data_3HI6
# 
_entry.id   3HI6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3HI6         pdb_00003hi6 10.2210/pdb3hi6/pdb 
RCSB  RCSB053163   ?            ?                   
WWPDB D_1000053163 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3HI5 
_pdbx_database_related.details        'Crystal structure of Fab fragment of AL-57 antibody' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3HI6 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.' 1 
'Wang, J.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of activation-dependent binding of ligand-mimetic antibody AL-57 to integrin LFA-1.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                18345 
_citation.page_last                 18350 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19805116 
_citation.pdbx_database_id_DOI      10.1073/pnas.0909301106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, H.'    1 ? 
primary 'Liu, J.H.'    2 ? 
primary 'Yang, W.'     3 ? 
primary 'Springer, T.' 4 ? 
primary 'Shimaoka, M.' 5 ? 
primary 'Wang, J.H.'   6 ? 
# 
_cell.length_a           133.780 
_cell.length_b           133.780 
_cell.length_c           161.050 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3HI6 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.entry_id                         3HI6 
_symmetry.Int_Tables_number                170 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin alpha-L'                                              20554.525 2   ? 'L186C, F324C' 
'UNP residues 153-332' ? 
2 polymer     man 'Heavy chain of Fab fragment of AL-57 against alpha L I domain' 23765.510 2   ? ?              ? ? 
3 polymer     man 'light chain of Fab fragment of AL-57 against alpha L I domain' 23016.424 2   ? ?              ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                            54.938    2   ? ?              ? ? 
5 non-polymer syn 'SULFATE ION'                                                   96.063    6   ? ?              ? ? 
6 water       nat water                                                           18.015    700 ? ?              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Leukocyte adhesion glycoprotein LFA-1 alpha chain, LFA-1A, Leukocyte function-associated molecule 1 alpha chain, CD11 antigen-like family member A
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKCSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLCTELQKKIY
;
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKCSNTSYQFAAVQFSTSYKTEFDFSDYVKWKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLCTELQKKIY
;
A,B ? 
2 'polypeptide(L)' no no 
;EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYVMWWVRQAPGKGLEWVSYIWPSGGNTYYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCASSYDFWSNAFDIWGQGTMVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
;
;EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYVMWWVRQAPGKGLEWVSYIWPSGGNTYYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCASSYDFWSNAFDIWGQGTMVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
;
H,X ? 
3 'polypeptide(L)' no no 
;QDIQMTQSPSSLSASVGDRVTITCRASQSIGSYLNWYQQKTGKAPKALIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ
LEDFATYYCQQSYSTPSFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
;
;QDIQMTQSPSSLSASVGDRVTITCRASQSIGSYLNWYQQKTGKAPKALIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ
LEDFATYYCQQSYSTPSFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
;
L,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   VAL n 
1 4   ASP n 
1 5   LEU n 
1 6   VAL n 
1 7   PHE n 
1 8   LEU n 
1 9   PHE n 
1 10  ASP n 
1 11  GLY n 
1 12  SER n 
1 13  MET n 
1 14  SER n 
1 15  LEU n 
1 16  GLN n 
1 17  PRO n 
1 18  ASP n 
1 19  GLU n 
1 20  PHE n 
1 21  GLN n 
1 22  LYS n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  PHE n 
1 27  MET n 
1 28  LYS n 
1 29  ASP n 
1 30  VAL n 
1 31  MET n 
1 32  LYS n 
1 33  LYS n 
1 34  CYS n 
1 35  SER n 
1 36  ASN n 
1 37  THR n 
1 38  SER n 
1 39  TYR n 
1 40  GLN n 
1 41  PHE n 
1 42  ALA n 
1 43  ALA n 
1 44  VAL n 
1 45  GLN n 
1 46  PHE n 
1 47  SER n 
1 48  THR n 
1 49  SER n 
1 50  TYR n 
1 51  LYS n 
1 52  THR n 
1 53  GLU n 
1 54  PHE n 
1 55  ASP n 
1 56  PHE n 
1 57  SER n 
1 58  ASP n 
1 59  TYR n 
1 60  VAL n 
1 61  LYS n 
1 62  TRP n 
1 63  LYS n 
1 64  ASP n 
1 65  PRO n 
1 66  ASP n 
1 67  ALA n 
1 68  LEU n 
1 69  LEU n 
1 70  LYS n 
1 71  HIS n 
1 72  VAL n 
1 73  LYS n 
1 74  HIS n 
1 75  MET n 
1 76  LEU n 
1 77  LEU n 
1 78  LEU n 
1 79  THR n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  GLY n 
1 84  ALA n 
1 85  ILE n 
1 86  ASN n 
1 87  TYR n 
1 88  VAL n 
1 89  ALA n 
1 90  THR n 
1 91  GLU n 
1 92  VAL n 
1 93  PHE n 
1 94  ARG n 
1 95  GLU n 
1 96  GLU n 
1 97  LEU n 
1 98  GLY n 
1 99  ALA n 
1 100 ARG n 
1 101 PRO n 
1 102 ASP n 
1 103 ALA n 
1 104 THR n 
1 105 LYS n 
1 106 VAL n 
1 107 LEU n 
1 108 ILE n 
1 109 ILE n 
1 110 ILE n 
1 111 THR n 
1 112 ASP n 
1 113 GLY n 
1 114 GLU n 
1 115 ALA n 
1 116 THR n 
1 117 ASP n 
1 118 SER n 
1 119 GLY n 
1 120 ASN n 
1 121 ILE n 
1 122 ASP n 
1 123 ALA n 
1 124 ALA n 
1 125 LYS n 
1 126 ASP n 
1 127 ILE n 
1 128 ILE n 
1 129 ARG n 
1 130 TYR n 
1 131 ILE n 
1 132 ILE n 
1 133 GLY n 
1 134 ILE n 
1 135 GLY n 
1 136 LYS n 
1 137 HIS n 
1 138 PHE n 
1 139 GLN n 
1 140 THR n 
1 141 LYS n 
1 142 GLU n 
1 143 SER n 
1 144 GLN n 
1 145 GLU n 
1 146 THR n 
1 147 LEU n 
1 148 HIS n 
1 149 LYS n 
1 150 PHE n 
1 151 ALA n 
1 152 SER n 
1 153 LYS n 
1 154 PRO n 
1 155 ALA n 
1 156 SER n 
1 157 GLU n 
1 158 PHE n 
1 159 VAL n 
1 160 LYS n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 THR n 
1 165 PHE n 
1 166 GLU n 
1 167 LYS n 
1 168 LEU n 
1 169 LYS n 
1 170 ASP n 
1 171 LEU n 
1 172 CYS n 
1 173 THR n 
1 174 GLU n 
1 175 LEU n 
1 176 GLN n 
1 177 LYS n 
1 178 LYS n 
1 179 ILE n 
1 180 TYR n 
2 1   GLU n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   LEU n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   GLY n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  GLN n 
2 14  PRO n 
2 15  GLY n 
2 16  GLY n 
2 17  SER n 
2 18  LEU n 
2 19  ARG n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  ALA n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  THR n 
2 29  PHE n 
2 30  SER n 
2 31  ARG n 
2 32  TYR n 
2 33  VAL n 
2 34  MET n 
2 35  TRP n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  VAL n 
2 49  SER n 
2 50  TYR n 
2 51  ILE n 
2 52  TRP n 
2 53  PRO n 
2 54  SER n 
2 55  GLY n 
2 56  GLY n 
2 57  ASN n 
2 58  THR n 
2 59  TYR n 
2 60  TYR n 
2 61  ALA n 
2 62  ASP n 
2 63  SER n 
2 64  VAL n 
2 65  LYS n 
2 66  GLY n 
2 67  ARG n 
2 68  PHE n 
2 69  THR n 
2 70  ILE n 
2 71  SER n 
2 72  ARG n 
2 73  ASP n 
2 74  ASN n 
2 75  SER n 
2 76  LYS n 
2 77  ASN n 
2 78  THR n 
2 79  LEU n 
2 80  TYR n 
2 81  LEU n 
2 82  GLN n 
2 83  MET n 
2 84  ASN n 
2 85  SER n 
2 86  LEU n 
2 87  ARG n 
2 88  ALA n 
2 89  GLU n 
2 90  ASP n 
2 91  THR n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  ALA n 
2 98  SER n 
2 99  SER n 
2 100 TYR n 
2 101 ASP n 
2 102 PHE n 
2 103 TRP n 
2 104 SER n 
2 105 ASN n 
2 106 ALA n 
2 107 PHE n 
2 108 ASP n 
2 109 ILE n 
2 110 TRP n 
2 111 GLY n 
2 112 GLN n 
2 113 GLY n 
2 114 THR n 
2 115 MET n 
2 116 VAL n 
2 117 THR n 
2 118 VAL n 
2 119 SER n 
2 120 SER n 
2 121 ALA n 
2 122 SER n 
2 123 THR n 
2 124 LYS n 
2 125 GLY n 
2 126 PRO n 
2 127 SER n 
2 128 VAL n 
2 129 PHE n 
2 130 PRO n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 CYS n 
2 135 SER n 
2 136 ARG n 
2 137 SER n 
2 138 THR n 
2 139 SER n 
2 140 GLU n 
2 141 SER n 
2 142 THR n 
2 143 ALA n 
2 144 ALA n 
2 145 LEU n 
2 146 GLY n 
2 147 CYS n 
2 148 LEU n 
2 149 VAL n 
2 150 LYS n 
2 151 ASP n 
2 152 TYR n 
2 153 PHE n 
2 154 PRO n 
2 155 GLU n 
2 156 PRO n 
2 157 VAL n 
2 158 THR n 
2 159 VAL n 
2 160 SER n 
2 161 TRP n 
2 162 ASN n 
2 163 SER n 
2 164 GLY n 
2 165 ALA n 
2 166 LEU n 
2 167 THR n 
2 168 SER n 
2 169 GLY n 
2 170 VAL n 
2 171 HIS n 
2 172 THR n 
2 173 PHE n 
2 174 PRO n 
2 175 ALA n 
2 176 VAL n 
2 177 LEU n 
2 178 GLN n 
2 179 SER n 
2 180 SER n 
2 181 GLY n 
2 182 LEU n 
2 183 TYR n 
2 184 SER n 
2 185 LEU n 
2 186 SER n 
2 187 SER n 
2 188 VAL n 
2 189 VAL n 
2 190 THR n 
2 191 VAL n 
2 192 PRO n 
2 193 SER n 
2 194 SER n 
2 195 SER n 
2 196 LEU n 
2 197 GLY n 
2 198 THR n 
2 199 LYS n 
2 200 THR n 
2 201 TYR n 
2 202 THR n 
2 203 CYS n 
2 204 ASN n 
2 205 VAL n 
2 206 ASP n 
2 207 HIS n 
2 208 LYS n 
2 209 PRO n 
2 210 SER n 
2 211 ASN n 
2 212 THR n 
2 213 LYS n 
2 214 VAL n 
2 215 ASP n 
2 216 LYS n 
2 217 ARG n 
2 218 VAL n 
2 219 GLU n 
2 220 SER n 
3 1   GLN n 
3 2   ASP n 
3 3   ILE n 
3 4   GLN n 
3 5   MET n 
3 6   THR n 
3 7   GLN n 
3 8   SER n 
3 9   PRO n 
3 10  SER n 
3 11  SER n 
3 12  LEU n 
3 13  SER n 
3 14  ALA n 
3 15  SER n 
3 16  VAL n 
3 17  GLY n 
3 18  ASP n 
3 19  ARG n 
3 20  VAL n 
3 21  THR n 
3 22  ILE n 
3 23  THR n 
3 24  CYS n 
3 25  ARG n 
3 26  ALA n 
3 27  SER n 
3 28  GLN n 
3 29  SER n 
3 30  ILE n 
3 31  GLY n 
3 32  SER n 
3 33  TYR n 
3 34  LEU n 
3 35  ASN n 
3 36  TRP n 
3 37  TYR n 
3 38  GLN n 
3 39  GLN n 
3 40  LYS n 
3 41  THR n 
3 42  GLY n 
3 43  LYS n 
3 44  ALA n 
3 45  PRO n 
3 46  LYS n 
3 47  ALA n 
3 48  LEU n 
3 49  ILE n 
3 50  TYR n 
3 51  ALA n 
3 52  ALA n 
3 53  SER n 
3 54  SER n 
3 55  LEU n 
3 56  GLN n 
3 57  SER n 
3 58  GLY n 
3 59  VAL n 
3 60  PRO n 
3 61  SER n 
3 62  ARG n 
3 63  PHE n 
3 64  SER n 
3 65  GLY n 
3 66  SER n 
3 67  GLY n 
3 68  SER n 
3 69  GLY n 
3 70  THR n 
3 71  ASP n 
3 72  PHE n 
3 73  THR n 
3 74  LEU n 
3 75  THR n 
3 76  ILE n 
3 77  SER n 
3 78  SER n 
3 79  LEU n 
3 80  GLN n 
3 81  LEU n 
3 82  GLU n 
3 83  ASP n 
3 84  PHE n 
3 85  ALA n 
3 86  THR n 
3 87  TYR n 
3 88  TYR n 
3 89  CYS n 
3 90  GLN n 
3 91  GLN n 
3 92  SER n 
3 93  TYR n 
3 94  SER n 
3 95  THR n 
3 96  PRO n 
3 97  SER n 
3 98  PHE n 
3 99  GLY n 
3 100 GLN n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 VAL n 
3 105 GLU n 
3 106 ILE n 
3 107 LYS n 
3 108 ARG n 
3 109 THR n 
3 110 VAL n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 SER n 
3 115 VAL n 
3 116 PHE n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 ASP n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 LYS n 
3 127 SER n 
3 128 GLY n 
3 129 THR n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 LEU n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 ARG n 
3 143 GLU n 
3 144 ALA n 
3 145 LYS n 
3 146 VAL n 
3 147 GLN n 
3 148 TRP n 
3 149 LYS n 
3 150 VAL n 
3 151 ASP n 
3 152 ASN n 
3 153 ALA n 
3 154 LEU n 
3 155 GLN n 
3 156 SER n 
3 157 GLY n 
3 158 ASN n 
3 159 SER n 
3 160 GLN n 
3 161 GLU n 
3 162 SER n 
3 163 VAL n 
3 164 THR n 
3 165 GLU n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 LEU n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 SER n 
3 183 LYS n 
3 184 ALA n 
3 185 ASP n 
3 186 TYR n 
3 187 GLU n 
3 188 LYS n 
3 189 HIS n 
3 190 LYS n 
3 191 VAL n 
3 192 TYR n 
3 193 ALA n 
3 194 CYS n 
3 195 GLU n 
3 196 VAL n 
3 197 THR n 
3 198 HIS n 
3 199 GLN n 
3 200 GLY n 
3 201 LEU n 
3 202 SER n 
3 203 SER n 
3 204 PRO n 
3 205 VAL n 
3 206 THR n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'CD11A, ITGAL, LFA-1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ?                 'Escherichia coli' 
562   ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? plasmid ? ? ? PET22 ? ? 
2 1 sample ? ? ? human ? ?                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 
'Cricetulus griseus' 10029 ? ? ? ? ? ? ?           ? ? ? ? ? ? ? ?       ? ? ? ?     ? ? 
3 1 sample ? ? ? human ? ?                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 
'Cricetulus griseus' 10029 ? ? ? ? ? ? ?           ? ? ? ? ? ? ? ?       ? ? ? ?     ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ITAL_HUMAN P20701 1 
;GNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTN
TFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVK
ILDTFEKLKDLFTELQKKIY
;
153 ? 
2 PDB 3HI6       3HI6   2 
;EVQLLESGGGLVQPGGSLRLSCAASGFTFSRYVMWWVRQAPGKGLEWVSYIWPSGGNTYYADSVKGRFTISRDNSKNTLY
LQMNSLRAEDTAVYYCASSYDFWSNAFDIWGQGTMVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
;
?   ? 
3 PDB 3HI6       3HI6   3 
;QDIQMTQSPSSLSASVGDRVTITCRASQSIGSYLNWYQQKTGKAPKALIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQ
LEDFATYYCQQSYSTPSFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG
;
?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HI6 A 1 ? 180 ? P20701 153 ? 332 ? 128 307 
2 1 3HI6 B 1 ? 180 ? P20701 153 ? 332 ? 128 307 
3 2 3HI6 H 1 ? 220 ? 3HI6   1   ? 220 ? 1   220 
4 2 3HI6 X 1 ? 220 ? 3HI6   1   ? 220 ? 1   220 
5 3 3HI6 L 1 ? 212 ? 3HI6   0   ? 211 ? 0   211 
6 3 3HI6 Y 1 ? 212 ? 3HI6   0   ? 211 ? 0   211 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3HI6 CYS A 34  ? UNP P20701 LEU 186 'engineered mutation' 161 1 
1 3HI6 TRP A 62  ? UNP P20701 ARG 214 variant               189 2 
1 3HI6 CYS A 172 ? UNP P20701 PHE 324 'engineered mutation' 299 3 
2 3HI6 CYS B 34  ? UNP P20701 LEU 186 'engineered mutation' 161 4 
2 3HI6 TRP B 62  ? UNP P20701 ARG 214 variant               189 5 
2 3HI6 CYS B 172 ? UNP P20701 PHE 324 'engineered mutation' 299 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3HI6 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.09 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.18 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    '2M (NH4)2SO4, 0.1M NaAc, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2007-06-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793688 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength_list        0.9793688 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     3HI6 
_reflns.d_resolution_high            2.300 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   70437 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_netI_over_sigmaI        10.500 
_reflns.pdbx_chi_squared             1.151 
_reflns.pdbx_redundancy              7.400 
_reflns.percent_possible_obs         97.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.30 2.35  ? ? ? 0.474 ? ? 1.031 4.90 ? 3786 78.80  ? 1  
2.35 2.41  ? ? ? 0.480 ? ? 1.032 5.30 ? 4247 89.60  ? 2  
2.41 2.48  ? ? ? 0.453 ? ? 1.031 6.10 ? 4718 98.40  ? 3  
2.48 2.55  ? ? ? 0.432 ? ? 1.033 7.30 ? 4789 99.90  ? 4  
2.55 2.63  ? ? ? 0.364 ? ? 1.047 7.80 ? 4783 100.00 ? 5  
2.63 2.73  ? ? ? 0.299 ? ? 1.082 8.00 ? 4810 100.00 ? 6  
2.73 2.84  ? ? ? 0.234 ? ? 1.092 8.00 ? 4789 100.00 ? 7  
2.84 2.97  ? ? ? 0.164 ? ? 1.096 8.00 ? 4801 100.00 ? 8  
2.97 3.12  ? ? ? 0.123 ? ? 1.107 8.00 ? 4795 100.00 ? 9  
3.12 3.32  ? ? ? 0.089 ? ? 1.171 8.00 ? 4803 100.00 ? 10 
3.32 3.57  ? ? ? 0.072 ? ? 1.301 7.90 ? 4780 100.00 ? 11 
3.57 3.93  ? ? ? 0.074 ? ? 1.370 7.90 ? 4824 100.00 ? 12 
3.93 4.50  ? ? ? 0.061 ? ? 1.362 7.70 ? 4792 100.00 ? 13 
4.50 5.67  ? ? ? 0.047 ? ? 1.238 7.60 ? 4834 100.00 ? 14 
5.67 50.00 ? ? ? 0.034 ? ? 1.118 7.80 ? 4886 99.80  ? 15 
# 
_refine.entry_id                                 3HI6 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    94.480 
_refine.ls_number_reflns_obs                     67977 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.173 
_refine.ls_R_factor_R_work                       0.170 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  3449 
_refine.B_iso_mean                               18.028 
_refine.aniso_B[1][1]                            0.100 
_refine.aniso_B[2][2]                            0.100 
_refine.aniso_B[3][3]                            -0.140 
_refine.aniso_B[1][2]                            0.050 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.pdbx_overall_ESU_R                       0.263 
_refine.pdbx_overall_ESU_R_Free                  0.213 
_refine.overall_SU_ML                            0.148 
_refine.overall_SU_B                             11.537 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9365 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             700 
_refine_hist.number_atoms_total               10097 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       9612  0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         6422  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    13048 1.142  1.953  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      15697 0.807  3.003  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 1203  6.463  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 393   33.834 24.529 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 1600  14.058 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 32    15.029 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         1459  0.066  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   10640 0.004  0.021  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     1932  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            6014  1.108  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         2445  0.208  3.000  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           9723  1.840  5.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            3598  1.292  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           3324  1.948  5.000  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.364 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               34.500 
_refine_ls_shell.number_reflns_R_work             1716 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.215 
_refine_ls_shell.R_factor_R_free                  0.277 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             103 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1819 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HI6 
_struct.title                     
'Crystal structure of intermediate affinity I domain of integrin LFA-1 with the Fab fragment of its antibody AL-57' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HI6 
_struct_keywords.text            
;integrin, I domain, Fab, ligand mimetic antibody, cell adhesion, Alternative splicing, Calcium, Disulfide bond, Glycoprotein, Magnesium, Membrane, Polymorphism, Receptor, Transmembrane, cell adhesion-immune system COMPLEX
;
_struct_keywords.pdbx_keywords   'cell adhesion/immune system' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 16  ? CYS A 34  ? GLN A 143 CYS A 161 1 ? 19 
HELX_P HELX_P2  2  ASP A 55  ? LYS A 63  ? ASP A 182 LYS A 190 1 ? 9  
HELX_P HELX_P3  3  ASP A 64  ? LYS A 70  ? ASP A 191 LYS A 197 1 ? 7  
HELX_P HELX_P4  4  ASN A 80  ? VAL A 92  ? ASN A 207 VAL A 219 1 ? 13 
HELX_P HELX_P5  5  ARG A 94  ? GLY A 98  ? ARG A 221 GLY A 225 5 ? 5  
HELX_P HELX_P6  6  ILE A 121 ? LYS A 125 ? ILE A 248 LYS A 252 5 ? 5  
HELX_P HELX_P7  7  SER A 143 ? ALA A 151 ? SER A 270 ALA A 278 1 ? 9  
HELX_P HELX_P8  8  PRO A 154 ? GLU A 157 ? PRO A 281 GLU A 284 5 ? 4  
HELX_P HELX_P9  9  LEU A 162 ? GLU A 166 ? LEU A 289 GLU A 293 1 ? 5  
HELX_P HELX_P10 10 LYS A 167 ? LYS A 169 ? LYS A 294 LYS A 296 5 ? 3  
HELX_P HELX_P11 11 ASP A 170 ? LYS A 177 ? ASP A 297 LYS A 304 1 ? 8  
HELX_P HELX_P12 12 GLN B 16  ? CYS B 34  ? GLN B 143 CYS B 161 1 ? 19 
HELX_P HELX_P13 13 ASP B 55  ? LYS B 63  ? ASP B 182 LYS B 190 1 ? 9  
HELX_P HELX_P14 14 ASP B 64  ? LYS B 70  ? ASP B 191 LYS B 197 1 ? 7  
HELX_P HELX_P15 15 ASN B 80  ? VAL B 92  ? ASN B 207 VAL B 219 1 ? 13 
HELX_P HELX_P16 16 ILE B 121 ? LYS B 125 ? ILE B 248 LYS B 252 5 ? 5  
HELX_P HELX_P17 17 THR B 140 ? ALA B 151 ? THR B 267 ALA B 278 1 ? 12 
HELX_P HELX_P18 18 PRO B 154 ? GLU B 157 ? PRO B 281 GLU B 284 5 ? 4  
HELX_P HELX_P19 19 LEU B 162 ? GLU B 166 ? LEU B 289 GLU B 293 1 ? 5  
HELX_P HELX_P20 20 ASP B 170 ? GLN B 176 ? ASP B 297 GLN B 303 1 ? 7  
HELX_P HELX_P21 21 THR C 28  ? TYR C 32  ? THR H 28  TYR H 32  5 ? 5  
HELX_P HELX_P22 22 ASP C 62  ? LYS C 65  ? ASP H 62  LYS H 65  5 ? 4  
HELX_P HELX_P23 23 ARG C 87  ? THR C 91  ? ARG H 87  THR H 91  5 ? 5  
HELX_P HELX_P24 24 SER C 163 ? ALA C 165 ? SER H 163 ALA H 165 5 ? 3  
HELX_P HELX_P25 25 SER C 194 ? THR C 198 ? SER H 194 THR H 198 5 ? 5  
HELX_P HELX_P26 26 LYS C 208 ? ASN C 211 ? LYS H 208 ASN H 211 5 ? 4  
HELX_P HELX_P27 27 GLN D 80  ? PHE D 84  ? GLN L 79  PHE L 83  5 ? 5  
HELX_P HELX_P28 28 GLU D 123 ? SER D 127 ? GLU L 122 SER L 126 5 ? 5  
HELX_P HELX_P29 29 LYS D 183 ? HIS D 189 ? LYS L 182 HIS L 188 1 ? 7  
HELX_P HELX_P30 30 THR E 28  ? TYR E 32  ? THR X 28  TYR X 32  5 ? 5  
HELX_P HELX_P31 31 ARG E 87  ? THR E 91  ? ARG X 87  THR X 91  5 ? 5  
HELX_P HELX_P32 32 SER E 163 ? ALA E 165 ? SER X 163 ALA X 165 5 ? 3  
HELX_P HELX_P33 33 SER E 194 ? LEU E 196 ? SER X 194 LEU X 196 5 ? 3  
HELX_P HELX_P34 34 LYS E 208 ? ASN E 211 ? LYS X 208 ASN X 211 5 ? 4  
HELX_P HELX_P35 35 GLN F 80  ? PHE F 84  ? GLN Y 79  PHE Y 83  5 ? 5  
HELX_P HELX_P36 36 SER F 121 ? SER F 127 ? SER Y 120 SER Y 126 1 ? 7  
HELX_P HELX_P37 37 LYS F 183 ? LYS F 188 ? LYS Y 182 LYS Y 187 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 34  SG ? ? ? 1_555 A CYS 172 SG  ? ? A CYS 161 A CYS 299 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf2  disulf ? ? B CYS 34  SG ? ? ? 1_555 B CYS 172 SG  ? ? B CYS 161 B CYS 299 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
disulf3  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG  ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf4  disulf ? ? C CYS 147 SG ? ? ? 1_555 C CYS 203 SG  ? ? H CYS 147 H CYS 203 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf5  disulf ? ? D CYS 24  SG ? ? ? 1_555 D CYS 89  SG  ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.092 ? ? 
