data_3HEG
# 
_entry.id   3HEG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HEG         
RCSB  RCSB053033   
WWPDB D_1000053033 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3HEC 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3HEG 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Namboodiri, H.V.' 1 
'Karpusas, M.'     2 
# 
_citation.id                        primary 
_citation.title                     
;Analysis of imatinib and sorafenib binding to p38alpha compared with c-Abl and b-Raf provides structural insights for understanding the selectivity of inhibitors targeting the DFG-out form of protein kinases.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            49 
_citation.page_first                3611 
_citation.page_last                 3618 
_citation.year                      2010 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20337484 
_citation.pdbx_database_id_DOI      10.1021/bi100070r 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Namboodiri, H.V.' 1 
primary 'Bukhtiyarova, M.' 2 
primary 'Ramcharan, J.'    3 
primary 'Karpusas, M.'     4 
primary 'Lee, Y.'          5 
primary 'Springman, E.B.'  6 
# 
_cell.entry_id           3HEG 
_cell.length_a           65.492 
_cell.length_b           74.249 
_cell.length_c           77.843 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HEG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mitogen-activated protein kinase 14'                                                                      
39905.695 1   2.7.11.24 ? 'Kinase Domain, UNP residues 5-352' ? 
2 non-polymer syn '4-{4-[({[4-CHLORO-3-(TRIFLUOROMETHYL)PHENYL]AMINO}CARBONYL)AMINO]PHENOXY}-N-METHYLPYRIDINE-2-CARBOXAMIDE' 
464.825   1   ?         ? ?                                   ? 
3 water       nat water                                                                                                      
18.015    109 ?         ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Mitogen-activated protein kinase p38 alpha, MAP kinase p38 alpha, Cytokine suppressive anti-inflammatory drug-binding protein, CSAID-binding protein, CSBP, MAX-interacting protein 2, MAP kinase MXI2, SAPK2A
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVI
GLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCEL
KILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGA
ELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYD
QSFESRDLLIDEWKSLTYDEVISFVPPP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVI
GLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCEL
KILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGA
ELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYD
QSFESRDLLIDEWKSLTYDEVISFVPPP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   PRO n 
1 3   THR n 
1 4   PHE n 
1 5   TYR n 
1 6   ARG n 
1 7   GLN n 
1 8   GLU n 
1 9   LEU n 
1 10  ASN n 
1 11  LYS n 
1 12  THR n 
1 13  ILE n 
1 14  TRP n 
1 15  GLU n 
1 16  VAL n 
1 17  PRO n 
1 18  GLU n 
1 19  ARG n 
1 20  TYR n 
1 21  GLN n 
1 22  ASN n 
1 23  LEU n 
1 24  SER n 
1 25  PRO n 
1 26  VAL n 
1 27  GLY n 
1 28  SER n 
1 29  GLY n 
1 30  ALA n 
1 31  TYR n 
1 32  GLY n 
1 33  SER n 
1 34  VAL n 
1 35  CYS n 
1 36  ALA n 
1 37  ALA n 
1 38  PHE n 
1 39  ASP n 
1 40  THR n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  LEU n 
1 45  ARG n 
1 46  VAL n 
1 47  ALA n 
1 48  VAL n 
1 49  LYS n 
1 50  LYS n 
1 51  LEU n 
1 52  SER n 
1 53  ARG n 
1 54  PRO n 
1 55  PHE n 
1 56  GLN n 
1 57  SER n 
1 58  ILE n 
1 59  ILE n 
1 60  HIS n 
1 61  ALA n 
1 62  LYS n 
1 63  ARG n 
1 64  THR n 
1 65  TYR n 
1 66  ARG n 
1 67  GLU n 
1 68  LEU n 
1 69  ARG n 
1 70  LEU n 
1 71  LEU n 
1 72  LYS n 
1 73  HIS n 
1 74  MET n 
1 75  LYS n 
1 76  HIS n 
1 77  GLU n 
1 78  ASN n 
1 79  VAL n 
1 80  ILE n 
1 81  GLY n 
1 82  LEU n 
1 83  LEU n 
1 84  ASP n 
1 85  VAL n 
1 86  PHE n 
1 87  THR n 
1 88  PRO n 
1 89  ALA n 
1 90  ARG n 
1 91  SER n 
1 92  LEU n 
1 93  GLU n 
1 94  GLU n 
1 95  PHE n 
1 96  ASN n 
1 97  ASP n 
1 98  VAL n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 THR n 
1 103 HIS n 
1 104 LEU n 
1 105 MET n 
1 106 GLY n 
1 107 ALA n 
1 108 ASP n 
1 109 LEU n 
1 110 ASN n 
1 111 ASN n 
1 112 ILE n 
1 113 VAL n 
1 114 LYS n 
1 115 CYS n 
1 116 GLN n 
1 117 LYS n 
1 118 LEU n 
1 119 THR n 
1 120 ASP n 
1 121 ASP n 
1 122 HIS n 
1 123 VAL n 
1 124 GLN n 
1 125 PHE n 
1 126 LEU n 
1 127 ILE n 
1 128 TYR n 
1 129 GLN n 
1 130 ILE n 
1 131 LEU n 
1 132 ARG n 
1 133 GLY n 
1 134 LEU n 
1 135 LYS n 
1 136 TYR n 
1 137 ILE n 
1 138 HIS n 
1 139 SER n 
1 140 ALA n 
1 141 ASP n 
1 142 ILE n 
1 143 ILE n 
1 144 HIS n 
1 145 ARG n 
1 146 ASP n 
1 147 LEU n 
1 148 LYS n 
1 149 PRO n 
1 150 SER n 
1 151 ASN n 
1 152 LEU n 
1 153 ALA n 
1 154 VAL n 
1 155 ASN n 
1 156 GLU n 
1 157 ASP n 
1 158 CYS n 
1 159 GLU n 
1 160 LEU n 
1 161 LYS n 
1 162 ILE n 
1 163 LEU n 
1 164 ASP n 
1 165 PHE n 
1 166 GLY n 
1 167 LEU n 
1 168 ALA n 
1 169 ARG n 
1 170 HIS n 
1 171 THR n 
1 172 ASP n 
1 173 ASP n 
1 174 GLU n 
1 175 MET n 
1 176 THR n 
1 177 GLY n 
1 178 TYR n 
1 179 VAL n 
1 180 ALA n 
1 181 THR n 
1 182 ARG n 
1 183 TRP n 
1 184 TYR n 
1 185 ARG n 
1 186 ALA n 
1 187 PRO n 
1 188 GLU n 
1 189 ILE n 
1 190 MET n 
1 191 LEU n 
1 192 ASN n 
1 193 TRP n 
1 194 MET n 
1 195 HIS n 
1 196 TYR n 
1 197 ASN n 
1 198 GLN n 
1 199 THR n 
1 200 VAL n 
1 201 ASP n 
1 202 ILE n 
1 203 TRP n 
1 204 SER n 
1 205 VAL n 
1 206 GLY n 
1 207 CYS n 
1 208 ILE n 
1 209 MET n 
1 210 ALA n 
1 211 GLU n 
1 212 LEU n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 ARG n 
1 217 THR n 
1 218 LEU n 
1 219 PHE n 
1 220 PRO n 
1 221 GLY n 
1 222 THR n 
1 223 ASP n 
1 224 HIS n 
1 225 ILE n 
1 226 ASP n 
1 227 GLN n 
1 228 LEU n 
1 229 LYS n 
1 230 LEU n 
1 231 ILE n 
1 232 LEU n 
1 233 ARG n 
1 234 LEU n 
1 235 VAL n 
1 236 GLY n 
1 237 THR n 
1 238 PRO n 
1 239 GLY n 
1 240 ALA n 
1 241 GLU n 
1 242 LEU n 
1 243 LEU n 
1 244 LYS n 
1 245 LYS n 
1 246 ILE n 
1 247 SER n 
1 248 SER n 
1 249 GLU n 
1 250 SER n 
1 251 ALA n 
1 252 ARG n 
1 253 ASN n 
1 254 TYR n 
1 255 ILE n 
1 256 GLN n 
1 257 SER n 
1 258 LEU n 
1 259 THR n 
1 260 GLN n 
1 261 MET n 
1 262 PRO n 
1 263 LYS n 
1 264 MET n 
1 265 ASN n 
1 266 PHE n 
1 267 ALA n 
1 268 ASN n 
1 269 VAL n 
1 270 PHE n 
1 271 ILE n 
1 272 GLY n 
1 273 ALA n 
1 274 ASN n 
1 275 PRO n 
1 276 LEU n 
1 277 ALA n 
1 278 VAL n 
1 279 ASP n 
1 280 LEU n 
1 281 LEU n 
1 282 GLU n 
1 283 LYS n 
1 284 MET n 
1 285 LEU n 
1 286 VAL n 
1 287 LEU n 
1 288 ASP n 
1 289 SER n 
1 290 ASP n 
1 291 LYS n 
1 292 ARG n 
1 293 ILE n 
1 294 THR n 
1 295 ALA n 
1 296 ALA n 
1 297 GLN n 
1 298 ALA n 
1 299 LEU n 
1 300 ALA n 
1 301 HIS n 
1 302 ALA n 
1 303 TYR n 
1 304 PHE n 
1 305 ALA n 
1 306 GLN n 
1 307 TYR n 
1 308 HIS n 
1 309 ASP n 
1 310 PRO n 
1 311 ASP n 
1 312 ASP n 
1 313 GLU n 
1 314 PRO n 
1 315 VAL n 
1 316 ALA n 
1 317 ASP n 
1 318 PRO n 
1 319 TYR n 
1 320 ASP n 
1 321 GLN n 
1 322 SER n 
1 323 PHE n 
1 324 GLU n 
1 325 SER n 
1 326 ARG n 
1 327 ASP n 
1 328 LEU n 
1 329 LEU n 
1 330 ILE n 
1 331 ASP n 
1 332 GLU n 
1 333 TRP n 
1 334 LYS n 
1 335 SER n 
1 336 LEU n 
1 337 THR n 
1 338 TYR n 
1 339 ASP n 
1 340 GLU n 
1 341 VAL n 
1 342 ILE n 
1 343 SER n 
1 344 PHE n 
1 345 VAL n 
1 346 PRO n 
1 347 PRO n 
1 348 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CSBP, CSBP1, CSBP2, CSPB1, MAPK14, MXI2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosetta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          DE3 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MK14_HUMAN 
_struct_ref.pdbx_db_accession          Q16539 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVI
GLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCEL
KILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGA
ELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYD
QSFESRDLLIDEWKSLTYDEVISFVPPP
;
_struct_ref.pdbx_align_begin           5 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3HEG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 348 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16539 
_struct_ref_seq.db_align_beg                  5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  352 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       5 
_struct_ref_seq.pdbx_auth_seq_align_end       352 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?         'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE ?         'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE ?         'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?         'C4 H7 N O4'          133.103 
BAX non-polymer         . 
'4-{4-[({[4-CHLORO-3-(TRIFLUOROMETHYL)PHENYL]AMINO}CARBONYL)AMINO]PHENOXY}-N-METHYLPYRIDINE-2-CARBOXAMIDE' Sorafenib 
'C21 H16 Cl F3 N4 O3' 464.825 
CYS 'L-peptide linking' y CYSTEINE ?         'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE ?         'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?         'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE ?         'C2 H5 N O2'          75.067  
HIS 'L-peptide linking' y HISTIDINE ?         'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER ?         'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?         'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE ?         'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE ?         'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE ?         'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?         'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE ?         'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE ?         'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE ?         'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?         'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE ?         'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE ?         'C5 H11 N O2'         117.146 
# 
_exptl.entry_id          3HEG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.37 
_exptl_crystal.density_percent_sol   48.13 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'10-20% PEG 4000, 0.1 M Cacodylic acid, 50 mM n-octyl-beta-D-glucoside, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-07-11 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.98 
# 
_reflns.entry_id                     3HEG 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   19920 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.86 
_reflns.pdbx_Rsym_value              0.64 
_reflns.pdbx_netI_over_sigmaI        20.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.37 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.559 
_reflns_shell.pdbx_Rsym_value        0.521 
_reflns_shell.meanI_over_sigI_obs    2.20 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3893 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3HEG 
_refine.ls_number_reflns_obs                     18776 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.35 
_refine.ls_R_factor_obs                          0.24004 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.23635 
_refine.ls_R_factor_R_free                       0.30929 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1008 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.932 
_refine.correlation_coeff_Fo_to_Fc_free          0.889 
_refine.B_iso_mean                               42.069 
_refine.aniso_B[1][1]                            -0.62 
_refine.aniso_B[2][2]                            -1.42 
_refine.aniso_B[3][3]                            2.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ZYJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.329 
_refine.pdbx_overall_ESU_R_Free                  0.270 
_refine.overall_SU_ML                            0.218 
_refine.overall_SU_B                             8.475 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2687 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             109 
_refine_hist.number_atoms_total               2828 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        40 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.016  0.022  ? 2802 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.714  1.977  ? 3807 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.770  5.000  ? 334  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   37.301 23.817 ? 131  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   20.007 15.000 ? 486  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.588 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.122  0.200  ? 425  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 2115 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.232  0.200  ? 1319 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.315  0.200  ? 1862 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.189  0.200  ? 117  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.268  0.200  ? 34   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.265  0.200  ? 4    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.917  1.500  ? 1722 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.581  2.000  ? 2713 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.084  3.000  ? 1241 'X-RAY DIFFRACTION' ? 
r_scangle_it             3.045  4.500  ? 1092 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.255 
_refine_ls_shell.number_reflns_R_work             1350 
_refine_ls_shell.R_factor_R_work                  0.282 
_refine_ls_shell.percent_reflns_obs               96.58 
_refine_ls_shell.R_factor_R_free                  0.365 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HEG 
_struct.title                     'P38 in complex with Sorafenib' 
_struct.pdbx_descriptor           'Mitogen-activated protein kinase 14 (E.C.2.7.11.24)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HEG 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'Transferases, ATP-binding, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 57  ? MET A 74  ? SER A 61  MET A 78  1 ? 18 
HELX_P HELX_P2  2  LEU A 109 ? LYS A 114 ? LEU A 113 LYS A 118 1 ? 6  
HELX_P HELX_P3  3  THR A 119 ? SER A 139 ? THR A 123 SER A 143 1 ? 21 
HELX_P HELX_P4  4  LYS A 148 ? SER A 150 ? LYS A 152 SER A 154 5 ? 3  
HELX_P HELX_P5  5  ALA A 180 ? ARG A 185 ? ALA A 184 ARG A 189 5 ? 6  
HELX_P HELX_P6  6  ALA A 186 ? LEU A 191 ? ALA A 190 LEU A 195 1 ? 6  
HELX_P HELX_P7  7  THR A 199 ? GLY A 215 ? THR A 203 GLY A 219 1 ? 17 
HELX_P HELX_P8  8  ASP A 223 ? GLY A 236 ? ASP A 227 GLY A 240 1 ? 14 
HELX_P HELX_P9  9  GLY A 239 ? LYS A 244 ? GLY A 243 LYS A 248 1 ? 6  
HELX_P HELX_P10 10 SER A 248 ? GLN A 256 ? SER A 252 GLN A 260 1 ? 9  
HELX_P HELX_P11 11 ASN A 265 ? PHE A 270 ? ASN A 269 PHE A 274 1 ? 6  
HELX_P HELX_P12 12 ASN A 274 ? LYS A 283 ? ASN A 278 LYS A 287 1 ? 10 
HELX_P HELX_P13 13 THR A 294 ? ALA A 300 ? THR A 298 ALA A 304 1 ? 7  
HELX_P HELX_P14 14 HIS A 301 ? ALA A 305 ? HIS A 305 ALA A 309 5 ? 5  
HELX_P HELX_P15 15 GLN A 321 ? ARG A 326 ? GLN A 325 ARG A 330 5 ? 6  
HELX_P HELX_P16 16 LEU A 329 ? SER A 343 ? LEU A 333 SER A 347 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 9   A . ? LEU 13  A ASN 10  A ? ASN 14  A 1 -11.03 
2 TYR 178 A . ? TYR 182 A VAL 179 A ? VAL 183 A 1 -12.28 
3 SER 250 A . ? SER 254 A ALA 251 A ? ALA 255 A 1 4.34   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? GLU A 8   ? PHE A 8   GLU A 12  
A 2 ILE A 13  ? PRO A 17  ? ILE A 17  PRO A 21  
B 1 TYR A 20  ? PRO A 25  ? TYR A 24  PRO A 29  
B 2 VAL A 34  ? ASP A 39  ? VAL A 38  ASP A 43  
B 3 ARG A 45  ? LYS A 50  ? ARG A 49  LYS A 54  
B 4 TYR A 99  ? HIS A 103 ? TYR A 103 HIS A 107 
B 5 ASP A 84  ? PHE A 86  ? ASP A 88  PHE A 90  
C 1 ALA A 107 ? ASP A 108 ? ALA A 111 ASP A 112 
C 2 LEU A 152 ? VAL A 154 ? LEU A 156 VAL A 158 
C 3 LEU A 160 ? ILE A 162 ? LEU A 164 ILE A 166 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 7   ? N GLN A 11  O TRP A 14  ? O TRP A 18  
B 1 2 N GLN A 21  ? N GLN A 25  O PHE A 38  ? O PHE A 42  
B 2 3 N ALA A 37  ? N ALA A 41  O VAL A 46  ? O VAL A 50  
B 3 4 N ALA A 47  ? N ALA A 51  O THR A 102 ? O THR A 106 
B 4 5 O VAL A 101 ? O VAL A 105 N ASP A 84  ? N ASP A 88  
C 1 2 N ALA A 107 ? N ALA A 111 O VAL A 154 ? O VAL A 158 
C 2 3 N ALA A 153 ? N ALA A 157 O LYS A 161 ? O LYS A 165 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    18 
_struct_site.details              'BINDING SITE FOR RESIDUE BAX A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 VAL A 26  ? VAL A 30  . ? 1_555 ? 
2  AC1 18 ALA A 47  ? ALA A 51  . ? 1_555 ? 
3  AC1 18 LYS A 49  ? LYS A 53  . ? 1_555 ? 
4  AC1 18 GLU A 67  ? GLU A 71  . ? 1_555 ? 
5  AC1 18 LEU A 70  ? LEU A 74  . ? 1_555 ? 
6  AC1 18 MET A 74  ? MET A 78  . ? 1_555 ? 
7  AC1 18 VAL A 79  ? VAL A 83  . ? 1_555 ? 
8  AC1 18 ILE A 80  ? ILE A 84  . ? 1_555 ? 
9  AC1 18 THR A 102 ? THR A 106 . ? 1_555 ? 
10 AC1 18 HIS A 103 ? HIS A 107 . ? 1_555 ? 
11 AC1 18 MET A 105 ? MET A 109 . ? 1_555 ? 
12 AC1 18 ILE A 137 ? ILE A 141 . ? 1_555 ? 
13 AC1 18 ILE A 142 ? ILE A 146 . ? 1_555 ? 
14 AC1 18 HIS A 144 ? HIS A 148 . ? 1_555 ? 
15 AC1 18 ILE A 162 ? ILE A 166 . ? 1_555 ? 
16 AC1 18 LEU A 163 ? LEU A 167 . ? 1_555 ? 
17 AC1 18 ASP A 164 ? ASP A 168 . ? 1_555 ? 
18 AC1 18 PHE A 165 ? PHE A 169 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3HEG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3HEG 
_atom_sites.fract_transf_matrix[1][1]   0.015269 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013468 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012846 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ARG A 1 1   ? 24.383  -5.727  33.593 1.00 59.42 ? 5   ARG A N    1 
ATOM   2    C  CA   . ARG A 1 1   ? 24.024  -4.745  32.521 1.00 59.20 ? 5   ARG A CA   1 
ATOM   3    C  C    . ARG A 1 1   ? 24.382  -5.248  31.118 1.00 58.88 ? 5   ARG A C    1 
ATOM   4    O  O    . ARG A 1 1   ? 25.524  -5.661  30.879 1.00 58.80 ? 5   ARG A O    1 
ATOM   5    C  CB   . ARG A 1 1   ? 24.696  -3.388  32.775 1.00 59.47 ? 5   ARG A CB   1 
ATOM   6    C  CG   . ARG A 1 1   ? 24.339  -2.340  31.742 1.00 60.39 ? 5   ARG A CG   1 
ATOM   7    C  CD   . ARG A 1 1   ? 24.790  -0.946  32.115 1.00 63.32 ? 5   ARG A CD   1 
ATOM   8    N  NE   . ARG A 1 1   ? 24.312  0.013   31.115 1.00 65.72 ? 5   ARG A NE   1 
ATOM   9    C  CZ   . ARG A 1 1   ? 24.918  0.273   29.953 1.00 66.29 ? 5   ARG A CZ   1 
ATOM   10   N  NH1  . ARG A 1 1   ? 26.043  -0.346  29.615 1.00 64.90 ? 5   ARG A NH1  1 
ATOM   11   N  NH2  . ARG A 1 1   ? 24.392  1.155   29.116 1.00 66.31 ? 5   ARG A NH2  1 
ATOM   12   N  N    . PRO A 1 2   ? 23.403  -5.202  30.184 1.00 58.68 ? 6   PRO A N    1 
ATOM   13   C  CA   . PRO A 1 2   ? 23.494  -5.552  28.748 1.00 57.83 ? 6   PRO A CA   1 
ATOM   14   C  C    . PRO A 1 2   ? 24.593  -4.806  27.995 1.00 56.94 ? 6   PRO A C    1 
ATOM   15   O  O    . PRO A 1 2   ? 25.071  -3.782  28.481 1.00 56.44 ? 6   PRO A O    1 
ATOM   16   C  CB   . PRO A 1 2   ? 22.132  -5.099  28.205 1.00 58.02 ? 6   PRO A CB   1 
ATOM   17   C  CG   . PRO A 1 2   ? 21.209  -5.250  29.364 1.00 57.95 ? 6   PRO A CG   1 
ATOM   18   C  CD   . PRO A 1 2   ? 22.026  -4.795  30.545 1.00 59.03 ? 6   PRO A CD   1 
ATOM   19   N  N    . THR A 1 3   ? 24.978  -5.307  26.818 1.00 55.97 ? 7   THR A N    1 
ATOM   20   C  CA   . THR A 1 3   ? 25.969  -4.606  26.005 1.00 55.23 ? 7   THR A CA   1 
ATOM   21   C  C    . THR A 1 3   ? 25.346  -4.052  24.716 1.00 55.19 ? 7   THR A C    1 
ATOM   22   O  O    . THR A 1 3   ? 24.656  -4.768  23.983 1.00 55.31 ? 7   THR A O    1 
ATOM   23   C  CB   . THR A 1 3   ? 27.358  -5.391  25.811 1.00 55.19 ? 7   THR A CB   1 
ATOM   24   O  OG1  . THR A 1 3   ? 27.661  -5.618  24.429 1.00 54.12 ? 7   THR A OG1  1 
ATOM   25   C  CG2  . THR A 1 3   ? 27.418  -6.694  26.591 1.00 54.63 ? 7   THR A CG2  1 
ATOM   26   N  N    . PHE A 1 4   ? 25.594  -2.768  24.462 1.00 54.74 ? 8   PHE A N    1 
ATOM   27   C  CA   . PHE A 1 4   ? 24.828  -1.999  23.489 1.00 54.56 ? 8   PHE A CA   1 
ATOM   28   C  C    . PHE A 1 4   ? 25.542  -1.870  22.160 1.00 55.17 ? 8   PHE A C    1 
ATOM   29   O  O    . PHE A 1 4   ? 26.731  -2.126  22.065 1.00 55.61 ? 8   PHE A O    1 
ATOM   30   C  CB   . PHE A 1 4   ? 24.517  -0.601  24.047 1.00 53.84 ? 8   PHE A CB   1 
ATOM   31   C  CG   . PHE A 1 4   ? 23.398  -0.574  25.063 1.00 52.17 ? 8   PHE A CG   1 
ATOM   32   C  CD1  . PHE A 1 4   ? 23.585  -1.079  26.343 1.00 50.35 ? 8   PHE A CD1  1 
ATOM   33   C  CD2  . PHE A 1 4   ? 22.159  -0.019  24.735 1.00 50.28 ? 8   PHE A CD2  1 
ATOM   34   C  CE1  . PHE A 1 4   ? 22.556  -1.048  27.273 1.00 50.99 ? 8   PHE A CE1  1 
ATOM   35   C  CE2  . PHE A 1 4   ? 21.130  0.029   25.647 1.00 50.13 ? 8   PHE A CE2  1 
ATOM   36   C  CZ   . PHE A 1 4   ? 21.318  -0.488  26.922 1.00 52.07 ? 8   PHE A CZ   1 
ATOM   37   N  N    . TYR A 1 5   ? 24.803  -1.481  21.129 1.00 55.74 ? 9   TYR A N    1 
ATOM   38   C  CA   . TYR A 1 5   ? 25.410  -1.127  19.863 1.00 56.50 ? 9   TYR A CA   1 
ATOM   39   C  C    . TYR A 1 5   ? 24.669  0.056   19.256 1.00 57.38 ? 9   TYR A C    1 
ATOM   40   O  O    . TYR A 1 5   ? 23.440  0.124   19.319 1.00 57.50 ? 9   TYR A O    1 
ATOM   41   C  CB   . TYR A 1 5   ? 25.486  -2.340  18.917 1.00 56.03 ? 9   TYR A CB   1 
ATOM   42   C  CG   . TYR A 1 5   ? 24.164  -2.873  18.402 1.00 55.82 ? 9   TYR A CG   1 
ATOM   43   C  CD1  . TYR A 1 5   ? 23.739  -2.581  17.103 1.00 56.44 ? 9   TYR A CD1  1 
ATOM   44   C  CD2  . TYR A 1 5   ? 23.350  -3.682  19.194 1.00 54.64 ? 9   TYR A CD2  1 
ATOM   45   C  CE1  . TYR A 1 5   ? 22.533  -3.067  16.613 1.00 55.11 ? 9   TYR A CE1  1 
ATOM   46   C  CE2  . TYR A 1 5   ? 22.146  -4.174  18.712 1.00 54.00 ? 9   TYR A CE2  1 
ATOM   47   C  CZ   . TYR A 1 5   ? 21.745  -3.861  17.422 1.00 55.25 ? 9   TYR A CZ   1 
ATOM   48   O  OH   . TYR A 1 5   ? 20.553  -4.329  16.923 1.00 54.78 ? 9   TYR A OH   1 
ATOM   49   N  N    . ARG A 1 6   ? 25.429  0.995   18.698 1.00 58.47 ? 10  ARG A N    1 
ATOM   50   C  CA   . ARG A 1 6   ? 24.884  2.203   18.097 1.00 59.62 ? 10  ARG A CA   1 
ATOM   51   C  C    . ARG A 1 6   ? 24.623  2.014   16.605 1.00 60.42 ? 10  ARG A C    1 
ATOM   52   O  O    . ARG A 1 6   ? 25.313  1.238   15.950 1.00 60.75 ? 10  ARG A O    1 
ATOM   53   C  CB   . ARG A 1 6   ? 25.876  3.361   18.250 1.00 60.05 ? 10  ARG A CB   1 
ATOM   54   C  CG   . ARG A 1 6   ? 26.000  3.987   19.615 1.00 60.83 ? 10  ARG A CG   1 
ATOM   55   C  CD   . ARG A 1 6   ? 26.794  5.291   19.486 1.00 62.55 ? 10  ARG A CD   1 
ATOM   56   N  NE   . ARG A 1 6   ? 26.222  6.385   20.275 1.00 64.37 ? 10  ARG A NE   1 
ATOM   57   C  CZ   . ARG A 1 6   ? 26.285  7.672   19.935 1.00 66.18 ? 10  ARG A CZ   1 
ATOM   58   N  NH1  . ARG A 1 6   ? 26.884  8.035   18.803 1.00 67.08 ? 10  ARG A NH1  1 
ATOM   59   N  NH2  . ARG A 1 6   ? 25.736  8.602   20.714 1.00 66.45 ? 10  ARG A NH2  1 
ATOM   60   N  N    . GLN A 1 7   ? 23.638  2.737   16.073 1.00 61.44 ? 11  GLN A N    1 
ATOM   61   C  CA   . GLN A 1 7   ? 23.420  2.838   14.623 1.00 62.58 ? 11  GLN A CA   1 
ATOM   62   C  C    . GLN A 1 7   ? 22.559  4.046   14.201 1.00 63.43 ? 11  GLN A C    1 
ATOM   63   O  O    . GLN A 1 7   ? 21.818  4.615   15.004 1.00 63.68 ? 11  GLN A O    1 
ATOM   64   C  CB   . GLN A 1 7   ? 22.868  1.532   14.031 1.00 62.37 ? 11  GLN A CB   1 
ATOM   65   C  CG   . GLN A 1 7   ? 21.560  1.065   14.625 1.00 62.67 ? 11  GLN A CG   1 
ATOM   66   C  CD   . GLN A 1 7   ? 20.972  -0.108  13.865 1.00 62.48 ? 11  GLN A CD   1 
ATOM   67   O  OE1  . GLN A 1 7   ? 20.666  -0.003  12.676 1.00 62.75 ? 11  GLN A OE1  1 
ATOM   68   N  NE2  . GLN A 1 7   ? 20.810  -1.233  14.549 1.00 61.50 ? 11  GLN A NE2  1 
ATOM   69   N  N    . GLU A 1 8   ? 22.685  4.411   12.927 1.00 64.69 ? 12  GLU A N    1 
ATOM   70   C  CA   . GLU A 1 8   ? 21.974  5.527   12.309 1.00 66.05 ? 12  GLU A CA   1 
ATOM   71   C  C    . GLU A 1 8   ? 20.693  5.033   11.645 1.00 66.57 ? 12  GLU A C    1 
ATOM   72   O  O    . GLU A 1 8   ? 20.738  4.498   10.533 1.00 66.98 ? 12  GLU A O    1 
ATOM   73   C  CB   . GLU A 1 8   ? 22.863  6.166   11.238 1.00 66.25 ? 12  GLU A CB   1 
ATOM   74   C  CG   . GLU A 1 8   ? 23.598  7.426   11.652 1.00 67.26 ? 12  GLU A CG   1 
ATOM   75   C  CD   . GLU A 1 8   ? 22.844  8.674   11.260 1.00 68.62 ? 12  GLU A CD   1 
ATOM   76   O  OE1  . GLU A 1 8   ? 22.534  9.478   12.169 1.00 69.61 ? 12  GLU A OE1  1 
ATOM   77   O  OE2  . GLU A 1 8   ? 22.545  8.841   10.051 1.00 68.42 ? 12  GLU A OE2  1 
ATOM   78   N  N    . LEU A 1 9   ? 19.558  5.224   12.316 1.00 66.85 ? 13  LEU A N    1 
ATOM   79   C  CA   . LEU A 1 9   ? 18.276  4.739   11.813 1.00 67.17 ? 13  LEU A CA   1 
ATOM   80   C  C    . LEU A 1 9   ? 17.089  5.646   12.158 1.00 67.35 ? 13  LEU A C    1 
ATOM   81   O  O    . LEU A 1 9   ? 16.390  5.405   13.145 1.00 67.53 ? 13  LEU A O    1 
ATOM   82   C  CB   . LEU A 1 9   ? 17.988  3.336   12.368 1.00 67.41 ? 13  LEU A CB   1 
ATOM   83   C  CG   . LEU A 1 9   ? 18.470  2.060   11.687 1.00 67.18 ? 13  LEU A CG   1 
ATOM   84   C  CD1  . LEU A 1 9   ? 17.639  0.926   12.228 1.00 67.11 ? 13  LEU A CD1  1 
ATOM   85   C  CD2  . LEU A 1 9   ? 18.371  2.119   10.162 1.00 68.32 ? 13  LEU A CD2  1 
ATOM   86   N  N    . ASN A 1 10  ? 16.840  6.690   11.375 1.00 67.37 ? 14  ASN A N    1 
ATOM   87   C  CA   . ASN A 1 10  ? 17.730  7.185   10.341 1.00 67.11 ? 14  ASN A CA   1 
ATOM   88   C  C    . ASN A 1 10  ? 17.768  8.694   10.543 1.00 66.45 ? 14  ASN A C    1 
ATOM   89   O  O    . ASN A 1 10  ? 16.717  9.338   10.679 1.00 66.46 ? 14  ASN A O    1 
ATOM   90   C  CB   . ASN A 1 10  ? 17.292  6.756   8.928  1.00 67.15 ? 14  ASN A CB   1 
ATOM   91   C  CG   . ASN A 1 10  ? 15.819  7.059   8.625  1.00 68.27 ? 14  ASN A CG   1 
ATOM   92   O  OD1  . ASN A 1 10  ? 15.526  7.845   7.720  1.00 70.20 ? 14  ASN A OD1  1 
ATOM   93   N  ND2  . ASN A 1 10  ? 14.893  6.412   9.342  1.00 66.96 ? 14  ASN A ND2  1 
ATOM   94   N  N    . LYS A 1 11  ? 18.989  9.230   10.614 1.00 65.54 ? 15  LYS A N    1 
ATOM   95   C  CA   . LYS A 1 11  ? 19.277  10.549  11.216 1.00 64.65 ? 15  LYS A CA   1 
ATOM   96   C  C    . LYS A 1 11  ? 19.042  10.546  12.736 1.00 63.61 ? 15  LYS A C    1 
ATOM   97   O  O    . LYS A 1 11  ? 19.448  11.472  13.441 1.00 63.29 ? 15  LYS A O    1 
ATOM   98   C  CB   . LYS A 1 11  ? 18.509  11.694  10.532 1.00 65.01 ? 15  LYS A CB   1 
ATOM   99   C  CG   . LYS A 1 11  ? 19.387  12.665  9.743  1.00 65.85 ? 15  LYS A CG   1 
ATOM   100  C  CD   . LYS A 1 11  ? 19.787  12.111  8.384  1.00 67.20 ? 15  LYS A CD   1 
ATOM   101  C  CE   . LYS A 1 11  ? 20.780  13.035  7.715  1.00 67.99 ? 15  LYS A CE   1 
ATOM   102  N  NZ   . LYS A 1 11  ? 21.574  12.317  6.686  1.00 69.27 ? 15  LYS A NZ   1 
ATOM   103  N  N    . THR A 1 12  ? 18.367  9.501   13.213 1.00 62.40 ? 16  THR A N    1 
ATOM   104  C  CA   . THR A 1 12  ? 18.240  9.200   14.633 1.00 60.91 ? 16  THR A CA   1 
ATOM   105  C  C    . THR A 1 12  ? 19.362  8.219   14.941 1.00 59.50 ? 16  THR A C    1 
ATOM   106  O  O    . THR A 1 12  ? 19.647  7.334   14.135 1.00 59.11 ? 16  THR A O    1 
ATOM   107  C  CB   . THR A 1 12  ? 16.885  8.488   14.964 1.00 61.39 ? 16  THR A CB   1 
ATOM   108  O  OG1  . THR A 1 12  ? 15.784  9.178   14.354 1.00 60.79 ? 16  THR A OG1  1 
ATOM   109  C  CG2  . THR A 1 12  ? 16.657  8.400   16.485 1.00 61.65 ? 16  THR A CG2  1 
ATOM   110  N  N    . ILE A 1 13  ? 20.001  8.395   16.093 1.00 57.71 ? 17  ILE A N    1 
ATOM   111  C  CA   . ILE A 1 13  ? 20.954  7.413   16.608 1.00 56.29 ? 17  ILE A CA   1 
ATOM   112  C  C    . ILE A 1 13  ? 20.249  6.451   17.590 1.00 54.81 ? 17  ILE A C    1 
ATOM   113  O  O    . ILE A 1 13  ? 19.633  6.882   18.586 1.00 54.60 ? 17  ILE A O    1 
ATOM   114  C  CB   . ILE A 1 13  ? 22.249  8.103   17.202 1.00 56.76 ? 17  ILE A CB   1 
ATOM   115  C  CG1  . ILE A 1 13  ? 23.282  7.079   17.740 1.00 56.51 ? 17  ILE A CG1  1 
ATOM   116  C  CG2  . ILE A 1 13  ? 21.888  9.262   18.179 1.00 57.62 ? 17  ILE A CG2  1 
ATOM   117  C  CD1  . ILE A 1 13  ? 23.074  6.606   19.174 1.00 58.63 ? 17  ILE A CD1  1 
ATOM   118  N  N    . TRP A 1 14  ? 20.313  5.156   17.273 1.00 52.47 ? 18  TRP A N    1 
ATOM   119  C  CA   . TRP A 1 14  ? 19.704  4.118   18.098 1.00 50.20 ? 18  TRP A CA   1 
ATOM   120  C  C    . TRP A 1 14  ? 20.747  3.390   18.911 1.00 49.86 ? 18  TRP A C    1 
ATOM   121  O  O    . TRP A 1 14  ? 21.686  2.834   18.348 1.00 50.21 ? 18  TRP A O    1 
ATOM   122  C  CB   . TRP A 1 14  ? 18.936  3.119   17.237 1.00 48.82 ? 18  TRP A CB   1 
ATOM   123  C  CG   . TRP A 1 14  ? 17.615  3.658   16.755 1.00 47.99 ? 18  TRP A CG   1 
ATOM   124  C  CD1  . TRP A 1 14  ? 17.429  4.644   15.828 1.00 46.59 ? 18  TRP A CD1  1 
ATOM   125  C  CD2  . TRP A 1 14  ? 16.297  3.244   17.168 1.00 45.48 ? 18  TRP A CD2  1 
ATOM   126  N  NE1  . TRP A 1 14  ? 16.089  4.883   15.651 1.00 46.99 ? 18  TRP A NE1  1 
ATOM   127  C  CE2  . TRP A 1 14  ? 15.368  4.035   16.449 1.00 46.37 ? 18  TRP A CE2  1 
ATOM   128  C  CE3  . TRP A 1 14  ? 15.815  2.298   18.075 1.00 44.64 ? 18  TRP A CE3  1 
ATOM   129  C  CZ2  . TRP A 1 14  ? 13.978  3.903   16.607 1.00 46.37 ? 18  TRP A CZ2  1 
ATOM   130  C  CZ3  . TRP A 1 14  ? 14.428  2.161   18.226 1.00 46.66 ? 18  TRP A CZ3  1 
ATOM   131  C  CH2  . TRP A 1 14  ? 13.533  2.959   17.495 1.00 46.51 ? 18  TRP A CH2  1 
ATOM   132  N  N    . GLU A 1 15  ? 20.596  3.398   20.235 1.00 48.60 ? 19  GLU A N    1 
ATOM   133  C  CA   . GLU A 1 15  ? 21.471  2.589   21.083 1.00 48.04 ? 19  GLU A CA   1 
ATOM   134  C  C    . GLU A 1 15  ? 20.667  1.521   21.835 1.00 46.72 ? 19  GLU A C    1 
ATOM   135  O  O    . GLU A 1 15  ? 19.989  1.832   22.800 1.00 46.51 ? 19  GLU A O    1 
ATOM   136  C  CB   . GLU A 1 15  ? 22.319  3.466   22.028 1.00 47.90 ? 19  GLU A CB   1 
ATOM   137  C  CG   . GLU A 1 15  ? 23.371  2.664   22.845 1.00 48.41 ? 19  GLU A CG   1 
ATOM   138  C  CD   . GLU A 1 15  ? 24.662  3.450   23.181 1.00 48.72 ? 19  GLU A CD   1 
ATOM   139  O  OE1  . GLU A 1 15  ? 24.733  4.661   22.885 1.00 48.99 ? 19  GLU A OE1  1 
ATOM   140  O  OE2  . GLU A 1 15  ? 25.614  2.838   23.736 1.00 48.14 ? 19  GLU A OE2  1 
ATOM   141  N  N    . VAL A 1 16  ? 20.737  0.272   21.364 1.00 46.04 ? 20  VAL A N    1 
ATOM   142  C  CA   . VAL A 1 16  ? 19.935  -0.850  21.929 1.00 45.48 ? 20  VAL A CA   1 
ATOM   143  C  C    . VAL A 1 16  ? 20.823  -2.019  22.389 1.00 44.70 ? 20  VAL A C    1 
ATOM   144  O  O    . VAL A 1 16  ? 21.911  -2.197  21.851 1.00 44.66 ? 20  VAL A O    1 
ATOM   145  C  CB   . VAL A 1 16  ? 18.781  -1.339  20.961 1.00 45.08 ? 20  VAL A CB   1 
ATOM   146  C  CG1  . VAL A 1 16  ? 18.098  -0.162  20.285 1.00 44.64 ? 20  VAL A CG1  1 
ATOM   147  C  CG2  . VAL A 1 16  ? 19.286  -2.278  19.900 1.00 46.49 ? 20  VAL A CG2  1 
ATOM   148  N  N    . PRO A 1 17  ? 20.381  -2.794  23.405 1.00 44.39 ? 21  PRO A N    1 
ATOM   149  C  CA   . PRO A 1 17  ? 21.136  -4.001  23.799 1.00 44.19 ? 21  PRO A CA   1 
ATOM   150  C  C    . PRO A 1 17  ? 21.272  -5.010  22.647 1.00 44.52 ? 21  PRO A C    1 
ATOM   151  O  O    . PRO A 1 17  ? 20.460  -4.989  21.711 1.00 44.05 ? 21  PRO A O    1 
ATOM   152  C  CB   . PRO A 1 17  ? 20.307  -4.582  24.957 1.00 44.13 ? 21  PRO A CB   1 
ATOM   153  C  CG   . PRO A 1 17  ? 19.505  -3.375  25.513 1.00 44.15 ? 21  PRO A CG   1 
ATOM   154  C  CD   . PRO A 1 17  ? 19.190  -2.582  24.263 1.00 44.25 ? 21  PRO A CD   1 
ATOM   155  N  N    . GLU A 1 18  ? 22.295  -5.868  22.696 1.00 45.05 ? 22  GLU A N    1 
ATOM   156  C  CA   . GLU A 1 18  ? 22.564  -6.764  21.557 1.00 46.24 ? 22  GLU A CA   1 
ATOM   157  C  C    . GLU A 1 18  ? 21.452  -7.771  21.288 1.00 45.01 ? 22  GLU A C    1 
ATOM   158  O  O    . GLU A 1 18  ? 21.230  -8.145  20.141 1.00 44.77 ? 22  GLU A O    1 
ATOM   159  C  CB   . GLU A 1 18  ? 23.943  -7.426  21.615 1.00 45.80 ? 22  GLU A CB   1 
ATOM   160  C  CG   . GLU A 1 18  ? 24.470  -7.722  23.001 1.00 49.31 ? 22  GLU A CG   1 
ATOM   161  C  CD   . GLU A 1 18  ? 25.917  -8.197  22.970 1.00 49.40 ? 22  GLU A CD   1 
ATOM   162  O  OE1  . GLU A 1 18  ? 26.269  -9.098  23.773 1.00 54.72 ? 22  GLU A OE1  1 
ATOM   163  O  OE2  . GLU A 1 18  ? 26.692  -7.677  22.129 1.00 53.03 ? 22  GLU A OE2  1 
ATOM   164  N  N    . ARG A 1 19  ? 20.772  -8.186  22.356 1.00 44.36 ? 23  ARG A N    1 
ATOM   165  C  CA   . ARG A 1 19  ? 19.490  -8.905  22.319 1.00 43.26 ? 23  ARG A CA   1 
ATOM   166  C  C    . ARG A 1 19  ? 18.563  -8.543  21.160 1.00 43.42 ? 23  ARG A C    1 
ATOM   167  O  O    . ARG A 1 19  ? 17.854  -9.401  20.650 1.00 43.46 ? 23  ARG A O    1 
ATOM   168  C  CB   . ARG A 1 19  ? 18.775  -8.710  23.669 1.00 43.25 ? 23  ARG A CB   1 
ATOM   169  C  CG   . ARG A 1 19  ? 17.264  -8.972  23.693 1.00 42.81 ? 23  ARG A CG   1 
ATOM   170  C  CD   . ARG A 1 19  ? 16.723  -9.119  25.141 1.00 42.33 ? 23  ARG A CD   1 
ATOM   171  N  NE   . ARG A 1 19  ? 15.277  -9.416  25.140 1.00 42.13 ? 23  ARG A NE   1 
ATOM   172  C  CZ   . ARG A 1 19  ? 14.470  -9.366  26.202 1.00 43.19 ? 23  ARG A CZ   1 
ATOM   173  N  NH1  . ARG A 1 19  ? 14.951  -9.021  27.397 1.00 42.22 ? 23  ARG A NH1  1 
ATOM   174  N  NH2  . ARG A 1 19  ? 13.164  -9.629  26.066 1.00 40.29 ? 23  ARG A NH2  1 
ATOM   175  N  N    . TYR A 1 20  ? 18.546  -7.274  20.749 1.00 43.53 ? 24  TYR A N    1 
ATOM   176  C  CA   . TYR A 1 20  ? 17.645  -6.828  19.678 1.00 43.48 ? 24  TYR A CA   1 
ATOM   177  C  C    . TYR A 1 20  ? 18.448  -6.597  18.414 1.00 45.13 ? 24  TYR A C    1 
ATOM   178  O  O    . TYR A 1 20  ? 19.421  -5.849  18.414 1.00 45.62 ? 24  TYR A O    1 
ATOM   179  C  CB   . TYR A 1 20  ? 16.847  -5.565  20.071 1.00 42.41 ? 24  TYR A CB   1 
ATOM   180  C  CG   . TYR A 1 20  ? 16.116  -5.714  21.388 1.00 40.13 ? 24  TYR A CG   1 
ATOM   181  C  CD1  . TYR A 1 20  ? 16.682  -5.228  22.584 1.00 38.14 ? 24  TYR A CD1  1 
ATOM   182  C  CD2  . TYR A 1 20  ? 14.876  -6.374  21.448 1.00 38.38 ? 24  TYR A CD2  1 
ATOM   183  C  CE1  . TYR A 1 20  ? 16.024  -5.380  23.814 1.00 37.73 ? 24  TYR A CE1  1 
ATOM   184  C  CE2  . TYR A 1 20  ? 14.215  -6.544  22.673 1.00 38.11 ? 24  TYR A CE2  1 
ATOM   185  C  CZ   . TYR A 1 20  ? 14.793  -6.045  23.842 1.00 38.95 ? 24  TYR A CZ   1 
ATOM   186  O  OH   . TYR A 1 20  ? 14.138  -6.218  25.032 1.00 39.37 ? 24  TYR A OH   1 
ATOM   187  N  N    . GLN A 1 21  ? 18.023  -7.240  17.330 1.00 46.35 ? 25  GLN A N    1 
ATOM   188  C  CA   . GLN A 1 21  ? 18.801  -7.262  16.117 1.00 47.11 ? 25  GLN A CA   1 
ATOM   189  C  C    . GLN A 1 21  ? 17.946  -6.863  14.917 1.00 47.88 ? 25  GLN A C    1 
ATOM   190  O  O    . GLN A 1 21  ? 16.694  -6.847  14.984 1.00 47.34 ? 25  GLN A O    1 
ATOM   191  C  CB   . GLN A 1 21  ? 19.396  -8.670  15.928 1.00 47.60 ? 25  GLN A CB   1 
ATOM   192  C  CG   . GLN A 1 21  ? 20.923  -8.688  15.716 1.00 49.23 ? 25  GLN A CG   1 
ATOM   193  C  CD   . GLN A 1 21  ? 21.684  -8.599  17.019 1.00 49.54 ? 25  GLN A CD   1 
ATOM   194  O  OE1  . GLN A 1 21  ? 21.790  -9.580  17.746 1.00 53.89 ? 25  GLN A OE1  1 
ATOM   195  N  NE2  . GLN A 1 21  ? 22.219  -7.426  17.325 1.00 49.40 ? 25  GLN A NE2  1 
ATOM   196  N  N    . ASN A 1 22  ? 18.633  -6.530  13.823 1.00 48.32 ? 26  ASN A N    1 
ATOM   197  C  CA   . ASN A 1 22  ? 17.998  -6.330  12.532 1.00 49.23 ? 26  ASN A CA   1 
ATOM   198  C  C    . ASN A 1 22  ? 16.880  -5.286  12.604 1.00 49.54 ? 26  ASN A C    1 
ATOM   199  O  O    . ASN A 1 22  ? 15.779  -5.485  12.086 1.00 49.42 ? 26  ASN A O    1 
ATOM   200  C  CB   . ASN A 1 22  ? 17.481  -7.667  11.980 1.00 49.81 ? 26  ASN A CB   1 
ATOM   201  C  CG   . ASN A 1 22  ? 18.458  -8.826  12.213 1.00 51.55 ? 26  ASN A CG   1 
ATOM   202  O  OD1  . ASN A 1 22  ? 19.667  -8.707  11.972 1.00 53.27 ? 26  ASN A OD1  1 
ATOM   203  N  ND2  . ASN A 1 22  ? 17.926  -9.955  12.690 1.00 52.17 ? 26  ASN A ND2  1 
ATOM   204  N  N    . LEU A 1 23  ? 17.190  -4.178  13.275 1.00 49.79 ? 27  LEU A N    1 
ATOM   205  C  CA   . LEU A 1 23  ? 16.291  -3.052  13.416 1.00 49.46 ? 27  LEU A CA   1 
ATOM   206  C  C    . LEU A 1 23  ? 15.951  -2.503  12.045 1.00 50.01 ? 27  LEU A C    1 
ATOM   207  O  O    . LEU A 1 23  ? 16.861  -2.218  11.255 1.00 49.95 ? 27  LEU A O    1 
ATOM   208  C  CB   . LEU A 1 23  ? 16.977  -1.948  14.240 1.00 49.54 ? 27  LEU A CB   1 
ATOM   209  C  CG   . LEU A 1 23  ? 16.775  -1.807  15.753 1.00 48.60 ? 27  LEU A CG   1 
ATOM   210  C  CD1  . LEU A 1 23  ? 17.234  -3.036  16.513 1.00 45.91 ? 27  LEU A CD1  1 
ATOM   211  C  CD2  . LEU A 1 23  ? 17.515  -0.561  16.238 1.00 49.23 ? 27  LEU A CD2  1 
ATOM   212  N  N    . SER A 1 24  ? 14.655  -2.349  11.767 1.00 50.20 ? 28  SER A N    1 
ATOM   213  C  CA   . SER A 1 24  ? 14.214  -1.583  10.590 1.00 50.93 ? 28  SER A CA   1 
ATOM   214  C  C    . SER A 1 24  ? 12.992  -0.688  10.849 1.00 51.08 ? 28  SER A C    1 
