
K 5 HOH 4  98  4  HOH HOH B . 
K 5 HOH 5  99  6  HOH HOH B . 
K 5 HOH 6  100 8  HOH HOH B . 
K 5 HOH 7  101 9  HOH HOH B . 
K 5 HOH 8  102 12 HOH HOH B . 
K 5 HOH 9  103 13 HOH HOH B . 
K 5 HOH 10 104 14 HOH HOH B . 
K 5 HOH 11 105 15 HOH HOH B . 
K 5 HOH 12 106 16 HOH HOH B . 
K 5 HOH 13 107 17 HOH HOH B . 
K 5 HOH 14 108 19 HOH HOH B . 
K 5 HOH 15 109 20 HOH HOH B . 
K 5 HOH 16 110 24 HOH HOH B . 
K 5 HOH 17 111 25 HOH HOH B . 
K 5 HOH 18 112 27 HOH HOH B . 
K 5 HOH 19 113 28 HOH HOH B . 
K 5 HOH 20 114 29 HOH HOH B . 
K 5 HOH 21 115 34 HOH HOH B . 
K 5 HOH 22 116 43 HOH HOH B . 
K 5 HOH 23 117 51 HOH HOH B . 
K 5 HOH 24 118 55 HOH HOH B . 
K 5 HOH 25 119 58 HOH HOH B . 
K 5 HOH 26 120 59 HOH HOH B . 
K 5 HOH 27 121 62 HOH HOH B . 
K 5 HOH 28 122 67 HOH HOH B . 
K 5 HOH 29 123 70 HOH HOH B . 
K 5 HOH 30 124 73 HOH HOH B . 
K 5 HOH 31 125 74 HOH HOH B . 
K 5 HOH 32 126 75 HOH HOH B . 
K 5 HOH 33 127 76 HOH HOH B . 
K 5 HOH 34 128 77 HOH HOH B . 
K 5 HOH 35 129 78 HOH HOH B . 
K 5 HOH 36 130 79 HOH HOH B . 
K 5 HOH 37 131 80 HOH HOH B . 
K 5 HOH 38 132 81 HOH HOH B . 
K 5 HOH 39 133 83 HOH HOH B . 
K 5 HOH 40 134 84 HOH HOH B . 
K 5 HOH 41 135 86 HOH HOH B . 
K 5 HOH 42 136 88 HOH HOH B . 
K 5 HOH 43 137 94 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3330 ? 
1 MORE         -72  ? 
1 'SSA (A^2)'  9820 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A GLU 22 ? A GLU 21  ? 1_555 107.5 ? 
2  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 78.7  ? 
3  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A ASP 24 ? A ASP 23  ? 1_555 82.7  ? 
4  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 88.6  ? 
5  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 159.3 ? 
6  O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 O   ? A LYS 27 ? A LYS 26  ? 1_555 87.9  ? 
7  O   ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 108.2 ? 
8  O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 105.0 ? 
9  O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 167.0 ? 
10 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE1 ? A GLU 32 ? A GLU 31  ? 1_555 81.3  ? 
11 O   ? A SER 19 ? A SER 18 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 91.1  ? 
12 O   ? A GLU 22 ? A GLU 21 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 64.4  ? 
13 O   ? A ASP 24 ? A ASP 23 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 141.0 ? 
14 O   ? A LYS 27 ? A LYS 26 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 129.8 ? 
15 OE1 ? A GLU 32 ? A GLU 31 ? 1_555 CA ? C CA . ? A CA 92 ? 1_555 OE2 ? A GLU 32 ? A GLU 31  ? 1_555 51.3  ? 
16 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 64 ? A ASP 63  ? 1_555 81.6  ? 
17 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 83.3  ? 
18 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OD1 ? A ASP 66 ? A ASP 65  ? 1_555 84.9  ? 
19 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 76.9  ? 
20 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 151.0 ? 
21 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? A GLU 68 ? A GLU 67  ? 1_555 73.6  ? 
22 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 109.9 ? 
23 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 126.3 ? 
24 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 146.8 ? 
25 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE1 ? A GLU 73 ? A GLU 72  ? 1_555 79.8  ? 
26 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 96.6  ? 
27 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 77.4  ? 
28 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 162.1 ? 
29 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 123.9 ? 
30 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 OE2 ? A GLU 73 ? A GLU 72  ? 1_555 49.8  ? 
31 OD1 ? A ASP 62 ? A ASP 61 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 139 ? 1_555 162.5 ? 
32 OD1 ? A ASP 64 ? A ASP 63 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 139 ? 1_555 93.6  ? 
33 OD1 ? A ASP 66 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 139 ? 1_555 79.5  ? 
34 O   ? A GLU 68 ? A GLU 67 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 139 ? 1_555 101.2 ? 
35 OE1 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 139 ? 1_555 86.6  ? 
36 OE2 ? A GLU 73 ? A GLU 72 ? 1_555 CA ? D CA . ? A CA 93 ? 1_555 O   ? J HOH .  ? A HOH 139 ? 1_555 98.7  ? 
37 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B GLU 22 ? B GLU 21  ? 1_555 107.1 ? 