disulf6  disulf ? ? D CYS 134 SG ? ? ? 1_555 D CYS 194 SG  ? ? L CYS 133 L CYS 193 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
disulf7  disulf ? ? E CYS 22  SG ? ? ? 1_555 E CYS 96  SG  ? ? X CYS 22  X CYS 96  1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf8  disulf ? ? E CYS 147 SG ? ? ? 1_555 E CYS 203 SG  ? ? X CYS 147 X CYS 203 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf9  disulf ? ? F CYS 24  SG ? ? ? 1_555 F CYS 89  SG  ? ? Y CYS 23  Y CYS 88  1_555 ? ? ? ? ? ? ? 2.078 ? ? 
disulf10 disulf ? ? F CYS 134 SG ? ? ? 1_555 F CYS 194 SG  ? ? Y CYS 133 Y CYS 193 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
metalc1  metalc ? ? G MN  .   MN ? ? ? 1_555 O HOH .   O   ? ? A MN  1   A HOH 4   1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc2  metalc ? ? G MN  .   MN ? ? ? 1_555 A SER 12  OG  ? ? A MN  1   A SER 139 1_555 ? ? ? ? ? ? ? 2.067 ? ? 
metalc3  metalc ? ? G MN  .   MN ? ? ? 1_555 A SER 14  OG  ? ? A MN  1   A SER 141 1_555 ? ? ? ? ? ? ? 2.167 ? ? 
metalc4  metalc ? ? G MN  .   MN ? ? ? 1_555 A THR 79  OG1 ? ? A MN  1   A THR 206 1_555 ? ? ? ? ? ? ? 2.197 ? ? 
metalc5  metalc ? ? G MN  .   MN ? ? ? 1_555 C ASP 101 OD2 ? ? A MN  1   H ASP 101 1_555 ? ? ? ? ? ? ? 2.114 ? ? 
metalc6  metalc ? ? G MN  .   MN ? ? ? 1_555 Q HOH .   O   ? ? A MN  1   H HOH 223 1_555 ? ? ? ? ? ? ? 2.123 ? ? 
metalc7  metalc ? ? P HOH .   O  ? ? ? 1_555 H MN  .   MN  ? ? B HOH 1   B MN  2   1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc8  metalc ? ? H MN  .   MN ? ? ? 1_555 B SER 12  OG  ? ? B MN  2   B SER 139 1_555 ? ? ? ? ? ? ? 2.213 ? ? 
metalc9  metalc ? ? H MN  .   MN ? ? ? 1_555 B SER 14  OG  ? ? B MN  2   B SER 141 1_555 ? ? ? ? ? ? ? 2.186 ? ? 
metalc10 metalc ? ? H MN  .   MN ? ? ? 1_555 B THR 79  OG1 ? ? B MN  2   B THR 206 1_555 ? ? ? ? ? ? ? 2.169 ? ? 
metalc11 metalc ? ? H MN  .   MN ? ? ? 1_555 E ASP 101 OD2 ? ? B MN  2   X ASP 101 1_555 ? ? ? ? ? ? ? 2.103 ? ? 
metalc12 metalc ? ? H MN  .   MN ? ? ? 1_555 S HOH .   O   ? ? B MN  2   X HOH 222 1_555 ? ? ? ? ? ? ? 2.213 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LYS 153 A . ? LYS 280 A PRO 154 A ? PRO 281 A 1 -5.85 
2  LYS 153 B . ? LYS 280 B PRO 154 B ? PRO 281 B 1 4.50  
3  PHE 153 C . ? PHE 153 H PRO 154 C ? PRO 154 H 1 -8.82 
4  GLU 155 C . ? GLU 155 H PRO 156 C ? PRO 156 H 1 2.05  
5  SER 8   D . ? SER 7   L PRO 9   D ? PRO 8   L 1 -6.48 
6  TYR 140 D . ? TYR 139 L PRO 141 D ? PRO 140 L 1 0.63  
7  PHE 153 E . ? PHE 153 X PRO 154 E ? PRO 154 X 1 -8.49 
8  GLU 155 E . ? GLU 155 X PRO 156 E ? PRO 156 X 1 -3.82 
9  SER 8   F . ? SER 7   Y PRO 9   F ? PRO 8   Y 1 -6.08 
10 TYR 140 F . ? TYR 139 Y PRO 141 F ? PRO 140 Y 1 1.15  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 4 ? 
D ? 6 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 3 ? 
I ? 4 ? 
J ? 6 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 4 ? 
O ? 6 ? 
P ? 4 ? 
Q ? 4 ? 
R ? 4 ? 
S ? 3 ? 
T ? 4 ? 
U ? 6 ? 
V ? 4 ? 
W ? 4 ? 
X ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
K 1 2 ? parallel      
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
P 1 2 ? parallel      
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? parallel      
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
U 4 5 ? anti-parallel 
U 5 6 ? anti-parallel 
V 1 2 ? parallel      
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? anti-parallel 
X 2 3 ? anti-parallel 
X 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 50  ? PHE A 54  ? TYR A 177 PHE A 181 
A 2 TYR A 39  ? PHE A 46  ? TYR A 166 PHE A 173 
A 3 VAL A 3   ? ASP A 10  ? VAL A 130 ASP A 137 
A 4 THR A 104 ? THR A 111 ? THR A 231 THR A 238 
A 5 ILE A 128 ? GLY A 133 ? ILE A 255 GLY A 260 
A 6 VAL A 159 ? ILE A 161 ? VAL A 286 ILE A 288 
B 1 TYR B 50  ? PHE B 54  ? TYR B 177 PHE B 181 
B 2 TYR B 39  ? PHE B 46  ? TYR B 166 PHE B 173 
B 3 VAL B 3   ? ASP B 10  ? VAL B 130 ASP B 137 
B 4 THR B 104 ? THR B 111 ? THR B 231 THR B 238 
B 5 ILE B 128 ? GLY B 133 ? ILE B 255 GLY B 260 
B 6 VAL B 159 ? ILE B 161 ? VAL B 286 ILE B 288 
C 1 GLN C 3   ? SER C 7   ? GLN H 3   SER H 7   
C 2 LEU C 18  ? SER C 25  ? LEU H 18  SER H 25  
C 3 THR C 78  ? MET C 83  ? THR H 78  MET H 83  
C 4 PHE C 68  ? ASP C 73  ? PHE H 68  ASP H 73  
D 1 GLY C 10  ? VAL C 12  ? GLY H 10  VAL H 12  
D 2 THR C 114 ? VAL C 118 ? THR H 114 VAL H 118 
D 3 ALA C 92  ? SER C 99  ? ALA H 92  SER H 99  
D 4 MET C 34  ? GLN C 39  ? MET H 34  GLN H 39  
D 5 LEU C 45  ? ILE C 51  ? LEU H 45  ILE H 51  
D 6 THR C 58  ? TYR C 60  ? THR H 58  TYR H 60  
E 1 GLY C 10  ? VAL C 12  ? GLY H 10  VAL H 12  
E 2 THR C 114 ? VAL C 118 ? THR H 114 VAL H 118 
E 3 ALA C 92  ? SER C 99  ? ALA H 92  SER H 99  
E 4 PHE C 107 ? TRP C 110 ? PHE H 107 TRP H 110 
F 1 SER C 127 ? LEU C 131 ? SER H 127 LEU H 131 
F 2 THR C 142 ? TYR C 152 ? THR H 142 TYR H 152 
F 3 TYR C 183 ? PRO C 192 ? TYR H 183 PRO H 192 
F 4 VAL C 170 ? THR C 172 ? VAL H 170 THR H 172 
G 1 SER C 127 ? LEU C 131 ? SER H 127 LEU H 131 
G 2 THR C 142 ? TYR C 152 ? THR H 142 TYR H 152 
G 3 TYR C 183 ? PRO C 192 ? TYR H 183 PRO H 192 
G 4 VAL C 176 ? LEU C 177 ? VAL H 176 LEU H 177 
H 1 THR C 158 ? TRP C 161 ? THR H 158 TRP H 161 
H 2 TYR C 201 ? HIS C 207 ? TYR H 201 HIS H 207 
H 3 THR C 212 ? VAL C 218 ? THR H 212 VAL H 218 
I 1 MET D 5   ? SER D 8   ? MET L 4   SER L 7   
I 2 VAL D 20  ? ALA D 26  ? VAL L 19  ALA L 25  
I 3 ASP D 71  ? ILE D 76  ? ASP L 70  ILE L 75  
I 4 PHE D 63  ? SER D 68  ? PHE L 62  SER L 67  
J 1 SER D 11  ? ALA D 14  ? SER L 10  ALA L 13  
J 2 THR D 102 ? ILE D 106 ? THR L 101 ILE L 105 
J 3 THR D 86  ? GLN D 91  ? THR L 85  GLN L 90  
J 4 LEU D 34  ? GLN D 39  ? LEU L 33  GLN L 38  
J 5 LYS D 46  ? TYR D 50  ? LYS L 45  TYR L 49  
J 6 SER D 54  ? LEU D 55  ? SER L 53  LEU L 54  
K 1 SER D 11  ? ALA D 14  ? SER L 10  ALA L 13  
K 2 THR D 102 ? ILE D 106 ? THR L 101 ILE L 105 
K 3 THR D 86  ? GLN D 91  ? THR L 85  GLN L 90  
K 4 SER D 97  ? PHE D 98  ? SER L 96  PHE L 97  
L 1 SER D 114 ? PHE D 118 ? SER L 113 PHE L 117 
L 2 THR D 129 ? PHE D 139 ? THR L 128 PHE L 138 
L 3 TYR D 173 ? SER D 182 ? TYR L 172 SER L 181 
L 4 SER D 159 ? VAL D 163 ? SER L 158 VAL L 162 
M 1 ALA D 153 ? LEU D 154 ? ALA L 152 LEU L 153 
M 2 LYS D 145 ? VAL D 150 ? LYS L 144 VAL L 149 
M 3 VAL D 191 ? THR D 197 ? VAL L 190 THR L 196 
M 4 VAL D 205 ? ASN D 210 ? VAL L 204 ASN L 209 
N 1 GLN E 3   ? SER E 7   ? GLN X 3   SER X 7   
N 2 LEU E 18  ? SER E 25  ? LEU X 18  SER X 25  
N 3 THR E 78  ? MET E 83  ? THR X 78  MET X 83  
N 4 PHE E 68  ? ASP E 73  ? PHE X 68  ASP X 73  
O 1 LEU E 11  ? VAL E 12  ? LEU X 11  VAL X 12  
O 2 THR E 114 ? VAL E 118 ? THR X 114 VAL X 118 
O 3 ALA E 92  ? SER E 99  ? ALA X 92  SER X 99  
O 4 MET E 34  ? GLN E 39  ? MET X 34  GLN X 39  
O 5 LEU E 45  ? ILE E 51  ? LEU X 45  ILE X 51  
O 6 THR E 58  ? TYR E 60  ? THR X 58  TYR X 60  
P 1 LEU E 11  ? VAL E 12  ? LEU X 11  VAL X 12  
P 2 THR E 114 ? VAL E 118 ? THR X 114 VAL X 118 
P 3 ALA E 92  ? SER E 99  ? ALA X 92  SER X 99  
P 4 PHE E 107 ? TRP E 110 ? PHE X 107 TRP X 110 
Q 1 SER E 127 ? LEU E 131 ? SER X 127 LEU X 131 
Q 2 THR E 142 ? TYR E 152 ? THR X 142 TYR X 152 
Q 3 TYR E 183 ? PRO E 192 ? TYR X 183 PRO X 192 
Q 4 VAL E 170 ? THR E 172 ? VAL X 170 THR X 172 
R 1 SER E 127 ? LEU E 131 ? SER X 127 LEU X 131 
R 2 THR E 142 ? TYR E 152 ? THR X 142 TYR X 152 
R 3 TYR E 183 ? PRO E 192 ? TYR X 183 PRO X 192 
R 4 VAL E 176 ? LEU E 177 ? VAL X 176 LEU X 177 
S 1 THR E 158 ? TRP E 161 ? THR X 158 TRP X 161 
S 2 THR E 202 ? HIS E 207 ? THR X 202 HIS X 207 
S 3 THR E 212 ? ARG E 217 ? THR X 212 ARG X 217 
T 1 MET F 5   ? SER F 8   ? MET Y 4   SER Y 7   
T 2 VAL F 20  ? ALA F 26  ? VAL Y 19  ALA Y 25  
T 3 ASP F 71  ? ILE F 76  ? ASP Y 70  ILE Y 75  
T 4 PHE F 63  ? SER F 68  ? PHE Y 62  SER Y 67  
U 1 SER F 11  ? SER F 15  ? SER Y 10  SER Y 14  
U 2 THR F 102 ? LYS F 107 ? THR Y 101 LYS Y 106 
U 3 ALA F 85  ? GLN F 91  ? ALA Y 84  GLN Y 90  
U 4 LEU F 34  ? GLN F 39  ? LEU Y 33  GLN Y 38  
U 5 LYS F 46  ? TYR F 50  ? LYS Y 45  TYR Y 49  
U 6 SER F 54  ? LEU F 55  ? SER Y 53  LEU Y 54  
V 1 SER F 11  ? SER F 15  ? SER Y 10  SER Y 14  
V 2 THR F 102 ? LYS F 107 ? THR Y 101 LYS Y 106 
V 3 ALA F 85  ? GLN F 91  ? ALA Y 84  GLN Y 90  
V 4 SER F 97  ? PHE F 98  ? SER Y 96  PHE Y 97  
W 1 SER F 114 ? PHE F 118 ? SER Y 113 PHE Y 117 
W 2 THR F 129 ? PHE F 139 ? THR Y 128 PHE Y 138 
W 3 TYR F 173 ? SER F 182 ? TYR Y 172 SER Y 181 
W 4 SER F 159 ? VAL F 163 ? SER Y 158 VAL Y 162 
X 1 ALA F 153 ? LEU F 154 ? ALA Y 152 LEU Y 153 
X 2 LYS F 145 ? VAL F 150 ? LYS Y 144 VAL Y 149 
X 3 VAL F 191 ? THR F 197 ? VAL Y 190 THR Y 196 
X 4 VAL F 205 ? ASN F 210 ? VAL Y 204 ASN Y 209 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 51  ? O LYS A 178 N GLN A 45  ? N GLN A 172 
A 2 3 O VAL A 44  ? O VAL A 171 N PHE A 7   ? N PHE A 134 
A 3 4 N VAL A 6   ? N VAL A 133 O ILE A 108 ? O ILE A 235 
A 4 5 N ILE A 109 ? N ILE A 236 O ILE A 132 ? O ILE A 259 
A 5 6 N ILE A 131 ? N ILE A 258 O LYS A 160 ? O LYS A 287 
B 1 2 O LYS B 51  ? O LYS B 178 N GLN B 45  ? N GLN B 172 
B 2 3 O VAL B 44  ? O VAL B 171 N PHE B 7   ? N PHE B 134 
B 3 4 N VAL B 6   ? N VAL B 133 O ILE B 108 ? O ILE B 235 
B 4 5 N LEU B 107 ? N LEU B 234 O ILE B 128 ? O ILE B 255 
B 5 6 N ILE B 131 ? N ILE B 258 O LYS B 160 ? O LYS B 287 
C 1 2 N LEU C 5   ? N LEU H 5   O ALA C 23  ? O ALA H 23  
C 2 3 N LEU C 20  ? N LEU H 20  O LEU C 81  ? O LEU H 81  
C 3 4 O TYR C 80  ? O TYR H 80  N SER C 71  ? N SER H 71  
D 1 2 N VAL C 12  ? N VAL H 12  O THR C 117 ? O THR H 117 
D 2 3 O THR C 114 ? O THR H 114 N TYR C 94  ? N TYR H 94  
D 3 4 O TYR C 95  ? O TYR H 95  N VAL C 37  ? N VAL H 37  
D 4 5 N TRP C 36  ? N TRP H 36  O VAL C 48  ? O VAL H 48  
D 5 6 N TYR C 50  ? N TYR H 50  O TYR C 59  ? O TYR H 59  
E 1 2 N VAL C 12  ? N VAL H 12  O THR C 117 ? O THR H 117 
E 2 3 O THR C 114 ? O THR H 114 N TYR C 94  ? N TYR H 94  
E 3 4 N SER C 98  ? N SER H 98  O ASP C 108 ? O ASP H 108 
F 1 2 N PHE C 129 ? N PHE H 129 O LEU C 148 ? O LEU H 148 
F 2 3 N ALA C 143 ? N ALA H 143 O VAL C 191 ? O VAL H 191 
F 3 4 O VAL C 188 ? O VAL H 188 N HIS C 171 ? N HIS H 171 
G 1 2 N PHE C 129 ? N PHE H 129 O LEU C 148 ? O LEU H 148 
G 2 3 N ALA C 143 ? N ALA H 143 O VAL C 191 ? O VAL H 191 
G 3 4 O SER C 184 ? O SER H 184 N VAL C 176 ? N VAL H 176 
H 1 2 N THR C 158 ? N THR H 158 O ASP C 206 ? O ASP H 206 
H 2 3 N VAL C 205 ? N VAL H 205 O VAL C 214 ? O VAL H 214 
I 1 2 N THR D 6   ? N THR L 5   O ARG D 25  ? O ARG L 24  
I 2 3 N CYS D 24  ? N CYS L 23  O PHE D 72  ? O PHE L 71  
I 3 4 O THR D 75  ? O THR L 74  N SER D 64  ? N SER L 63  
J 1 2 N LEU D 12  ? N LEU L 11  O GLU D 105 ? O GLU L 104 
J 2 3 O THR D 102 ? O THR L 101 N TYR D 87  ? N TYR L 86  
J 3 4 O GLN D 90  ? O GLN L 89  N ASN D 35  ? N ASN L 34  
J 4 5 N GLN D 38  ? N GLN L 37  O LYS D 46  ? O LYS L 45  
J 5 6 N TYR D 50  ? N TYR L 49  O SER D 54  ? O SER L 53  
K 1 2 N LEU D 12  ? N LEU L 11  O GLU D 105 ? O GLU L 104 
K 2 3 O THR D 102 ? O THR L 101 N TYR D 87  ? N TYR L 86  
K 3 4 N GLN D 91  ? N GLN L 90  O SER D 97  ? O SER L 96  
L 1 2 N PHE D 116 ? N PHE L 115 O LEU D 135 ? O LEU L 134 
L 2 3 N LEU D 136 ? N LEU L 135 O LEU D 175 ? O LEU L 174 
L 3 4 O THR D 178 ? O THR L 177 N GLN D 160 ? N GLN L 159 
M 1 2 O ALA D 153 ? O ALA L 152 N VAL D 150 ? N VAL L 149 
M 2 3 N GLN D 147 ? N GLN L 146 O GLU D 195 ? O GLU L 194 
M 3 4 N VAL D 196 ? N VAL L 195 O VAL D 205 ? O VAL L 204 
N 1 2 N GLN E 3   ? N GLN X 3   O SER E 25  ? O SER X 25  
N 2 3 N LEU E 18  ? N LEU X 18  O MET E 83  ? O MET X 83  
N 3 4 O TYR E 80  ? O TYR X 80  N SER E 71  ? N SER X 71  
O 1 2 N VAL E 12  ? N VAL X 12  O THR E 117 ? O THR X 117 
O 2 3 O THR E 114 ? O THR X 114 N TYR E 94  ? N TYR X 94  
O 3 4 O TYR E 95  ? O TYR X 95  N VAL E 37  ? N VAL X 37  
O 4 5 N ARG E 38  ? N ARG X 38  O GLU E 46  ? O GLU X 46  
O 5 6 N TYR E 50  ? N TYR X 50  O TYR E 59  ? O TYR X 59  
P 1 2 N VAL E 12  ? N VAL X 12  O THR E 117 ? O THR X 117 
P 2 3 O THR E 114 ? O THR X 114 N TYR E 94  ? N TYR X 94  
P 3 4 N SER E 98  ? N SER X 98  O ASP E 108 ? O ASP X 108 
Q 1 2 N SER E 127 ? N SER X 127 O LYS E 150 ? O LYS X 150 
Q 2 3 N VAL E 149 ? N VAL X 149 O LEU E 185 ? O LEU X 185 
Q 3 4 O VAL E 188 ? O VAL X 188 N HIS E 171 ? N HIS X 171 
R 1 2 N SER E 127 ? N SER X 127 O LYS E 150 ? O LYS X 150 
R 2 3 N VAL E 149 ? N VAL X 149 O LEU E 185 ? O LEU X 185 
R 3 4 O SER E 184 ? O SER X 184 N VAL E 176 ? N VAL X 176 
S 1 2 N SER E 160 ? N SER X 160 O ASN E 204 ? O ASN X 204 
S 2 3 N HIS E 207 ? N HIS X 207 O THR E 212 ? O THR X 212 
T 1 2 N THR F 6   ? N THR Y 5   O ARG F 25  ? O ARG Y 24  
T 2 3 N VAL F 20  ? N VAL Y 19  O ILE F 76  ? O ILE Y 75  
T 3 4 O THR F 75  ? O THR Y 74  N SER F 64  ? N SER Y 63  
U 1 2 N LEU F 12  ? N LEU Y 11  O GLU F 105 ? O GLU Y 104 
U 2 3 O VAL F 104 ? O VAL Y 103 N ALA F 85  ? N ALA Y 84  
U 3 4 O THR F 86  ? O THR Y 85  N GLN F 39  ? N GLN Y 38  
U 4 5 N TRP F 36  ? N TRP Y 35  O LEU F 48  ? O LEU Y 47  
U 5 6 N TYR F 50  ? N TYR Y 49  O SER F 54  ? O SER Y 53  
V 1 2 N LEU F 12  ? N LEU Y 11  O GLU F 105 ? O GLU Y 104 
V 2 3 O VAL F 104 ? O VAL Y 103 N ALA F 85  ? N ALA Y 84  
V 3 4 N GLN F 91  ? N GLN Y 90  O SER F 97  ? O SER Y 96  
W 1 2 N PHE F 116 ? N PHE Y 115 O LEU F 135 ? O LEU Y 134 
W 2 3 N LEU F 136 ? N LEU Y 135 O LEU F 175 ? O LEU Y 174 
W 3 4 O THR F 178 ? O THR Y 177 N GLN F 160 ? N GLN Y 159 
X 1 2 O ALA F 153 ? O ALA Y 152 N VAL F 150 ? N VAL Y 149 
X 2 3 N GLN F 147 ? N GLN Y 146 O GLU F 195 ? O GLU Y 194 
X 3 4 N VAL F 196 ? N VAL Y 195 O VAL F 205 ? O VAL Y 204 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  1   ? 6 'BINDING SITE FOR RESIDUE MN A 1'    
AC2 Software B MN  2   ? 6 'BINDING SITE FOR RESIDUE MN B 2'    
AC3 Software B SO4 5   ? 6 'BINDING SITE FOR RESIDUE SO4 B 5'   
AC4 Software H SO4 221 ? 9 'BINDING SITE FOR RESIDUE SO4 H 221' 
AC5 Software H SO4 222 ? 5 'BINDING SITE FOR RESIDUE SO4 H 222' 
AC6 Software L SO4 212 ? 3 'BINDING SITE FOR RESIDUE SO4 L 212' 
AC7 Software X SO4 221 ? 5 'BINDING SITE FOR RESIDUE SO4 X 221' 
AC8 Software Y SO4 212 ? 5 'BINDING SITE FOR RESIDUE SO4 Y 212' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HOH O .   ? HOH A 4   . ? 1_555 ? 