ATOM   215  O  O    . SER A 1 24  ? 11.997  -1.142  11.398 1.00 51.17 ? 28  SER A O    1 
ATOM   216  C  CB   . SER A 1 24  ? 14.012  -2.480  9.351  1.00 51.07 ? 28  SER A CB   1 
ATOM   217  O  OG   . SER A 1 24  ? 12.838  -3.256  9.437  1.00 52.66 ? 28  SER A OG   1 
ATOM   218  N  N    . PRO A 1 25  ? 13.094  0.610   10.492 1.00 51.86 ? 29  PRO A N    1 
ATOM   219  C  CA   . PRO A 1 25  ? 11.999  1.586   10.589 1.00 52.19 ? 29  PRO A CA   1 
ATOM   220  C  C    . PRO A 1 25  ? 10.605  1.049   10.226 1.00 52.44 ? 29  PRO A C    1 
ATOM   221  O  O    . PRO A 1 25  ? 10.462  0.326   9.247  1.00 52.97 ? 29  PRO A O    1 
ATOM   222  C  CB   . PRO A 1 25  ? 12.448  2.681   9.626  1.00 52.37 ? 29  PRO A CB   1 
ATOM   223  C  CG   . PRO A 1 25  ? 13.933  2.686   9.773  1.00 51.81 ? 29  PRO A CG   1 
ATOM   224  C  CD   . PRO A 1 25  ? 14.347  1.257   10.044 1.00 51.47 ? 29  PRO A CD   1 
ATOM   225  N  N    . VAL A 1 26  ? 9.593   1.420   11.006 1.00 52.99 ? 30  VAL A N    1 
ATOM   226  C  CA   . VAL A 1 26  ? 8.249   0.868   10.857 1.00 53.35 ? 30  VAL A CA   1 
ATOM   227  C  C    . VAL A 1 26  ? 7.187   1.933   11.164 1.00 54.25 ? 30  VAL A C    1 
ATOM   228  O  O    . VAL A 1 26  ? 6.129   2.018   10.498 1.00 54.85 ? 30  VAL A O    1 
ATOM   229  C  CB   . VAL A 1 26  ? 8.097   -0.423  11.743 1.00 53.80 ? 30  VAL A CB   1 
ATOM   230  C  CG1  . VAL A 1 26  ? 7.479   -0.127  13.096 1.00 52.84 ? 30  VAL A CG1  1 
ATOM   231  C  CG2  . VAL A 1 26  ? 7.324   -1.515  11.024 1.00 53.61 ? 30  VAL A CG2  1 
ATOM   232  N  N    . TYR A 1 31  ? 3.890   5.530   15.364 1.00 56.36 ? 35  TYR A N    1 
ATOM   233  C  CA   . TYR A 1 31  ? 4.070   6.446   16.490 1.00 55.91 ? 35  TYR A CA   1 
ATOM   234  C  C    . TYR A 1 31  ? 5.048   7.601   16.179 1.00 55.30 ? 35  TYR A C    1 
ATOM   235  O  O    . TYR A 1 31  ? 4.746   8.521   15.397 1.00 55.26 ? 35  TYR A O    1 
ATOM   236  C  CB   . TYR A 1 31  ? 4.508   5.658   17.762 1.00 55.74 ? 35  TYR A CB   1 
ATOM   237  N  N    . GLY A 1 32  ? 6.220   7.530   16.802 1.00 54.42 ? 36  GLY A N    1 
ATOM   238  C  CA   . GLY A 1 32  ? 7.269   8.525   16.642 1.00 51.99 ? 36  GLY A CA   1 
ATOM   239  C  C    . GLY A 1 32  ? 8.593   7.873   16.953 1.00 50.71 ? 36  GLY A C    1 
ATOM   240  O  O    . GLY A 1 32  ? 9.160   8.042   18.072 1.00 50.85 ? 36  GLY A O    1 
ATOM   241  N  N    . SER A 1 33  ? 9.058   7.131   15.941 1.00 49.11 ? 37  SER A N    1 
ATOM   242  C  CA   . SER A 1 33  ? 10.322  6.360   15.900 1.00 47.05 ? 37  SER A CA   1 
ATOM   243  C  C    . SER A 1 33  ? 10.190  4.967   16.490 1.00 45.41 ? 37  SER A C    1 
ATOM   244  O  O    . SER A 1 33  ? 10.440  4.746   17.665 1.00 44.40 ? 37  SER A O    1 
ATOM   245  C  CB   . SER A 1 33  ? 11.539  7.124   16.442 1.00 47.46 ? 37  SER A CB   1 
ATOM   246  O  OG   . SER A 1 33  ? 12.067  7.956   15.430 1.00 47.91 ? 37  SER A OG   1 
ATOM   247  N  N    . VAL A 1 34  ? 9.777   4.049   15.622 1.00 43.74 ? 38  VAL A N    1 
ATOM   248  C  CA   . VAL A 1 34  ? 9.605   2.654   15.941 1.00 42.34 ? 38  VAL A CA   1 
ATOM   249  C  C    . VAL A 1 34  ? 10.431  1.869   14.930 1.00 42.26 ? 38  VAL A C    1 
ATOM   250  O  O    . VAL A 1 34  ? 10.499  2.213   13.730 1.00 40.89 ? 38  VAL A O    1 
ATOM   251  C  CB   . VAL A 1 34  ? 8.090   2.222   15.901 1.00 42.72 ? 38  VAL A CB   1 
ATOM   252  C  CG1  . VAL A 1 34  ? 7.916   0.747   16.163 1.00 40.63 ? 38  VAL A CG1  1 
ATOM   253  C  CG2  . VAL A 1 34  ? 7.263   3.017   16.922 1.00 41.47 ? 38  VAL A CG2  1 
ATOM   254  N  N    . CYS A 1 35  ? 11.106  0.845   15.440 1.00 40.99 ? 39  CYS A N    1 
ATOM   255  C  CA   . CYS A 1 35  ? 11.739  -0.138  14.598 1.00 40.21 ? 39  CYS A CA   1 
ATOM   256  C  C    . CYS A 1 35  ? 11.117  -1.486  14.898 1.00 39.89 ? 39  CYS A C    1 
ATOM   257  O  O    . CYS A 1 35  ? 10.853  -1.821  16.059 1.00 39.80 ? 39  CYS A O    1 
ATOM   258  C  CB   . CYS A 1 35  ? 13.246  -0.218  14.872 1.00 39.41 ? 39  CYS A CB   1 
ATOM   259  S  SG   . CYS A 1 35  ? 14.187  1.133   14.182 1.00 39.70 ? 39  CYS A SG   1 
ATOM   260  N  N    . ALA A 1 36  ? 10.884  -2.262  13.847 1.00 39.68 ? 40  ALA A N    1 
ATOM   261  C  CA   . ALA A 1 36  ? 10.685  -3.687  14.015 1.00 40.02 ? 40  ALA A CA   1 
ATOM   262  C  C    . ALA A 1 36  ? 12.080  -4.263  14.391 1.00 39.68 ? 40  ALA A C    1 
ATOM   263  O  O    . ALA A 1 36  ? 13.103  -3.778  13.914 1.00 38.58 ? 40  ALA A O    1 
ATOM   264  C  CB   . ALA A 1 36  ? 10.148  -4.289  12.730 1.00 39.47 ? 40  ALA A CB   1 
ATOM   265  N  N    . ALA A 1 37  ? 12.118  -5.245  15.277 1.00 40.46 ? 41  ALA A N    1 
ATOM   266  C  CA   . ALA A 1 37  ? 13.394  -5.847  15.679 1.00 41.59 ? 41  ALA A CA   1 
ATOM   267  C  C    . ALA A 1 37  ? 13.245  -7.324  15.998 1.00 42.16 ? 41  ALA A C    1 
ATOM   268  O  O    . ALA A 1 37  ? 12.174  -7.782  16.395 1.00 42.06 ? 41  ALA A O    1 
ATOM   269  C  CB   . ALA A 1 37  ? 13.992  -5.116  16.872 1.00 41.79 ? 41  ALA A CB   1 
ATOM   270  N  N    . PHE A 1 38  ? 14.330  -8.070  15.828 1.00 43.47 ? 42  PHE A N    1 
ATOM   271  C  CA   . PHE A 1 38  ? 14.338  -9.460  16.254 1.00 44.34 ? 42  PHE A CA   1 
ATOM   272  C  C    . PHE A 1 38  ? 14.828  -9.549  17.685 1.00 44.07 ? 42  PHE A C    1 
ATOM   273  O  O    . PHE A 1 38  ? 15.966  -9.202  17.974 1.00 44.49 ? 42  PHE A O    1 
ATOM   274  C  CB   . PHE A 1 38  ? 15.202  -10.331 15.330 1.00 45.36 ? 42  PHE A CB   1 
ATOM   275  C  CG   . PHE A 1 38  ? 15.028  -11.801 15.564 1.00 47.37 ? 42  PHE A CG   1 
ATOM   276  C  CD1  . PHE A 1 38  ? 13.989  -12.496 14.950 1.00 49.35 ? 42  PHE A CD1  1 
ATOM   277  C  CD2  . PHE A 1 38  ? 15.889  -12.490 16.414 1.00 49.50 ? 42  PHE A CD2  1 
ATOM   278  C  CE1  . PHE A 1 38  ? 13.817  -13.849 15.177 1.00 50.90 ? 42  PHE A CE1  1 
ATOM   279  C  CE2  . PHE A 1 38  ? 15.728  -13.856 16.648 1.00 50.91 ? 42  PHE A CE2  1 
ATOM   280  C  CZ   . PHE A 1 38  ? 14.686  -14.532 16.035 1.00 50.08 ? 42  PHE A CZ   1 
ATOM   281  N  N    . ASP A 1 39  ? 13.967  -10.035 18.567 1.00 44.62 ? 43  ASP A N    1 
ATOM   282  C  CA   . ASP A 1 39  ? 14.310  -10.237 19.970 1.00 45.56 ? 43  ASP A CA   1 
ATOM   283  C  C    . ASP A 1 39  ? 14.930  -11.608 20.126 1.00 46.62 ? 43  ASP A C    1 
ATOM   284  O  O    . ASP A 1 39  ? 14.222  -12.614 20.216 1.00 47.24 ? 43  ASP A O    1 
ATOM   285  C  CB   . ASP A 1 39  ? 13.052  -10.111 20.846 1.00 45.48 ? 43  ASP A CB   1 
ATOM   286  C  CG   . ASP A 1 39  ? 13.333  -10.328 22.328 1.00 44.45 ? 43  ASP A CG   1 
ATOM   287  O  OD1  . ASP A 1 39  ? 14.487  -10.606 22.697 1.00 43.92 ? 43  ASP A OD1  1 
ATOM   288  O  OD2  . ASP A 1 39  ? 12.388  -10.209 23.128 1.00 45.00 ? 43  ASP A OD2  1 
ATOM   289  N  N    . THR A 1 40  ? 16.254  -11.654 20.184 1.00 47.66 ? 44  THR A N    1 
ATOM   290  C  CA   . THR A 1 40  ? 16.953  -12.933 20.155 1.00 48.69 ? 44  THR A CA   1 
ATOM   291  C  C    . THR A 1 40  ? 16.791  -13.716 21.445 1.00 49.19 ? 44  THR A C    1 
ATOM   292  O  O    . THR A 1 40  ? 17.199  -14.871 21.519 1.00 49.10 ? 44  THR A O    1 
ATOM   293  C  CB   . THR A 1 40  ? 18.467  -12.791 19.834 1.00 48.77 ? 44  THR A CB   1 
ATOM   294  O  OG1  . THR A 1 40  ? 19.140  -12.211 20.956 1.00 49.11 ? 44  THR A OG1  1 
ATOM   295  C  CG2  . THR A 1 40  ? 18.703  -11.951 18.576 1.00 48.12 ? 44  THR A CG2  1 
ATOM   296  N  N    . LYS A 1 41  ? 16.192  -13.103 22.463 1.00 50.31 ? 45  LYS A N    1 
ATOM   297  C  CA   . LYS A 1 41  ? 16.045  -13.795 23.745 1.00 51.16 ? 45  LYS A CA   1 
ATOM   298  C  C    . LYS A 1 41  ? 14.837  -14.725 23.744 1.00 51.49 ? 45  LYS A C    1 
ATOM   299  O  O    . LYS A 1 41  ? 14.836  -15.752 24.428 1.00 51.97 ? 45  LYS A O    1 
ATOM   300  C  CB   . LYS A 1 41  ? 15.938  -12.800 24.900 1.00 51.30 ? 45  LYS A CB   1 
ATOM   301  C  CG   . LYS A 1 41  ? 16.423  -13.386 26.239 1.00 52.41 ? 45  LYS A CG   1 
ATOM   302  C  CD   . LYS A 1 41  ? 16.174  -12.460 27.429 1.00 52.79 ? 45  LYS A CD   1 
ATOM   303  C  CE   . LYS A 1 41  ? 14.872  -12.826 28.129 1.00 54.46 ? 45  LYS A CE   1 
ATOM   304  N  NZ   . LYS A 1 41  ? 14.808  -12.225 29.499 1.00 55.25 ? 45  LYS A NZ   1 
ATOM   305  N  N    . THR A 1 42  ? 13.812  -14.352 22.981 1.00 51.14 ? 46  THR A N    1 
ATOM   306  C  CA   . THR A 1 42  ? 12.547  -15.075 22.952 1.00 51.23 ? 46  THR A CA   1 
ATOM   307  C  C    . THR A 1 42  ? 12.313  -15.672 21.572 1.00 51.02 ? 46  THR A C    1 
ATOM   308  O  O    . THR A 1 42  ? 11.458  -16.538 21.414 1.00 51.70 ? 46  THR A O    1 
ATOM   309  C  CB   . THR A 1 42  ? 11.364  -14.122 23.232 1.00 51.40 ? 46  THR A CB   1 
ATOM   310  O  OG1  . THR A 1 42  ? 11.468  -12.998 22.352 1.00 51.40 ? 46  THR A OG1  1 
ATOM   311  C  CG2  . THR A 1 42  ? 11.366  -13.626 24.679 1.00 51.28 ? 46  THR A CG2  1 
ATOM   312  N  N    . GLY A 1 43  ? 13.062  -15.183 20.583 1.00 50.68 ? 47  GLY A N    1 
ATOM   313  C  CA   . GLY A 1 43  ? 12.942  -15.617 19.194 1.00 50.41 ? 47  GLY A CA   1 
ATOM   314  C  C    . GLY A 1 43  ? 11.872  -14.823 18.467 1.00 50.37 ? 47  GLY A C    1 
ATOM   315  O  O    . GLY A 1 43  ? 11.578  -15.067 17.292 1.00 50.79 ? 47  GLY A O    1 
ATOM   316  N  N    . LEU A 1 44  ? 11.298  -13.847 19.159 1.00 49.22 ? 48  LEU A N    1 
ATOM   317  C  CA   . LEU A 1 44  ? 10.123  -13.161 18.643 1.00 48.24 ? 48  LEU A CA   1 
ATOM   318  C  C    . LEU A 1 44  ? 10.462  -11.826 17.973 1.00 46.99 ? 48  LEU A C    1 
ATOM   319  O  O    . LEU A 1 44  ? 11.553  -11.273 18.148 1.00 46.60 ? 48  LEU A O    1 
ATOM   320  C  CB   . LEU A 1 44  ? 9.040   -13.030 19.751 1.00 48.62 ? 48  LEU A CB   1 
ATOM   321  C  CG   . LEU A 1 44  ? 8.607   -14.346 20.458 1.00 48.84 ? 48  LEU A CG   1 
ATOM   322  C  CD1  . LEU A 1 44  ? 7.594   -14.143 21.575 1.00 47.93 ? 48  LEU A CD1  1 
ATOM   323  C  CD2  . LEU A 1 44  ? 8.080   -15.420 19.473 1.00 49.34 ? 48  LEU A CD2  1 
ATOM   324  N  N    . ARG A 1 45  ? 9.541   -11.353 17.148 1.00 46.09 ? 49  ARG A N    1 
ATOM   325  C  CA   A ARG A 1 45  ? 9.672   -10.048 16.522 0.50 45.28 ? 49  ARG A CA   1 
ATOM   326  C  CA   B ARG A 1 45  ? 9.679   -10.055 16.518 0.50 45.43 ? 49  ARG A CA   1 
ATOM   327  C  C    . ARG A 1 45  ? 8.982   -9.002  17.400 1.00 44.70 ? 49  ARG A C    1 
ATOM   328  O  O    . ARG A 1 45  ? 7.853   -9.214  17.867 1.00 44.61 ? 49  ARG A O    1 
ATOM   329  C  CB   A ARG A 1 45  ? 9.079   -10.058 15.113 0.50 45.46 ? 49  ARG A CB   1 
ATOM   330  C  CB   B ARG A 1 45  ? 9.112   -10.091 15.092 0.50 45.56 ? 49  ARG A CB   1 
ATOM   331  C  CG   A ARG A 1 45  ? 10.097  -10.225 13.991 0.50 45.67 ? 49  ARG A CG   1 
ATOM   332  C  CG   B ARG A 1 45  ? 9.901   -9.249  14.094 0.50 45.85 ? 49  ARG A CG   1 
ATOM   333  C  CD   A ARG A 1 45  ? 9.418   -10.185 12.629 0.50 44.90 ? 49  ARG A CD   1 
ATOM   334  C  CD   B ARG A 1 45  ? 9.308   -9.284  12.682 0.50 45.65 ? 49  ARG A CD   1 
ATOM   335  N  NE   A ARG A 1 45  ? 8.852   -11.481 12.279 0.50 45.13 ? 49  ARG A NE   1 
ATOM   336  N  NE   B ARG A 1 45  ? 9.839   -8.181  11.877 0.50 45.85 ? 49  ARG A NE   1 
ATOM   337  C  CZ   A ARG A 1 45  ? 7.587   -11.855 12.475 0.50 45.12 ? 49  ARG A CZ   1 
ATOM   338  C  CZ   B ARG A 1 45  ? 9.178   -7.553  10.911 0.50 45.70 ? 49  ARG A CZ   1 
ATOM   339  N  NH1  A ARG A 1 45  ? 6.705   -11.029 13.022 0.50 44.58 ? 49  ARG A NH1  1 
ATOM   340  N  NH1  B ARG A 1 45  ? 7.936   -7.901  10.605 0.50 46.20 ? 49  ARG A NH1  1 
ATOM   341  N  NH2  A ARG A 1 45  ? 7.201   -13.074 12.115 0.50 44.97 ? 49  ARG A NH2  1 
ATOM   342  N  NH2  B ARG A 1 45  ? 9.758   -6.560  10.255 0.50 45.49 ? 49  ARG A NH2  1 
ATOM   343  N  N    . VAL A 1 46  ? 9.671   -7.880  17.635 1.00 43.55 ? 50  VAL A N    1 
ATOM   344  C  CA   . VAL A 1 46  ? 9.186   -6.833  18.550 1.00 41.84 ? 50  VAL A CA   1 
ATOM   345  C  C    . VAL A 1 46  ? 9.129   -5.428  17.905 1.00 41.37 ? 50  VAL A C    1 
ATOM   346  O  O    . VAL A 1 46  ? 9.817   -5.148  16.914 1.00 41.20 ? 50  VAL A O    1 
ATOM   347  C  CB   . VAL A 1 46  ? 10.017  -6.786  19.871 1.00 41.59 ? 50  VAL A CB   1 
ATOM   348  C  CG1  . VAL A 1 46  ? 9.879   -8.073  20.641 1.00 40.37 ? 50  VAL A CG1  1 
ATOM   349  C  CG2  . VAL A 1 46  ? 11.485  -6.461  19.607 1.00 40.18 ? 50  VAL A CG2  1 
ATOM   350  N  N    . ALA A 1 47  ? 8.287   -4.566  18.465 1.00 39.82 ? 51  ALA A N    1 
ATOM   351  C  CA   . ALA A 1 47  ? 8.369   -3.141  18.207 1.00 38.51 ? 51  ALA A CA   1 
ATOM   352  C  C    . ALA A 1 47  ? 9.227   -2.508  19.294 1.00 37.91 ? 51  ALA A C    1 
ATOM   353  O  O    . ALA A 1 47  ? 8.966   -2.692  20.492 1.00 38.13 ? 51  ALA A O    1 
ATOM   354  C  CB   . ALA A 1 47  ? 6.991   -2.524  18.210 1.00 38.89 ? 51  ALA A CB   1 
ATOM   355  N  N    . VAL A 1 48  ? 10.260  -1.780  18.875 1.00 36.46 ? 52  VAL A N    1 
ATOM   356  C  CA   . VAL A 1 48  ? 11.060  -1.003  19.781 1.00 34.59 ? 52  VAL A CA   1 
ATOM   357  C  C    . VAL A 1 48  ? 10.789  0.462   19.470 1.00 33.98 ? 52  VAL A C    1 
ATOM   358  O  O    . VAL A 1 48  ? 10.995  0.924   18.345 1.00 32.76 ? 52  VAL A O    1 
ATOM   359  C  CB   . VAL A 1 48  ? 12.595  -1.320  19.643 1.00 35.71 ? 52  VAL A CB   1 
ATOM   360  C  CG1  . VAL A 1 48  ? 13.419  -0.483  20.645 1.00 32.95 ? 52  VAL A CG1  1 
ATOM   361  C  CG2  . VAL A 1 48  ? 12.867  -2.830  19.821 1.00 35.10 ? 52  VAL A CG2  1 
ATOM   362  N  N    . LYS A 1 49  ? 10.305  1.187   20.473 1.00 33.62 ? 53  LYS A N    1 
ATOM   363  C  CA   . LYS A 1 49  ? 9.944   2.582   20.279 1.00 33.93 ? 53  LYS A CA   1 
ATOM   364  C  C    . LYS A 1 49  ? 10.939  3.457   21.043 1.00 33.03 ? 53  LYS A C    1 
ATOM   365  O  O    . LYS A 1 49  ? 11.151  3.278   22.245 1.00 32.60 ? 53  LYS A O    1 
ATOM   366  C  CB   . LYS A 1 49  ? 8.487   2.843   20.699 1.00 33.99 ? 53  LYS A CB   1 
ATOM   367  C  CG   . LYS A 1 49  ? 8.015   4.329   20.683 1.00 36.22 ? 53  LYS A CG   1 
ATOM   368  C  CD   . LYS A 1 49  ? 6.534   4.444   21.124 1.00 35.43 ? 53  LYS A CD   1 
ATOM   369  C  CE   . LYS A 1 49  ? 6.114   5.839   21.704 1.00 38.16 ? 53  LYS A CE   1 
ATOM   370  N  NZ   . LYS A 1 49  ? 5.339   5.781   23.107 1.00 32.75 ? 53  LYS A NZ   1 
ATOM   371  N  N    . LYS A 1 50  ? 11.576  4.365   20.319 1.00 32.50 ? 54  LYS A N    1 
ATOM   372  C  CA   . LYS A 1 50  ? 12.441  5.368   20.918 1.00 32.98 ? 54  LYS A CA   1 
ATOM   373  C  C    . LYS A 1 50  ? 11.667  6.670   21.002 1.00 33.08 ? 54  LYS A C    1 
ATOM   374  O  O    . LYS A 1 50  ? 11.193  7.163   19.992 1.00 32.99 ? 54  LYS A O    1 
ATOM   375  C  CB   . LYS A 1 50  ? 13.683  5.590   20.084 1.00 32.40 ? 54  LYS A CB   1 
ATOM   376  C  CG   . LYS A 1 50  ? 14.687  6.447   20.799 1.00 35.34 ? 54  LYS A CG   1 
ATOM   377  C  CD   . LYS A 1 50  ? 15.485  7.351   19.845 1.00 36.88 ? 54  LYS A CD   1 
ATOM   378  C  CE   . LYS A 1 50  ? 16.873  7.530   20.416 1.00 36.53 ? 54  LYS A CE   1 
ATOM   379  N  NZ   . LYS A 1 50  ? 17.490  8.835   20.087 1.00 40.70 ? 54  LYS A NZ   1 
ATOM   380  N  N    . LEU A 1 51  ? 11.556  7.204   22.214 1.00 33.93 ? 55  LEU A N    1 
ATOM   381  C  CA   . LEU A 1 51  ? 10.806  8.416   22.493 1.00 34.63 ? 55  LEU A CA   1 
ATOM   382  C  C    . LEU A 1 51  ? 11.671  9.610   22.137 1.00 35.76 ? 55  LEU A C    1 
ATOM   383  O  O    . LEU A 1 51  ? 12.849  9.671   22.532 1.00 35.55 ? 55  LEU A O    1 
ATOM   384  C  CB   . LEU A 1 51  ? 10.427  8.463   23.982 1.00 34.28 ? 55  LEU A CB   1 
ATOM   385  C  CG   . LEU A 1 51  ? 9.286   7.551   24.510 1.00 35.79 ? 55  LEU A CG   1 
ATOM   386  C  CD1  . LEU A 1 51  ? 9.286   6.187   23.871 1.00 35.63 ? 55  LEU A CD1  1 
ATOM   387  C  CD2  . LEU A 1 51  ? 9.345   7.394   26.022 1.00 33.36 ? 55  LEU A CD2  1 
ATOM   388  N  N    . SER A 1 52  ? 11.105  10.539  21.364 1.00 36.37 ? 56  SER A N    1 
ATOM   389  C  CA   . SER A 1 52  ? 11.814  11.764  21.025 1.00 37.24 ? 56  SER A CA   1 
ATOM   390  C  C    . SER A 1 52  ? 11.680  12.751  22.167 1.00 37.14 ? 56  SER A C    1 
ATOM   391  O  O    . SER A 1 52  ? 10.595  12.939  22.716 1.00 37.59 ? 56  SER A O    1 
ATOM   392  C  CB   . SER A 1 52  ? 11.366  12.377  19.674 1.00 37.63 ? 56  SER A CB   1 
ATOM   393  O  OG   . SER A 1 52  ? 9.961   12.345  19.509 1.00 38.31 ? 56  SER A OG   1 
ATOM   394  N  N    . ARG A 1 53  ? 12.814  13.308  22.574 1.00 36.76 ? 57  ARG A N    1 
ATOM   395  C  CA   . ARG A 1 53  ? 12.842  14.367  23.576 1.00 37.26 ? 57  ARG A CA   1 
ATOM   396  C  C    . ARG A 1 53  ? 11.953  14.016  24.780 1.00 35.62 ? 57  ARG A C    1 
ATOM   397  O  O    . ARG A 1 53  ? 11.066  14.794  25.136 1.00 36.54 ? 57  ARG A O    1 
ATOM   398  C  CB   . ARG A 1 53  ? 12.374  15.706  22.948 1.00 37.23 ? 57  ARG A CB   1 
ATOM   399  C  CG   . ARG A 1 53  ? 12.795  15.980  21.476 1.00 38.38 ? 57  ARG A CG   1 
ATOM   400  C  CD   . ARG A 1 53  ? 11.709  16.928  20.845 1.00 40.33 ? 57  ARG A CD   1 
ATOM   401  N  NE   . ARG A 1 53  ? 12.130  17.669  19.645 1.00 47.38 ? 57  ARG A NE   1 
ATOM   402  C  CZ   . ARG A 1 53  ? 11.321  18.444  18.905 1.00 47.53 ? 57  ARG A CZ   1 
ATOM   403  N  NH1  . ARG A 1 53  ? 10.042  18.609  19.237 1.00 48.74 ? 57  ARG A NH1  1 
ATOM   404  N  NH2  . ARG A 1 53  ? 11.785  19.046  17.818 1.00 45.54 ? 57  ARG A NH2  1 
ATOM   405  N  N    . PRO A 1 54  ? 12.191  12.865  25.449 1.00 34.03 ? 58  PRO A N    1 
ATOM   406  C  CA   . PRO A 1 54  ? 11.188  12.578  26.471 1.00 32.46 ? 58  PRO A CA   1 
ATOM   407  C  C    . PRO A 1 54  ? 11.101  13.621  27.609 1.00 31.55 ? 58  PRO A C    1 
ATOM   408  O  O    . PRO A 1 54  ? 10.049  13.755  28.202 1.00 31.33 ? 58  PRO A O    1 
ATOM   409  C  CB   . PRO A 1 54  ? 11.589  11.173  26.977 1.00 32.22 ? 58  PRO A CB   1 
ATOM   410  C  CG   . PRO A 1 54  ? 13.063  11.054  26.662 1.00 31.99 ? 58  PRO A CG   1 
ATOM   411  C  CD   . PRO A 1 54  ? 13.243  11.821  25.379 1.00 33.59 ? 58  PRO A CD   1 
ATOM   412  N  N    . PHE A 1 55  ? 12.171  14.360  27.894 1.00 31.02 ? 59  PHE A N    1 
ATOM   413  C  CA   . PHE A 1 55  ? 12.194  15.239  29.068 1.00 31.70 ? 59  PHE A CA   1 
ATOM   414  C  C    . PHE A 1 55  ? 12.410  16.725  28.731 1.00 32.72 ? 59  PHE A C    1 
ATOM   415  O  O    . PHE A 1 55  ? 12.940  17.511  29.533 1.00 32.02 ? 59  PHE A O    1 
ATOM   416  C  CB   . PHE A 1 55  ? 13.229  14.724  30.077 1.00 30.22 ? 59  PHE A CB   1 
ATOM   417  C  CG   . PHE A 1 55  ? 13.101  13.231  30.362 1.00 30.55 ? 59  PHE A CG   1 
ATOM   418  C  CD1  . PHE A 1 55  ? 11.967  12.733  31.020 1.00 27.42 ? 59  PHE A CD1  1 
ATOM   419  C  CD2  . PHE A 1 55  ? 14.086  12.327  29.936 1.00 27.73 ? 59  PHE A CD2  1 
ATOM   420  C  CE1  . PHE A 1 55  ? 11.825  11.372  31.269 1.00 28.29 ? 59  PHE A CE1  1 
ATOM   421  C  CE2  . PHE A 1 55  ? 13.951  10.931  30.193 1.00 29.01 ? 59  PHE A CE2  1 
ATOM   422  C  CZ   . PHE A 1 55  ? 12.826  10.466  30.863 1.00 28.18 ? 59  PHE A CZ   1 
ATOM   423  N  N    . GLN A 1 56  ? 11.971  17.106  27.543 1.00 34.29 ? 60  GLN A N    1 
ATOM   424  C  CA   . GLN A 1 56  ? 12.245  18.422  27.014 1.00 35.45 ? 60  GLN A CA   1 
ATOM   425  C  C    . GLN A 1 56  ? 11.487  19.506  27.769 1.00 36.79 ? 60  GLN A C    1 
ATOM   426  O  O    . GLN A 1 56  ? 11.966  20.654  27.867 1.00 37.82 ? 60  GLN A O    1 
ATOM   427  C  CB   . GLN A 1 56  ? 11.879  18.462  25.544 1.00 35.93 ? 60  GLN A CB   1 
ATOM   428  C  CG   . GLN A 1 56  ? 12.118  19.824  24.905 1.00 38.17 ? 60  GLN A CG   1 
ATOM   429  C  CD   . GLN A 1 56  ? 11.925  19.816  23.406 1.00 37.65 ? 60  GLN A CD   1 
ATOM   430  O  OE1  . GLN A 1 56  ? 10.874  19.408  22.905 1.00 39.87 ? 60  GLN A OE1  1 
ATOM   431  N  NE2  . GLN A 1 56  ? 12.937  20.284  22.684 1.00 37.30 ? 60  GLN A NE2  1 
ATOM   432  N  N    . SER A 1 57  ? 10.311  19.158  28.298 1.00 35.92 ? 61  SER A N    1 
ATOM   433  C  CA   . SER A 1 57  ? 9.551   20.086  29.105 1.00 35.36 ? 61  SER A CA   1 
ATOM   434  C  C    . SER A 1 57  ? 8.907   19.355  30.267 1.00 35.10 ? 61  SER A C    1 
ATOM   435  O  O    . SER A 1 57  ? 9.084   18.139  30.438 1.00 34.78 ? 61  SER A O    1 
ATOM   436  C  CB   . SER A 1 57  ? 8.495   20.786  28.259 1.00 35.35 ? 61  SER A CB   1 
ATOM   437  O  OG   . SER A 1 57  ? 7.587   19.825  27.761 1.00 38.07 ? 61  SER A OG   1 
ATOM   438  N  N    . ILE A 1 58  ? 8.180   20.104  31.084 1.00 34.70 ? 62  ILE A N    1 
ATOM   439  C  CA   . ILE A 1 58  ? 7.392   19.522  32.152 1.00 34.68 ? 62  ILE A CA   1 
ATOM   440  C  C    . ILE A 1 58  ? 6.253   18.653  31.598 1.00 34.14 ? 62  ILE A C    1 
ATOM   441  O  O    . ILE A 1 58  ? 6.065   17.513  32.030 1.00 33.90 ? 62  ILE A O    1 
ATOM   442  C  CB   . ILE A 1 58  ? 6.892   20.594  33.147 1.00 34.41 ? 62  ILE A CB   1 
ATOM   443  C  CG1  . ILE A 1 58  ? 8.091   21.400  33.666 1.00 33.99 ? 62  ILE A CG1  1 
ATOM   444  C  CG2  . ILE A 1 58  ? 6.135   19.937  34.292 1.00 33.13 ? 62  ILE A CG2  1 
ATOM   445  C  CD1  . ILE A 1 58  ? 7.730   22.521  34.668 1.00 34.91 ? 62  ILE A CD1  1 
ATOM   446  N  N    . ILE A 1 59  ? 5.532   19.171  30.621 1.00 34.28 ? 63  ILE A N    1 
ATOM   447  C  CA   . ILE A 1 59  ? 4.484   18.378  29.971 1.00 35.13 ? 63  ILE A CA   1 
ATOM   448  C  C    . ILE A 1 59  ? 4.994   17.105  29.247 1.00 33.53 ? 63  ILE A C    1 
ATOM   449  O  O    . ILE A 1 59  ? 4.382   16.069  29.395 1.00 32.51 ? 63  ILE A O    1 
ATOM   450  C  CB   . ILE A 1 59  ? 3.517   19.238  29.086 1.00 35.83 ? 63  ILE A CB   1 
ATOM   451  C  CG1  . ILE A 1 59  ? 2.551   19.991  30.005 1.00 37.80 ? 63  ILE A CG1  1 
ATOM   452  C  CG2  . ILE A 1 59  ? 2.701   18.359  28.139 1.00 35.28 ? 63  ILE A CG2  1 
ATOM   453  C  CD1  . ILE A 1 59  ? 1.296   19.202  30.435 1.00 42.29 ? 63  ILE A CD1  1 
ATOM   454  N  N    . HIS A 1 60  ? 6.096   17.209  28.492 1.00 32.26 ? 64  HIS A N    1 
ATOM   455  C  CA   . HIS A 1 60  ? 6.756   16.053  27.864 1.00 31.60 ? 64  HIS A CA   1 
ATOM   456  C  C    . HIS A 1 60  ? 7.224   15.038  28.903 1.00 30.04 ? 64  HIS A C    1 
ATOM   457  O  O    . HIS A 1 60  ? 7.156   13.838  28.663 1.00 30.69 ? 64  HIS A O    1 
ATOM   458  C  CB   . HIS A 1 60  ? 8.022   16.485  27.116 1.00 31.74 ? 64  HIS A CB   1 
ATOM   459  C  CG   . HIS A 1 60  ? 7.937   16.420  25.622 1.00 33.93 ? 64  HIS A CG   1 
ATOM   460  N  ND1  . HIS A 1 60  ? 7.079   17.210  24.884 1.00 38.00 ? 64  HIS A ND1  1 
ATOM   461  C  CD2  . HIS A 1 60  ? 8.680   15.733  24.722 1.00 33.44 ? 64  HIS A CD2  1 
ATOM   462  C  CE1  . HIS A 1 60  ? 7.263   16.970  23.595 1.00 36.11 ? 64  HIS A CE1  1 
ATOM   463  N  NE2  . HIS A 1 60  ? 8.229   16.076  23.472 1.00 36.73 ? 64  HIS A NE2  1 
ATOM   464  N  N    . ALA A 1 61  ? 7.790   15.537  29.994 1.00 26.91 ? 65  ALA A N    1 
ATOM   465  C  CA   . ALA A 1 61  ? 8.297   14.699  31.068 1.00 26.51 ? 65  ALA A CA   1 
ATOM   466  C  C    . ALA A 1 61  ? 7.189   13.957  31.846 1.00 25.75 ? 65  ALA A C    1 
ATOM   467  O  O    . ALA A 1 61  ? 7.325   12.748  32.112 1.00 25.48 ? 65  ALA A O    1 
ATOM   468  C  CB   . ALA A 1 61  ? 9.247   15.516  32.037 1.00 25.20 ? 65  ALA A CB   1 
ATOM   469  N  N    . LYS A 1 62  ? 6.114   14.666  32.204 1.00 25.20 ? 66  LYS A N    1 
ATOM   470  C  CA   . LYS A 1 62  ? 4.931   14.025  32.744 1.00 25.37 ? 66  LYS A CA   1 
ATOM   471  C  C    . LYS A 1 62  ? 4.363   12.993  31.761 1.00 25.08 ? 66  LYS A C    1 
ATOM   472  O  O    . LYS A 1 62  ? 3.931   11.925  32.174 1.00 25.23 ? 66  LYS A O    1 
ATOM   473  C  CB   . LYS A 1 62  ? 3.836   15.031  33.105 1.00 25.48 ? 66  LYS A CB   1 
ATOM   474  C  CG   . LYS A 1 62  ? 2.806   14.474  34.134 1.00 26.40 ? 66  LYS A CG   1 
ATOM   475  C  CD   . LYS A 1 62  ? 1.804   15.571  34.588 1.00 27.22 ? 66  LYS A CD   1 
ATOM   476  C  CE   . LYS A 1 62  ? 0.897   15.045  35.737 1.00 26.94 ? 66  LYS A CE   1 
ATOM   477  N  NZ   . LYS A 1 62  ? 0.005   16.097  36.338 1.00 27.87 ? 66  LYS A NZ   1 
ATOM   478  N  N    . ARG A 1 63  ? 4.339   13.322  30.475 1.00 25.13 ? 67  ARG A N    1 
ATOM   479  C  CA   . ARG A 1 63  ? 3.790   12.428  29.456 1.00 26.43 ? 67  ARG A CA   1 
ATOM   480  C  C    . ARG A 1 63  ? 4.559   11.122  29.411 1.00 24.21 ? 67  ARG A C    1 
ATOM   481  O  O    . ARG A 1 63  ? 3.969   10.065  29.407 1.00 24.37 ? 67  ARG A O    1 
ATOM   482  C  CB   . ARG A 1 63  ? 3.840   13.118  28.090 1.00 26.84 ? 67  ARG A CB   1 
ATOM   483  C  CG   . ARG A 1 63  ? 3.131   12.414  26.957 1.00 30.21 ? 67  ARG A CG   1 
ATOM   484  C  CD   . ARG A 1 63  ? 3.154   13.291  25.654 1.00 31.25 ? 67  ARG A CD   1 
ATOM   485  N  NE   . ARG A 1 63  ? 2.268   14.451  25.783 1.00 41.19 ? 67  ARG A NE   1 
ATOM   486  C  CZ   . ARG A 1 63  ? 2.612   15.686  25.412 1.00 46.76 ? 67  ARG A CZ   1 
ATOM   487  N  NH1  . ARG A 1 63  ? 3.830   15.922  24.900 1.00 46.03 ? 67  ARG A NH1  1 
ATOM   488  N  NH2  . ARG A 1 63  ? 1.754   16.690  25.587 1.00 48.12 ? 67  ARG A NH2  1 
ATOM   489  N  N    . THR A 1 64  ? 5.882   11.224  29.343 1.00 23.56 ? 68  THR A N    1 
ATOM   490  C  CA   . THR A 1 64  ? 6.798   10.103  29.374 1.00 22.42 ? 68  THR A CA   1 
ATOM   491  C  C    . THR A 1 64  ? 6.584   9.168   30.608 1.00 22.40 ? 68  THR A C    1 
ATOM   492  O  O    . THR A 1 64  ? 6.462   7.937   30.465 1.00 21.63 ? 68  THR A O    1 
ATOM   493  C  CB   . THR A 1 64  ? 8.229   10.673  29.340 1.00 23.47 ? 68  THR A CB   1 
ATOM   494  O  OG1  . THR A 1 64  ? 8.393   11.409  28.129 1.00 23.92 ? 68  THR A OG1  1 
ATOM   495  C  CG2  . THR A 1 64  ? 9.309   9.578   29.436 1.00 20.98 ? 68  THR A CG2  1 
ATOM   496  N  N    . TYR A 1 65  ? 6.526   9.750   31.804 1.00 22.13 ? 69  TYR A N    1 
ATOM   497  C  CA   . TYR A 1 65  ? 6.291   8.970   33.062 1.00 22.55 ? 69  TYR A CA   1 
ATOM   498  C  C    . TYR A 1 65  ? 4.913   8.313   33.028 1.00 22.29 ? 69  TYR A C    1 
ATOM   499  O  O    . TYR A 1 65  ? 4.763   7.182   33.446 1.00 23.14 ? 69  TYR A O    1 
ATOM   500  C  CB   . TYR A 1 65  ? 6.332   9.922   34.276 1.00 23.65 ? 69  TYR A CB   1 
ATOM   501  C  CG   . TYR A 1 65  ? 6.094   9.262   35.624 1.00 24.63 ? 69  TYR A CG   1 
ATOM   502  C  CD1  . TYR A 1 65  ? 4.929   9.482   36.339 1.00 23.03 ? 69  TYR A CD1  1 
ATOM   503  C  CD2  . TYR A 1 65  ? 7.035   8.406   36.166 1.00 26.52 ? 69  TYR A CD2  1 
ATOM   504  C  CE1  . TYR A 1 65  ? 4.720   8.882   37.613 1.00 26.27 ? 69  TYR A CE1  1 
ATOM   505  C  CE2  . TYR A 1 65  ? 6.836   7.810   37.422 1.00 27.69 ? 69  TYR A CE2  1 
ATOM   506  C  CZ   . TYR A 1 65  ? 5.688   8.041   38.116 1.00 25.32 ? 69  TYR A CZ   1 
ATOM   507  O  OH   . TYR A 1 65  ? 5.542   7.415   39.342 1.00 31.76 ? 69  TYR A OH   1 
ATOM   508  N  N    . ARG A 1 66  ? 3.911   9.033   32.523 1.00 21.83 ? 70  ARG A N    1 
ATOM   509  C  CA   . ARG A 1 66  ? 2.537   8.524   32.467 1.00 22.75 ? 70  ARG A CA   1 
ATOM   510  C  C    . ARG A 1 66  ? 2.491   7.281   31.559 1.00 22.34 ? 70  ARG A C    1 
ATOM   511  O  O    . ARG A 1 66  ? 1.844   6.298   31.886 1.00 21.11 ? 70  ARG A O    1 
ATOM   512  C  CB   . ARG A 1 66  ? 1.572   9.619   31.947 1.00 22.96 ? 70  ARG A CB   1 
ATOM   513  C  CG   . ARG A 1 66  ? 0.160   9.125   31.510 1.00 25.48 ? 70  ARG A CG   1 
ATOM   514  C  CD   . ARG A 1 66  ? -0.680  10.221  30.789 1.00 23.42 ? 70  ARG A CD   1 
ATOM   515  N  NE   . ARG A 1 66  ? -0.825  11.366  31.681 1.00 23.96 ? 70  ARG A NE   1 
ATOM   516  C  CZ   . ARG A 1 66  ? -0.399  12.599  31.414 1.00 24.08 ? 70  ARG A CZ   1 
ATOM   517  N  NH1  . ARG A 1 66  ? 0.143   12.900  30.234 1.00 20.76 ? 70  ARG A NH1  1 
ATOM   518  N  NH2  . ARG A 1 66  ? -0.560  13.537  32.331 1.00 24.15 ? 70  ARG A NH2  1 
ATOM   519  N  N    . GLU A 1 67  ? 3.162   7.357   30.413 1.00 22.84 ? 71  GLU A N    1 
ATOM   520  C  CA   . GLU A 1 67  ? 3.135   6.262   29.428 1.00 24.00 ? 71  GLU A CA   1 
ATOM   521  C  C    . GLU A 1 67  ? 3.877   5.061   30.020 1.00 24.17 ? 71  GLU A C    1 
ATOM   522  O  O    . GLU A 1 67  ? 3.371   3.954   29.987 1.00 25.01 ? 71  GLU A O    1 
ATOM   523  C  CB   . GLU A 1 67  ? 3.769   6.744   28.117 1.00 25.00 ? 71  GLU A CB   1 
ATOM   524  C  CG   . GLU A 1 67  ? 4.231   5.683   27.147 1.00 25.27 ? 71  GLU A CG   1 
ATOM   525  C  CD   . GLU A 1 67  ? 3.121   5.187   26.220 1.00 26.76 ? 71  GLU A CD   1 
ATOM   526  O  OE1  . GLU A 1 67  ? 3.481   4.598   25.155 1.00 27.17 ? 71  GLU A OE1  1 
ATOM   527  O  OE2  . GLU A 1 67  ? 1.913   5.358   26.552 1.00 20.67 ? 71  GLU A OE2  1 
ATOM   528  N  N    . LEU A 1 68  ? 5.035   5.301   30.618 1.00 24.19 ? 72  LEU A N    1 
ATOM   529  C  CA   . LEU A 1 68  ? 5.792   4.217   31.251 1.00 25.59 ? 72  LEU A CA   1 
ATOM   530  C  C    . LEU A 1 68  ? 5.010   3.580   32.396 1.00 25.15 ? 72  LEU A C    1 
ATOM   531  O  O    . LEU A 1 68  ? 4.903   2.363   32.463 1.00 24.83 ? 72  LEU A O    1 
ATOM   532  C  CB   . LEU A 1 68  ? 7.170   4.659   31.746 1.00 24.74 ? 72  LEU A CB   1 
ATOM   533  C  CG   . LEU A 1 68  ? 8.361   3.705   31.635 1.00 26.55 ? 72  LEU A CG   1 
ATOM   534  C  CD1  . LEU A 1 68  ? 9.474   4.071   32.604 1.00 27.01 ? 72  LEU A CD1  1 
ATOM   535  C  CD2  . LEU A 1 68  ? 8.069   2.179   31.650 1.00 22.28 ? 72  LEU A CD2  1 
ATOM   536  N  N    . ARG A 1 69  ? 4.449   4.400   33.286 1.00 25.85 ? 73  ARG A N    1 
ATOM   537  C  CA   . ARG A 1 69  ? 3.619   3.852   34.363 1.00 25.36 ? 73  ARG A CA   1 
ATOM   538  C  C    . ARG A 1 69  ? 2.475   2.951   33.848 1.00 25.67 ? 73  ARG A C    1 
ATOM   539  O  O    . ARG A 1 69  ? 2.192   1.864   34.411 1.00 24.84 ? 73  ARG A O    1 
ATOM   540  C  CB   . ARG A 1 69  ? 3.077   4.971   35.249 1.00 24.88 ? 73  ARG A CB   1 
ATOM   541  C  CG   . ARG A 1 69  ? 4.124   5.560   36.170 1.00 25.58 ? 73  ARG A CG   1 
ATOM   542  C  CD   . ARG A 1 69  ? 4.461   4.604   37.386 1.00 27.71 ? 73  ARG A CD   1 
ATOM   543  N  NE   . ARG A 1 69  ? 3.240   4.109   37.957 1.00 28.38 ? 73  ARG A NE   1 
ATOM   544  C  CZ   . ARG A 1 69  ? 2.469   4.815   38.770 1.00 32.29 ? 73  ARG A CZ   1 
ATOM   545  N  NH1  . ARG A 1 69  ? 2.857   6.028   39.145 1.00 34.78 ? 73  ARG A NH1  1 
ATOM   546  N  NH2  . ARG A 1 69  ? 1.316   4.317   39.208 1.00 30.23 ? 73  ARG A NH2  1 
ATOM   547  N  N    . LEU A 1 70  ? 1.830   3.390   32.767 1.00 25.69 ? 74  LEU A N    1 
ATOM   548  C  CA   . LEU A 1 70  ? 0.650   2.685   32.235 1.00 25.37 ? 74  LEU A CA   1 
ATOM   549  C  C    . LEU A 1 70  ? 1.068   1.368   31.564 1.00 24.76 ? 74  LEU A C    1 
ATOM   550  O  O    . LEU A 1 70  ? 0.497   0.308   31.835 1.00 25.58 ? 74  LEU A O    1 
ATOM   551  C  CB   . LEU A 1 70  ? -0.170  3.588   31.272 1.00 25.28 ? 74  LEU A CB   1 
ATOM   552  C  CG   . LEU A 1 70  ? -1.460  2.936   30.772 1.00 27.48 ? 74  LEU A CG   1 
ATOM   553  C  CD1  . LEU A 1 70  ? -2.593  3.911   30.797 1.00 29.49 ? 74  LEU A CD1  1 
ATOM   554  C  CD2  . LEU A 1 70  ? -1.299  2.243   29.396 1.00 30.32 ? 74  LEU A CD2  1 
ATOM   555  N  N    . LEU A 1 71  ? 2.068   1.424   30.696 1.00 23.72 ? 75  LEU A N    1 
ATOM   556  C  CA   . LEU A 1 71  ? 2.537   0.233   30.009 1.00 22.79 ? 75  LEU A CA   1 
ATOM   557  C  C    . LEU A 1 71  ? 3.000   -0.876  30.982 1.00 23.78 ? 75  LEU A C    1 
ATOM   558  O  O    . LEU A 1 71  ? 2.715   -2.054  30.758 1.00 21.48 ? 75  LEU A O    1 
ATOM   559  C  CB   . LEU A 1 71  ? 3.613   0.595   28.977 1.00 22.76 ? 75  LEU A CB   1 
ATOM   560  C  CG   . LEU A 1 71  ? 3.098   1.340   27.713 1.00 20.52 ? 75  LEU A CG   1 
ATOM   561  C  CD1  . LEU A 1 71  ? 4.273   1.671   26.781 1.00 18.35 ? 75  LEU A CD1  1 
ATOM   562  C  CD2  . LEU A 1 71  ? 2.055   0.497   26.968 1.00 18.05 ? 75  LEU A CD2  1 
ATOM   563  N  N    . LYS A 1 72  ? 3.685   -0.471  32.067 1.00 24.62 ? 76  LYS A N    1 
ATOM   564  C  CA   . LYS A 1 72  ? 4.139   -1.369  33.130 1.00 25.26 ? 76  LYS A CA   1 
ATOM   565  C  C    . LYS A 1 72  ? 2.993   -1.992  33.890 1.00 25.71 ? 76  LYS A C    1 
ATOM   566  O  O    . LYS A 1 72  ? 3.173   -3.034  34.492 1.00 27.52 ? 76  LYS A O    1 
ATOM   567  C  CB   . LYS A 1 72  ? 5.067   -0.652  34.124 1.00 24.65 ? 76  LYS A CB   1 
ATOM   568  C  CG   . LYS A 1 72  ? 6.469   -0.428  33.603 1.00 26.81 ? 76  LYS A CG   1 
ATOM   569  C  CD   . LYS A 1 72  ? 7.395   0.286   34.612 1.00 28.33 ? 76  LYS A CD   1 
ATOM   570  C  CE   . LYS A 1 72  ? 7.754   -0.607  35.784 1.00 33.25 ? 76  LYS A CE   1 
ATOM   571  N  NZ   . LYS A 1 72  ? 8.598   0.192   36.760 1.00 32.31 ? 76  LYS A NZ   1 
ATOM   572  N  N    . HIS A 1 73  ? 1.820   -1.382  33.886 1.00 25.83 ? 77  HIS A N    1 
ATOM   573  C  CA   . HIS A 1 73  ? 0.715   -1.918  34.675 1.00 26.78 ? 77  HIS A CA   1 
ATOM   574  C  C    . HIS A 1 73  ? -0.110  -2.884  33.857 1.00 27.05 ? 77  HIS A C    1 
ATOM   575  O  O    . HIS A 1 73  ? -0.745  -3.773  34.415 1.00 27.98 ? 77  HIS A O    1 
ATOM   576  C  CB   . HIS A 1 73  ? -0.201  -0.806  35.166 1.00 26.81 ? 77  HIS A CB   1 
ATOM   577  C  CG   . HIS A 1 73  ? -1.196  -1.248  36.201 1.00 29.56 ? 77  HIS A CG   1 
ATOM   578  N  ND1  . HIS A 1 73  ? -0.824  -1.625  37.474 1.00 28.06 ? 77  HIS A ND1  1 
ATOM   579  C  CD2  . HIS A 1 73  ? -2.554  -1.317  36.168 1.00 28.21 ? 77  HIS A CD2  1 
ATOM   580  C  CE1  . HIS A 1 73  ? -1.907  -1.925  38.173 1.00 28.72 ? 77  HIS A CE1  1 
ATOM   581  N  NE2  . HIS A 1 73  ? -2.968  -1.745  37.404 1.00 28.46 ? 77  HIS A NE2  1 
ATOM   582  N  N    . MET A 1 74  ? -0.105  -2.688  32.537 1.00 26.74 ? 78  MET A N    1 
ATOM   583  C  CA   . MET A 1 74  ? -0.961  -3.416  31.616 1.00 25.48 ? 78  MET A CA   1 
ATOM   584  C  C    . MET A 1 74  ? -0.474  -4.834  31.428 1.00 25.98 ? 78  MET A C    1 
ATOM   585  O  O    . MET A 1 74  ? 0.592   -5.070  30.857 1.00 23.93 ? 78  MET A O    1 
ATOM   586  C  CB   . MET A 1 74  ? -1.076  -2.691  30.271 1.00 24.97 ? 78  MET A CB   1 
ATOM   587  C  CG   . MET A 1 74  ? -1.768  -1.347  30.360 1.00 22.74 ? 78  MET A CG   1 
ATOM   588  S  SD   . MET A 1 74  ? -3.449  -1.256  31.001 1.00 23.08 ? 78  MET A SD   1 
ATOM   589  C  CE   . MET A 1 74  ? -3.256  -0.849  32.764 1.00 22.64 ? 78  MET A CE   1 
ATOM   590  N  N    . LYS A 1 75  ? -1.274  -5.754  31.978 1.00 26.62 ? 79  LYS A N    1 
ATOM   591  C  CA   . LYS A 1 75  ? -0.998  -7.183  31.999 1.00 27.87 ? 79  LYS A CA   1 
ATOM   592  C  C    . LYS A 1 75  ? -2.279  -7.968  31.652 1.00 28.06 ? 79  LYS A C    1 
ATOM   593  O  O    . LYS A 1 75  ? -2.875  -8.622  32.509 1.00 28.98 ? 79  LYS A O    1 
ATOM   594  C  CB   . LYS A 1 75  ? -0.449  -7.576  33.356 1.00 27.64 ? 79  LYS A CB   1 
ATOM   595  C  CG   . LYS A 1 75  ? 1.025   -7.220  33.456 1.00 31.11 ? 79  LYS A CG   1 
ATOM   596  C  CD   . LYS A 1 75  ? 1.565   -7.132  34.883 1.00 32.93 ? 79  LYS A CD   1 
ATOM   597  C  CE   . LYS A 1 75  ? 3.023   -6.643  34.822 1.00 33.09 ? 79  LYS A CE   1 
ATOM   598  N  NZ   . LYS A 1 75  ? 3.816   -6.978  36.037 1.00 35.12 ? 79  LYS A NZ   1 
ATOM   599  N  N    . HIS A 1 76  ? -2.660  -7.909  30.378 1.00 26.97 ? 80  HIS A N    1 
ATOM   600  C  CA   . HIS A 1 76  ? -3.876  -8.527  29.902 1.00 27.52 ? 80  HIS A CA   1 
ATOM   601  C  C    . HIS A 1 76  ? -3.667  -8.922  28.465 1.00 27.95 ? 80  HIS A C    1 
ATOM   602  O  O    . HIS A 1 76  ? -2.916  -8.258  27.719 1.00 27.48 ? 80  HIS A O    1 
ATOM   603  C  CB   . HIS A 1 76  ? -5.041  -7.550  30.021 1.00 27.34 ? 80  HIS A CB   1 
ATOM   604  C  CG   . HIS A 1 76  ? -6.384  -8.125  29.672 1.00 25.71 ? 80  HIS A CG   1 
ATOM   605  N  ND1  . HIS A 1 76  ? -7.291  -8.537  30.624 1.00 27.23 ? 80  HIS A ND1  1 
ATOM   606  C  CD2  . HIS A 1 76  ? -7.012  -8.250  28.482 1.00 21.12 ? 80  HIS A CD2  1 
ATOM   607  C  CE1  . HIS A 1 76  ? -8.407  -8.930  30.032 1.00 22.44 ? 80  HIS A CE1  1 
ATOM   608  N  NE2  . HIS A 1 76  ? -8.254  -8.777  28.729 1.00 22.68 ? 80  HIS A NE2  1 
ATOM   609  N  N    . GLU A 1 77  ? -4.334  -10.012 28.077 1.00 28.25 ? 81  GLU A N    1 
ATOM   610  C  CA   . GLU A 1 77  ? -4.211  -10.604 26.741 1.00 27.85 ? 81  GLU A CA   1 
ATOM   611  C  C    . GLU A 1 77  ? -4.715  -9.682  25.676 1.00 27.44 ? 81  GLU A C    1 
ATOM   612  O  O    . GLU A 1 77  ? -4.125  -9.632  24.602 1.00 27.33 ? 81  GLU A O    1 
ATOM   613  C  CB   . GLU A 1 77  ? -4.966  -11.943 26.686 1.00 29.54 ? 81  GLU A CB   1 
ATOM   614  C  CG   . GLU A 1 77  ? -5.166  -12.500 28.112 1.00 34.90 ? 81  GLU A CG   1 
ATOM   615  C  CD   . GLU A 1 77  ? -5.157  -14.014 28.212 1.00 45.77 ? 81  GLU A CD   1 
ATOM   616  O  OE1  . GLU A 1 77  ? -4.766  -14.672 27.216 1.00 50.87 ? 81  GLU A OE1  1 
ATOM   617  O  OE2  . GLU A 1 77  ? -5.526  -14.543 29.307 1.00 47.87 ? 81  GLU A OE2  1 
ATOM   618  N  N    . ASN A 1 78  ? -5.781  -8.930  25.958 1.00 25.85 ? 82  ASN A N    1 
ATOM   619  C  CA   . ASN A 1 78  ? -6.349  -7.993  24.965 1.00 25.77 ? 82  ASN A CA   1 
ATOM   620  C  C    . ASN A 1 78  ? -5.870  -6.529  25.125 1.00 26.07 ? 82  ASN A C    1 
ATOM   621  O  O    . ASN A 1 78  ? -6.509  -5.556  24.653 1.00 26.60 ? 82  ASN A O    1 
ATOM   622  C  CB   . ASN A 1 78  ? -7.882  -8.099  24.964 1.00 25.30 ? 82  ASN A CB   1 
ATOM   623  C  CG   . ASN A 1 78  ? -8.348  -9.525  24.753 1.00 26.19 ? 82  ASN A CG   1 