38 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B ASP 24 ? B ASP 23  ? 1_555 83.2  ? 
39 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B ASP 24 ? B ASP 23  ? 1_555 91.7  ? 
40 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B LYS 27 ? B LYS 26  ? 1_555 94.5  ? 
41 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B LYS 27 ? B LYS 26  ? 1_555 154.1 ? 
42 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? B LYS 27 ? B LYS 26  ? 1_555 76.5  ? 
43 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 98.4  ? 
44 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 115.9 ? 
45 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 150.0 ? 
46 O   ? B LYS 27 ? B LYS 26 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE1 ? B GLU 32 ? B GLU 31  ? 1_555 73.5  ? 
47 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 89.8  ? 
48 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 74.1  ? 
49 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 161.5 ? 
50 O   ? B LYS 27 ? B LYS 26 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 121.2 ? 
51 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 OE2 ? B GLU 32 ? B GLU 31  ? 1_555 48.0  ? 
52 O   ? B SER 19 ? B SER 18 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 123 ? 1_555 164.0 ? 
53 O   ? B GLU 22 ? B GLU 21 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 123 ? 1_555 83.0  ? 
54 O   ? B ASP 24 ? B ASP 23 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 123 ? 1_555 84.2  ? 
55 O   ? B LYS 27 ? B LYS 26 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 123 ? 1_555 73.1  ? 
56 OE1 ? B GLU 32 ? B GLU 31 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 123 ? 1_555 87.7  ? 
57 OE2 ? B GLU 32 ? B GLU 31 ? 1_555 CA ? G CA . ? B CA 92 ? 1_555 O   ? K HOH .  ? B HOH 123 ? 1_555 105.1 ? 
58 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OD1 ? B ASP 64 ? B ASP 63  ? 1_555 78.2  ? 
59 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OD1 ? B ASP 66 ? B ASP 65  ? 1_555 79.6  ? 
60 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OD1 ? B ASP 66 ? B ASP 65  ? 1_555 76.6  ? 
61 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? B GLU 68 ? B GLU 67  ? 1_555 80.8  ? 
62 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? B GLU 68 ? B GLU 67  ? 1_555 148.7 ? 
63 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? B GLU 68 ? B GLU 67  ? 1_555 76.9  ? 
64 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 118.2 ? 
65 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 132.0 ? 
66 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 146.8 ? 
67 O   ? B GLU 68 ? B GLU 67 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE1 ? B GLU 73 ? B GLU 72  ? 1_555 78.7  ? 
68 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 93.3  ? 
69 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 82.7  ? 
70 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 159.0 ? 
71 O   ? B GLU 68 ? B GLU 67 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 121.7 ? 
72 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 OE2 ? B GLU 73 ? B GLU 72  ? 1_555 53.5  ? 
73 OD1 ? B ASP 62 ? B ASP 61 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 131 ? 1_555 149.8 ? 
74 OD1 ? B ASP 64 ? B ASP 63 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 131 ? 1_555 80.6  ? 
75 OD1 ? B ASP 66 ? B ASP 65 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 131 ? 1_555 74.7  ? 
76 O   ? B GLU 68 ? B GLU 67 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 131 ? 1_555 108.0 ? 
77 OE1 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 131 ? 1_555 92.0  ? 
78 OE2 ? B GLU 73 ? B GLU 72 ? 1_555 CA ? H CA . ? B CA 93 ? 1_555 O   ? K HOH .  ? B HOH 131 ? 1_555 105.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-02-02 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_detector 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_detector.detector' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
MOLREP phasing          .        ? 1 ? ? ? ? 
REFMAC refinement       5.2.0019 ? 2 ? ? ? ? 
MOSFLM 'data reduction' .        ? 3 ? ? ? ? 
SCALA  'data scaling'   .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 B GLU 67 ? ? O   B HOH 123 ? ? 2.08 
2 1 NH1 B ARG 20 ? ? OE1 B GLU 34  ? ? 2.16 
3 1 OH  A TYR 17 ? ? OE2 A GLU 39  ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 86 ? ? -52.86 -1.03 
2 1 PHE A 88 ? ? -86.38 32.55 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A HIS 90 ? A HIS 91 
2 1 Y 1 A GLU 91 ? A GLU 92 
3 1 Y 1 B GLU 91 ? B GLU 92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                                                CA  
3 '(3R)-3-[3-(4-chlorophenyl)-1,2,4-oxadiazol-5-yl]piperidine' S45 
4 'ACETATE ION'                                                ACT 
5 water                                                        HOH 
#