2  AC1 6 SER A 12  ? SER A 139 . ? 1_555 ? 
3  AC1 6 SER A 14  ? SER A 141 . ? 1_555 ? 
4  AC1 6 THR A 79  ? THR A 206 . ? 1_555 ? 
5  AC1 6 ASP C 101 ? ASP H 101 . ? 1_555 ? 
6  AC1 6 HOH Q .   ? HOH H 223 . ? 1_555 ? 
7  AC2 6 HOH P .   ? HOH B 1   . ? 1_555 ? 
8  AC2 6 SER B 12  ? SER B 139 . ? 1_555 ? 
9  AC2 6 SER B 14  ? SER B 141 . ? 1_555 ? 
10 AC2 6 THR B 79  ? THR B 206 . ? 1_555 ? 
11 AC2 6 ASP E 101 ? ASP X 101 . ? 1_555 ? 
12 AC2 6 HOH S .   ? HOH X 222 . ? 1_555 ? 
13 AC3 6 LYS B 70  ? LYS B 197 . ? 1_555 ? 
14 AC3 6 HOH P .   ? HOH B 695 . ? 1_555 ? 
15 AC3 6 ASP C 215 ? ASP H 215 . ? 3_545 ? 
16 AC3 6 LYS C 216 ? LYS H 216 . ? 3_545 ? 
17 AC3 6 ARG C 217 ? ARG H 217 . ? 3_545 ? 
18 AC3 6 HOH Q .   ? HOH H 683 . ? 3_545 ? 
19 AC4 9 HIS A 148 ? HIS A 275 . ? 4_544 ? 
20 AC4 9 PRO A 154 ? PRO A 281 . ? 4_544 ? 
21 AC4 9 ALA A 155 ? ALA A 282 . ? 4_544 ? 
22 AC4 9 SER A 156 ? SER A 283 . ? 4_544 ? 
23 AC4 9 LYS C 199 ? LYS H 199 . ? 1_555 ? 
24 AC4 9 THR C 200 ? THR H 200 . ? 1_555 ? 
25 AC4 9 HOH Q .   ? HOH H 261 . ? 1_555 ? 
26 AC4 9 HOH Q .   ? HOH H 271 . ? 1_555 ? 
27 AC4 9 SER E 194 ? SER X 194 . ? 1_555 ? 
28 AC5 5 PHE C 27  ? PHE H 27  . ? 1_555 ? 
29 AC5 5 THR C 28  ? THR H 28  . ? 1_555 ? 
30 AC5 5 TYR C 32  ? TYR H 32  . ? 1_555 ? 
31 AC5 5 HOH Q .   ? HOH H 297 . ? 1_555 ? 
32 AC5 5 LYS E 76  ? LYS X 76  . ? 1_555 ? 
33 AC6 3 LYS D 40  ? LYS L 39  . ? 1_555 ? 
34 AC6 3 LYS D 46  ? LYS L 45  . ? 1_555 ? 
35 AC6 3 HOH R .   ? HOH L 259 . ? 1_555 ? 
36 AC7 5 PHE E 27  ? PHE X 27  . ? 1_555 ? 
37 AC7 5 THR E 28  ? THR X 28  . ? 1_555 ? 
38 AC7 5 TYR E 32  ? TYR X 32  . ? 1_555 ? 
39 AC7 5 HOH S .   ? HOH X 325 . ? 1_555 ? 
40 AC7 5 HOH S .   ? HOH X 674 . ? 1_555 ? 
41 AC8 5 ASN B 36  ? ASN B 163 . ? 2_444 ? 
42 AC8 5 THR B 37  ? THR B 164 . ? 2_444 ? 
43 AC8 5 PRO F 60  ? PRO Y 59  . ? 1_555 ? 
44 AC8 5 ARG F 62  ? ARG Y 61  . ? 1_555 ? 
45 AC8 5 HOH T .   ? HOH Y 273 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3HI6 
_atom_sites.fract_transf_matrix[1][1]   0.007475 
_atom_sites.fract_transf_matrix[1][2]   0.004316 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008631 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006209 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLY A 1 1   ? 60.974  -36.140  34.631  1.00 24.47  ? 128 GLY A N   1 
ATOM   2     C  CA  . GLY A 1 1   ? 61.459  -37.128  33.627  1.00 24.48  ? 128 GLY A CA  1 
ATOM   3     C  C   . GLY A 1 1   ? 61.556  -36.574  32.209  1.00 23.23  ? 128 GLY A C   1 
ATOM   4     O  O   . GLY A 1 1   ? 60.632  -35.931  31.726  1.00 23.75  ? 128 GLY A O   1 
ATOM   5     N  N   . ASN A 1 2   ? 62.681  -36.827  31.544  1.00 22.61  ? 129 ASN A N   1 
ATOM   6     C  CA  . ASN A 1 2   ? 62.854  -36.445  30.139  1.00 21.83  ? 129 ASN A CA  1 
ATOM   7     C  C   . ASN A 1 2   ? 61.931  -37.248  29.242  1.00 20.29  ? 129 ASN A C   1 
ATOM   8     O  O   . ASN A 1 2   ? 61.698  -38.433  29.478  1.00 20.12  ? 129 ASN A O   1 
ATOM   9     C  CB  . ASN A 1 2   ? 64.304  -36.631  29.673  1.00 21.90  ? 129 ASN A CB  1 
ATOM   10    C  CG  . ASN A 1 2   ? 65.274  -35.711  30.398  1.00 22.24  ? 129 ASN A CG  1 
ATOM   11    O  OD1 . ASN A 1 2   ? 64.906  -34.613  30.814  1.00 21.85  ? 129 ASN A OD1 1 
ATOM   12    N  ND2 . ASN A 1 2   ? 66.514  -36.166  30.568  1.00 21.56  ? 129 ASN A ND2 1 
ATOM   13    N  N   . VAL A 1 3   ? 61.391  -36.578  28.226  1.00 20.24  ? 130 VAL A N   1 
ATOM   14    C  CA  . VAL A 1 3   ? 60.532  -37.215  27.245  1.00 18.56  ? 130 VAL A CA  1 
ATOM   15    C  C   . VAL A 1 3   ? 61.013  -36.857  25.855  1.00 17.53  ? 130 VAL A C   1 
ATOM   16    O  O   . VAL A 1 3   ? 61.193  -35.673  25.540  1.00 15.47  ? 130 VAL A O   1 
ATOM   17    C  CB  . VAL A 1 3   ? 59.050  -36.799  27.404  1.00 18.13  ? 130 VAL A CB  1 
ATOM   18    C  CG1 . VAL A 1 3   ? 58.176  -37.601  26.455  1.00 18.20  ? 130 VAL A CG1 1 
ATOM   19    C  CG2 . VAL A 1 3   ? 58.586  -37.016  28.833  1.00 18.95  ? 130 VAL A CG2 1 
ATOM   20    N  N   . ASP A 1 4   ? 61.243  -37.893  25.046  1.00 16.68  ? 131 ASP A N   1 
ATOM   21    C  CA  . ASP A 1 4   ? 61.471  -37.745  23.610  1.00 15.32  ? 131 ASP A CA  1 
ATOM   22    C  C   . ASP A 1 4   ? 60.176  -38.094  22.946  1.00 14.10  ? 131 ASP A C   1 
ATOM   23    O  O   . ASP A 1 4   ? 59.767  -39.253  22.958  1.00 14.36  ? 131 ASP A O   1 
ATOM   24    C  CB  . ASP A 1 4   ? 62.560  -38.702  23.097  1.00 15.65  ? 131 ASP A CB  1 
ATOM   25    C  CG  . ASP A 1 4   ? 63.961  -38.228  23.402  1.00 15.38  ? 131 ASP A CG  1 
ATOM   26    O  OD1 . ASP A 1 4   ? 64.106  -37.096  23.895  1.00 15.14  ? 131 ASP A OD1 1 
ATOM   27    O  OD2 . ASP A 1 4   ? 64.919  -39.002  23.162  1.00 16.18  ? 131 ASP A OD2 1 
ATOM   28    N  N   . LEU A 1 5   ? 59.542  -37.095  22.346  1.00 14.81  ? 132 LEU A N   1 
ATOM   29    C  CA  . LEU A 1 5   ? 58.206  -37.247  21.793  1.00 14.84  ? 132 LEU A CA  1 
ATOM   30    C  C   . LEU A 1 5   ? 58.199  -37.082  20.264  1.00 15.02  ? 132 LEU A C   1 
ATOM   31    O  O   . LEU A 1 5   ? 58.792  -36.149  19.730  1.00 14.15  ? 132 LEU A O   1 
ATOM   32    C  CB  . LEU A 1 5   ? 57.263  -36.237  22.455  1.00 15.38  ? 132 LEU A CB  1 
ATOM   33    C  CG  . LEU A 1 5   ? 55.769  -36.445  22.173  1.00 15.46  ? 132 LEU A CG  1 
ATOM   34    C  CD1 . LEU A 1 5   ? 54.878  -36.000  23.344  1.00 14.19  ? 132 LEU A CD1 1 
ATOM   35    C  CD2 . LEU A 1 5   ? 55.370  -35.749  20.876  1.00 16.61  ? 132 LEU A CD2 1 
ATOM   36    N  N   . VAL A 1 6   ? 57.537  -38.001  19.569  1.00 14.39  ? 133 VAL A N   1 
ATOM   37    C  CA  . VAL A 1 6   ? 57.388  -37.903  18.124  1.00 14.62  ? 133 VAL A CA  1 
ATOM   38    C  C   . VAL A 1 6   ? 55.914  -37.701  17.765  1.00 16.42  ? 133 VAL A C   1 
ATOM   39    O  O   . VAL A 1 6   ? 55.045  -38.422  18.255  1.00 15.14  ? 133 VAL A O   1 
ATOM   40    C  CB  . VAL A 1 6   ? 57.915  -39.159  17.396  1.00 13.75  ? 133 VAL A CB  1 
ATOM   41    C  CG1 . VAL A 1 6   ? 57.912  -38.939  15.876  1.00 12.89  ? 133 VAL A CG1 1 
ATOM   42    C  CG2 . VAL A 1 6   ? 59.327  -39.519  17.870  1.00 12.33  ? 133 VAL A CG2 1 
ATOM   43    N  N   . PHE A 1 7   ? 55.643  -36.701  16.924  1.00 17.96  ? 134 PHE A N   1 
ATOM   44    C  CA  . PHE A 1 7   ? 54.343  -36.575  16.279  1.00 17.85  ? 134 PHE A CA  1 
ATOM   45    C  C   . PHE A 1 7   ? 54.389  -37.368  14.997  1.00 17.79  ? 134 PHE A C   1 
ATOM   46    O  O   . PHE A 1 7   ? 55.223  -37.100  14.127  1.00 18.13  ? 134 PHE A O   1 
ATOM   47    C  CB  . PHE A 1 7   ? 54.030  -35.129  15.907  1.00 19.49  ? 134 PHE A CB  1 
ATOM   48    C  CG  . PHE A 1 7   ? 54.053  -34.176  17.055  1.00 20.29  ? 134 PHE A CG  1 
ATOM   49    C  CD1 . PHE A 1 7   ? 53.011  -34.147  17.967  1.00 19.87  ? 134 PHE A CD1 1 
ATOM   50    C  CD2 . PHE A 1 7   ? 55.116  -33.283  17.213  1.00 21.44  ? 134 PHE A CD2 1 
ATOM   51    C  CE1 . PHE A 1 7   ? 53.023  -33.243  19.024  1.00 20.10  ? 134 PHE A CE1 1 
ATOM   52    C  CE2 . PHE A 1 7   ? 55.137  -32.390  18.279  1.00 20.82  ? 134 PHE A CE2 1 
ATOM   53    C  CZ  . PHE A 1 7   ? 54.082  -32.371  19.179  1.00 19.81  ? 134 PHE A CZ  1 
ATOM   54    N  N   . LEU A 1 8   ? 53.511  -38.353  14.886  1.00 16.65  ? 135 LEU A N   1 
ATOM   55    C  CA  . LEU A 1 8   ? 53.347  -39.092  13.650  1.00 16.27  ? 135 LEU A CA  1 
ATOM   56    C  C   . LEU A 1 8   ? 51.991  -38.699  13.073  1.00 16.87  ? 135 LEU A C   1 
ATOM   57    O  O   . LEU A 1 8   ? 50.952  -39.142  13.570  1.00 17.06  ? 135 LEU A O   1 
ATOM   58    C  CB  . LEU A 1 8   ? 53.423  -40.596  13.918  1.00 15.60  ? 135 LEU A CB  1 
ATOM   59    C  CG  . LEU A 1 8   ? 53.257  -41.491  12.688  1.00 15.79  ? 135 LEU A CG  1 
ATOM   60    C  CD1 . LEU A 1 8   ? 54.308  -41.147  11.621  1.00 13.92  ? 135 LEU A CD1 1 
ATOM   61    C  CD2 . LEU A 1 8   ? 53.286  -42.988  13.072  1.00 13.54  ? 135 LEU A CD2 1 
ATOM   62    N  N   . PHE A 1 9   ? 52.003  -37.862  12.037  1.00 15.73  ? 136 PHE A N   1 
ATOM   63    C  CA  . PHE A 1 9   ? 50.777  -37.210  11.580  1.00 16.39  ? 136 PHE A CA  1 
ATOM   64    C  C   . PHE A 1 9   ? 50.366  -37.549  10.146  1.00 17.23  ? 136 PHE A C   1 
ATOM   65    O  O   . PHE A 1 9   ? 51.187  -37.572  9.223   1.00 16.83  ? 136 PHE A O   1 
ATOM   66    C  CB  . PHE A 1 9   ? 50.813  -35.684  11.817  1.00 16.07  ? 136 PHE A CB  1 
ATOM   67    C  CG  . PHE A 1 9   ? 51.830  -34.942  11.007  1.00 17.24  ? 136 PHE A CG  1 
ATOM   68    C  CD1 . PHE A 1 9   ? 51.458  -34.254  9.869   1.00 18.44  ? 136 PHE A CD1 1 
ATOM   69    C  CD2 . PHE A 1 9   ? 53.158  -34.876  11.416  1.00 17.67  ? 136 PHE A CD2 1 
ATOM   70    C  CE1 . PHE A 1 9   ? 52.390  -33.538  9.141   1.00 18.82  ? 136 PHE A CE1 1 
ATOM   71    C  CE2 . PHE A 1 9   ? 54.087  -34.171  10.690  1.00 17.80  ? 136 PHE A CE2 1 
ATOM   72    C  CZ  . PHE A 1 9   ? 53.707  -33.496  9.554   1.00 18.08  ? 136 PHE A CZ  1 
ATOM   73    N  N   . ASP A 1 10  ? 49.063  -37.786  10.003  1.00 17.09  ? 137 ASP A N   1 
ATOM   74    C  CA  . ASP A 1 10  ? 48.444  -38.327  8.793   1.00 18.47  ? 137 ASP A CA  1 
ATOM   75    C  C   . ASP A 1 10  ? 48.352  -37.305  7.643   1.00 18.67  ? 137 ASP A C   1 
ATOM   76    O  O   . ASP A 1 10  ? 47.588  -36.360  7.709   1.00 18.66  ? 137 ASP A O   1 
ATOM   77    C  CB  . ASP A 1 10  ? 47.039  -38.834  9.171   1.00 18.76  ? 137 ASP A CB  1 
ATOM   78    C  CG  . ASP A 1 10  ? 46.433  -39.766  8.133   1.00 18.53  ? 137 ASP A CG  1 
ATOM   79    O  OD1 . ASP A 1 10  ? 46.647  -39.544  6.918   1.00 16.62  ? 137 ASP A OD1 1 
ATOM   80    O  OD2 . ASP A 1 10  ? 45.714  -40.703  8.555   1.00 16.90  ? 137 ASP A OD2 1 
ATOM   81    N  N   . GLY A 1 11  ? 49.122  -37.520  6.581   1.00 18.69  ? 138 GLY A N   1 
ATOM   82    C  CA  . GLY A 1 11  ? 49.059  -36.667  5.396   1.00 17.37  ? 138 GLY A CA  1 
ATOM   83    C  C   . GLY A 1 11  ? 48.262  -37.231  4.239   1.00 15.44  ? 138 GLY A C   1 
ATOM   84    O  O   . GLY A 1 11  ? 48.358  -36.734  3.127   1.00 14.87  ? 138 GLY A O   1 
ATOM   85    N  N   . SER A 1 12  ? 47.457  -38.257  4.495   1.00 15.46  ? 139 SER A N   1 
ATOM   86    C  CA  . SER A 1 12  ? 46.698  -38.931  3.432   1.00 14.60  ? 139 SER A CA  1 
ATOM   87    C  C   . SER A 1 12  ? 45.538  -38.062  2.937   1.00 15.37  ? 139 SER A C   1 
ATOM   88    O  O   . SER A 1 12  ? 45.116  -37.109  3.613   1.00 14.89  ? 139 SER A O   1 
ATOM   89    C  CB  . SER A 1 12  ? 46.167  -40.279  3.941   1.00 14.57  ? 139 SER A CB  1 
ATOM   90    O  OG  . SER A 1 12  ? 45.114  -40.108  4.894   1.00 15.10  ? 139 SER A OG  1 
ATOM   91    N  N   . MET A 1 13  ? 44.998  -38.408  1.773   1.00 14.25  ? 140 MET A N   1 
ATOM   92    C  CA  . MET A 1 13  ? 43.967  -37.589  1.163   1.00 13.88  ? 140 MET A CA  1 
ATOM   93    C  C   . MET A 1 13  ? 42.618  -37.673  1.873   1.00 13.16  ? 140 MET A C   1 
ATOM   94    O  O   . MET A 1 13  ? 41.798  -36.774  1.711   1.00 11.86  ? 140 MET A O   1 
ATOM   95    C  CB  . MET A 1 13  ? 43.781  -37.918  -0.324  1.00 14.15  ? 140 MET A CB  1 
ATOM   96    C  CG  . MET A 1 13  ? 43.188  -36.739  -1.097  1.00 13.56  ? 140 MET A CG  1 
ATOM   97    S  SD  . MET A 1 13  ? 42.568  -37.172  -2.705  1.00 14.20  ? 140 MET A SD  1 
ATOM   98    C  CE  . MET A 1 13  ? 44.130  -37.203  -3.619  1.00 13.87  ? 140 MET A CE  1 
ATOM   99    N  N   . SER A 1 14  ? 42.400  -38.737  2.646   1.00 14.22  ? 141 SER A N   1 
ATOM   100   C  CA  . SER A 1 14  ? 41.124  -38.958  3.357   1.00 15.85  ? 141 SER A CA  1 
ATOM   101   C  C   . SER A 1 14  ? 40.735  -37.826  4.306   1.00 16.03  ? 141 SER A C   1 
ATOM   102   O  O   . SER A 1 14  ? 39.547  -37.563  4.528   1.00 16.85  ? 141 SER A O   1 
ATOM   103   C  CB  . SER A 1 14  ? 41.178  -40.260  4.155   1.00 16.17  ? 141 SER A CB  1 
ATOM   104   O  OG  . SER A 1 14  ? 42.178  -40.216  5.155   1.00 16.33  ? 141 SER A OG  1 
ATOM   105   N  N   . LEU A 1 15  ? 41.733  -37.161  4.872   1.00 17.39  ? 142 LEU A N   1 
ATOM   106   C  CA  . LEU A 1 15  ? 41.477  -36.021  5.737   1.00 18.39  ? 142 LEU A CA  1 
ATOM   107   C  C   . LEU A 1 15  ? 40.948  -34.855  4.917   1.00 18.30  ? 142 LEU A C   1 
ATOM   108   O  O   . LEU A 1 15  ? 41.419  -34.584  3.806   1.00 16.00  ? 142 LEU A O   1 
ATOM   109   C  CB  . LEU A 1 15  ? 42.746  -35.589  6.483   1.00 20.48  ? 142 LEU A CB  1 
ATOM   110   C  CG  . LEU A 1 15  ? 43.154  -36.471  7.679   1.00 21.86  ? 142 LEU A CG  1 
ATOM   111   C  CD1 . LEU A 1 15  ? 43.953  -37.687  7.202   1.00 19.82  ? 142 LEU A CD1 1 
ATOM   112   C  CD2 . LEU A 1 15  ? 43.934  -35.655  8.701   1.00 19.78  ? 142 LEU A CD2 1 
ATOM   113   N  N   . GLN A 1 16  ? 39.964  -34.158  5.472   1.00 18.09  ? 143 GLN A N   1 
ATOM   114   C  CA  . GLN A 1 16  ? 39.557  -32.886  4.903   1.00 18.73  ? 143 GLN A CA  1 
ATOM   115   C  C   . GLN A 1 16  ? 40.690  -31.861  5.021   1.00 18.34  ? 143 GLN A C   1 
ATOM   116   O  O   . GLN A 1 16  ? 41.537  -31.950  5.931   1.00 17.05  ? 143 GLN A O   1 
ATOM   117   C  CB  . GLN A 1 16  ? 38.289  -32.411  5.569   1.00 20.77  ? 143 GLN A CB  1 
ATOM   118   C  CG  . GLN A 1 16  ? 37.089  -33.155  5.012   1.00 23.16  ? 143 GLN A CG  1 
ATOM   119   C  CD  . GLN A 1 16  ? 35.926  -33.176  5.935   1.00 24.74  ? 143 GLN A CD  1 
ATOM   120   O  OE1 . GLN A 1 16  ? 35.957  -32.584  7.013   1.00 26.88  ? 143 GLN A OE1 1 
ATOM   121   N  NE2 . GLN A 1 16  ? 34.886  -33.882  5.534   1.00 25.82  ? 143 GLN A NE2 1 
ATOM   122   N  N   . PRO A 1 17  ? 40.754  -30.919  4.067   1.00 17.52  ? 144 PRO A N   1 
ATOM   123   C  CA  . PRO A 1 17  ? 41.833  -29.941  4.100   1.00 17.31  ? 144 PRO A CA  1 
ATOM   124   C  C   . PRO A 1 17  ? 41.983  -29.267  5.460   1.00 17.33  ? 144 PRO A C   1 
ATOM   125   O  O   . PRO A 1 17  ? 43.092  -29.207  5.992   1.00 18.42  ? 144 PRO A O   1 
ATOM   126   C  CB  . PRO A 1 17  ? 41.429  -28.933  3.015   1.00 17.05  ? 144 PRO A CB  1 
ATOM   127   C  CG  . PRO A 1 17  ? 40.651  -29.721  2.045   1.00 16.39  ? 144 PRO A CG  1 
ATOM   128   C  CD  . PRO A 1 17  ? 39.963  -30.820  2.826   1.00 17.26  ? 144 PRO A CD  1 
ATOM   129   N  N   . ASP A 1 18  ? 40.894  -28.795  6.047   1.00 19.20  ? 145 ASP A N   1 
ATOM   130   C  CA  . ASP A 1 18  ? 41.030  -28.051  7.312   1.00 21.95  ? 145 ASP A CA  1 
ATOM   131   C  C   . ASP A 1 18  ? 41.379  -28.935  8.512   1.00 20.19  ? 145 ASP A C   1 
ATOM   132   O  O   . ASP A 1 18  ? 41.897  -28.443  9.501   1.00 17.24  ? 145 ASP A O   1 
ATOM   133   C  CB  . ASP A 1 18  ? 39.821  -27.149  7.593   1.00 25.81  ? 145 ASP A CB  1 
ATOM   134   C  CG  . ASP A 1 18  ? 38.523  -27.911  7.709   1.00 31.24  ? 145 ASP A CG  1 
ATOM   135   O  OD1 . ASP A 1 18  ? 38.500  -29.131  7.409   1.00 34.88  ? 145 ASP A OD1 1 
ATOM   136   O  OD2 . ASP A 1 18  ? 37.506  -27.273  8.089   1.00 35.58  ? 145 ASP A OD2 1 
ATOM   137   N  N   . GLU A 1 19  ? 41.131  -30.240  8.404   1.00 20.03  ? 146 GLU A N   1 
ATOM   138   C  CA  . GLU A 1 19  ? 41.559  -31.198  9.440   1.00 20.35  ? 146 GLU A CA  1 
ATOM   139   C  C   . GLU A 1 19  ? 43.086  -31.265  9.509   1.00 20.54  ? 146 GLU A C   1 
ATOM   140   O  O   . GLU A 1 19  ? 43.680  -31.163  10.578  1.00 18.74  ? 146 GLU A O   1 
ATOM   141   C  CB  . GLU A 1 19  ? 40.945  -32.589  9.189   1.00 19.26  ? 146 GLU A CB  1 
ATOM   142   C  CG  . GLU A 1 19  ? 39.433  -32.626  9.502   1.00 19.10  ? 146 GLU A CG  1 
ATOM   143   C  CD  . GLU A 1 19  ? 38.725  -33.910  9.069   1.00 19.70  ? 146 GLU A CD  1 
ATOM   144   O  OE1 . GLU A 1 19  ? 39.350  -34.750  8.381   1.00 18.90  ? 146 GLU A OE1 1 
ATOM   145   O  OE2 . GLU A 1 19  ? 37.522  -34.067  9.408   1.00 20.81  ? 146 GLU A OE2 1 
ATOM   146   N  N   . PHE A 1 20  ? 43.722  -31.394  8.353   1.00 21.25  ? 147 PHE A N   1 
ATOM   147   C  CA  . PHE A 1 20  ? 45.173  -31.402  8.293   1.00 20.39  ? 147 PHE A CA  1 
ATOM   148   C  C   . PHE A 1 20  ? 45.793  -30.105  8.840   1.00 19.97  ? 147 PHE A C   1 
ATOM   149   O  O   . PHE A 1 20  ? 46.797  -30.165  9.543   1.00 19.61  ? 147 PHE A O   1 
ATOM   150   C  CB  . PHE A 1 20  ? 45.632  -31.674  6.869   1.00 20.99  ? 147 PHE A CB  1 
ATOM   151   C  CG  . PHE A 1 20  ? 47.112  -31.815  6.734   1.00 20.94  ? 147 PHE A CG  1 
ATOM   152   C  CD1 . PHE A 1 20  ? 47.751  -32.980  7.153   1.00 20.45  ? 147 PHE A CD1 1 
ATOM   153   C  CD2 . PHE A 1 20  ? 47.873  -30.789  6.185   1.00 20.19  ? 147 PHE A CD2 1 