ATOM   624  O  OD1  . ASN A 1 78  ? -9.017  -10.113 25.599 1.00 27.79 ? 82  ASN A OD1  1 
ATOM   625  N  ND2  . ASN A 1 78  ? -7.922  -10.111 23.643 1.00 18.62 ? 82  ASN A ND2  1 
ATOM   626  N  N    . VAL A 1 79  ? -4.732  -6.369  25.766 1.00 25.11 ? 83  VAL A N    1 
ATOM   627  C  CA   . VAL A 1 79  ? -4.187  -5.029  25.956 1.00 25.74 ? 83  VAL A CA   1 
ATOM   628  C  C    . VAL A 1 79  ? -2.677  -5.071  25.718 1.00 25.62 ? 83  VAL A C    1 
ATOM   629  O  O    . VAL A 1 79  ? -2.032  -5.976  26.219 1.00 24.98 ? 83  VAL A O    1 
ATOM   630  C  CB   . VAL A 1 79  ? -4.472  -4.475  27.383 1.00 24.65 ? 83  VAL A CB   1 
ATOM   631  C  CG1  . VAL A 1 79  ? -3.807  -3.075  27.559 1.00 25.16 ? 83  VAL A CG1  1 
ATOM   632  C  CG2  . VAL A 1 79  ? -5.989  -4.452  27.693 1.00 22.19 ? 83  VAL A CG2  1 
ATOM   633  N  N    . ILE A 1 80  ? -2.143  -4.094  24.952 1.00 26.10 ? 84  ILE A N    1 
ATOM   634  C  CA   . ILE A 1 80  ? -0.672  -3.934  24.739 1.00 25.39 ? 84  ILE A CA   1 
ATOM   635  C  C    . ILE A 1 80  ? 0.057   -4.088  26.047 1.00 25.86 ? 84  ILE A C    1 
ATOM   636  O  O    . ILE A 1 80  ? -0.436  -3.650  27.096 1.00 27.21 ? 84  ILE A O    1 
ATOM   637  C  CB   . ILE A 1 80  ? -0.249  -2.576  24.039 1.00 25.11 ? 84  ILE A CB   1 
ATOM   638  C  CG1  . ILE A 1 80  ? 1.255   -2.563  23.706 1.00 25.01 ? 84  ILE A CG1  1 
ATOM   639  C  CG2  . ILE A 1 80  ? -0.696  -1.327  24.870 1.00 25.25 ? 84  ILE A CG2  1 
ATOM   640  C  CD1  . ILE A 1 80  ? 1.708   -1.502  22.736 1.00 26.18 ? 84  ILE A CD1  1 
ATOM   641  N  N    . GLY A 1 81  ? 1.214   -4.742  25.981 1.00 26.86 ? 85  GLY A N    1 
ATOM   642  C  CA   . GLY A 1 81  ? 2.073   -4.982  27.131 1.00 27.55 ? 85  GLY A CA   1 
ATOM   643  C  C    . GLY A 1 81  ? 3.503   -4.541  26.895 1.00 27.93 ? 85  GLY A C    1 
ATOM   644  O  O    . GLY A 1 81  ? 3.945   -4.391  25.735 1.00 28.47 ? 85  GLY A O    1 
ATOM   645  N  N    . LEU A 1 82  ? 4.242   -4.357  27.998 1.00 27.88 ? 86  LEU A N    1 
ATOM   646  C  CA   . LEU A 1 82  ? 5.639   -3.940  27.920 1.00 27.51 ? 86  LEU A CA   1 
ATOM   647  C  C    . LEU A 1 82  ? 6.538   -5.168  28.028 1.00 28.02 ? 86  LEU A C    1 
ATOM   648  O  O    . LEU A 1 82  ? 6.628   -5.770  29.081 1.00 26.94 ? 86  LEU A O    1 
ATOM   649  C  CB   . LEU A 1 82  ? 6.001   -2.988  29.057 1.00 27.14 ? 86  LEU A CB   1 
ATOM   650  C  CG   . LEU A 1 82  ? 6.669   -1.620  28.892 1.00 26.39 ? 86  LEU A CG   1 
ATOM   651  C  CD1  . LEU A 1 82  ? 7.520   -1.290  30.130 1.00 24.74 ? 86  LEU A CD1  1 
ATOM   652  C  CD2  . LEU A 1 82  ? 7.396   -1.315  27.561 1.00 24.99 ? 86  LEU A CD2  1 
ATOM   653  N  N    . LEU A 1 83  ? 7.199   -5.529  26.938 1.00 28.58 ? 87  LEU A N    1 
ATOM   654  C  CA   . LEU A 1 83  ? 8.157   -6.631  26.963 1.00 29.74 ? 87  LEU A CA   1 
ATOM   655  C  C    . LEU A 1 83  ? 9.466   -6.236  27.654 1.00 29.86 ? 87  LEU A C    1 
ATOM   656  O  O    . LEU A 1 83  ? 10.048  -7.016  28.442 1.00 30.48 ? 87  LEU A O    1 
ATOM   657  C  CB   . LEU A 1 83  ? 8.455   -7.068  25.522 1.00 30.69 ? 87  LEU A CB   1 
ATOM   658  C  CG   . LEU A 1 83  ? 7.547   -8.177  24.981 1.00 31.84 ? 87  LEU A CG   1 
ATOM   659  C  CD1  . LEU A 1 83  ? 6.255   -8.340  25.784 1.00 34.66 ? 87  LEU A CD1  1 
ATOM   660  C  CD2  . LEU A 1 83  ? 7.292   -8.033  23.503 1.00 34.92 ? 87  LEU A CD2  1 
ATOM   661  N  N    . ASP A 1 84  ? 9.921   -5.012  27.377 1.00 29.54 ? 88  ASP A N    1 
ATOM   662  C  CA   . ASP A 1 84  ? 11.153  -4.493  27.984 1.00 28.81 ? 88  ASP A CA   1 
ATOM   663  C  C    . ASP A 1 84  ? 11.108  -2.959  27.987 1.00 28.80 ? 88  ASP A C    1 
ATOM   664  O  O    . ASP A 1 84  ? 10.410  -2.337  27.187 1.00 27.53 ? 88  ASP A O    1 
ATOM   665  C  CB   . ASP A 1 84  ? 12.341  -4.987  27.164 1.00 28.81 ? 88  ASP A CB   1 
ATOM   666  C  CG   . ASP A 1 84  ? 13.693  -4.805  27.849 1.00 28.07 ? 88  ASP A CG   1 
ATOM   667  O  OD1  . ASP A 1 84  ? 14.656  -4.922  27.096 1.00 26.23 ? 88  ASP A OD1  1 
ATOM   668  O  OD2  . ASP A 1 84  ? 13.820  -4.582  29.087 1.00 30.76 ? 88  ASP A OD2  1 
ATOM   669  N  N    . VAL A 1 85  ? 11.841  -2.360  28.906 1.00 28.87 ? 89  VAL A N    1 
ATOM   670  C  CA   . VAL A 1 85  ? 12.121  -0.930  28.848 1.00 29.63 ? 89  VAL A CA   1 
ATOM   671  C  C    . VAL A 1 85  ? 13.612  -0.716  29.163 1.00 30.17 ? 89  VAL A C    1 
ATOM   672  O  O    . VAL A 1 85  ? 14.105  -1.191  30.210 1.00 30.07 ? 89  VAL A O    1 
ATOM   673  C  CB   . VAL A 1 85  ? 11.207  -0.111  29.795 1.00 29.41 ? 89  VAL A CB   1 
ATOM   674  C  CG1  . VAL A 1 85  ? 11.354  -0.584  31.262 1.00 28.85 ? 89  VAL A CG1  1 
ATOM   675  C  CG2  . VAL A 1 85  ? 11.516  1.364   29.666 1.00 30.00 ? 89  VAL A CG2  1 
ATOM   676  N  N    . PHE A 1 86  ? 14.320  -0.044  28.247 1.00 29.97 ? 90  PHE A N    1 
ATOM   677  C  CA   . PHE A 1 86  ? 15.749  0.220   28.420 1.00 30.28 ? 90  PHE A CA   1 
ATOM   678  C  C    . PHE A 1 86  ? 16.178  1.676   28.122 1.00 30.77 ? 90  PHE A C    1 
ATOM   679  O  O    . PHE A 1 86  ? 15.523  2.380   27.374 1.00 29.47 ? 90  PHE A O    1 
ATOM   680  C  CB   . PHE A 1 86  ? 16.623  -0.785  27.637 1.00 28.97 ? 90  PHE A CB   1 
ATOM   681  C  CG   . PHE A 1 86  ? 16.478  -0.702  26.125 1.00 28.30 ? 90  PHE A CG   1 
ATOM   682  C  CD1  . PHE A 1 86  ? 17.206  0.221   25.386 1.00 24.74 ? 90  PHE A CD1  1 
ATOM   683  C  CD2  . PHE A 1 86  ? 15.643  -1.580  25.449 1.00 27.07 ? 90  PHE A CD2  1 
ATOM   684  C  CE1  . PHE A 1 86  ? 17.078  0.283   24.006 1.00 25.43 ? 90  PHE A CE1  1 
ATOM   685  C  CE2  . PHE A 1 86  ? 15.495  -1.514  24.056 1.00 26.74 ? 90  PHE A CE2  1 
ATOM   686  C  CZ   . PHE A 1 86  ? 16.208  -0.593  23.341 1.00 28.02 ? 90  PHE A CZ   1 
ATOM   687  N  N    . THR A 1 87  ? 17.290  2.087   28.750 1.00 33.02 ? 91  THR A N    1 
ATOM   688  C  CA   . THR A 1 87  ? 18.053  3.313   28.408 1.00 33.78 ? 91  THR A CA   1 
ATOM   689  C  C    . THR A 1 87  ? 19.537  2.948   28.241 1.00 35.00 ? 91  THR A C    1 
ATOM   690  O  O    . THR A 1 87  ? 20.052  2.094   28.975 1.00 33.88 ? 91  THR A O    1 
ATOM   691  C  CB   . THR A 1 87  ? 17.905  4.444   29.489 1.00 34.24 ? 91  THR A CB   1 
ATOM   692  O  OG1  . THR A 1 87  ? 18.816  5.517   29.210 1.00 34.02 ? 91  THR A OG1  1 
ATOM   693  C  CG2  . THR A 1 87  ? 18.183  3.928   30.925 1.00 33.78 ? 91  THR A CG2  1 
ATOM   694  N  N    . PRO A 1 88  ? 20.239  3.594   27.288 1.00 35.96 ? 92  PRO A N    1 
ATOM   695  C  CA   . PRO A 1 88  ? 21.718  3.434   27.338 1.00 37.44 ? 92  PRO A CA   1 
ATOM   696  C  C    . PRO A 1 88  ? 22.378  4.024   28.607 1.00 38.57 ? 92  PRO A C    1 
ATOM   697  O  O    . PRO A 1 88  ? 23.524  3.728   28.896 1.00 39.30 ? 92  PRO A O    1 
ATOM   698  C  CB   . PRO A 1 88  ? 22.224  4.184   26.093 1.00 36.98 ? 92  PRO A CB   1 
ATOM   699  C  CG   . PRO A 1 88  ? 21.042  4.842   25.454 1.00 37.02 ? 92  PRO A CG   1 
ATOM   700  C  CD   . PRO A 1 88  ? 19.771  4.452   26.185 1.00 35.99 ? 92  PRO A CD   1 
ATOM   701  N  N    . ALA A 1 89  ? 21.668  4.859   29.358 1.00 40.23 ? 93  ALA A N    1 
ATOM   702  C  CA   . ALA A 1 89  ? 22.292  5.630   30.439 1.00 41.42 ? 93  ALA A CA   1 
ATOM   703  C  C    . ALA A 1 89  ? 22.717  4.754   31.596 1.00 43.23 ? 93  ALA A C    1 
ATOM   704  O  O    . ALA A 1 89  ? 22.066  3.749   31.910 1.00 43.38 ? 93  ALA A O    1 
ATOM   705  C  CB   . ALA A 1 89  ? 21.370  6.713   30.910 1.00 40.78 ? 93  ALA A CB   1 
ATOM   706  N  N    . ARG A 1 90  ? 23.823  5.131   32.231 1.00 45.01 ? 94  ARG A N    1 
ATOM   707  C  CA   . ARG A 1 90  ? 24.400  4.331   33.309 1.00 45.66 ? 94  ARG A CA   1 
ATOM   708  C  C    . ARG A 1 90  ? 24.007  4.940   34.647 1.00 45.70 ? 94  ARG A C    1 
ATOM   709  O  O    . ARG A 1 90  ? 23.885  4.241   35.662 1.00 45.65 ? 94  ARG A O    1 
ATOM   710  C  CB   . ARG A 1 90  ? 25.920  4.246   33.150 1.00 46.19 ? 94  ARG A CB   1 
ATOM   711  C  CG   . ARG A 1 90  ? 26.539  2.858   33.407 1.00 49.01 ? 94  ARG A CG   1 
ATOM   712  C  CD   . ARG A 1 90  ? 26.499  2.417   34.903 1.00 54.27 ? 94  ARG A CD   1 
ATOM   713  N  NE   . ARG A 1 90  ? 26.791  3.512   35.855 1.00 58.17 ? 94  ARG A NE   1 
ATOM   714  C  CZ   . ARG A 1 90  ? 27.970  3.742   36.441 1.00 58.30 ? 94  ARG A CZ   1 
ATOM   715  N  NH1  . ARG A 1 90  ? 29.013  2.948   36.198 1.00 58.40 ? 94  ARG A NH1  1 
ATOM   716  N  NH2  . ARG A 1 90  ? 28.099  4.772   37.279 1.00 56.20 ? 94  ARG A NH2  1 
ATOM   717  N  N    . SER A 1 91  ? 23.766  6.243   34.633 1.00 45.23 ? 95  SER A N    1 
ATOM   718  C  CA   . SER A 1 91  ? 23.448  6.985   35.837 1.00 45.24 ? 95  SER A CA   1 
ATOM   719  C  C    . SER A 1 91  ? 22.228  7.874   35.580 1.00 45.12 ? 95  SER A C    1 
ATOM   720  O  O    . SER A 1 91  ? 21.926  8.190   34.426 1.00 45.10 ? 95  SER A O    1 
ATOM   721  C  CB   . SER A 1 91  ? 24.667  7.835   36.222 1.00 45.64 ? 95  SER A CB   1 
ATOM   722  O  OG   . SER A 1 91  ? 25.104  8.629   35.113 1.00 45.18 ? 95  SER A OG   1 
ATOM   723  N  N    . LEU A 1 92  ? 21.530  8.282   36.636 1.00 44.98 ? 96  LEU A N    1 
ATOM   724  C  CA   . LEU A 1 92  ? 20.472  9.280   36.511 1.00 45.59 ? 96  LEU A CA   1 
ATOM   725  C  C    . LEU A 1 92  ? 21.002  10.456  35.691 1.00 46.62 ? 96  LEU A C    1 
ATOM   726  O  O    . LEU A 1 92  ? 20.296  11.054  34.869 1.00 46.42 ? 96  LEU A O    1 
ATOM   727  C  CB   . LEU A 1 92  ? 20.084  9.799   37.889 1.00 45.21 ? 96  LEU A CB   1 
ATOM   728  C  CG   . LEU A 1 92  ? 18.667  10.326  38.205 1.00 46.17 ? 96  LEU A CG   1 
ATOM   729  C  CD1  . LEU A 1 92  ? 18.744  11.531  39.161 1.00 41.27 ? 96  LEU A CD1  1 
ATOM   730  C  CD2  . LEU A 1 92  ? 17.783  10.648  36.968 1.00 45.38 ? 96  LEU A CD2  1 
ATOM   731  N  N    . GLU A 1 93  ? 22.280  10.747  35.929 1.00 47.61 ? 97  GLU A N    1 
ATOM   732  C  CA   . GLU A 1 93  ? 22.968  11.912  35.432 1.00 48.32 ? 97  GLU A CA   1 
ATOM   733  C  C    . GLU A 1 93  ? 23.098  11.884  33.930 1.00 48.10 ? 97  GLU A C    1 
ATOM   734  O  O    . GLU A 1 93  ? 22.843  12.894  33.305 1.00 48.95 ? 97  GLU A O    1 
ATOM   735  C  CB   . GLU A 1 93  ? 24.322  12.050  36.129 1.00 49.01 ? 97  GLU A CB   1 
ATOM   736  C  CG   . GLU A 1 93  ? 24.207  12.468  37.651 1.00 51.80 ? 97  GLU A CG   1 
ATOM   737  C  CD   . GLU A 1 93  ? 23.518  11.421  38.576 1.00 54.81 ? 97  GLU A CD   1 
ATOM   738  O  OE1  . GLU A 1 93  ? 22.885  11.845  39.584 1.00 56.84 ? 97  GLU A OE1  1 
ATOM   739  O  OE2  . GLU A 1 93  ? 23.602  10.192  38.309 1.00 53.77 ? 97  GLU A OE2  1 
ATOM   740  N  N    . GLU A 1 94  ? 23.445  10.738  33.344 1.00 47.28 ? 98  GLU A N    1 
ATOM   741  C  CA   . GLU A 1 94  ? 23.451  10.631  31.879 1.00 47.49 ? 98  GLU A CA   1 
ATOM   742  C  C    . GLU A 1 94  ? 22.091  10.202  31.234 1.00 45.95 ? 98  GLU A C    1 
ATOM   743  O  O    . GLU A 1 94  ? 22.026  10.005  30.017 1.00 45.69 ? 98  GLU A O    1 
ATOM   744  C  CB   . GLU A 1 94  ? 24.658  9.810   31.353 1.00 47.19 ? 98  GLU A CB   1 
ATOM   745  C  CG   . GLU A 1 94  ? 24.583  8.309   31.592 1.00 49.26 ? 98  GLU A CG   1 
ATOM   746  C  CD   . GLU A 1 94  ? 25.615  7.508   30.799 1.00 50.58 ? 98  GLU A CD   1 
ATOM   747  O  OE1  . GLU A 1 94  ? 25.666  7.614   29.539 1.00 52.32 ? 98  GLU A OE1  1 
ATOM   748  O  OE2  . GLU A 1 94  ? 26.370  6.734   31.447 1.00 56.12 ? 98  GLU A OE2  1 
ATOM   749  N  N    . PHE A 1 95  ? 21.023  10.111  32.043 1.00 44.40 ? 99  PHE A N    1 
ATOM   750  C  CA   . PHE A 1 95  ? 19.698  9.617   31.594 1.00 42.87 ? 99  PHE A CA   1 
ATOM   751  C  C    . PHE A 1 95  ? 18.966  10.604  30.694 1.00 42.86 ? 99  PHE A C    1 
ATOM   752  O  O    . PHE A 1 95  ? 18.491  11.642  31.148 1.00 41.93 ? 99  PHE A O    1 
ATOM   753  C  CB   . PHE A 1 95  ? 18.843  9.224   32.802 1.00 42.46 ? 99  PHE A CB   1 
ATOM   754  C  CG   . PHE A 1 95  ? 17.455  8.681   32.471 1.00 41.72 ? 99  PHE A CG   1 
ATOM   755  C  CD1  . PHE A 1 95  ? 17.274  7.634   31.564 1.00 38.63 ? 99  PHE A CD1  1 
ATOM   756  C  CD2  . PHE A 1 95  ? 16.342  9.177   33.146 1.00 39.55 ? 99  PHE A CD2  1 
ATOM   757  C  CE1  . PHE A 1 95  ? 16.000  7.132   31.306 1.00 38.67 ? 99  PHE A CE1  1 
ATOM   758  C  CE2  . PHE A 1 95  ? 15.065  8.671   32.894 1.00 40.21 ? 99  PHE A CE2  1 
ATOM   759  C  CZ   . PHE A 1 95  ? 14.894  7.645   31.976 1.00 37.31 ? 99  PHE A CZ   1 
ATOM   760  N  N    . ASN A 1 96  ? 18.877  10.257  29.411 1.00 42.83 ? 100 ASN A N    1 
ATOM   761  C  CA   . ASN A 1 96  ? 18.209  11.109  28.425 1.00 43.59 ? 100 ASN A CA   1 
ATOM   762  C  C    . ASN A 1 96  ? 17.244  10.354  27.478 1.00 42.90 ? 100 ASN A C    1 
ATOM   763  O  O    . ASN A 1 96  ? 16.292  10.925  26.967 1.00 42.77 ? 100 ASN A O    1 
ATOM   764  C  CB   . ASN A 1 96  ? 19.277  11.805  27.592 1.00 44.03 ? 100 ASN A CB   1 
ATOM   765  C  CG   . ASN A 1 96  ? 19.174  13.299  27.658 1.00 47.86 ? 100 ASN A CG   1 
ATOM   766  O  OD1  . ASN A 1 96  ? 18.331  13.907  26.987 1.00 51.73 ? 100 ASN A OD1  1 
ATOM   767  N  ND2  . ASN A 1 96  ? 20.052  13.915  28.457 1.00 48.49 ? 100 ASN A ND2  1 
ATOM   768  N  N    . ASP A 1 97  ? 17.517  9.087   27.195 1.00 42.09 ? 101 ASP A N    1 
ATOM   769  C  CA   . ASP A 1 97  ? 16.628  8.344   26.293 1.00 41.67 ? 101 ASP A CA   1 
ATOM   770  C  C    . ASP A 1 97  ? 15.945  7.164   26.944 1.00 39.48 ? 101 ASP A C    1 
ATOM   771  O  O    . ASP A 1 97  ? 16.494  6.531   27.811 1.00 39.91 ? 101 ASP A O    1 
ATOM   772  C  CB   . ASP A 1 97  ? 17.344  7.901   25.024 1.00 42.57 ? 101 ASP A CB   1 
ATOM   773  C  CG   . ASP A 1 97  ? 18.038  9.038   24.348 1.00 45.53 ? 101 ASP A CG   1 
ATOM   774  O  OD1  . ASP A 1 97  ? 17.358  9.845   23.666 1.00 47.91 ? 101 ASP A OD1  1 
ATOM   775  O  OD2  . ASP A 1 97  ? 19.268  9.136   24.545 1.00 49.83 ? 101 ASP A OD2  1 
ATOM   776  N  N    . VAL A 1 98  ? 14.731  6.897   26.493 1.00 37.52 ? 102 VAL A N    1 
ATOM   777  C  CA   . VAL A 1 98  ? 13.894  5.820   27.008 1.00 35.14 ? 102 VAL A CA   1 
ATOM   778  C  C    . VAL A 1 98  ? 13.404  5.052   25.785 1.00 33.78 ? 102 VAL A C    1 
ATOM   779  O  O    . VAL A 1 98  ? 12.862  5.638   24.860 1.00 32.98 ? 102 VAL A O    1 
ATOM   780  C  CB   . VAL A 1 98  ? 12.667  6.378   27.761 1.00 34.90 ? 102 VAL A CB   1 
ATOM   781  C  CG1  . VAL A 1 98  ? 11.635  5.252   28.095 1.00 32.90 ? 102 VAL A CG1  1 
ATOM   782  C  CG2  . VAL A 1 98  ? 13.093  7.143   29.001 1.00 32.76 ? 102 VAL A CG2  1 
ATOM   783  N  N    . TYR A 1 99  ? 13.642  3.751   25.771 1.00 32.61 ? 103 TYR A N    1 
ATOM   784  C  CA   . TYR A 1 99  ? 13.129  2.888   24.702 1.00 31.66 ? 103 TYR A CA   1 
ATOM   785  C  C    . TYR A 1 99  ? 12.144  1.889   25.249 1.00 30.27 ? 103 TYR A C    1 
ATOM   786  O  O    . TYR A 1 99  ? 12.393  1.269   26.287 1.00 29.90 ? 103 TYR A O    1 
ATOM   787  C  CB   . TYR A 1 99  ? 14.240  2.110   24.040 1.00 32.30 ? 103 TYR A CB   1 
ATOM   788  C  CG   . TYR A 1 99  ? 15.352  2.909   23.411 1.00 33.65 ? 103 TYR A CG   1 
ATOM   789  C  CD1  . TYR A 1 99  ? 16.368  3.451   24.195 1.00 33.82 ? 103 TYR A CD1  1 
ATOM   790  C  CD2  . TYR A 1 99  ? 15.439  3.048   22.024 1.00 34.02 ? 103 TYR A CD2  1 
ATOM   791  C  CE1  . TYR A 1 99  ? 17.418  4.136   23.623 1.00 35.13 ? 103 TYR A CE1  1 
ATOM   792  C  CE2  . TYR A 1 99  ? 16.499  3.731   21.438 1.00 32.63 ? 103 TYR A CE2  1 
ATOM   793  C  CZ   . TYR A 1 99  ? 17.475  4.282   22.246 1.00 34.10 ? 103 TYR A CZ   1 
ATOM   794  O  OH   . TYR A 1 99  ? 18.534  4.970   21.697 1.00 34.02 ? 103 TYR A OH   1 
ATOM   795  N  N    . LEU A 1 100 ? 11.036  1.733   24.531 1.00 29.53 ? 104 LEU A N    1 
ATOM   796  C  CA   . LEU A 1 100 ? 9.932   0.842   24.917 1.00 29.41 ? 104 LEU A CA   1 
ATOM   797  C  C    . LEU A 1 100 ? 9.915   -0.380  24.005 1.00 29.61 ? 104 LEU A C    1 
ATOM   798  O  O    . LEU A 1 100 ? 9.920   -0.225  22.792 1.00 29.59 ? 104 LEU A O    1 
ATOM   799  C  CB   . LEU A 1 100 ? 8.573   1.575   24.798 1.00 28.25 ? 104 LEU A CB   1 
ATOM   800  C  CG   . LEU A 1 100 ? 8.439   2.856   25.626 1.00 27.76 ? 104 LEU A CG   1 
ATOM   801  C  CD1  . LEU A 1 100 ? 7.079   3.542   25.354 1.00 25.99 ? 104 LEU A CD1  1 
ATOM   802  C  CD2  . LEU A 1 100 ? 8.618   2.535   27.110 1.00 21.22 ? 104 LEU A CD2  1 
ATOM   803  N  N    . VAL A 1 101 ? 9.899   -1.576  24.586 1.00 30.51 ? 105 VAL A N    1 
ATOM   804  C  CA   . VAL A 1 101 ? 9.842   -2.820  23.796 1.00 31.95 ? 105 VAL A CA   1 
ATOM   805  C  C    . VAL A 1 101 ? 8.469   -3.475  23.983 1.00 33.18 ? 105 VAL A C    1 
ATOM   806  O  O    . VAL A 1 101 ? 8.056   -3.847  25.092 1.00 32.44 ? 105 VAL A O    1 
ATOM   807  C  CB   . VAL A 1 101 ? 11.031  -3.784  24.052 1.00 32.18 ? 105 VAL A CB   1 
ATOM   808  C  CG1  . VAL A 1 101 ? 11.011  -4.939  23.046 1.00 31.66 ? 105 VAL A CG1  1 
ATOM   809  C  CG2  . VAL A 1 101 ? 12.379  -3.015  23.928 1.00 31.15 ? 105 VAL A CG2  1 
ATOM   810  N  N    . THR A 1 102 ? 7.772   -3.530  22.865 1.00 34.38 ? 106 THR A N    1 
ATOM   811  C  CA   . THR A 1 102 ? 6.393   -3.929  22.772 1.00 38.11 ? 106 THR A CA   1 
ATOM   812  C  C    . THR A 1 102 ? 6.361   -5.072  21.725 1.00 39.70 ? 106 THR A C    1 
ATOM   813  O  O    . THR A 1 102 ? 7.324   -5.239  20.966 1.00 40.19 ? 106 THR A O    1 
ATOM   814  C  CB   . THR A 1 102 ? 5.600   -2.683  22.302 1.00 38.17 ? 106 THR A CB   1 
ATOM   815  O  OG1  . THR A 1 102 ? 4.969   -2.034  23.424 1.00 39.56 ? 106 THR A OG1  1 
ATOM   816  C  CG2  . THR A 1 102 ? 4.611   -3.011  21.253 1.00 37.97 ? 106 THR A CG2  1 
ATOM   817  N  N    . HIS A 1 103 ? 5.294   -5.875  21.694 1.00 41.68 ? 107 HIS A N    1 
ATOM   818  C  CA   . HIS A 1 103 ? 5.132   -6.839  20.594 1.00 42.61 ? 107 HIS A CA   1 
ATOM   819  C  C    . HIS A 1 103 ? 4.865   -6.035  19.338 1.00 42.46 ? 107 HIS A C    1 
ATOM   820  O  O    . HIS A 1 103 ? 4.320   -4.934  19.408 1.00 42.47 ? 107 HIS A O    1 
ATOM   821  C  CB   . HIS A 1 103 ? 3.966   -7.805  20.846 1.00 43.53 ? 107 HIS A CB   1 
ATOM   822  C  CG   . HIS A 1 103 ? 4.364   -9.115  21.473 1.00 46.04 ? 107 HIS A CG   1 
ATOM   823  N  ND1  . HIS A 1 103 ? 5.254   -9.993  20.883 1.00 48.61 ? 107 HIS A ND1  1 
ATOM   824  C  CD2  . HIS A 1 103 ? 3.944   -9.721  22.613 1.00 46.74 ? 107 HIS A CD2  1 
ATOM   825  C  CE1  . HIS A 1 103 ? 5.392   -11.062 21.652 1.00 46.44 ? 107 HIS A CE1  1 
ATOM   826  N  NE2  . HIS A 1 103 ? 4.608   -10.921 22.706 1.00 45.60 ? 107 HIS A NE2  1 
ATOM   827  N  N    . LEU A 1 104 ? 5.248   -6.572  18.190 1.00 42.50 ? 108 LEU A N    1 
ATOM   828  C  CA   . LEU A 1 104 ? 5.037   -5.874  16.939 1.00 43.19 ? 108 LEU A CA   1 
ATOM   829  C  C    . LEU A 1 104 ? 3.560   -6.003  16.450 1.00 43.70 ? 108 LEU A C    1 
ATOM   830  O  O    . LEU A 1 104 ? 3.037   -7.129  16.366 1.00 43.94 ? 108 LEU A O    1 
ATOM   831  C  CB   . LEU A 1 104 ? 6.056   -6.376  15.916 1.00 43.21 ? 108 LEU A CB   1 
ATOM   832  C  CG   . LEU A 1 104 ? 6.176   -5.676  14.561 1.00 44.51 ? 108 LEU A CG   1 
ATOM   833  C  CD1  . LEU A 1 104 ? 6.638   -4.228  14.663 1.00 43.57 ? 108 LEU A CD1  1 
ATOM   834  C  CD2  . LEU A 1 104 ? 7.106   -6.465  13.712 1.00 44.00 ? 108 LEU A CD2  1 
ATOM   835  N  N    . MET A 1 105 ? 2.893   -4.854  16.219 1.00 43.58 ? 109 MET A N    1 
ATOM   836  C  CA   . MET A 1 105 ? 1.578   -4.786  15.550 1.00 43.50 ? 109 MET A CA   1 
ATOM   837  C  C    . MET A 1 105 ? 1.828   -4.839  14.051 1.00 42.49 ? 109 MET A C    1 
ATOM   838  O  O    . MET A 1 105 ? 2.518   -3.998  13.515 1.00 42.60 ? 109 MET A O    1 
ATOM   839  C  CB   . MET A 1 105 ? 0.770   -3.487  15.882 1.00 43.44 ? 109 MET A CB   1 
ATOM   840  C  CG   . MET A 1 105 ? -0.429  -3.188  14.862 1.00 43.83 ? 109 MET A CG   1 
ATOM   841  S  SD   . MET A 1 105 ? -1.534  -1.676  14.815 1.00 45.32 ? 109 MET A SD   1 
ATOM   842  C  CE   . MET A 1 105 ? -0.542  -0.537  13.837 1.00 45.08 ? 109 MET A CE   1 
ATOM   843  N  N    . GLY A 1 106 ? 1.267   -5.826  13.366 1.00 42.11 ? 110 GLY A N    1 
ATOM   844  C  CA   . GLY A 1 106 ? 1.283   -5.806  11.912 1.00 40.92 ? 110 GLY A CA   1 
ATOM   845  C  C    . GLY A 1 106 ? 0.106   -4.969  11.461 1.00 40.30 ? 110 GLY A C    1 
ATOM   846  O  O    . GLY A 1 106 ? 0.251   -3.784  11.175 1.00 41.29 ? 110 GLY A O    1 
ATOM   847  N  N    . ALA A 1 107 ? -1.068  -5.595  11.414 1.00 38.83 ? 111 ALA A N    1 
ATOM   848  C  CA   . ALA A 1 107 ? -2.267  -4.958  10.948 1.00 37.78 ? 111 ALA A CA   1 
ATOM   849  C  C    . ALA A 1 107 ? -3.085  -4.398  12.112 1.00 37.13 ? 111 ALA A C    1 
ATOM   850  O  O    . ALA A 1 107 ? -3.165  -5.004  13.184 1.00 36.86 ? 111 ALA A O    1 
ATOM   851  C  CB   . ALA A 1 107 ? -3.095  -5.953  10.156 1.00 37.58 ? 111 ALA A CB   1 
ATOM   852  N  N    . ASP A 1 108 ? -3.709  -3.257  11.881 1.00 36.23 ? 112 ASP A N    1 
ATOM   853  C  CA   . ASP A 1 108 ? -4.746  -2.789  12.781 1.00 36.60 ? 112 ASP A CA   1 
ATOM   854  C  C    . ASP A 1 108 ? -6.108  -3.292  12.303 1.00 37.43 ? 112 ASP A C    1 
ATOM   855  O  O    . ASP A 1 108 ? -6.222  -3.945  11.246 1.00 37.48 ? 112 ASP A O    1 
ATOM   856  C  CB   . ASP A 1 108 ? -4.704  -1.252  12.952 1.00 35.51 ? 112 ASP A CB   1 
ATOM   857  C  CG   . ASP A 1 108 ? -4.982  -0.477  11.648 1.00 35.32 ? 112 ASP A CG   1 
ATOM   858  O  OD1  . ASP A 1 108 ? -4.423  0.624   11.478 1.00 34.50 ? 112 ASP A OD1  1 
ATOM   859  O  OD2  . ASP A 1 108 ? -5.777  -0.920  10.807 1.00 33.73 ? 112 ASP A OD2  1 
ATOM   860  N  N    . LEU A 1 109 ? -7.146  -2.973  13.062 1.00 38.01 ? 113 LEU A N    1 
ATOM   861  C  CA   . LEU A 1 109 ? -8.502  -3.316  12.674 1.00 38.72 ? 113 LEU A CA   1 
ATOM   862  C  C    . LEU A 1 109 ? -8.942  -2.886  11.247 1.00 40.09 ? 113 LEU A C    1 
ATOM   863  O  O    . LEU A 1 109 ? -9.662  -3.642  10.577 1.00 39.62 ? 113 LEU A O    1 
ATOM   864  C  CB   . LEU A 1 109 ? -9.478  -2.762  13.692 1.00 38.57 ? 113 LEU A CB   1 
ATOM   865  C  CG   . LEU A 1 109 ? -10.736 -3.562  13.998 1.00 38.02 ? 113 LEU A CG   1 
ATOM   866  C  CD1  . LEU A 1 109 ? -11.897 -2.592  14.174 1.00 34.53 ? 113 LEU A CD1  1 
ATOM   867  C  CD2  . LEU A 1 109 ? -11.051 -4.644  12.961 1.00 35.04 ? 113 LEU A CD2  1 
ATOM   868  N  N    . ASN A 1 110 ? -8.539  -1.693  10.808 1.00 41.68 ? 114 ASN A N    1 
ATOM   869  C  CA   . ASN A 1 110 ? -8.869  -1.207  9.460  1.00 44.07 ? 114 ASN A CA   1 
ATOM   870  C  C    . ASN A 1 110 ? -8.191  -1.988  8.345  1.00 45.22 ? 114 ASN A C    1 
ATOM   871  O  O    . ASN A 1 110 ? -8.823  -2.326  7.360  1.00 44.82 ? 114 ASN A O    1 
ATOM   872  C  CB   . ASN A 1 110 ? -8.527  0.275   9.319  1.00 45.11 ? 114 ASN A CB   1 
ATOM   873  C  CG   . ASN A 1 110 ? -9.717  1.177   9.600  1.00 47.12 ? 114 ASN A CG   1 
ATOM   874  O  OD1  . ASN A 1 110 ? -9.561  2.385   9.776  1.00 50.25 ? 114 ASN A OD1  1 
ATOM   875  N  ND2  . ASN A 1 110 ? -10.916 0.589   9.651  1.00 49.04 ? 114 ASN A ND2  1 
ATOM   876  N  N    . ASN A 1 111 ? -6.900  -2.261  8.525  1.00 47.02 ? 115 ASN A N    1 
ATOM   877  C  CA   . ASN A 1 111 ? -6.122  -3.127  7.653  1.00 49.30 ? 115 ASN A CA   1 
ATOM   878  C  C    . ASN A 1 111 ? -6.732  -4.515  7.545  1.00 50.50 ? 115 ASN A C    1 
ATOM   879  O  O    . ASN A 1 111 ? -6.612  -5.150  6.515  1.00 50.91 ? 115 ASN A O    1 
ATOM   880  C  CB   . ASN A 1 111 ? -4.680  -3.265  8.166  1.00 49.65 ? 115 ASN A CB   1 
ATOM   881  C  CG   . ASN A 1 111 ? -3.990  -1.921  8.400  1.00 51.51 ? 115 ASN A CG   1 
ATOM   882  O  OD1  . ASN A 1 111 ? -3.149  -1.804  9.294  1.00 53.13 ? 115 ASN A OD1  1 
ATOM   883  N  ND2  . ASN A 1 111 ? -4.350  -0.899  7.607  1.00 53.10 ? 115 ASN A ND2  1 
ATOM   884  N  N    . ILE A 1 112 ? -7.384  -4.969  8.616  1.00 51.80 ? 116 ILE A N    1 
ATOM   885  C  CA   . ILE A 1 112 ? -8.027  -6.282  8.683  1.00 53.18 ? 116 ILE A CA   1 
ATOM   886  C  C    . ILE A 1 112 ? -9.325  -6.354  7.873  1.00 54.49 ? 116 ILE A C    1 
ATOM   887  O  O    . ILE A 1 112 ? -9.557  -7.336  7.164  1.00 54.59 ? 116 ILE A O    1 
ATOM   888  C  CB   . ILE A 1 112 ? -8.228  -6.733  10.163 1.00 53.19 ? 116 ILE A CB   1 
ATOM   889  C  CG1  . ILE A 1 112 ? -6.933  -7.352  10.703 1.00 52.57 ? 116 ILE A CG1  1 
ATOM   890  C  CG2  . ILE A 1 112 ? -9.419  -7.667  10.323 1.00 53.87 ? 116 ILE A CG2  1 
ATOM   891  C  CD1  . ILE A 1 112 ? -6.510  -8.660  10.075 1.00 50.46 ? 116 ILE A CD1  1 
ATOM   892  N  N    . VAL A 1 113 ? -10.154 -5.317  7.980  1.00 55.67 ? 117 VAL A N    1 
ATOM   893  C  CA   . VAL A 1 113 ? -11.302 -5.151  7.101  1.00 57.18 ? 117 VAL A CA   1 
ATOM   894  C  C    . VAL A 1 113 ? -10.870 -4.958  5.632  1.00 58.12 ? 117 VAL A C    1 
ATOM   895  O  O    . VAL A 1 113 ? -11.324 -5.683  4.740  1.00 58.13 ? 117 VAL A O    1 
ATOM   896  C  CB   . VAL A 1 113 ? -12.170 -3.927  7.512  1.00 57.31 ? 117 VAL A CB   1 
ATOM   897  C  CG1  . VAL A 1 113 ? -13.188 -3.633  6.431  1.00 56.95 ? 117 VAL A CG1  1 
ATOM   898  C  CG2  . VAL A 1 113 ? -12.854 -4.163  8.862  1.00 57.21 ? 117 VAL A CG2  1 
ATOM   899  N  N    . LYS A 1 114 ? -10.003 -3.975  5.391  1.00 58.95 ? 118 LYS A N    1 
ATOM   900  C  CA   . LYS A 1 114 ? -9.604  -3.611  4.033  1.00 59.89 ? 118 LYS A CA   1 
ATOM   901  C  C    . LYS A 1 114 ? -8.767  -4.721  3.381  1.00 60.07 ? 118 LYS A C    1 
ATOM   902  O  O    . LYS A 1 114 ? -8.177  -4.534  2.314  1.00 60.02 ? 118 LYS A O    1 
ATOM   903  C  CB   . LYS A 1 114 ? -8.890  -2.245  4.000  1.00 60.08 ? 118 LYS A CB   1 
ATOM   904  C  CG   . LYS A 1 114 ? -9.589  -1.090  4.772  1.00 61.27 ? 118 LYS A CG   1 
ATOM   905  C  CD   . LYS A 1 114 ? -11.116 -1.014  4.580  1.00 63.19 ? 118 LYS A CD   1 
ATOM   906  C  CE   . LYS A 1 114 ? -11.507 -0.642  3.156  1.00 64.08 ? 118 LYS A CE   1 
ATOM   907  N  NZ   . LYS A 1 114 ? -12.517 0.458   3.140  1.00 65.67 ? 118 LYS A NZ   1 
ATOM   908  N  N    . CYS A 1 115 ? -8.727  -5.869  4.054  1.00 60.50 ? 119 CYS A N    1 
ATOM   909  C  CA   . CYS A 1 115 ? -8.301  -7.125  3.461  1.00 60.84 ? 119 CYS A CA   1 
ATOM   910  C  C    . CYS A 1 115 ? -9.556  -7.875  3.017  1.00 60.29 ? 119 CYS A C    1 
ATOM   911  O  O    . CYS A 1 115 ? -9.724  -8.166  1.823  1.00 60.48 ? 119 CYS A O    1 
ATOM   912  C  CB   . CYS A 1 115 ? -7.527  -7.998  4.463  1.00 61.04 ? 119 CYS A CB   1 
ATOM   913  S  SG   . CYS A 1 115 ? -5.950  -7.338  5.090  1.00 64.28 ? 119 CYS A SG   1 
ATOM   914  N  N    . GLN A 1 116 ? -10.451 -8.148  3.977  1.00 59.29 ? 120 GLN A N    1 
ATOM   915  C  CA   . GLN A 1 116 ? -11.493 -9.183  3.818  1.00 57.78 ? 120 GLN A CA   1 
ATOM   916  C  C    . GLN A 1 116 ? -12.843 -8.886  4.475  1.00 56.30 ? 120 GLN A C    1 
ATOM   917  O  O    . GLN A 1 116 ? -12.915 -8.154  5.455  1.00 56.27 ? 120 GLN A O    1 
ATOM   918  C  CB   . GLN A 1 116 ? -10.962 -10.489 4.390  1.00 58.25 ? 120 GLN A CB   1 
ATOM   919  C  CG   . GLN A 1 116 ? -10.553 -10.365 5.842  1.00 58.33 ? 120 GLN A CG   1 
ATOM   920  C  CD   . GLN A 1 116 ? -10.393 -11.707 6.495  1.00 60.81 ? 120 GLN A CD   1 
ATOM   921  O  OE1  . GLN A 1 116 ? -9.399  -11.945 7.184  1.00 61.80 ? 120 GLN A OE1  1 
ATOM   922  N  NE2  . GLN A 1 116 ? -11.367 -12.611 6.275  1.00 60.40 ? 120 GLN A NE2  1 
ATOM   923  N  N    . LYS A 1 117 ? -13.909 -9.487  3.955  1.00 54.48 ? 121 LYS A N    1 
ATOM   924  C  CA   . LYS A 1 117 ? -15.228 -9.256  4.531  1.00 52.96 ? 121 LYS A CA   1 
ATOM   925  C  C    . LYS A 1 117 ? -15.511 -10.143 5.746  1.00 51.35 ? 121 LYS A C    1 
ATOM   926  C  CB   . LYS A 1 117 ? -16.357 -9.304  3.488  1.00 52.96 ? 121 LYS A CB   1 
ATOM   927  C  CG   . LYS A 1 117 ? -16.453 -10.553 2.673  1.00 53.65 ? 121 LYS A CG   1 
ATOM   928  C  CD   . LYS A 1 117 ? -17.813 -10.613 2.006  1.00 54.86 ? 121 LYS A CD   1 
ATOM   929  C  CE   . LYS A 1 117 ? -17.932 -11.854 1.149  1.00 56.41 ? 121 LYS A CE   1 
ATOM   930  N  NZ   . LYS A 1 117 ? -19.322 -12.003 0.606  1.00 56.54 ? 121 LYS A NZ   1 
ATOM   931  N  N    . LEU A 1 118 ? -16.216 -9.525  6.685  1.00 49.12 ? 122 LEU A N    1 
ATOM   932  C  CA   . LEU A 1 118 ? -16.359 -10.062 8.015  1.00 46.90 ? 122 LEU A CA   1 
ATOM   933  C  C    . LEU A 1 118 ? -17.666 -10.785 8.175  1.00 45.60 ? 122 LEU A C    1 
ATOM   934  O  O    . LEU A 1 118 ? -18.726 -10.320 7.769  1.00 45.00 ? 122 LEU A O    1 
ATOM   935  C  CB   . LEU A 1 118 ? -16.225 -8.962  9.084  1.00 46.71 ? 122 LEU A CB   1 
ATOM   936  C  CG   . LEU A 1 118 ? -14.981 -8.068  9.166  1.00 46.10 ? 122 LEU A CG   1 
ATOM   937  C  CD1  . LEU A 1 118 ? -15.036 -7.250  10.430 1.00 43.25 ? 122 LEU A CD1  1 
ATOM   938  C  CD2  . LEU A 1 118 ? -13.660 -8.844  9.107  1.00 47.18 ? 122 LEU A CD2  1 
ATOM   939  N  N    . THR A 1 119 ? -17.556 -11.953 8.776  1.00 44.52 ? 123 THR A N    1 
ATOM   940  C  CA   . THR A 1 119 ? -18.684 -12.732 9.209  1.00 43.44 ? 123 THR A CA   1 
ATOM   941  C  C    . THR A 1 119 ? -19.219 -12.068 10.476 1.00 42.51 ? 123 THR A C    1 
ATOM   942  O  O    . THR A 1 119 ? -18.512 -11.259 11.108 1.00 42.01 ? 123 THR A O    1 
ATOM   943  C  CB   . THR A 1 119 ? -18.188 -14.169 9.492  1.00 43.59 ? 123 THR A CB   1 
ATOM   944  O  OG1  . THR A 1 119 ? -18.027 -14.869 8.242  1.00 45.16 ? 123 THR A OG1  1 
ATOM   945  C  CG2  . THR A 1 119 ? -19.156 -14.943 10.342 1.00 44.67 ? 123 THR A CG2  1 
ATOM   946  N  N    . ASP A 1 120 ? -20.448 -12.422 10.843 1.00 40.84 ? 124 ASP A N    1 
ATOM   947  C  CA   . ASP A 1 120 ? -21.002 -12.078 12.128 1.00 39.87 ? 124 ASP A CA   1 
ATOM   948  C  C    . ASP A 1 120 ? -20.217 -12.707 13.268 1.00 39.08 ? 124 ASP A C    1 
ATOM   949  O  O    . ASP A 1 120 ? -20.230 -12.209 14.380 1.00 39.70 ? 124 ASP A O    1 
ATOM   950  C  CB   . ASP A 1 120 ? -22.476 -12.491 12.231 1.00 39.33 ? 124 ASP A CB   1 
ATOM   951  C  CG   . ASP A 1 120 ? -23.099 -12.083 13.578 1.00 39.22 ? 124 ASP A CG   1 
ATOM   952  O  OD1  . ASP A 1 120 ? -23.488 -10.913 13.739 1.00 37.67 ? 124 ASP A OD1  1 
ATOM   953  O  OD2  . ASP A 1 120 ? -23.160 -12.914 14.489 1.00 36.09 ? 124 ASP A OD2  1 
ATOM   954  N  N    . ASP A 1 121 ? -19.571 -13.831 13.008 1.00 38.34 ? 125 ASP A N    1 
ATOM   955  C  CA   . ASP A 1 121 ? -18.742 -14.486 14.013 1.00 37.32 ? 125 ASP A CA   1 
ATOM   956  C  C    . ASP A 1 121 ? -17.465 -13.678 14.236 1.00 36.42 ? 125 ASP A C    1 
ATOM   957  O  O    . ASP A 1 121 ? -16.983 -13.600 15.348 1.00 36.87 ? 125 ASP A O    1 
ATOM   958  C  CB   . ASP A 1 121 ? -18.387 -15.908 13.589 1.00 37.23 ? 125 ASP A CB   1 
ATOM   959  C  CG   . ASP A 1 121 ? -17.379 -16.559 14.529 1.00 38.92 ? 125 ASP A CG   1 
ATOM   960  O  OD1  . ASP A 1 121 ? -16.215 -16.768 14.096 1.00 40.30 ? 125 ASP A OD1  1 
ATOM   961  O  OD2  . ASP A 1 121 ? -17.748 -16.829 15.709 1.00 38.40 ? 125 ASP A OD2  1 
ATOM   962  N  N    . HIS A 1 122 ? -16.914 -13.102 13.171 1.00 35.28 ? 126 HIS A N    1 
ATOM   963  C  CA   . HIS A 1 122 ? -15.798 -12.186 13.295 1.00 34.87 ? 126 HIS A CA   1 
ATOM   964  C  C    . HIS A 1 122 ? -16.118 -10.940 14.122 1.00 34.37 ? 126 HIS A C    1 
ATOM   965  O  O    . HIS A 1 122 ? -15.338 -10.602 14.985 1.00 35.03 ? 126 HIS A O    1 
ATOM   966  C  CB   . HIS A 1 122 ? -15.320 -11.731 11.939 1.00 34.95 ? 126 HIS A CB   1 
ATOM   967  C  CG   . HIS A 1 122 ? -14.743 -12.822 11.108 1.00 35.94 ? 126 HIS A CG   1 
ATOM   968  N  ND1  . HIS A 1 122 ? -14.391 -14.045 11.631 1.00 37.60 ? 126 HIS A ND1  1 
ATOM   969  C  CD2  . HIS A 1 122 ? -14.420 -12.860 9.800  1.00 34.79 ? 126 HIS A CD2  1 
ATOM   970  C  CE1  . HIS A 1 122 ? -13.899 -14.801 10.669 1.00 39.43 ? 126 HIS A CE1  1 
ATOM   971  N  NE2  . HIS A 1 122 ? -13.879 -14.096 9.558  1.00 38.76 ? 126 HIS A NE2  1 
ATOM   972  N  N    . VAL A 1 123 ? -17.248 -10.271 13.840 1.00 32.90 ? 127 VAL A N    1 
ATOM   973  C  CA   . VAL A 1 123 ? -17.711 -9.128  14.619 1.00 31.73 ? 127 VAL A CA   1 
ATOM   974  C  C    . VAL A 1 123 ? -17.849 -9.530  16.090 1.00 31.98 ? 127 VAL A C    1 
ATOM   975  O  O    . VAL A 1 123 ? -17.442 -8.792  16.983 1.00 31.52 ? 127 VAL A O    1 
ATOM   976  C  CB   . VAL A 1 123 ? -19.070 -8.552  14.056 1.00 32.78 ? 127 VAL A CB   1 
ATOM   977  C  CG1  . VAL A 1 123 ? -19.460 -7.250  14.759 1.00 29.76 ? 127 VAL A CG1  1 
ATOM   978  C  CG2  . VAL A 1 123 ? -18.993 -8.338  12.501 1.00 27.94 ? 127 VAL A CG2  1 
ATOM   979  N  N    . GLN A 1 124 ? -18.379 -10.731 16.337 1.00 31.79 ? 128 GLN A N    1 
ATOM   980  C  CA   . GLN A 1 124 ? -18.604 -11.215 17.692 1.00 31.53 ? 128 GLN A CA   1 
ATOM   981  C  C    . GLN A 1 124 ? -17.286 -11.330 18.428 1.00 30.66 ? 128 GLN A C    1 
ATOM   982  O  O    . GLN A 1 124 ? -17.165 -10.878 19.590 1.00 30.28 ? 128 GLN A O    1 
ATOM   983  C  CB   . GLN A 1 124 ? -19.255 -12.597 17.681 1.00 32.41 ? 128 GLN A CB   1 
ATOM   984  C  CG   . GLN A 1 124 ? -20.731 -12.647 17.251 1.00 33.60 ? 128 GLN A CG   1 
ATOM   985  C  CD   . GLN A 1 124 ? -21.285 -14.082 17.164 1.00 32.74 ? 128 GLN A CD   1 
ATOM   986  O  OE1  . GLN A 1 124 ? -20.897 -14.961 17.923 1.00 33.40 ? 128 GLN A OE1  1 
ATOM   987  N  NE2  . GLN A 1 124 ? -22.197 -14.300 16.234 1.00 31.77 ? 128 GLN A NE2  1 
ATOM   988  N  N    . PHE A 1 125 ? -16.311 -11.954 17.755 1.00 28.80 ? 129 PHE A N    1 
ATOM   989  C  CA   . PHE A 1 125 ? -14.982 -12.234 18.345 1.00 27.62 ? 129 PHE A CA   1 
ATOM   990  C  C    . PHE A 1 125 ? -14.182 -10.952 18.553 1.00 27.11 ? 129 PHE A C    1 
ATOM   991  O  O    . PHE A 1 125 ? -13.613 -10.749 19.619 1.00 26.26 ? 129 PHE A O    1 
ATOM   992  C  CB   . PHE A 1 125 ? -14.192 -13.229 17.477 1.00 26.88 ? 129 PHE A CB   1 
ATOM   993  C  CG   . PHE A 1 125 ? -12.903 -13.741 18.124 1.00 25.77 ? 129 PHE A CG   1 
ATOM   994  C  CD1  . PHE A 1 125 ? -12.871 -14.144 19.442 1.00 24.78 ? 129 PHE A CD1  1 
ATOM   995  C  CD2  . PHE A 1 125 ? -11.744 -13.834 17.388 1.00 27.12 ? 129 PHE A CD2  1 
ATOM   996  C  CE1  . PHE A 1 125 ? -11.683 -14.607 20.010 1.00 26.17 ? 129 PHE A CE1  1 
ATOM   997  C  CE2  . PHE A 1 125 ? -10.554 -14.295 17.961 1.00 26.54 ? 129 PHE A CE2  1 
ATOM   998  C  CZ   . PHE A 1 125 ? -10.548 -14.675 19.278 1.00 26.17 ? 129 PHE A CZ   1 
ATOM   999  N  N    . LEU A 1 126 ? -14.150 -10.105 17.520 1.00 26.95 ? 130 LEU A N    1 
ATOM   1000 C  CA   . LEU A 1 126 ? -13.465 -8.801  17.566 1.00 27.99 ? 130 LEU A CA   1 
ATOM   1001 C  C    . LEU A 1 126 ? -13.974 -7.880  18.657 1.00 27.80 ? 130 LEU A C    1 
ATOM   1002 O  O    . LEU A 1 126 ? -13.193 -7.374  19.433 1.00 28.63 ? 130 LEU A O    1 
ATOM   1003 C  CB   . LEU A 1 126 ? -13.561 -8.115  16.194 1.00 29.06 ? 130 LEU A CB   1 
ATOM   1004 C  CG   . LEU A 1 126 ? -12.415 -8.260  15.165 1.00 30.64 ? 130 LEU A CG   1 
ATOM   1005 C  CD1  . LEU A 1 126 ? -11.301 -9.255  15.551 1.00 31.92 ? 130 LEU A CD1  1 
ATOM   1006 C  CD2  . LEU A 1 126 ? -12.970 -8.464  13.759 1.00 32.30 ? 130 LEU A CD2  1 
ATOM   1007 N  N    . ILE A 1 127 ? -15.286 -7.662  18.707 1.00 27.73 ? 131 ILE A N    1 
ATOM   1008 C  CA   . ILE A 1 127 ? -15.926 -6.846  19.747 1.00 27.81 ? 131 ILE A CA   1 
ATOM   1009 C  C    . ILE A 1 127 ? -15.902 -7.506  21.146 1.00 27.95 ? 131 ILE A C    1 
ATOM   1010 O  O    . ILE A 1 127 ? -15.748 -6.818  22.162 1.00 28.98 ? 131 ILE A O    1 
ATOM   1011 C  CB   . ILE A 1 127 ? -17.387 -6.358  19.327 1.00 27.41 ? 131 ILE A CB   1 
ATOM   1012 C  CG1  . ILE A 1 127 ? -17.405 -5.718  17.930 1.00 26.22 ? 131 ILE A CG1  1 
ATOM   1013 C  CG2  . ILE A 1 127 ? -17.951 -5.361  20.329 1.00 28.44 ? 131 ILE A CG2  1 
ATOM   1014 C  CD1  . ILE A 1 127 ? -16.508 -4.473  17.742 1.00 24.11 ? 131 ILE A CD1  1 
ATOM   1015 N  N    . TYR A 1 128 ? -16.027 -8.831  21.216 1.00 27.15 ? 132 TYR A N    1 
ATOM   1016 C  CA   . TYR A 1 128 ? -15.777 -9.541  22.476 1.00 26.20 ? 132 TYR A CA   1 
ATOM   1017 C  C    . TYR A 1 128 ? -14.419 -9.153  23.092 1.00 26.30 ? 132 TYR A C    1 
ATOM   1018 O  O    . TYR A 1 128 ? -14.314 -8.865  24.284 1.00 27.55 ? 132 TYR A O    1 
ATOM   1019 C  CB   . TYR A 1 128 ? -15.843 -11.079 22.333 1.00 24.97 ? 132 TYR A CB   1 
ATOM   1020 C  CG   . TYR A 1 128 ? -15.559 -11.725 23.641 1.00 25.23 ? 132 TYR A CG   1 
ATOM   1021 C  CD1  . TYR A 1 128 ? -16.505 -11.685 24.668 1.00 26.03 ? 132 TYR A CD1  1 
ATOM   1022 C  CD2  . TYR A 1 128 ? -14.321 -12.310 23.915 1.00 26.26 ? 132 TYR A CD2  1 
ATOM   1023 C  CE1  . TYR A 1 128 ? -16.242 -12.235 25.886 1.00 21.37 ? 132 TYR A CE1  1 
ATOM   1024 C  CE2  . TYR A 1 128 ? -14.051 -12.852 25.180 1.00 24.98 ? 132 TYR A CE2  1 
ATOM   1025 C  CZ   . TYR A 1 128 ? -15.024 -12.789 26.136 1.00 22.15 ? 132 TYR A CZ   1 
ATOM   1026 O  OH   . TYR A 1 128 ? -14.827 -13.334 27.358 1.00 26.08 ? 132 TYR A OH   1 
ATOM   1027 N  N    . GLN A 1 129 ? -13.387 -9.168  22.270 1.00 24.77 ? 133 GLN A N    1 
ATOM   1028 C  CA   . GLN A 1 129 ? -12.051 -8.975  22.749 1.00 24.27 ? 133 GLN A CA   1 
ATOM   1029 C  C    . GLN A 1 129 ? -11.808 -7.514  23.125 1.00 23.82 ? 133 GLN A C    1 
ATOM   1030 O  O    . GLN A 1 129 ? -11.127 -7.270  24.086 1.00 24.74 ? 133 GLN A O    1 
ATOM   1031 C  CB   . GLN A 1 129 ? -11.058 -9.408  21.689 1.00 23.26 ? 133 GLN A CB   1 