ATOM   154   C  CE1 . PHE A 1 20  ? 49.138  -33.118  7.036   1.00 19.83  ? 147 PHE A CE1 1 
ATOM   155   C  CE2 . PHE A 1 20  ? 49.264  -30.926  6.060   1.00 20.03  ? 147 PHE A CE2 1 
ATOM   156   C  CZ  . PHE A 1 20  ? 49.891  -32.095  6.478   1.00 19.32  ? 147 PHE A CZ  1 
ATOM   157   N  N   . GLN A 1 21  ? 45.203  -28.947  8.548   1.00 19.49  ? 148 GLN A N   1 
ATOM   158   C  CA  . GLN A 1 21  ? 45.683  -27.687  9.150   1.00 21.60  ? 148 GLN A CA  1 
ATOM   159   C  C   . GLN A 1 21  ? 45.494  -27.679  10.676  1.00 21.67  ? 148 GLN A C   1 
ATOM   160   O  O   . GLN A 1 21  ? 46.321  -27.149  11.405  1.00 21.09  ? 148 GLN A O   1 
ATOM   161   C  CB  . GLN A 1 21  ? 44.994  -26.454  8.536   1.00 22.73  ? 148 GLN A CB  1 
ATOM   162   C  CG  . GLN A 1 21  ? 45.563  -25.092  9.026   1.00 22.78  ? 148 GLN A CG  1 
ATOM   163   C  CD  . GLN A 1 21  ? 47.072  -24.947  8.769   1.00 24.09  ? 148 GLN A CD  1 
ATOM   164   O  OE1 . GLN A 1 21  ? 47.527  -25.060  7.623   1.00 24.30  ? 148 GLN A OE1 1 
ATOM   165   N  NE2 . GLN A 1 21  ? 47.849  -24.713  9.837   1.00 22.76  ? 148 GLN A NE2 1 
ATOM   166   N  N   . LYS A 1 22  ? 44.392  -28.264  11.134  1.00 21.95  ? 149 LYS A N   1 
ATOM   167   C  CA  . LYS A 1 22  ? 44.133  -28.492  12.552  1.00 23.12  ? 149 LYS A CA  1 
ATOM   168   C  C   . LYS A 1 22  ? 45.279  -29.297  13.208  1.00 22.09  ? 149 LYS A C   1 
ATOM   169   O  O   . LYS A 1 22  ? 45.703  -29.007  14.328  1.00 21.09  ? 149 LYS A O   1 
ATOM   170   C  CB  . LYS A 1 22  ? 42.807  -29.258  12.710  1.00 25.29  ? 149 LYS A CB  1 
ATOM   171   C  CG  . LYS A 1 22  ? 41.963  -28.872  13.892  1.00 27.75  ? 149 LYS A CG  1 
ATOM   172   C  CD  . LYS A 1 22  ? 40.985  -27.760  13.557  1.00 29.60  ? 149 LYS A CD  1 
ATOM   173   C  CE  . LYS A 1 22  ? 40.292  -27.233  14.833  1.00 31.03  ? 149 LYS A CE  1 
ATOM   174   N  NZ  . LYS A 1 22  ? 39.703  -25.854  14.695  1.00 31.10  ? 149 LYS A NZ  1 
ATOM   175   N  N   . ILE A 1 23  ? 45.772  -30.307  12.496  1.00 20.93  ? 150 ILE A N   1 
ATOM   176   C  CA  . ILE A 1 23  ? 46.846  -31.152  12.992  1.00 20.36  ? 150 ILE A CA  1 
ATOM   177   C  C   . ILE A 1 23  ? 48.143  -30.361  13.123  1.00 19.70  ? 150 ILE A C   1 
ATOM   178   O  O   . ILE A 1 23  ? 48.857  -30.473  14.126  1.00 19.24  ? 150 ILE A O   1 
ATOM   179   C  CB  . ILE A 1 23  ? 47.058  -32.387  12.081  1.00 22.26  ? 150 ILE A CB  1 
ATOM   180   C  CG1 . ILE A 1 23  ? 45.832  -33.307  12.133  1.00 21.99  ? 150 ILE A CG1 1 
ATOM   181   C  CG2 . ILE A 1 23  ? 48.305  -33.165  12.504  1.00 22.40  ? 150 ILE A CG2 1 
ATOM   182   C  CD1 . ILE A 1 23  ? 45.889  -34.471  11.159  1.00 20.70  ? 150 ILE A CD1 1 
ATOM   183   N  N   . LEU A 1 24  ? 48.448  -29.565  12.104  1.00 19.87  ? 151 LEU A N   1 
ATOM   184   C  CA  . LEU A 1 24  ? 49.620  -28.699  12.147  1.00 20.28  ? 151 LEU A CA  1 
ATOM   185   C  C   . LEU A 1 24  ? 49.556  -27.765  13.362  1.00 19.34  ? 151 LEU A C   1 
ATOM   186   O  O   . LEU A 1 24  ? 50.501  -27.690  14.154  1.00 19.37  ? 151 LEU A O   1 
ATOM   187   C  CB  . LEU A 1 24  ? 49.746  -27.883  10.849  1.00 18.64  ? 151 LEU A CB  1 
ATOM   188   C  CG  . LEU A 1 24  ? 50.003  -28.641  9.543   1.00 17.30  ? 151 LEU A CG  1 
ATOM   189   C  CD1 . LEU A 1 24  ? 49.957  -27.683  8.305   1.00 13.84  ? 151 LEU A CD1 1 
ATOM   190   C  CD2 . LEU A 1 24  ? 51.314  -29.412  9.608   1.00 15.14  ? 151 LEU A CD2 1 
ATOM   191   N  N   . ASP A 1 25  ? 48.427  -27.084  13.512  1.00 19.11  ? 152 ASP A N   1 
ATOM   192   C  CA  . ASP A 1 25  ? 48.224  -26.153  14.619  1.00 20.26  ? 152 ASP A CA  1 
ATOM   193   C  C   . ASP A 1 25  ? 48.324  -26.852  15.980  1.00 19.93  ? 152 ASP A C   1 
ATOM   194   O  O   . ASP A 1 25  ? 48.830  -26.284  16.932  1.00 18.69  ? 152 ASP A O   1 
ATOM   195   C  CB  . ASP A 1 25  ? 46.879  -25.427  14.468  1.00 21.19  ? 152 ASP A CB  1 
ATOM   196   C  CG  . ASP A 1 25  ? 46.836  -24.508  13.229  1.00 23.99  ? 152 ASP A CG  1 
ATOM   197   O  OD1 . ASP A 1 25  ? 47.887  -23.907  12.896  1.00 26.68  ? 152 ASP A OD1 1 
ATOM   198   O  OD2 . ASP A 1 25  ? 45.756  -24.378  12.594  1.00 23.32  ? 152 ASP A OD2 1 
ATOM   199   N  N   . PHE A 1 26  ? 47.861  -28.094  16.058  1.00 20.55  ? 153 PHE A N   1 
ATOM   200   C  CA  . PHE A 1 26  ? 47.924  -28.850  17.299  1.00 22.02  ? 153 PHE A CA  1 
ATOM   201   C  C   . PHE A 1 26  ? 49.373  -29.149  17.739  1.00 23.33  ? 153 PHE A C   1 
ATOM   202   O  O   . PHE A 1 26  ? 49.706  -28.980  18.915  1.00 21.60  ? 153 PHE A O   1 
ATOM   203   C  CB  . PHE A 1 26  ? 47.141  -30.151  17.153  1.00 22.13  ? 153 PHE A CB  1 
ATOM   204   C  CG  . PHE A 1 26  ? 47.351  -31.109  18.283  1.00 21.88  ? 153 PHE A CG  1 
ATOM   205   C  CD1 . PHE A 1 26  ? 46.740  -30.898  19.506  1.00 21.20  ? 153 PHE A CD1 1 
ATOM   206   C  CD2 . PHE A 1 26  ? 48.164  -32.223  18.123  1.00 22.32  ? 153 PHE A CD2 1 
ATOM   207   C  CE1 . PHE A 1 26  ? 46.929  -31.779  20.546  1.00 21.25  ? 153 PHE A CE1 1 
ATOM   208   C  CE2 . PHE A 1 26  ? 48.361  -33.116  19.165  1.00 21.41  ? 153 PHE A CE2 1 
ATOM   209   C  CZ  . PHE A 1 26  ? 47.745  -32.898  20.372  1.00 21.56  ? 153 PHE A CZ  1 
ATOM   210   N  N   . MET A 1 27  ? 50.207  -29.598  16.793  1.00 23.04  ? 154 MET A N   1 
ATOM   211   C  CA  . MET A 1 27  ? 51.610  -29.927  17.068  1.00 22.53  ? 154 MET A CA  1 
ATOM   212   C  C   . MET A 1 27  ? 52.363  -28.684  17.532  1.00 22.57  ? 154 MET A C   1 
ATOM   213   O  O   . MET A 1 27  ? 53.163  -28.754  18.470  1.00 22.04  ? 154 MET A O   1 
ATOM   214   C  CB  . MET A 1 27  ? 52.299  -30.524  15.828  1.00 21.76  ? 154 MET A CB  1 
ATOM   215   C  CG  . MET A 1 27  ? 51.741  -31.877  15.391  1.00 22.28  ? 154 MET A CG  1 
ATOM   216   S  SD  . MET A 1 27  ? 52.622  -32.683  14.008  1.00 22.21  ? 154 MET A SD  1 
ATOM   217   C  CE  . MET A 1 27  ? 52.062  -31.716  12.593  1.00 18.23  ? 154 MET A CE  1 
ATOM   218   N  N   . LYS A 1 28  ? 52.106  -27.557  16.871  1.00 23.08  ? 155 LYS A N   1 
ATOM   219   C  CA  . LYS A 1 28  ? 52.664  -26.272  17.288  1.00 24.68  ? 155 LYS A CA  1 
ATOM   220   C  C   . LYS A 1 28  ? 52.219  -25.855  18.685  1.00 24.50  ? 155 LYS A C   1 
ATOM   221   O  O   . LYS A 1 28  ? 53.039  -25.391  19.467  1.00 24.28  ? 155 LYS A O   1 
ATOM   222   C  CB  . LYS A 1 28  ? 52.282  -25.158  16.308  1.00 25.53  ? 155 LYS A CB  1 
ATOM   223   C  CG  . LYS A 1 28  ? 52.872  -25.331  14.922  1.00 26.60  ? 155 LYS A CG  1 
ATOM   224   C  CD  . LYS A 1 28  ? 52.585  -24.109  14.063  1.00 26.36  ? 155 LYS A CD  1 
ATOM   225   C  CE  . LYS A 1 28  ? 52.989  -24.323  12.616  1.00 26.28  ? 155 LYS A CE  1 
ATOM   226   N  NZ  . LYS A 1 28  ? 53.002  -23.028  11.875  1.00 25.73  ? 155 LYS A NZ  1 
ATOM   227   N  N   . ASP A 1 29  ? 50.929  -25.995  18.989  1.00 25.28  ? 156 ASP A N   1 
ATOM   228   C  CA  . ASP A 1 29  ? 50.414  -25.634  20.320  1.00 26.73  ? 156 ASP A CA  1 
ATOM   229   C  C   . ASP A 1 29  ? 51.055  -26.472  21.433  1.00 24.85  ? 156 ASP A C   1 
ATOM   230   O  O   . ASP A 1 29  ? 51.479  -25.936  22.458  1.00 23.41  ? 156 ASP A O   1 
ATOM   231   C  CB  . ASP A 1 29  ? 48.888  -25.780  20.400  1.00 30.03  ? 156 ASP A CB  1 
ATOM   232   C  CG  . ASP A 1 29  ? 48.342  -25.509  21.822  1.00 34.31  ? 156 ASP A CG  1 
ATOM   233   O  OD1 . ASP A 1 29  ? 48.263  -24.323  22.242  1.00 35.07  ? 156 ASP A OD1 1 
ATOM   234   O  OD2 . ASP A 1 29  ? 48.013  -26.494  22.533  1.00 38.17  ? 156 ASP A OD2 1 
ATOM   235   N  N   . VAL A 1 30  ? 51.108  -27.783  21.225  1.00 23.21  ? 157 VAL A N   1 
ATOM   236   C  CA  . VAL A 1 30  ? 51.712  -28.695  22.187  1.00 22.85  ? 157 VAL A CA  1 
ATOM   237   C  C   . VAL A 1 30  ? 53.165  -28.294  22.457  1.00 24.02  ? 157 VAL A C   1 
ATOM   238   O  O   . VAL A 1 30  ? 53.555  -28.135  23.604  1.00 23.24  ? 157 VAL A O   1 
ATOM   239   C  CB  . VAL A 1 30  ? 51.660  -30.159  21.686  1.00 21.66  ? 157 VAL A CB  1 
ATOM   240   C  CG1 . VAL A 1 30  ? 52.475  -31.092  22.623  1.00 19.24  ? 157 VAL A CG1 1 
ATOM   241   C  CG2 . VAL A 1 30  ? 50.214  -30.624  21.551  1.00 18.01  ? 157 VAL A CG2 1 
ATOM   242   N  N   . MET A 1 31  ? 53.939  -28.101  21.388  1.00 25.13  ? 158 MET A N   1 
ATOM   243   C  CA  . MET A 1 31  ? 55.341  -27.689  21.494  1.00 25.93  ? 158 MET A CA  1 
ATOM   244   C  C   . MET A 1 31  ? 55.524  -26.338  22.194  1.00 26.79  ? 158 MET A C   1 
ATOM   245   O  O   . MET A 1 31  ? 56.424  -26.175  23.022  1.00 26.56  ? 158 MET A O   1 
ATOM   246   C  CB  . MET A 1 31  ? 55.991  -27.662  20.107  1.00 26.82  ? 158 MET A CB  1 
ATOM   247   C  CG  . MET A 1 31  ? 56.455  -29.047  19.650  1.00 28.57  ? 158 MET A CG  1 
ATOM   248   S  SD  . MET A 1 31  ? 57.171  -29.083  18.003  1.00 30.74  ? 158 MET A SD  1 
ATOM   249   C  CE  . MET A 1 31  ? 58.544  -27.979  18.182  1.00 32.24  ? 158 MET A CE  1 
ATOM   250   N  N   . LYS A 1 32  ? 54.660  -25.385  21.860  1.00 27.81  ? 159 LYS A N   1 
ATOM   251   C  CA  . LYS A 1 32  ? 54.691  -24.053  22.452  1.00 29.37  ? 159 LYS A CA  1 
ATOM   252   C  C   . LYS A 1 32  ? 54.406  -24.127  23.951  1.00 29.79  ? 159 LYS A C   1 
ATOM   253   O  O   . LYS A 1 32  ? 54.961  -23.367  24.741  1.00 27.49  ? 159 LYS A O   1 
ATOM   254   C  CB  . LYS A 1 32  ? 53.657  -23.147  21.778  1.00 30.04  ? 159 LYS A CB  1 
ATOM   255   C  CG  . LYS A 1 32  ? 53.990  -21.679  21.877  1.00 32.01  ? 159 LYS A CG  1 
ATOM   256   C  CD  . LYS A 1 32  ? 52.759  -20.765  21.776  1.00 33.28  ? 159 LYS A CD  1 
ATOM   257   C  CE  . LYS A 1 32  ? 52.401  -20.125  23.121  1.00 33.54  ? 159 LYS A CE  1 
ATOM   258   N  NZ  . LYS A 1 32  ? 51.349  -19.086  22.953  1.00 33.60  ? 159 LYS A NZ  1 
ATOM   259   N  N   . LYS A 1 33  ? 53.535  -25.064  24.312  1.00 31.37  ? 160 LYS A N   1 
ATOM   260   C  CA  . LYS A 1 33  ? 53.068  -25.255  25.671  1.00 31.85  ? 160 LYS A CA  1 
ATOM   261   C  C   . LYS A 1 33  ? 54.050  -26.080  26.496  1.00 31.76  ? 160 LYS A C   1 
ATOM   262   O  O   . LYS A 1 33  ? 54.310  -25.750  27.649  1.00 32.26  ? 160 LYS A O   1 
ATOM   263   C  CB  . LYS A 1 33  ? 51.711  -25.948  25.620  1.00 33.10  ? 160 LYS A CB  1 
ATOM   264   C  CG  . LYS A 1 33  ? 50.986  -26.011  26.925  1.00 34.83  ? 160 LYS A CG  1 
ATOM   265   C  CD  . LYS A 1 33  ? 49.477  -26.130  26.705  1.00 36.13  ? 160 LYS A CD  1 
ATOM   266   C  CE  . LYS A 1 33  ? 48.695  -25.859  27.991  1.00 37.06  ? 160 LYS A CE  1 
ATOM   267   N  NZ  . LYS A 1 33  ? 49.080  -24.611  28.745  1.00 36.77  ? 160 LYS A NZ  1 
ATOM   268   N  N   . CYS A 1 34  ? 54.582  -27.152  25.913  1.00 31.20  ? 161 CYS A N   1 
ATOM   269   C  CA  . CYS A 1 34  ? 55.582  -27.990  26.586  1.00 32.27  ? 161 CYS A CA  1 
ATOM   270   C  C   . CYS A 1 34  ? 56.994  -27.601  26.167  1.00 32.71  ? 161 CYS A C   1 
ATOM   271   O  O   . CYS A 1 34  ? 57.773  -28.452  25.747  1.00 33.03  ? 161 CYS A O   1 
ATOM   272   C  CB  . CYS A 1 34  ? 55.367  -29.477  26.280  1.00 32.54  ? 161 CYS A CB  1 
ATOM   273   S  SG  . CYS A 1 34  ? 53.703  -30.096  26.533  1.00 33.01  ? 161 CYS A SG  1 
ATOM   274   N  N   . SER A 1 35  ? 57.323  -26.318  26.299  1.00 33.35  ? 162 SER A N   1 
ATOM   275   C  CA  . SER A 1 35  ? 58.645  -25.802  25.920  1.00 33.90  ? 162 SER A CA  1 
ATOM   276   C  C   . SER A 1 35  ? 59.716  -26.084  26.984  1.00 34.65  ? 162 SER A C   1 
ATOM   277   O  O   . SER A 1 35  ? 60.848  -25.603  26.884  1.00 35.27  ? 162 SER A O   1 
ATOM   278   C  CB  . SER A 1 35  ? 58.558  -24.296  25.676  1.00 33.32  ? 162 SER A CB  1 
ATOM   279   O  OG  . SER A 1 35  ? 58.292  -23.615  26.890  1.00 32.95  ? 162 SER A OG  1 
ATOM   280   N  N   . ASN A 1 36  ? 59.348  -26.855  28.003  1.00 35.32  ? 163 ASN A N   1 
ATOM   281   C  CA  . ASN A 1 36  ? 60.243  -27.205  29.105  1.00 35.05  ? 163 ASN A CA  1 
ATOM   282   C  C   . ASN A 1 36  ? 61.361  -28.183  28.677  1.00 33.56  ? 163 ASN A C   1 
ATOM   283   O  O   . ASN A 1 36  ? 61.113  -29.159  27.960  1.00 32.16  ? 163 ASN A O   1 
ATOM   284   C  CB  . ASN A 1 36  ? 59.399  -27.772  30.255  1.00 36.43  ? 163 ASN A CB  1 
ATOM   285   C  CG  . ASN A 1 36  ? 60.215  -28.515  31.276  1.00 38.60  ? 163 ASN A CG  1 
ATOM   286   O  OD1 . ASN A 1 36  ? 59.987  -29.704  31.509  1.00 40.35  ? 163 ASN A OD1 1 
ATOM   287   N  ND2 . ASN A 1 36  ? 61.170  -27.826  31.900  1.00 39.83  ? 163 ASN A ND2 1 
ATOM   288   N  N   . THR A 1 37  ? 62.578  -27.894  29.144  1.00 31.84  ? 164 THR A N   1 
ATOM   289   C  CA  . THR A 1 37  ? 63.823  -28.609  28.794  1.00 30.38  ? 164 THR A CA  1 
ATOM   290   C  C   . THR A 1 37  ? 63.772  -30.142  28.848  1.00 27.22  ? 164 THR A C   1 
ATOM   291   O  O   . THR A 1 37  ? 64.526  -30.806  28.134  1.00 26.86  ? 164 THR A O   1 
ATOM   292   C  CB  . THR A 1 37  ? 64.984  -28.121  29.709  1.00 31.81  ? 164 THR A CB  1 
ATOM   293   O  OG1 . THR A 1 37  ? 65.360  -26.795  29.325  1.00 33.07  ? 164 THR A OG1 1 
ATOM   294   C  CG2 . THR A 1 37  ? 66.208  -29.022  29.612  1.00 33.53  ? 164 THR A CG2 1 
ATOM   295   N  N   . SER A 1 38  ? 62.901  -30.696  29.690  1.00 23.40  ? 165 SER A N   1 
ATOM   296   C  CA  . SER A 1 38  ? 62.685  -32.141  29.740  1.00 22.52  ? 165 SER A CA  1 
ATOM   297   C  C   . SER A 1 38  ? 62.172  -32.726  28.421  1.00 21.78  ? 165 SER A C   1 
ATOM   298   O  O   . SER A 1 38  ? 62.396  -33.900  28.133  1.00 20.53  ? 165 SER A O   1 
ATOM   299   C  CB  . SER A 1 38  ? 61.687  -32.488  30.847  1.00 22.94  ? 165 SER A CB  1 
ATOM   300   O  OG  . SER A 1 38  ? 62.236  -32.199  32.120  1.00 23.37  ? 165 SER A OG  1 
ATOM   301   N  N   . TYR A 1 39  ? 61.487  -31.897  27.639  1.00 21.34  ? 166 TYR A N   1 
ATOM   302   C  CA  . TYR A 1 39  ? 60.825  -32.319  26.417  1.00 22.08  ? 166 TYR A CA  1 
ATOM   303   C  C   . TYR A 1 39  ? 61.663  -32.032  25.174  1.00 21.05  ? 166 TYR A C   1 
ATOM   304   O  O   . TYR A 1 39  ? 62.155  -30.919  25.004  1.00 21.40  ? 166 TYR A O   1 
ATOM   305   C  CB  . TYR A 1 39  ? 59.468  -31.610  26.281  1.00 22.82  ? 166 TYR A CB  1 
ATOM   306   C  CG  . TYR A 1 39  ? 58.301  -32.350  26.896  1.00 23.45  ? 166 TYR A CG  1 
ATOM   307   C  CD1 . TYR A 1 39  ? 57.853  -32.065  28.187  1.00 23.89  ? 166 TYR A CD1 1 
ATOM   308   C  CD2 . TYR A 1 39  ? 57.634  -33.325  26.177  1.00 24.37  ? 166 TYR A CD2 1 
ATOM   309   C  CE1 . TYR A 1 39  ? 56.770  -32.753  28.741  1.00 24.03  ? 166 TYR A CE1 1 
ATOM   310   C  CE2 . TYR A 1 39  ? 56.551  -34.011  26.715  1.00 24.15  ? 166 TYR A CE2 1 
ATOM   311   C  CZ  . TYR A 1 39  ? 56.123  -33.726  27.985  1.00 24.34  ? 166 TYR A CZ  1 
ATOM   312   O  OH  . TYR A 1 39  ? 55.052  -34.438  28.480  1.00 24.39  ? 166 TYR A OH  1 
ATOM   313   N  N   . GLN A 1 40  ? 61.813  -33.052  24.327  1.00 19.46  ? 167 GLN A N   1 
ATOM   314   C  CA  . GLN A 1 40  ? 62.327  -32.911  22.959  1.00 19.79  ? 167 GLN A CA  1 
ATOM   315   C  C   . GLN A 1 40  ? 61.303  -33.472  21.963  1.00 17.57  ? 167 GLN A C   1 
ATOM   316   O  O   . GLN A 1 40  ? 60.653  -34.484  22.233  1.00 17.37  ? 167 GLN A O   1 
ATOM   317   C  CB  . GLN A 1 40  ? 63.600  -33.717  22.777  1.00 21.23  ? 167 GLN A CB  1 
ATOM   318   C  CG  . GLN A 1 40  ? 64.874  -33.027  23.158  1.00 23.88  ? 167 GLN A CG  1 
ATOM   319   C  CD  . GLN A 1 40  ? 66.083  -33.918  22.905  1.00 24.78  ? 167 GLN A CD  1 
ATOM   320   O  OE1 . GLN A 1 40  ? 65.958  -35.054  22.391  1.00 23.93  ? 167 GLN A OE1 1 
ATOM   321   N  NE2 . GLN A 1 40  ? 67.261  -33.416  23.269  1.00 24.84  ? 167 GLN A NE2 1 
ATOM   322   N  N   . PHE A 1 41  ? 61.210  -32.853  20.793  1.00 14.57  ? 168 PHE A N   1 
ATOM   323   C  CA  . PHE A 1 41  ? 60.215  -33.243  19.811  1.00 15.60  ? 168 PHE A CA  1 
ATOM   324   C  C   . PHE A 1 41  ? 60.813  -33.587  18.452  1.00 16.39  ? 168 PHE A C   1 
ATOM   325   O  O   . PHE A 1 41  ? 61.858  -33.060  18.065  1.00 16.43  ? 168 PHE A O   1 
ATOM   326   C  CB  . PHE A 1 41  ? 59.213  -32.115  19.629  1.00 14.81  ? 168 PHE A CB  1 
ATOM   327   C  CG  . PHE A 1 41  ? 58.492  -31.754  20.882  1.00 15.95  ? 168 PHE A CG  1 
ATOM   328   C  CD1 . PHE A 1 41  ? 57.319  -32.413  21.242  1.00 17.34  ? 168 PHE A CD1 1 
ATOM   329   C  CD2 . PHE A 1 41  ? 58.974  -30.756  21.708  1.00 15.84  ? 168 PHE A CD2 1 
ATOM   330   C  CE1 . PHE A 1 41  ? 56.650  -32.074  22.411  1.00 17.15  ? 168 PHE A CE1 1 
ATOM   331   C  CE2 . PHE A 1 41  ? 58.313  -30.413  22.871  1.00 15.15  ? 168 PHE A CE2 1 
ATOM   332   C  CZ  . PHE A 1 41  ? 57.158  -31.069  23.224  1.00 16.71  ? 168 PHE A CZ  1 
ATOM   333   N  N   . ALA A 1 42  ? 60.125  -34.485  17.749  1.00 17.03  ? 169 ALA A N   1 
ATOM   334   C  CA  . ALA A 1 42  ? 60.350  -34.745  16.330  1.00 17.21  ? 169 ALA A CA  1 
ATOM   335   C  C   . ALA A 1 42  ? 58.971  -34.926  15.683  1.00 17.27  ? 169 ALA A C   1 
ATOM   336   O  O   . ALA A 1 42  ? 57.973  -35.159  16.376  1.00 15.79  ? 169 ALA A O   1 
ATOM   337   C  CB  . ALA A 1 42  ? 61.229  -35.982  16.120  1.00 14.84  ? 169 ALA A CB  1 
ATOM   338   N  N   . ALA A 1 43  ? 58.922  -34.781  14.361  1.00 17.79  ? 170 ALA A N   1 
ATOM   339   C  CA  . ALA A 1 43  ? 57.676  -34.896  13.614  1.00 17.85  ? 170 ALA A CA  1 
ATOM   340   C  C   . ALA A 1 43  ? 57.896  -35.663  12.326  1.00 17.04  ? 170 ALA A C   1 
ATOM   341   O  O   . ALA A 1 43  ? 58.822  -35.380  11.578  1.00 16.76  ? 170 ALA A O   1 
ATOM   342   C  CB  . ALA A 1 43  ? 57.096  -33.515  13.311  1.00 16.98  ? 170 ALA A CB  1 
ATOM   343   N  N   . VAL A 1 44  ? 57.024  -36.634  12.085  1.00 18.20  ? 171 VAL A N   1 
ATOM   344   C  CA  . VAL A 1 44  ? 57.036  -37.435  10.866  1.00 17.53  ? 171 VAL A CA  1 
ATOM   345   C  C   . VAL A 1 44  ? 55.663  -37.366  10.190  1.00 17.17  ? 171 VAL A C   1 
ATOM   346   O  O   . VAL A 1 44  ? 54.642  -37.658  10.829  1.00 15.98  ? 171 VAL A O   1 
ATOM   347   C  CB  . VAL A 1 44  ? 57.329  -38.893  11.187  1.00 17.02  ? 171 VAL A CB  1 
ATOM   348   C  CG1 . VAL A 1 44  ? 57.422  -39.722  9.890   1.00 18.43  ? 171 VAL A CG1 1 
ATOM   349   C  CG2 . VAL A 1 44  ? 58.613  -39.007  12.012  1.00 15.74  ? 171 VAL A CG2 1 
ATOM   350   N  N   . GLN A 1 45  ? 55.635  -36.946  8.922   1.00 16.44  ? 172 GLN A N   1 
ATOM   351   C  CA  . GLN A 1 45  ? 54.415  -37.030  8.109   1.00 15.07  ? 172 GLN A CA  1 
ATOM   352   C  C   . GLN A 1 45  ? 54.382  -38.394  7.447   1.00 16.21  ? 172 GLN A C   1 
ATOM   353   O  O   . GLN A 1 45  ? 55.397  -38.859  6.926   1.00 16.42  ? 172 GLN A O   1 
ATOM   354   C  CB  . GLN A 1 45  ? 54.345  -35.925  7.040   1.00 14.78  ? 172 GLN A CB  1 
ATOM   355   C  CG  . GLN A 1 45  ? 52.937  -35.800  6.423   1.00 15.01  ? 172 GLN A CG  1 
ATOM   356   C  CD  . GLN A 1 45  ? 52.835  -34.976  5.140   1.00 14.80  ? 172 GLN A CD  1 
ATOM   357   O  OE1 . GLN A 1 45  ? 51.780  -34.970  4.512   1.00 14.68  ? 172 GLN A OE1 1 
ATOM   358   N  NE2 . GLN A 1 45  ? 53.908  -34.293  4.744   1.00 14.39  ? 172 GLN A NE2 1 
ATOM   359   N  N   . PHE A 1 46  ? 53.222  -39.043  7.483   1.00 17.12  ? 173 PHE A N   1 
ATOM   360   C  CA  . PHE A 1 46  ? 53.032  -40.316  6.799   1.00 16.44  ? 173 PHE A CA  1 
ATOM   361   C  C   . PHE A 1 46  ? 51.817  -40.273  5.884   1.00 17.75  ? 173 PHE A C   1 
ATOM   362   O  O   . PHE A 1 46  ? 50.796  -39.653  6.214   1.00 16.94  ? 173 PHE A O   1 
ATOM   363   C  CB  . PHE A 1 46  ? 52.926  -41.494  7.788   1.00 16.43  ? 173 PHE A CB  1 
ATOM   364   C  CG  . PHE A 1 46  ? 51.590  -41.618  8.505   1.00 16.13  ? 173 PHE A CG  1 
ATOM   365   C  CD1 . PHE A 1 46  ? 50.592  -42.445  8.007   1.00 16.80  ? 173 PHE A CD1 1 
ATOM   366   C  CD2 . PHE A 1 46  ? 51.359  -40.956  9.713   1.00 14.77  ? 173 PHE A CD2 1 
ATOM   367   C  CE1 . PHE A 1 46  ? 49.357  -42.572  8.680   1.00 16.53  ? 173 PHE A CE1 1 
ATOM   368   C  CE2 . PHE A 1 46  ? 50.150  -41.080  10.384  1.00 13.82  ? 173 PHE A CE2 1 
ATOM   369   C  CZ  . PHE A 1 46  ? 49.148  -41.885  9.872   1.00 15.05  ? 173 PHE A CZ  1 
ATOM   370   N  N   . SER A 1 47  ? 51.964  -40.918  4.725   1.00 18.48  ? 174 SER A N   1 
ATOM   371   C  CA  . SER A 1 47  ? 50.851  -41.224  3.829   1.00 17.91  ? 174 SER A CA  1 
ATOM   372   C  C   . SER A 1 47  ? 51.121  -42.628  3.236   1.00 17.77  ? 174 SER A C   1 
ATOM   373   O  O   . SER A 1 47  ? 51.054  -43.624  3.960   1.00 16.10  ? 174 SER A O   1 
ATOM   374   C  CB  . SER A 1 47  ? 50.683  -40.118  2.771   1.00 17.75  ? 174 SER A CB  1 
ATOM   375   O  OG  . SER A 1 47  ? 49.498  -40.267  2.005   1.00 16.35  ? 174 SER A OG  1 
ATOM   376   N  N   . THR A 1 48  ? 51.396  -42.713  1.936   1.00 17.25  ? 175 THR A N   1 
ATOM   377   C  CA  . THR A 1 48  ? 51.923  -43.931  1.328   1.00 16.67  ? 175 THR A CA  1 
ATOM   378   C  C   . THR A 1 48  ? 53.320  -44.186  1.884   1.00 16.35  ? 175 THR A C   1 
ATOM   379   O  O   . THR A 1 48  ? 53.687  -45.317  2.243   1.00 14.42  ? 175 THR A O   1 
ATOM   380   C  CB  . THR A 1 48  ? 51.953  -43.789  -0.220  1.00 16.37  ? 175 THR A CB  1 
ATOM   381   O  OG1 . THR A 1 48  ? 50.607  -43.814  -0.711  1.00 15.04  ? 175 THR A OG1 1 
ATOM   382   C  CG2 . THR A 1 48  ? 52.777  -44.902  -0.903  1.00 14.46  ? 175 THR A CG2 1 
ATOM   383   N  N   . SER A 1 49  ? 54.072  -43.097  1.980   1.00 18.29  ? 176 SER A N   1 
ATOM   384   C  CA  . SER A 1 49  ? 55.449  -43.108  2.440   1.00 19.18  ? 176 SER A CA  1 
ATOM   385   C  C   . SER A 1 49  ? 55.607  -42.211  3.670   1.00 18.02  ? 176 SER A C   1 
ATOM   386   O  O   . SER A 1 49  ? 54.636  -41.638  4.155   1.00 17.84  ? 176 SER A O   1 
ATOM   387   C  CB  . SER A 1 49  ? 56.340  -42.614  1.299   1.00 21.57  ? 176 SER A CB  1 
ATOM   388   O  OG  . SER A 1 49  ? 57.670  -43.022  1.525   1.00 26.81  ? 176 SER A OG  1 
ATOM   389   N  N   . TYR A 1 50  ? 56.832  -42.077  4.157   1.00 18.63  ? 177 TYR A N   1 
ATOM   390   C  CA  . TYR A 1 50  ? 57.104  -41.414  5.434   1.00 21.82  ? 177 TYR A CA  1 
ATOM   391   C  C   . TYR A 1 50  ? 58.213  -40.391  5.271   1.00 22.48  ? 177 TYR A C   1 
ATOM   392   O  O   . TYR A 1 50  ? 59.192  -40.635  4.558   1.00 22.48  ? 177 TYR A O   1 
ATOM   393   C  CB  . TYR A 1 50  ? 57.503  -42.452  6.495   1.00 23.44  ? 177 TYR A CB  1 
ATOM   394   C  CG  . TYR A 1 50  ? 56.773  -43.758  6.290   1.00 25.36  ? 177 TYR A CG  1 
ATOM   395   C  CD1 . TYR A 1 50  ? 55.374  -43.792  6.275   1.00 25.81  ? 177 TYR A CD1 1 
ATOM   396   C  CD2 . TYR A 1 50  ? 57.466  -44.939  6.056   1.00 25.64  ? 177 TYR A CD2 1 
ATOM   397   C  CE1 . TYR A 1 50  ? 54.685  -44.964  6.047   1.00 26.56  ? 177 TYR A CE1 1 
ATOM   398   C  CE2 . TYR A 1 50  ? 56.788  -46.129  5.832   1.00 28.18  ? 177 TYR A CE2 1 
ATOM   399   C  CZ  . TYR A 1 50  ? 55.391  -46.133  5.835   1.00 29.15  ? 177 TYR A CZ  1 
ATOM   400   O  OH  . TYR A 1 50  ? 54.709  -47.309  5.613   1.00 31.10  ? 177 TYR A OH  1 
ATOM   401   N  N   . LYS A 1 51  ? 58.052  -39.244  5.927   1.00 22.24  ? 178 LYS A N   1 
ATOM   402   C  CA  . LYS A 1 51  ? 59.067  -38.193  5.892   1.00 21.69  ? 178 LYS A CA  1 
ATOM   403   C  C   . LYS A 1 51  ? 59.251  -37.583  7.267   1.00 19.35  ? 178 LYS A C   1 
ATOM   404   O  O   . LYS A 1 51  ? 58.284  -37.125  7.868   1.00 18.53  ? 178 LYS A O   1 
ATOM   405   C  CB  . LYS A 1 51  ? 58.680  -37.086  4.910   1.00 23.53  ? 178 LYS A CB  1 
ATOM   406   C  CG  . LYS A 1 51  ? 59.867  -36.252  4.506   1.00 25.39  ? 178 LYS A CG  1 
ATOM   407   C  CD  . LYS A 1 51  ? 59.500  -34.873  3.999   1.00 26.91  ? 178 LYS A CD  1 
ATOM   408   C  CE  . LYS A 1 51  ? 60.767  -34.016  3.838   1.00 27.70  ? 178 LYS A CE  1 
ATOM   409   N  NZ  . LYS A 1 51  ? 61.448  -33.773  5.170   1.00 27.78  ? 178 LYS A NZ  1 
ATOM   410   N  N   . THR A 1 52  ? 60.487  -37.581  7.760   1.00 18.05  ? 179 THR A N   1 
ATOM   411   C  CA  . THR A 1 52  ? 60.815  -36.826  8.957   1.00 17.08  ? 179 THR A CA  1 
ATOM   412   C  C   . THR A 1 52  ? 60.828  -35.364  8.543   1.00 16.09  ? 179 THR A C   1 
ATOM   413   O  O   . THR A 1 52  ? 61.631  -34.962  7.708   1.00 14.95  ? 179 THR A O   1 
ATOM   414   C  CB  . THR A 1 52  ? 62.193  -37.230  9.550   1.00 17.33  ? 179 THR A CB  1 
ATOM   415   O  OG1 . THR A 1 52  ? 62.208  -38.636  9.806   1.00 16.59  ? 179 THR A OG1 1 
ATOM   416   C  CG2 . THR A 1 52  ? 62.465  -36.478  10.862  1.00 16.34  ? 179 THR A CG2 1 
ATOM   417   N  N   . GLU A 1 53  ? 59.914  -34.583  9.098   1.00 16.30  ? 180 GLU A N   1 
ATOM   418   C  CA  . GLU A 1 53  ? 59.864  -33.157  8.807   1.00 18.84  ? 180 GLU A CA  1 
ATOM   419   C  C   . GLU A 1 53  ? 60.914  -32.407  9.634   1.00 19.00  ? 180 GLU A C   1 
ATOM   420   O  O   . GLU A 1 53  ? 61.524  -31.454  9.146   1.00 18.19  ? 180 GLU A O   1 
ATOM   421   C  CB  . GLU A 1 53  ? 58.451  -32.604  9.042   1.00 18.61  ? 180 GLU A CB  1 
ATOM   422   C  CG  . GLU A 1 53  ? 57.393  -33.259  8.143   1.00 18.84  ? 180 GLU A CG  1 
ATOM   423   C  CD  . GLU A 1 53  ? 57.534  -32.958  6.630   1.00 20.29  ? 180 GLU A CD  1 
ATOM   424   O  OE1 . GLU A 1 53  ? 58.416  -32.163  6.205   1.00 20.16  ? 180 GLU A OE1 1 
ATOM   425   O  OE2 . GLU A 1 53  ? 56.731  -33.530  5.850   1.00 19.52  ? 180 GLU A OE2 1 
ATOM   426   N  N   . PHE A 1 54  ? 61.120  -32.856  10.873  1.00 18.02  ? 181 PHE A N   1 
ATOM   427   C  CA  . PHE A 1 54  ? 62.243  -32.414  11.681  1.00 17.78  ? 181 PHE A CA  1 
ATOM   428   C  C   . PHE A 1 54  ? 62.594  -33.459  12.747  1.00 18.12  ? 181 PHE A C   1 
ATOM   429   O  O   . PHE A 1 54  ? 61.707  -34.086  13.347  1.00 18.34  ? 181 PHE A O   1 
ATOM   430   C  CB  . PHE A 1 54  ? 61.971  -31.042  12.320  1.00 17.80  ? 181 PHE A CB  1 
ATOM   431   C  CG  . PHE A 1 54  ? 60.901  -31.053  13.363  1.00 19.08  ? 181 PHE A CG  1 
ATOM   432   C  CD1 . PHE A 1 54  ? 61.216  -31.289  14.705  1.00 19.15  ? 181 PHE A CD1 1 
ATOM   433   C  CD2 . PHE A 1 54  ? 59.580  -30.810  13.022  1.00 18.14  ? 181 PHE A CD2 1 
ATOM   434   C  CE1 . PHE A 1 54  ? 60.224  -31.295  15.671  1.00 19.37  ? 181 PHE A CE1 1 
ATOM   435   C  CE2 . PHE A 1 54  ? 58.586  -30.811  13.994  1.00 19.95  ? 181 PHE A CE2 1 
ATOM   436   C  CZ  . PHE A 1 54  ? 58.908  -31.065  15.319  1.00 19.07  ? 181 PHE A CZ  1 
ATOM   437   N  N   . ASP A 1 55  ? 63.896  -33.633  12.952  1.00 18.39  ? 182 ASP A N   1 
ATOM   438   C  CA  . ASP A 1 55  ? 64.464  -34.530  13.959  1.00 19.27  ? 182 ASP A CA  1 
ATOM   439   C  C   . ASP A 1 55  ? 64.588  -33.838  15.305  1.00 16.80  ? 182 ASP A C   1 
ATOM   440   O  O   . ASP A 1 55  ? 64.416  -32.637  15.410  1.00 15.58  ? 182 ASP A O   1 
ATOM   441   C  CB  . ASP A 1 55  ? 65.868  -34.971  13.520  1.00 21.24  ? 182 ASP A CB  1 
ATOM   442   C  CG  . ASP A 1 55  ? 65.833  -35.980  12.402  1.00 25.64  ? 182 ASP A CG  1 
ATOM   443   O  OD1 . ASP A 1 55  ? 65.383  -37.125  12.646  1.00 27.95  ? 182 ASP A OD1 1 
ATOM   444   O  OD2 . ASP A 1 55  ? 66.271  -35.645  11.276  1.00 29.23  ? 182 ASP A OD2 1 
ATOM   445   N  N   . PHE A 1 56  ? 64.948  -34.610  16.325  1.00 16.77  ? 183 PHE A N   1 
ATOM   446   C  CA  . PHE A 1 56  ? 65.172  -34.076  17.659  1.00 15.32  ? 183 PHE A CA  1 
ATOM   447   C  C   . PHE A 1 56  ? 66.260  -33.002  17.647  1.00 16.33  ? 183 PHE A C   1 
ATOM   448   O  O   . PHE A 1 56  ? 66.146  -31.983  18.341  1.00 15.57  ? 183 PHE A O   1 
ATOM   449   C  CB  . PHE A 1 56  ? 65.562  -35.198  18.625  1.00 14.87  ? 183 PHE A CB  1 
ATOM   450   C  CG  . PHE A 1 56  ? 64.446  -36.155  18.928  1.00 14.97  ? 183 PHE A CG  1 
ATOM   451   C  CD1 . PHE A 1 56  ? 63.295  -35.718  19.566  1.00 15.53  ? 183 PHE A CD1 1 
ATOM   452   C  CD2 . PHE A 1 56  ? 64.554  -37.505  18.599  1.00 15.44  ? 183 PHE A CD2 1 
ATOM   453   C  CE1 . PHE A 1 56  ? 62.262  -36.600  19.855  1.00 14.66  ? 183 PHE A CE1 1 
ATOM   454   C  CE2 . PHE A 1 56  ? 63.534  -38.393  18.895  1.00 14.79  ? 183 PHE A CE2 1 
ATOM   455   C  CZ  . PHE A 1 56  ? 62.383  -37.935  19.515  1.00 15.20  ? 183 PHE A CZ  1 
ATOM   456   N  N   . SER A 1 57  ? 67.314  -33.242  16.869  1.00 17.18  ? 184 SER A N   1 
ATOM   457   C  CA  . SER A 1 57  ? 68.422  -32.295  16.752  1.00 18.35  ? 184 SER A CA  1 
ATOM   458   C  C   . SER A 1 57  ? 67.977  -30.984  16.100  1.00 16.95  ? 184 SER A C   1 
ATOM   459   O  O   . SER A 1 57  ? 68.453  -29.914  16.471  1.00 14.84  ? 184 SER A O   1 
ATOM   460   C  CB  . SER A 1 57  ? 69.581  -32.909  15.967  1.00 19.51  ? 184 SER A CB  1 
ATOM   461   O  OG  . SER A 1 57  ? 69.179  -33.180  14.631  1.00 24.01  ? 184 SER A OG  1 
ATOM   462   N  N   . ASP A 1 58  ? 67.059  -31.069  15.138  1.00 17.75  ? 185 ASP A N   1 
ATOM   463   C  CA  . ASP A 1 58  ? 66.442  -29.868  14.558  1.00 16.75  ? 185 ASP A CA  1 
ATOM   464   C  C   . ASP A 1 58  ? 65.686  -29.066  15.619  1.00 16.09  ? 185 ASP A C   1 
ATOM   465   O  O   . ASP A 1 58  ? 65.777  -27.849  15.660  1.00 15.57  ? 185 ASP A O   1 
ATOM   466   C  CB  . ASP A 1 58  ? 65.464  -30.238  13.440  1.00 18.01  ? 185 ASP A CB  1 
ATOM   467   C  CG  . ASP A 1 58  ? 66.143  -30.849  12.233  1.00 18.53  ? 185 ASP A CG  1 
ATOM   468   O  OD1 . ASP A 1 58  ? 67.243  -30.390  11.859  1.00 20.40  ? 185 ASP A OD1 1 
ATOM   469   O  OD2 . ASP A 1 58  ? 65.558  -31.781  11.647  1.00 18.24  ? 185 ASP A OD2 1 
ATOM   470   N  N   . TYR A 1 59  ? 64.939  -29.756  16.474  1.00 16.74  ? 186 TYR A N   1 
ATOM   471   C  CA  . TYR A 1 59  ? 64.171  -29.098  17.526  1.00 16.43  ? 186 TYR A CA  1 
ATOM   472   C  C   . TYR A 1 59  ? 65.069  -28.385  18.535  1.00 17.34  ? 186 TYR A C   1 
ATOM   473   O  O   . TYR A 1 59  ? 64.787  -27.254  18.933  1.00 17.67  ? 186 TYR A O   1 
ATOM   474   C  CB  . TYR A 1 59  ? 63.270  -30.096  18.265  1.00 17.25  ? 186 TYR A CB  1 
ATOM   475   C  CG  . TYR A 1 59  ? 62.596  -29.461  19.474  1.00 16.92  ? 186 TYR A CG  1 
ATOM   476   C  CD1 . TYR A 1 59  ? 61.470  -28.654  19.325  1.00 16.56  ? 186 TYR A CD1 1 
ATOM   477   C  CD2 . TYR A 1 59  ? 63.124  -29.614  20.745  1.00 14.75  ? 186 TYR A CD2 1 
ATOM   478   C  CE1 . TYR A 1 59  ? 60.871  -28.045  20.429  1.00 16.26  ? 186 TYR A CE1 1 
ATOM   479   C  CE2 . TYR A 1 59  ? 62.534  -29.024  21.840  1.00 15.57  ? 186 TYR A CE2 1 
ATOM   480   C  CZ  . TYR A 1 59  ? 61.413  -28.241  21.680  1.00 15.77  ? 186 TYR A CZ  1 
ATOM   481   O  OH  . TYR A 1 59  ? 60.837  -27.660  22.786  1.00 16.86  ? 186 TYR A OH  1 
ATOM   482   N  N   . VAL A 1 60  ? 66.140  -29.047  18.963  1.00 18.24  ? 187 VAL A N   1 
ATOM   483   C  CA  . VAL A 1 60  ? 67.087  -28.445  19.918  1.00 17.69  ? 187 VAL A CA  1 
ATOM   484   C  C   . VAL A 1 60  ? 67.718  -27.176  19.336  1.00 18.56  ? 187 VAL A C   1 
ATOM   485   O  O   . VAL A 1 60  ? 67.841  -26.158  20.027  1.00 15.98  ? 187 VAL A O   1 
ATOM   486   C  CB  . VAL A 1 60  ? 68.197  -29.452  20.342  1.00 17.41  ? 187 VAL A CB  1 
ATOM   487   C  CG1 . VAL A 1 60  ? 69.290  -28.762  21.158  1.00 16.44  ? 187 VAL A CG1 1 
ATOM   488   C  CG2 . VAL A 1 60  ? 67.593  -30.604  21.140  1.00 16.91  ? 187 VAL A CG2 1 
ATOM   489   N  N   . LYS A 1 61  ? 68.094  -27.233  18.059  1.00 20.90  ? 188 LYS A N   1 
ATOM   490   C  CA  . LYS A 1 61  ? 68.740  -26.094  17.405  1.00 23.15  ? 188 LYS A CA  1 
ATOM   491   C  C   . LYS A 1 61  ? 67.777  -24.923  17.228  1.00 23.84  ? 188 LYS A C   1 
ATOM   492   O  O   . LYS A 1 61  ? 68.146  -23.785  17.482  1.00 22.92  ? 188 LYS A O   1 
ATOM   493   C  CB  . LYS A 1 61  ? 69.300  -26.498  16.040  1.00 24.05  ? 188 LYS A CB  1 
ATOM   494   C  CG  . LYS A 1 61  ? 70.068  -25.396  15.324  1.00 24.42  ? 188 LYS A CG  1 
ATOM   495   C  CD  . LYS A 1 61  ? 70.439  -25.836  13.917  1.00 25.85  ? 188 LYS A CD  1 
ATOM   496   C  CE  . LYS A 1 61  ? 71.218  -24.772  13.157  1.00 26.10  ? 188 LYS A CE  1 
ATOM   497   N  NZ  . LYS A 1 61  ? 72.660  -24.747  13.516  1.00 27.39  ? 188 LYS A NZ  1 
ATOM   498   N  N   . TRP A 1 62  ? 66.551  -25.199  16.784  1.00 24.68  ? 189 TRP A N   1 
ATOM   499   C  CA  . TRP A 1 62  ? 65.612  -24.119  16.452  1.00 26.19  ? 189 TRP A CA  1 
ATOM   500   C  C   . TRP A 1 62  ? 64.682  -23.718  17.603  1.00 25.46  ? 189 TRP A C   1 
ATOM   501   O  O   . TRP A 1 62  ? 64.502  -22.531  17.847  1.00 26.97  ? 189 TRP A O   1 
ATOM   502   C  CB  . TRP A 1 62  ? 64.817  -24.460  15.180  1.00 26.40  ? 189 TRP A CB  1 
ATOM   503   C  CG  . TRP A 1 62  ? 65.691  -24.493  13.947  1.00 25.85  ? 189 TRP A CG  1 
ATOM   504   C  CD1 . TRP A 1 62  ? 66.553  -25.486  13.579  1.00 25.92  ? 189 TRP A CD1 1 
ATOM   505   C  CD2 . TRP A 1 62  ? 65.793  -23.484  12.934  1.00 26.23  ? 189 TRP A CD2 1 
ATOM   506   N  NE1 . TRP A 1 62  ? 67.184  -25.163  12.405  1.00 25.86  ? 189 TRP A NE1 1 