ATOM   1032 C  CG   . GLN A 1 129 ? -10.969 -10.893 21.464 1.00 25.24 ? 133 GLN A CG   1 
ATOM   1033 C  CD   . GLN A 1 129 ? -9.995  -11.199 20.395 1.00 26.34 ? 133 GLN A CD   1 
ATOM   1034 O  OE1  . GLN A 1 129 ? -8.852  -11.491 20.680 1.00 31.87 ? 133 GLN A OE1  1 
ATOM   1035 N  NE2  . GLN A 1 129 ? -10.413 -11.076 19.144 1.00 26.75 ? 133 GLN A NE2  1 
ATOM   1036 N  N    . ILE A 1 130 ? -12.297 -6.559  22.335 1.00 24.00 ? 134 ILE A N    1 
ATOM   1037 C  CA   . ILE A 1 130 ? -12.265 -5.148  22.739 1.00 24.62 ? 134 ILE A CA   1 
ATOM   1038 C  C    . ILE A 1 130 ? -12.893 -4.943  24.102 1.00 25.35 ? 134 ILE A C    1 
ATOM   1039 O  O    . ILE A 1 130 ? -12.279 -4.359  24.968 1.00 26.84 ? 134 ILE A O    1 
ATOM   1040 C  CB   . ILE A 1 130 ? -12.964 -4.199  21.746 1.00 24.24 ? 134 ILE A CB   1 
ATOM   1041 C  CG1  . ILE A 1 130 ? -12.339 -4.311  20.380 1.00 19.93 ? 134 ILE A CG1  1 
ATOM   1042 C  CG2  . ILE A 1 130 ? -12.880 -2.686  22.269 1.00 23.50 ? 134 ILE A CG2  1 
ATOM   1043 C  CD1  . ILE A 1 130 ? -13.195 -3.625  19.319 1.00 22.62 ? 134 ILE A CD1  1 
ATOM   1044 N  N    . LEU A 1 131 ? -14.113 -5.431  24.305 1.00 27.23 ? 135 LEU A N    1 
ATOM   1045 C  CA   . LEU A 1 131 ? -14.776 -5.329  25.635 1.00 28.34 ? 135 LEU A CA   1 
ATOM   1046 C  C    . LEU A 1 131 ? -14.068 -6.007  26.794 1.00 28.85 ? 135 LEU A C    1 
ATOM   1047 O  O    . LEU A 1 131 ? -14.032 -5.483  27.934 1.00 29.66 ? 135 LEU A O    1 
ATOM   1048 C  CB   . LEU A 1 131 ? -16.264 -5.740  25.574 1.00 28.68 ? 135 LEU A CB   1 
ATOM   1049 C  CG   . LEU A 1 131 ? -17.085 -4.866  24.622 1.00 28.58 ? 135 LEU A CG   1 
ATOM   1050 C  CD1  . LEU A 1 131 ? -18.392 -5.564  24.273 1.00 28.12 ? 135 LEU A CD1  1 
ATOM   1051 C  CD2  . LEU A 1 131 ? -17.329 -3.425  25.139 1.00 27.25 ? 135 LEU A CD2  1 
ATOM   1052 N  N    . ARG A 1 132 ? -13.513 -7.182  26.545 1.00 29.56 ? 136 ARG A N    1 
ATOM   1053 C  CA   . ARG A 1 132 ? -12.751 -7.845  27.593 1.00 29.08 ? 136 ARG A CA   1 
ATOM   1054 C  C    . ARG A 1 132 ? -11.467 -7.056  27.984 1.00 28.57 ? 136 ARG A C    1 
ATOM   1055 O  O    . ARG A 1 132 ? -11.153 -6.913  29.168 1.00 27.50 ? 136 ARG A O    1 
ATOM   1056 C  CB   . ARG A 1 132 ? -12.469 -9.280  27.175 1.00 29.82 ? 136 ARG A CB   1 
ATOM   1057 C  CG   . ARG A 1 132 ? -11.773 -10.126 28.202 1.00 30.66 ? 136 ARG A CG   1 
ATOM   1058 C  CD   . ARG A 1 132 ? -11.609 -11.547 27.680 1.00 34.35 ? 136 ARG A CD   1 
ATOM   1059 N  NE   . ARG A 1 132 ? -10.747 -12.328 28.571 1.00 34.93 ? 136 ARG A NE   1 
ATOM   1060 C  CZ   . ARG A 1 132 ? -9.523  -12.762 28.273 1.00 33.96 ? 136 ARG A CZ   1 
ATOM   1061 N  NH1  . ARG A 1 132 ? -8.979  -12.521 27.097 1.00 32.51 ? 136 ARG A NH1  1 
ATOM   1062 N  NH2  . ARG A 1 132 ? -8.834  -13.436 29.174 1.00 35.80 ? 136 ARG A NH2  1 
ATOM   1063 N  N    . GLY A 1 133 ? -10.737 -6.514  27.003 1.00 28.59 ? 137 GLY A N    1 
ATOM   1064 C  CA   . GLY A 1 133 ? -9.602  -5.613  27.321 1.00 27.78 ? 137 GLY A CA   1 
ATOM   1065 C  C    . GLY A 1 133 ? -10.062 -4.324  28.010 1.00 28.64 ? 137 GLY A C    1 
ATOM   1066 O  O    . GLY A 1 133 ? -9.437  -3.851  28.957 1.00 28.21 ? 137 GLY A O    1 
ATOM   1067 N  N    . LEU A 1 134 ? -11.171 -3.757  27.557 1.00 28.28 ? 138 LEU A N    1 
ATOM   1068 C  CA   . LEU A 1 134 ? -11.688 -2.530  28.158 1.00 29.77 ? 138 LEU A CA   1 
ATOM   1069 C  C    . LEU A 1 134 ? -12.172 -2.767  29.587 1.00 30.16 ? 138 LEU A C    1 
ATOM   1070 O  O    . LEU A 1 134 ? -12.018 -1.904  30.471 1.00 30.47 ? 138 LEU A O    1 
ATOM   1071 C  CB   . LEU A 1 134 ? -12.828 -2.002  27.296 1.00 30.46 ? 138 LEU A CB   1 
ATOM   1072 C  CG   . LEU A 1 134 ? -12.948 -0.533  26.978 1.00 30.29 ? 138 LEU A CG   1 
ATOM   1073 C  CD1  . LEU A 1 134 ? -11.590 0.124   26.578 1.00 24.96 ? 138 LEU A CD1  1 
ATOM   1074 C  CD2  . LEU A 1 134 ? -14.013 -0.431  25.902 1.00 31.13 ? 138 LEU A CD2  1 
ATOM   1075 N  N    . LYS A 1 135 ? -12.755 -3.933  29.831 1.00 29.82 ? 139 LYS A N    1 
ATOM   1076 C  CA   . LYS A 1 135 ? -13.174 -4.268  31.198 1.00 29.77 ? 139 LYS A CA   1 
ATOM   1077 C  C    . LYS A 1 135 ? -11.990 -4.140  32.126 1.00 29.51 ? 139 LYS A C    1 
ATOM   1078 O  O    . LYS A 1 135 ? -12.088 -3.549  33.204 1.00 30.69 ? 139 LYS A O    1 
ATOM   1079 C  CB   . LYS A 1 135 ? -13.775 -5.684  31.312 1.00 29.07 ? 139 LYS A CB   1 
ATOM   1080 C  CG   . LYS A 1 135 ? -14.393 -5.921  32.712 1.00 29.69 ? 139 LYS A CG   1 
ATOM   1081 C  CD   . LYS A 1 135 ? -14.600 -7.373  32.985 1.00 31.62 ? 139 LYS A CD   1 
ATOM   1082 C  CE   . LYS A 1 135 ? -15.083 -7.629  34.401 1.00 33.25 ? 139 LYS A CE   1 
ATOM   1083 N  NZ   . LYS A 1 135 ? -15.141 -9.137  34.617 1.00 33.02 ? 139 LYS A NZ   1 
ATOM   1084 N  N    . TYR A 1 136 ? -10.867 -4.696  31.686 1.00 28.50 ? 140 TYR A N    1 
ATOM   1085 C  CA   . TYR A 1 136 ? -9.622  -4.665  32.449 1.00 26.65 ? 140 TYR A CA   1 
ATOM   1086 C  C    . TYR A 1 136 ? -9.137  -3.234  32.681 1.00 27.02 ? 140 TYR A C    1 
ATOM   1087 O  O    . TYR A 1 136 ? -8.759  -2.881  33.800 1.00 28.11 ? 140 TYR A O    1 
ATOM   1088 C  CB   . TYR A 1 136 ? -8.573  -5.543  31.753 1.00 25.69 ? 140 TYR A CB   1 
ATOM   1089 C  CG   . TYR A 1 136 ? -7.166  -5.472  32.334 1.00 24.08 ? 140 TYR A CG   1 
ATOM   1090 C  CD1  . TYR A 1 136 ? -6.793  -6.269  33.418 1.00 24.50 ? 140 TYR A CD1  1 
ATOM   1091 C  CD2  . TYR A 1 136 ? -6.205  -4.591  31.783 1.00 22.23 ? 140 TYR A CD2  1 
ATOM   1092 C  CE1  . TYR A 1 136 ? -5.490  -6.224  33.938 1.00 24.92 ? 140 TYR A CE1  1 
ATOM   1093 C  CE2  . TYR A 1 136 ? -4.919  -4.516  32.293 1.00 21.42 ? 140 TYR A CE2  1 
ATOM   1094 C  CZ   . TYR A 1 136 ? -4.572  -5.318  33.386 1.00 24.72 ? 140 TYR A CZ   1 
ATOM   1095 O  OH   . TYR A 1 136 ? -3.303  -5.232  33.917 1.00 27.93 ? 140 TYR A OH   1 
ATOM   1096 N  N    . ILE A 1 137 ? -9.181  -2.408  31.631 1.00 27.18 ? 141 ILE A N    1 
ATOM   1097 C  CA   . ILE A 1 137 ? -8.622  -1.036  31.644 1.00 26.33 ? 141 ILE A CA   1 
ATOM   1098 C  C    . ILE A 1 137 ? -9.447  -0.141  32.529 1.00 26.71 ? 141 ILE A C    1 
ATOM   1099 O  O    . ILE A 1 137 ? -8.904  0.527   33.398 1.00 26.84 ? 141 ILE A O    1 
ATOM   1100 C  CB   . ILE A 1 137 ? -8.510  -0.444  30.204 1.00 26.47 ? 141 ILE A CB   1 
ATOM   1101 C  CG1  . ILE A 1 137 ? -7.276  -1.045  29.485 1.00 24.67 ? 141 ILE A CG1  1 
ATOM   1102 C  CG2  . ILE A 1 137 ? -8.390  1.095   30.240 1.00 22.72 ? 141 ILE A CG2  1 
ATOM   1103 C  CD1  . ILE A 1 137 ? -7.461  -1.143  27.980 1.00 26.52 ? 141 ILE A CD1  1 
ATOM   1104 N  N    . HIS A 1 138 ? -10.761 -0.177  32.320 1.00 26.97 ? 142 HIS A N    1 
ATOM   1105 C  CA   . HIS A 1 138 ? -11.719 0.514   33.148 1.00 28.33 ? 142 HIS A CA   1 
ATOM   1106 C  C    . HIS A 1 138 ? -11.597 0.213   34.629 1.00 29.69 ? 142 HIS A C    1 
ATOM   1107 O  O    . HIS A 1 138 ? -11.794 1.103   35.441 1.00 30.54 ? 142 HIS A O    1 
ATOM   1108 C  CB   . HIS A 1 138 ? -13.158 0.303   32.632 1.00 27.17 ? 142 HIS A CB   1 
ATOM   1109 C  CG   . HIS A 1 138 ? -13.439 1.074   31.381 1.00 27.40 ? 142 HIS A CG   1 
ATOM   1110 N  ND1  . HIS A 1 138 ? -14.630 0.983   30.683 1.00 23.63 ? 142 HIS A ND1  1 
ATOM   1111 C  CD2  . HIS A 1 138 ? -12.650 1.925   30.679 1.00 25.38 ? 142 HIS A CD2  1 
ATOM   1112 C  CE1  . HIS A 1 138 ? -14.571 1.791   29.633 1.00 27.56 ? 142 HIS A CE1  1 
ATOM   1113 N  NE2  . HIS A 1 138 ? -13.376 2.362   29.600 1.00 24.74 ? 142 HIS A NE2  1 
ATOM   1114 N  N    . SER A 1 139 ? -11.221 -1.015  34.971 1.00 30.68 ? 143 SER A N    1 
ATOM   1115 C  CA   . SER A 1 139 ? -11.179 -1.447  36.379 1.00 32.15 ? 143 SER A CA   1 
ATOM   1116 C  C    . SER A 1 139 ? -9.925  -0.910  37.083 1.00 32.75 ? 143 SER A C    1 
ATOM   1117 O  O    . SER A 1 139 ? -9.792  -0.966  38.317 1.00 33.30 ? 143 SER A O    1 
ATOM   1118 C  CB   . SER A 1 139 ? -11.224 -2.974  36.452 1.00 30.99 ? 143 SER A CB   1 
ATOM   1119 O  OG   . SER A 1 139 ? -9.954  -3.480  36.066 1.00 33.20 ? 143 SER A OG   1 
ATOM   1120 N  N    . ALA A 1 140 ? -9.016  -0.353  36.299 1.00 33.62 ? 144 ALA A N    1 
ATOM   1121 C  CA   . ALA A 1 140 ? -7.812  0.269   36.837 1.00 33.87 ? 144 ALA A CA   1 
ATOM   1122 C  C    . ALA A 1 140 ? -8.061  1.759   36.985 1.00 34.15 ? 144 ALA A C    1 
ATOM   1123 O  O    . ALA A 1 140 ? -7.135  2.539   37.279 1.00 34.71 ? 144 ALA A O    1 
ATOM   1124 C  CB   . ALA A 1 140 ? -6.620  -0.011  35.920 1.00 33.87 ? 144 ALA A CB   1 
ATOM   1125 N  N    . ASP A 1 141 ? -9.325  2.145   36.793 1.00 34.38 ? 145 ASP A N    1 
ATOM   1126 C  CA   . ASP A 1 141 ? -9.754  3.558   36.764 1.00 35.26 ? 145 ASP A CA   1 
ATOM   1127 C  C    . ASP A 1 141 ? -9.160  4.370   35.580 1.00 33.97 ? 145 ASP A C    1 
ATOM   1128 O  O    . ASP A 1 141 ? -9.041  5.617   35.641 1.00 32.52 ? 145 ASP A O    1 
ATOM   1129 C  CB   . ASP A 1 141 ? -9.489  4.262   38.119 1.00 36.67 ? 145 ASP A CB   1 
ATOM   1130 C  CG   . ASP A 1 141 ? -10.379 5.499   38.323 1.00 40.75 ? 145 ASP A CG   1 
ATOM   1131 O  OD1  . ASP A 1 141 ? -9.878  6.532   38.844 1.00 45.78 ? 145 ASP A OD1  1 
ATOM   1132 O  OD2  . ASP A 1 141 ? -11.583 5.446   37.946 1.00 47.65 ? 145 ASP A OD2  1 
ATOM   1133 N  N    . ILE A 1 142 ? -8.817  3.656   34.503 1.00 32.01 ? 146 ILE A N    1 
ATOM   1134 C  CA   . ILE A 1 142 ? -8.267  4.273   33.283 1.00 31.01 ? 146 ILE A CA   1 
ATOM   1135 C  C    . ILE A 1 142 ? -9.335  4.406   32.221 1.00 30.67 ? 146 ILE A C    1 
ATOM   1136 O  O    . ILE A 1 142 ? -10.126 3.485   32.009 1.00 30.77 ? 146 ILE A O    1 
ATOM   1137 C  CB   . ILE A 1 142 ? -7.034  3.443   32.734 1.00 31.33 ? 146 ILE A CB   1 
ATOM   1138 C  CG1  . ILE A 1 142 ? -6.018  3.180   33.843 1.00 29.75 ? 146 ILE A CG1  1 
ATOM   1139 C  CG2  . ILE A 1 142 ? -6.323  4.146   31.542 1.00 32.01 ? 146 ILE A CG2  1 
ATOM   1140 C  CD1  . ILE A 1 142 ? -4.861  2.309   33.438 1.00 31.50 ? 146 ILE A CD1  1 
ATOM   1141 N  N    . ILE A 1 143 ? -9.329  5.530   31.501 1.00 30.16 ? 147 ILE A N    1 
ATOM   1142 C  CA   . ILE A 1 143 ? -10.268 5.755   30.436 1.00 29.36 ? 147 ILE A CA   1 
ATOM   1143 C  C    . ILE A 1 143 ? -9.446  5.917   29.161 1.00 28.97 ? 147 ILE A C    1 
ATOM   1144 O  O    . ILE A 1 143 ? -8.553  6.768   29.127 1.00 28.12 ? 147 ILE A O    1 
ATOM   1145 C  CB   . ILE A 1 143 ? -11.136 7.037   30.668 1.00 29.65 ? 147 ILE A CB   1 
ATOM   1146 C  CG1  . ILE A 1 143 ? -11.927 6.957   31.985 1.00 30.33 ? 147 ILE A CG1  1 
ATOM   1147 C  CG2  . ILE A 1 143 ? -12.109 7.266   29.502 1.00 29.62 ? 147 ILE A CG2  1 
ATOM   1148 C  CD1  . ILE A 1 143 ? -12.863 8.191   32.219 1.00 31.10 ? 147 ILE A CD1  1 
ATOM   1149 N  N    . HIS A 1 144 ? -9.738  5.129   28.109 1.00 26.72 ? 148 HIS A N    1 
ATOM   1150 C  CA   . HIS A 1 144 ? -8.894  5.168   26.917 1.00 25.70 ? 148 HIS A CA   1 
ATOM   1151 C  C    . HIS A 1 144 ? -9.023  6.505   26.193 1.00 26.61 ? 148 HIS A C    1 
ATOM   1152 O  O    . HIS A 1 144 ? -8.008  7.146   25.902 1.00 25.52 ? 148 HIS A O    1 
ATOM   1153 C  CB   . HIS A 1 144 ? -9.195  3.992   25.976 1.00 24.92 ? 148 HIS A CB   1 
ATOM   1154 C  CG   . HIS A 1 144 ? -8.247  3.899   24.820 1.00 24.48 ? 148 HIS A CG   1 
ATOM   1155 N  ND1  . HIS A 1 144 ? -7.335  2.865   24.677 1.00 24.63 ? 148 HIS A ND1  1 
ATOM   1156 C  CD2  . HIS A 1 144 ? -8.055  4.719   23.759 1.00 21.42 ? 148 HIS A CD2  1 
ATOM   1157 C  CE1  . HIS A 1 144 ? -6.622  3.062   23.578 1.00 21.47 ? 148 HIS A CE1  1 
ATOM   1158 N  NE2  . HIS A 1 144 ? -7.055  4.164   22.995 1.00 23.25 ? 148 HIS A NE2  1 
ATOM   1159 N  N    . ARG A 1 145 ? -10.284 6.900   25.945 1.00 27.42 ? 149 ARG A N    1 
ATOM   1160 C  CA   . ARG A 1 145 ? -10.730 8.148   25.302 1.00 29.88 ? 149 ARG A CA   1 
ATOM   1161 C  C    . ARG A 1 145 ? -10.393 8.303   23.839 1.00 30.39 ? 149 ARG A C    1 
ATOM   1162 O  O    . ARG A 1 145 ? -10.834 9.269   23.220 1.00 30.83 ? 149 ARG A O    1 
ATOM   1163 C  CB   . ARG A 1 145 ? -10.240 9.403   26.011 1.00 31.23 ? 149 ARG A CB   1 
ATOM   1164 C  CG   . ARG A 1 145 ? -10.755 9.652   27.408 1.00 35.72 ? 149 ARG A CG   1 
ATOM   1165 C  CD   . ARG A 1 145 ? -9.854  10.723  28.057 1.00 42.53 ? 149 ARG A CD   1 
ATOM   1166 N  NE   . ARG A 1 145 ? -9.595  10.405  29.467 1.00 46.66 ? 149 ARG A NE   1 
ATOM   1167 C  CZ   . ARG A 1 145 ? -8.471  9.845   29.921 1.00 46.07 ? 149 ARG A CZ   1 
ATOM   1168 N  NH1  . ARG A 1 145 ? -7.470  9.565   29.091 1.00 45.25 ? 149 ARG A NH1  1 
ATOM   1169 N  NH2  . ARG A 1 145 ? -8.348  9.578   31.216 1.00 47.96 ? 149 ARG A NH2  1 
ATOM   1170 N  N    . ASP A 1 146 ? -9.603  7.400   23.262 1.00 30.95 ? 150 ASP A N    1 
ATOM   1171 C  CA   . ASP A 1 146 ? -9.400  7.495   21.811 1.00 30.65 ? 150 ASP A CA   1 
ATOM   1172 C  C    . ASP A 1 146 ? -9.487  6.179   21.063 1.00 29.59 ? 150 ASP A C    1 
ATOM   1173 O  O    . ASP A 1 146 ? -8.690  5.897   20.160 1.00 28.93 ? 150 ASP A O    1 
ATOM   1174 C  CB   . ASP A 1 146 ? -8.099  8.227   21.483 1.00 31.66 ? 150 ASP A CB   1 
ATOM   1175 C  CG   . ASP A 1 146 ? -8.056  8.682   20.035 1.00 35.51 ? 150 ASP A CG   1 
ATOM   1176 O  OD1  . ASP A 1 146 ? -6.946  8.903   19.510 1.00 36.81 ? 150 ASP A OD1  1 
ATOM   1177 O  OD2  . ASP A 1 146 ? -9.153  8.778   19.418 1.00 39.16 ? 150 ASP A OD2  1 
ATOM   1178 N  N    . LEU A 1 147 ? -10.468 5.376   21.446 1.00 28.88 ? 151 LEU A N    1 
ATOM   1179 C  CA   . LEU A 1 147 ? -10.716 4.103   20.803 1.00 28.51 ? 151 LEU A CA   1 
ATOM   1180 C  C    . LEU A 1 147 ? -11.188 4.301   19.387 1.00 28.64 ? 151 LEU A C    1 
ATOM   1181 O  O    . LEU A 1 147 ? -12.137 5.055   19.120 1.00 28.23 ? 151 LEU A O    1 
ATOM   1182 C  CB   . LEU A 1 147 ? -11.774 3.322   21.542 1.00 28.32 ? 151 LEU A CB   1 
ATOM   1183 C  CG   . LEU A 1 147 ? -11.278 2.518   22.707 1.00 30.10 ? 151 LEU A CG   1 
ATOM   1184 C  CD1  . LEU A 1 147 ? -12.505 1.893   23.335 1.00 33.00 ? 151 LEU A CD1  1 
ATOM   1185 C  CD2  . LEU A 1 147 ? -10.204 1.460   22.264 1.00 32.00 ? 151 LEU A CD2  1 
ATOM   1186 N  N    . LYS A 1 148 ? -10.495 3.646   18.469 1.00 28.52 ? 152 LYS A N    1 
ATOM   1187 C  CA   . LYS A 1 148 ? -10.865 3.691   17.062 1.00 28.74 ? 152 LYS A CA   1 
ATOM   1188 C  C    . LYS A 1 148 ? -10.088 2.545   16.408 1.00 28.37 ? 152 LYS A C    1 
ATOM   1189 O  O    . LYS A 1 148 ? -9.199  1.995   17.050 1.00 28.61 ? 152 LYS A O    1 
ATOM   1190 C  CB   . LYS A 1 148 ? -10.504 5.045   16.479 1.00 27.89 ? 152 LYS A CB   1 
ATOM   1191 C  CG   . LYS A 1 148 ? -9.059  5.356   16.681 1.00 28.98 ? 152 LYS A CG   1 
ATOM   1192 C  CD   . LYS A 1 148 ? -8.650  6.637   16.047 1.00 29.20 ? 152 LYS A CD   1 
ATOM   1193 C  CE   . LYS A 1 148 ? -7.195  6.855   16.332 1.00 31.51 ? 152 LYS A CE   1 
ATOM   1194 N  NZ   . LYS A 1 148 ? -6.861  8.272   16.235 1.00 36.23 ? 152 LYS A NZ   1 
ATOM   1195 N  N    . PRO A 1 149 ? -10.441 2.158   15.159 1.00 28.49 ? 153 PRO A N    1 
ATOM   1196 C  CA   . PRO A 1 149 ? -9.829  0.983   14.499 1.00 28.50 ? 153 PRO A CA   1 
ATOM   1197 C  C    . PRO A 1 149 ? -8.309  1.056   14.353 1.00 28.38 ? 153 PRO A C    1 
ATOM   1198 O  O    . PRO A 1 149 ? -7.645  0.043   14.412 1.00 29.52 ? 153 PRO A O    1 
ATOM   1199 C  CB   . PRO A 1 149 ? -10.520 0.973   13.124 1.00 28.50 ? 153 PRO A CB   1 
ATOM   1200 C  CG   . PRO A 1 149 ? -11.853 1.597   13.416 1.00 28.63 ? 153 PRO A CG   1 
ATOM   1201 C  CD   . PRO A 1 149 ? -11.487 2.746   14.300 1.00 27.76 ? 153 PRO A CD   1 
ATOM   1202 N  N    . SER A 1 150 ? -7.759  2.248   14.197 1.00 29.06 ? 154 SER A N    1 
ATOM   1203 C  CA   . SER A 1 150 ? -6.310  2.417   14.146 1.00 28.30 ? 154 SER A CA   1 
ATOM   1204 C  C    . SER A 1 150 ? -5.623  2.170   15.480 1.00 28.03 ? 154 SER A C    1 
ATOM   1205 O  O    . SER A 1 150 ? -4.422  1.971   15.508 1.00 27.90 ? 154 SER A O    1 
ATOM   1206 C  CB   . SER A 1 150 ? -5.965  3.798   13.605 1.00 29.01 ? 154 SER A CB   1 
ATOM   1207 O  OG   . SER A 1 150 ? -6.508  4.806   14.445 1.00 29.09 ? 154 SER A OG   1 
ATOM   1208 N  N    . ASN A 1 151 ? -6.377  2.142   16.593 1.00 28.03 ? 155 ASN A N    1 
ATOM   1209 C  CA   . ASN A 1 151 ? -5.764  1.837   17.905 1.00 26.71 ? 155 ASN A CA   1 
ATOM   1210 C  C    . ASN A 1 151 ? -5.967  0.396   18.367 1.00 26.62 ? 155 ASN A C    1 
ATOM   1211 O  O    . ASN A 1 151 ? -5.875  0.098   19.560 1.00 25.11 ? 155 ASN A O    1 
ATOM   1212 C  CB   . ASN A 1 151 ? -6.217  2.826   19.004 1.00 26.34 ? 155 ASN A CB   1 
ATOM   1213 C  CG   . ASN A 1 151 ? -5.444  4.148   18.970 1.00 26.95 ? 155 ASN A CG   1 
ATOM   1214 O  OD1  . ASN A 1 151 ? -6.013  5.220   19.149 1.00 28.68 ? 155 ASN A OD1  1 
ATOM   1215 N  ND2  . ASN A 1 151 ? -4.167  4.076   18.714 1.00 20.27 ? 155 ASN A ND2  1 
ATOM   1216 N  N    . LEU A 1 152 ? -6.220  -0.511  17.422 1.00 26.32 ? 156 LEU A N    1 
ATOM   1217 C  CA   . LEU A 1 152 ? -6.518  -1.897  17.779 1.00 25.97 ? 156 LEU A CA   1 
ATOM   1218 C  C    . LEU A 1 152 ? -5.714  -2.799  16.858 1.00 26.52 ? 156 LEU A C    1 
ATOM   1219 O  O    . LEU A 1 152 ? -5.874  -2.768  15.633 1.00 27.02 ? 156 LEU A O    1 
ATOM   1220 C  CB   . LEU A 1 152 ? -8.034  -2.200  17.644 1.00 24.95 ? 156 LEU A CB   1 
ATOM   1221 C  CG   . LEU A 1 152 ? -9.094  -1.344  18.377 1.00 26.45 ? 156 LEU A CG   1 
ATOM   1222 C  CD1  . LEU A 1 152 ? -10.511 -1.512  17.872 1.00 19.10 ? 156 LEU A CD1  1 
ATOM   1223 C  CD2  . LEU A 1 152 ? -9.046  -1.532  19.907 1.00 21.24 ? 156 LEU A CD2  1 
ATOM   1224 N  N    . ALA A 1 153 ? -4.870  -3.619  17.458 1.00 27.39 ? 157 ALA A N    1 
ATOM   1225 C  CA   . ALA A 1 153 ? -3.982  -4.457  16.716 1.00 27.68 ? 157 ALA A CA   1 
ATOM   1226 C  C    . ALA A 1 153 ? -4.665  -5.791  16.652 1.00 29.04 ? 157 ALA A C    1 
ATOM   1227 O  O    . ALA A 1 153 ? -5.194  -6.278  17.671 1.00 27.82 ? 157 ALA A O    1 
ATOM   1228 C  CB   . ALA A 1 153 ? -2.660  -4.556  17.435 1.00 27.14 ? 157 ALA A CB   1 
ATOM   1229 N  N    . VAL A 1 154 ? -4.647  -6.377  15.448 1.00 29.59 ? 158 VAL A N    1 
ATOM   1230 C  CA   . VAL A 1 154 ? -5.313  -7.660  15.164 1.00 31.00 ? 158 VAL A CA   1 
ATOM   1231 C  C    . VAL A 1 154 ? -4.325  -8.542  14.407 1.00 31.98 ? 158 VAL A C    1 
ATOM   1232 O  O    . VAL A 1 154 ? -3.779  -8.108  13.393 1.00 32.33 ? 158 VAL A O    1 
ATOM   1233 C  CB   . VAL A 1 154 ? -6.599  -7.474  14.299 1.00 30.73 ? 158 VAL A CB   1 
ATOM   1234 C  CG1  . VAL A 1 154 ? -7.398  -8.772  14.238 1.00 29.24 ? 158 VAL A CG1  1 
ATOM   1235 C  CG2  . VAL A 1 154 ? -7.492  -6.314  14.818 1.00 30.41 ? 158 VAL A CG2  1 
ATOM   1236 N  N    . ASN A 1 155 ? -4.059  -9.742  14.916 1.00 34.22 ? 159 ASN A N    1 
ATOM   1237 C  CA   . ASN A 1 155 ? -3.165  -10.681 14.221 1.00 36.24 ? 159 ASN A CA   1 
ATOM   1238 C  C    . ASN A 1 155 ? -3.864  -11.522 13.126 1.00 37.40 ? 159 ASN A C    1 
ATOM   1239 O  O    . ASN A 1 155 ? -5.045  -11.276 12.766 1.00 37.72 ? 159 ASN A O    1 
ATOM   1240 C  CB   . ASN A 1 155 ? -2.285  -11.514 15.180 1.00 35.99 ? 159 ASN A CB   1 
ATOM   1241 C  CG   . ASN A 1 155 ? -3.069  -12.517 16.030 1.00 38.85 ? 159 ASN A CG   1 
ATOM   1242 O  OD1  . ASN A 1 155 ? -4.213  -12.890 15.720 1.00 39.32 ? 159 ASN A OD1  1 
ATOM   1243 N  ND2  . ASN A 1 155 ? -2.434  -12.976 17.126 1.00 38.33 ? 159 ASN A ND2  1 
ATOM   1244 N  N    . GLU A 1 156 ? -3.120  -12.493 12.592 1.00 38.15 ? 160 GLU A N    1 
ATOM   1245 C  CA   . GLU A 1 156 ? -3.585  -13.381 11.536 1.00 39.18 ? 160 GLU A CA   1 
ATOM   1246 C  C    . GLU A 1 156 ? -4.622  -14.337 12.093 1.00 38.03 ? 160 GLU A C    1 
ATOM   1247 O  O    . GLU A 1 156 ? -5.461  -14.831 11.370 1.00 38.41 ? 160 GLU A O    1 
ATOM   1248 C  CB   . GLU A 1 156 ? -2.401  -14.158 10.960 1.00 39.60 ? 160 GLU A CB   1 
ATOM   1249 C  CG   . GLU A 1 156 ? -1.219  -14.266 11.949 1.00 40.99 ? 160 GLU A CG   1 
ATOM   1250 C  CD   . GLU A 1 156 ? -0.088  -15.202 11.467 1.00 42.42 ? 160 GLU A CD   1 
ATOM   1251 O  OE1  . GLU A 1 156 ? 0.475   -14.947 10.347 1.00 42.83 ? 160 GLU A OE1  1 
ATOM   1252 O  OE2  . GLU A 1 156 ? 0.207   -16.189 12.221 1.00 42.61 ? 160 GLU A OE2  1 
ATOM   1253 N  N    . ASP A 1 157 ? -4.557  -14.584 13.391 1.00 36.86 ? 161 ASP A N    1 
ATOM   1254 C  CA   . ASP A 1 157 ? -5.598  -15.311 14.071 1.00 36.59 ? 161 ASP A CA   1 
ATOM   1255 C  C    . ASP A 1 157 ? -6.772  -14.458 14.512 1.00 34.61 ? 161 ASP A C    1 
ATOM   1256 O  O    . ASP A 1 157 ? -7.619  -14.958 15.231 1.00 32.95 ? 161 ASP A O    1 
ATOM   1257 C  CB   . ASP A 1 157 ? -5.027  -16.050 15.284 1.00 37.05 ? 161 ASP A CB   1 
ATOM   1258 C  CG   . ASP A 1 157 ? -4.374  -17.340 14.890 1.00 41.36 ? 161 ASP A CG   1 
ATOM   1259 O  OD1  . ASP A 1 157 ? -3.144  -17.479 15.096 1.00 45.40 ? 161 ASP A OD1  1 
ATOM   1260 O  OD2  . ASP A 1 157 ? -5.106  -18.190 14.325 1.00 44.33 ? 161 ASP A OD2  1 
ATOM   1261 N  N    . CYS A 1 158 ? -6.818  -13.192 14.088 1.00 34.25 ? 162 CYS A N    1 
ATOM   1262 C  CA   . CYS A 1 158 ? -7.940  -12.276 14.447 1.00 33.59 ? 162 CYS A CA   1 
ATOM   1263 C  C    . CYS A 1 158 ? -8.006  -12.075 16.019 1.00 34.17 ? 162 CYS A C    1 
ATOM   1264 O  O    . CYS A 1 158 ? -9.031  -11.661 16.609 1.00 35.47 ? 162 CYS A O    1 
ATOM   1265 C  CB   . CYS A 1 158 ? -9.284  -12.612 13.619 1.00 33.52 ? 162 CYS A CB   1 
ATOM   1266 S  SG   . CYS A 1 158 ? -9.609  -11.534 11.941 1.00 28.88 ? 162 CYS A SG   1 
ATOM   1267 N  N    . GLU A 1 159 ? -6.882  -12.353 16.698 1.00 33.48 ? 163 GLU A N    1 
ATOM   1268 C  CA   . GLU A 1 159 ? -6.717  -12.029 18.130 1.00 34.11 ? 163 GLU A CA   1 
ATOM   1269 C  C    . GLU A 1 159 ? -6.346  -10.547 18.228 1.00 32.07 ? 163 GLU A C    1 
ATOM   1270 O  O    . GLU A 1 159 ? -5.603  -10.057 17.405 1.00 32.68 ? 163 GLU A O    1 
ATOM   1271 C  CB   . GLU A 1 159 ? -5.607  -12.839 18.791 1.00 34.82 ? 163 GLU A CB   1 
ATOM   1272 C  CG   . GLU A 1 159 ? -5.926  -14.312 19.071 1.00 37.53 ? 163 GLU A CG   1 
ATOM   1273 C  CD   . GLU A 1 159 ? -4.663  -15.145 19.355 1.00 37.04 ? 163 GLU A CD   1 
ATOM   1274 O  OE1  . GLU A 1 159 ? -4.818  -16.303 19.784 1.00 43.57 ? 163 GLU A OE1  1 
ATOM   1275 O  OE2  . GLU A 1 159 ? -3.526  -14.664 19.147 1.00 39.03 ? 163 GLU A OE2  1 
ATOM   1276 N  N    . LEU A 1 160 ? -6.885  -9.846  19.215 1.00 30.14 ? 164 LEU A N    1 
ATOM   1277 C  CA   . LEU A 1 160 ? -6.867  -8.391  19.228 1.00 28.24 ? 164 LEU A CA   1 
ATOM   1278 C  C    . LEU A 1 160 ? -6.262  -7.806  20.530 1.00 28.32 ? 164 LEU A C    1 
ATOM   1279 O  O    . LEU A 1 160 ? -6.500  -8.337  21.619 1.00 27.27 ? 164 LEU A O    1 
ATOM   1280 C  CB   . LEU A 1 160 ? -8.316  -7.880  19.003 1.00 27.16 ? 164 LEU A CB   1 
ATOM   1281 C  CG   . LEU A 1 160 ? -8.736  -6.420  19.273 1.00 26.52 ? 164 LEU A CG   1 
ATOM   1282 C  CD1  . LEU A 1 160 ? -9.990  -6.073  18.420 1.00 22.07 ? 164 LEU A CD1  1 
ATOM   1283 C  CD2  . LEU A 1 160 ? -8.914  -6.019  20.807 1.00 17.60 ? 164 LEU A CD2  1 
ATOM   1284 N  N    . LYS A 1 161 ? -5.486  -6.721  20.399 1.00 27.85 ? 165 LYS A N    1 
ATOM   1285 C  CA   . LYS A 1 161 ? -5.171  -5.864  21.539 1.00 28.67 ? 165 LYS A CA   1 
ATOM   1286 C  C    . LYS A 1 161 ? -5.425  -4.385  21.363 1.00 26.29 ? 165 LYS A C    1 
ATOM   1287 O  O    . LYS A 1 161 ? -5.381  -3.822  20.267 1.00 25.43 ? 165 LYS A O    1 
ATOM   1288 C  CB   . LYS A 1 161 ? -3.781  -6.116  22.183 1.00 30.07 ? 165 LYS A CB   1 
ATOM   1289 C  CG   . LYS A 1 161 ? -2.748  -6.750  21.357 1.00 31.80 ? 165 LYS A CG   1 
ATOM   1290 C  CD   . LYS A 1 161 ? -1.619  -7.331  22.233 1.00 32.92 ? 165 LYS A CD   1 
ATOM   1291 C  CE   . LYS A 1 161 ? -2.127  -8.458  23.086 1.00 39.11 ? 165 LYS A CE   1 
ATOM   1292 N  NZ   . LYS A 1 161 ? -1.193  -8.840  24.180 1.00 38.11 ? 165 LYS A NZ   1 
ATOM   1293 N  N    . ILE A 1 162 ? -5.790  -3.795  22.490 1.00 24.39 ? 166 ILE A N    1 
ATOM   1294 C  CA   . ILE A 1 162 ? -5.976  -2.388  22.636 1.00 22.35 ? 166 ILE A CA   1 
ATOM   1295 C  C    . ILE A 1 162 ? -4.629  -1.750  22.885 1.00 22.80 ? 166 ILE A C    1 
ATOM   1296 O  O    . ILE A 1 162 ? -3.844  -2.204  23.717 1.00 22.25 ? 166 ILE A O    1 
ATOM   1297 C  CB   . ILE A 1 162 ? -7.019  -2.069  23.777 1.00 23.13 ? 166 ILE A CB   1 
ATOM   1298 C  CG1  . ILE A 1 162 ? -8.401  -2.673  23.406 1.00 19.44 ? 166 ILE A CG1  1 
ATOM   1299 C  CG2  . ILE A 1 162 ? -7.130  -0.555  23.986 1.00 20.55 ? 166 ILE A CG2  1 
ATOM   1300 C  CD1  . ILE A 1 162 ? -9.475  -2.683  24.556 1.00 22.69 ? 166 ILE A CD1  1 
ATOM   1301 N  N    . LEU A 1 163 ? -4.364  -0.696  22.113 1.00 22.71 ? 167 LEU A N    1 
ATOM   1302 C  CA   . LEU A 1 163 ? -3.267  0.212   22.380 1.00 23.85 ? 167 LEU A CA   1 
ATOM   1303 C  C    . LEU A 1 163 ? -3.713  1.671   22.137 1.00 24.21 ? 167 LEU A C    1 
ATOM   1304 O  O    . LEU A 1 163 ? -4.881  1.965   21.871 1.00 24.53 ? 167 LEU A O    1 
ATOM   1305 C  CB   . LEU A 1 163 ? -2.018  -0.160  21.553 1.00 22.04 ? 167 LEU A CB   1 
ATOM   1306 C  CG   . LEU A 1 163 ? -2.342  -0.238  20.067 1.00 24.08 ? 167 LEU A CG   1 
ATOM   1307 C  CD1  . LEU A 1 163 ? -1.896  0.996   19.333 1.00 26.51 ? 167 LEU A CD1  1 
ATOM   1308 C  CD2  . LEU A 1 163 ? -1.708  -1.451  19.477 1.00 26.26 ? 167 LEU A CD2  1 
ATOM   1309 N  N    . ASP A 1 164 ? -2.779  2.584   22.274 1.00 25.68 ? 168 ASP A N    1 
ATOM   1310 C  CA   . ASP A 1 164 ? -3.014  3.950   21.910 1.00 28.49 ? 168 ASP A CA   1 
ATOM   1311 C  C    . ASP A 1 164 ? -1.696  4.460   21.328 1.00 31.81 ? 168 ASP A C    1 
ATOM   1312 O  O    . ASP A 1 164 ? -0.684  4.563   22.039 1.00 32.09 ? 168 ASP A O    1 
ATOM   1313 C  CB   . ASP A 1 164 ? -3.390  4.777   23.160 1.00 28.61 ? 168 ASP A CB   1 
ATOM   1314 C  CG   . ASP A 1 164 ? -3.835  6.192   22.812 1.00 28.10 ? 168 ASP A CG   1 
ATOM   1315 O  OD1  . ASP A 1 164 ? -3.885  6.544   21.614 1.00 26.84 ? 168 ASP A OD1  1 
ATOM   1316 O  OD2  . ASP A 1 164 ? -4.158  6.949   23.725 1.00 25.16 ? 168 ASP A OD2  1 
ATOM   1317 N  N    . PHE A 1 165 ? -1.700  4.733   20.035 1.00 34.89 ? 169 PHE A N    1 
ATOM   1318 C  CA   . PHE A 1 165 ? -0.694  5.577   19.401 1.00 38.89 ? 169 PHE A CA   1 
ATOM   1319 C  C    . PHE A 1 165 ? -0.707  7.078   19.808 1.00 40.29 ? 169 PHE A C    1 
ATOM   1320 O  O    . PHE A 1 165 ? -0.108  7.461   20.802 1.00 42.12 ? 169 PHE A O    1 
ATOM   1321 C  CB   . PHE A 1 165 ? -0.866  5.456   17.886 1.00 38.54 ? 169 PHE A CB   1 
ATOM   1322 C  CG   . PHE A 1 165 ? -0.443  4.147   17.343 1.00 39.88 ? 169 PHE A CG   1 
ATOM   1323 C  CD1  . PHE A 1 165 ? 0.863   3.713   17.493 1.00 38.52 ? 169 PHE A CD1  1 
ATOM   1324 C  CD2  . PHE A 1 165 ? -1.336  3.357   16.642 1.00 40.94 ? 169 PHE A CD2  1 
ATOM   1325 C  CE1  . PHE A 1 165 ? 1.267   2.518   16.973 1.00 39.97 ? 169 PHE A CE1  1 
ATOM   1326 C  CE2  . PHE A 1 165 ? -0.937  2.158   16.110 1.00 40.63 ? 169 PHE A CE2  1 
ATOM   1327 C  CZ   . PHE A 1 165 ? 0.364   1.728   16.280 1.00 41.45 ? 169 PHE A CZ   1 
ATOM   1328 N  N    . GLY A 1 166 ? -1.364  7.921   19.011 1.00 43.00 ? 170 GLY A N    1 
ATOM   1329 C  CA   . GLY A 1 166 ? -1.349  9.401   19.169 1.00 44.41 ? 170 GLY A CA   1 
ATOM   1330 C  C    . GLY A 1 166 ? -0.879  10.132  17.904 1.00 45.65 ? 170 GLY A C    1 
ATOM   1331 O  O    . GLY A 1 166 ? 0.054   10.976  17.935 1.00 46.58 ? 170 GLY A O    1 
ATOM   1332 N  N    . TYR A 1 178 ? -6.934  6.054   7.278  1.00 64.42 ? 182 TYR A N    1 
ATOM   1333 C  CA   . TYR A 1 178 ? -8.140  6.715   7.788  1.00 63.91 ? 182 TYR A CA   1 
ATOM   1334 C  C    . TYR A 1 178 ? -7.722  8.068   8.326  1.00 63.47 ? 182 TYR A C    1 
ATOM   1335 O  O    . TYR A 1 178 ? -7.189  8.872   7.560  1.00 63.86 ? 182 TYR A O    1 
ATOM   1336 N  N    . VAL A 1 179 ? -7.958  8.362   9.614  1.00 62.68 ? 183 VAL A N    1 
ATOM   1337 C  CA   . VAL A 1 179 ? -8.817  7.614   10.560 1.00 61.44 ? 183 VAL A CA   1 
ATOM   1338 C  C    . VAL A 1 179 ? -9.072  8.632   11.670 1.00 60.11 ? 183 VAL A C    1 
ATOM   1339 O  O    . VAL A 1 179 ? -8.311  8.681   12.649 1.00 60.29 ? 183 VAL A O    1 
ATOM   1340 C  CB   . VAL A 1 179 ? -8.131  6.391   11.265 1.00 61.93 ? 183 VAL A CB   1 
ATOM   1341 C  CG1  . VAL A 1 179 ? -9.176  5.339   11.662 1.00 61.53 ? 183 VAL A CG1  1 
ATOM   1342 C  CG2  . VAL A 1 179 ? -6.955  5.791   10.455 1.00 62.31 ? 183 VAL A CG2  1 
ATOM   1343 N  N    . ALA A 1 180 ? -10.113 9.453   11.530 1.00 58.15 ? 184 ALA A N    1 
ATOM   1344 C  CA   . ALA A 1 180 ? -10.301 10.571  12.458 1.00 55.53 ? 184 ALA A CA   1 
ATOM   1345 C  C    . ALA A 1 180 ? -10.898 10.138  13.790 1.00 53.84 ? 184 ALA A C    1 
ATOM   1346 O  O    . ALA A 1 180 ? -11.877 9.398   13.848 1.00 53.82 ? 184 ALA A O    1 
ATOM   1347 C  CB   . ALA A 1 180 ? -11.124 11.681  11.823 1.00 55.77 ? 184 ALA A CB   1 
ATOM   1348 N  N    . THR A 1 181 ? -10.288 10.619  14.861 1.00 51.61 ? 185 THR A N    1 
ATOM   1349 C  CA   . THR A 1 181 ? -10.705 10.301  16.222 1.00 49.93 ? 185 THR A CA   1 
ATOM   1350 C  C    . THR A 1 181 ? -12.141 10.704  16.524 1.00 48.76 ? 185 THR A C    1 
ATOM   1351 O  O    . THR A 1 181 ? -12.814 10.042  17.332 1.00 48.11 ? 185 THR A O    1 
ATOM   1352 C  CB   . THR A 1 181 ? -9.729  10.939  17.247 1.00 50.02 ? 185 THR A CB   1 
ATOM   1353 O  OG1  . THR A 1 181 ? -8.526  10.154  17.305 1.00 48.31 ? 185 THR A OG1  1 
ATOM   1354 C  CG2  . THR A 1 181 ? -10.349 11.036  18.638 1.00 50.06 ? 185 THR A CG2  1 
ATOM   1355 N  N    . ARG A 1 182 ? -12.596 11.776  15.859 1.00 47.67 ? 186 ARG A N    1 
ATOM   1356 C  CA   . ARG A 1 182 ? -13.924 12.374  16.088 1.00 46.04 ? 186 ARG A CA   1 
ATOM   1357 C  C    . ARG A 1 182 ? -15.047 11.454  15.688 1.00 43.90 ? 186 ARG A C    1 
ATOM   1358 O  O    . ARG A 1 182 ? -16.059 11.402  16.366 1.00 43.54 ? 186 ARG A O    1 
ATOM   1359 C  CB   . ARG A 1 182 ? -14.074 13.743  15.394 1.00 46.80 ? 186 ARG A CB   1 
ATOM   1360 C  CG   . ARG A 1 182 ? -14.270 13.705  13.866 1.00 47.62 ? 186 ARG A CG   1 
ATOM   1361 C  CD   . ARG A 1 182 ? -14.430 15.100  13.268 1.00 47.69 ? 186 ARG A CD   1 
ATOM   1362 N  NE   . ARG A 1 182 ? -13.869 15.148  11.911 1.00 51.63 ? 186 ARG A NE   1 
ATOM   1363 C  CZ   . ARG A 1 182 ? -12.589 15.406  11.635 1.00 53.22 ? 186 ARG A CZ   1 
ATOM   1364 N  NH1  . ARG A 1 182 ? -11.735 15.655  12.624 1.00 52.43 ? 186 ARG A NH1  1 
ATOM   1365 N  NH2  . ARG A 1 182 ? -12.153 15.413  10.370 1.00 52.24 ? 186 ARG A NH2  1 
ATOM   1366 N  N    . TRP A 1 183 ? -14.865 10.694  14.608 1.00 42.57 ? 187 TRP A N    1 
ATOM   1367 C  CA   . TRP A 1 183 ? -15.899 9.741   14.178 1.00 40.19 ? 187 TRP A CA   1 
ATOM   1368 C  C    . TRP A 1 183 ? -16.342 8.803   15.273 1.00 38.74 ? 187 TRP A C    1 
ATOM   1369 O  O    . TRP A 1 183 ? -17.451 8.309   15.233 1.00 38.12 ? 187 TRP A O    1 
ATOM   1370 C  CB   . TRP A 1 183 ? -15.464 8.940   12.949 1.00 41.08 ? 187 TRP A CB   1 
ATOM   1371 C  CG   . TRP A 1 183 ? -15.059 9.806   11.803 1.00 41.25 ? 187 TRP A CG   1 
ATOM   1372 C  CD1  . TRP A 1 183 ? -15.401 11.111  11.601 1.00 40.63 ? 187 TRP A CD1  1 
ATOM   1373 C  CD2  . TRP A 1 183 ? -14.239 9.424   10.693 1.00 42.24 ? 187 TRP A CD2  1 
ATOM   1374 N  NE1  . TRP A 1 183 ? -14.831 11.573  10.441 1.00 43.13 ? 187 TRP A NE1  1 
ATOM   1375 C  CE2  . TRP A 1 183 ? -14.103 10.565  9.865  1.00 43.16 ? 187 TRP A CE2  1 
ATOM   1376 C  CE3  . TRP A 1 183 ? -13.599 8.233   10.321 1.00 41.07 ? 187 TRP A CE3  1 
ATOM   1377 C  CZ2  . TRP A 1 183 ? -13.354 10.552  8.678  1.00 43.08 ? 187 TRP A CZ2  1 
ATOM   1378 C  CZ3  . TRP A 1 183 ? -12.859 8.216   9.163  1.00 42.08 ? 187 TRP A CZ3  1 
ATOM   1379 C  CH2  . TRP A 1 183 ? -12.743 9.376   8.342  1.00 42.83 ? 187 TRP A CH2  1 
ATOM   1380 N  N    . TYR A 1 184 ? -15.488 8.586   16.270 1.00 37.44 ? 188 TYR A N    1 
ATOM   1381 C  CA   . TYR A 1 184 ? -15.735 7.571   17.296 1.00 36.69 ? 188 TYR A CA   1 
ATOM   1382 C  C    . TYR A 1 184 ? -15.941 8.227   18.656 1.00 36.74 ? 188 TYR A C    1 
ATOM   1383 O  O    . TYR A 1 184 ? -16.145 7.571   19.669 1.00 35.85 ? 188 TYR A O    1 
ATOM   1384 C  CB   . TYR A 1 184 ? -14.575 6.559   17.295 1.00 36.78 ? 188 TYR A CB   1 
ATOM   1385 C  CG   . TYR A 1 184 ? -14.294 5.988   15.912 1.00 35.24 ? 188 TYR A CG   1 
ATOM   1386 C  CD1  . TYR A 1 184 ? -13.391 6.594   15.052 1.00 36.21 ? 188 TYR A CD1  1 
ATOM   1387 C  CD2  . TYR A 1 184 ? -14.968 4.872   15.462 1.00 34.66 ? 188 TYR A CD2  1 
ATOM   1388 C  CE1  . TYR A 1 184 ? -13.141 6.079   13.776 1.00 36.69 ? 188 TYR A CE1  1 
ATOM   1389 C  CE2  . TYR A 1 184 ? -14.746 4.366   14.202 1.00 34.95 ? 188 TYR A CE2  1 
ATOM   1390 C  CZ   . TYR A 1 184 ? -13.840 4.971   13.355 1.00 36.06 ? 188 TYR A CZ   1 
ATOM   1391 O  OH   . TYR A 1 184 ? -13.631 4.437   12.088 1.00 35.73 ? 188 TYR A OH   1 
ATOM   1392 N  N    . ARG A 1 185 ? -15.929 9.551   18.660 1.00 38.10 ? 189 ARG A N    1 
ATOM   1393 C  CA   . ARG A 1 185 ? -16.020 10.307  19.911 1.00 39.53 ? 189 ARG A CA   1 
ATOM   1394 C  C    . ARG A 1 185 ? -17.430 10.407  20.431 1.00 39.79 ? 189 ARG A C    1 
ATOM   1395 O  O    . ARG A 1 185 ? -18.338 10.815  19.711 1.00 40.35 ? 189 ARG A O    1 
ATOM   1396 C  CB   . ARG A 1 185 ? -15.481 11.706  19.721 1.00 39.65 ? 189 ARG A CB   1 
ATOM   1397 C  CG   . ARG A 1 185 ? -14.009 11.791  19.771 1.00 43.87 ? 189 ARG A CG   1 
ATOM   1398 C  CD   . ARG A 1 185 ? -13.496 12.050  21.175 1.00 48.69 ? 189 ARG A CD   1 
ATOM   1399 N  NE   . ARG A 1 185 ? -12.032 11.979  21.176 1.00 51.46 ? 189 ARG A NE   1 
ATOM   1400 C  CZ   . ARG A 1 185 ? -11.265 12.143  22.249 1.00 48.88 ? 189 ARG A CZ   1 
ATOM   1401 N  NH1  . ARG A 1 185 ? -11.815 12.387  23.424 1.00 49.84 ? 189 ARG A NH1  1 
ATOM   1402 N  NH2  . ARG A 1 185 ? -9.951  12.053  22.141 1.00 46.44 ? 189 ARG A NH2  1 
ATOM   1403 N  N    . ALA A 1 186 ? -17.601 10.068  21.700 1.00 40.49 ? 190 ALA A N    1 
ATOM   1404 C  CA   . ALA A 1 186 ? -18.841 10.326  22.395 1.00 40.92 ? 190 ALA A CA   1 
ATOM   1405 C  C    . ALA A 1 186 ? -19.253 11.807  22.224 1.00 42.06 ? 190 ALA A C    1 
ATOM   1406 O  O    . ALA A 1 186 ? -18.386 12.707  22.132 1.00 40.93 ? 190 ALA A O    1 
ATOM   1407 C  CB   . ALA A 1 186 ? -18.697 9.953   23.838 1.00 40.39 ? 190 ALA A CB   1 
ATOM   1408 N  N    . PRO A 1 187 ? -20.573 12.064  22.132 1.00 43.32 ? 191 PRO A N    1 
ATOM   1409 C  CA   . PRO A 1 187 ? -21.021 13.442  21.875 1.00 45.10 ? 191 PRO A CA   1 
ATOM   1410 C  C    . PRO A 1 187 ? -20.584 14.422  23.005 1.00 46.65 ? 191 PRO A C    1 
ATOM   1411 O  O    . PRO A 1 187 ? -20.206 15.561  22.723 1.00 47.10 ? 191 PRO A O    1 
ATOM   1412 C  CB   . PRO A 1 187 ? -22.554 13.297  21.807 1.00 44.97 ? 191 PRO A CB   1 
ATOM   1413 C  CG   . PRO A 1 187 ? -22.853 12.064  22.598 1.00 43.30 ? 191 PRO A CG   1 
ATOM   1414 C  CD   . PRO A 1 187 ? -21.712 11.142  22.302 1.00 43.24 ? 191 PRO A CD   1 
ATOM   1415 N  N    . GLU A 1 188 ? -20.589 13.950  24.251 1.00 48.47 ? 192 GLU A N    1 
ATOM   1416 C  CA   . GLU A 1 188 ? -20.198 14.761  25.418 1.00 50.68 ? 192 GLU A CA   1 
ATOM   1417 C  C    . GLU A 1 188 ? -18.764 15.265  25.380 1.00 52.38 ? 192 GLU A C    1 
ATOM   1418 O  O    . GLU A 1 188 ? -18.405 16.182  26.117 1.00 53.74 ? 192 GLU A O    1 
ATOM   1419 C  CB   . GLU A 1 188 ? -20.421 13.989  26.717 1.00 50.46 ? 192 GLU A CB   1 
ATOM   1420 C  CG   . GLU A 1 188 ? -19.551 12.747  26.891 1.00 51.03 ? 192 GLU A CG   1 
ATOM   1421 C  CD   . GLU A 1 188 ? -20.329 11.446  26.767 1.00 50.70 ? 192 GLU A CD   1 
ATOM   1422 O  OE1  . GLU A 1 188 ? -20.125 10.546  27.614 1.00 51.01 ? 192 GLU A OE1  1 
ATOM   1423 O  OE2  . GLU A 1 188 ? -21.137 11.313  25.828 1.00 49.32 ? 192 GLU A OE2  1 
ATOM   1424 N  N    . ILE A 1 189 ? -17.937 14.675  24.528 1.00 53.91 ? 193 ILE A N    1 
ATOM   1425 C  CA   . ILE A 1 189 ? -16.554 15.091  24.417 1.00 54.98 ? 193 ILE A CA   1 
ATOM   1426 C  C    . ILE A 1 189 ? -16.391 16.222  23.414 1.00 56.32 ? 193 ILE A C    1 
ATOM   1427 O  O    . ILE A 1 189 ? -15.520 17.084  23.567 1.00 56.55 ? 193 ILE A O    1 
ATOM   1428 C  CB   . ILE A 1 189 ? -15.657 13.915  24.041 1.00 55.04 ? 193 ILE A CB   1 
ATOM   1429 C  CG1  . ILE A 1 189 ? -15.549 12.946  25.238 1.00 55.97 ? 193 ILE A CG1  1 
ATOM   1430 C  CG2  . ILE A 1 189 ? -14.299 14.422  23.582 1.00 55.97 ? 193 ILE A CG2  1 
ATOM   1431 C  CD1  . ILE A 1 189 ? -14.806 11.632  24.968 1.00 54.49 ? 193 ILE A CD1  1 
ATOM   1432 N  N    . MET A 1 190 ? -17.225 16.239  22.383 1.00 57.62 ? 194 MET A N    1 
ATOM   1433 C  CA   . MET A 1 190 ? -17.043 17.254  21.350 1.00 58.96 ? 194 MET A CA   1 
ATOM   1434 C  C    . MET A 1 190 ? -17.699 18.595  21.634 1.00 60.14 ? 194 MET A C    1 
ATOM   1435 O  O    . MET A 1 190 ? -17.344 19.601  21.024 1.00 60.37 ? 194 MET A O    1 
ATOM   1436 C  CB   . MET A 1 190 ? -17.447 16.710  20.014 1.00 58.51 ? 194 MET A CB   1 
ATOM   1437 C  CG   . MET A 1 190 ? -16.498 15.655  19.600 1.00 57.24 ? 194 MET A CG   1 
ATOM   1438 S  SD   . MET A 1 190 ? -17.236 14.976  18.193 1.00 55.24 ? 194 MET A SD   1 
ATOM   1439 C  CE   . MET A 1 190 ? -18.551 14.071  18.995 1.00 56.39 ? 194 MET A CE   1 
ATOM   1440 N  N    . LEU A 1 191 ? -18.651 18.597  22.564 1.00 61.76 ? 195 LEU A N    1 