ATOM   507   C  CE2 . TRP A 1 62  ? 66.738  -23.937  11.986  1.00 26.45  ? 189 TRP A CE2 1 
ATOM   508   C  CE3 . TRP A 1 62  ? 65.177  -22.241  12.733  1.00 26.60  ? 189 TRP A CE3 1 
ATOM   509   C  CZ2 . TRP A 1 62  ? 67.088  -23.189  10.858  1.00 26.32  ? 189 TRP A CZ2 1 
ATOM   510   C  CZ3 . TRP A 1 62  ? 65.518  -21.502  11.609  1.00 26.95  ? 189 TRP A CZ3 1 
ATOM   511   C  CH2 . TRP A 1 62  ? 66.467  -21.983  10.683  1.00 27.04  ? 189 TRP A CH2 1 
ATOM   512   N  N   . LYS A 1 63  ? 64.118  -24.694  18.308  1.00 24.75  ? 190 LYS A N   1 
ATOM   513   C  CA  . LYS A 1 63  ? 63.118  -24.442  19.363  1.00 26.17  ? 190 LYS A CA  1 
ATOM   514   C  C   . LYS A 1 63  ? 62.030  -23.456  18.908  1.00 26.53  ? 190 LYS A C   1 
ATOM   515   O  O   . LYS A 1 63  ? 61.692  -22.508  19.629  1.00 27.71  ? 190 LYS A O   1 
ATOM   516   C  CB  . LYS A 1 63  ? 63.787  -23.942  20.657  1.00 26.15  ? 190 LYS A CB  1 
ATOM   517   C  CG  . LYS A 1 63  ? 64.813  -24.906  21.215  1.00 27.14  ? 190 LYS A CG  1 
ATOM   518   C  CD  . LYS A 1 63  ? 65.046  -24.716  22.699  1.00 28.12  ? 190 LYS A CD  1 
ATOM   519   C  CE  . LYS A 1 63  ? 66.022  -25.773  23.251  1.00 29.00  ? 190 LYS A CE  1 
ATOM   520   N  NZ  . LYS A 1 63  ? 67.456  -25.575  22.816  1.00 29.17  ? 190 LYS A NZ  1 
ATOM   521   N  N   . ASP A 1 64  ? 61.498  -23.693  17.712  1.00 25.46  ? 191 ASP A N   1 
ATOM   522   C  CA  . ASP A 1 64  ? 60.551  -22.784  17.056  1.00 24.79  ? 191 ASP A CA  1 
ATOM   523   C  C   . ASP A 1 64  ? 59.624  -23.607  16.151  1.00 23.56  ? 191 ASP A C   1 
ATOM   524   O  O   . ASP A 1 64  ? 60.026  -24.025  15.069  1.00 21.04  ? 191 ASP A O   1 
ATOM   525   C  CB  . ASP A 1 64  ? 61.312  -21.734  16.241  1.00 25.31  ? 191 ASP A CB  1 
ATOM   526   C  CG  . ASP A 1 64  ? 60.392  -20.805  15.444  1.00 26.30  ? 191 ASP A CG  1 
ATOM   527   O  OD1 . ASP A 1 64  ? 59.154  -20.818  15.623  1.00 27.30  ? 191 ASP A OD1 1 
ATOM   528   O  OD2 . ASP A 1 64  ? 60.925  -20.039  14.622  1.00 27.81  ? 191 ASP A OD2 1 
ATOM   529   N  N   . PRO A 1 65  ? 58.386  -23.854  16.606  1.00 24.26  ? 192 PRO A N   1 
ATOM   530   C  CA  . PRO A 1 65  ? 57.445  -24.709  15.882  1.00 24.43  ? 192 PRO A CA  1 
ATOM   531   C  C   . PRO A 1 65  ? 57.070  -24.239  14.474  1.00 22.97  ? 192 PRO A C   1 
ATOM   532   O  O   . PRO A 1 65  ? 56.854  -25.069  13.597  1.00 24.58  ? 192 PRO A O   1 
ATOM   533   C  CB  . PRO A 1 65  ? 56.207  -24.708  16.784  1.00 24.56  ? 192 PRO A CB  1 
ATOM   534   C  CG  . PRO A 1 65  ? 56.728  -24.419  18.136  1.00 24.84  ? 192 PRO A CG  1 
ATOM   535   C  CD  . PRO A 1 65  ? 57.857  -23.463  17.927  1.00 24.36  ? 192 PRO A CD  1 
ATOM   536   N  N   . ASP A 1 66  ? 56.984  -22.934  14.263  1.00 22.47  ? 193 ASP A N   1 
ATOM   537   C  CA  . ASP A 1 66  ? 56.646  -22.391  12.937  1.00 22.55  ? 193 ASP A CA  1 
ATOM   538   C  C   . ASP A 1 66  ? 57.736  -22.685  11.897  1.00 20.85  ? 193 ASP A C   1 
ATOM   539   O  O   . ASP A 1 66  ? 57.440  -23.098  10.775  1.00 21.14  ? 193 ASP A O   1 
ATOM   540   C  CB  . ASP A 1 66  ? 56.409  -20.882  13.022  1.00 22.87  ? 193 ASP A CB  1 
ATOM   541   C  CG  . ASP A 1 66  ? 55.144  -20.523  13.801  1.00 24.88  ? 193 ASP A CG  1 
ATOM   542   O  OD1 . ASP A 1 66  ? 54.103  -21.193  13.631  1.00 26.29  ? 193 ASP A OD1 1 
ATOM   543   O  OD2 . ASP A 1 66  ? 55.179  -19.542  14.575  1.00 27.62  ? 193 ASP A OD2 1 
ATOM   544   N  N   . ALA A 1 67  ? 58.990  -22.463  12.282  1.00 18.64  ? 194 ALA A N   1 
ATOM   545   C  CA  . ALA A 1 67  ? 60.132  -22.743  11.416  1.00 17.64  ? 194 ALA A CA  1 
ATOM   546   C  C   . ALA A 1 67  ? 60.242  -24.244  11.176  1.00 15.95  ? 194 ALA A C   1 
ATOM   547   O  O   . ALA A 1 67  ? 60.430  -24.689  10.055  1.00 17.42  ? 194 ALA A O   1 
ATOM   548   C  CB  . ALA A 1 67  ? 61.446  -22.172  12.029  1.00 14.29  ? 194 ALA A CB  1 
ATOM   549   N  N   . LEU A 1 68  ? 60.083  -25.019  12.237  1.00 17.38  ? 195 LEU A N   1 
ATOM   550   C  CA  . LEU A 1 68  ? 60.182  -26.479  12.166  1.00 18.35  ? 195 LEU A CA  1 
ATOM   551   C  C   . LEU A 1 68  ? 59.184  -27.137  11.204  1.00 18.07  ? 195 LEU A C   1 
ATOM   552   O  O   . LEU A 1 68  ? 59.513  -28.147  10.557  1.00 18.79  ? 195 LEU A O   1 
ATOM   553   C  CB  . LEU A 1 68  ? 60.023  -27.080  13.569  1.00 17.81  ? 195 LEU A CB  1 
ATOM   554   C  CG  . LEU A 1 68  ? 61.221  -26.827  14.494  1.00 18.11  ? 195 LEU A CG  1 
ATOM   555   C  CD1 . LEU A 1 68  ? 60.887  -27.256  15.904  1.00 15.38  ? 195 LEU A CD1 1 
ATOM   556   C  CD2 . LEU A 1 68  ? 62.494  -27.534  13.973  1.00 18.88  ? 195 LEU A CD2 1 
ATOM   557   N  N   . LEU A 1 69  ? 57.980  -26.576  11.116  1.00 16.61  ? 196 LEU A N   1 
ATOM   558   C  CA  . LEU A 1 69  ? 56.945  -27.124  10.246  1.00 16.92  ? 196 LEU A CA  1 
ATOM   559   C  C   . LEU A 1 69  ? 56.704  -26.303  8.981   1.00 16.79  ? 196 LEU A C   1 
ATOM   560   O  O   . LEU A 1 69  ? 55.816  -26.621  8.210   1.00 19.88  ? 196 LEU A O   1 
ATOM   561   C  CB  . LEU A 1 69  ? 55.641  -27.288  11.029  1.00 16.81  ? 196 LEU A CB  1 
ATOM   562   C  CG  . LEU A 1 69  ? 55.692  -28.366  12.114  1.00 17.32  ? 196 LEU A CG  1 
ATOM   563   C  CD1 . LEU A 1 69  ? 54.501  -28.242  13.095  1.00 15.24  ? 196 LEU A CD1 1 
ATOM   564   C  CD2 . LEU A 1 69  ? 55.743  -29.758  11.461  1.00 18.05  ? 196 LEU A CD2 1 
ATOM   565   N  N   . LYS A 1 70  ? 57.527  -25.288  8.741   1.00 17.35  ? 197 LYS A N   1 
ATOM   566   C  CA  . LYS A 1 70  ? 57.334  -24.371  7.618   1.00 16.24  ? 197 LYS A CA  1 
ATOM   567   C  C   . LYS A 1 70  ? 57.245  -25.051  6.255   1.00 17.68  ? 197 LYS A C   1 
ATOM   568   O  O   . LYS A 1 70  ? 56.418  -24.677  5.426   1.00 17.41  ? 197 LYS A O   1 
ATOM   569   C  CB  . LYS A 1 70  ? 58.469  -23.351  7.575   1.00 15.62  ? 197 LYS A CB  1 
ATOM   570   C  CG  . LYS A 1 70  ? 58.276  -22.248  6.568   1.00 14.91  ? 197 LYS A CG  1 
ATOM   571   C  CD  . LYS A 1 70  ? 59.314  -21.153  6.740   1.00 14.92  ? 197 LYS A CD  1 
ATOM   572   C  CE  . LYS A 1 70  ? 59.379  -20.244  5.509   1.00 15.18  ? 197 LYS A CE  1 
ATOM   573   N  NZ  . LYS A 1 70  ? 60.676  -19.525  5.446   1.00 15.68  ? 197 LYS A NZ  1 
ATOM   574   N  N   . HIS A 1 71  ? 58.097  -26.044  6.024   1.00 19.02  ? 198 HIS A N   1 
ATOM   575   C  CA  . HIS A 1 71  ? 58.270  -26.606  4.687   1.00 18.96  ? 198 HIS A CA  1 
ATOM   576   C  C   . HIS A 1 71  ? 57.588  -27.965  4.510   1.00 19.55  ? 198 HIS A C   1 
ATOM   577   O  O   . HIS A 1 71  ? 57.951  -28.733  3.627   1.00 21.44  ? 198 HIS A O   1 
ATOM   578   C  CB  . HIS A 1 71  ? 59.760  -26.660  4.346   1.00 18.63  ? 198 HIS A CB  1 
ATOM   579   C  CG  . HIS A 1 71  ? 60.388  -25.307  4.230   1.00 18.25  ? 198 HIS A CG  1 
ATOM   580   N  ND1 . HIS A 1 71  ? 60.086  -24.437  3.203   1.00 18.67  ? 198 HIS A ND1 1 
ATOM   581   C  CD2 . HIS A 1 71  ? 61.285  -24.664  5.015   1.00 18.20  ? 198 HIS A CD2 1 
ATOM   582   C  CE1 . HIS A 1 71  ? 60.776  -23.321  3.356   1.00 18.59  ? 198 HIS A CE1 1 
ATOM   583   N  NE2 . HIS A 1 71  ? 61.511  -23.432  4.448   1.00 18.68  ? 198 HIS A NE2 1 
ATOM   584   N  N   . VAL A 1 72  ? 56.559  -28.232  5.314   1.00 19.91  ? 199 VAL A N   1 
ATOM   585   C  CA  . VAL A 1 72  ? 55.767  -29.454  5.171   1.00 17.42  ? 199 VAL A CA  1 
ATOM   586   C  C   . VAL A 1 72  ? 54.931  -29.394  3.896   1.00 16.67  ? 199 VAL A C   1 
ATOM   587   O  O   . VAL A 1 72  ? 54.171  -28.447  3.693   1.00 16.19  ? 199 VAL A O   1 
ATOM   588   C  CB  . VAL A 1 72  ? 54.817  -29.660  6.388   1.00 18.23  ? 199 VAL A CB  1 
ATOM   589   C  CG1 . VAL A 1 72  ? 53.825  -30.817  6.133   1.00 17.48  ? 199 VAL A CG1 1 
ATOM   590   C  CG2 . VAL A 1 72  ? 55.612  -29.898  7.661   1.00 17.41  ? 199 VAL A CG2 1 
ATOM   591   N  N   . LYS A 1 73  ? 55.076  -30.405  3.039   1.00 16.03  ? 200 LYS A N   1 
ATOM   592   C  CA  . LYS A 1 73  ? 54.240  -30.549  1.852   1.00 14.92  ? 200 LYS A CA  1 
ATOM   593   C  C   . LYS A 1 73  ? 53.231  -31.676  2.094   1.00 12.89  ? 200 LYS A C   1 
ATOM   594   O  O   . LYS A 1 73  ? 53.611  -32.824  2.359   1.00 9.82   ? 200 LYS A O   1 
ATOM   595   C  CB  . LYS A 1 73  ? 55.100  -30.819  0.607   1.00 16.17  ? 200 LYS A CB  1 
ATOM   596   C  CG  . LYS A 1 73  ? 54.326  -31.238  -0.669  1.00 16.94  ? 200 LYS A CG  1 
ATOM   597   C  CD  . LYS A 1 73  ? 53.619  -30.065  -1.342  1.00 18.77  ? 200 LYS A CD  1 
ATOM   598   C  CE  . LYS A 1 73  ? 52.651  -30.516  -2.462  1.00 19.17  ? 200 LYS A CE  1 
ATOM   599   N  NZ  . LYS A 1 73  ? 51.281  -30.912  -1.944  1.00 18.74  ? 200 LYS A NZ  1 
ATOM   600   N  N   . HIS A 1 74  ? 51.946  -31.328  1.997   1.00 11.03  ? 201 HIS A N   1 
ATOM   601   C  CA  . HIS A 1 74  ? 50.857  -32.273  2.226   1.00 11.10  ? 201 HIS A CA  1 
ATOM   602   C  C   . HIS A 1 74  ? 50.923  -33.403  1.187   1.00 10.29  ? 201 HIS A C   1 
ATOM   603   O  O   . HIS A 1 74  ? 50.765  -33.147  0.006   1.00 10.42  ? 201 HIS A O   1 
ATOM   604   C  CB  . HIS A 1 74  ? 49.508  -31.544  2.128   1.00 10.97  ? 201 HIS A CB  1 
ATOM   605   C  CG  . HIS A 1 74  ? 48.388  -32.227  2.850   1.00 12.58  ? 201 HIS A CG  1 
ATOM   606   N  ND1 . HIS A 1 74  ? 47.140  -31.654  2.990   1.00 12.82  ? 201 HIS A ND1 1 
ATOM   607   C  CD2 . HIS A 1 74  ? 48.335  -33.413  3.506   1.00 12.13  ? 201 HIS A CD2 1 
ATOM   608   C  CE1 . HIS A 1 74  ? 46.359  -32.471  3.680   1.00 13.45  ? 201 HIS A CE1 1 
ATOM   609   N  NE2 . HIS A 1 74  ? 47.061  -33.541  4.011   1.00 13.38  ? 201 HIS A NE2 1 
ATOM   610   N  N   . MET A 1 75  ? 51.147  -34.641  1.627   1.00 9.53   ? 202 MET A N   1 
ATOM   611   C  CA  . MET A 1 75  ? 51.375  -35.761  0.706   1.00 9.47   ? 202 MET A CA  1 
ATOM   612   C  C   . MET A 1 75  ? 50.141  -36.170  -0.103  1.00 9.85   ? 202 MET A C   1 
ATOM   613   O  O   . MET A 1 75  ? 50.233  -36.376  -1.305  1.00 7.84   ? 202 MET A O   1 
ATOM   614   C  CB  . MET A 1 75  ? 51.904  -36.968  1.465   1.00 11.85  ? 202 MET A CB  1 
ATOM   615   C  CG  . MET A 1 75  ? 53.334  -36.823  1.960   1.00 12.06  ? 202 MET A CG  1 
ATOM   616   S  SD  . MET A 1 75  ? 53.717  -38.021  3.262   1.00 14.49  ? 202 MET A SD  1 
ATOM   617   C  CE  . MET A 1 75  ? 55.507  -37.793  3.376   1.00 12.44  ? 202 MET A CE  1 
ATOM   618   N  N   . LEU A 1 76  ? 49.003  -36.320  0.575   1.00 10.70  ? 203 LEU A N   1 
ATOM   619   C  CA  . LEU A 1 76  ? 47.703  -36.542  -0.065  1.00 9.96   ? 203 LEU A CA  1 
ATOM   620   C  C   . LEU A 1 76  ? 47.526  -37.891  -0.759  1.00 9.39   ? 203 LEU A C   1 
ATOM   621   O  O   . LEU A 1 76  ? 46.756  -38.003  -1.706  1.00 7.52   ? 203 LEU A O   1 
ATOM   622   C  CB  . LEU A 1 76  ? 47.381  -35.411  -1.058  1.00 10.93  ? 203 LEU A CB  1 
ATOM   623   C  CG  . LEU A 1 76  ? 47.120  -34.024  -0.482  1.00 10.79  ? 203 LEU A CG  1 
ATOM   624   C  CD1 . LEU A 1 76  ? 46.770  -33.071  -1.614  1.00 9.13   ? 203 LEU A CD1 1 
ATOM   625   C  CD2 . LEU A 1 76  ? 46.011  -34.086  0.561   1.00 9.99   ? 203 LEU A CD2 1 
ATOM   626   N  N   . LEU A 1 77  ? 48.212  -38.920  -0.276  1.00 11.52  ? 204 LEU A N   1 
ATOM   627   C  CA  . LEU A 1 77  ? 48.132  -40.240  -0.891  1.00 11.30  ? 204 LEU A CA  1 
ATOM   628   C  C   . LEU A 1 77  ? 47.449  -41.219  0.084   1.00 11.36  ? 204 LEU A C   1 
ATOM   629   O  O   . LEU A 1 77  ? 46.415  -40.861  0.665   1.00 10.79  ? 204 LEU A O   1 
ATOM   630   C  CB  . LEU A 1 77  ? 49.526  -40.700  -1.361  1.00 10.67  ? 204 LEU A CB  1 
ATOM   631   C  CG  . LEU A 1 77  ? 50.253  -39.829  -2.395  1.00 10.20  ? 204 LEU A CG  1 
ATOM   632   C  CD1 . LEU A 1 77  ? 51.652  -40.385  -2.681  1.00 8.93   ? 204 LEU A CD1 1 
ATOM   633   C  CD2 . LEU A 1 77  ? 49.472  -39.710  -3.705  1.00 7.73   ? 204 LEU A CD2 1 
ATOM   634   N  N   . LEU A 1 78  ? 48.000  -42.427  0.263   1.00 10.63  ? 205 LEU A N   1 
ATOM   635   C  CA  . LEU A 1 78  ? 47.345  -43.479  1.067   1.00 10.77  ? 205 LEU A CA  1 
ATOM   636   C  C   . LEU A 1 78  ? 47.710  -43.376  2.560   1.00 10.67  ? 205 LEU A C   1 
ATOM   637   O  O   . LEU A 1 78  ? 48.223  -42.346  2.987   1.00 11.65  ? 205 LEU A O   1 
ATOM   638   C  CB  . LEU A 1 78  ? 47.620  -44.872  0.463   1.00 10.47  ? 205 LEU A CB  1 
ATOM   639   C  CG  . LEU A 1 78  ? 47.024  -45.045  -0.953  1.00 10.26  ? 205 LEU A CG  1 
ATOM   640   C  CD1 . LEU A 1 78  ? 47.448  -46.359  -1.635  1.00 6.36   ? 205 LEU A CD1 1 
ATOM   641   C  CD2 . LEU A 1 78  ? 45.494  -44.926  -0.922  1.00 8.75   ? 205 LEU A CD2 1 
ATOM   642   N  N   . THR A 1 79  ? 47.407  -44.396  3.359   1.00 10.96  ? 206 THR A N   1 
ATOM   643   C  CA  . THR A 1 79  ? 47.495  -44.294  4.824   1.00 11.94  ? 206 THR A CA  1 
ATOM   644   C  C   . THR A 1 79  ? 48.228  -45.507  5.426   1.00 13.23  ? 206 THR A C   1 
ATOM   645   O  O   . THR A 1 79  ? 47.624  -46.314  6.138   1.00 13.26  ? 206 THR A O   1 
ATOM   646   C  CB  . THR A 1 79  ? 46.062  -44.171  5.448   1.00 12.51  ? 206 THR A CB  1 
ATOM   647   O  OG1 . THR A 1 79  ? 45.307  -43.215  4.707   1.00 14.05  ? 206 THR A OG1 1 
ATOM   648   C  CG2 . THR A 1 79  ? 46.091  -43.735  6.920   1.00 10.14  ? 206 THR A CG2 1 
ATOM   649   N  N   . ASN A 1 80  ? 49.532  -45.617  5.160   1.00 12.74  ? 207 ASN A N   1 
ATOM   650   C  CA  . ASN A 1 80  ? 50.291  -46.803  5.554   1.00 13.12  ? 207 ASN A CA  1 
ATOM   651   C  C   . ASN A 1 80  ? 50.872  -46.648  6.958   1.00 14.91  ? 207 ASN A C   1 
ATOM   652   O  O   . ASN A 1 80  ? 52.093  -46.584  7.158   1.00 14.72  ? 207 ASN A O   1 
ATOM   653   C  CB  . ASN A 1 80  ? 51.369  -47.138  4.525   1.00 11.26  ? 207 ASN A CB  1 
ATOM   654   C  CG  . ASN A 1 80  ? 50.777  -47.604  3.193   1.00 12.59  ? 207 ASN A CG  1 
ATOM   655   O  OD1 . ASN A 1 80  ? 49.791  -48.336  3.178   1.00 12.42  ? 207 ASN A OD1 1 
ATOM   656   N  ND2 . ASN A 1 80  ? 51.388  -47.194  2.072   1.00 9.16   ? 207 ASN A ND2 1 
ATOM   657   N  N   . THR A 1 81  ? 49.961  -46.626  7.925   1.00 14.59  ? 208 THR A N   1 
ATOM   658   C  CA  . THR A 1 81  ? 50.283  -46.311  9.309   1.00 14.18  ? 208 THR A CA  1 
ATOM   659   C  C   . THR A 1 81  ? 51.151  -47.354  9.995   1.00 16.72  ? 208 THR A C   1 
ATOM   660   O  O   . THR A 1 81  ? 51.943  -46.998  10.858  1.00 17.40  ? 208 THR A O   1 
ATOM   661   C  CB  . THR A 1 81  ? 49.003  -46.125  10.153  1.00 13.70  ? 208 THR A CB  1 
ATOM   662   O  OG1 . THR A 1 81  ? 47.985  -45.490  9.365   1.00 11.52  ? 208 THR A OG1 1 
ATOM   663   C  CG2 . THR A 1 81  ? 49.309  -45.271  11.422  1.00 11.75  ? 208 THR A CG2 1 
ATOM   664   N  N   . PHE A 1 82  ? 51.000  -48.633  9.629   1.00 18.53  ? 209 PHE A N   1 
ATOM   665   C  CA  . PHE A 1 82  ? 51.813  -49.696  10.227  1.00 19.08  ? 209 PHE A CA  1 
ATOM   666   C  C   . PHE A 1 82  ? 53.276  -49.509  9.867   1.00 18.18  ? 209 PHE A C   1 
ATOM   667   O  O   . PHE A 1 82  ? 54.129  -49.514  10.743  1.00 20.06  ? 209 PHE A O   1 
ATOM   668   C  CB  . PHE A 1 82  ? 51.335  -51.094  9.819   1.00 19.84  ? 209 PHE A CB  1 
ATOM   669   C  CG  . PHE A 1 82  ? 50.100  -51.558  10.549  1.00 20.54  ? 209 PHE A CG  1 
ATOM   670   C  CD1 . PHE A 1 82  ? 48.836  -51.160  10.131  1.00 19.95  ? 209 PHE A CD1 1 
ATOM   671   C  CD2 . PHE A 1 82  ? 50.206  -52.413  11.646  1.00 21.85  ? 209 PHE A CD2 1 
ATOM   672   C  CE1 . PHE A 1 82  ? 47.694  -51.581  10.803  1.00 22.05  ? 209 PHE A CE1 1 
ATOM   673   C  CE2 . PHE A 1 82  ? 49.067  -52.852  12.332  1.00 22.64  ? 209 PHE A CE2 1 
ATOM   674   C  CZ  . PHE A 1 82  ? 47.805  -52.432  11.916  1.00 22.86  ? 209 PHE A CZ  1 
ATOM   675   N  N   . GLY A 1 83  ? 53.568  -49.329  8.588   1.00 17.85  ? 210 GLY A N   1 
ATOM   676   C  CA  . GLY A 1 83  ? 54.936  -49.014  8.162   1.00 18.71  ? 210 GLY A CA  1 
ATOM   677   C  C   . GLY A 1 83  ? 55.482  -47.738  8.798   1.00 19.46  ? 210 GLY A C   1 
ATOM   678   O  O   . GLY A 1 83  ? 56.661  -47.669  9.145   1.00 20.76  ? 210 GLY A O   1 
ATOM   679   N  N   . ALA A 1 84  ? 54.611  -46.745  8.969   1.00 17.94  ? 211 ALA A N   1 
ATOM   680   C  CA  . ALA A 1 84  ? 54.966  -45.459  9.582   1.00 17.89  ? 211 ALA A CA  1 
ATOM   681   C  C   . ALA A 1 84  ? 55.402  -45.576  11.052  1.00 17.39  ? 211 ALA A C   1 
ATOM   682   O  O   . ALA A 1 84  ? 56.377  -44.949  11.475  1.00 15.92  ? 211 ALA A O   1 
ATOM   683   C  CB  . ALA A 1 84  ? 53.784  -44.493  9.469   1.00 14.13  ? 211 ALA A CB  1 
ATOM   684   N  N   . ILE A 1 85  ? 54.654  -46.361  11.823  1.00 17.27  ? 212 ILE A N   1 
ATOM   685   C  CA  . ILE A 1 85  ? 54.956  -46.580  13.229  1.00 16.46  ? 212 ILE A CA  1 
ATOM   686   C  C   . ILE A 1 85  ? 56.308  -47.308  13.356  1.00 16.85  ? 212 ILE A C   1 
ATOM   687   O  O   . ILE A 1 85  ? 57.093  -47.000  14.241  1.00 17.03  ? 212 ILE A O   1 
ATOM   688   C  CB  . ILE A 1 85  ? 53.829  -47.365  13.940  1.00 14.97  ? 212 ILE A CB  1 
ATOM   689   C  CG1 . ILE A 1 85  ? 52.534  -46.543  13.984  1.00 15.43  ? 212 ILE A CG1 1 
ATOM   690   C  CG2 . ILE A 1 85  ? 54.213  -47.691  15.384  1.00 14.55  ? 212 ILE A CG2 1 
ATOM   691   C  CD1 . ILE A 1 85  ? 51.278  -47.355  14.381  1.00 14.37  ? 212 ILE A CD1 1 
ATOM   692   N  N   . ASN A 1 86  ? 56.586  -48.253  12.461  1.00 17.00  ? 213 ASN A N   1 
ATOM   693   C  CA  . ASN A 1 86  ? 57.905  -48.922  12.449  1.00 17.63  ? 213 ASN A CA  1 
ATOM   694   C  C   . ASN A 1 86  ? 59.019  -47.995  11.983  1.00 16.46  ? 213 ASN A C   1 
ATOM   695   O  O   . ASN A 1 86  ? 60.124  -48.037  12.515  1.00 18.50  ? 213 ASN A O   1 
ATOM   696   C  CB  . ASN A 1 86  ? 57.874  -50.184  11.593  1.00 17.23  ? 213 ASN A CB  1 
ATOM   697   C  CG  . ASN A 1 86  ? 56.993  -51.252  12.188  1.00 19.26  ? 213 ASN A CG  1 
ATOM   698   O  OD1 . ASN A 1 86  ? 57.025  -51.477  13.395  1.00 21.91  ? 213 ASN A OD1 1 
ATOM   699   N  ND2 . ASN A 1 86  ? 56.178  -51.898  11.359  1.00 19.78  ? 213 ASN A ND2 1 
ATOM   700   N  N   . TYR A 1 87  ? 58.719  -47.155  10.997  1.00 16.38  ? 214 TYR A N   1 
ATOM   701   C  CA  . TYR A 1 87  ? 59.679  -46.164  10.525  1.00 15.85  ? 214 TYR A CA  1 
ATOM   702   C  C   . TYR A 1 87  ? 60.116  -45.290  11.686  1.00 15.03  ? 214 TYR A C   1 
ATOM   703   O  O   . TYR A 1 87  ? 61.308  -45.066  11.876  1.00 14.95  ? 214 TYR A O   1 
ATOM   704   C  CB  . TYR A 1 87  ? 59.089  -45.311  9.413   1.00 14.87  ? 214 TYR A CB  1 
ATOM   705   C  CG  . TYR A 1 87  ? 59.937  -44.120  9.030   1.00 16.94  ? 214 TYR A CG  1 
ATOM   706   C  CD1 . TYR A 1 87  ? 60.944  -44.227  8.067   1.00 19.55  ? 214 TYR A CD1 1 
ATOM   707   C  CD2 . TYR A 1 87  ? 59.733  -42.878  9.626   1.00 17.84  ? 214 TYR A CD2 1 
ATOM   708   C  CE1 . TYR A 1 87  ? 61.726  -43.111  7.712   1.00 19.52  ? 214 TYR A CE1 1 
ATOM   709   C  CE2 . TYR A 1 87  ? 60.505  -41.777  9.288   1.00 18.35  ? 214 TYR A CE2 1 
ATOM   710   C  CZ  . TYR A 1 87  ? 61.489  -41.894  8.336   1.00 18.78  ? 214 TYR A CZ  1 
ATOM   711   O  OH  . TYR A 1 87  ? 62.234  -40.788  8.016   1.00 20.81  ? 214 TYR A OH  1 
ATOM   712   N  N   . VAL A 1 88  ? 59.148  -44.808  12.459  1.00 13.57  ? 215 VAL A N   1 
ATOM   713   C  CA  . VAL A 1 88  ? 59.457  -44.010  13.635  1.00 13.52  ? 215 VAL A CA  1 
ATOM   714   C  C   . VAL A 1 88  ? 60.361  -44.747  14.628  1.00 12.96  ? 215 VAL A C   1 
ATOM   715   O  O   . VAL A 1 88  ? 61.383  -44.206  15.065  1.00 11.84  ? 215 VAL A O   1 
ATOM   716   C  CB  . VAL A 1 88  ? 58.186  -43.548  14.360  1.00 13.08  ? 215 VAL A CB  1 
ATOM   717   C  CG1 . VAL A 1 88  ? 58.556  -42.953  15.741  1.00 14.85  ? 215 VAL A CG1 1 
ATOM   718   C  CG2 . VAL A 1 88  ? 57.432  -42.537  13.503  1.00 12.49  ? 215 VAL A CG2 1 
ATOM   719   N  N   . ALA A 1 89  ? 59.990  -45.982  14.961  1.00 12.82  ? 216 ALA A N   1 
ATOM   720   C  CA  . ALA A 1 89  ? 60.720  -46.759  15.949  1.00 14.61  ? 216 ALA A CA  1 
ATOM   721   C  C   . ALA A 1 89  ? 62.184  -47.008  15.557  1.00 16.28  ? 216 ALA A C   1 
ATOM   722   O  O   . ALA A 1 89  ? 63.073  -46.993  16.407  1.00 16.48  ? 216 ALA A O   1 
ATOM   723   C  CB  . ALA A 1 89  ? 60.009  -48.081  16.198  1.00 15.23  ? 216 ALA A CB  1 
ATOM   724   N  N   . THR A 1 90  ? 62.448  -47.227  14.274  1.00 17.41  ? 217 THR A N   1 
ATOM   725   C  CA  . THR A 1 90  ? 63.815  -47.529  13.839  1.00 17.72  ? 217 THR A CA  1 
ATOM   726   C  C   . THR A 1 90  ? 64.555  -46.319  13.256  1.00 17.27  ? 217 THR A C   1 
ATOM   727   O  O   . THR A 1 90  ? 65.782  -46.298  13.279  1.00 15.13  ? 217 THR A O   1 
ATOM   728   C  CB  . THR A 1 90  ? 63.840  -48.666  12.801  1.00 18.93  ? 217 THR A CB  1 
ATOM   729   O  OG1 . THR A 1 90  ? 63.372  -48.175  11.544  1.00 21.47  ? 217 THR A OG1 1 
ATOM   730   C  CG2 . THR A 1 90  ? 62.951  -49.822  13.249  1.00 19.33  ? 217 THR A CG2 1 
ATOM   731   N  N   . GLU A 1 91  ? 63.836  -45.322  12.731  1.00 16.55  ? 218 GLU A N   1 
ATOM   732   C  CA  . GLU A 1 91  ? 64.510  -44.232  12.013  1.00 17.34  ? 218 GLU A CA  1 
ATOM   733   C  C   . GLU A 1 91  ? 64.528  -42.902  12.737  1.00 16.95  ? 218 GLU A C   1 
ATOM   734   O  O   . GLU A 1 91  ? 65.303  -42.021  12.382  1.00 17.01  ? 218 GLU A O   1 
ATOM   735   C  CB  . GLU A 1 91  ? 63.907  -44.022  10.618  1.00 18.59  ? 218 GLU A CB  1 
ATOM   736   C  CG  . GLU A 1 91  ? 63.921  -45.246  9.722   1.00 20.13  ? 218 GLU A CG  1 
ATOM   737   C  CD  . GLU A 1 91  ? 65.307  -45.791  9.477   1.00 22.18  ? 218 GLU A CD  1 
ATOM   738   O  OE1 . GLU A 1 91  ? 66.292  -45.046  9.678   1.00 24.75  ? 218 GLU A OE1 1 
ATOM   739   O  OE2 . GLU A 1 91  ? 65.418  -46.971  9.084   1.00 23.79  ? 218 GLU A OE2 1 
ATOM   740   N  N   . VAL A 1 92  ? 63.678  -42.732  13.736  1.00 17.01  ? 219 VAL A N   1 
ATOM   741   C  CA  . VAL A 1 92  ? 63.538  -41.422  14.353  1.00 16.40  ? 219 VAL A CA  1 
ATOM   742   C  C   . VAL A 1 92  ? 64.129  -41.415  15.737  1.00 15.87  ? 219 VAL A C   1 
ATOM   743   O  O   . VAL A 1 92  ? 64.877  -40.512  16.087  1.00 15.69  ? 219 VAL A O   1 
ATOM   744   C  CB  . VAL A 1 92  ? 62.063  -40.971  14.345  1.00 16.94  ? 219 VAL A CB  1 
ATOM   745   C  CG1 . VAL A 1 92  ? 61.887  -39.641  15.073  1.00 15.01  ? 219 VAL A CG1 1 
ATOM   746   C  CG2 . VAL A 1 92  ? 61.604  -40.879  12.908  1.00 15.35  ? 219 VAL A CG2 1 
ATOM   747   N  N   . PHE A 1 93  ? 63.812  -42.439  16.517  1.00 17.83  ? 220 PHE A N   1 
ATOM   748   C  CA  . PHE A 1 93  ? 64.398  -42.618  17.844  1.00 17.53  ? 220 PHE A CA  1 
ATOM   749   C  C   . PHE A 1 93  ? 65.830  -43.145  17.742  1.00 18.57  ? 220 PHE A C   1 
ATOM   750   O  O   . PHE A 1 93  ? 66.133  -44.243  18.189  1.00 20.31  ? 220 PHE A O   1 
ATOM   751   C  CB  . PHE A 1 93  ? 63.517  -43.553  18.689  1.00 16.17  ? 220 PHE A CB  1 
ATOM   752   C  CG  . PHE A 1 93  ? 62.238  -42.911  19.189  1.00 15.38  ? 220 PHE A CG  1 
ATOM   753   C  CD1 . PHE A 1 93  ? 62.276  -41.953  20.192  1.00 14.41  ? 220 PHE A CD1 1 
ATOM   754   C  CD2 . PHE A 1 93  ? 61.004  -43.290  18.683  1.00 15.02  ? 220 PHE A CD2 1 
ATOM   755   C  CE1 . PHE A 1 93  ? 61.116  -41.379  20.666  1.00 14.20  ? 220 PHE A CE1 1 
ATOM   756   C  CE2 . PHE A 1 93  ? 59.835  -42.727  19.159  1.00 13.78  ? 220 PHE A CE2 1 
ATOM   757   C  CZ  . PHE A 1 93  ? 59.888  -41.765  20.148  1.00 13.69  ? 220 PHE A CZ  1 
ATOM   758   N  N   . ARG A 1 94  ? 66.714  -42.348  17.152  1.00 19.93  ? 221 ARG A N   1 
ATOM   759   C  CA  . ARG A 1 94  ? 68.121  -42.697  17.054  1.00 19.70  ? 221 ARG A CA  1 
ATOM   760   C  C   . ARG A 1 94  ? 68.966  -41.582  17.635  1.00 19.09  ? 221 ARG A C   1 
ATOM   761   O  O   . ARG A 1 94  ? 68.692  -40.401  17.413  1.00 17.40  ? 221 ARG A O   1 
ATOM   762   C  CB  . ARG A 1 94  ? 68.537  -42.922  15.608  1.00 22.34  ? 221 ARG A CB  1 
ATOM   763   C  CG  . ARG A 1 94  ? 67.669  -43.887  14.826  1.00 24.08  ? 221 ARG A CG  1 
ATOM   764   C  CD  . ARG A 1 94  ? 68.523  -44.878  14.054  1.00 26.50  ? 221 ARG A CD  1 
ATOM   765   N  NE  . ARG A 1 94  ? 69.651  -44.257  13.360  1.00 27.88  ? 221 ARG A NE  1 
ATOM   766   C  CZ  . ARG A 1 94  ? 69.625  -43.773  12.120  1.00 29.94  ? 221 ARG A CZ  1 
ATOM   767   N  NH1 . ARG A 1 94  ? 68.514  -43.819  11.382  1.00 31.80  ? 221 ARG A NH1 1 
ATOM   768   N  NH2 . ARG A 1 94  ? 70.731  -43.230  11.609  1.00 30.12  ? 221 ARG A NH2 1 
ATOM   769   N  N   . GLU A 1 95  ? 70.011  -41.973  18.357  1.00 19.76  ? 222 GLU A N   1 
ATOM   770   C  CA  . GLU A 1 95  ? 70.835  -41.039  19.103  1.00 21.37  ? 222 GLU A CA  1 
ATOM   771   C  C   . GLU A 1 95  ? 71.627  -40.121  18.172  1.00 21.72  ? 222 GLU A C   1 
ATOM   772   O  O   . GLU A 1 95  ? 71.993  -39.011  18.560  1.00 21.86  ? 222 GLU A O   1 
ATOM   773   C  CB  . GLU A 1 95  ? 71.770  -41.815  20.036  1.00 23.62  ? 222 GLU A CB  1 
ATOM   774   C  CG  . GLU A 1 95  ? 72.568  -40.945  21.005  1.00 26.16  ? 222 GLU A CG  1 
ATOM   775   C  CD  . GLU A 1 95  ? 73.376  -41.753  22.008  1.00 27.66  ? 222 GLU A CD  1 
ATOM   776   O  OE1 . GLU A 1 95  ? 73.632  -42.953  21.760  1.00 29.48  ? 222 GLU A OE1 1 
ATOM   777   O  OE2 . GLU A 1 95  ? 73.760  -41.180  23.050  1.00 28.80  ? 222 GLU A OE2 1 
ATOM   778   N  N   . GLU A 1 96  ? 71.875  -40.586  16.946  1.00 21.69  ? 223 GLU A N   1 
ATOM   779   C  CA  . GLU A 1 96  ? 72.582  -39.810  15.919  1.00 21.57  ? 223 GLU A CA  1 
ATOM   780   C  C   . GLU A 1 96  ? 71.767  -38.617  15.429  1.00 19.47  ? 223 GLU A C   1 
ATOM   781   O  O   . GLU A 1 96  ? 72.324  -37.638  14.929  1.00 19.10  ? 223 GLU A O   1 
ATOM   782   C  CB  . GLU A 1 96  ? 72.914  -40.702  14.714  1.00 24.08  ? 223 GLU A CB  1 
ATOM   783   C  CG  . GLU A 1 96  ? 74.102  -41.647  14.931  1.00 26.21  ? 223 GLU A CG  1 
ATOM   784   C  CD  . GLU A 1 96  ? 73.787  -42.866  15.815  1.00 27.83  ? 223 GLU A CD  1 
ATOM   785   O  OE1 . GLU A 1 96  ? 72.581  -43.173  16.042  1.00 26.44  ? 223 GLU A OE1 1 
ATOM   786   O  OE2 . GLU A 1 96  ? 74.771  -43.518  16.270  1.00 28.52  ? 223 GLU A OE2 1 
ATOM   787   N  N   . LEU A 1 97  ? 70.447  -38.729  15.550  1.00 16.79  ? 224 LEU A N   1 
ATOM   788   C  CA  . LEU A 1 97  ? 69.517  -37.671  15.179  1.00 15.06  ? 224 LEU A CA  1 
ATOM   789   C  C   . LEU A 1 97  ? 68.966  -36.941  16.411  1.00 13.51  ? 224 LEU A C   1 
ATOM   790   O  O   . LEU A 1 97  ? 67.971  -36.225  16.303  1.00 9.26   ? 224 LEU A O   1 
ATOM   791   C  CB  . LEU A 1 97  ? 68.359  -38.268  14.379  1.00 15.01  ? 224 LEU A CB  1 
ATOM   792   C  CG  . LEU A 1 97  ? 68.757  -39.179  13.218  1.00 15.93  ? 224 LEU A CG  1 
ATOM   793   C  CD1 . LEU A 1 97  ? 67.525  -39.761  12.560  1.00 15.26  ? 224 LEU A CD1 1 
ATOM   794   C  CD2 . LEU A 1 97  ? 69.605  -38.417  12.204  1.00 15.59  ? 224 LEU A CD2 1 
ATOM   795   N  N   . GLY A 1 98  ? 69.606  -37.147  17.570  1.00 13.29  ? 225 GLY A N   1 
ATOM   796   C  CA  . GLY A 1 98  ? 69.322  -36.384  18.791  1.00 13.34  ? 225 GLY A CA  1 
ATOM   797   C  C   . GLY A 1 98  ? 68.496  -37.070  19.880  1.00 13.86  ? 225 GLY A C   1 
ATOM   798   O  O   . GLY A 1 98  ? 68.306  -36.496  20.952  1.00 13.31  ? 225 GLY A O   1 
ATOM   799   N  N   . ALA A 1 99  ? 67.999  -38.281  19.624  1.00 15.22  ? 226 ALA A N   1 
ATOM   800   C  CA  . ALA A 1 99  ? 67.306  -39.071  20.654  1.00 15.18  ? 226 ALA A CA  1 
ATOM   801   C  C   . ALA A 1 99  ? 68.185  -39.272  21.888  1.00 15.68  ? 226 ALA A C   1 
ATOM   802   O  O   . ALA A 1 99  ? 69.384  -39.534  21.774  1.00 17.52  ? 226 ALA A O   1 
ATOM   803   C  CB  . ALA A 1 99  ? 66.881  -40.414  20.097  1.00 14.91  ? 226 ALA A CB  1 
ATOM   804   N  N   . ARG A 1 100 ? 67.585  -39.137  23.068  1.00 15.84  ? 227 ARG A N   1 
ATOM   805   C  CA  . ARG A 1 100 ? 68.300  -39.317  24.338  1.00 15.53  ? 227 ARG A CA  1 
ATOM   806   C  C   . ARG A 1 100 ? 68.003  -40.696  24.939  1.00 15.85  ? 227 ARG A C   1 
ATOM   807   O  O   . ARG A 1 100 ? 66.846  -41.090  25.047  1.00 15.69  ? 227 ARG A O   1 
ATOM   808   C  CB  . ARG A 1 100 ? 67.883  -38.234  25.334  1.00 14.91  ? 227 ARG A CB  1 
ATOM   809   C  CG  . ARG A 1 100 ? 68.306  -36.820  24.964  1.00 14.54  ? 227 ARG A CG  1 
ATOM   810   C  CD  . ARG A 1 100 ? 67.607  -35.796  25.859  1.00 15.13  ? 227 ARG A CD  1 
ATOM   811   N  NE  . ARG A 1 100 ? 66.160  -35.813  25.642  1.00 15.98  ? 227 ARG A NE  1 
ATOM   812   C  CZ  . ARG A 1 100 ? 65.274  -35.065  26.297  1.00 16.48  ? 227 ARG A CZ  1 
ATOM   813   N  NH1 . ARG A 1 100 ? 65.665  -34.217  27.241  1.00 17.34  ? 227 ARG A NH1 1 
ATOM   814   N  NH2 . ARG A 1 100 ? 63.983  -35.166  26.005  1.00 15.60  ? 227 ARG A NH2 1 
ATOM   815   N  N   . PRO A 1 101 ? 69.043  -41.438  25.337  1.00 18.50  ? 228 PRO A N   1 
ATOM   816   C  CA  . PRO A 1 101 ? 68.777  -42.724  25.999  1.00 19.26  ? 228 PRO A CA  1 
ATOM   817   C  C   . PRO A 1 101 ? 68.185  -42.550  27.412  1.00 19.45  ? 228 PRO A C   1 
ATOM   818   O  O   . PRO A 1 101 ? 67.420  -43.390  27.880  1.00 18.57  ? 228 PRO A O   1 
ATOM   819   C  CB  . PRO A 1 101 ? 70.155  -43.392  26.030  1.00 19.70  ? 228 PRO A CB  1 
ATOM   820   C  CG  . PRO A 1 101 ? 71.136  -42.265  26.003  1.00 19.70  ? 228 PRO A CG  1 
ATOM   821   C  CD  . PRO A 1 101 ? 70.486  -41.141  25.243  1.00 19.33  ? 228 PRO A CD  1 
ATOM   822   N  N   . ASP A 1 102 ? 68.519  -41.440  28.059  1.00 21.64  ? 229 ASP A N   1 
ATOM   823   C  CA  . ASP A 1 102 ? 67.943  -41.066  29.353  1.00 23.69  ? 229 ASP A CA  1 
ATOM   824   C  C   . ASP A 1 102 ? 66.611  -40.326  29.189  1.00 22.55  ? 229 ASP A C   1 
ATOM   825   O  O   . ASP A 1 102 ? 66.454  -39.216  29.694  1.00 24.78  ? 229 ASP A O   1 
ATOM   826   C  CB  . ASP A 1 102 ? 68.931  -40.166  30.101  1.00 27.10  ? 229 ASP A CB  1 
ATOM   827   C  CG  . ASP A 1 102 ? 69.290  -38.894  29.311  1.00 30.81  ? 229 ASP A CG  1 
ATOM   828   O  OD1 . ASP A 1 102 ? 69.694  -39.000  28.122  1.00 31.37  ? 229 ASP A OD1 1 
ATOM   829   O  OD2 . ASP A 1 102 ? 69.170  -37.790  29.888  1.00 33.66  ? 229 ASP A OD2 1 
ATOM   830   N  N   . ALA A 1 103 ? 65.656  -40.927  28.484  1.00 19.40  ? 230 ALA A N   1 
ATOM   831   C  CA  . ALA A 1 103 ? 64.374  -40.255  28.182  1.00 16.97  ? 230 ALA A CA  1 
ATOM   832   C  C   . ALA A 1 103 ? 63.265  -41.274  27.939  1.00 14.81  ? 230 ALA A C   1 
ATOM   833   O  O   . ALA A 1 103 ? 63.518  -42.370  27.426  1.00 13.01  ? 230 ALA A O   1 
ATOM   834   C  CB  . ALA A 1 103 ? 64.516  -39.342  26.964  1.00 14.68  ? 230 ALA A CB  1 
ATOM   835   N  N   . THR A 1 104 ? 62.038  -40.921  28.308  1.00 12.88  ? 231 THR A N   1 
ATOM   836   C  CA  . THR A 1 104 ? 60.898  -41.787  28.001  1.00 12.99  ? 231 THR A CA  1 
ATOM   837   C  C   . THR A 1 104 ? 60.465  -41.541  26.556  1.00 12.52  ? 231 THR A C   1 
ATOM   838   O  O   . THR A 1 104 ? 60.264  -40.397  26.150  1.00 12.88  ? 231 THR A O   1 
ATOM   839   C  CB  . THR A 1 104 ? 59.722  -41.571  28.983  1.00 12.23  ? 231 THR A CB  1 
ATOM   840   O  OG1 . THR A 1 104 ? 60.117  -41.998  30.299  1.00 11.87  ? 231 THR A OG1 1 
ATOM   841   C  CG2 . THR A 1 104 ? 58.499  -42.368  28.543  1.00 10.44  ? 231 THR A CG2 1 
ATOM   842   N  N   . LYS A 1 105 ? 60.338  -42.612  25.779  1.00 13.37  ? 232 LYS A N   1 
ATOM   843   C  CA  . LYS A 1 105 ? 59.931  -42.497  24.377  1.00 15.42  ? 232 LYS A CA  1 
ATOM   844   C  C   . LYS A 1 105 ? 58.409  -42.428  24.226  1.00 14.84  ? 232 LYS A C   1 
ATOM   845   O  O   . LYS A 1 105 ? 57.693  -43.348  24.619  1.00 15.42  ? 232 LYS A O   1 
ATOM   846   C  CB  . LYS A 1 105 ? 60.481  -43.667  23.557  1.00 17.08  ? 232 LYS A CB  1 
ATOM   847   C  CG  . LYS A 1 105 ? 61.993  -43.689  23.447  1.00 19.49  ? 232 LYS A CG  1 
ATOM   848   C  CD  . LYS A 1 105 ? 62.484  -44.936  22.692  1.00 21.84  ? 232 LYS A CD  1 
ATOM   849   C  CE  . LYS A 1 105 ? 63.906  -45.351  23.104  1.00 24.56  ? 232 LYS A CE  1 
ATOM   850   N  NZ  . LYS A 1 105 ? 64.975  -44.634  22.329  1.00 26.84  ? 232 LYS A NZ  1 
ATOM   851   N  N   . VAL A 1 106 ? 57.919  -41.342  23.641  1.00 14.95  ? 233 VAL A N   1 
ATOM   852   C  CA  . VAL A 1 106 ? 56.477  -41.167  23.432  1.00 14.53  ? 233 VAL A CA  1 
ATOM   853   C  C   . VAL A 1 106 ? 56.150  -40.891  21.961  1.00 13.53  ? 233 VAL A C   1 
ATOM   854   O  O   . VAL A 1 106 ? 56.839  -40.133  21.290  1.00 10.69  ? 233 VAL A O   1 
ATOM   855   C  CB  . VAL A 1 106 ? 55.880  -40.047  24.337  1.00 14.54  ? 233 VAL A CB  1 
ATOM   856   C  CG1 . VAL A 1 106 ? 54.373  -39.883  24.073  1.00 13.82  ? 233 VAL A CG1 1 
ATOM   857   C  CG2 . VAL A 1 106 ? 56.124  -40.356  25.816  1.00 12.64  ? 233 VAL A CG2 1 
ATOM   858   N  N   . LEU A 1 107 ? 55.098  -41.548  21.483  1.00 13.91  ? 234 LEU A N   1 
ATOM   859   C  CA  . LEU A 1 107 ? 54.598  -41.390  20.130  1.00 15.39  ? 234 LEU A CA  1 
ATOM   860   C  C   . LEU A 1 107 ? 53.163  -40.870  20.230  1.00 16.55  ? 234 LEU A C   1 