ATOM   1441 C  CA   . LEU A 1 191 ? -18.979 19.803  23.300 1.00 63.19 ? 195 LEU A CA   1 
ATOM   1442 C  C    . LEU A 1 191 ? -17.789 19.900  24.264 1.00 64.36 ? 195 LEU A C    1 
ATOM   1443 O  O    . LEU A 1 191 ? -16.728 19.359  23.980 1.00 64.38 ? 195 LEU A O    1 
ATOM   1444 C  CB   . LEU A 1 191 ? -20.323 19.658  24.033 1.00 62.91 ? 195 LEU A CB   1 
ATOM   1445 C  CG   . LEU A 1 191 ? -21.612 19.070  23.403 1.00 63.61 ? 195 LEU A CG   1 
ATOM   1446 C  CD1  . LEU A 1 191 ? -22.863 19.487  24.205 1.00 63.29 ? 195 LEU A CD1  1 
ATOM   1447 C  CD2  . LEU A 1 191 ? -21.816 19.422  21.928 1.00 63.82 ? 195 LEU A CD2  1 
ATOM   1448 N  N    . ASN A 1 192 ? -17.924 20.568  25.397 1.00 65.88 ? 196 ASN A N    1 
ATOM   1449 C  CA   . ASN A 1 192 ? -16.835 20.522  26.368 1.00 67.26 ? 196 ASN A CA   1 
ATOM   1450 C  C    . ASN A 1 192 ? -17.385 19.878  27.628 1.00 68.03 ? 196 ASN A C    1 
ATOM   1451 O  O    . ASN A 1 192 ? -18.535 20.133  27.985 1.00 68.44 ? 196 ASN A O    1 
ATOM   1452 C  CB   . ASN A 1 192 ? -16.316 21.943  26.643 1.00 67.49 ? 196 ASN A CB   1 
ATOM   1453 C  CG   . ASN A 1 192 ? -14.786 22.016  26.815 1.00 67.90 ? 196 ASN A CG   1 
ATOM   1454 O  OD1  . ASN A 1 192 ? -14.277 22.963  27.426 1.00 68.39 ? 196 ASN A OD1  1 
ATOM   1455 N  ND2  . ASN A 1 192 ? -14.058 21.035  26.272 1.00 66.60 ? 196 ASN A ND2  1 
ATOM   1456 N  N    . TRP A 1 193 ? -16.613 19.033  28.305 1.00 68.87 ? 197 TRP A N    1 
ATOM   1457 C  CA   . TRP A 1 193 ? -17.087 18.640  29.627 1.00 69.46 ? 197 TRP A CA   1 
ATOM   1458 C  C    . TRP A 1 193 ? -16.415 19.350  30.842 1.00 69.72 ? 197 TRP A C    1 
ATOM   1459 O  O    . TRP A 1 193 ? -17.001 20.327  31.322 1.00 69.76 ? 197 TRP A O    1 
ATOM   1460 C  CB   . TRP A 1 193 ? -17.381 17.138  29.734 1.00 69.94 ? 197 TRP A CB   1 
ATOM   1461 C  CG   . TRP A 1 193 ? -18.858 16.921  30.127 1.00 70.44 ? 197 TRP A CG   1 
ATOM   1462 C  CD1  . TRP A 1 193 ? -19.335 16.425  31.313 1.00 70.50 ? 197 TRP A CD1  1 
ATOM   1463 C  CD2  . TRP A 1 193 ? -20.018 17.240  29.339 1.00 70.19 ? 197 TRP A CD2  1 
ATOM   1464 N  NE1  . TRP A 1 193 ? -20.706 16.406  31.305 1.00 70.40 ? 197 TRP A NE1  1 
ATOM   1465 C  CE2  . TRP A 1 193 ? -21.152 16.896  30.105 1.00 70.69 ? 197 TRP A CE2  1 
ATOM   1466 C  CE3  . TRP A 1 193 ? -20.209 17.779  28.056 1.00 70.54 ? 197 TRP A CE3  1 
ATOM   1467 C  CZ2  . TRP A 1 193 ? -22.460 17.071  29.628 1.00 70.60 ? 197 TRP A CZ2  1 
ATOM   1468 C  CZ3  . TRP A 1 193 ? -21.504 17.954  27.586 1.00 70.26 ? 197 TRP A CZ3  1 
ATOM   1469 C  CH2  . TRP A 1 193 ? -22.611 17.597  28.368 1.00 70.24 ? 197 TRP A CH2  1 
ATOM   1470 N  N    . MET A 1 194 ? -15.287 18.910  31.415 1.00 69.72 ? 198 MET A N    1 
ATOM   1471 C  CA   . MET A 1 194 ? -14.886 17.525  31.584 1.00 69.83 ? 198 MET A CA   1 
ATOM   1472 C  C    . MET A 1 194 ? -15.879 17.002  32.623 1.00 68.49 ? 198 MET A C    1 
ATOM   1473 O  O    . MET A 1 194 ? -16.919 17.621  32.826 1.00 68.64 ? 198 MET A O    1 
ATOM   1474 C  CB   . MET A 1 194 ? -13.436 17.438  32.080 1.00 69.65 ? 198 MET A CB   1 
ATOM   1475 C  CG   . MET A 1 194 ? -12.454 18.321  31.287 1.00 71.03 ? 198 MET A CG   1 
ATOM   1476 S  SD   . MET A 1 194 ? -10.883 18.682  32.140 1.00 72.79 ? 198 MET A SD   1 
ATOM   1477 C  CE   . MET A 1 194 ? -11.401 19.840  33.430 1.00 73.02 ? 198 MET A CE   1 
ATOM   1478 N  N    . HIS A 1 195 ? -15.568 15.903  33.298 1.00 67.18 ? 199 HIS A N    1 
ATOM   1479 C  CA   . HIS A 1 195 ? -16.600 15.038  33.892 1.00 65.98 ? 199 HIS A CA   1 
ATOM   1480 C  C    . HIS A 1 195 ? -16.984 13.980  32.837 1.00 64.92 ? 199 HIS A C    1 
ATOM   1481 O  O    . HIS A 1 195 ? -18.164 13.718  32.573 1.00 65.06 ? 199 HIS A O    1 
ATOM   1482 C  CB   . HIS A 1 195 ? -17.844 15.807  34.403 1.00 65.92 ? 199 HIS A CB   1 
ATOM   1483 C  CG   . HIS A 1 195 ? -17.546 16.866  35.428 1.00 66.39 ? 199 HIS A CG   1 
ATOM   1484 N  ND1  . HIS A 1 195 ? -16.645 16.685  36.457 1.00 66.85 ? 199 HIS A ND1  1 
ATOM   1485 C  CD2  . HIS A 1 195 ? -18.050 18.115  35.590 1.00 66.21 ? 199 HIS A CD2  1 
ATOM   1486 C  CE1  . HIS A 1 195 ? -16.596 17.779  37.196 1.00 66.25 ? 199 HIS A CE1  1 
ATOM   1487 N  NE2  . HIS A 1 195 ? -17.441 18.660  36.693 1.00 66.14 ? 199 HIS A NE2  1 
ATOM   1488 N  N    . TYR A 1 196 ? -15.950 13.413  32.214 1.00 63.36 ? 200 TYR A N    1 
ATOM   1489 C  CA   . TYR A 1 196 ? -16.048 12.193  31.442 1.00 61.76 ? 200 TYR A CA   1 
ATOM   1490 C  C    . TYR A 1 196 ? -16.330 11.044  32.400 1.00 59.57 ? 200 TYR A C    1 
ATOM   1491 O  O    . TYR A 1 196 ? -15.676 10.938  33.437 1.00 59.83 ? 200 TYR A O    1 
ATOM   1492 C  CB   . TYR A 1 196 ? -14.681 11.842  30.854 1.00 62.97 ? 200 TYR A CB   1 
ATOM   1493 C  CG   . TYR A 1 196 ? -13.994 12.786  29.880 1.00 64.53 ? 200 TYR A CG   1 
ATOM   1494 C  CD1  . TYR A 1 196 ? -14.694 13.757  29.143 1.00 64.55 ? 200 TYR A CD1  1 
ATOM   1495 C  CD2  . TYR A 1 196 ? -12.611 12.637  29.642 1.00 66.19 ? 200 TYR A CD2  1 
ATOM   1496 C  CE1  . TYR A 1 196 ? -14.004 14.595  28.218 1.00 65.30 ? 200 TYR A CE1  1 
ATOM   1497 C  CE2  . TYR A 1 196 ? -11.932 13.441  28.728 1.00 66.09 ? 200 TYR A CE2  1 
ATOM   1498 C  CZ   . TYR A 1 196 ? -12.620 14.411  28.017 1.00 65.40 ? 200 TYR A CZ   1 
ATOM   1499 O  OH   . TYR A 1 196 ? -11.894 15.174  27.118 1.00 65.79 ? 200 TYR A OH   1 
ATOM   1500 N  N    . ASN A 1 197 ? -17.255 10.161  32.066 1.00 56.62 ? 201 ASN A N    1 
ATOM   1501 C  CA   . ASN A 1 197 ? -17.232 8.841   32.693 1.00 53.92 ? 201 ASN A CA   1 
ATOM   1502 C  C    . ASN A 1 197 ? -16.618 7.822   31.708 1.00 51.46 ? 201 ASN A C    1 
ATOM   1503 O  O    . ASN A 1 197 ? -16.341 8.154   30.548 1.00 51.63 ? 201 ASN A O    1 
ATOM   1504 C  CB   . ASN A 1 197 ? -18.617 8.413   33.178 1.00 54.67 ? 201 ASN A CB   1 
ATOM   1505 C  CG   . ASN A 1 197 ? -19.423 7.714   32.096 1.00 56.50 ? 201 ASN A CG   1 
ATOM   1506 O  OD1  . ASN A 1 197 ? -19.439 8.156   30.939 1.00 60.34 ? 201 ASN A OD1  1 
ATOM   1507 N  ND2  . ASN A 1 197 ? -20.098 6.616   32.461 1.00 55.77 ? 201 ASN A ND2  1 
ATOM   1508 N  N    . GLN A 1 198 ? -16.397 6.599   32.180 1.00 47.82 ? 202 GLN A N    1 
ATOM   1509 C  CA   . GLN A 1 198 ? -15.748 5.557   31.411 1.00 44.22 ? 202 GLN A CA   1 
ATOM   1510 C  C    . GLN A 1 198 ? -16.466 5.154   30.124 1.00 42.11 ? 202 GLN A C    1 
ATOM   1511 O  O    . GLN A 1 198 ? -15.812 4.745   29.180 1.00 40.24 ? 202 GLN A O    1 
ATOM   1512 C  CB   . GLN A 1 198 ? -15.527 4.343   32.295 1.00 44.67 ? 202 GLN A CB   1 
ATOM   1513 C  CG   . GLN A 1 198 ? -14.479 4.569   33.384 1.00 44.28 ? 202 GLN A CG   1 
ATOM   1514 C  CD   . GLN A 1 198 ? -14.414 3.418   34.348 1.00 43.52 ? 202 GLN A CD   1 
ATOM   1515 O  OE1  . GLN A 1 198 ? -15.365 2.672   34.472 1.00 45.97 ? 202 GLN A OE1  1 
ATOM   1516 N  NE2  . GLN A 1 198 ? -13.290 3.248   35.006 1.00 41.86 ? 202 GLN A NE2  1 
ATOM   1517 N  N    . THR A 1 199 ? -17.800 5.297   30.076 1.00 40.05 ? 203 THR A N    1 
ATOM   1518 C  CA   . THR A 1 199 ? -18.592 4.811   28.935 1.00 37.86 ? 203 THR A CA   1 
ATOM   1519 C  C    . THR A 1 199 ? -18.511 5.716   27.726 1.00 36.38 ? 203 THR A C    1 
ATOM   1520 O  O    . THR A 1 199 ? -19.263 5.534   26.782 1.00 36.35 ? 203 THR A O    1 
ATOM   1521 C  CB   . THR A 1 199 ? -20.100 4.579   29.263 1.00 38.84 ? 203 THR A CB   1 
ATOM   1522 O  OG1  . THR A 1 199 ? -20.753 5.848   29.470 1.00 37.60 ? 203 THR A OG1  1 
ATOM   1523 C  CG2  . THR A 1 199 ? -20.283 3.616   30.481 1.00 37.79 ? 203 THR A CG2  1 
ATOM   1524 N  N    . VAL A 1 200 ? -17.631 6.718   27.764 1.00 34.75 ? 204 VAL A N    1 
ATOM   1525 C  CA   . VAL A 1 200 ? -17.210 7.390   26.531 1.00 32.59 ? 204 VAL A CA   1 
ATOM   1526 C  C    . VAL A 1 200 ? -16.548 6.358   25.614 1.00 31.17 ? 204 VAL A C    1 
ATOM   1527 O  O    . VAL A 1 200 ? -16.537 6.514   24.392 1.00 30.26 ? 204 VAL A O    1 
ATOM   1528 C  CB   . VAL A 1 200 ? -16.190 8.509   26.776 1.00 32.69 ? 204 VAL A CB   1 
ATOM   1529 C  CG1  . VAL A 1 200 ? -16.848 9.678   27.536 1.00 35.44 ? 204 VAL A CG1  1 
ATOM   1530 C  CG2  . VAL A 1 200 ? -15.000 8.000   27.529 1.00 32.07 ? 204 VAL A CG2  1 
ATOM   1531 N  N    . ASP A 1 201 ? -15.966 5.336   26.239 1.00 28.59 ? 205 ASP A N    1 
ATOM   1532 C  CA   . ASP A 1 201 ? -15.219 4.303   25.545 1.00 28.15 ? 205 ASP A CA   1 
ATOM   1533 C  C    . ASP A 1 201 ? -16.163 3.253   24.927 1.00 28.46 ? 205 ASP A C    1 
ATOM   1534 O  O    . ASP A 1 201 ? -15.936 2.791   23.823 1.00 29.00 ? 205 ASP A O    1 
ATOM   1535 C  CB   . ASP A 1 201 ? -14.258 3.645   26.514 1.00 27.03 ? 205 ASP A CB   1 
ATOM   1536 C  CG   . ASP A 1 201 ? -12.964 4.420   26.701 1.00 25.20 ? 205 ASP A CG   1 
ATOM   1537 O  OD1  . ASP A 1 201 ? -12.294 4.053   27.664 1.00 22.87 ? 205 ASP A OD1  1 
ATOM   1538 O  OD2  . ASP A 1 201 ? -12.584 5.333   25.898 1.00 23.24 ? 205 ASP A OD2  1 
ATOM   1539 N  N    . ILE A 1 202 ? -17.231 2.923   25.637 1.00 29.23 ? 206 ILE A N    1 
ATOM   1540 C  CA   . ILE A 1 202 ? -18.356 2.151   25.083 1.00 29.95 ? 206 ILE A CA   1 
ATOM   1541 C  C    . ILE A 1 202 ? -19.027 2.766   23.822 1.00 29.71 ? 206 ILE A C    1 
ATOM   1542 O  O    . ILE A 1 202 ? -19.360 2.026   22.878 1.00 29.93 ? 206 ILE A O    1 
ATOM   1543 C  CB   . ILE A 1 202 ? -19.371 1.873   26.165 1.00 30.63 ? 206 ILE A CB   1 
ATOM   1544 C  CG1  . ILE A 1 202 ? -18.729 1.053   27.280 1.00 28.47 ? 206 ILE A CG1  1 
ATOM   1545 C  CG2  . ILE A 1 202 ? -20.638 1.210   25.584 1.00 31.03 ? 206 ILE A CG2  1 
ATOM   1546 C  CD1  . ILE A 1 202 ? -18.323 -0.429  26.842 1.00 33.86 ? 206 ILE A CD1  1 
ATOM   1547 N  N    . TRP A 1 203 ? -19.217 4.086   23.795 1.00 28.35 ? 207 TRP A N    1 
ATOM   1548 C  CA   . TRP A 1 203 ? -19.675 4.790   22.587 1.00 27.39 ? 207 TRP A CA   1 
ATOM   1549 C  C    . TRP A 1 203 ? -18.833 4.481   21.350 1.00 27.40 ? 207 TRP A C    1 
ATOM   1550 O  O    . TRP A 1 203 ? -19.373 4.309   20.236 1.00 26.55 ? 207 TRP A O    1 
ATOM   1551 C  CB   . TRP A 1 203 ? -19.640 6.332   22.760 1.00 27.91 ? 207 TRP A CB   1 
ATOM   1552 C  CG   . TRP A 1 203 ? -20.138 7.085   21.538 1.00 27.20 ? 207 TRP A CG   1 
ATOM   1553 C  CD1  . TRP A 1 203 ? -19.405 7.546   20.479 1.00 26.16 ? 207 TRP A CD1  1 
ATOM   1554 C  CD2  . TRP A 1 203 ? -21.510 7.432   21.253 1.00 27.57 ? 207 TRP A CD2  1 
ATOM   1555 N  NE1  . TRP A 1 203 ? -20.243 8.179   19.548 1.00 26.67 ? 207 TRP A NE1  1 
ATOM   1556 C  CE2  . TRP A 1 203 ? -21.533 8.108   20.012 1.00 26.26 ? 207 TRP A CE2  1 
ATOM   1557 C  CE3  . TRP A 1 203 ? -22.707 7.240   21.931 1.00 26.14 ? 207 TRP A CE3  1 
ATOM   1558 C  CZ2  . TRP A 1 203 ? -22.704 8.583   19.457 1.00 27.31 ? 207 TRP A CZ2  1 
ATOM   1559 C  CZ3  . TRP A 1 203 ? -23.856 7.685   21.374 1.00 26.20 ? 207 TRP A CZ3  1 
ATOM   1560 C  CH2  . TRP A 1 203 ? -23.856 8.363   20.157 1.00 27.72 ? 207 TRP A CH2  1 
ATOM   1561 N  N    . SER A 1 204 ? -17.517 4.558   21.547 1.00 27.00 ? 208 SER A N    1 
ATOM   1562 C  CA   . SER A 1 204 ? -16.509 4.308   20.527 1.00 27.22 ? 208 SER A CA   1 
ATOM   1563 C  C    . SER A 1 204 ? -16.625 2.881   20.024 1.00 27.01 ? 208 SER A C    1 
ATOM   1564 O  O    . SER A 1 204 ? -16.726 2.667   18.815 1.00 27.01 ? 208 SER A O    1 
ATOM   1565 C  CB   . SER A 1 204 ? -15.090 4.568   21.075 1.00 27.36 ? 208 SER A CB   1 
ATOM   1566 O  OG   . SER A 1 204 ? -15.009 5.793   21.797 1.00 24.80 ? 208 SER A OG   1 
ATOM   1567 N  N    . VAL A 1 205 ? -16.607 1.923   20.952 1.00 27.19 ? 209 VAL A N    1 
ATOM   1568 C  CA   . VAL A 1 205 ? -16.902 0.523   20.665 1.00 27.25 ? 209 VAL A CA   1 
ATOM   1569 C  C    . VAL A 1 205 ? -18.194 0.337   19.836 1.00 29.18 ? 209 VAL A C    1 
ATOM   1570 O  O    . VAL A 1 205 ? -18.208 -0.437  18.833 1.00 28.81 ? 209 VAL A O    1 
ATOM   1571 C  CB   . VAL A 1 205 ? -17.035 -0.348  21.946 1.00 28.34 ? 209 VAL A CB   1 
ATOM   1572 C  CG1  . VAL A 1 205 ? -17.328 -1.819  21.534 1.00 28.29 ? 209 VAL A CG1  1 
ATOM   1573 C  CG2  . VAL A 1 205 ? -15.768 -0.281  22.822 1.00 21.37 ? 209 VAL A CG2  1 
ATOM   1574 N  N    . GLY A 1 206 ? -19.278 1.015   20.265 1.00 29.36 ? 210 GLY A N    1 
ATOM   1575 C  CA   . GLY A 1 206 ? -20.534 1.055   19.525 1.00 28.25 ? 210 GLY A CA   1 
ATOM   1576 C  C    . GLY A 1 206 ? -20.295 1.470   18.103 1.00 29.90 ? 210 GLY A C    1 
ATOM   1577 O  O    . GLY A 1 206 ? -20.771 0.805   17.142 1.00 31.03 ? 210 GLY A O    1 
ATOM   1578 N  N    . CYS A 1 207 ? -19.537 2.552   17.945 1.00 29.42 ? 211 CYS A N    1 
ATOM   1579 C  CA   . CYS A 1 207 ? -19.222 3.112   16.636 1.00 29.59 ? 211 CYS A CA   1 
ATOM   1580 C  C    . CYS A 1 207 ? -18.394 2.164   15.742 1.00 30.27 ? 211 CYS A C    1 
ATOM   1581 O  O    . CYS A 1 207 ? -18.610 2.103   14.524 1.00 30.26 ? 211 CYS A O    1 
ATOM   1582 C  CB   . CYS A 1 207 ? -18.470 4.439   16.799 1.00 29.76 ? 211 CYS A CB   1 
ATOM   1583 S  SG   . CYS A 1 207 ? -19.482 5.843   17.432 1.00 29.04 ? 211 CYS A SG   1 
ATOM   1584 N  N    . ILE A 1 208 ? -17.413 1.489   16.346 1.00 30.06 ? 212 ILE A N    1 
ATOM   1585 C  CA   . ILE A 1 208 ? -16.602 0.476   15.686 1.00 30.00 ? 212 ILE A CA   1 
ATOM   1586 C  C    . ILE A 1 208 ? -17.451 -0.758  15.312 1.00 30.38 ? 212 ILE A C    1 
ATOM   1587 O  O    . ILE A 1 208 ? -17.401 -1.229  14.175 1.00 29.17 ? 212 ILE A O    1 
ATOM   1588 C  CB   . ILE A 1 208 ? -15.394 0.044   16.576 1.00 30.52 ? 212 ILE A CB   1 
ATOM   1589 C  CG1  . ILE A 1 208 ? -14.417 1.216   16.844 1.00 28.89 ? 212 ILE A CG1  1 
ATOM   1590 C  CG2  . ILE A 1 208 ? -14.661 -1.181  15.960 1.00 30.43 ? 212 ILE A CG2  1 
ATOM   1591 C  CD1  . ILE A 1 208 ? -13.480 0.928   18.057 1.00 28.87 ? 212 ILE A CD1  1 
ATOM   1592 N  N    . MET A 1 209 ? -18.229 -1.268  16.270 1.00 31.08 ? 213 MET A N    1 
ATOM   1593 C  CA   . MET A 1 209 ? -19.101 -2.423  16.016 1.00 32.43 ? 213 MET A CA   1 
ATOM   1594 C  C    . MET A 1 209 ? -20.092 -2.238  14.855 1.00 33.63 ? 213 MET A C    1 
ATOM   1595 O  O    . MET A 1 209 ? -20.174 -3.094  13.960 1.00 33.13 ? 213 MET A O    1 
ATOM   1596 C  CB   . MET A 1 209 ? -19.839 -2.861  17.266 1.00 31.97 ? 213 MET A CB   1 
ATOM   1597 C  CG   . MET A 1 209 ? -20.713 -4.043  17.010 1.00 33.14 ? 213 MET A CG   1 
ATOM   1598 S  SD   . MET A 1 209 ? -21.615 -4.581  18.444 1.00 33.35 ? 213 MET A SD   1 
ATOM   1599 C  CE   . MET A 1 209 ? -20.599 -5.837  19.109 1.00 34.95 ? 213 MET A CE   1 
ATOM   1600 N  N    . ALA A 1 210 ? -20.837 -1.132  14.862 1.00 33.47 ? 214 ALA A N    1 
ATOM   1601 C  CA   . ALA A 1 210 ? -21.652 -0.773  13.690 1.00 34.64 ? 214 ALA A CA   1 
ATOM   1602 C  C    . ALA A 1 210 ? -20.858 -0.777  12.353 1.00 34.79 ? 214 ALA A C    1 
ATOM   1603 O  O    . ALA A 1 210 ? -21.302 -1.341  11.371 1.00 35.31 ? 214 ALA A O    1 
ATOM   1604 C  CB   . ALA A 1 210 ? -22.307 0.559   13.895 1.00 34.45 ? 214 ALA A CB   1 
ATOM   1605 N  N    . GLU A 1 211 ? -19.713 -0.117  12.323 1.00 34.12 ? 215 GLU A N    1 
ATOM   1606 C  CA   . GLU A 1 211 ? -18.847 -0.123  11.171 1.00 34.50 ? 215 GLU A CA   1 
ATOM   1607 C  C    . GLU A 1 211 ? -18.376 -1.516  10.701 1.00 34.81 ? 215 GLU A C    1 
ATOM   1608 O  O    . GLU A 1 211 ? -18.241 -1.741  9.509  1.00 35.26 ? 215 GLU A O    1 
ATOM   1609 C  CB   . GLU A 1 211 ? -17.627 0.716   11.476 1.00 35.06 ? 215 GLU A CB   1 
ATOM   1610 C  CG   . GLU A 1 211 ? -16.662 0.870   10.329 1.00 36.04 ? 215 GLU A CG   1 
ATOM   1611 C  CD   . GLU A 1 211 ? -15.564 1.814   10.669 1.00 39.95 ? 215 GLU A CD   1 
ATOM   1612 O  OE1  . GLU A 1 211 ? -15.716 2.574   11.656 1.00 42.33 ? 215 GLU A OE1  1 
ATOM   1613 O  OE2  . GLU A 1 211 ? -14.557 1.823   9.943  1.00 40.47 ? 215 GLU A OE2  1 
ATOM   1614 N  N    . LEU A 1 212 ? -18.071 -2.423  11.627 1.00 34.89 ? 216 LEU A N    1 
ATOM   1615 C  CA   . LEU A 1 212 ? -17.751 -3.801  11.261 1.00 35.40 ? 216 LEU A CA   1 
ATOM   1616 C  C    . LEU A 1 212 ? -18.975 -4.496  10.589 1.00 36.83 ? 216 LEU A C    1 
ATOM   1617 O  O    . LEU A 1 212 ? -18.825 -5.342  9.713  1.00 37.18 ? 216 LEU A O    1 
ATOM   1618 C  CB   . LEU A 1 212 ? -17.305 -4.597  12.493 1.00 34.41 ? 216 LEU A CB   1 
ATOM   1619 C  CG   . LEU A 1 212 ? -15.959 -4.285  13.177 1.00 32.44 ? 216 LEU A CG   1 
ATOM   1620 C  CD1  . LEU A 1 212 ? -15.571 -5.389  14.161 1.00 30.05 ? 216 LEU A CD1  1 
ATOM   1621 C  CD2  . LEU A 1 212 ? -14.849 -4.063  12.192 1.00 33.62 ? 216 LEU A CD2  1 
ATOM   1622 N  N    . LEU A 1 213 ? -20.174 -4.139  11.027 1.00 36.96 ? 217 LEU A N    1 
ATOM   1623 C  CA   . LEU A 1 213 ? -21.377 -4.802  10.573 1.00 38.19 ? 217 LEU A CA   1 
ATOM   1624 C  C    . LEU A 1 213 ? -21.741 -4.291  9.206  1.00 39.55 ? 217 LEU A C    1 
ATOM   1625 O  O    . LEU A 1 213 ? -22.154 -5.044  8.330  1.00 40.59 ? 217 LEU A O    1 
ATOM   1626 C  CB   . LEU A 1 213 ? -22.523 -4.551  11.566 1.00 36.88 ? 217 LEU A CB   1 
ATOM   1627 C  CG   . LEU A 1 213 ? -22.380 -5.331  12.880 1.00 34.13 ? 217 LEU A CG   1 
ATOM   1628 C  CD1  . LEU A 1 213 ? -23.340 -4.802  13.950 1.00 30.63 ? 217 LEU A CD1  1 
ATOM   1629 C  CD2  . LEU A 1 213 ? -22.561 -6.839  12.650 1.00 34.27 ? 217 LEU A CD2  1 
ATOM   1630 N  N    . THR A 1 214 ? -21.520 -2.998  9.031  1.00 40.97 ? 218 THR A N    1 
ATOM   1631 C  CA   . THR A 1 214 ? -22.095 -2.203  7.972  1.00 41.74 ? 218 THR A CA   1 
ATOM   1632 C  C    . THR A 1 214 ? -21.122 -2.028  6.809  1.00 42.56 ? 218 THR A C    1 
ATOM   1633 O  O    . THR A 1 214 ? -21.537 -1.802  5.648  1.00 42.36 ? 218 THR A O    1 
ATOM   1634 C  CB   . THR A 1 214 ? -22.504 -0.848  8.595  1.00 41.51 ? 218 THR A CB   1 
ATOM   1635 O  OG1  . THR A 1 214 ? -23.826 -0.988  9.158  1.00 43.12 ? 218 THR A OG1  1 
ATOM   1636 C  CG2  . THR A 1 214 ? -22.491 0.275   7.597  1.00 41.91 ? 218 THR A CG2  1 
ATOM   1637 N  N    . GLY A 1 215 ? -19.832 -2.132  7.141  1.00 42.65 ? 219 GLY A N    1 
ATOM   1638 C  CA   . GLY A 1 215 ? -18.744 -1.889  6.209  1.00 43.33 ? 219 GLY A CA   1 
ATOM   1639 C  C    . GLY A 1 215 ? -18.520 -0.411  5.991  1.00 44.35 ? 219 GLY A C    1 
ATOM   1640 O  O    . GLY A 1 215 ? -17.726 -0.028  5.123  1.00 44.58 ? 219 GLY A O    1 
ATOM   1641 N  N    . ARG A 1 216 ? -19.230 0.420   6.765  1.00 44.32 ? 220 ARG A N    1 
ATOM   1642 C  CA   . ARG A 1 216 ? -19.141 1.874   6.638  1.00 44.63 ? 220 ARG A CA   1 
ATOM   1643 C  C    . ARG A 1 216 ? -19.015 2.631   7.992  1.00 43.56 ? 220 ARG A C    1 
ATOM   1644 O  O    . ARG A 1 216 ? -19.538 2.200   9.027  1.00 42.69 ? 220 ARG A O    1 
ATOM   1645 C  CB   . ARG A 1 216 ? -20.328 2.445   5.800  1.00 45.85 ? 220 ARG A CB   1 
ATOM   1646 C  CG   . ARG A 1 216 ? -20.679 1.679   4.479  1.00 49.15 ? 220 ARG A CG   1 
ATOM   1647 C  CD   . ARG A 1 216 ? -20.922 2.574   3.255  1.00 53.06 ? 220 ARG A CD   1 
ATOM   1648 N  NE   . ARG A 1 216 ? -19.895 3.612   3.095  1.00 57.48 ? 220 ARG A NE   1 
ATOM   1649 C  CZ   . ARG A 1 216 ? -19.476 4.135   1.930  1.00 59.23 ? 220 ARG A CZ   1 
ATOM   1650 N  NH1  . ARG A 1 216 ? -19.953 3.712   0.760  1.00 58.09 ? 220 ARG A NH1  1 
ATOM   1651 N  NH2  . ARG A 1 216 ? -18.544 5.087   1.938  1.00 58.21 ? 220 ARG A NH2  1 
ATOM   1652 N  N    . THR A 1 217 ? -18.311 3.761   7.957  1.00 42.84 ? 221 THR A N    1 
ATOM   1653 C  CA   . THR A 1 217 ? -18.217 4.675   9.097  1.00 42.99 ? 221 THR A CA   1 
ATOM   1654 C  C    . THR A 1 217 ? -19.630 5.094   9.523  1.00 43.14 ? 221 THR A C    1 
ATOM   1655 O  O    . THR A 1 217 ? -20.430 5.575   8.700  1.00 42.68 ? 221 THR A O    1 
ATOM   1656 C  CB   . THR A 1 217 ? -17.339 5.918   8.775  1.00 42.91 ? 221 THR A CB   1 
ATOM   1657 O  OG1  . THR A 1 217 ? -16.000 5.495   8.500  1.00 42.71 ? 221 THR A OG1  1 
ATOM   1658 C  CG2  . THR A 1 217 ? -17.291 6.917   9.968  1.00 43.64 ? 221 THR A CG2  1 
ATOM   1659 N  N    . LEU A 1 218 ? -19.931 4.872   10.798 1.00 42.47 ? 222 LEU A N    1 
ATOM   1660 C  CA   . LEU A 1 218 ? -21.254 5.174   11.335 1.00 42.91 ? 222 LEU A CA   1 
ATOM   1661 C  C    . LEU A 1 218 ? -21.576 6.678   11.349 1.00 43.51 ? 222 LEU A C    1 
ATOM   1662 O  O    . LEU A 1 218 ? -22.715 7.062   11.059 1.00 44.31 ? 222 LEU A O    1 
ATOM   1663 C  CB   . LEU A 1 218 ? -21.460 4.543   12.726 1.00 42.50 ? 222 LEU A CB   1 
ATOM   1664 C  CG   . LEU A 1 218 ? -22.816 4.717   13.429 1.00 41.85 ? 222 LEU A CG   1 
ATOM   1665 C  CD1  . LEU A 1 218 ? -23.933 4.325   12.511 1.00 39.76 ? 222 LEU A CD1  1 
ATOM   1666 C  CD2  . LEU A 1 218 ? -22.877 3.903   14.705 1.00 41.66 ? 222 LEU A CD2  1 
ATOM   1667 N  N    . PHE A 1 219 ? -20.585 7.508   11.686 1.00 43.09 ? 223 PHE A N    1 
ATOM   1668 C  CA   . PHE A 1 219 ? -20.774 8.958   11.831 1.00 42.60 ? 223 PHE A CA   1 
ATOM   1669 C  C    . PHE A 1 219 ? -19.583 9.713   11.208 1.00 43.86 ? 223 PHE A C    1 
ATOM   1670 O  O    . PHE A 1 219 ? -18.759 10.288  11.935 1.00 42.96 ? 223 PHE A O    1 
ATOM   1671 C  CB   . PHE A 1 219 ? -20.881 9.362   13.302 1.00 40.96 ? 223 PHE A CB   1 
ATOM   1672 C  CG   . PHE A 1 219 ? -22.024 8.747   14.054 1.00 38.63 ? 223 PHE A CG   1 
ATOM   1673 C  CD1  . PHE A 1 219 ? -21.790 8.078   15.239 1.00 35.58 ? 223 PHE A CD1  1 
ATOM   1674 C  CD2  . PHE A 1 219 ? -23.343 8.896   13.621 1.00 39.51 ? 223 PHE A CD2  1 
ATOM   1675 C  CE1  . PHE A 1 219 ? -22.832 7.529   15.971 1.00 36.22 ? 223 PHE A CE1  1 
ATOM   1676 C  CE2  . PHE A 1 219 ? -24.400 8.349   14.346 1.00 35.69 ? 223 PHE A CE2  1 
ATOM   1677 C  CZ   . PHE A 1 219 ? -24.141 7.667   15.529 1.00 37.87 ? 223 PHE A CZ   1 
ATOM   1678 N  N    . PRO A 1 220 ? -19.513 9.753   9.861  1.00 45.54 ? 224 PRO A N    1 
ATOM   1679 C  CA   . PRO A 1 220 ? -18.297 10.223  9.194  1.00 46.82 ? 224 PRO A CA   1 
ATOM   1680 C  C    . PRO A 1 220 ? -18.211 11.749  9.132  1.00 48.88 ? 224 PRO A C    1 
ATOM   1681 O  O    . PRO A 1 220 ? -17.824 12.307  8.086  1.00 49.50 ? 224 PRO A O    1 
ATOM   1682 C  CB   . PRO A 1 220 ? -18.398 9.610   7.788  1.00 46.69 ? 224 PRO A CB   1 
ATOM   1683 C  CG   . PRO A 1 220 ? -19.851 9.129   7.634  1.00 46.23 ? 224 PRO A CG   1 
ATOM   1684 C  CD   . PRO A 1 220 ? -20.588 9.424   8.898  1.00 45.40 ? 224 PRO A CD   1 
ATOM   1685 N  N    . GLY A 1 221 ? -18.545 12.409  10.249 1.00 50.02 ? 225 GLY A N    1 
ATOM   1686 C  CA   . GLY A 1 221 ? -18.481 13.868  10.374 1.00 51.75 ? 225 GLY A CA   1 
ATOM   1687 C  C    . GLY A 1 221 ? -17.314 14.525  9.650  1.00 53.13 ? 225 GLY A C    1 
ATOM   1688 O  O    . GLY A 1 221 ? -16.219 13.950  9.553  1.00 53.20 ? 225 GLY A O    1 
ATOM   1689 N  N    . THR A 1 222 ? -17.554 15.726  9.120  1.00 54.15 ? 226 THR A N    1 
ATOM   1690 C  CA   . THR A 1 222 ? -16.490 16.498  8.474  1.00 55.00 ? 226 THR A CA   1 
ATOM   1691 C  C    . THR A 1 222 ? -15.719 17.345  9.487  1.00 55.22 ? 226 THR A C    1 
ATOM   1692 O  O    . THR A 1 222 ? -14.558 17.727  9.244  1.00 55.71 ? 226 THR A O    1 
ATOM   1693 C  CB   . THR A 1 222 ? -17.014 17.364  7.307  1.00 55.39 ? 226 THR A CB   1 
ATOM   1694 O  OG1  . THR A 1 222 ? -15.900 17.895  6.575  1.00 55.14 ? 226 THR A OG1  1 
ATOM   1695 C  CG2  . THR A 1 222 ? -17.898 18.500  7.810  1.00 55.83 ? 226 THR A CG2  1 
ATOM   1696 N  N    . ASP A 1 223 ? -16.381 17.620  10.615 1.00 54.97 ? 227 ASP A N    1 
ATOM   1697 C  CA   . ASP A 1 223 ? -15.799 18.308  11.762 1.00 54.60 ? 227 ASP A CA   1 
ATOM   1698 C  C    . ASP A 1 223 ? -16.705 18.070  12.964 1.00 53.63 ? 227 ASP A C    1 
ATOM   1699 O  O    . ASP A 1 223 ? -17.680 17.332  12.848 1.00 53.76 ? 227 ASP A O    1 
ATOM   1700 C  CB   . ASP A 1 223 ? -15.615 19.813  11.481 1.00 55.33 ? 227 ASP A CB   1 
ATOM   1701 C  CG   . ASP A 1 223 ? -16.803 20.434  10.761 1.00 56.40 ? 227 ASP A CG   1 
ATOM   1702 O  OD1  . ASP A 1 223 ? -17.951 20.349  11.280 1.00 56.54 ? 227 ASP A OD1  1 
ATOM   1703 O  OD2  . ASP A 1 223 ? -16.569 21.015  9.669  1.00 58.99 ? 227 ASP A OD2  1 
ATOM   1704 N  N    . HIS A 1 224 ? -16.403 18.709  14.098 1.00 52.86 ? 228 HIS A N    1 
ATOM   1705 C  CA   . HIS A 1 224 ? -17.141 18.501  15.344 1.00 51.83 ? 228 HIS A CA   1 
ATOM   1706 C  C    . HIS A 1 224 ? -18.626 18.868  15.283 1.00 52.51 ? 228 HIS A C    1 
ATOM   1707 O  O    . HIS A 1 224 ? -19.431 18.269  16.008 1.00 52.11 ? 228 HIS A O    1 
ATOM   1708 C  CB   . HIS A 1 224 ? -16.484 19.247  16.493 1.00 51.86 ? 228 HIS A CB   1 
ATOM   1709 C  CG   . HIS A 1 224 ? -15.276 18.567  17.072 1.00 50.65 ? 228 HIS A CG   1 
ATOM   1710 N  ND1  . HIS A 1 224 ? -14.381 17.845  16.312 1.00 49.70 ? 228 HIS A ND1  1 
ATOM   1711 C  CD2  . HIS A 1 224 ? -14.798 18.538  18.340 1.00 49.83 ? 228 HIS A CD2  1 
ATOM   1712 C  CE1  . HIS A 1 224 ? -13.417 17.378  17.090 1.00 50.27 ? 228 HIS A CE1  1 
ATOM   1713 N  NE2  . HIS A 1 224 ? -13.641 17.793  18.324 1.00 50.10 ? 228 HIS A NE2  1 
ATOM   1714 N  N    . ILE A 1 225 ? -18.987 19.850  14.440 1.00 52.90 ? 229 ILE A N    1 
ATOM   1715 C  CA   . ILE A 1 225 ? -20.389 20.293  14.299 1.00 52.96 ? 229 ILE A CA   1 
ATOM   1716 C  C    . ILE A 1 225 ? -21.204 19.283  13.484 1.00 52.98 ? 229 ILE A C    1 
ATOM   1717 O  O    . ILE A 1 225 ? -22.237 18.791  13.938 1.00 53.32 ? 229 ILE A O    1 
ATOM   1718 C  CB   . ILE A 1 225 ? -20.500 21.742  13.688 1.00 53.39 ? 229 ILE A CB   1 
ATOM   1719 C  CG1  . ILE A 1 225 ? -20.054 22.809  14.719 1.00 53.16 ? 229 ILE A CG1  1 
ATOM   1720 C  CG2  . ILE A 1 225 ? -21.918 22.002  13.130 1.00 51.37 ? 229 ILE A CG2  1 
ATOM   1721 C  CD1  . ILE A 1 225 ? -20.036 24.274  14.200 1.00 53.20 ? 229 ILE A CD1  1 
ATOM   1722 N  N    . ASP A 1 226 ? -20.701 18.987  12.287 1.00 53.46 ? 230 ASP A N    1 
ATOM   1723 C  CA   . ASP A 1 226 ? -21.257 18.033  11.334 1.00 53.97 ? 230 ASP A CA   1 
ATOM   1724 C  C    . ASP A 1 226 ? -21.305 16.645  11.954 1.00 53.93 ? 230 ASP A C    1 
ATOM   1725 O  O    . ASP A 1 226 ? -22.190 15.846  11.646 1.00 54.41 ? 230 ASP A O    1 
ATOM   1726 C  CB   . ASP A 1 226 ? -20.362 18.023  10.087 1.00 54.55 ? 230 ASP A CB   1 
ATOM   1727 C  CG   . ASP A 1 226 ? -20.884 17.123  8.979  1.00 56.50 ? 230 ASP A CG   1 
ATOM   1728 O  OD1  . ASP A 1 226 ? -20.279 16.056  8.745  1.00 58.67 ? 230 ASP A OD1  1 
ATOM   1729 O  OD2  . ASP A 1 226 ? -21.877 17.492  8.316  1.00 59.54 ? 230 ASP A OD2  1 
ATOM   1730 N  N    . GLN A 1 227 ? -20.339 16.381  12.834 1.00 53.67 ? 231 GLN A N    1 
ATOM   1731 C  CA   . GLN A 1 227 ? -20.270 15.157  13.632 1.00 52.67 ? 231 GLN A CA   1 
ATOM   1732 C  C    . GLN A 1 227 ? -21.474 14.989  14.508 1.00 52.28 ? 231 GLN A C    1 
ATOM   1733 O  O    . GLN A 1 227 ? -22.074 13.913  14.555 1.00 52.23 ? 231 GLN A O    1 
ATOM   1734 C  CB   . GLN A 1 227 ? -19.048 15.182  14.556 1.00 52.15 ? 231 GLN A CB   1 
ATOM   1735 C  CG   . GLN A 1 227 ? -18.848 13.857  15.288 1.00 50.63 ? 231 GLN A CG   1 
ATOM   1736 C  CD   . GLN A 1 227 ? -18.369 12.771  14.345 1.00 45.51 ? 231 GLN A CD   1 
ATOM   1737 O  OE1  . GLN A 1 227 ? -17.554 13.032  13.468 1.00 44.40 ? 231 GLN A OE1  1 
ATOM   1738 N  NE2  . GLN A 1 227 ? -18.867 11.559  14.524 1.00 43.88 ? 231 GLN A NE2  1 
ATOM   1739 N  N    . LEU A 1 228 ? -21.794 16.057  15.232 1.00 52.00 ? 232 LEU A N    1 
ATOM   1740 C  CA   . LEU A 1 228 ? -22.826 16.009  16.246 1.00 51.75 ? 232 LEU A CA   1 
ATOM   1741 C  C    . LEU A 1 228 ? -24.171 15.996  15.554 1.00 51.73 ? 232 LEU A C    1 
ATOM   1742 O  O    . LEU A 1 228 ? -25.130 15.460  16.095 1.00 51.49 ? 232 LEU A O    1 
ATOM   1743 C  CB   . LEU A 1 228 ? -22.726 17.202  17.216 1.00 51.27 ? 232 LEU A CB   1 
ATOM   1744 C  CG   . LEU A 1 228 ? -22.901 16.943  18.725 1.00 50.56 ? 232 LEU A CG   1 
ATOM   1745 C  CD1  . LEU A 1 228 ? -23.949 15.875  19.042 1.00 49.60 ? 232 LEU A CD1  1 
ATOM   1746 C  CD2  . LEU A 1 228 ? -21.583 16.574  19.377 1.00 49.09 ? 232 LEU A CD2  1 
ATOM   1747 N  N    . LYS A 1 229 ? -24.222 16.581  14.356 1.00 52.17 ? 233 LYS A N    1 
ATOM   1748 C  CA   . LYS A 1 229 ? -25.434 16.539  13.516 1.00 52.71 ? 233 LYS A CA   1 
ATOM   1749 C  C    . LYS A 1 229 ? -25.763 15.093  13.177 1.00 51.50 ? 233 LYS A C    1 
ATOM   1750 O  O    . LYS A 1 229 ? -26.899 14.642  13.368 1.00 51.89 ? 233 LYS A O    1 
ATOM   1751 C  CB   . LYS A 1 229 ? -25.256 17.353  12.227 1.00 52.66 ? 233 LYS A CB   1 
ATOM   1752 C  CG   . LYS A 1 229 ? -25.163 18.851  12.461 1.00 54.35 ? 233 LYS A CG   1 
ATOM   1753 C  CD   . LYS A 1 229 ? -25.415 19.677  11.183 1.00 54.55 ? 233 LYS A CD   1 
ATOM   1754 C  CE   . LYS A 1 229 ? -24.118 20.143  10.524 1.00 56.87 ? 233 LYS A CE   1 
ATOM   1755 N  NZ   . LYS A 1 229 ? -24.333 21.369  9.694  1.00 59.24 ? 233 LYS A NZ   1 
ATOM   1756 N  N    . LEU A 1 230 ? -24.749 14.369  12.711 1.00 50.36 ? 234 LEU A N    1 
ATOM   1757 C  CA   . LEU A 1 230 ? -24.887 12.960  12.349 1.00 48.98 ? 234 LEU A CA   1 
ATOM   1758 C  C    . LEU A 1 230 ? -25.310 12.099  13.535 1.00 48.25 ? 234 LEU A C    1 
ATOM   1759 O  O    . LEU A 1 230 ? -26.178 11.241  13.408 1.00 47.97 ? 234 LEU A O    1 
ATOM   1760 C  CB   . LEU A 1 230 ? -23.580 12.458  11.736 1.00 49.42 ? 234 LEU A CB   1 
ATOM   1761 C  CG   . LEU A 1 230 ? -23.183 13.059  10.372 1.00 48.82 ? 234 LEU A CG   1 
ATOM   1762 C  CD1  . LEU A 1 230 ? -21.703 12.956  10.174 1.00 45.42 ? 234 LEU A CD1  1 
ATOM   1763 C  CD2  . LEU A 1 230 ? -23.918 12.375  9.201  1.00 49.02 ? 234 LEU A CD2  1 
ATOM   1764 N  N    . ILE A 1 231 ? -24.723 12.357  14.696 1.00 47.62 ? 235 ILE A N    1 
ATOM   1765 C  CA   . ILE A 1 231 ? -25.047 11.605  15.897 1.00 47.26 ? 235 ILE A CA   1 
ATOM   1766 C  C    . ILE A 1 231 ? -26.526 11.763  16.250 1.00 48.06 ? 235 ILE A C    1 
ATOM   1767 O  O    . ILE A 1 231 ? -27.186 10.780  16.600 1.00 47.83 ? 235 ILE A O    1 
ATOM   1768 C  CB   . ILE A 1 231 ? -24.152 12.002  17.096 1.00 46.88 ? 235 ILE A CB   1 
ATOM   1769 C  CG1  . ILE A 1 231 ? -22.705 11.530  16.859 1.00 46.91 ? 235 ILE A CG1  1 
ATOM   1770 C  CG2  . ILE A 1 231 ? -24.745 11.460  18.411 1.00 46.42 ? 235 ILE A CG2  1 
ATOM   1771 C  CD1  . ILE A 1 231 ? -21.728 11.874  17.941 1.00 45.91 ? 235 ILE A CD1  1 
ATOM   1772 N  N    . LEU A 1 232 ? -27.037 12.995  16.144 1.00 48.96 ? 236 LEU A N    1 
ATOM   1773 C  CA   . LEU A 1 232 ? -28.419 13.321  16.566 1.00 49.97 ? 236 LEU A CA   1 
ATOM   1774 C  C    . LEU A 1 232 ? -29.524 12.634  15.767 1.00 50.11 ? 236 LEU A C    1 
ATOM   1775 O  O    . LEU A 1 232 ? -30.515 12.176  16.344 1.00 50.51 ? 236 LEU A O    1 
ATOM   1776 C  CB   . LEU A 1 232 ? -28.655 14.829  16.578 1.00 49.99 ? 236 LEU A CB   1 
ATOM   1777 C  CG   . LEU A 1 232 ? -27.752 15.626  17.505 1.00 49.98 ? 236 LEU A CG   1 
ATOM   1778 C  CD1  . LEU A 1 232 ? -27.797 17.119  17.119 1.00 50.16 ? 236 LEU A CD1  1 
ATOM   1779 C  CD2  . LEU A 1 232 ? -28.051 15.373  18.999 1.00 48.82 ? 236 LEU A CD2  1 
ATOM   1780 N  N    . ARG A 1 233 ? -29.333 12.567  14.453 1.00 50.77 ? 237 ARG A N    1 
ATOM   1781 C  CA   . ARG A 1 233 ? -30.199 11.829  13.529 1.00 51.45 ? 237 ARG A CA   1 
ATOM   1782 C  C    . ARG A 1 233 ? -30.569 10.453  14.046 1.00 51.61 ? 237 ARG A C    1 
ATOM   1783 O  O    . ARG A 1 233 ? -31.750 10.091  14.067 1.00 52.34 ? 237 ARG A O    1 
ATOM   1784 C  CB   . ARG A 1 233 ? -29.496 11.623  12.191 1.00 51.93 ? 237 ARG A CB   1 
ATOM   1785 C  CG   . ARG A 1 233 ? -29.148 12.874  11.443 1.00 53.49 ? 237 ARG A CG   1 
ATOM   1786 C  CD   . ARG A 1 233 ? -28.520 12.479  10.129 1.00 57.38 ? 237 ARG A CD   1 
ATOM   1787 N  NE   . ARG A 1 233 ? -28.363 13.600  9.209  1.00 60.17 ? 237 ARG A NE   1 
ATOM   1788 C  CZ   . ARG A 1 233 ? -27.689 13.533  8.062  1.00 62.09 ? 237 ARG A CZ   1 
ATOM   1789 N  NH1  . ARG A 1 233 ? -27.091 12.403  7.696  1.00 60.97 ? 237 ARG A NH1  1 
ATOM   1790 N  NH2  . ARG A 1 233 ? -27.601 14.603  7.281  1.00 63.80 ? 237 ARG A NH2  1 
ATOM   1791 N  N    . LEU A 1 234 ? -29.561 9.683   14.455 1.00 50.95 ? 238 LEU A N    1 
ATOM   1792 C  CA   . LEU A 1 234 ? -29.772 8.278   14.759 1.00 50.39 ? 238 LEU A CA   1 
ATOM   1793 C  C    . LEU A 1 234 ? -30.419 8.077   16.114 1.00 49.85 ? 238 LEU A C    1 
ATOM   1794 O  O    . LEU A 1 234 ? -31.378 7.309   16.269 1.00 49.74 ? 238 LEU A O    1 
ATOM   1795 C  CB   . LEU A 1 234 ? -28.443 7.511   14.713 1.00 50.83 ? 238 LEU A CB   1 
ATOM   1796 C  CG   . LEU A 1 234 ? -28.635 6.000   14.548 1.00 51.74 ? 238 LEU A CG   1 
ATOM   1797 C  CD1  . LEU A 1 234 ? -28.467 5.643   13.088 1.00 52.72 ? 238 LEU A CD1  1 
ATOM   1798 C  CD2  . LEU A 1 234 ? -27.652 5.220   15.407 1.00 52.22 ? 238 LEU A CD2  1 
ATOM   1799 N  N    . VAL A 1 235 ? -29.860 8.754   17.103 1.00 49.28 ? 239 VAL A N    1 
ATOM   1800 C  CA   . VAL A 1 235 ? -30.228 8.520   18.482 1.00 48.69 ? 239 VAL A CA   1 
ATOM   1801 C  C    . VAL A 1 235 ? -31.314 9.484   18.964 1.00 48.07 ? 239 VAL A C    1 
ATOM   1802 O  O    . VAL A 1 235 ? -31.939 9.249   19.992 1.00 47.54 ? 239 VAL A O    1 
ATOM   1803 C  CB   . VAL A 1 235 ? -28.978 8.554   19.400 1.00 49.11 ? 239 VAL A CB   1 
ATOM   1804 C  CG1  . VAL A 1 235 ? -28.180 7.235   19.273 1.00 48.96 ? 239 VAL A CG1  1 
ATOM   1805 C  CG2  . VAL A 1 235 ? -28.092 9.762   19.057 1.00 48.94 ? 239 VAL A CG2  1 
ATOM   1806 N  N    . GLY A 1 236 ? -31.535 10.549  18.201 1.00 48.10 ? 240 GLY A N    1 
ATOM   1807 C  CA   . GLY A 1 236 ? -32.502 11.592  18.553 1.00 48.51 ? 240 GLY A CA   1 
ATOM   1808 C  C    . GLY A 1 236 ? -31.832 12.825  19.157 1.00 48.43 ? 240 GLY A C    1 
ATOM   1809 O  O    . GLY A 1 236 ? -30.608 12.854  19.344 1.00 48.70 ? 240 GLY A O    1 
ATOM   1810 N  N    . THR A 1 237 ? -32.620 13.859  19.427 1.00 47.70 ? 241 THR A N    1 
ATOM   1811 C  CA   . THR A 1 237 ? -32.149 14.953  20.262 1.00 46.93 ? 241 THR A CA   1 
ATOM   1812 C  C    . THR A 1 237 ? -32.455 14.536  21.704 1.00 46.73 ? 241 THR A C    1 
ATOM   1813 O  O    . THR A 1 237 ? -33.343 13.709  21.940 1.00 45.85 ? 241 THR A O    1 
ATOM   1814 C  CB   . THR A 1 237 ? -32.757 16.344  19.860 1.00 47.38 ? 241 THR A CB   1 
ATOM   1815 O  OG1  . THR A 1 237 ? -34.190 16.267  19.755 1.00 46.64 ? 241 THR A OG1  1 
ATOM   1816 C  CG2  . THR A 1 237 ? -32.151 16.845  18.536 1.00 45.90 ? 241 THR A CG2  1 
ATOM   1817 N  N    . PRO A 1 238 ? -31.688 15.045  22.680 1.00 46.81 ? 242 PRO A N    1 
ATOM   1818 C  CA   . PRO A 1 238 ? -32.001 14.552  24.034 1.00 46.88 ? 242 PRO A CA   1 
ATOM   1819 C  C    . PRO A 1 238 ? -33.413 14.903  24.511 1.00 46.96 ? 242 PRO A C    1 
ATOM   1820 O  O    . PRO A 1 238 ? -33.989 15.929  24.110 1.00 46.47 ? 242 PRO A O    1 
ATOM   1821 C  CB   . PRO A 1 238 ? -30.952 15.230  24.922 1.00 47.27 ? 242 PRO A CB   1 
ATOM   1822 C  CG   . PRO A 1 238 ? -30.390 16.348  24.125 1.00 47.19 ? 242 PRO A CG   1 
ATOM   1823 C  CD   . PRO A 1 238 ? -30.568 16.001  22.663 1.00 46.95 ? 242 PRO A CD   1 
ATOM   1824 N  N    . GLY A 1 239 ? -33.962 14.027  25.340 1.00 47.01 ? 243 GLY A N    1 
ATOM   1825 C  CA   . GLY A 1 239 ? -35.220 14.294  25.998 1.00 47.41 ? 243 GLY A CA   1 
ATOM   1826 C  C    . GLY A 1 239 ? -34.990 15.093  27.268 1.00 47.99 ? 243 GLY A C    1 
ATOM   1827 O  O    . GLY A 1 239 ? -33.843 15.361  27.647 1.00 47.36 ? 243 GLY A O    1 
ATOM   1828 N  N    . ALA A 1 240 ? -36.086 15.468  27.929 1.00 48.58 ? 244 ALA A N    1 
ATOM   1829 C  CA   . ALA A 1 240 ? -36.023 16.309  29.126 1.00 49.12 ? 244 ALA A CA   1 
ATOM   1830 C  C    . ALA A 1 240 ? -35.262 15.675  30.298 1.00 49.17 ? 244 ALA A C    1 
ATOM   1831 O  O    . ALA A 1 240 ? -34.631 16.385  31.074 1.00 49.50 ? 244 ALA A O    1 
ATOM   1832 C  CB   . ALA A 1 240 ? -37.444 16.762  29.561 1.00 49.26 ? 244 ALA A CB   1 
ATOM   1833 N  N    . GLU A 1 241 ? -35.293 14.350  30.419 1.00 49.13 ? 245 GLU A N    1 
ATOM   1834 C  CA   . GLU A 1 241 ? -34.580 13.695  31.522 1.00 49.29 ? 245 GLU A CA   1 
ATOM   1835 C  C    . GLU A 1 241 ? -33.051 13.781  31.390 1.00 48.66 ? 245 GLU A C    1 
ATOM   1836 O  O    . GLU A 1 241 ? -32.333 13.709  32.406 1.00 49.12 ? 245 GLU A O    1 
ATOM   1837 C  CB   . GLU A 1 241 ? -35.032 12.245  31.684 1.00 50.16 ? 245 GLU A CB   1 
ATOM   1838 C  CG   . GLU A 1 241 ? -34.474 11.524  32.940 1.00 53.55 ? 245 GLU A CG   1 
ATOM   1839 C  CD   . GLU A 1 241 ? -33.243 10.654  32.658 1.00 56.91 ? 245 GLU A CD   1 
ATOM   1840 O  OE1  . GLU A 1 241 ? -32.897 10.441  31.463 1.00 59.25 ? 245 GLU A OE1  1 
ATOM   1841 O  OE2  . GLU A 1 241 ? -32.629 10.171  33.645 1.00 57.51 ? 245 GLU A OE2  1 
ATOM   1842 N  N    . LEU A 1 242 ? -32.563 13.932  30.153 1.00 46.71 ? 246 LEU A N    1 
ATOM   1843 C  CA   . LEU A 1 242 ? -31.140 14.140  29.891 1.00 45.79 ? 246 LEU A CA   1 
ATOM   1844 C  C    . LEU A 1 242 ? -30.833 15.632  29.929 1.00 44.87 ? 246 LEU A C    1 
ATOM   1845 O  O    . LEU A 1 242 ? -29.709 16.041  30.283 1.00 44.12 ? 246 LEU A O    1 
ATOM   1846 C  CB   . LEU A 1 242 ? -30.737 13.595  28.506 1.00 45.26 ? 246 LEU A CB   1 
ATOM   1847 C  CG   . LEU A 1 242 ? -29.265 13.398  28.070 1.00 45.49 ? 246 LEU A CG   1 
ATOM   1848 C  CD1  . LEU A 1 242 ? -28.968 14.057  26.699 1.00 43.70 ? 246 LEU A CD1  1 
ATOM   1849 C  CD2  . LEU A 1 242 ? -28.195 13.823  29.069 1.00 40.85 ? 246 LEU A CD2  1 
ATOM   1850 N  N    . LEU A 1 243 ? -31.814 16.429  29.511 1.00 44.24 ? 247 LEU A N    1 
ATOM   1851 C  CA   . LEU A 1 243 ? -31.689 17.884  29.517 1.00 44.79 ? 247 LEU A CA   1 
ATOM   1852 C  C    . LEU A 1 243 ? -31.586 18.435  30.951 1.00 44.40 ? 247 LEU A C    1 
ATOM   1853 O  O    . LEU A 1 243 ? -30.963 19.489  31.172 1.00 44.57 ? 247 LEU A O    1 
ATOM   1854 C  CB   . LEU A 1 243 ? -32.828 18.566  28.714 1.00 45.33 ? 247 LEU A CB   1 
ATOM   1855 C  CG   . LEU A 1 243 ? -32.698 18.584  27.178 1.00 44.86 ? 247 LEU A CG   1 
ATOM   1856 C  CD1  . LEU A 1 243 ? -34.006 18.982  26.485 1.00 44.58 ? 247 LEU A CD1  1 
ATOM   1857 C  CD2  . LEU A 1 243 ? -31.552 19.459  26.695 1.00 42.47 ? 247 LEU A CD2  1 
ATOM   1858 N  N    . LYS A 1 244 ? -32.162 17.693  31.907 1.00 43.89 ? 248 LYS A N    1 
ATOM   1859 C  CA   . LYS A 1 244 ? -32.015 17.953  33.350 1.00 43.34 ? 248 LYS A CA   1 
ATOM   1860 C  C    . LYS A 1 244 ? -30.554 18.002  33.775 1.00 43.28 ? 248 LYS A C    1 
ATOM   1861 O  O    . LYS A 1 244 ? -30.195 18.777  34.652 1.00 42.16 ? 248 LYS A O    1 
ATOM   1862 C  CB   . LYS A 1 244 ? -32.638 16.820  34.158 1.00 44.02 ? 248 LYS A CB   1 
ATOM   1863 C  CG   . LYS A 1 244 ? -34.060 16.948  34.540 1.00 43.64 ? 248 LYS A CG   1 
ATOM   1864 C  CD   . LYS A 1 244 ? -34.383 15.742  35.406 1.00 47.38 ? 248 LYS A CD   1 
ATOM   1865 C  CE   . LYS A 1 244 ? -35.721 15.899  36.110 1.00 49.79 ? 248 LYS A CE   1 
ATOM   1866 N  NZ   . LYS A 1 244 ? -36.440 14.601  36.253 1.00 49.82 ? 248 LYS A NZ   1 
ATOM   1867 N  N    . LYS A 1 245 ? -29.725 17.136  33.174 1.00 43.27 ? 249 LYS A N    1 
ATOM   1868 C  CA   . LYS A 1 245 ? -28.344 16.906  33.636 1.00 43.49 ? 249 LYS A CA   1 
ATOM   1869 C  C    . LYS A 1 245 ? -27.326 17.836  32.987 1.00 43.64 ? 249 LYS A C    1 
ATOM   1870 O  O    . LYS A 1 245 ? -26.150 17.812  33.335 1.00 43.68 ? 249 LYS A O    1 
ATOM   1871 C  CB   . LYS A 1 245 ? -27.916 15.437  33.451 1.00 43.17 ? 249 LYS A CB   1 
ATOM   1872 C  CG   . LYS A 1 245 ? -28.775 14.402  34.179 1.00 44.27 ? 249 LYS A CG   1 
ATOM   1873 C  CD   . LYS A 1 245 ? -28.467 12.969  33.737 1.00 44.00 ? 249 LYS A CD   1 
ATOM   1874 C  CE   . LYS A 1 245 ? -29.433 11.978  34.404 1.00 47.17 ? 249 LYS A CE   1 
ATOM   1875 N  NZ   . LYS A 1 245 ? -29.231 10.519  34.058 1.00 46.83 ? 249 LYS A NZ   1 
ATOM   1876 N  N    . ILE A 1 246 ? -27.769 18.647  32.039 1.00 44.73 ? 250 ILE A N    1 
ATOM   1877 C  CA   . ILE A 1 246 ? -26.858 19.529  31.323 1.00 46.49 ? 250 ILE A CA   1 
ATOM   1878 C  C    . ILE A 1 246 ? -26.701 20.865  32.055 1.00 48.04 ? 250 ILE A C    1 
ATOM   1879 O  O    . ILE A 1 246 ? -27.656 21.628  32.207 1.00 47.50 ? 250 ILE A O    1 
ATOM   1880 C  CB   . ILE A 1 246 ? -27.240 19.685  29.815 1.00 46.25 ? 250 ILE A CB   1 
ATOM   1881 C  CG1  . ILE A 1 246 ? -27.128 18.323  29.113 1.00 46.34 ? 250 ILE A CG1  1 
ATOM   1882 C  CG2  . ILE A 1 246 ? -26.327 20.710  29.124 1.00 45.38 ? 250 ILE A CG2  1 
ATOM   1883 C  CD1  . ILE A 1 246 ? -27.782 18.254  27.726 1.00 46.51 ? 250 ILE A CD1  1 
ATOM   1884 N  N    . SER A 1 247 ? -25.475 21.120  32.509 1.00 50.21 ? 251 SER A N    1 
ATOM   1885 C  CA   . SER A 1 247 ? -25.163 22.271  33.359 1.00 52.24 ? 251 SER A CA   1 
ATOM   1886 C  C    . SER A 1 247 ? -25.109 23.581  32.581 1.00 53.55 ? 251 SER A C    1 
ATOM   1887 O  O    . SER A 1 247 ? -25.830 24.540  32.901 1.00 53.46 ? 251 SER A O    1 
ATOM   1888 C  CB   . SER A 1 247 ? -23.847 22.030  34.117 1.00 52.15 ? 251 SER A CB   1 
ATOM   1889 O  OG   . SER A 1 247 ? -23.152 23.244  34.323 1.00 54.02 ? 251 SER A OG   1 
ATOM   1890 N  N    . SER A 1 248 ? -24.263 23.603  31.551 1.00 55.26 ? 252 SER A N    1 
ATOM   1891 C  CA   . SER A 1 248 ? -23.969 24.815  30.787 1.00 56.71 ? 252 SER A CA   1 
ATOM   1892 C  C    . SER A 1 248 ? -25.184 25.404  30.092 1.00 57.22 ? 252 SER A C    1 
ATOM   1893 O  O    . SER A 1 248 ? -25.962 24.678  29.475 1.00 57.43 ? 252 SER A O    1 
ATOM   1894 C  CB   . SER A 1 248 ? -22.870 24.539  29.764 1.00 56.92 ? 252 SER A CB   1 
ATOM   1895 O  OG   . SER A 1 248 ? -22.877 25.507  28.721 1.00 58.91 ? 252 SER A OG   1 
ATOM   1896 N  N    . GLU A 1 249 ? -25.307 26.729  30.177 1.00 58.38 ? 253 GLU A N    1 
ATOM   1897 C  CA   . GLU A 1 249 ? -26.422 27.484  29.594 1.00 59.47 ? 253 GLU A CA   1 
ATOM   1898 C  C    . GLU A 1 249 ? -26.544 27.283  28.074 1.00 60.04 ? 253 GLU A C    1 
ATOM   1899 O  O    . GLU A 1 249 ? -27.655 27.199  27.538 1.00 60.47 ? 253 GLU A O    1 
ATOM   1900 C  CB   . GLU A 1 249 ? -26.319 28.971  29.966 1.00 59.70 ? 253 GLU A CB   1 
ATOM   1901 C  CG   . GLU A 1 249 ? -27.601 29.785  29.747 1.00 60.17 ? 253 GLU A CG   1 
ATOM   1902 C  CD   . GLU A 1 249 ? -28.826 29.138  30.377 1.00 61.06 ? 253 GLU A CD   1 
ATOM   1903 O  OE1  . GLU A 1 249 ? -28.800 28.933  31.616 1.00 61.09 ? 253 GLU A OE1  1 
ATOM   1904 O  OE2  . GLU A 1 249 ? -29.799 28.832  29.637 1.00 59.23 ? 253 GLU A OE2  1 
ATOM   1905 N  N    . SER A 1 250 ? -25.407 27.171  27.395 1.00 60.40 ? 254 SER A N    1 
ATOM   1906 C  CA   . SER A 1 250 ? -25.372 26.842  25.969 1.00 60.74 ? 254 SER A CA   1 
ATOM   1907 C  C    . SER A 1 250 ? -23.961 26.370  25.693 1.00 61.06 ? 254 SER A C    1 
ATOM   1908 O  O    . SER A 1 250 ? -23.096 27.221  25.463 1.00 61.93 ? 254 SER A O    1 
ATOM   1909 C  CB   . SER A 1 250 ? -25.662 28.111  25.145 1.00 60.94 ? 254 SER A CB   1 
ATOM   1910 O  OG   . SER A 1 250 ? -25.492 27.933  23.747 1.00 60.43 ? 254 SER A OG   1 
ATOM   1911 N  N    . ALA A 1 251 ? -23.639 25.069  25.721 1.00 60.79 ? 255 ALA A N    1 
ATOM   1912 C  CA   . ALA A 1 251 ? -24.450 23.837  25.909 1.00 60.21 ? 255 ALA A CA   1 
ATOM   1913 C  C    . ALA A 1 251 ? -25.948 23.689  25.599 1.00 59.85 ? 255 ALA A C    1 
ATOM   1914 O  O    . ALA A 1 251 ? -26.283 23.164  24.553 1.00 59.81 ? 255 ALA A O    1 
ATOM   1915 C  CB   . ALA A 1 251 ? -24.094 23.158  27.219 1.00 60.28 ? 255 ALA A CB   1 
ATOM   1916 N  N    . ARG A 1 252 ? -26.831 24.076  26.515 1.00 59.58 ? 256 ARG A N    1 
ATOM   1917 C  CA   . ARG A 1 252 ? -28.276 23.841  26.335 1.00 59.76 ? 256 ARG A CA   1 
ATOM   1918 C  C    . ARG A 1 252 ? -28.947 24.605  25.179 1.00 60.01 ? 256 ARG A C    1 
ATOM   1919 O  O    . ARG A 1 252 ? -29.895 24.098  24.582 1.00 60.26 ? 256 ARG A O    1 
ATOM   1920 C  CB   . ARG A 1 252 ? -29.041 24.024  27.649 1.00 59.14 ? 256 ARG A CB   1 
ATOM   1921 C  CG   . ARG A 1 252 ? -29.406 22.705  28.324 1.00 59.56 ? 256 ARG A CG   1 
ATOM   1922 C  CD   . ARG A 1 252 ? -29.770 22.832  29.833 1.00 58.91 ? 256 ARG A CD   1 
ATOM   1923 N  NE   . ARG A 1 252 ? -29.900 24.219  30.273 1.00 56.53 ? 256 ARG A NE   1 
ATOM   1924 C  CZ   . ARG A 1 252 ? -29.113 24.807  31.167 1.00 55.11 ? 256 ARG A CZ   1 
ATOM   1925 N  NH1  . ARG A 1 252 ? -28.145 24.134  31.752 1.00 55.35 ? 256 ARG A NH1  1 
ATOM   1926 N  NH2  . ARG A 1 252 ? -29.303 26.076  31.488 1.00 56.05 ? 256 ARG A NH2  1 
ATOM   1927 N  N    . ASN A 1 253 ? -28.445 25.792  24.848 1.00 60.73 ? 257 ASN A N    1 
ATOM   1928 C  CA   . ASN A 1 253 ? -28.938 26.543  23.672 1.00 61.76 ? 257 ASN A CA   1 
ATOM   1929 C  C    . ASN A 1 253 ? -28.359 26.085  22.325 1.00 62.62 ? 257 ASN A C    1 
ATOM   1930 O  O    . ASN A 1 253 ? -28.357 26.846  21.355 1.00 62.73 ? 257 ASN A O    1 
ATOM   1931 C  CB   . ASN A 1 253 ? -28.743 28.057  23.825 1.00 61.31 ? 257 ASN A CB   1 
ATOM   1932 C  CG   . ASN A 1 253 ? -29.529 28.645  24.980 1.00 61.26 ? 257 ASN A CG   1 
ATOM   1933 O  OD1  . ASN A 1 253 ? -29.067 29.591  25.626 1.00 62.19 ? 257 ASN A OD1  1 
ATOM   1934 N  ND2  . ASN A 1 253 ? -30.714 28.100  25.248 1.00 59.45 ? 257 ASN A ND2  1 
ATOM   1935 N  N    . TYR A 1 254 ? -27.819 24.870  22.290 1.00 63.53 ? 258 TYR A N    1 
ATOM   1936 C  CA   A TYR A 1 254 ? -27.516 24.223  21.010 0.50 63.90 ? 258 TYR A CA   1 
ATOM   1937 C  CA   B TYR A 1 254 ? -27.447 24.191  21.055 0.50 63.92 ? 258 TYR A CA   1 
ATOM   1938 C  C    . TYR A 1 254 ? -28.453 23.060  20.819 1.00 64.14 ? 258 TYR A C    1 
ATOM   1939 O  O    . TYR A 1 254 ? -29.041 22.916  19.757 1.00 64.32 ? 258 TYR A O    1 
ATOM   1940 C  CB   A TYR A 1 254 ? -26.070 23.726  20.885 0.50 63.77 ? 258 TYR A CB   1 
ATOM   1941 C  CB   B TYR A 1 254 ? -26.052 23.588  21.236 0.50 63.79 ? 258 TYR A CB   1 
ATOM   1942 C  CG   A TYR A 1 254 ? -25.880 22.808  19.674 0.50 63.49 ? 258 TYR A CG   1 
ATOM   1943 C  CG   B TYR A 1 254 ? -24.961 24.126  20.339 0.50 63.65 ? 258 TYR A CG   1 
ATOM   1944 C  CD1  A TYR A 1 254 ? -25.656 23.337  18.403 0.50 63.31 ? 258 TYR A CD1  1 
ATOM   1945 C  CD1  B TYR A 1 254 ? -24.493 25.431  20.463 0.50 62.98 ? 258 TYR A CD1  1 
ATOM   1946 C  CD2  A TYR A 1 254 ? -25.960 21.417  19.800 0.50 62.64 ? 258 TYR A CD2  1 
ATOM   1947 C  CD2  B TYR A 1 254 ? -24.369 23.300  19.380 0.50 63.63 ? 258 TYR A CD2  1 
ATOM   1948 C  CE1  A TYR A 1 254 ? -25.497 22.509  17.294 0.50 63.09 ? 258 TYR A CE1  1 
ATOM   1949 C  CE1  B TYR A 1 254 ? -23.480 25.905  19.631 0.50 63.41 ? 258 TYR A CE1  1 
ATOM   1950 C  CE2  A TYR A 1 254 ? -25.805 20.582  18.697 0.50 62.49 ? 258 TYR A CE2  1 
ATOM   1951 C  CE2  B TYR A 1 254 ? -23.356 23.761  18.554 0.50 63.85 ? 258 TYR A CE2  1 
ATOM   1952 C  CZ   A TYR A 1 254 ? -25.571 21.134  17.449 0.50 63.36 ? 258 TYR A CZ   1 
ATOM   1953 C  CZ   B TYR A 1 254 ? -22.916 25.062  18.682 0.50 63.59 ? 258 TYR A CZ   1 
ATOM   1954 O  OH   A TYR A 1 254 ? -25.413 20.320  16.347 0.50 63.85 ? 258 TYR A OH   1 
ATOM   1955 O  OH   B TYR A 1 254 ? -21.913 25.502  17.850 0.50 63.47 ? 258 TYR A OH   1 
ATOM   1956 N  N    . ILE A 1 255 ? -28.604 22.256  21.857 1.00 65.05 ? 259 ILE A N    1 
ATOM   1957 C  CA   . ILE A 1 255 ? -29.390 21.045  21.823 1.00 65.89 ? 259 ILE A CA   1 
ATOM   1958 C  C    . ILE A 1 255 ? -30.895 21.317  21.730 1.00 66.73 ? 259 ILE A C    1 
ATOM   1959 O  O    . ILE A 1 255 ? -31.624 20.607  21.021 1.00 66.96 ? 259 ILE A O    1 
ATOM   1960 C  CB   . ILE A 1 255 ? -29.101 20.204  23.080 1.00 65.47 ? 259 ILE A CB   1 
ATOM   1961 C  CG1  . ILE A 1 255 ? -27.642 19.737  23.096 1.00 65.37 ? 259 ILE A CG1  1 
ATOM   1962 C  CG2  . ILE A 1 255 ? -30.063 19.054  23.161 1.00 65.97 ? 259 ILE A CG2  1 
ATOM   1963 C  CD1  . ILE A 1 255 ? -27.275 18.898  24.292 1.00 62.57 ? 259 ILE A CD1  1 
ATOM   1964 N  N    . GLN A 1 256 ? -31.361 22.319  22.471 1.00 67.73 ? 260 GLN A N    1 
ATOM   1965 C  CA   . GLN A 1 256 ? -32.773 22.657  22.456 1.00 68.64 ? 260 GLN A CA   1 
ATOM   1966 C  C    . GLN A 1 256 ? -33.025 23.639  21.320 1.00 69.36 ? 260 GLN A C    1 
ATOM   1967 O  O    . GLN A 1 256 ? -34.156 23.771  20.847 1.00 69.58 ? 260 GLN A O    1 
ATOM   1968 C  CB   . GLN A 1 256 ? -33.219 23.257  23.786 1.00 68.45 ? 260 GLN A CB   1 
ATOM   1969 C  CG   . GLN A 1 256 ? -33.073 22.368  25.004 1.00 68.57 ? 260 GLN A CG   1 
ATOM   1970 C  CD   . GLN A 1 256 ? -33.681 23.002  26.256 1.00 69.02 ? 260 GLN A CD   1 
ATOM   1971 O  OE1  . GLN A 1 256 ? -32.976 23.298  27.226 1.00 69.16 ? 260 GLN A OE1  1 
ATOM   1972 N  NE2  . GLN A 1 256 ? -34.996 23.230  26.229 1.00 68.84 ? 260 GLN A NE2  1 
ATOM   1973 N  N    . SER A 1 257 ? -31.968 24.323  20.881 1.00 70.13 ? 261 SER A N    1 
ATOM   1974 C  CA   . SER A 1 257 ? -32.067 25.229  19.735 1.00 71.10 ? 261 SER A CA   1 
ATOM   1975 C  C    . SER A 1 257 ? -32.011 24.467  18.418 1.00 71.96 ? 261 SER A C    1 
ATOM   1976 O  O    . SER A 1 257 ? -32.154 25.059  17.347 1.00 72.33 ? 261 SER A O    1 
ATOM   1977 C  CB   . SER A 1 257 ? -30.976 26.296  19.763 1.00 70.91 ? 261 SER A CB   1 
ATOM   1978 O  OG   . SER A 1 257 ? -31.307 27.350  20.643 1.00 71.13 ? 261 SER A OG   1 
ATOM   1979 N  N    . LEU A 1 258 ? -31.789 23.158  18.487 1.00 72.80 ? 262 LEU A N    1 
ATOM   1980 C  CA   . LEU A 1 258 ? -31.863 22.337  17.283 1.00 73.61 ? 262 LEU A CA   1 
ATOM   1981 C  C    . LEU A 1 258 ? -33.109 21.457  17.260 1.00 74.13 ? 262 LEU A C    1 
ATOM   1982 O  O    . LEU A 1 258 ? -33.325 20.641  18.166 1.00 74.21 ? 262 LEU A O    1 
ATOM   1983 C  CB   . LEU A 1 258 ? -30.565 21.554  17.044 1.00 73.43 ? 262 LEU A CB   1 
ATOM   1984 C  CG   . LEU A 1 258 ? -29.604 22.244  16.060 1.00 73.57 ? 262 LEU A CG   1 
ATOM   1985 C  CD1  . LEU A 1 258 ? -29.099 23.635  16.525 1.00 73.52 ? 262 LEU A CD1  1 
ATOM   1986 C  CD2  . LEU A 1 258 ? -28.442 21.325  15.731 1.00 73.01 ? 262 LEU A CD2  1 
ATOM   1987 N  N    . THR A 1 259 ? -33.919 21.670  16.214 1.00 74.78 ? 263 THR A N    1 
ATOM   1988 C  CA   . THR A 1 259 ? -35.155 20.921  15.904 1.00 75.15 ? 263 THR A CA   1 
ATOM   1989 C  C    . THR A 1 259 ? -35.153 19.505  16.457 1.00 75.10 ? 263 THR A C    1 
ATOM   1990 O  O    . THR A 1 259 ? -34.206 18.745  16.203 1.00 75.00 ? 263 THR A O    1 
ATOM   1991 C  CB   . THR A 1 259 ? -35.356 20.807  14.367 1.00 75.28 ? 263 THR A CB   1 
ATOM   1992 O  OG1  . THR A 1 259 ? -35.044 22.059  13.739 1.00 76.45 ? 263 THR A OG1  1 
ATOM   1993 C  CG2  . THR A 1 259 ? -36.787 20.381  14.013 1.00 75.33 ? 263 THR A CG2  1 
ATOM   1994 N  N    . GLN A 1 260 ? -36.218 19.157  17.189 1.00 75.01 ? 264 GLN A N    1 
ATOM   1995 C  CA   . GLN A 1 260 ? -36.375 17.810  17.773 1.00 74.92 ? 264 GLN A CA   1 
ATOM   1996 C  C    . GLN A 1 260 ? -36.280 16.670  16.744 1.00 74.49 ? 264 GLN A C    1 
ATOM   1997 O  O    . GLN A 1 260 ? -36.937 16.704  15.695 1.00 74.31 ? 264 GLN A O    1 
ATOM   1998 C  CB   . GLN A 1 260 ? -37.681 17.683  18.571 1.00 74.96 ? 264 GLN A CB   1 
ATOM   1999 C  CG   . GLN A 1 260 ? -38.148 16.232  18.730 1.00 75.53 ? 264 GLN A CG   1 
ATOM   2000 C  CD   . GLN A 1 260 ? -39.001 15.998  19.955 1.00 76.12 ? 264 GLN A CD   1 
ATOM   2001 O  OE1  . GLN A 1 260 ? -38.848 16.674  20.974 1.00 77.38 ? 264 GLN A OE1  1 
ATOM   2002 N  NE2  . GLN A 1 260 ? -39.896 15.021  19.870 1.00 75.40 ? 264 GLN A NE2  1 
ATOM   2003 N  N    . MET A 1 261 ? -35.455 15.670  17.062 1.00 73.91 ? 265 MET A N    1 
ATOM   2004 C  CA   . MET A 1 261 ? -35.320 14.494  16.207 1.00 73.47 ? 265 MET A CA   1 
ATOM   2005 C  C    . MET A 1 261 ? -35.792 13.227  16.920 1.00 72.64 ? 265 MET A C    1 
ATOM   2006 O  O    . MET A 1 261 ? -35.501 13.028  18.104 1.00 72.17 ? 265 MET A O    1 
ATOM   2007 C  CB   . MET A 1 261 ? -33.889 14.350  15.665 1.00 73.33 ? 265 MET A CB   1 
ATOM   2008 C  CG   . MET A 1 261 ? -33.394 15.609  14.955 1.00 73.60 ? 265 MET A CG   1 
ATOM   2009 S  SD   . MET A 1 261 ? -32.201 15.347  13.629 1.00 74.47 ? 265 MET A SD   1 
ATOM   2010 C  CE   . MET A 1 261 ? -33.285 14.856  12.276 1.00 74.69 ? 265 MET A CE   1 
ATOM   2011 N  N    . PRO A 1 262 ? -36.568 12.386  16.203 1.00 72.02 ? 266 PRO A N    1 
ATOM   2012 C  CA   . PRO A 1 262 ? -36.930 11.068  16.706 1.00 71.29 ? 266 PRO A CA   1 
ATOM   2013 C  C    . PRO A 1 262 ? -35.710 10.139  16.724 1.00 70.59 ? 266 PRO A C    1 
ATOM   2014 O  O    . PRO A 1 262 ? -34.848 10.213  15.831 1.00 70.04 ? 266 PRO A O    1 
ATOM   2015 C  CB   . PRO A 1 262 ? -37.971 10.574  15.688 1.00 71.26 ? 266 PRO A CB   1 
ATOM   2016 C  CG   . PRO A 1 262 ? -38.391 11.796  14.908 1.00 71.50 ? 266 PRO A CG   1 
ATOM   2017 C  CD   . PRO A 1 262 ? -37.167 12.644  14.878 1.00 72.08 ? 266 PRO A CD   1 
ATOM   2018 N  N    . LYS A 1 263 ? -35.643 9.303   17.762 1.00 69.92 ? 267 LYS A N    1 
ATOM   2019 C  CA   . LYS A 1 263 ? -34.660 8.236   17.874 1.00 69.06 ? 267 LYS A CA   1 
ATOM   2020 C  C    . LYS A 1 263 ? -35.024 7.156   16.872 1.00 68.59 ? 267 LYS A C    1 
ATOM   2021 O  O    . LYS A 1 263 ? -36.049 6.483   17.035 1.00 68.96 ? 267 LYS A O    1 
ATOM   2022 C  CB   . LYS A 1 263 ? -34.687 7.626   19.277 1.00 69.01 ? 267 LYS A CB   1 
ATOM   2023 C  CG   . LYS A 1 263 ? -33.613 6.574   19.474 1.00 69.09 ? 267 LYS A CG   1 
ATOM   2024 C  CD   . LYS A 1 263 ? -34.111 5.325   20.164 1.00 70.12 ? 267 LYS A CD   1 
ATOM   2025 C  CE   . LYS A 1 263 ? -33.069 4.217   19.990 1.00 70.79 ? 267 LYS A CE   1 
ATOM   2026 N  NZ   . LYS A 1 263 ? -33.574 2.854   20.294 1.00 70.99 ? 267 LYS A NZ   1 
ATOM   2027 N  N    . MET A 1 264 ? -34.186 6.974   15.854 1.00 67.59 ? 268 MET A N    1 
ATOM   2028 C  CA   . MET A 1 264 ? -34.482 6.029   14.776 1.00 66.64 ? 268 MET A CA   1 
ATOM   2029 C  C    . MET A 1 264 ? -34.605 4.587   15.269 1.00 65.60 ? 268 MET A C    1 
ATOM   2030 O  O    . MET A 1 264 ? -34.162 4.249   16.370 1.00 65.52 ? 268 MET A O    1 
ATOM   2031 C  CB   . MET A 1 264 ? -33.450 6.144   13.653 1.00 66.75 ? 268 MET A CB   1 
ATOM   2032 C  CG   . MET A 1 264 ? -33.572 7.441   12.860 1.00 67.06 ? 268 MET A CG   1 
ATOM   2033 S  SD   . MET A 1 264 ? -32.305 7.606   11.590 1.00 68.00 ? 268 MET A SD   1 
ATOM   2034 C  CE   . MET A 1 264 ? -32.644 9.249   10.944 1.00 68.60 ? 268 MET A CE   1 
ATOM   2035 N  N    . ASN A 1 265 ? -35.253 3.755   14.456 1.00 64.55 ? 269 ASN A N    1 
ATOM   2036 C  CA   . ASN A 1 265 ? -35.344 2.324   14.712 1.00 62.96 ? 269 ASN A CA   1 
ATOM   2037 C  C    . ASN A 1 265 ? -34.021 1.703   14.278 1.00 62.30 ? 269 ASN A C    1 
ATOM   2038 O  O    . ASN A 1 265 ? -33.656 1.770   13.096 1.00 62.24 ? 269 ASN A O    1 
ATOM   2039 C  CB   . ASN A 1 265 ? -36.529 1.718   13.944 1.00 62.67 ? 269 ASN A CB   1 
ATOM   2040 C  CG   . ASN A 1 265 ? -37.001 0.387   14.531 1.00 61.89 ? 269 ASN A CG   1 
ATOM   2041 O  OD1  . ASN A 1 265 ? -36.237 -0.569  14.672 1.00 59.96 ? 269 ASN A OD1  1 
ATOM   2042 N  ND2  . ASN A 1 265 ? -38.278 0.327   14.867 1.00 62.42 ? 269 ASN A ND2  1 
ATOM   2043 N  N    . PHE A 1 266 ? -33.282 1.139   15.233 1.00 61.29 ? 270 PHE A N    1 
ATOM   2044 C  CA   . PHE A 1 266 ? -31.980 0.553   14.916 1.00 60.24 ? 270 PHE A CA   1 
ATOM   2045 C  C    . PHE A 1 266 ? -32.160 -0.646  13.971 1.00 59.33 ? 270 PHE A C    1 
ATOM   2046 O  O    . PHE A 1 266 ? -31.432 -0.787  12.994 1.00 58.83 ? 270 PHE A O    1 
ATOM   2047 C  CB   . PHE A 1 266 ? -31.214 0.157   16.188 1.00 60.18 ? 270 PHE A CB   1 
ATOM   2048 C  CG   . PHE A 1 266 ? -30.394 1.280   16.810 1.00 60.11 ? 270 PHE A CG   1 
ATOM   2049 C  CD1  . PHE A 1 266 ? -29.044 1.078   17.120 1.00 59.70 ? 270 PHE A CD1  1 
ATOM   2050 C  CD2  . PHE A 1 266 ? -30.971 2.517   17.110 1.00 59.39 ? 270 PHE A CD2  1 
ATOM   2051 C  CE1  . PHE A 1 266 ? -28.279 2.091   17.711 1.00 59.82 ? 270 PHE A CE1  1 
ATOM   2052 C  CE2  . PHE A 1 266 ? -30.218 3.542   17.698 1.00 59.98 ? 270 PHE A CE2  1 
ATOM   2053 C  CZ   . PHE A 1 266 ? -28.869 3.325   18.009 1.00 60.23 ? 270 PHE A CZ   1 
ATOM   2054 N  N    . ALA A 1 267 ? -33.149 -1.488  14.254 1.00 58.43 ? 271 ALA A N    1 
ATOM   2055 C  CA   . ALA A 1 267 ? -33.445 -2.621  13.382 1.00 57.57 ? 271 ALA A CA   1 
ATOM   2056 C  C    . ALA A 1 267 ? -33.523 -2.212  11.899 1.00 56.76 ? 271 ALA A C    1 
ATOM   2057 O  O    . ALA A 1 267 ? -33.051 -2.931  11.040 1.00 55.89 ? 271 ALA A O    1 
ATOM   2058 C  CB   . ALA A 1 267 ? -34.717 -3.335  13.833 1.00 57.62 ? 271 ALA A CB   1 
ATOM   2059 N  N    . ASN A 1 268 ? -34.109 -1.047  11.622 1.00 56.65 ? 272 ASN A N    1 
ATOM   2060 C  CA   . ASN A 1 268 ? -34.213 -0.498  10.266 1.00 56.14 ? 272 ASN A CA   1 
ATOM   2061 C  C    . ASN A 1 268 ? -32.859 -0.017  9.740  1.00 55.82 ? 272 ASN A C    1 
ATOM   2062 O  O    . ASN A 1 268 ? -32.556 -0.171  8.549  1.00 55.60 ? 272 ASN A O    1 
ATOM   2063 C  CB   . ASN A 1 268 ? -35.161 0.709   10.238 1.00 56.45 ? 272 ASN A CB   1 
ATOM   2064 C  CG   . ASN A 1 268 ? -36.630 0.340   10.374 1.00 57.79 ? 272 ASN A CG   1 
ATOM   2065 O  OD1  . ASN A 1 268 ? -36.999 -0.654  11.012 1.00 58.86 ? 272 ASN A OD1  1 
ATOM   2066 N  ND2  . ASN A 1 268 ? -37.490 1.180   9.793  1.00 58.11 ? 272 ASN A ND2  1 
ATOM   2067 N  N    . VAL A 1 269 ? -32.064 0.594   10.626 1.00 54.81 ? 273 VAL A N    1 
ATOM   2068 C  CA   . VAL A 1 269 ? -30.794 1.213   10.228 1.00 54.03 ? 273 VAL A CA   1 
ATOM   2069 C  C    . VAL A 1 269 ? -29.743 0.137   10.000 1.00 53.04 ? 273 VAL A C    1 
ATOM   2070 O  O    . VAL A 1 269 ? -28.910 0.233   9.091  1.00 53.19 ? 273 VAL A O    1 
ATOM   2071 C  CB   . VAL A 1 269 ? -30.259 2.235   11.278 1.00 53.93 ? 273 VAL A CB   1 
ATOM   2072 C  CG1  . VAL A 1 269 ? -28.886 2.765   10.846 1.00 54.32 ? 273 VAL A CG1  1 
ATOM   2073 C  CG2  . VAL A 1 269 ? -31.244 3.413   11.466 1.00 54.26 ? 273 VAL A CG2  1 
ATOM   2074 N  N    . PHE A 1 270 ? -29.784 -0.886  10.842 1.00 51.68 ? 274 PHE A N    1 
ATOM   2075 C  CA   . PHE A 1 270 ? -28.826 -1.962  10.748 1.00 50.59 ? 274 PHE A CA   1 
ATOM   2076 C  C    . PHE A 1 270 ? -29.457 -3.184  10.092 1.00 50.01 ? 274 PHE A C    1 
ATOM   2077 O  O    . PHE A 1 270 ? -29.435 -4.302  10.626 1.00 49.25 ? 274 PHE A O    1 
ATOM   2078 C  CB   . PHE A 1 270 ? -28.133 -2.210  12.097 1.00 49.94 ? 274 PHE A CB   1 
ATOM   2079 C  CG   . PHE A 1 270 ? -27.351 -1.014  12.576 1.00 49.35 ? 274 PHE A CG   1 
ATOM   2080 C  CD1  . PHE A 1 270 ? -27.875 -0.165  13.546 1.00 47.15 ? 274 PHE A CD1  1 
ATOM   2081 C  CD2  . PHE A 1 270 ? -26.111 -0.711  12.021 1.00 47.76 ? 274 PHE A CD2  1 
ATOM   2082 C  CE1  . PHE A 1 270 ? -27.156 0.968   13.969 1.00 47.63 ? 274 PHE A CE1  1 
ATOM   2083 C  CE2  . PHE A 1 270 ? -25.401 0.423   12.421 1.00 48.27 ? 274 PHE A CE2  1 
ATOM   2084 C  CZ   . PHE A 1 270 ? -25.923 1.263   13.399 1.00 48.18 ? 274 PHE A CZ   1 
ATOM   2085 N  N    . ILE A 1 271 ? -30.068 -2.907  8.933  1.00 50.12 ? 275 ILE A N    1 
ATOM   2086 C  CA   . ILE A 1 271 ? -30.262 -3.888  7.844  1.00 50.46 ? 275 ILE A CA   1 
ATOM   2087 C  C    . ILE A 1 271 ? -30.812 -5.216  8.369  1.00 49.74 ? 275 ILE A C    1 
ATOM   2088 O  O    . ILE A 1 271 ? -31.676 -5.242  9.266  1.00 49.83 ? 275 ILE A O    1 
ATOM   2089 C  CB   . ILE A 1 271 ? -28.884 -4.068  7.049  1.00 50.19 ? 275 ILE A CB   1 
ATOM   2090 C  CG1  . ILE A 1 271 ? -29.000 -4.917  5.780  1.00 51.03 ? 275 ILE A CG1  1 
ATOM   2091 C  CG2  . ILE A 1 271 ? -27.706 -4.560  7.966  1.00 51.13 ? 275 ILE A CG2  1 
ATOM   2092 C  CD1  . ILE A 1 271 ? -27.691 -4.921  4.958  1.00 51.08 ? 275 ILE A CD1  1 
ATOM   2093 N  N    . GLY A 1 272 ? -30.316 -6.295  7.777  1.00 49.02 ? 276 GLY A N    1 
ATOM   2094 C  CA   . GLY A 1 272 ? -30.341 -7.610  8.362  1.00 47.92 ? 276 GLY A CA   1 
ATOM   2095 C  C    . GLY A 1 272 ? -28.954 -7.961  8.885  1.00 47.11 ? 276 GLY A C    1 
ATOM   2096 O  O    . GLY A 1 272 ? -28.325 -8.879  8.375  1.00 47.06 ? 276 GLY A O    1 
ATOM   2097 N  N    . ALA A 1 273 ? -28.466 -7.189  9.862  1.00 45.90 ? 277 ALA A N    1 
ATOM   2098 C  CA   . ALA A 1 273 ? -27.400 -7.634  10.781 1.00 44.88 ? 277 ALA A CA   1 
ATOM   2099 C  C    . ALA A 1 273 ? -28.078 -8.514  11.810 1.00 44.28 ? 277 ALA A C    1 
ATOM   2100 O  O    . ALA A 1 273 ? -29.307 -8.490  11.922 1.00 44.21 ? 277 ALA A O    1 
ATOM   2101 C  CB   . ALA A 1 273 ? -26.722 -6.441  11.477 1.00 44.27 ? 277 ALA A CB   1 
ATOM   2102 N  N    . ASN A 1 274 ? -27.300 -9.279  12.569 1.00 43.44 ? 278 ASN A N    1 
ATOM   2103 C  CA   . ASN A 1 274 ? -27.866 -10.088 13.617 1.00 42.99 ? 278 ASN A CA   1 
ATOM   2104 C  C    . ASN A 1 274 ? -28.685 -9.180  14.542 1.00 43.56 ? 278 ASN A C    1 
ATOM   2105 O  O    . ASN A 1 274 ? -28.167 -8.162  15.003 1.00 43.72 ? 278 ASN A O    1 
ATOM   2106 C  CB   . ASN A 1 274 ? -26.746 -10.798 14.379 1.00 42.39 ? 278 ASN A CB   1 
ATOM   2107 C  CG   . ASN A 1 274 ? -27.250 -11.667 15.501 1.00 41.27 ? 278 ASN A CG   1 
ATOM   2108 O  OD1  . ASN A 1 274 ? -28.381 -11.541 15.954 1.00 41.81 ? 278 ASN A OD1  1 
ATOM   2109 N  ND2  . ASN A 1 274 ? -26.402 -12.558 15.970 1.00 42.33 ? 278 ASN A ND2  1 
ATOM   2110 N  N    . PRO A 1 275 ? -29.967 -9.522  14.778 1.00 43.20 ? 279 PRO A N    1 
ATOM   2111 C  CA   . PRO A 1 275 ? -30.799 -8.794  15.768 1.00 43.35 ? 279 PRO A CA   1 
ATOM   2112 C  C    . PRO A 1 275 ? -30.219 -8.630  17.198 1.00 42.51 ? 279 PRO A C    1 
ATOM   2113 O  O    . PRO A 1 275 ? -30.585 -7.674  17.887 1.00 42.71 ? 279 PRO A O    1 
ATOM   2114 C  CB   . PRO A 1 275 ? -32.118 -9.605  15.815 1.00 43.55 ? 279 PRO A CB   1 
ATOM   2115 C  CG   . PRO A 1 275 ? -32.171 -10.352 14.500 1.00 43.68 ? 279 PRO A CG   1 
ATOM   2116 C  CD   . PRO A 1 275 ? -30.719 -10.599 14.098 1.00 43.55 ? 279 PRO A CD   1 
ATOM   2117 N  N    . LEU A 1 276 ? -29.375 -9.554  17.654 1.00 41.28 ? 280 LEU A N    1 
ATOM   2118 C  CA   . LEU A 1 276 ? -28.699 -9.388  18.952 1.00 40.22 ? 280 LEU A CA   1 
ATOM   2119 C  C    . LEU A 1 276 ? -27.537 -8.409  18.914 1.00 40.13 ? 280 LEU A C    1 
ATOM   2120 O  O    . LEU A 1 276 ? -27.133 -7.920  19.961 1.00 40.82 ? 280 LEU A O    1 
ATOM   2121 C  CB   . LEU A 1 276 ? -28.189 -10.698 19.534 1.00 39.91 ? 280 LEU A CB   1 
ATOM   2122 C  CG   . LEU A 1 276 ? -29.159 -11.775 20.006 1.00 38.58 ? 280 LEU A CG   1 
ATOM   2123 C  CD1  . LEU A 1 276 ? -28.376 -13.062 20.238 1.00 35.11 ? 280 LEU A CD1  1 
ATOM   2124 C  CD2  . LEU A 1 276 ? -29.921 -11.334 21.249 1.00 38.42 ? 280 LEU A CD2  1 
ATOM   2125 N  N    . ALA A 1 277 ? -27.014 -8.120  17.727 1.00 39.14 ? 281 ALA A N    1 
ATOM   2126 C  CA   . ALA A 1 277 ? -25.972 -7.119  17.565 1.00 38.38 ? 281 ALA A CA   1 
ATOM   2127 C  C    . ALA A 1 277 ? -26.672 -5.781  17.449 1.00 38.67 ? 281 ALA A C    1 
ATOM   2128 O  O    . ALA A 1 277 ? -26.097 -4.717  17.722 1.00 38.32 ? 281 ALA A O    1 
ATOM   2129 C  CB   . ALA A 1 277 ? -25.158 -7.377  16.306 1.00 37.36 ? 281 ALA A CB   1 
ATOM   2130 N  N    . VAL A 1 278 ? -27.910 -5.828  16.990 1.00 38.08 ? 282 VAL A N    1 
ATOM   2131 C  CA   . VAL A 1 278 ? -28.669 -4.618  16.899 1.00 38.01 ? 282 VAL A CA   1 
ATOM   2132 C  C    . VAL A 1 278 ? -29.091 -4.225  18.330 1.00 37.83 ? 282 VAL A C    1 
ATOM   2133 O  O    . VAL A 1 278 ? -28.982 -3.071  18.691 1.00 37.75 ? 282 VAL A O    1 
ATOM   2134 C  CB   . VAL A 1 278 ? -29.807 -4.712  15.841 1.00 38.29 ? 282 VAL A CB   1 
ATOM   2135 C  CG1  . VAL A 1 278 ? -30.657 -3.453  15.858 1.00 37.34 ? 282 VAL A CG1  1 
ATOM   2136 C  CG2  . VAL A 1 278 ? -29.208 -4.919  14.435 1.00 35.49 ? 282 VAL A CG2  1 
ATOM   2137 N  N    . ASP A 1 279 ? -29.484 -5.194  19.154 1.00 37.77 ? 283 ASP A N    1 
ATOM   2138 C  CA   . ASP A 1 279 ? -29.844 -4.922  20.539 1.00 38.45 ? 283 ASP A CA   1 
ATOM   2139 C  C    . ASP A 1 279 ? -28.640 -4.258  21.243 1.00 38.60 ? 283 ASP A C    1 
ATOM   2140 O  O    . ASP A 1 279 ? -28.712 -3.099  21.664 1.00 38.66 ? 283 ASP A O    1 
ATOM   2141 C  CB   . ASP A 1 279 ? -30.271 -6.215  21.239 1.00 38.78 ? 283 ASP A CB   1 
ATOM   2142 C  CG   . ASP A 1 279 ? -30.758 -5.989  22.668 1.00 40.29 ? 283 ASP A CG   1 
ATOM   2143 O  OD1  . ASP A 1 279 ? -31.723 -5.237  22.823 1.00 43.76 ? 283 ASP A OD1  1 
ATOM   2144 O  OD2  . ASP A 1 279 ? -30.226 -6.590  23.633 1.00 40.48 ? 283 ASP A OD2  1 
ATOM   2145 N  N    . LEU A 1 280 ? -27.523 -4.972  21.321 1.00 38.50 ? 284 LEU A N    1 
ATOM   2146 C  CA   . LEU A 1 280 ? -26.320 -4.443  21.965 1.00 38.58 ? 284 LEU A CA   1 
ATOM   2147 C  C    . LEU A 1 280 ? -25.924 -3.022  21.481 1.00 38.62 ? 284 LEU A C    1 
ATOM   2148 O  O    . LEU A 1 280 ? -25.620 -2.177  22.299 1.00 38.64 ? 284 LEU A O    1 
ATOM   2149 C  CB   . LEU A 1 280 ? -25.167 -5.443  21.855 1.00 38.30 ? 284 LEU A CB   1 
ATOM   2150 C  CG   . LEU A 1 280 ? -23.869 -5.041  22.550 1.00 38.44 ? 284 LEU A CG   1 
ATOM   2151 C  CD1  . LEU A 1 280 ? -23.949 -5.209  24.047 1.00 38.17 ? 284 LEU A CD1  1 
ATOM   2152 C  CD2  . LEU A 1 280 ? -22.740 -5.853  21.987 1.00 37.78 ? 284 LEU A CD2  1 
ATOM   2153 N  N    . LEU A 1 281 ? -25.977 -2.756  20.179 1.00 39.46 ? 285 LEU A N    1 
ATOM   2154 C  CA   . LEU A 1 281 ? -25.674 -1.435  19.625 1.00 40.68 ? 285 LEU A CA   1 
ATOM   2155 C  C    . LEU A 1 281 ? -26.551 -0.383  20.295 1.00 41.98 ? 285 LEU A C    1 
ATOM   2156 O  O    . LEU A 1 281 ? -26.030 0.541   20.915 1.00 42.49 ? 285 LEU A O    1 
ATOM   2157 C  CB   . LEU A 1 281 ? -25.895 -1.403  18.108 1.00 40.36 ? 285 LEU A CB   1 
ATOM   2158 C  CG   . LEU A 1 281 ? -24.775 -1.737  17.124 1.00 40.33 ? 285 LEU A CG   1 
ATOM   2159 C  CD1  . LEU A 1 281 ? -25.284 -1.632  15.691 1.00 38.50 ? 285 LEU A CD1  1 
ATOM   2160 C  CD2  . LEU A 1 281 ? -23.540 -0.868  17.329 1.00 38.96 ? 285 LEU A CD2  1 
ATOM   2161 N  N    . GLU A 1 282 ? -27.879 -0.557  20.199 1.00 42.73 ? 286 GLU A N    1 
ATOM   2162 C  CA   . GLU A 1 282 ? -28.869 0.261   20.930 1.00 43.34 ? 286 GLU A CA   1 
ATOM   2163 C  C    . GLU A 1 282 ? -28.408 0.630   22.325 1.00 42.22 ? 286 GLU A C    1 
ATOM   2164 O  O    . GLU A 1 282 ? -28.412 1.789   22.683 1.00 42.58 ? 286 GLU A O    1 
ATOM   2165 C  CB   . GLU A 1 282 ? -30.201 -0.480  21.062 1.00 43.38 ? 286 GLU A CB   1 
ATOM   2166 C  CG   . GLU A 1 282 ? -31.256 -0.030  20.088 1.00 47.21 ? 286 GLU A CG   1 
ATOM   2167 C  CD   . GLU A 1 282 ? -32.410 -1.000  19.985 1.00 49.26 ? 286 GLU A CD   1 
ATOM   2168 O  OE1  . GLU A 1 282 ? -32.634 -1.785  20.934 1.00 51.41 ? 286 GLU A OE1  1 
ATOM   2169 O  OE2  . GLU A 1 282 ? -33.096 -0.970  18.944 1.00 51.94 ? 286 GLU A OE2  1 
ATOM   2170 N  N    . LYS A 1 283 ? -28.029 -0.382  23.095 1.00 42.35 ? 287 LYS A N    1 
ATOM   2171 C  CA   . LYS A 1 283 ? -27.572 -0.247  24.477 1.00 42.02 ? 287 LYS A CA   1 
ATOM   2172 C  C    . LYS A 1 283 ? -26.190 0.425   24.664 1.00 42.00 ? 287 LYS A C    1 
ATOM   2173 O  O    . LYS A 1 283 ? -25.771 0.656   25.794 1.00 42.57 ? 287 LYS A O    1 
ATOM   2174 C  CB   . LYS A 1 283 ? -27.516 -1.630  25.102 1.00 42.23 ? 287 LYS A CB   1 
ATOM   2175 C  CG   . LYS A 1 283 ? -28.866 -2.313  25.289 1.00 41.54 ? 287 LYS A CG   1 
ATOM   2176 C  CD   . LYS A 1 283 ? -28.658 -3.570  26.101 1.00 41.63 ? 287 LYS A CD   1 
ATOM   2177 C  CE   . LYS A 1 283 ? -29.976 -4.118  26.665 1.00 42.75 ? 287 LYS A CE   1 
ATOM   2178 N  NZ   . LYS A 1 283 ? -30.778 -4.769  25.624 1.00 40.63 ? 287 LYS A NZ   1 
ATOM   2179 N  N    . MET A 1 284 ? -25.486 0.705   23.563 1.00 41.14 ? 288 MET A N    1 
ATOM   2180 C  CA   . MET A 1 284 ? -24.134 1.232   23.621 1.00 40.62 ? 288 MET A CA   1 
ATOM   2181 C  C    . MET A 1 284 ? -24.162 2.662   23.175 1.00 40.46 ? 288 MET A C    1 
ATOM   2182 O  O    . MET A 1 284 ? -23.499 3.506   23.753 1.00 40.53 ? 288 MET A O    1 
ATOM   2183 C  CB   . MET A 1 284 ? -23.194 0.480   22.667 1.00 39.70 ? 288 MET A CB   1 
ATOM   2184 C  CG   . MET A 1 284 ? -22.579 -0.758  23.200 1.00 38.95 ? 288 MET A CG   1 
ATOM   2185 S  SD   . MET A 1 284 ? -21.491 -1.539  21.952 1.00 39.76 ? 288 MET A SD   1 
ATOM   2186 C  CE   . MET A 1 284 ? -20.772 -2.758  23.041 1.00 36.48 ? 288 MET A CE   1 
ATOM   2187 N  N    . LEU A 1 285 ? -24.928 2.908   22.122 1.00 41.09 ? 289 LEU A N    1 
ATOM   2188 C  CA   . LEU A 1 285 ? -25.008 4.208   21.500 1.00 42.53 ? 289 LEU A CA   1 
ATOM   2189 C  C    . LEU A 1 285 ? -26.211 4.982   22.055 1.00 43.70 ? 289 LEU A C    1 
ATOM   2190 O  O    . LEU A 1 285 ? -27.073 5.454   21.308 1.00 44.04 ? 289 LEU A O    1 
ATOM   2191 C  CB   . LEU A 1 285 ? -25.071 4.068   19.974 1.00 42.10 ? 289 LEU A CB   1 
ATOM   2192 C  CG   . LEU A 1 285 ? -23.839 3.552   19.215 1.00 40.92 ? 289 LEU A CG   1 
ATOM   2193 C  CD1  . LEU A 1 285 ? -24.142 3.475   17.730 1.00 37.77 ? 289 LEU A CD1  1 
ATOM   2194 C  CD2  . LEU A 1 285 ? -22.595 4.422   19.471 1.00 36.77 ? 289 LEU A CD2  1 
ATOM   2195 N  N    . VAL A 1 286 ? -26.256 5.064   23.381 1.00 44.71 ? 290 VAL A N    1 
ATOM   2196 C  CA   . VAL A 1 286 ? -27.209 5.896   24.121 1.00 46.21 ? 290 VAL A CA   1 
ATOM   2197 C  C    . VAL A 1 286 ? -26.603 7.299   24.284 1.00 46.51 ? 290 VAL A C    1 
ATOM   2198 O  O    . VAL A 1 286 ? -25.456 7.430   24.710 1.00 46.72 ? 290 VAL A O    1 
ATOM   2199 C  CB   . VAL A 1 286 ? -27.512 5.286   25.510 1.00 46.11 ? 290 VAL A CB   1 
ATOM   2200 C  CG1  . VAL A 1 286 ? -28.624 6.066   26.232 1.00 47.38 ? 290 VAL A CG1  1 
ATOM   2201 C  CG2  . VAL A 1 286 ? -27.892 3.819   25.362 1.00 46.44 ? 290 VAL A CG2  1 
ATOM   2202 N  N    . LEU A 1 287 ? -27.357 8.335   23.917 1.00 46.29 ? 291 LEU A N    1 
ATOM   2203 C  CA   . LEU A 1 287 ? -26.891 9.719   24.063 1.00 46.41 ? 291 LEU A CA   1 
ATOM   2204 C  C    . LEU A 1 287 ? -26.605 10.069  25.526 1.00 46.13 ? 291 LEU A C    1 
ATOM   2205 O  O    . LEU A 1 287 ? -25.689 10.848  25.821 1.00 46.54 ? 291 LEU A O    1 
ATOM   2206 C  CB   . LEU A 1 287 ? -27.925 10.678  23.462 1.00 46.69 ? 291 LEU A CB   1 
ATOM   2207 C  CG   . LEU A 1 287 ? -27.586 12.119  23.089 1.00 46.77 ? 291 LEU A CG   1 
ATOM   2208 C  CD1  . LEU A 1 287 ? -26.525 12.255  21.983 1.00 48.04 ? 291 LEU A CD1  1 
ATOM   2209 C  CD2  . LEU A 1 287 ? -28.870 12.798  22.659 1.00 46.58 ? 291 LEU A CD2  1 
ATOM   2210 N  N    . ASP A 1 288 ? -27.361 9.469   26.442 1.00 45.92 ? 292 ASP A N    1 
ATOM   2211 C  CA   . ASP A 1 288 ? -27.112 9.654   27.880 1.00 45.55 ? 292 ASP A CA   1 
ATOM   2212 C  C    . ASP A 1 288 ? -26.064 8.698   28.463 1.00 45.10 ? 292 ASP A C    1 
ATOM   2213 O  O    . ASP A 1 288 ? -26.350 7.516   28.689 1.00 44.59 ? 292 ASP A O    1 
ATOM   2214 C  CB   . ASP A 1 288 ? -28.412 9.574   28.690 1.00 45.68 ? 292 ASP A CB   1 
ATOM   2215 C  CG   . ASP A 1 288 ? -28.216 9.980   30.139 1.00 45.85 ? 292 ASP A CG   1 
ATOM   2216 O  OD1  . ASP A 1 288 ? -27.538 10.986  30.364 1.00 46.43 ? 292 ASP A OD1  1 
ATOM   2217 O  OD2  . ASP A 1 288 ? -28.727 9.293   31.054 1.00 49.27 ? 292 ASP A OD2  1 
ATOM   2218 N  N    . SER A 1 289 ? -24.884 9.244   28.769 1.00 44.64 ? 293 SER A N    1 
ATOM   2219 C  CA   . SER A 1 289 ? -23.716 8.441   29.160 1.00 44.92 ? 293 SER A CA   1 
ATOM   2220 C  C    . SER A 1 289 ? -23.963 7.595   30.396 1.00 44.56 ? 293 SER A C    1 
ATOM   2221 O  O    . SER A 1 289 ? -23.241 6.637   30.643 1.00 44.41 ? 293 SER A O    1 
ATOM   2222 C  CB   . SER A 1 289 ? -22.443 9.302   29.309 1.00 44.60 ? 293 SER A CB   1 
ATOM   2223 O  OG   . SER A 1 289 ? -22.570 10.293  30.315 1.00 45.41 ? 293 SER A OG   1 
ATOM   2224 N  N    . ASP A 1 290 ? -25.014 7.948   31.131 1.00 44.43 ? 294 ASP A N    1 
ATOM   2225 C  CA   . ASP A 1 290 ? -25.411 7.294   32.365 1.00 45.02 ? 294 ASP A CA   1 
ATOM   2226 C  C    . ASP A 1 290 ? -26.190 6.012   32.088 1.00 44.53 ? 294 ASP A C    1 
ATOM   2227 O  O    . ASP A 1 290 ? -26.263 5.129   32.925 1.00 44.02 ? 294 ASP A O    1 
ATOM   2228 C  CB   . ASP A 1 290 ? -26.333 8.227   33.157 1.00 45.51 ? 294 ASP A CB   1 
ATOM   2229 C  CG   . ASP A 1 290 ? -25.598 9.397   33.811 1.00 48.35 ? 294 ASP A CG   1 
ATOM   2230 O  OD1  . ASP A 1 290 ? -26.290 10.159  34.537 1.00 49.01 ? 294 ASP A OD1  1 
ATOM   2231 O  OD2  . ASP A 1 290 ? -24.357 9.552   33.621 1.00 49.41 ? 294 ASP A OD2  1 
ATOM   2232 N  N    . LYS A 1 291 ? -26.814 5.942   30.918 1.00 44.64 ? 295 LYS A N    1 
ATOM   2233 C  CA   . LYS A 1 291 ? -27.665 4.791   30.591 1.00 44.65 ? 295 LYS A CA   1 
ATOM   2234 C  C    . LYS A 1 291 ? -26.943 3.808   29.669 1.00 43.06 ? 295 LYS A C    1 
ATOM   2235 O  O    . LYS A 1 291 ? -27.532 2.814   29.237 1.00 43.10 ? 295 LYS A O    1 
ATOM   2236 C  CB   . LYS A 1 291 ? -28.973 5.248   29.938 1.00 44.85 ? 295 LYS A CB   1 
ATOM   2237 C  CG   . LYS A 1 291 ? -29.735 6.294   30.744 1.00 47.79 ? 295 LYS A CG   1 
ATOM   2238 C  CD   . LYS A 1 291 ? -30.076 5.799   32.140 1.00 51.13 ? 295 LYS A CD   1 
ATOM   2239 C  CE   . LYS A 1 291 ? -30.708 6.918   32.974 1.00 54.40 ? 295 LYS A CE   1 
ATOM   2240 N  NZ   . LYS A 1 291 ? -31.825 7.611   32.239 1.00 55.94 ? 295 LYS A NZ   1 
ATOM   2241 N  N    . ARG A 1 292 ? -25.679 4.118   29.377 1.00 40.82 ? 296 ARG A N    1 
ATOM   2242 C  CA   . ARG A 1 292 ? -24.839 3.307   28.506 1.00 39.07 ? 296 ARG A CA   1 
ATOM   2243 C  C    . ARG A 1 292 ? -24.445 2.059   29.246 1.00 37.40 ? 296 ARG A C    1 
ATOM   2244 O  O    . ARG A 1 292 ? -24.028 2.122   30.408 1.00 38.44 ? 296 ARG A O    1 
ATOM   2245 C  CB   . ARG A 1 292 ? -23.583 4.065   28.059 1.00 38.68 ? 296 ARG A CB   1 
ATOM   2246 C  CG   . ARG A 1 292 ? -23.571 4.451   26.621 1.00 38.28 ? 296 ARG A CG   1 
ATOM   2247 C  CD   . ARG A 1 292 ? -23.717 5.926   26.337 1.00 39.27 ? 296 ARG A CD   1 
ATOM   2248 N  NE   . ARG A 1 292 ? -22.444 6.592   26.515 1.00 37.30 ? 296 ARG A NE   1 
ATOM   2249 C  CZ   . ARG A 1 292 ? -22.093 7.794   26.066 1.00 36.50 ? 296 ARG A CZ   1 
ATOM   2250 N  NH1  . ARG A 1 292 ? -22.901 8.558   25.342 1.00 35.67 ? 296 ARG A NH1  1 
ATOM   2251 N  NH2  . ARG A 1 292 ? -20.865 8.216   26.338 1.00 35.20 ? 296 ARG A NH2  1 
ATOM   2252 N  N    . ILE A 1 293 ? -24.611 0.925   28.569 1.00 34.96 ? 297 ILE A N    1 
ATOM   2253 C  CA   . ILE A 1 293 ? -24.077 -0.334  29.032 1.00 33.07 ? 297 ILE A CA   1 
ATOM   2254 C  C    . ILE A 1 293 ? -22.561 -0.191  29.267 1.00 32.52 ? 297 ILE A C    1 
ATOM   2255 O  O    . ILE A 1 293 ? -21.881 0.490   28.517 1.00 31.27 ? 297 ILE A O    1 
ATOM   2256 C  CB   . ILE A 1 293 ? -24.386 -1.476  28.002 1.00 33.46 ? 297 ILE A CB   1 
ATOM   2257 C  CG1  . ILE A 1 293 ? -24.255 -2.850  28.665 1.00 32.96 ? 297 ILE A CG1  1 
ATOM   2258 C  CG2  . ILE A 1 293 ? -23.521 -1.373  26.765 1.00 29.40 ? 297 ILE A CG2  1 
ATOM   2259 C  CD1  . ILE A 1 293 ? -25.193 -3.878  28.069 1.00 32.41 ? 297 ILE A CD1  1 
ATOM   2260 N  N    . THR A 1 294 ? -22.066 -0.812  30.331 1.00 32.22 ? 298 THR A N    1 
ATOM   2261 C  CA   . THR A 1 294 ? -20.674 -0.836  30.630 1.00 31.98 ? 298 THR A CA   1 
ATOM   2262 C  C    . THR A 1 294 ? -20.035 -2.022  29.879 1.00 32.51 ? 298 THR A C    1 
ATOM   2263 O  O    . THR A 1 294 ? -20.738 -2.862  29.316 1.00 32.86 ? 298 THR A O    1 
ATOM   2264 C  CB   . THR A 1 294 ? -20.430 -0.991  32.181 1.00 31.99 ? 298 THR A CB   1 
ATOM   2265 O  OG1  . THR A 1 294 ? -20.793 -2.313  32.605 1.00 29.87 ? 298 THR A OG1  1 
ATOM   2266 C  CG2  . THR A 1 294 ? -21.220 0.078   33.045 1.00 31.21 ? 298 THR A CG2  1 
ATOM   2267 N  N    . ALA A 1 295 ? -18.704 -2.097  29.927 1.00 32.82 ? 299 ALA A N    1 
ATOM   2268 C  CA   . ALA A 1 295 ? -17.919 -3.219  29.387 1.00 32.86 ? 299 ALA A CA   1 
ATOM   2269 C  C    . ALA A 1 295 ? -18.228 -4.548  30.075 1.00 33.36 ? 299 ALA A C    1 
ATOM   2270 O  O    . ALA A 1 295 ? -18.464 -5.546  29.394 1.00 32.98 ? 299 ALA A O    1 
ATOM   2271 C  CB   . ALA A 1 295 ? -16.414 -2.902  29.474 1.00 32.16 ? 299 ALA A CB   1 
ATOM   2272 N  N    . ALA A 1 296 ? -18.208 -4.580  31.411 1.00 33.66 ? 300 ALA A N    1 
ATOM   2273 C  CA   . ALA A 1 296 ? -18.536 -5.819  32.141 1.00 34.65 ? 300 ALA A CA   1 
ATOM   2274 C  C    . ALA A 1 296 ? -19.966 -6.323  31.869 1.00 35.45 ? 300 ALA A C    1 
ATOM   2275 O  O    . ALA A 1 296 ? -20.209 -7.541  31.806 1.00 36.25 ? 300 ALA A O    1 
ATOM   2276 C  CB   . ALA A 1 296 ? -18.309 -5.651  33.620 1.00 34.52 ? 300 ALA A CB   1 
ATOM   2277 N  N    . GLN A 1 297 ? -20.898 -5.389  31.700 1.00 35.31 ? 301 GLN A N    1 
ATOM   2278 C  CA   . GLN A 1 297 ? -22.264 -5.715  31.297 1.00 36.12 ? 301 GLN A CA   1 
ATOM   2279 C  C    . GLN A 1 297 ? -22.352 -6.212  29.834 1.00 36.21 ? 301 GLN A C    1 
ATOM   2280 O  O    . GLN A 1 297 ? -23.075 -7.187  29.536 1.00 36.70 ? 301 GLN A O    1 
ATOM   2281 C  CB   . GLN A 1 297 ? -23.172 -4.495  31.513 1.00 35.65 ? 301 GLN A CB   1 
ATOM   2282 C  CG   . GLN A 1 297 ? -23.399 -4.154  33.010 1.00 36.12 ? 301 GLN A CG   1 
ATOM   2283 C  CD   . GLN A 1 297 ? -24.139 -2.857  33.230 1.00 37.74 ? 301 GLN A CD   1 
ATOM   2284 O  OE1  . GLN A 1 297 ? -24.296 -2.040  32.313 1.00 37.85 ? 301 GLN A OE1  1 
ATOM   2285 N  NE2  . GLN A 1 297 ? -24.608 -2.650  34.467 1.00 41.32 ? 301 GLN A NE2  1 
ATOM   2286 N  N    . ALA A 1 298 ? -21.635 -5.544  28.923 1.00 35.33 ? 302 ALA A N    1 
ATOM   2287 C  CA   . ALA A 1 298 ? -21.695 -5.906  27.514 1.00 35.21 ? 302 ALA A CA   1 
ATOM   2288 C  C    . ALA A 1 298 ? -21.176 -7.330  27.250 1.00 35.45 ? 302 ALA A C    1 
ATOM   2289 O  O    . ALA A 1 298 ? -21.645 -7.988  26.328 1.00 36.40 ? 302 ALA A O    1 
ATOM   2290 C  CB   . ALA A 1 298 ? -20.972 -4.886  26.653 1.00 34.81 ? 302 ALA A CB   1 
ATOM   2291 N  N    . LEU A 1 299 ? -20.241 -7.798  28.075 1.00 35.71 ? 303 LEU A N    1 
ATOM   2292 C  CA   . LEU A 1 299 ? -19.660 -9.130  27.948 1.00 36.87 ? 303 LEU A CA   1 
ATOM   2293 C  C    . LEU A 1 299 ? -20.676 -10.238 28.220 1.00 38.10 ? 303 LEU A C    1 
ATOM   2294 O  O    . LEU A 1 299 ? -20.582 -11.306 27.624 1.00 37.86 ? 303 LEU A O    1 
ATOM   2295 C  CB   . LEU A 1 299 ? -18.441 -9.313  28.863 1.00 36.08 ? 303 LEU A CB   1 
ATOM   2296 C  CG   . LEU A 1 299 ? -17.189 -8.447  28.650 1.00 36.82 ? 303 LEU A CG   1 
ATOM   2297 C  CD1  . LEU A 1 299 ? -16.163 -8.715  29.760 1.00 36.70 ? 303 LEU A CD1  1 
ATOM   2298 C  CD2  . LEU A 1 299 ? -16.566 -8.662  27.281 1.00 34.81 ? 303 LEU A CD2  1 
ATOM   2299 N  N    . ALA A 1 300 ? -21.618 -9.978  29.130 1.00 38.69 ? 304 ALA A N    1 
ATOM   2300 C  CA   . ALA A 1 300 ? -22.694 -10.922 29.448 1.00 39.83 ? 304 ALA A CA   1 
ATOM   2301 C  C    . ALA A 1 300 ? -23.907 -10.726 28.522 1.00 39.93 ? 304 ALA A C    1 
ATOM   2302 O  O    . ALA A 1 300 ? -24.979 -11.197 28.840 1.00 40.62 ? 304 ALA A O    1 
ATOM   2303 C  CB   . ALA A 1 300 ? -23.121 -10.818 30.958 1.00 39.33 ? 304 ALA A CB   1 
ATOM   2304 N  N    . HIS A 1 301 ? -23.741 -10.025 27.396 1.00 40.00 ? 305 HIS A N    1 
ATOM   2305 C  CA   . HIS A 1 301 ? -24.838 -9.871  26.424 1.00 39.64 ? 305 HIS A CA   1 
ATOM   2306 C  C    . HIS A 1 301 ? -24.887 -11.116 25.503 1.00 39.85 ? 305 HIS A C    1 
ATOM   2307 O  O    . HIS A 1 301 ? -23.840 -11.758 25.224 1.00 38.87 ? 305 HIS A O    1 
ATOM   2308 C  CB   . HIS A 1 301 ? -24.715 -8.566  25.624 1.00 39.49 ? 305 HIS A CB   1 
ATOM   2309 C  CG   . HIS A 1 301 ? -25.863 -8.286  24.679 1.00 39.85 ? 305 HIS A CG   1 
ATOM   2310 N  ND1  . HIS A 1 301 ? -25.981 -8.885  23.437 1.00 39.91 ? 305 HIS A ND1  1 
ATOM   2311 C  CD2  . HIS A 1 301 ? -26.911 -7.431  24.777 1.00 38.69 ? 305 HIS A CD2  1 
ATOM   2312 C  CE1  . HIS A 1 301 ? -27.055 -8.425  22.821 1.00 38.61 ? 305 HIS A CE1  1 
ATOM   2313 N  NE2  . HIS A 1 301 ? -27.634 -7.535  23.609 1.00 41.32 ? 305 HIS A NE2  1 
ATOM   2314 N  N    . ALA A 1 302 ? -26.112 -11.437 25.055 1.00 39.14 ? 306 ALA A N    1 
ATOM   2315 C  CA   . ALA A 1 302 ? -26.405 -12.661 24.293 1.00 38.79 ? 306 ALA A CA   1 
ATOM   2316 C  C    . ALA A 1 302 ? -25.655 -12.744 22.968 1.00 38.06 ? 306 ALA A C    1 
ATOM   2317 O  O    . ALA A 1 302 ? -25.446 -13.840 22.462 1.00 39.01 ? 306 ALA A O    1 
ATOM   2318 C  CB   . ALA A 1 302 ? -27.924 -12.831 24.074 1.00 38.10 ? 306 ALA A CB   1 
ATOM   2319 N  N    . TYR A 1 303 ? -25.239 -11.597 22.424 1.00 36.96 ? 307 TYR A N    1 
ATOM   2320 C  CA   . TYR A 1 303 ? -24.378 -11.576 21.256 1.00 35.74 ? 307 TYR A CA   1 
ATOM   2321 C  C    . TYR A 1 303 ? -23.013 -12.226 21.478 1.00 35.95 ? 307 TYR A C    1 
ATOM   2322 O  O    . TYR A 1 303 ? -22.321 -12.620 20.521 1.00 36.46 ? 307 TYR A O    1 
ATOM   2323 C  CB   . TYR A 1 303 ? -24.200 -10.164 20.790 1.00 35.12 ? 307 TYR A CB   1 
ATOM   2324 C  CG   . TYR A 1 303 ? -23.605 -10.032 19.416 1.00 34.51 ? 307 TYR A CG   1 
ATOM   2325 C  CD1  . TYR A 1 303 ? -24.216 -10.601 18.293 1.00 32.75 ? 307 TYR A CD1  1 
ATOM   2326 C  CD2  . TYR A 1 303 ? -22.433 -9.315  19.231 1.00 33.90 ? 307 TYR A CD2  1 
ATOM   2327 C  CE1  . TYR A 1 303 ? -23.679 -10.441 17.027 1.00 32.56 ? 307 TYR A CE1  1 
ATOM   2328 C  CE2  . TYR A 1 303 ? -21.885 -9.155  17.973 1.00 31.67 ? 307 TYR A CE2  1 
ATOM   2329 C  CZ   . TYR A 1 303 ? -22.499 -9.707  16.875 1.00 33.64 ? 307 TYR A CZ   1 
ATOM   2330 O  OH   . TYR A 1 303 ? -21.899 -9.513  15.636 1.00 32.71 ? 307 TYR A OH   1 
ATOM   2331 N  N    . PHE A 1 304 ? -22.616 -12.358 22.734 1.00 35.74 ? 308 PHE A N    1 
ATOM   2332 C  CA   . PHE A 1 304 ? -21.291 -12.895 23.040 1.00 35.66 ? 308 PHE A CA   1 
ATOM   2333 C  C    . PHE A 1 304 ? -21.373 -14.286 23.663 1.00 36.71 ? 308 PHE A C    1 
ATOM   2334 O  O    . PHE A 1 304 ? -20.395 -14.778 24.262 1.00 36.46 ? 308 PHE A O    1 
ATOM   2335 C  CB   . PHE A 1 304 ? -20.477 -11.891 23.894 1.00 34.13 ? 308 PHE A CB   1 
ATOM   2336 C  CG   . PHE A 1 304 ? -20.283 -10.539 23.220 1.00 32.61 ? 308 PHE A CG   1 
ATOM   2337 C  CD1  . PHE A 1 304 ? -20.843 -9.379  23.780 1.00 29.73 ? 308 PHE A CD1  1 
ATOM   2338 C  CD2  . PHE A 1 304 ? -19.558 -10.423 22.034 1.00 30.20 ? 308 PHE A CD2  1 
ATOM   2339 C  CE1  . PHE A 1 304 ? -20.681 -8.154  23.186 1.00 26.96 ? 308 PHE A CE1  1 
ATOM   2340 C  CE2  . PHE A 1 304 ? -19.399 -9.151  21.404 1.00 28.23 ? 308 PHE A CE2  1 
ATOM   2341 C  CZ   . PHE A 1 304 ? -19.966 -8.024  21.999 1.00 27.04 ? 308 PHE A CZ   1 
ATOM   2342 N  N    . ALA A 1 305 ? -22.530 -14.938 23.467 1.00 37.84 ? 309 ALA A N    1 
ATOM   2343 C  CA   . ALA A 1 305 ? -22.808 -16.248 24.078 1.00 38.78 ? 309 ALA A CA   1 
ATOM   2344 C  C    . ALA A 1 305 ? -21.772 -17.304 23.717 1.00 39.05 ? 309 ALA A C    1 
ATOM   2345 O  O    . ALA A 1 305 ? -21.452 -18.163 24.529 1.00 38.50 ? 309 ALA A O    1 
ATOM   2346 C  CB   . ALA A 1 305 ? -24.216 -16.718 23.733 1.00 38.89 ? 309 ALA A CB   1 
ATOM   2347 N  N    . GLN A 1 306 ? -21.210 -17.196 22.514 1.00 40.02 ? 310 GLN A N    1 
ATOM   2348 C  CA   . GLN A 1 306 ? -20.214 -18.157 22.050 1.00 41.06 ? 310 GLN A CA   1 
ATOM   2349 C  C    . GLN A 1 306 ? -18.819 -17.949 22.645 1.00 40.99 ? 310 GLN A C    1 
ATOM   2350 O  O    . GLN A 1 306 ? -17.967 -18.847 22.595 1.00 40.86 ? 310 GLN A O    1 
ATOM   2351 C  CB   . GLN A 1 306 ? -20.147 -18.155 20.518 1.00 41.74 ? 310 GLN A CB   1 
ATOM   2352 C  CG   . GLN A 1 306 ? -21.473 -18.455 19.831 1.00 44.26 ? 310 GLN A CG   1 
ATOM   2353 C  CD   . GLN A 1 306 ? -22.204 -19.673 20.413 1.00 48.12 ? 310 GLN A CD   1 
ATOM   2354 O  OE1  . GLN A 1 306 ? -23.419 -19.618 20.659 1.00 48.83 ? 310 GLN A OE1  1 
ATOM   2355 N  NE2  . GLN A 1 306 ? -21.468 -20.770 20.643 1.00 47.37 ? 310 GLN A NE2  1 
ATOM   2356 N  N    . TYR A 1 307 ? -18.580 -16.772 23.224 1.00 41.45 ? 311 TYR A N    1 
ATOM   2357 C  CA   . TYR A 1 307 ? -17.228 -16.407 23.656 1.00 40.60 ? 311 TYR A CA   1 
ATOM   2358 C  C    . TYR A 1 307 ? -17.113 -16.096 25.136 1.00 40.80 ? 311 TYR A C    1 
ATOM   2359 O  O    . TYR A 1 307 ? -16.042 -16.218 25.734 1.00 40.99 ? 311 TYR A O    1 
ATOM   2360 C  CB   . TYR A 1 307 ? -16.713 -15.248 22.812 1.00 40.31 ? 311 TYR A CB   1 
ATOM   2361 C  CG   . TYR A 1 307 ? -16.474 -15.598 21.369 1.00 39.56 ? 311 TYR A CG   1 
ATOM   2362 C  CD1  . TYR A 1 307 ? -17.358 -15.183 20.368 1.00 40.45 ? 311 TYR A CD1  1 
ATOM   2363 C  CD2  . TYR A 1 307 ? -15.351 -16.319 20.988 1.00 39.87 ? 311 TYR A CD2  1 
ATOM   2364 C  CE1  . TYR A 1 307 ? -17.134 -15.489 19.030 1.00 38.37 ? 311 TYR A CE1  1 
ATOM   2365 C  CE2  . TYR A 1 307 ? -15.134 -16.654 19.644 1.00 40.18 ? 311 TYR A CE2  1 
ATOM   2366 C  CZ   . TYR A 1 307 ? -16.021 -16.229 18.683 1.00 40.04 ? 311 TYR A CZ   1 
ATOM   2367 O  OH   . TYR A 1 307 ? -15.776 -16.547 17.360 1.00 41.69 ? 311 TYR A OH   1 
ATOM   2368 N  N    . HIS A 1 308 ? -18.230 -15.709 25.729 1.00 41.27 ? 312 HIS A N    1 
ATOM   2369 C  CA   . HIS A 1 308 ? -18.266 -15.219 27.094 1.00 41.07 ? 312 HIS A CA   1 
ATOM   2370 C  C    . HIS A 1 308 ? -17.913 -16.336 28.043 1.00 41.80 ? 312 HIS A C    1 
ATOM   2371 O  O    . HIS A 1 308 ? -18.423 -17.441 27.919 1.00 41.92 ? 312 HIS A O    1 
ATOM   2372 C  CB   . HIS A 1 308 ? -19.660 -14.664 27.389 1.00 40.71 ? 312 HIS A CB   1 
ATOM   2373 C  CG   . HIS A 1 308 ? -19.882 -14.217 28.808 1.00 41.18 ? 312 HIS A CG   1 
ATOM   2374 N  ND1  . HIS A 1 308 ? -19.023 -13.373 29.475 1.00 39.83 ? 312 HIS A ND1  1 
ATOM   2375 C  CD2  . HIS A 1 308 ? -20.919 -14.438 29.654 1.00 40.93 ? 312 HIS A CD2  1 
ATOM   2376 C  CE1  . HIS A 1 308 ? -19.500 -13.127 30.683 1.00 41.50 ? 312 HIS A CE1  1 
ATOM   2377 N  NE2  . HIS A 1 308 ? -20.648 -13.765 30.816 1.00 43.14 ? 312 HIS A NE2  1 
ATOM   2378 N  N    . ASP A 1 309 ? -16.991 -16.042 28.951 1.00 42.25 ? 313 ASP A N    1 
ATOM   2379 C  CA   . ASP A 1 309 ? -16.716 -16.877 30.087 1.00 43.19 ? 313 ASP A CA   1 
ATOM   2380 C  C    . ASP A 1 309 ? -16.459 -15.980 31.318 1.00 43.62 ? 313 ASP A C    1 
ATOM   2381 O  O    . ASP A 1 309 ? -15.389 -15.386 31.446 1.00 43.74 ? 313 ASP A O    1 
ATOM   2382 C  CB   . ASP A 1 309 ? -15.540 -17.820 29.811 1.00 43.47 ? 313 ASP A CB   1 
ATOM   2383 C  CG   . ASP A 1 309 ? -15.091 -18.560 31.061 1.00 43.99 ? 313 ASP A CG   1 
ATOM   2384 O  OD1  . ASP A 1 309 ? -15.786 -18.435 32.082 1.00 44.35 ? 313 ASP A OD1  1 
ATOM   2385 O  OD2  . ASP A 1 309 ? -14.044 -19.232 31.045 1.00 44.53 ? 313 ASP A OD2  1 
ATOM   2386 N  N    . PRO A 1 310 ? -17.442 -15.899 32.243 1.00 44.41 ? 314 PRO A N    1 
ATOM   2387 C  CA   . PRO A 1 310 ? -17.401 -15.054 33.464 1.00 44.26 ? 314 PRO A CA   1 
ATOM   2388 C  C    . PRO A 1 310 ? -16.149 -15.233 34.304 1.00 44.45 ? 314 PRO A C    1 
ATOM   2389 O  O    . PRO A 1 310 ? -15.811 -14.353 35.118 1.00 44.94 ? 314 PRO A O    1 
ATOM   2390 C  CB   . PRO A 1 310 ? -18.605 -15.549 34.251 1.00 44.27 ? 314 PRO A CB   1 
ATOM   2391 C  CG   . PRO A 1 310 ? -19.557 -15.967 33.190 1.00 44.47 ? 314 PRO A CG   1 
ATOM   2392 C  CD   . PRO A 1 310 ? -18.703 -16.662 32.174 1.00 44.12 ? 314 PRO A CD   1 
ATOM   2393 N  N    . ASP A 1 311 ? -15.461 -16.357 34.099 1.00 44.29 ? 315 ASP A N    1 
ATOM   2394 C  CA   . ASP A 1 311 ? -14.279 -16.700 34.889 1.00 44.21 ? 315 ASP A CA   1 
ATOM   2395 C  C    . ASP A 1 311 ? -12.933 -16.498 34.162 1.00 42.87 ? 315 ASP A C    1 
ATOM   2396 O  O    . ASP A 1 311 ? -11.872 -16.826 34.692 1.00 42.58 ? 315 ASP A O    1 
ATOM   2397 C  CB   . ASP A 1 311 ? -14.440 -18.125 35.429 1.00 44.97 ? 315 ASP A CB   1 
ATOM   2398 C  CG   . ASP A 1 311 ? -15.367 -18.168 36.645 1.00 48.50 ? 315 ASP A CG   1 
ATOM   2399 O  OD1  . ASP A 1 311 ? -16.571 -18.498 36.481 1.00 49.12 ? 315 ASP A OD1  1 
ATOM   2400 O  OD2  . ASP A 1 311 ? -14.895 -17.813 37.761 1.00 50.90 ? 315 ASP A OD2  1 
ATOM   2401 N  N    . ASP A 1 312 ? -12.988 -15.967 32.948 1.00 41.51 ? 316 ASP A N    1 
ATOM   2402 C  CA   . ASP A 1 312 ? -11.789 -15.662 32.173 1.00 40.91 ? 316 ASP A CA   1 
ATOM   2403 C  C    . ASP A 1 312 ? -11.990 -14.272 31.544 1.00 39.86 ? 316 ASP A C    1 
ATOM   2404 O  O    . ASP A 1 312 ? -11.770 -14.048 30.350 1.00 39.67 ? 316 ASP A O    1 
ATOM   2405 C  CB   . ASP A 1 312 ? -11.575 -16.763 31.140 1.00 41.34 ? 316 ASP A CB   1 
ATOM   2406 C  CG   . ASP A 1 312 ? -10.196 -16.723 30.469 1.00 43.01 ? 316 ASP A CG   1 
ATOM   2407 O  OD1  . ASP A 1 312 ? -9.209  -16.273 31.077 1.00 41.13 ? 316 ASP A OD1  1 
ATOM   2408 O  OD2  . ASP A 1 312 ? -10.116 -17.169 29.296 1.00 46.29 ? 316 ASP A OD2  1 
ATOM   2409 N  N    . GLU A 1 313 ? -12.475 -13.361 32.376 1.00 38.63 ? 317 GLU A N    1 
ATOM   2410 C  CA   . GLU A 1 313 ? -12.623 -11.938 32.041 1.00 38.03 ? 317 GLU A CA   1 
ATOM   2411 C  C    . GLU A 1 313 ? -12.039 -11.122 33.226 1.00 37.88 ? 317 GLU A C    1 
ATOM   2412 O  O    . GLU A 1 313 ? -12.773 -10.450 33.985 1.00 38.03 ? 317 GLU A O    1 
ATOM   2413 C  CB   . GLU A 1 313 ? -14.083 -11.606 31.665 1.00 37.60 ? 317 GLU A CB   1 
ATOM   2414 C  CG   . GLU A 1 313 ? -14.564 -12.531 30.557 1.00 36.25 ? 317 GLU A CG   1 
ATOM   2415 C  CD   . GLU A 1 313 ? -16.008 -12.400 30.186 1.00 35.07 ? 317 GLU A CD   1 
ATOM   2416 O  OE1  . GLU A 1 313 ? -16.368 -12.816 29.049 1.00 32.94 ? 317 GLU A OE1  1 
ATOM   2417 O  OE2  . GLU A 1 313 ? -16.778 -11.872 30.996 1.00 33.87 ? 317 GLU A OE2  1 
ATOM   2418 N  N    . PRO A 1 314 ? -10.700 -11.205 33.390 1.00 37.08 ? 318 PRO A N    1 
ATOM   2419 C  CA   . PRO A 1 314 ? -10.018 -10.645 34.576 1.00 37.69 ? 318 PRO A CA   1 
ATOM   2420 C  C    . PRO A 1 314 ? -10.008 -9.113  34.671 1.00 37.89 ? 318 PRO A C    1 
ATOM   2421 O  O    . PRO A 1 314 ? -10.178 -8.395  33.651 1.00 37.56 ? 318 PRO A O    1 
ATOM   2422 C  CB   . PRO A 1 314 ? -8.597  -11.223 34.482 1.00 37.33 ? 318 PRO A CB   1 
ATOM   2423 C  CG   . PRO A 1 314 ? -8.417  -11.592 33.018 1.00 36.63 ? 318 PRO A CG   1 
ATOM   2424 C  CD   . PRO A 1 314 ? -9.764  -11.861 32.454 1.00 36.45 ? 318 PRO A CD   1 
ATOM   2425 N  N    . VAL A 1 315 ? -9.888  -8.639  35.914 1.00 38.18 ? 319 VAL A N    1 
ATOM   2426 C  CA   . VAL A 1 315 ? -9.744  -7.223  36.233 1.00 38.28 ? 319 VAL A CA   1 
ATOM   2427 C  C    . VAL A 1 315 ? -8.277  -6.904  36.613 1.00 38.17 ? 319 VAL A C    1 
ATOM   2428 O  O    . VAL A 1 315 ? -7.458  -7.812  36.891 1.00 38.14 ? 319 VAL A O    1 
ATOM   2429 C  CB   . VAL A 1 315 ? -10.730 -6.721  37.356 1.00 39.08 ? 319 VAL A CB   1 
ATOM   2430 C  CG1  . VAL A 1 315 ? -12.196 -6.850  36.934 1.00 39.70 ? 319 VAL A CG1  1 
ATOM   2431 C  CG2  . VAL A 1 315 ? -10.475 -7.397  38.696 1.00 38.90 ? 319 VAL A CG2  1 
ATOM   2432 N  N    . ALA A 1 316 ? -7.954  -5.611  36.611 1.00 37.45 ? 320 ALA A N    1 
ATOM   2433 C  CA   . ALA A 1 316 ? -6.613  -5.159  36.864 1.00 37.02 ? 320 ALA A CA   1 
ATOM   2434 C  C    . ALA A 1 316 ? -6.315  -4.998  38.349 1.00 37.13 ? 320 ALA A C    1 
ATOM   2435 O  O    . ALA A 1 316 ? -7.194  -4.648  39.136 1.00 35.74 ? 320 ALA A O    1 
ATOM   2436 C  CB   . ALA A 1 316 ? -6.373  -3.834  36.140 1.00 37.00 ? 320 ALA A CB   1 
ATOM   2437 N  N    . ASP A 1 317 ? -5.052  -5.234  38.696 1.00 37.16 ? 321 ASP A N    1 
ATOM   2438 C  CA   . ASP A 1 317 ? -4.504  -4.788  39.963 1.00 38.29 ? 321 ASP A CA   1 
ATOM   2439 C  C    . ASP A 1 317 ? -4.770  -3.306  40.161 1.00 37.86 ? 321 ASP A C    1 
ATOM   2440 O  O    . ASP A 1 317 ? -4.878  -2.577  39.178 1.00 37.35 ? 321 ASP A O    1 
ATOM   2441 C  CB   . ASP A 1 317 ? -2.994  -5.051  39.995 1.00 39.28 ? 321 ASP A CB   1 
ATOM   2442 C  CG   . ASP A 1 317 ? -2.673  -6.509  40.175 1.00 40.46 ? 321 ASP A CG   1 
ATOM   2443 O  OD1  . ASP A 1 317 ? -3.571  -7.256  40.601 1.00 41.89 ? 321 ASP A OD1  1 
ATOM   2444 O  OD2  . ASP A 1 317 ? -1.523  -6.905  39.906 1.00 42.93 ? 321 ASP A OD2  1 
ATOM   2445 N  N    . PRO A 1 318 ? -4.875  -2.851  41.438 1.00 38.34 ? 322 PRO A N    1 
ATOM   2446 C  CA   . PRO A 1 318 ? -5.055  -1.412  41.738 1.00 38.16 ? 322 PRO A CA   1 
ATOM   2447 C  C    . PRO A 1 318 ? -4.012  -0.537  41.045 1.00 37.16 ? 322 PRO A C    1 
ATOM   2448 O  O    . PRO A 1 318 ? -2.848  -0.925  40.954 1.00 37.12 ? 322 PRO A O    1 
ATOM   2449 C  CB   . PRO A 1 318 ? -4.842  -1.338  43.266 1.00 38.23 ? 322 PRO A CB   1 
ATOM   2450 C  CG   . PRO A 1 318 ? -4.163  -2.640  43.631 1.00 39.46 ? 322 PRO A CG   1 
ATOM   2451 C  CD   . PRO A 1 318 ? -4.801  -3.634  42.689 1.00 37.55 ? 322 PRO A CD   1 
ATOM   2452 N  N    . TYR A 1 319 ? -4.415  0.629   40.560 1.00 36.60 ? 323 TYR A N    1 
ATOM   2453 C  CA   . TYR A 1 319 ? -3.467  1.430   39.771 1.00 35.88 ? 323 TYR A CA   1 
ATOM   2454 C  C    . TYR A 1 319 ? -3.334  2.841   40.296 1.00 35.58 ? 323 TYR A C    1 
ATOM   2455 O  O    . TYR A 1 319 ? -4.289  3.584   40.335 1.00 36.15 ? 323 TYR A O    1 
ATOM   2456 C  CB   . TYR A 1 319 ? -3.847  1.418   38.279 1.00 35.50 ? 323 TYR A CB   1 
ATOM   2457 C  CG   . TYR A 1 319 ? -2.964  2.289   37.421 1.00 34.58 ? 323 TYR A CG   1 
ATOM   2458 C  CD1  . TYR A 1 319 ? -1.581  2.122   37.416 1.00 32.74 ? 323 TYR A CD1  1 
ATOM   2459 C  CD2  . TYR A 1 319 ? -3.514  3.278   36.628 1.00 34.06 ? 323 TYR A CD2  1 
ATOM   2460 C  CE1  . TYR A 1 319 ? -0.785  2.909   36.656 1.00 32.67 ? 323 TYR A CE1  1 
ATOM   2461 C  CE2  . TYR A 1 319 ? -2.723  4.072   35.853 1.00 34.34 ? 323 TYR A CE2  1 
ATOM   2462 C  CZ   . TYR A 1 319 ? -1.360  3.882   35.880 1.00 32.92 ? 323 TYR A CZ   1 
ATOM   2463 O  OH   . TYR A 1 319 ? -0.586  4.679   35.128 1.00 34.51 ? 323 TYR A OH   1 
ATOM   2464 N  N    . ASP A 1 320 ? -2.140  3.203   40.703 1.00 35.60 ? 324 ASP A N    1 
ATOM   2465 C  CA   . ASP A 1 320 ? -1.929  4.493   41.367 1.00 35.88 ? 324 ASP A CA   1 
ATOM   2466 C  C    . ASP A 1 320 ? -1.743  5.602   40.331 1.00 35.79 ? 324 ASP A C    1 
ATOM   2467 O  O    . ASP A 1 320 ? -0.723  5.676   39.676 1.00 35.25 ? 324 ASP A O    1 
ATOM   2468 C  CB   . ASP A 1 320 ? -0.693  4.382   42.290 1.00 35.88 ? 324 ASP A CB   1 
ATOM   2469 C  CG   . ASP A 1 320 ? -0.381  5.671   43.044 1.00 35.81 ? 324 ASP A CG   1 
ATOM   2470 O  OD1  . ASP A 1 320 ? 0.781   5.836   43.448 1.00 37.60 ? 324 ASP A OD1  1 
ATOM   2471 O  OD2  . ASP A 1 320 ? -1.273  6.499   43.251 1.00 36.00 ? 324 ASP A OD2  1 
ATOM   2472 N  N    . GLN A 1 321 ? -2.743  6.444   40.145 1.00 36.49 ? 325 GLN A N    1 
ATOM   2473 C  CA   . GLN A 1 321 ? -2.507  7.591   39.294 1.00 37.39 ? 325 GLN A CA   1 
ATOM   2474 C  C    . GLN A 1 321 ? -2.654  8.950   40.032 1.00 36.90 ? 325 GLN A C    1 
ATOM   2475 O  O    . GLN A 1 321 ? -3.113  9.953   39.479 1.00 36.46 ? 325 GLN A O    1 
ATOM   2476 C  CB   . GLN A 1 321 ? -3.306  7.473   37.989 1.00 38.22 ? 325 GLN A CB   1 
ATOM   2477 C  CG   . GLN A 1 321 ? -4.742  7.090   38.124 1.00 41.30 ? 325 GLN A CG   1 
ATOM   2478 C  CD   . GLN A 1 321 ? -5.311  6.550   36.810 1.00 42.92 ? 325 GLN A CD   1 
ATOM   2479 O  OE1  . GLN A 1 321 ? -5.072  7.112   35.723 1.00 43.00 ? 325 GLN A OE1  1 
ATOM   2480 N  NE2  . GLN A 1 321 ? -6.073  5.464   36.906 1.00 41.00 ? 325 GLN A NE2  1 
ATOM   2481 N  N    . SER A 1 322 ? -2.243  8.958   41.299 1.00 36.25 ? 326 SER A N    1 
ATOM   2482 C  CA   . SER A 1 322 ? -2.230  10.199  42.092 1.00 35.63 ? 326 SER A CA   1 
ATOM   2483 C  C    . SER A 1 322 ? -1.221  11.190  41.490 1.00 34.73 ? 326 SER A C    1 
ATOM   2484 O  O    . SER A 1 322 ? -1.427  12.401  41.580 1.00 34.94 ? 326 SER A O    1 
ATOM   2485 C  CB   . SER A 1 322 ? -1.975  9.911   43.585 1.00 35.62 ? 326 SER A CB   1 
ATOM   2486 O  OG   . SER A 1 322 ? -0.803  9.124   43.781 1.00 35.65 ? 326 SER A OG   1 
ATOM   2487 N  N    . PHE A 1 323 ? -0.214  10.674  40.774 1.00 33.58 ? 327 PHE A N    1 
ATOM   2488 C  CA   . PHE A 1 323 ? 0.793   11.526  40.115 1.00 31.91 ? 327 PHE A CA   1 
ATOM   2489 C  C    . PHE A 1 323 ? 0.118   12.537  39.218 1.00 32.07 ? 327 PHE A C    1 
ATOM   2490 O  O    . PHE A 1 323 ? 0.616   13.659  39.005 1.00 31.76 ? 327 PHE A O    1 
ATOM   2491 C  CB   . PHE A 1 323 ? 1.851   10.710  39.370 1.00 30.44 ? 327 PHE A CB   1 
ATOM   2492 C  CG   . PHE A 1 323 ? 1.376   10.131  38.014 1.00 31.79 ? 327 PHE A CG   1 
ATOM   2493 C  CD1  . PHE A 1 323 ? 1.392   10.903  36.861 1.00 29.11 ? 327 PHE A CD1  1 
ATOM   2494 C  CD2  . PHE A 1 323 ? 0.972   8.788   37.906 1.00 31.81 ? 327 PHE A CD2  1 
ATOM   2495 C  CE1  . PHE A 1 323 ? 0.986   10.345  35.622 1.00 32.45 ? 327 PHE A CE1  1 
ATOM   2496 C  CE2  . PHE A 1 323 ? 0.577   8.234   36.661 1.00 32.91 ? 327 PHE A CE2  1 
ATOM   2497 C  CZ   . PHE A 1 323 ? 0.566   9.025   35.539 1.00 27.92 ? 327 PHE A CZ   1 
ATOM   2498 N  N    . GLU A 1 324 ? -1.060  12.170  38.726 1.00 32.00 ? 328 GLU A N    1 
ATOM   2499 C  CA   . GLU A 1 324 ? -1.754  13.031  37.797 1.00 31.82 ? 328 GLU A CA   1 
ATOM   2500 C  C    . GLU A 1 324 ? -2.069  14.393  38.399 1.00 31.71 ? 328 GLU A C    1 
ATOM   2501 O  O    . GLU A 1 324 ? -2.182  15.374  37.683 1.00 31.75 ? 328 GLU A O    1 
ATOM   2502 C  CB   . GLU A 1 324 ? -3.035  12.361  37.295 1.00 32.18 ? 328 GLU A CB   1 
ATOM   2503 C  CG   . GLU A 1 324 ? -2.784  11.130  36.409 1.00 32.04 ? 328 GLU A CG   1 
ATOM   2504 C  CD   . GLU A 1 324 ? -2.285  11.472  35.005 1.00 30.42 ? 328 GLU A CD   1 
ATOM   2505 O  OE1  . GLU A 1 324 ? -1.957  12.646  34.704 1.00 33.32 ? 328 GLU A OE1  1 
ATOM   2506 O  OE2  . GLU A 1 324 ? -2.193  10.541  34.194 1.00 28.93 ? 328 GLU A OE2  1 
ATOM   2507 N  N    . SER A 1 325 ? -2.210  14.460  39.713 1.00 33.40 ? 329 SER A N    1 
ATOM   2508 C  CA   . SER A 1 325 ? -2.579  15.736  40.375 1.00 35.49 ? 329 SER A CA   1 
ATOM   2509 C  C    . SER A 1 325 ? -1.365  16.586  40.772 1.00 35.79 ? 329 SER A C    1 
ATOM   2510 O  O    . SER A 1 325 ? -1.508  17.709  41.285 1.00 37.01 ? 329 SER A O    1 
ATOM   2511 C  CB   . SER A 1 325 ? -3.431  15.463  41.618 1.00 36.17 ? 329 SER A CB   1 
ATOM   2512 O  OG   . SER A 1 325 ? -2.736  14.539  42.467 1.00 39.36 ? 329 SER A OG   1 
ATOM   2513 N  N    . ARG A 1 326 ? -0.182  16.030  40.538 1.00 35.62 ? 330 ARG A N    1 
ATOM   2514 C  CA   . ARG A 1 326 ? 1.082   16.624  40.900 1.00 34.90 ? 330 ARG A CA   1 
ATOM   2515 C  C    . ARG A 1 326 ? 1.609   17.501  39.794 1.00 34.79 ? 330 ARG A C    1 
ATOM   2516 O  O    . ARG A 1 326 ? 1.643   17.107  38.629 1.00 35.15 ? 330 ARG A O    1 
ATOM   2517 C  CB   . ARG A 1 326 ? 2.087   15.519  41.179 1.00 34.43 ? 330 ARG A CB   1 
ATOM   2518 C  CG   . ARG A 1 326 ? 2.457   15.373  42.611 1.00 36.84 ? 330 ARG A CG   1 
ATOM   2519 C  CD   . ARG A 1 326 ? 1.431   14.636  43.422 1.00 38.13 ? 330 ARG A CD   1 
ATOM   2520 N  NE   . ARG A 1 326 ? 1.783   13.230  43.454 1.00 41.26 ? 330 ARG A NE   1 
ATOM   2521 C  CZ   . ARG A 1 326 ? 1.226   12.328  44.248 1.00 42.35 ? 330 ARG A CZ   1 
ATOM   2522 N  NH1  . ARG A 1 326 ? 0.293   12.671  45.128 1.00 42.54 ? 330 ARG A NH1  1 
ATOM   2523 N  NH2  . ARG A 1 326 ? 1.616   11.072  44.163 1.00 40.54 ? 330 ARG A NH2  1 
ATOM   2524 N  N    . ASP A 1 327 ? 2.017   18.704  40.167 1.00 34.77 ? 331 ASP A N    1 
ATOM   2525 C  CA   . ASP A 1 327 ? 2.809   19.565  39.302 1.00 34.97 ? 331 ASP A CA   1 
ATOM   2526 C  C    . ASP A 1 327 ? 4.238   19.538  39.798 1.00 34.40 ? 331 ASP A C    1 
ATOM   2527 O  O    . ASP A 1 327 ? 4.522   19.923  40.936 1.00 35.35 ? 331 ASP A O    1 
ATOM   2528 C  CB   . ASP A 1 327 ? 2.264   20.984  39.321 1.00 34.91 ? 331 ASP A CB   1 
ATOM   2529 C  CG   . ASP A 1 327 ? 0.763   21.030  39.108 1.00 35.70 ? 331 ASP A CG   1 
ATOM   2530 O  OD1  . ASP A 1 327 ? 0.238   20.351  38.195 1.00 35.35 ? 331 ASP A OD1  1 
ATOM   2531 O  OD2  . ASP A 1 327 ? 0.102   21.744  39.875 1.00 38.87 ? 331 ASP A OD2  1 
ATOM   2532 N  N    . LEU A 1 328 ? 5.137   19.060  38.953 1.00 33.43 ? 332 LEU A N    1 
ATOM   2533 C  CA   . LEU A 1 328 ? 6.493   18.766  39.372 1.00 31.98 ? 332 LEU A CA   1 
ATOM   2534 C  C    . LEU A 1 328 ? 7.472   19.392  38.392 1.00 31.50 ? 332 LEU A C    1 
ATOM   2535 O  O    . LEU A 1 328 ? 7.044   19.946  37.389 1.00 31.83 ? 332 LEU A O    1 
ATOM   2536 C  CB   . LEU A 1 328 ? 6.695   17.260  39.494 1.00 32.17 ? 332 LEU A CB   1 
ATOM   2537 C  CG   . LEU A 1 328 ? 5.912   16.413  40.493 1.00 31.17 ? 332 LEU A CG   1 
ATOM   2538 C  CD1  . LEU A 1 328 ? 6.423   14.990  40.453 1.00 28.69 ? 332 LEU A CD1  1 
ATOM   2539 C  CD2  . LEU A 1 328 ? 6.002   16.988  41.903 1.00 32.74 ? 332 LEU A CD2  1 
ATOM   2540 N  N    . LEU A 1 329 ? 8.765   19.357  38.706 1.00 31.37 ? 333 LEU A N    1 
ATOM   2541 C  CA   . LEU A 1 329 ? 9.812   19.853  37.804 1.00 32.46 ? 333 LEU A CA   1 
ATOM   2542 C  C    . LEU A 1 329 ? 10.240  18.770  36.797 1.00 31.76 ? 333 LEU A C    1 
ATOM   2543 O  O    . LEU A 1 329 ? 10.003  17.590  37.022 1.00 31.29 ? 333 LEU A O    1 
ATOM   2544 C  CB   . LEU A 1 329 ? 11.047  20.292  38.611 1.00 32.51 ? 333 LEU A CB   1 
ATOM   2545 C  CG   . LEU A 1 329 ? 11.265  21.634  39.358 1.00 35.67 ? 333 LEU A CG   1 
ATOM   2546 C  CD1  . LEU A 1 329 ? 9.998   22.270  39.861 1.00 35.78 ? 333 LEU A CD1  1 
ATOM   2547 C  CD2  . LEU A 1 329 ? 12.232  21.370  40.556 1.00 34.26 ? 333 LEU A CD2  1 
ATOM   2548 N  N    . ILE A 1 330 ? 10.881  19.182  35.704 1.00 30.96 ? 334 ILE A N    1 
ATOM   2549 C  CA   . ILE A 1 330 ? 11.402  18.263  34.706 1.00 31.33 ? 334 ILE A CA   1 
ATOM   2550 C  C    . ILE A 1 330 ? 12.312  17.177  35.310 1.00 31.65 ? 334 ILE A C    1 
ATOM   2551 O  O    . ILE A 1 330 ? 12.184  15.990  34.976 1.00 29.48 ? 334 ILE A O    1 
ATOM   2552 C  CB   . ILE A 1 330 ? 12.192  19.025  33.612 1.00 31.68 ? 334 ILE A CB   1 
ATOM   2553 C  CG1  . ILE A 1 330 ? 11.231  19.884  32.805 1.00 31.09 ? 334 ILE A CG1  1 
ATOM   2554 C  CG2  . ILE A 1 330 ? 12.995  18.055  32.704 1.00 31.75 ? 334 ILE A CG2  1 
ATOM   2555 C  CD1  . ILE A 1 330 ? 11.900  20.833  31.860 1.00 32.20 ? 334 ILE A CD1  1 
ATOM   2556 N  N    . ASP A 1 331 ? 13.237  17.599  36.181 1.00 31.63 ? 335 ASP A N    1 
ATOM   2557 C  CA   . ASP A 1 331 ? 14.190  16.690  36.816 1.00 31.36 ? 335 ASP A CA   1 
ATOM   2558 C  C    . ASP A 1 331 ? 13.486  15.693  37.737 1.00 29.94 ? 335 ASP A C    1 
ATOM   2559 O  O    . ASP A 1 331 ? 13.946  14.576  37.906 1.00 29.89 ? 335 ASP A O    1 
ATOM   2560 C  CB   . ASP A 1 331 ? 15.263  17.457  37.611 1.00 32.05 ? 335 ASP A CB   1 
ATOM   2561 C  CG   . ASP A 1 331 ? 16.298  18.162  36.717 1.00 37.30 ? 335 ASP A CG   1 
ATOM   2562 O  OD1  . ASP A 1 331 ? 16.576  17.728  35.565 1.00 39.48 ? 335 ASP A OD1  1 
ATOM   2563 O  OD2  . ASP A 1 331 ? 16.855  19.184  37.193 1.00 45.00 ? 335 ASP A OD2  1 
ATOM   2564 N  N    . GLU A 1 332 ? 12.382  16.098  38.343 1.00 28.90 ? 336 GLU A N    1 
ATOM   2565 C  CA   . GLU A 1 332 ? 11.623  15.194  39.212 1.00 28.53 ? 336 GLU A CA   1 
ATOM   2566 C  C    . GLU A 1 332 ? 10.855  14.125  38.420 1.00 28.62 ? 336 GLU A C    1 
ATOM   2567 O  O    . GLU A 1 332 ? 10.967  12.934  38.730 1.00 29.08 ? 336 GLU A O    1 
ATOM   2568 C  CB   . GLU A 1 332 ? 10.676  15.975  40.109 1.00 27.52 ? 336 GLU A CB   1 
ATOM   2569 C  CG   . GLU A 1 332 ? 11.376  17.056  40.861 1.00 28.99 ? 336 GLU A CG   1 
ATOM   2570 C  CD   . GLU A 1 332 ? 10.500  17.781  41.835 1.00 30.88 ? 336 GLU A CD   1 
ATOM   2571 O  OE1  . GLU A 1 332 ? 9.524   18.426  41.436 1.00 31.74 ? 336 GLU A OE1  1 
ATOM   2572 O  OE2  . GLU A 1 332 ? 10.800  17.730  43.038 1.00 37.41 ? 336 GLU A OE2  1 
ATOM   2573 N  N    . TRP A 1 333 ? 10.077  14.558  37.421 1.00 27.64 ? 337 TRP A N    1 
ATOM   2574 C  CA   . TRP A 1 333 ? 9.446   13.667  36.455 1.00 27.45 ? 337 TRP A CA   1 
ATOM   2575 C  C    . TRP A 1 333 ? 10.464  12.735  35.847 1.00 28.20 ? 337 TRP A C    1 
ATOM   2576 O  O    . TRP A 1 333 ? 10.206  11.540  35.687 1.00 29.47 ? 337 TRP A O    1 
ATOM   2577 C  CB   . TRP A 1 333 ? 8.757   14.463  35.352 1.00 26.13 ? 337 TRP A CB   1 
ATOM   2578 C  CG   . TRP A 1 333 ? 7.490   15.137  35.810 1.00 25.39 ? 337 TRP A CG   1 
ATOM   2579 C  CD1  . TRP A 1 333 ? 7.161   16.449  35.666 1.00 24.76 ? 337 TRP A CD1  1 
ATOM   2580 C  CD2  . TRP A 1 333 ? 6.381   14.516  36.485 1.00 25.73 ? 337 TRP A CD2  1 
ATOM   2581 N  NE1  . TRP A 1 333 ? 5.919   16.692  36.219 1.00 24.24 ? 337 TRP A NE1  1 
ATOM   2582 C  CE2  . TRP A 1 333 ? 5.423   15.521  36.728 1.00 25.45 ? 337 TRP A CE2  1 
ATOM   2583 C  CE3  . TRP A 1 333 ? 6.106   13.196  36.908 1.00 27.13 ? 337 TRP A CE3  1 
ATOM   2584 C  CZ2  . TRP A 1 333 ? 4.198   15.255  37.355 1.00 25.01 ? 337 TRP A CZ2  1 
ATOM   2585 C  CZ3  . TRP A 1 333 ? 4.912   12.946  37.559 1.00 25.10 ? 337 TRP A CZ3  1 
ATOM   2586 C  CH2  . TRP A 1 333 ? 3.968   13.973  37.767 1.00 23.56 ? 337 TRP A CH2  1 
ATOM   2587 N  N    . LYS A 1 334 ? 11.629  13.271  35.523 1.00 28.97 ? 338 LYS A N    1 
ATOM   2588 C  CA   . LYS A 1 334 ? 12.685  12.487  34.904 1.00 29.96 ? 338 LYS A CA   1 
ATOM   2589 C  C    . LYS A 1 334 ? 13.301  11.445  35.866 1.00 30.29 ? 338 LYS A C    1 
ATOM   2590 O  O    . LYS A 1 334 ? 13.566  10.323  35.437 1.00 31.18 ? 338 LYS A O    1 
ATOM   2591 C  CB   . LYS A 1 334 ? 13.762  13.380  34.304 1.00 29.03 ? 338 LYS A CB   1 
ATOM   2592 C  CG   . LYS A 1 334 ? 14.889  12.611  33.642 1.00 31.14 ? 338 LYS A CG   1 
ATOM   2593 C  CD   . LYS A 1 334 ? 16.223  13.370  33.666 1.00 37.81 ? 338 LYS A CD   1 
ATOM   2594 C  CE   . LYS A 1 334 ? 16.521  13.999  32.320 1.00 39.10 ? 338 LYS A CE   1 
ATOM   2595 N  NZ   . LYS A 1 334 ? 17.999  14.105  32.112 1.00 38.58 ? 338 LYS A NZ   1 
ATOM   2596 N  N    . SER A 1 335 ? 13.522  11.817  37.131 1.00 30.80 ? 339 SER A N    1 
ATOM   2597 C  CA   . SER A 1 335 ? 14.058  10.899  38.167 1.00 31.15 ? 339 SER A CA   1 
ATOM   2598 C  C    . SER A 1 335 ? 13.096  9.741   38.418 1.00 31.03 ? 339 SER A C    1 
ATOM   2599 O  O    . SER A 1 335 ? 13.515  8.591   38.525 1.00 32.13 ? 339 SER A O    1 
ATOM   2600 C  CB   . SER A 1 335 ? 14.335  11.645  39.487 1.00 31.73 ? 339 SER A CB   1 
ATOM   2601 O  OG   . SER A 1 335 ? 14.660  10.765  40.584 1.00 32.68 ? 339 SER A OG   1 
ATOM   2602 N  N    . LEU A 1 336 ? 11.814  10.073  38.518 1.00 30.40 ? 340 LEU A N    1 
ATOM   2603 C  CA   . LEU A 1 336 ? 10.725  9.132   38.690 1.00 30.79 ? 340 LEU A CA   1 
ATOM   2604 C  C    . LEU A 1 336 ? 10.583  8.167   37.520 1.00 30.62 ? 340 LEU A C    1 
ATOM   2605 O  O    . LEU A 1 336 ? 10.274  6.992   37.721 1.00 32.64 ? 340 LEU A O    1 
ATOM   2606 C  CB   . LEU A 1 336 ? 9.435   9.910   38.866 1.00 30.61 ? 340 LEU A CB   1 
ATOM   2607 C  CG   . LEU A 1 336 ? 8.637   10.105  40.169 1.00 33.91 ? 340 LEU A CG   1 
ATOM   2608 C  CD1  . LEU A 1 336 ? 9.363   9.912   41.543 1.00 33.34 ? 340 LEU A CD1  1 
ATOM   2609 C  CD2  . LEU A 1 336 ? 7.854   11.454  40.103 1.00 30.62 ? 340 LEU A CD2  1 
ATOM   2610 N  N    . THR A 1 337 ? 10.795  8.648   36.299 1.00 30.96 ? 341 THR A N    1 
ATOM   2611 C  CA   . THR A 1 337 ? 10.853  7.768   35.112 1.00 29.85 ? 341 THR A CA   1 
ATOM   2612 C  C    . THR A 1 337 ? 12.081  6.831   35.213 1.00 31.19 ? 341 THR A C    1 
ATOM   2613 O  O    . THR A 1 337 ? 11.986  5.608   34.919 1.00 30.11 ? 341 THR A O    1 
ATOM   2614 C  CB   . THR A 1 337 ? 10.833  8.581   33.788 1.00 29.22 ? 341 THR A CB   1 
ATOM   2615 O  OG1  . THR A 1 337 ? 9.600   9.344   33.701 1.00 24.89 ? 341 THR A OG1  1 
ATOM   2616 C  CG2  . THR A 1 337 ? 10.955  7.665   32.565 1.00 27.62 ? 341 THR A CG2  1 
ATOM   2617 N  N    . TYR A 1 338 ? 13.219  7.394   35.647 1.00 31.47 ? 342 TYR A N    1 
ATOM   2618 C  CA   . TYR A 1 338 ? 14.437  6.598   35.818 1.00 32.48 ? 342 TYR A CA   1 
ATOM   2619 C  C    . TYR A 1 338 ? 14.208  5.461   36.833 1.00 32.19 ? 342 TYR A C    1 
ATOM   2620 O  O    . TYR A 1 338 ? 14.512  4.320   36.556 1.00 31.40 ? 342 TYR A O    1 
ATOM   2621 C  CB   . TYR A 1 338 ? 15.652  7.478   36.194 1.00 33.60 ? 342 TYR A CB   1 
ATOM   2622 C  CG   . TYR A 1 338 ? 16.998  6.752   36.158 1.00 33.51 ? 342 TYR A CG   1 
ATOM   2623 C  CD1  . TYR A 1 338 ? 17.526  6.297   34.968 1.00 33.69 ? 342 TYR A CD1  1 
ATOM   2624 C  CD2  . TYR A 1 338 ? 17.720  6.504   37.348 1.00 36.94 ? 342 TYR A CD2  1 
ATOM   2625 C  CE1  . TYR A 1 338 ? 18.742  5.627   34.942 1.00 35.48 ? 342 TYR A CE1  1 
ATOM   2626 C  CE2  . TYR A 1 338 ? 18.948  5.845   37.336 1.00 34.55 ? 342 TYR A CE2  1 
ATOM   2627 C  CZ   . TYR A 1 338 ? 19.447  5.401   36.133 1.00 34.81 ? 342 TYR A CZ   1 
ATOM   2628 O  OH   . TYR A 1 338 ? 20.663  4.733   36.097 1.00 35.26 ? 342 TYR A OH   1 
ATOM   2629 N  N    . ASP A 1 339 ? 13.634  5.771   37.980 1.00 32.80 ? 343 ASP A N    1 
ATOM   2630 C  CA   . ASP A 1 339 ? 13.219  4.716   38.898 1.00 34.48 ? 343 ASP A CA   1 
ATOM   2631 C  C    . ASP A 1 339 ? 12.388  3.625   38.203 1.00 34.84 ? 343 ASP A C    1 
ATOM   2632 O  O    . ASP A 1 339 ? 12.693  2.426   38.327 1.00 36.08 ? 343 ASP A O    1 
ATOM   2633 C  CB   . ASP A 1 339 ? 12.395  5.291   40.036 1.00 34.50 ? 343 ASP A CB   1 
ATOM   2634 C  CG   . ASP A 1 339 ? 13.158  6.301   40.844 1.00 37.06 ? 343 ASP A CG   1 
ATOM   2635 O  OD1  . ASP A 1 339 ? 12.493  7.082   41.578 1.00 40.45 ? 343 ASP A OD1  1 
ATOM   2636 O  OD2  . ASP A 1 339 ? 14.409  6.315   40.726 1.00 36.59 ? 343 ASP A OD2  1 
ATOM   2637 N  N    . GLU A 1 340 ? 11.332  4.036   37.511 1.00 33.61 ? 344 GLU A N    1 
ATOM   2638 C  CA   . GLU A 1 340 ? 10.446  3.091   36.858 1.00 34.11 ? 344 GLU A CA   1 
ATOM   2639 C  C    . GLU A 1 340 ? 11.193  2.204   35.849 1.00 34.20 ? 344 GLU A C    1 
ATOM   2640 O  O    . GLU A 1 340 ? 10.876  1.033   35.686 1.00 34.31 ? 344 GLU A O    1 
ATOM   2641 C  CB   . GLU A 1 340 ? 9.251   3.810   36.226 1.00 33.38 ? 344 GLU A CB   1 
ATOM   2642 C  CG   . GLU A 1 340 ? 8.284   4.395   37.233 1.00 34.10 ? 344 GLU A CG   1 
ATOM   2643 C  CD   . GLU A 1 340 ? 7.540   3.341   38.086 1.00 35.64 ? 344 GLU A CD   1 
ATOM   2644 O  OE1  . GLU A 1 340 ? 7.358   2.184   37.644 1.00 34.95 ? 344 GLU A OE1  1 
ATOM   2645 O  OE2  . GLU A 1 340 ? 7.078   3.704   39.188 1.00 35.93 ? 344 GLU A OE2  1 
ATOM   2646 N  N    . VAL A 1 341 ? 12.202  2.771   35.202 1.00 35.33 ? 345 VAL A N    1 
ATOM   2647 C  CA   . VAL A 1 341 ? 13.055  2.015   34.302 1.00 36.80 ? 345 VAL A CA   1 
ATOM   2648 C  C    . VAL A 1 341 ? 13.884  0.959   35.063 1.00 38.09 ? 345 VAL A C    1 
ATOM   2649 O  O    . VAL A 1 341 ? 14.041  -0.167  34.598 1.00 38.21 ? 345 VAL A O    1 
ATOM   2650 C  CB   . VAL A 1 341 ? 13.969  2.942   33.455 1.00 36.27 ? 345 VAL A CB   1 
ATOM   2651 C  CG1  . VAL A 1 341 ? 14.985  2.105   32.612 1.00 36.06 ? 345 VAL A CG1  1 
ATOM   2652 C  CG2  . VAL A 1 341 ? 13.146  3.775   32.552 1.00 35.47 ? 345 VAL A CG2  1 
ATOM   2653 N  N    . ILE A 1 342 ? 14.387  1.339   36.234 1.00 39.47 ? 346 ILE A N    1 
ATOM   2654 C  CA   . ILE A 1 342 ? 15.274  0.501   37.045 1.00 40.11 ? 346 ILE A CA   1 
ATOM   2655 C  C    . ILE A 1 342 ? 14.485  -0.631  37.720 1.00 40.36 ? 346 ILE A C    1 
ATOM   2656 O  O    . ILE A 1 342 ? 14.947  -1.772  37.758 1.00 39.90 ? 346 ILE A O    1 
ATOM   2657 C  CB   . ILE A 1 342 ? 16.118  1.379   38.045 1.00 40.58 ? 346 ILE A CB   1 
ATOM   2658 C  CG1  . ILE A 1 342 ? 17.424  1.872   37.408 1.00 41.02 ? 346 ILE A CG1  1 
ATOM   2659 C  CG2  . ILE A 1 342 ? 16.478  0.625   39.358 1.00 40.14 ? 346 ILE A CG2  1 
ATOM   2660 C  CD1  . ILE A 1 342 ? 17.601  1.631   35.886 1.00 43.16 ? 346 ILE A CD1  1 
ATOM   2661 N  N    . SER A 1 343 ? 13.282  -0.315  38.196 1.00 41.41 ? 347 SER A N    1 
ATOM   2662 C  CA   . SER A 1 343 ? 12.393  -1.290  38.846 1.00 41.94 ? 347 SER A CA   1 
ATOM   2663 C  C    . SER A 1 343 ? 11.587  -2.191  37.914 1.00 42.47 ? 347 SER A C    1 
ATOM   2664 O  O    . SER A 1 343 ? 10.670  -2.885  38.369 1.00 42.91 ? 347 SER A O    1 
ATOM   2665 C  CB   . SER A 1 343 ? 11.431  -0.576  39.783 1.00 42.38 ? 347 SER A CB   1 
ATOM   2666 O  OG   . SER A 1 343 ? 10.474  0.173   39.047 1.00 44.62 ? 347 SER A OG   1 
ATOM   2667 N  N    . PHE A 1 344 ? 11.898  -2.176  36.616 1.00 42.77 ? 348 PHE A N    1 
ATOM   2668 C  CA   . PHE A 1 344 ? 11.170  -3.005  35.654 1.00 43.16 ? 348 PHE A CA   1 
ATOM   2669 C  C    . PHE A 1 344 ? 11.523  -4.480  35.867 1.00 44.16 ? 348 PHE A C    1 
ATOM   2670 O  O    . PHE A 1 344 ? 12.692  -4.843  35.976 1.00 44.07 ? 348 PHE A O    1 
ATOM   2671 C  CB   . PHE A 1 344 ? 11.426  -2.573  34.196 1.00 41.65 ? 348 PHE A CB   1 
ATOM   2672 C  CG   . PHE A 1 344 ? 10.790  -3.486  33.162 1.00 41.53 ? 348 PHE A CG   1 
ATOM   2673 C  CD1  . PHE A 1 344 ? 9.414   -3.518  32.989 1.00 39.20 ? 348 PHE A CD1  1 
ATOM   2674 C  CD2  . PHE A 1 344 ? 11.578  -4.313  32.363 1.00 40.12 ? 348 PHE A CD2  1 
ATOM   2675 C  CE1  . PHE A 1 344 ? 8.838   -4.364  32.061 1.00 38.12 ? 348 PHE A CE1  1 
ATOM   2676 C  CE2  . PHE A 1 344 ? 11.006  -5.163  31.427 1.00 40.36 ? 348 PHE A CE2  1 
ATOM   2677 C  CZ   . PHE A 1 344 ? 9.635   -5.187  31.265 1.00 39.92 ? 348 PHE A CZ   1 
ATOM   2678 N  N    . VAL A 1 345 ? 10.497  -5.323  35.924 1.00 45.94 ? 349 VAL A N    1 
ATOM   2679 C  CA   . VAL A 1 345 ? 10.706  -6.766  36.053 1.00 47.37 ? 349 VAL A CA   1 
ATOM   2680 C  C    . VAL A 1 345 ? 10.258  -7.405  34.753 1.00 48.18 ? 349 VAL A C    1 
ATOM   2681 O  O    . VAL A 1 345 ? 9.082   -7.374  34.431 1.00 48.54 ? 349 VAL A O    1 
ATOM   2682 C  CB   . VAL A 1 345 ? 9.938   -7.334  37.266 1.00 47.21 ? 349 VAL A CB   1 
ATOM   2683 C  CG1  . VAL A 1 345 ? 10.044  -8.878  37.332 1.00 48.01 ? 349 VAL A CG1  1 
ATOM   2684 C  CG2  . VAL A 1 345 ? 10.450  -6.708  38.558 1.00 47.29 ? 349 VAL A CG2  1 
ATOM   2685 N  N    . PRO A 1 346 ? 11.193  -7.949  33.971 1.00 49.54 ? 350 PRO A N    1 
ATOM   2686 C  CA   . PRO A 1 346 ? 10.739  -8.526  32.712 1.00 51.25 ? 350 PRO A CA   1 
ATOM   2687 C  C    . PRO A 1 346 ? 9.722   -9.667  32.916 1.00 52.98 ? 350 PRO A C    1 
ATOM   2688 O  O    . PRO A 1 346 ? 9.852   -10.447 33.874 1.00 53.73 ? 350 PRO A O    1 
ATOM   2689 C  CB   . PRO A 1 346 ? 12.033  -9.019  32.054 1.00 51.30 ? 350 PRO A CB   1 
ATOM   2690 C  CG   . PRO A 1 346 ? 13.033  -9.059  33.127 1.00 50.72 ? 350 PRO A CG   1 
ATOM   2691 C  CD   . PRO A 1 346 ? 12.650  -8.035  34.132 1.00 49.87 ? 350 PRO A CD   1 
ATOM   2692 N  N    . PRO A 1 347 ? 8.691   -9.736  32.054 1.00 54.28 ? 351 PRO A N    1 
ATOM   2693 C  CA   . PRO A 1 347 ? 7.695   -10.810 32.164 1.00 55.40 ? 351 PRO A CA   1 
ATOM   2694 C  C    . PRO A 1 347 ? 8.256   -12.172 31.720 1.00 56.38 ? 351 PRO A C    1 
ATOM   2695 O  O    . PRO A 1 347 ? 9.265   -12.216 30.997 1.00 56.66 ? 351 PRO A O    1 
ATOM   2696 C  CB   . PRO A 1 347 ? 6.581   -10.359 31.217 1.00 55.19 ? 351 PRO A CB   1 
ATOM   2697 C  CG   . PRO A 1 347 ? 7.292   -9.516  30.195 1.00 55.29 ? 351 PRO A CG   1 
ATOM   2698 C  CD   . PRO A 1 347 ? 8.392   -8.815  30.940 1.00 54.62 ? 351 PRO A CD   1 
ATOM   2699 N  N    . PRO A 1 348 ? 7.636   -13.275 32.195 1.00 56.95 ? 352 PRO A N    1 
ATOM   2700 C  CA   . PRO A 1 348 ? 7.879   -14.625 31.681 1.00 56.96 ? 352 PRO A CA   1 
ATOM   2701 C  C    . PRO A 1 348 ? 7.686   -14.736 30.167 1.00 57.00 ? 352 PRO A C    1 
ATOM   2702 C  CB   . PRO A 1 348 ? 6.828   -15.453 32.412 1.00 57.07 ? 352 PRO A CB   1 
ATOM   2703 C  CG   . PRO A 1 348 ? 6.649   -14.735 33.716 1.00 57.45 ? 352 PRO A CG   1 
ATOM   2704 C  CD   . PRO A 1 348 ? 6.699   -13.289 33.339 1.00 56.99 ? 352 PRO A CD   1 
HETATM 2705 C  C1   . BAX B 2 .   ? -1.978  2.259   25.948 1.00 25.24 ? 1   BAX A C1   1 
HETATM 2706 C  C2   . BAX B 2 .   ? -1.228  3.428   25.857 1.00 22.79 ? 1   BAX A C2   1 
HETATM 2707 C  C3   . BAX B 2 .   ? -1.698  4.591   26.452 1.00 25.65 ? 1   BAX A C3   1 
HETATM 2708 C  C4   . BAX B 2 .   ? -2.920  4.660   27.100 1.00 23.52 ? 1   BAX A C4   1 
HETATM 2709 C  C13  . BAX B 2 .   ? 0.448   2.704   24.285 1.00 27.05 ? 1   BAX A C13  1 
HETATM 2710 C  C16  . BAX B 2 .   ? 2.338   2.378   22.900 1.00 30.36 ? 1   BAX A C16  1 
HETATM 2711 C  C17  . BAX B 2 .   ? 1.656   2.271   21.665 1.00 31.76 ? 1   BAX A C17  1 
HETATM 2712 C  C18  . BAX B 2 .   ? 2.333   1.822   20.527 1.00 33.19 ? 1   BAX A C18  1 
HETATM 2713 C  C19  . BAX B 2 .   ? 3.707   1.491   20.634 1.00 32.99 ? 1   BAX A C19  1 
HETATM 2714 C  C20  . BAX B 2 .   ? 4.382   1.594   21.851 1.00 29.05 ? 1   BAX A C20  1 
HETATM 2715 C  C21  . BAX B 2 .   ? 3.692   2.044   22.967 1.00 29.27 ? 1   BAX A C21  1 
HETATM 2716 O  O22  . BAX B 2 .   ? 4.464   1.088   19.562 1.00 36.29 ? 1   BAX A O22  1 
HETATM 2717 C  C24  . BAX B 2 .   ? 3.713   -1.029  18.888 1.00 38.31 ? 1   BAX A C24  1 
HETATM 2718 C  C25  . BAX B 2 .   ? 3.417   -1.928  17.863 1.00 41.85 ? 1   BAX A C25  1 
HETATM 2719 C  C27  . BAX B 2 .   ? 4.041   -0.309  16.236 1.00 38.70 ? 1   BAX A C27  1 
HETATM 2720 C  C28  . BAX B 2 .   ? 4.328   0.623   17.229 1.00 34.62 ? 1   BAX A C28  1 
HETATM 2721 N  N30  . BAX B 2 .   ? 4.101   -1.034  13.892 1.00 45.15 ? 1   BAX A N30  1 
HETATM 2722 C  C31  . BAX B 2 .   ? 3.253   -1.004  12.705 1.00 44.89 ? 1   BAX A C31  1 
HETATM 2723 C  C5   . BAX B 2 .   ? -3.710  3.535   27.168 1.00 23.46 ? 1   BAX A C5   1 
HETATM 2724 C  C6   . BAX B 2 .   ? -3.219  2.265   26.584 1.00 25.07 ? 1   BAX A C6   1 
HETATM 2725 C  C7   . BAX B 2 .   ? -4.050  0.997   26.698 1.00 22.96 ? 1   BAX A C7   1 
HETATM 2726 F  F8   . BAX B 2 .   ? -5.238  1.142   26.211 1.00 24.28 ? 1   BAX A F8   1 
HETATM 2727 F  F9   . BAX B 2 .   ? -3.480  0.001   26.122 1.00 18.78 ? 1   BAX A F9   1 
HETATM 2728 F  F10  . BAX B 2 .   ? -4.225  0.649   27.928 1.00 21.90 ? 1   BAX A F10  1 
HETATM 2729 CL CL11 . BAX B 2 .   ? -5.276  3.599   28.042 1.00 25.86 ? 1   BAX A CL11 1 
HETATM 2730 N  N12  . BAX B 2 .   ? -0.022  3.487   25.264 1.00 23.16 ? 1   BAX A N12  1 
HETATM 2731 N  N14  . BAX B 2 .   ? 1.748   2.809   24.051 1.00 27.95 ? 1   BAX A N14  1 
HETATM 2732 O  O15  . BAX B 2 .   ? -0.262  1.946   23.616 1.00 24.59 ? 1   BAX A O15  1 
HETATM 2733 C  C23  . BAX B 2 .   ? 4.155   0.236   18.558 1.00 35.36 ? 1   BAX A C23  1 
HETATM 2734 N  N26  . BAX B 2 .   ? 3.581   -1.537  16.578 1.00 42.06 ? 1   BAX A N26  1 
HETATM 2735 C  C29  . BAX B 2 .   ? 4.131   0.000   14.762 1.00 43.08 ? 1   BAX A C29  1 
HETATM 2736 O  O32  . BAX B 2 .   ? 4.155   1.173   14.391 1.00 42.53 ? 1   BAX A O32  1 
HETATM 2737 O  O    . HOH C 3 .   ? -17.724 3.681   12.972 1.00 29.62 ? 2   HOH A O    1 
HETATM 2738 O  O    . HOH C 3 .   ? -7.779  -13.253 22.502 1.00 41.12 ? 3   HOH A O    1 
HETATM 2739 O  O    . HOH C 3 .   ? -13.020 -13.116 35.922 1.00 40.54 ? 4   HOH A O    1 
HETATM 2740 O  O    . HOH C 3 .   ? -3.122  15.344  34.541 1.00 47.25 ? 353 HOH A O    1 
HETATM 2741 O  O    . HOH C 3 .   ? -0.809  -0.579  10.059 1.00 48.23 ? 354 HOH A O    1 
HETATM 2742 O  O    . HOH C 3 .   ? -14.450 -2.592  34.192 1.00 23.74 ? 355 HOH A O    1 
HETATM 2743 O  O    . HOH C 3 .   ? -2.294  18.926  37.940 1.00 46.24 ? 356 HOH A O    1 
HETATM 2744 O  O    . HOH C 3 .   ? -12.646 5.993   23.366 1.00 22.67 ? 357 HOH A O    1 
HETATM 2745 O  O    . HOH C 3 .   ? 6.832   8.619   12.613 1.00 55.90 ? 358 HOH A O    1 
HETATM 2746 O  O    . HOH C 3 .   ? 2.030   -7.742  24.369 1.00 53.46 ? 359 HOH A O    1 
HETATM 2747 O  O    . HOH C 3 .   ? 20.152  8.391   27.725 1.00 36.77 ? 360 HOH A O    1 
HETATM 2748 O  O    . HOH C 3 .   ? -0.349  12.015  27.731 1.00 41.35 ? 361 HOH A O    1 
HETATM 2749 O  O    . HOH C 3 .   ? -15.142 8.568   23.113 1.00 29.59 ? 362 HOH A O    1 
HETATM 2750 O  O    . HOH C 3 .   ? -30.822 -9.794  24.339 1.00 45.11 ? 363 HOH A O    1 
HETATM 2751 O  O    . HOH C 3 .   ? 2.933   -4.635  30.715 1.00 25.35 ? 364 HOH A O    1 
HETATM 2752 O  O    . HOH C 3 .   ? 12.973  9.538   42.103 1.00 32.79 ? 365 HOH A O    1 
HETATM 2753 O  O    . HOH C 3 .   ? 2.791   1.466   36.910 1.00 22.96 ? 366 HOH A O    1 
HETATM 2754 O  O    . HOH C 3 .   ? -31.866 21.186  13.302 1.00 59.68 ? 367 HOH A O    1 
HETATM 2755 O  O    . HOH C 3 .   ? -5.360  -9.973  33.039 1.00 25.18 ? 368 HOH A O    1 
HETATM 2756 O  O    . HOH C 3 .   ? 9.070   1.577   40.722 1.00 46.56 ? 369 HOH A O    1 
HETATM 2757 O  O    . HOH C 3 .   ? -12.473 -15.407 28.030 1.00 50.25 ? 370 HOH A O    1 
HETATM 2758 O  O    . HOH C 3 .   ? -27.701 0.050   28.374 1.00 35.46 ? 371 HOH A O    1 
HETATM 2759 O  O    . HOH C 3 .   ? -29.980 4.888   21.003 1.00 38.34 ? 372 HOH A O    1 
HETATM 2760 O  O    . HOH C 3 .   ? 20.735  14.897  30.969 1.00 61.61 ? 373 HOH A O    1 
HETATM 2761 O  O    . HOH C 3 .   ? -2.639  8.038   34.260 1.00 32.40 ? 374 HOH A O    1 
HETATM 2762 O  O    . HOH C 3 .   ? 20.011  6.513   22.725 1.00 24.25 ? 375 HOH A O    1 
HETATM 2763 O  O    . HOH C 3 .   ? 14.287  20.429  36.444 1.00 32.87 ? 376 HOH A O    1 
HETATM 2764 O  O    . HOH C 3 .   ? 16.569  13.860  37.220 1.00 45.23 ? 377 HOH A O    1 
HETATM 2765 O  O    . HOH C 3 .   ? -12.119 8.180   19.419 1.00 29.32 ? 378 HOH A O    1 
HETATM 2766 O  O    . HOH C 3 .   ? -17.508 -10.128 32.944 1.00 42.69 ? 379 HOH A O    1 
HETATM 2767 O  O    . HOH C 3 .   ? -0.541  -4.818  36.647 1.00 28.72 ? 380 HOH A O    1 
HETATM 2768 O  O    . HOH C 3 .   ? 1.361   8.038   41.079 1.00 36.92 ? 381 HOH A O    1 
HETATM 2769 O  O    . HOH C 3 .   ? -13.704 -0.897  9.200  1.00 47.28 ? 382 HOH A O    1 
HETATM 2770 O  O    . HOH C 3 .   ? -9.438  8.327   34.257 1.00 52.56 ? 383 HOH A O    1 
HETATM 2771 O  O    . HOH C 3 .   ? 2.028   0.820   39.565 1.00 54.79 ? 384 HOH A O    1 
HETATM 2772 O  O    . HOH C 3 .   ? 3.818   18.697  36.389 1.00 26.73 ? 385 HOH A O    1 
HETATM 2773 O  O    . HOH C 3 .   ? -4.827  7.334   42.175 1.00 65.63 ? 386 HOH A O    1 
HETATM 2774 O  O    . HOH C 3 .   ? -3.206  -6.258  36.379 1.00 34.60 ? 387 HOH A O    1 
HETATM 2775 O  O    . HOH C 3 .   ? -4.892  8.054   19.837 1.00 33.91 ? 388 HOH A O    1 
HETATM 2776 O  O    . HOH C 3 .   ? 2.619   3.388   42.774 1.00 53.81 ? 389 HOH A O    1 
HETATM 2777 O  O    . HOH C 3 .   ? 27.950  1.046   17.662 1.00 39.51 ? 390 HOH A O    1 
HETATM 2778 O  O    . HOH C 3 .   ? -38.023 17.365  23.421 1.00 58.32 ? 391 HOH A O    1 
HETATM 2779 O  O    . HOH C 3 .   ? 22.566  11.950  14.012 1.00 50.62 ? 392 HOH A O    1 
HETATM 2780 O  O    . HOH C 3 .   ? -6.350  4.437   39.404 1.00 31.74 ? 393 HOH A O    1 
HETATM 2781 O  O    . HOH C 3 .   ? -28.487 -10.493 26.397 1.00 37.47 ? 394 HOH A O    1 
HETATM 2782 O  O    . HOH C 3 .   ? -11.371 -8.825  30.978 1.00 43.64 ? 395 HOH A O    1 
HETATM 2783 O  O    . HOH C 3 .   ? -16.291 -17.138 10.803 1.00 36.50 ? 396 HOH A O    1 
HETATM 2784 O  O    . HOH C 3 .   ? 21.404  -8.005  25.403 1.00 38.07 ? 397 HOH A O    1 
HETATM 2785 O  O    . HOH C 3 .   ? -33.179 -6.462  18.120 1.00 51.03 ? 398 HOH A O    1 
HETATM 2786 O  O    . HOH C 3 .   ? 14.832  14.862  26.316 1.00 42.60 ? 399 HOH A O    1 
HETATM 2787 O  O    . HOH C 3 .   ? -10.043 -18.083 34.738 1.00 51.83 ? 400 HOH A O    1 
HETATM 2788 O  O    . HOH C 3 .   ? 1.722   15.752  30.251 1.00 46.92 ? 401 HOH A O    1 
HETATM 2789 O  O    . HOH C 3 .   ? -16.982 -0.039  31.508 1.00 32.19 ? 402 HOH A O    1 
HETATM 2790 O  O    . HOH C 3 .   ? -22.202 -14.620 9.533  1.00 42.62 ? 403 HOH A O    1 
HETATM 2791 O  O    . HOH C 3 .   ? 7.444   6.055   40.400 1.00 39.12 ? 404 HOH A O    1 
HETATM 2792 O  O    . HOH C 3 .   ? 7.950   20.305  42.530 1.00 32.96 ? 405 HOH A O    1 
HETATM 2793 O  O    . HOH C 3 .   ? -11.551 -20.547 32.714 1.00 54.07 ? 406 HOH A O    1 
HETATM 2794 O  O    . HOH C 3 .   ? -7.672  -15.422 33.039 1.00 50.89 ? 407 HOH A O    1 
HETATM 2795 O  O    . HOH C 3 .   ? -35.870 11.985  28.572 1.00 52.97 ? 408 HOH A O    1 
HETATM 2796 O  O    . HOH C 3 .   ? -12.992 -11.722 1.951  1.00 36.57 ? 409 HOH A O    1 
HETATM 2797 O  O    . HOH C 3 .   ? 21.389  4.006   38.912 1.00 47.80 ? 410 HOH A O    1 
HETATM 2798 O  O    . HOH C 3 .   ? -1.052  17.754  34.054 1.00 43.83 ? 411 HOH A O    1 
HETATM 2799 O  O    . HOH C 3 .   ? -1.109  -6.476  28.371 1.00 26.11 ? 412 HOH A O    1 
HETATM 2800 O  O    . HOH C 3 .   ? 1.696   9.684   28.044 1.00 23.45 ? 413 HOH A O    1 
HETATM 2801 O  O    . HOH C 3 .   ? -7.468  -17.202 28.440 1.00 48.39 ? 414 HOH A O    1 
HETATM 2802 O  O    . HOH C 3 .   ? 16.574  8.217   39.873 1.00 52.53 ? 415 HOH A O    1 
HETATM 2803 O  O    . HOH C 3 .   ? 6.481   17.569  21.047 1.00 60.88 ? 416 HOH A O    1 
HETATM 2804 O  O    . HOH C 3 .   ? 4.840   9.681   19.707 1.00 40.73 ? 417 HOH A O    1 
HETATM 2805 O  O    . HOH C 3 .   ? 21.408  3.061   34.128 1.00 40.61 ? 418 HOH A O    1 
HETATM 2806 O  O    . HOH C 3 .   ? 3.856   14.318  22.259 1.00 47.47 ? 419 HOH A O    1 
HETATM 2807 O  O    . HOH C 3 .   ? -3.044  -8.762  36.453 1.00 44.23 ? 420 HOH A O    1 
HETATM 2808 O  O    . HOH C 3 .   ? 9.454   18.160  45.004 1.00 44.86 ? 421 HOH A O    1 
HETATM 2809 O  O    . HOH C 3 .   ? -19.809 -20.410 33.833 1.00 35.67 ? 422 HOH A O    1 
HETATM 2810 O  O    . HOH C 3 .   ? 2.999   -2.812  37.921 1.00 27.94 ? 423 HOH A O    1 
HETATM 2811 O  O    . HOH C 3 .   ? 0.343   7.158   24.001 1.00 35.87 ? 424 HOH A O    1 
HETATM 2812 O  O    . HOH C 3 .   ? -21.025 -16.465 11.615 1.00 37.64 ? 425 HOH A O    1 
HETATM 2813 O  O    . HOH C 3 .   ? -25.209 -14.852 18.319 1.00 49.76 ? 426 HOH A O    1 
HETATM 2814 O  O    . HOH C 3 .   ? -24.583 -16.529 19.667 1.00 46.13 ? 427 HOH A O    1 
HETATM 2815 O  O    . HOH C 3 .   ? -16.753 -2.206  33.151 1.00 32.11 ? 428 HOH A O    1 
HETATM 2816 O  O    . HOH C 3 .   ? -18.599 6.088   13.501 1.00 41.72 ? 429 HOH A O    1 
HETATM 2817 O  O    . HOH C 3 .   ? 7.353   -4.267  36.556 1.00 31.81 ? 430 HOH A O    1 
HETATM 2818 O  O    . HOH C 3 .   ? -13.128 9.228   21.943 1.00 33.12 ? 431 HOH A O    1 
HETATM 2819 O  O    . HOH C 3 .   ? -22.351 -13.157 26.306 1.00 38.39 ? 432 HOH A O    1 
HETATM 2820 O  O    . HOH C 3 .   ? 17.318  -7.635  27.974 1.00 36.40 ? 433 HOH A O    1 
HETATM 2821 O  O    . HOH C 3 .   ? -15.735 -2.313  7.988  1.00 40.95 ? 434 HOH A O    1 
HETATM 2822 O  O    . HOH C 3 .   ? -1.756  -11.686 30.380 1.00 40.52 ? 435 HOH A O    1 
HETATM 2823 O  O    . HOH C 3 .   ? 11.184  22.190  35.466 1.00 34.59 ? 436 HOH A O    1 
HETATM 2824 O  O    . HOH C 3 .   ? 14.274  8.834   24.191 1.00 36.81 ? 437 HOH A O    1 
HETATM 2825 O  O    . HOH C 3 .   ? 13.389  2.214   41.276 1.00 47.99 ? 438 HOH A O    1 
HETATM 2826 O  O    . HOH C 3 .   ? -5.003  6.791   25.944 1.00 30.93 ? 439 HOH A O    1 
HETATM 2827 O  O    . HOH C 3 .   ? 0.797   -4.492  19.241 1.00 33.62 ? 440 HOH A O    1 
HETATM 2828 O  O    . HOH C 3 .   ? -4.379  7.239   30.597 1.00 39.94 ? 441 HOH A O    1 
HETATM 2829 O  O    . HOH C 3 .   ? -14.764 1.946   6.393  1.00 43.34 ? 442 HOH A O    1 
HETATM 2830 O  O    . HOH C 3 .   ? -6.452  -5.088  0.863  1.00 51.18 ? 443 HOH A O    1 
HETATM 2831 O  O    . HOH C 3 .   ? 8.072   -2.484  38.837 1.00 39.93 ? 444 HOH A O    1 
HETATM 2832 O  O    . HOH C 3 .   ? 7.030   22.751  41.228 1.00 43.02 ? 445 HOH A O    1 
HETATM 2833 O  O    . HOH C 3 .   ? 15.304  16.715  19.704 1.00 47.84 ? 446 HOH A O    1 
HETATM 2834 O  O    . HOH C 3 .   ? -8.919  -3.898  41.112 1.00 55.40 ? 447 HOH A O    1 
HETATM 2835 O  O    . HOH C 3 .   ? -17.212 4.236   5.577  1.00 51.65 ? 448 HOH A O    1 
HETATM 2836 O  O    . HOH C 3 .   ? 11.743  12.648  42.799 1.00 54.56 ? 449 HOH A O    1 
HETATM 2837 O  O    . HOH C 3 .   ? 18.183  0.385   31.380 1.00 55.32 ? 450 HOH A O    1 
HETATM 2838 O  O    . HOH C 3 .   ? -24.239 -9.607  11.652 1.00 42.97 ? 451 HOH A O    1 
HETATM 2839 O  O    . HOH C 3 .   ? -25.297 12.567  31.285 1.00 44.37 ? 452 HOH A O    1 
HETATM 2840 O  O    . HOH C 3 .   ? -17.931 1.952   33.232 1.00 41.88 ? 453 HOH A O    1 
HETATM 2841 O  O    . HOH C 3 .   ? 8.252   20.143  21.124 1.00 59.80 ? 454 HOH A O    1 
HETATM 2842 O  O    . HOH C 3 .   ? -24.668 1.245   34.661 1.00 40.71 ? 455 HOH A O    1 
HETATM 2843 O  O    . HOH C 3 .   ? 13.142  -7.737  11.797 1.00 43.39 ? 456 HOH A O    1 
HETATM 2844 O  O    . HOH C 3 .   ? -20.827 13.373  31.188 1.00 43.76 ? 457 HOH A O    1 
HETATM 2845 O  O    . HOH C 3 .   ? -25.079 13.696  26.391 1.00 60.62 ? 458 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   5   5   ARG ARG A . n 
A 1 2   PRO 2   6   6   PRO PRO A . n 
A 1 3   THR 3   7   7   THR THR A . n 
A 1 4   PHE 4   8   8   PHE PHE A . n 
A 1 5   TYR 5   9   9   TYR TYR A . n 
A 1 6   ARG 6   10  10  ARG ARG A . n 
A 1 7   GLN 7   11  11  GLN GLN A . n 
A 1 8   GLU 8   12  12  GLU GLU A . n 
A 1 9   LEU 9   13  13  LEU LEU A . n 
A 1 10  ASN 10  14  14  ASN ASN A . n 
A 1 11  LYS 11  15  15  LYS LYS A . n 
A 1 12  THR 12  16  16  THR THR A . n 
A 1 13  ILE 13  17  17  ILE ILE A . n 
A 1 14  TRP 14  18  18  TRP TRP A . n 
A 1 15  GLU 15  19  19  GLU GLU A . n 
A 1 16  VAL 16  20  20  VAL VAL A . n 
A 1 17  PRO 17  21  21  PRO PRO A . n 
A 1 18  GLU 18  22  22  GLU GLU A . n 
A 1 19  ARG 19  23  23  ARG ARG A . n 
A 1 20  TYR 20  24  24  TYR TYR A . n 
A 1 21  GLN 21  25  25  GLN GLN A . n 
A 1 22  ASN 22  26  26  ASN ASN A . n 
A 1 23  LEU 23  27  27  LEU LEU A . n 
A 1 24  SER 24  28  28  SER SER A . n 
A 1 25  PRO 25  29  29  PRO PRO A . n 
A 1 26  VAL 26  30  30  VAL VAL A . n 
A 1 27  GLY 27  31  ?   ?   ?   A . n 
A 1 28  SER 28  32  ?   ?   ?   A . n 
A 1 29  GLY 29  33  ?   ?   ?   A . n 
A 1 30  ALA 30  34  ?   ?   ?   A . n 
A 1 31  TYR 31  35  35  TYR TYR A . n 
A 1 32  GLY 32  36  36  GLY GLY A . n 
A 1 33  SER 33  37  37  SER SER A . n 
A 1 34  VAL 34  38  38  VAL VAL A . n 
A 1 35  CYS 35  39  39  CYS CYS A . n 
A 1 36  ALA 36  40  40  ALA ALA A . n 
A 1 37  ALA 37  41  41  ALA ALA A . n 
A 1 38  PHE 38  42  42  PHE PHE A . n 
A 1 39  ASP 39  43  43  ASP ASP A . n 
A 1 40  THR 40  44  44  THR THR A . n 
A 1 41  LYS 41  45  45  LYS LYS A . n 
A 1 42  THR 42  46  46  THR THR A . n 
A 1 43  GLY 43  47  47  GLY GLY A . n 
A 1 44  LEU 44  48  48  LEU LEU A . n 
A 1 45  ARG 45  49  49  ARG ARG A . n 
A 1 46  VAL 46  50  50  VAL VAL A . n 
A 1 47  ALA 47  51  51  ALA ALA A . n 
A 1 48  VAL 48  52  52  VAL VAL A . n 
A 1 49  LYS 49  53  53  LYS LYS A . n 
A 1 50  LYS 50  54  54  LYS LYS A . n 
A 1 51  LEU 51  55  55  LEU LEU A . n 
A 1 52  SER 52  56  56  SER SER A . n 
A 1 53  ARG 53  57  57  ARG ARG A . n 
A 1 54  PRO 54  58  58  PRO PRO A . n 
A 1 55  PHE 55  59  59  PHE PHE A . n 
A 1 56  GLN 56  60  60  GLN GLN A . n 
A 1 57  SER 57  61  61  SER SER A . n 
A 1 58  ILE 58  62  62  ILE ILE A . n 
A 1 59  ILE 59  63  63  ILE ILE A . n 
A 1 60  HIS 60  64  64  HIS HIS A . n 
A 1 61  ALA 61  65  65  ALA ALA A . n 
A 1 62  LYS 62  66  66  LYS LYS A . n 
A 1 63  ARG 63  67  67  ARG ARG A . n 
A 1 64  THR 64  68  68  THR THR A . n 
A 1 65  TYR 65  69  69  TYR TYR A . n 
A 1 66  ARG 66  70  70  ARG ARG A . n 
A 1 67  GLU 67  71  71  GLU GLU A . n 
A 1 68  LEU 68  72  72  LEU LEU A . n 
A 1 69  ARG 69  73  73  ARG ARG A . n 
A 1 70  LEU 70  74  74  LEU LEU A . n 
A 1 71  LEU 71  75  75  LEU LEU A . n 
A 1 72  LYS 72  76  76  LYS LYS A . n 
A 1 73  HIS 73  77  77  HIS HIS A . n 
A 1 74  MET 74  78  78  MET MET A . n 
A 1 75  LYS 75  79  79  LYS LYS A . n 
A 1 76  HIS 76  80  80  HIS HIS A . n 
A 1 77  GLU 77  81  81  GLU GLU A . n 
A 1 78  ASN 78  82  82  ASN ASN A . n 
A 1 79  VAL 79  83  83  VAL VAL A . n 
A 1 80  ILE 80  84  84  ILE ILE A . n 
A 1 81  GLY 81  85  85  GLY GLY A . n 
A 1 82  LEU 82  86  86  LEU LEU A . n 
A 1 83  LEU 83  87  87  LEU LEU A . n 
A 1 84  ASP 84  88  88  ASP ASP A . n 
A 1 85  VAL 85  89  89  VAL VAL A . n 
A 1 86  PHE 86  90  90  PHE PHE A . n 
A 1 87  THR 87  91  91  THR THR A . n 
A 1 88  PRO 88  92  92  PRO PRO A . n 
A 1 89  ALA 89  93  93  ALA ALA A . n 
A 1 90  ARG 90  94  94  ARG ARG A . n 
A 1 91  SER 91  95  95  SER SER A . n 
A 1 92  LEU 92  96  96  LEU LEU A . n 
A 1 93  GLU 93  97  97  GLU GLU A . n 
A 1 94  GLU 94  98  98  GLU GLU A . n 
A 1 95  PHE 95  99  99  PHE PHE A . n 
A 1 96  ASN 96  100 100 ASN ASN A . n 
A 1 97  ASP 97  101 101 ASP ASP A . n 
A 1 98  VAL 98  102 102 VAL VAL A . n 
A 1 99  TYR 99  103 103 TYR TYR A . n 
A 1 100 LEU 100 104 104 LEU LEU A . n 
A 1 101 VAL 101 105 105 VAL VAL A . n 
A 1 102 THR 102 106 106 THR THR A . n 
A 1 103 HIS 103 107 107 HIS HIS A . n 
A 1 104 LEU 104 108 108 LEU LEU A . n 
A 1 105 MET 105 109 109 MET MET A . n 
A 1 106 GLY 106 110 110 GLY GLY A . n 
A 1 107 ALA 107 111 111 ALA ALA A . n 
A 1 108 ASP 108 112 112 ASP ASP A . n 
A 1 109 LEU 109 113 113 LEU LEU A . n 
A 1 110 ASN 110 114 114 ASN ASN A . n 
A 1 111 ASN 111 115 115 ASN ASN A . n 
A 1 112 ILE 112 116 116 ILE ILE A . n 
A 1 113 VAL 113 117 117 VAL VAL A . n 
A 1 114 LYS 114 118 118 LYS LYS A . n 
A 1 115 CYS 115 119 119 CYS CYS A . n 
A 1 116 GLN 116 120 120 GLN GLN A . n 
A 1 117 LYS 117 121 121 LYS LYS A . n 
A 1 118 LEU 118 122 122 LEU LEU A . n 
A 1 119 THR 119 123 123 THR THR A . n 
A 1 120 ASP 120 124 124 ASP ASP A . n 
A 1 121 ASP 121 125 125 ASP ASP A . n 
A 1 122 HIS 122 126 126 HIS HIS A . n 
A 1 123 VAL 123 127 127 VAL VAL A . n 
A 1 124 GLN 124 128 128 GLN GLN A . n 
A 1 125 PHE 125 129 129 PHE PHE A . n 
A 1 126 LEU 126 130 130 LEU LEU A . n 
A 1 127 ILE 127 131 131 ILE ILE A . n 
A 1 128 TYR 128 132 132 TYR TYR A . n 
A 1 129 GLN 129 133 133 GLN GLN A . n 
A 1 130 ILE 130 134 134 ILE ILE A . n 
A 1 131 LEU 131 135 135 LEU LEU A . n 
A 1 132 ARG 132 136 136 ARG ARG A . n 
A 1 133 GLY 133 137 137 GLY GLY A . n 
A 1 134 LEU 134 138 138 LEU LEU A . n 
A 1 135 LYS 135 139 139 LYS LYS A . n 
A 1 136 TYR 136 140 140 TYR TYR A . n 
A 1 137 ILE 137 141 141 ILE ILE A . n 
A 1 138 HIS 138 142 142 HIS HIS A . n 
A 1 139 SER 139 143 143 SER SER A . n 
A 1 140 ALA 140 144 144 ALA ALA A . n 
A 1 141 ASP 141 145 145 ASP ASP A . n 
A 1 142 ILE 142 146 146 ILE ILE A . n 
A 1 143 ILE 143 147 147 ILE ILE A . n 
A 1 144 HIS 144 148 148 HIS HIS A . n 
A 1 145 ARG 145 149 149 ARG ARG A . n 
A 1 146 ASP 146 150 150 ASP ASP A . n 
A 1 147 LEU 147 151 151 LEU LEU A . n 
A 1 148 LYS 148 152 152 LYS LYS A . n 
A 1 149 PRO 149 153 153 PRO PRO A . n 
A 1 150 SER 150 154 154 SER SER A . n 
A 1 151 ASN 151 155 155 ASN ASN A . n 
A 1 152 LEU 152 156 156 LEU LEU A . n 
A 1 153 ALA 153 157 157 ALA ALA A . n 
A 1 154 VAL 154 158 158 VAL VAL A . n 
A 1 155 ASN 155 159 159 ASN ASN A . n 
A 1 156 GLU 156 160 160 GLU GLU A . n 
A 1 157 ASP 157 161 161 ASP ASP A . n 
A 1 158 CYS 158 162 162 CYS CYS A . n 
A 1 159 GLU 159 163 163 GLU GLU A . n 
A 1 160 LEU 160 164 164 LEU LEU A . n 
A 1 161 LYS 161 165 165 LYS LYS A . n 
A 1 162 ILE 162 166 166 ILE ILE A . n 
A 1 163 LEU 163 167 167 LEU LEU A . n 
A 1 164 ASP 164 168 168 ASP ASP A . n 
A 1 165 PHE 165 169 169 PHE PHE A . n 
A 1 166 GLY 166 170 170 GLY GLY A . n 
A 1 167 LEU 167 171 ?   ?   ?   A . n 
A 1 168 ALA 168 172 ?   ?   ?   A . n 
A 1 169 ARG 169 173 ?   ?   ?   A . n 
A 1 170 HIS 170 174 ?   ?   ?   A . n 
A 1 171 THR 171 175 ?   ?   ?   A . n 
A 1 172 ASP 172 176 ?   ?   ?   A . n 
A 1 173 ASP 173 177 ?   ?   ?   A . n 
A 1 174 GLU 174 178 ?   ?   ?   A . n 
A 1 175 MET 175 179 ?   ?   ?   A . n 
A 1 176 THR 176 180 ?   ?   ?   A . n 
A 1 177 GLY 177 181 ?   ?   ?   A . n 
A 1 178 TYR 178 182 182 TYR TYR A . n 
A 1 179 VAL 179 183 183 VAL VAL A . n 
A 1 180 ALA 180 184 184 ALA ALA A . n 
A 1 181 THR 181 185 185 THR THR A . n 
A 1 182 ARG 182 186 186 ARG ARG A . n 
A 1 183 TRP 183 187 187 TRP TRP A . n 
A 1 184 TYR 184 188 188 TYR TYR A . n 
A 1 185 ARG 185 189 189 ARG ARG A . n 
A 1 186 ALA 186 190 190 ALA ALA A . n 
A 1 187 PRO 187 191 191 PRO PRO A . n 
A 1 188 GLU 188 192 192 GLU GLU A . n 
A 1 189 ILE 189 193 193 ILE ILE A . n 
A 1 190 MET 190 194 194 MET MET A . n 
A 1 191 LEU 191 195 195 LEU LEU A . n 
A 1 192 ASN 192 196 196 ASN ASN A . n 
A 1 193 TRP 193 197 197 TRP TRP A . n 
A 1 194 MET 194 198 198 MET MET A . n 
A 1 195 HIS 195 199 199 HIS HIS A . n 
A 1 196 TYR 196 200 200 TYR TYR A . n 
A 1 197 ASN 197 201 201 ASN ASN A . n 
A 1 198 GLN 198 202 202 GLN GLN A . n 
A 1 199 THR 199 203 203 THR THR A . n 
A 1 200 VAL 200 204 204 VAL VAL A . n 
A 1 201 ASP 201 205 205 ASP ASP A . n 
A 1 202 ILE 202 206 206 ILE ILE A . n 
A 1 203 TRP 203 207 207 TRP TRP A . n 
A 1 204 SER 204 208 208 SER SER A . n 
A 1 205 VAL 205 209 209 VAL VAL A . n 
A 1 206 GLY 206 210 210 GLY GLY A . n 
A 1 207 CYS 207 211 211 CYS CYS A . n 
A 1 208 ILE 208 212 212 ILE ILE A . n 
A 1 209 MET 209 213 213 MET MET A . n 
A 1 210 ALA 210 214 214 ALA ALA A . n 
A 1 211 GLU 211 215 215 GLU GLU A . n 
A 1 212 LEU 212 216 216 LEU LEU A . n 
A 1 213 LEU 213 217 217 LEU LEU A . n 
A 1 214 THR 214 218 218 THR THR A . n 
A 1 215 GLY 215 219 219 GLY GLY A . n 
A 1 216 ARG 216 220 220 ARG ARG A . n 
A 1 217 THR 217 221 221 THR THR A . n 
A 1 218 LEU 218 222 222 LEU LEU A . n 
A 1 219 PHE 219 223 223 PHE PHE A . n 
A 1 220 PRO 220 224 224 PRO PRO A . n 
A 1 221 GLY 221 225 225 GLY GLY A . n 
A 1 222 THR 222 226 226 THR THR A . n 
A 1 223 ASP 223 227 227 ASP ASP A . n 
A 1 224 HIS 224 228 228 HIS HIS A . n 
A 1 225 ILE 225 229 229 ILE ILE A . n 
A 1 226 ASP 226 230 230 ASP ASP A . n 
A 1 227 GLN 227 231 231 GLN GLN A . n 
A 1 228 LEU 228 232 232 LEU LEU A . n 
A 1 229 LYS 229 233 233 LYS LYS A . n 
A 1 230 LEU 230 234 234 LEU LEU A . n 
A 1 231 ILE 231 235 235 ILE ILE A . n 
A 1 232 LEU 232 236 236 LEU LEU A . n 
A 1 233 ARG 233 237 237 ARG ARG A . n 
A 1 234 LEU 234 238 238 LEU LEU A . n 
A 1 235 VAL 235 239 239 VAL VAL A . n 
A 1 236 GLY 236 240 240 GLY GLY A . n 
A 1 237 THR 237 241 241 THR THR A . n 
A 1 238 PRO 238 242 242 PRO PRO A . n 
A 1 239 GLY 239 243 243 GLY GLY A . n 
A 1 240 ALA 240 244 244 ALA ALA A . n 
A 1 241 GLU 241 245 245 GLU GLU A . n 
A 1 242 LEU 242 246 246 LEU LEU A . n 
A 1 243 LEU 243 247 247 LEU LEU A . n 
A 1 244 LYS 244 248 248 LYS LYS A . n 
A 1 245 LYS 245 249 249 LYS LYS A . n 
A 1 246 ILE 246 250 250 ILE ILE A . n 
A 1 247 SER 247 251 251 SER SER A . n 
A 1 248 SER 248 252 252 SER SER A . n 
A 1 249 GLU 249 253 253 GLU GLU A . n 
A 1 250 SER 250 254 254 SER SER A . n 
A 1 251 ALA 251 255 255 ALA ALA A . n 
A 1 252 ARG 252 256 256 ARG ARG A . n 
A 1 253 ASN 253 257 257 ASN ASN A . n 
A 1 254 TYR 254 258 258 TYR TYR A . n 
A 1 255 ILE 255 259 259 ILE ILE A . n 
A 1 256 GLN 256 260 260 GLN GLN A . n 
A 1 257 SER 257 261 261 SER SER A . n 
A 1 258 LEU 258 262 262 LEU LEU A . n 
A 1 259 THR 259 263 263 THR THR A . n 
A 1 260 GLN 260 264 264 GLN GLN A . n 
A 1 261 MET 261 265 265 MET MET A . n 
A 1 262 PRO 262 266 266 PRO PRO A . n 
A 1 263 LYS 263 267 267 LYS LYS A . n 
A 1 264 MET 264 268 268 MET MET A . n 
A 1 265 ASN 265 269 269 ASN ASN A . n 
A 1 266 PHE 266 270 270 PHE PHE A . n 
A 1 267 ALA 267 271 271 ALA ALA A . n 
A 1 268 ASN 268 272 272 ASN ASN A . n 
A 1 269 VAL 269 273 273 VAL VAL A . n 
A 1 270 PHE 270 274 274 PHE PHE A . n 
A 1 271 ILE 271 275 275 ILE ILE A . n 
A 1 272 GLY 272 276 276 GLY GLY A . n 
A 1 273 ALA 273 277 277 ALA ALA A . n 
A 1 274 ASN 274 278 278 ASN ASN A . n 
A 1 275 PRO 275 279 279 PRO PRO A . n 
A 1 276 LEU 276 280 280 LEU LEU A . n 
A 1 277 ALA 277 281 281 ALA ALA A . n 
A 1 278 VAL 278 282 282 VAL VAL A . n 
A 1 279 ASP 279 283 283 ASP ASP A . n 
A 1 280 LEU 280 284 284 LEU LEU A . n 
A 1 281 LEU 281 285 285 LEU LEU A . n 
A 1 282 GLU 282 286 286 GLU GLU A . n 
A 1 283 LYS 283 287 287 LYS LYS A . n 
A 1 284 MET 284 288 288 MET MET A . n 
A 1 285 LEU 285 289 289 LEU LEU A . n 
A 1 286 VAL 286 290 290 VAL VAL A . n 
A 1 287 LEU 287 291 291 LEU LEU A . n 
A 1 288 ASP 288 292 292 ASP ASP A . n 
A 1 289 SER 289 293 293 SER SER A . n 
A 1 290 ASP 290 294 294 ASP ASP A . n 
A 1 291 LYS 291 295 295 LYS LYS A . n 
A 1 292 ARG 292 296 296 ARG ARG A . n 
A 1 293 ILE 293 297 297 ILE ILE A . n 
A 1 294 THR 294 298 298 THR THR A . n 
A 1 295 ALA 295 299 299 ALA ALA A . n 
A 1 296 ALA 296 300 300 ALA ALA A . n 
A 1 297 GLN 297 301 301 GLN GLN A . n 
A 1 298 ALA 298 302 302 ALA ALA A . n 
A 1 299 LEU 299 303 303 LEU LEU A . n 
A 1 300 ALA 300 304 304 ALA ALA A . n 
A 1 301 HIS 301 305 305 HIS HIS A . n 
A 1 302 ALA 302 306 306 ALA ALA A . n 
A 1 303 TYR 303 307 307 TYR TYR A . n 
A 1 304 PHE 304 308 308 PHE PHE A . n 
A 1 305 ALA 305 309 309 ALA ALA A . n 
A 1 306 GLN 306 310 310 GLN GLN A . n 
A 1 307 TYR 307 311 311 TYR TYR A . n 
A 1 308 HIS 308 312 312 HIS HIS A . n 
A 1 309 ASP 309 313 313 ASP ASP A . n 
A 1 310 PRO 310 314 314 PRO PRO A . n 
A 1 311 ASP 311 315 315 ASP ASP A . n 
A 1 312 ASP 312 316 316 ASP ASP A . n 
A 1 313 GLU 313 317 317 GLU GLU A . n 
A 1 314 PRO 314 318 318 PRO PRO A . n 
A 1 315 VAL 315 319 319 VAL VAL A . n 
A 1 316 ALA 316 320 320 ALA ALA A . n 
A 1 317 ASP 317 321 321 ASP ASP A . n 
A 1 318 PRO 318 322 322 PRO PRO A . n 
A 1 319 TYR 319 323 323 TYR TYR A . n 
A 1 320 ASP 320 324 324 ASP ASP A . n 
A 1 321 GLN 321 325 325 GLN GLN A . n 
A 1 322 SER 322 326 326 SER SER A . n 
A 1 323 PHE 323 327 327 PHE PHE A . n 
A 1 324 GLU 324 328 328 GLU GLU A . n 
A 1 325 SER 325 329 329 SER SER A . n 
A 1 326 ARG 326 330 330 ARG ARG A . n 
A 1 327 ASP 327 331 331 ASP ASP A . n 
A 1 328 LEU 328 332 332 LEU LEU A . n 
A 1 329 LEU 329 333 333 LEU LEU A . n 
A 1 330 ILE 330 334 334 ILE ILE A . n 
A 1 331 ASP 331 335 335 ASP ASP A . n 
A 1 332 GLU 332 336 336 GLU GLU A . n 
A 1 333 TRP 333 337 337 TRP TRP A . n 
A 1 334 LYS 334 338 338 LYS LYS A . n 
A 1 335 SER 335 339 339 SER SER A . n 
A 1 336 LEU 336 340 340 LEU LEU A . n 
A 1 337 THR 337 341 341 THR THR A . n 
A 1 338 TYR 338 342 342 TYR TYR A . n 
A 1 339 ASP 339 343 343 ASP ASP A . n 
A 1 340 GLU 340 344 344 GLU GLU A . n 
A 1 341 VAL 341 345 345 VAL VAL A . n 
A 1 342 ILE 342 346 346 ILE ILE A . n 
A 1 343 SER 343 347 347 SER SER A . n 
A 1 344 PHE 344 348 348 PHE PHE A . n 
A 1 345 VAL 345 349 349 VAL VAL A . n 
A 1 346 PRO 346 350 350 PRO PRO A . n 
A 1 347 PRO 347 351 351 PRO PRO A . n 
A 1 348 PRO 348 352 352 PRO PRO A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-10 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum  ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             162 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             162 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                2.021 
_pdbx_validate_rmsd_bond.bond_target_value         1.818 
_pdbx_validate_rmsd_bond.bond_deviation            0.203 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.017 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              162 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              162 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              162 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                120.01 
_pdbx_validate_rmsd_angle.angle_target_value         111.50 
_pdbx_validate_rmsd_angle.angle_deviation            8.51 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 15  ? ? 67.50   -13.73  
2  1 ARG A 23  ? ? -32.40  -35.63  
3  1 PRO A 29  ? ? -38.53  137.75  
4  1 SER A 37  ? ? 85.82   86.77   
5  1 LYS A 118 ? ? -68.15  9.90    
6  1 ARG A 149 ? ? 67.42   -7.32   
7  1 PHE A 169 ? ? -66.98  -96.10  
8  1 VAL A 183 ? ? -161.71 88.05   
9  1 LEU A 195 ? ? -75.01  -156.23 
10 1 TRP A 197 ? ? -101.53 -86.96  
11 1 MET A 198 ? ? -69.15  -160.37 
12 1 HIS A 199 ? ? 90.19   45.38   
13 1 PRO A 224 ? ? -81.14  43.53   
14 1 SER A 254 ? ? -161.93 94.35   
15 1 ALA A 255 ? ? 25.13   -84.09  
16 1 THR A 263 ? ? -26.44  128.07  
17 1 PHE A 274 ? ? -102.81 51.15   
18 1 ILE A 275 ? ? 47.51   -141.93 
19 1 LEU A 289 ? ? -95.39  52.84   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   TRP 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    197 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   MET 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    198 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -35.10 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A TYR 35  ? CG  ? A TYR 31  CG  
2  1 Y 1 A TYR 35  ? CD1 ? A TYR 31  CD1 
3  1 Y 1 A TYR 35  ? CD2 ? A TYR 31  CD2 
4  1 Y 1 A TYR 35  ? CE1 ? A TYR 31  CE1 
5  1 Y 1 A TYR 35  ? CE2 ? A TYR 31  CE2 
6  1 Y 1 A TYR 35  ? CZ  ? A TYR 31  CZ  
7  1 Y 1 A TYR 35  ? OH  ? A TYR 31  OH  
8  1 Y 1 A LYS 121 ? O   ? A LYS 117 O   
9  1 Y 1 A TYR 182 ? CB  ? A TYR 178 CB  
10 1 Y 1 A TYR 182 ? CG  ? A TYR 178 CG  
11 1 Y 1 A TYR 182 ? CD1 ? A TYR 178 CD1 
12 1 Y 1 A TYR 182 ? CD2 ? A TYR 178 CD2 
13 1 Y 1 A TYR 182 ? CE1 ? A TYR 178 CE1 
14 1 Y 1 A TYR 182 ? CE2 ? A TYR 178 CE2 
15 1 Y 1 A TYR 182 ? CZ  ? A TYR 178 CZ  
16 1 Y 1 A TYR 182 ? OH  ? A TYR 178 OH  
17 1 Y 1 A PRO 352 ? O   ? A PRO 348 O   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 31  ? A GLY 27  
2  1 Y 1 A SER 32  ? A SER 28  
3  1 Y 1 A GLY 33  ? A GLY 29  
4  1 Y 1 A ALA 34  ? A ALA 30  
5  1 Y 1 A LEU 171 ? A LEU 167 
6  1 Y 1 A ALA 172 ? A ALA 168 
7  1 Y 1 A ARG 173 ? A ARG 169 
8  1 Y 1 A HIS 174 ? A HIS 170 
9  1 Y 1 A THR 175 ? A THR 171 
10 1 Y 1 A ASP 176 ? A ASP 172 
11 1 Y 1 A ASP 177 ? A ASP 173 
12 1 Y 1 A GLU 178 ? A GLU 174 
13 1 Y 1 A MET 179 ? A MET 175 
14 1 Y 1 A THR 180 ? A THR 176 
15 1 Y 1 A GLY 181 ? A GLY 177 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-{4-[({[4-CHLORO-3-(TRIFLUOROMETHYL)PHENYL]AMINO}CARBONYL)AMINO]PHENOXY}-N-METHYLPYRIDINE-2-CARBOXAMIDE' BAX 
3 water                                                                                                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BAX 1   1   1   BAX BAX A . 
C 3 HOH 1   2   2   HOH HOH A . 
C 3 HOH 2   3   3   HOH HOH A . 
C 3 HOH 3   4   4   HOH HOH A . 
C 3 HOH 4   353 5   HOH HOH A . 
C 3 HOH 5   354 6   HOH HOH A . 
C 3 HOH 6   355 7   HOH HOH A . 
C 3 HOH 7   356 8   HOH HOH A . 
C 3 HOH 8   357 9   HOH HOH A . 
C 3 HOH 9   358 10  HOH HOH A . 
C 3 HOH 10  359 11  HOH HOH A . 
C 3 HOH 11  360 12  HOH HOH A . 
C 3 HOH 12  361 14  HOH HOH A . 
C 3 HOH 13  362 15  HOH HOH A . 
C 3 HOH 14  363 16  HOH HOH A . 
C 3 HOH 15  364 17  HOH HOH A . 
C 3 HOH 16  365 18  HOH HOH A . 
C 3 HOH 17  366 19  HOH HOH A . 
C 3 HOH 18  367 21  HOH HOH A . 
C 3 HOH 19  368 22  HOH HOH A . 
C 3 HOH 20  369 23  HOH HOH A . 
C 3 HOH 21  370 24  HOH HOH A . 
C 3 HOH 22  371 26  HOH HOH A . 
C 3 HOH 23  372 27  HOH HOH A . 
C 3 HOH 24  373 28  HOH HOH A . 
C 3 HOH 25  374 29  HOH HOH A . 
C 3 HOH 26  375 31  HOH HOH A . 
C 3 HOH 27  376 33  HOH HOH A . 
C 3 HOH 28  377 34  HOH HOH A . 
C 3 HOH 29  378 35  HOH HOH A . 
C 3 HOH 30  379 36  HOH HOH A . 
C 3 HOH 31  380 38  HOH HOH A . 
C 3 HOH 32  381 39  HOH HOH A . 
C 3 HOH 33  382 40  HOH HOH A . 
C 3 HOH 34  383 41  HOH HOH A . 
C 3 HOH 35  384 42  HOH HOH A . 
C 3 HOH 36  385 43  HOH HOH A . 
C 3 HOH 37  386 44  HOH HOH A . 
C 3 HOH 38  387 45  HOH HOH A . 
C 3 HOH 39  388 46  HOH HOH A . 
C 3 HOH 40  389 48  HOH HOH A . 
C 3 HOH 41  390 49  HOH HOH A . 
C 3 HOH 42  391 50  HOH HOH A . 
C 3 HOH 43  392 51  HOH HOH A . 
C 3 HOH 44  393 52  HOH HOH A . 
C 3 HOH 45  394 53  HOH HOH A . 
C 3 HOH 46  395 54  HOH HOH A . 
C 3 HOH 47  396 55  HOH HOH A . 
C 3 HOH 48  397 56  HOH HOH A . 
C 3 HOH 49  398 57  HOH HOH A . 
C 3 HOH 50  399 58  HOH HOH A . 
C 3 HOH 51  400 59  HOH HOH A . 
C 3 HOH 52  401 60  HOH HOH A . 
C 3 HOH 53  402 61  HOH HOH A . 
C 3 HOH 54  403 62  HOH HOH A . 
C 3 HOH 55  404 63  HOH HOH A . 
C 3 HOH 56  405 64  HOH HOH A . 
C 3 HOH 57  406 65  HOH HOH A . 
C 3 HOH 58  407 66  HOH HOH A . 
C 3 HOH 59  408 67  HOH HOH A . 
C 3 HOH 60  409 69  HOH HOH A . 
C 3 HOH 61  410 71  HOH HOH A . 
C 3 HOH 62  411 72  HOH HOH A . 
C 3 HOH 63  412 73  HOH HOH A . 
C 3 HOH 64  413 76  HOH HOH A . 
C 3 HOH 65  414 77  HOH HOH A . 
C 3 HOH 66  415 78  HOH HOH A . 
C 3 HOH 67  416 79  HOH HOH A . 
C 3 HOH 68  417 80  HOH HOH A . 
C 3 HOH 69  418 81  HOH HOH A . 
C 3 HOH 70  419 86  HOH HOH A . 
C 3 HOH 71  420 92  HOH HOH A . 
C 3 HOH 72  421 93  HOH HOH A . 
C 3 HOH 73  422 94  HOH HOH A . 
C 3 HOH 74  423 95  HOH HOH A . 
C 3 HOH 75  424 96  HOH HOH A . 
C 3 HOH 76  425 97  HOH HOH A . 
C 3 HOH 77  426 98  HOH HOH A . 
C 3 HOH 78  427 99  HOH HOH A . 
C 3 HOH 79  428 100 HOH HOH A . 
C 3 HOH 80  429 101 HOH HOH A . 
C 3 HOH 81  430 102 HOH HOH A . 
C 3 HOH 82  431 103 HOH HOH A . 
C 3 HOH 83  432 104 HOH HOH A . 
C 3 HOH 84  433 105 HOH HOH A . 
C 3 HOH 85  434 106 HOH HOH A . 
C 3 HOH 86  435 107 HOH HOH A . 
C 3 HOH 87  436 108 HOH HOH A . 
C 3 HOH 88  437 109 HOH HOH A . 
C 3 HOH 89  438 110 HOH HOH A . 
C 3 HOH 90  439 111 HOH HOH A . 
C 3 HOH 91  440 112 HOH HOH A . 
C 3 HOH 92  441 113 HOH HOH A . 
C 3 HOH 93  442 114 HOH HOH A . 
C 3 HOH 94  443 115 HOH HOH A . 
C 3 HOH 95  444 116 HOH HOH A . 
C 3 HOH 96  445 117 HOH HOH A . 
C 3 HOH 97  446 118 HOH HOH A . 
C 3 HOH 98  447 119 HOH HOH A . 
C 3 HOH 99  448 120 HOH HOH A . 
C 3 HOH 100 449 121 HOH HOH A . 
C 3 HOH 101 450 122 HOH HOH A . 
C 3 HOH 102 451 123 HOH HOH A . 
C 3 HOH 103 452 124 HOH HOH A . 
C 3 HOH 104 453 125 HOH HOH A . 
C 3 HOH 105 454 126 HOH HOH A . 
C 3 HOH 106 455 127 HOH HOH A . 
C 3 HOH 107 456 128 HOH HOH A . 
C 3 HOH 108 457 129 HOH HOH A . 
C 3 HOH 109 458 130 HOH HOH A . 
#