ATOM   861   O  O   . LEU A 1 107 ? 52.346  -41.435  20.956  1.00 17.20  ? 234 LEU A O   1 
ATOM   862   C  CB  . LEU A 1 107 ? 54.646  -42.738  19.414  1.00 15.64  ? 234 LEU A CB  1 
ATOM   863   C  CG  . LEU A 1 107 ? 54.517  -42.886  17.884  1.00 17.32  ? 234 LEU A CG  1 
ATOM   864   C  CD1 . LEU A 1 107 ? 55.117  -41.718  17.069  1.00 15.70  ? 234 LEU A CD1 1 
ATOM   865   C  CD2 . LEU A 1 107 ? 55.131  -44.253  17.445  1.00 15.19  ? 234 LEU A CD2 1 
ATOM   866   N  N   . ILE A 1 108 ? 52.894  -39.756  19.553  1.00 15.68  ? 235 ILE A N   1 
ATOM   867   C  CA  . ILE A 1 108 ? 51.549  -39.245  19.371  1.00 15.25  ? 235 ILE A CA  1 
ATOM   868   C  C   . ILE A 1 108 ? 51.148  -39.473  17.919  1.00 16.52  ? 235 ILE A C   1 
ATOM   869   O  O   . ILE A 1 108 ? 51.646  -38.795  17.017  1.00 15.33  ? 235 ILE A O   1 
ATOM   870   C  CB  . ILE A 1 108 ? 51.454  -37.750  19.702  1.00 15.46  ? 235 ILE A CB  1 
ATOM   871   C  CG1 . ILE A 1 108 ? 51.759  -37.529  21.188  1.00 16.47  ? 235 ILE A CG1 1 
ATOM   872   C  CG2 . ILE A 1 108 ? 50.044  -37.201  19.375  1.00 14.69  ? 235 ILE A CG2 1 
ATOM   873   C  CD1 . ILE A 1 108 ? 51.243  -36.206  21.723  1.00 17.61  ? 235 ILE A CD1 1 
ATOM   874   N  N   . ILE A 1 109 ? 50.271  -40.457  17.700  1.00 16.87  ? 236 ILE A N   1 
ATOM   875   C  CA  . ILE A 1 109 ? 49.809  -40.803  16.357  1.00 14.31  ? 236 ILE A CA  1 
ATOM   876   C  C   . ILE A 1 109 ? 48.514  -40.071  16.097  1.00 13.43  ? 236 ILE A C   1 
ATOM   877   O  O   . ILE A 1 109 ? 47.525  -40.305  16.780  1.00 10.43  ? 236 ILE A O   1 
ATOM   878   C  CB  . ILE A 1 109 ? 49.582  -42.313  16.178  1.00 14.07  ? 236 ILE A CB  1 
ATOM   879   C  CG1 . ILE A 1 109 ? 50.886  -43.086  16.392  1.00 16.18  ? 236 ILE A CG1 1 
ATOM   880   C  CG2 . ILE A 1 109 ? 49.060  -42.618  14.775  1.00 12.59  ? 236 ILE A CG2 1 
ATOM   881   C  CD1 . ILE A 1 109 ? 50.677  -44.609  16.616  1.00 16.50  ? 236 ILE A CD1 1 
ATOM   882   N  N   . ILE A 1 110 ? 48.541  -39.187  15.100  1.00 14.20  ? 237 ILE A N   1 
ATOM   883   C  CA  . ILE A 1 110 ? 47.418  -38.343  14.750  1.00 16.38  ? 237 ILE A CA  1 
ATOM   884   C  C   . ILE A 1 110 ? 46.837  -38.820  13.408  1.00 16.98  ? 237 ILE A C   1 
ATOM   885   O  O   . ILE A 1 110 ? 47.502  -38.718  12.378  1.00 18.74  ? 237 ILE A O   1 
ATOM   886   C  CB  . ILE A 1 110 ? 47.842  -36.843  14.647  1.00 16.38  ? 237 ILE A CB  1 
ATOM   887   C  CG1 . ILE A 1 110 ? 48.775  -36.460  15.814  1.00 15.78  ? 237 ILE A CG1 1 
ATOM   888   C  CG2 . ILE A 1 110 ? 46.598  -35.958  14.579  1.00 14.30  ? 237 ILE A CG2 1 
ATOM   889   C  CD1 . ILE A 1 110 ? 49.280  -35.007  15.781  1.00 14.43  ? 237 ILE A CD1 1 
ATOM   890   N  N   . THR A 1 111 ? 45.605  -39.339  13.432  1.00 15.31  ? 238 THR A N   1 
ATOM   891   C  CA  . THR A 1 111 ? 45.025  -40.013  12.268  1.00 13.35  ? 238 THR A CA  1 
ATOM   892   C  C   . THR A 1 111 ? 43.501  -39.996  12.335  1.00 14.07  ? 238 THR A C   1 
ATOM   893   O  O   . THR A 1 111 ? 42.924  -39.587  13.343  1.00 14.66  ? 238 THR A O   1 
ATOM   894   C  CB  . THR A 1 111 ? 45.580  -41.485  12.094  1.00 11.82  ? 238 THR A CB  1 
ATOM   895   O  OG1 . THR A 1 111 ? 45.256  -41.987  10.778  1.00 9.45   ? 238 THR A OG1 1 
ATOM   896   C  CG2 . THR A 1 111 ? 45.029  -42.430  13.167  1.00 8.68   ? 238 THR A CG2 1 
ATOM   897   N  N   . ASP A 1 112 ? 42.858  -40.432  11.252  1.00 14.66  ? 239 ASP A N   1 
ATOM   898   C  CA  . ASP A 1 112 ? 41.421  -40.249  11.082  1.00 14.47  ? 239 ASP A CA  1 
ATOM   899   C  C   . ASP A 1 112 ? 40.615  -41.545  11.005  1.00 13.81  ? 239 ASP A C   1 
ATOM   900   O  O   . ASP A 1 112 ? 39.414  -41.503  10.729  1.00 11.90  ? 239 ASP A O   1 
ATOM   901   C  CB  . ASP A 1 112 ? 41.157  -39.384  9.841   1.00 15.16  ? 239 ASP A CB  1 
ATOM   902   C  CG  . ASP A 1 112 ? 41.392  -40.128  8.508   1.00 16.12  ? 239 ASP A CG  1 
ATOM   903   O  OD1 . ASP A 1 112 ? 41.986  -41.225  8.492   1.00 17.41  ? 239 ASP A OD1 1 
ATOM   904   O  OD2 . ASP A 1 112 ? 40.967  -39.597  7.460   1.00 16.01  ? 239 ASP A OD2 1 
ATOM   905   N  N   . GLY A 1 113 ? 41.271  -42.674  11.262  1.00 13.52  ? 240 GLY A N   1 
ATOM   906   C  CA  . GLY A 1 113 ? 40.655  -43.989  11.139  1.00 14.53  ? 240 GLY A CA  1 
ATOM   907   C  C   . GLY A 1 113 ? 41.700  -45.054  10.844  1.00 16.77  ? 240 GLY A C   1 
ATOM   908   O  O   . GLY A 1 113 ? 42.853  -44.919  11.253  1.00 18.36  ? 240 GLY A O   1 
ATOM   909   N  N   . GLU A 1 114 ? 41.307  -46.101  10.116  1.00 18.74  ? 241 GLU A N   1 
ATOM   910   C  CA  . GLU A 1 114 ? 42.159  -47.283  9.933   1.00 18.93  ? 241 GLU A CA  1 
ATOM   911   C  C   . GLU A 1 114 ? 43.230  -47.090  8.852   1.00 17.18  ? 241 GLU A C   1 
ATOM   912   O  O   . GLU A 1 114 ? 43.260  -46.066  8.166   1.00 16.89  ? 241 GLU A O   1 
ATOM   913   C  CB  . GLU A 1 114 ? 41.322  -48.556  9.690   1.00 20.90  ? 241 GLU A CB  1 
ATOM   914   C  CG  . GLU A 1 114 ? 40.609  -48.674  8.348   1.00 23.15  ? 241 GLU A CG  1 
ATOM   915   C  CD  . GLU A 1 114 ? 39.201  -48.096  8.371   1.00 26.44  ? 241 GLU A CD  1 
ATOM   916   O  OE1 . GLU A 1 114 ? 38.933  -47.226  9.242   1.00 27.69  ? 241 GLU A OE1 1 
ATOM   917   O  OE2 . GLU A 1 114 ? 38.371  -48.499  7.508   1.00 26.50  ? 241 GLU A OE2 1 
ATOM   918   N  N   . ALA A 1 115 ? 44.122  -48.073  8.744   1.00 15.47  ? 242 ALA A N   1 
ATOM   919   C  CA  . ALA A 1 115 ? 45.287  -47.983  7.874   1.00 14.56  ? 242 ALA A CA  1 
ATOM   920   C  C   . ALA A 1 115 ? 44.999  -48.700  6.584   1.00 13.93  ? 242 ALA A C   1 
ATOM   921   O  O   . ALA A 1 115 ? 44.176  -49.629  6.535   1.00 13.94  ? 242 ALA A O   1 
ATOM   922   C  CB  . ALA A 1 115 ? 46.526  -48.601  8.547   1.00 13.19  ? 242 ALA A CB  1 
ATOM   923   N  N   . THR A 1 116 ? 45.690  -48.270  5.543   1.00 14.21  ? 243 THR A N   1 
ATOM   924   C  CA  . THR A 1 116 ? 45.686  -48.980  4.275   1.00 16.60  ? 243 THR A CA  1 
ATOM   925   C  C   . THR A 1 116 ? 46.511  -50.259  4.335   1.00 16.60  ? 243 THR A C   1 
ATOM   926   O  O   . THR A 1 116 ? 46.241  -51.194  3.591   1.00 19.16  ? 243 THR A O   1 
ATOM   927   C  CB  . THR A 1 116 ? 46.309  -48.148  3.147   1.00 16.81  ? 243 THR A CB  1 
ATOM   928   O  OG1 . THR A 1 116 ? 45.763  -46.838  3.157   1.00 17.20  ? 243 THR A OG1 1 
ATOM   929   C  CG2 . THR A 1 116 ? 46.026  -48.815  1.790   1.00 18.91  ? 243 THR A CG2 1 
ATOM   930   N  N   . ASP A 1 117 ? 47.538  -50.273  5.179   1.00 16.15  ? 244 ASP A N   1 
ATOM   931   C  CA  . ASP A 1 117 ? 48.450  -51.407  5.267   1.00 16.40  ? 244 ASP A CA  1 
ATOM   932   C  C   . ASP A 1 117 ? 48.144  -52.256  6.493   1.00 17.16  ? 244 ASP A C   1 
ATOM   933   O  O   . ASP A 1 117 ? 47.171  -52.000  7.192   1.00 17.44  ? 244 ASP A O   1 
ATOM   934   C  CB  . ASP A 1 117 ? 49.924  -50.941  5.226   1.00 16.08  ? 244 ASP A CB  1 
ATOM   935   C  CG  . ASP A 1 117 ? 50.355  -50.116  6.453   1.00 14.73  ? 244 ASP A CG  1 
ATOM   936   O  OD1 . ASP A 1 117 ? 49.535  -49.727  7.302   1.00 13.51  ? 244 ASP A OD1 1 
ATOM   937   O  OD2 . ASP A 1 117 ? 51.562  -49.830  6.550   1.00 16.01  ? 244 ASP A OD2 1 
ATOM   938   N  N   . SER A 1 118 ? 48.954  -53.290  6.710   1.00 18.75  ? 245 SER A N   1 
ATOM   939   C  CA  . SER A 1 118 ? 48.871  -54.132  7.894   1.00 19.63  ? 245 SER A CA  1 
ATOM   940   C  C   . SER A 1 118 ? 50.276  -54.562  8.296   1.00 20.78  ? 245 SER A C   1 
ATOM   941   O  O   . SER A 1 118 ? 51.245  -54.256  7.609   1.00 21.45  ? 245 SER A O   1 
ATOM   942   C  CB  . SER A 1 118 ? 48.017  -55.362  7.606   1.00 20.75  ? 245 SER A CB  1 
ATOM   943   O  OG  . SER A 1 118 ? 48.641  -56.211  6.649   1.00 20.96  ? 245 SER A OG  1 
ATOM   944   N  N   . GLY A 1 119 ? 50.376  -55.271  9.412   1.00 22.89  ? 246 GLY A N   1 
ATOM   945   C  CA  . GLY A 1 119 ? 51.644  -55.832  9.875   1.00 23.99  ? 246 GLY A CA  1 
ATOM   946   C  C   . GLY A 1 119 ? 51.718  -55.881  11.389  1.00 25.21  ? 246 GLY A C   1 
ATOM   947   O  O   . GLY A 1 119 ? 50.695  -55.791  12.072  1.00 28.20  ? 246 GLY A O   1 
ATOM   948   N  N   . ASN A 1 120 ? 52.925  -56.048  11.918  1.00 24.72  ? 247 ASN A N   1 
ATOM   949   C  CA  . ASN A 1 120 ? 53.148  -55.903  13.348  1.00 23.94  ? 247 ASN A CA  1 
ATOM   950   C  C   . ASN A 1 120 ? 53.892  -54.603  13.600  1.00 22.92  ? 247 ASN A C   1 
ATOM   951   O  O   . ASN A 1 120 ? 54.532  -54.056  12.698  1.00 22.55  ? 247 ASN A O   1 
ATOM   952   C  CB  . ASN A 1 120 ? 53.916  -57.096  13.914  1.00 24.33  ? 247 ASN A CB  1 
ATOM   953   C  CG  . ASN A 1 120 ? 55.412  -56.997  13.689  1.00 25.30  ? 247 ASN A CG  1 
ATOM   954   O  OD1 . ASN A 1 120 ? 56.088  -56.151  14.273  1.00 25.96  ? 247 ASN A OD1 1 
ATOM   955   N  ND2 . ASN A 1 120 ? 55.940  -57.880  12.857  1.00 25.40  ? 247 ASN A ND2 1 
ATOM   956   N  N   . ILE A 1 121 ? 53.800  -54.112  14.829  1.00 20.94  ? 248 ILE A N   1 
ATOM   957   C  CA  . ILE A 1 121 ? 54.550  -52.939  15.228  1.00 18.92  ? 248 ILE A CA  1 
ATOM   958   C  C   . ILE A 1 121 ? 55.397  -53.282  16.444  1.00 18.52  ? 248 ILE A C   1 
ATOM   959   O  O   . ILE A 1 121 ? 55.577  -52.471  17.344  1.00 16.51  ? 248 ILE A O   1 
ATOM   960   C  CB  . ILE A 1 121 ? 53.626  -51.719  15.461  1.00 18.84  ? 248 ILE A CB  1 
ATOM   961   C  CG1 . ILE A 1 121 ? 52.484  -52.059  16.427  1.00 19.26  ? 248 ILE A CG1 1 
ATOM   962   C  CG2 . ILE A 1 121 ? 53.064  -51.226  14.124  1.00 16.53  ? 248 ILE A CG2 1 
ATOM   963   C  CD1 . ILE A 1 121 ? 51.894  -50.843  17.166  1.00 18.44  ? 248 ILE A CD1 1 
ATOM   964   N  N   . ASP A 1 122 ? 55.951  -54.494  16.441  1.00 19.69  ? 249 ASP A N   1 
ATOM   965   C  CA  . ASP A 1 122 ? 56.813  -54.951  17.536  1.00 20.32  ? 249 ASP A CA  1 
ATOM   966   C  C   . ASP A 1 122 ? 58.002  -54.018  17.751  1.00 19.32  ? 249 ASP A C   1 
ATOM   967   O  O   . ASP A 1 122 ? 58.443  -53.833  18.884  1.00 18.55  ? 249 ASP A O   1 
ATOM   968   C  CB  . ASP A 1 122 ? 57.301  -56.380  17.293  1.00 21.22  ? 249 ASP A CB  1 
ATOM   969   C  CG  . ASP A 1 122 ? 56.241  -57.425  17.602  1.00 22.61  ? 249 ASP A CG  1 
ATOM   970   O  OD1 . ASP A 1 122 ? 55.107  -57.062  17.991  1.00 23.79  ? 249 ASP A OD1 1 
ATOM   971   O  OD2 . ASP A 1 122 ? 56.556  -58.627  17.473  1.00 24.54  ? 249 ASP A OD2 1 
ATOM   972   N  N   . ALA A 1 123 ? 58.497  -53.409  16.674  1.00 17.48  ? 250 ALA A N   1 
ATOM   973   C  CA  . ALA A 1 123 ? 59.593  -52.442  16.780  1.00 15.96  ? 250 ALA A CA  1 
ATOM   974   C  C   . ALA A 1 123 ? 59.259  -51.310  17.730  1.00 15.51  ? 250 ALA A C   1 
ATOM   975   O  O   . ALA A 1 123 ? 60.155  -50.746  18.351  1.00 14.17  ? 250 ALA A O   1 
ATOM   976   C  CB  . ALA A 1 123 ? 59.961  -51.885  15.414  1.00 13.88  ? 250 ALA A CB  1 
ATOM   977   N  N   . ALA A 1 124 ? 57.969  -50.986  17.842  1.00 17.65  ? 251 ALA A N   1 
ATOM   978   C  CA  . ALA A 1 124 ? 57.497  -49.857  18.655  1.00 17.63  ? 251 ALA A CA  1 
ATOM   979   C  C   . ALA A 1 124 ? 57.047  -50.251  20.065  1.00 17.76  ? 251 ALA A C   1 
ATOM   980   O  O   . ALA A 1 124 ? 56.527  -49.418  20.796  1.00 17.38  ? 251 ALA A O   1 
ATOM   981   C  CB  . ALA A 1 124 ? 56.366  -49.140  17.931  1.00 18.40  ? 251 ALA A CB  1 
ATOM   982   N  N   . LYS A 1 125 ? 57.275  -51.508  20.439  1.00 19.65  ? 252 LYS A N   1 
ATOM   983   C  CA  . LYS A 1 125 ? 56.826  -52.070  21.713  1.00 21.04  ? 252 LYS A CA  1 
ATOM   984   C  C   . LYS A 1 125 ? 57.141  -51.173  22.904  1.00 21.08  ? 252 LYS A C   1 
ATOM   985   O  O   . LYS A 1 125 ? 56.288  -50.957  23.756  1.00 22.04  ? 252 LYS A O   1 
ATOM   986   C  CB  . LYS A 1 125 ? 57.492  -53.431  21.929  1.00 22.53  ? 252 LYS A CB  1 
ATOM   987   C  CG  . LYS A 1 125 ? 56.806  -54.368  22.924  1.00 24.67  ? 252 LYS A CG  1 
ATOM   988   C  CD  . LYS A 1 125 ? 57.413  -55.799  22.848  1.00 26.42  ? 252 LYS A CD  1 
ATOM   989   C  CE  . LYS A 1 125 ? 56.979  -56.568  21.567  1.00 27.55  ? 252 LYS A CE  1 
ATOM   990   N  NZ  . LYS A 1 125 ? 57.974  -57.583  21.060  1.00 26.81  ? 252 LYS A NZ  1 
ATOM   991   N  N   . ASP A 1 126 ? 58.367  -50.658  22.962  1.00 21.13  ? 253 ASP A N   1 
ATOM   992   C  CA  . ASP A 1 126 ? 58.853  -49.951  24.152  1.00 21.50  ? 253 ASP A CA  1 
ATOM   993   C  C   . ASP A 1 126 ? 58.619  -48.433  24.086  1.00 20.55  ? 253 ASP A C   1 
ATOM   994   O  O   . ASP A 1 126 ? 59.114  -47.678  24.926  1.00 19.60  ? 253 ASP A O   1 
ATOM   995   C  CB  . ASP A 1 126 ? 60.327  -50.284  24.377  1.00 21.93  ? 253 ASP A CB  1 
ATOM   996   C  CG  . ASP A 1 126 ? 60.561  -51.789  24.551  1.00 25.18  ? 253 ASP A CG  1 
ATOM   997   O  OD1 . ASP A 1 126 ? 59.921  -52.396  25.448  1.00 26.17  ? 253 ASP A OD1 1 
ATOM   998   O  OD2 . ASP A 1 126 ? 61.371  -52.370  23.785  1.00 25.44  ? 253 ASP A OD2 1 
ATOM   999   N  N   . ILE A 1 127 ? 57.857  -48.000  23.086  1.00 19.85  ? 254 ILE A N   1 
ATOM   1000  C  CA  . ILE A 1 127 ? 57.423  -46.617  22.968  1.00 18.79  ? 254 ILE A CA  1 
ATOM   1001  C  C   . ILE A 1 127 ? 56.018  -46.533  23.542  1.00 18.08  ? 254 ILE A C   1 
ATOM   1002  O  O   . ILE A 1 127 ? 55.221  -47.435  23.325  1.00 18.38  ? 254 ILE A O   1 
ATOM   1003  C  CB  . ILE A 1 127 ? 57.402  -46.177  21.486  1.00 18.77  ? 254 ILE A CB  1 
ATOM   1004  C  CG1 . ILE A 1 127 ? 58.775  -46.417  20.835  1.00 19.24  ? 254 ILE A CG1 1 
ATOM   1005  C  CG2 . ILE A 1 127 ? 56.986  -44.721  21.361  1.00 16.29  ? 254 ILE A CG2 1 
ATOM   1006  C  CD1 . ILE A 1 127 ? 58.759  -46.264  19.308  1.00 18.70  ? 254 ILE A CD1 1 
ATOM   1007  N  N   . ILE A 1 128 ? 55.722  -45.468  24.284  1.00 17.87  ? 255 ILE A N   1 
ATOM   1008  C  CA  . ILE A 1 128 ? 54.371  -45.225  24.794  1.00 16.94  ? 255 ILE A CA  1 
ATOM   1009  C  C   . ILE A 1 128 ? 53.574  -44.577  23.672  1.00 16.08  ? 255 ILE A C   1 
ATOM   1010  O  O   . ILE A 1 128 ? 54.006  -43.567  23.133  1.00 16.93  ? 255 ILE A O   1 
ATOM   1011  C  CB  . ILE A 1 128 ? 54.366  -44.286  26.042  1.00 16.83  ? 255 ILE A CB  1 
ATOM   1012  C  CG1 . ILE A 1 128 ? 55.134  -44.914  27.207  1.00 16.96  ? 255 ILE A CG1 1 
ATOM   1013  C  CG2 . ILE A 1 128 ? 52.943  -44.014  26.495  1.00 17.46  ? 255 ILE A CG2 1 
ATOM   1014  C  CD1 . ILE A 1 128 ? 55.298  -43.980  28.411  1.00 16.58  ? 255 ILE A CD1 1 
ATOM   1015  N  N   . ARG A 1 129 ? 52.414  -45.141  23.334  1.00 14.92  ? 256 ARG A N   1 
ATOM   1016  C  CA  . ARG A 1 129 ? 51.692  -44.745  22.106  1.00 15.37  ? 256 ARG A CA  1 
ATOM   1017  C  C   . ARG A 1 129 ? 50.264  -44.254  22.361  1.00 13.52  ? 256 ARG A C   1 
ATOM   1018  O  O   . ARG A 1 129 ? 49.410  -45.010  22.815  1.00 11.13  ? 256 ARG A O   1 
ATOM   1019  C  CB  . ARG A 1 129 ? 51.699  -45.895  21.103  1.00 15.00  ? 256 ARG A CB  1 
ATOM   1020  C  CG  . ARG A 1 129 ? 53.127  -46.300  20.748  1.00 17.67  ? 256 ARG A CG  1 
ATOM   1021  C  CD  . ARG A 1 129 ? 53.240  -47.608  19.988  1.00 18.35  ? 256 ARG A CD  1 
ATOM   1022  N  NE  . ARG A 1 129 ? 52.248  -48.596  20.405  1.00 19.10  ? 256 ARG A NE  1 
ATOM   1023  C  CZ  . ARG A 1 129 ? 52.404  -49.514  21.350  1.00 16.90  ? 256 ARG A CZ  1 
ATOM   1024  N  NH1 . ARG A 1 129 ? 53.536  -49.649  22.024  1.00 18.36  ? 256 ARG A NH1 1 
ATOM   1025  N  NH2 . ARG A 1 129 ? 51.399  -50.329  21.602  1.00 17.49  ? 256 ARG A NH2 1 
ATOM   1026  N  N   . TYR A 1 130 ? 50.050  -42.970  22.082  1.00 13.03  ? 257 TYR A N   1 
ATOM   1027  C  CA  . TYR A 1 130 ? 48.745  -42.340  22.158  1.00 14.21  ? 257 TYR A CA  1 
ATOM   1028  C  C   . TYR A 1 130 ? 48.195  -42.214  20.758  1.00 14.20  ? 257 TYR A C   1 
ATOM   1029  O  O   . TYR A 1 130 ? 48.925  -41.848  19.832  1.00 13.03  ? 257 TYR A O   1 
ATOM   1030  C  CB  . TYR A 1 130 ? 48.850  -40.935  22.741  1.00 15.10  ? 257 TYR A CB  1 
ATOM   1031  C  CG  . TYR A 1 130 ? 49.245  -40.854  24.202  1.00 17.89  ? 257 TYR A CG  1 
ATOM   1032  C  CD1 . TYR A 1 130 ? 48.288  -40.644  25.191  1.00 18.13  ? 257 TYR A CD1 1 
ATOM   1033  C  CD2 . TYR A 1 130 ? 50.585  -40.939  24.587  1.00 18.17  ? 257 TYR A CD2 1 
ATOM   1034  C  CE1 . TYR A 1 130 ? 48.646  -40.552  26.532  1.00 19.09  ? 257 TYR A CE1 1 
ATOM   1035  C  CE2 . TYR A 1 130 ? 50.952  -40.841  25.922  1.00 19.54  ? 257 TYR A CE2 1 
ATOM   1036  C  CZ  . TYR A 1 130 ? 49.975  -40.649  26.891  1.00 20.04  ? 257 TYR A CZ  1 
ATOM   1037  O  OH  . TYR A 1 130 ? 50.337  -40.556  28.216  1.00 21.69  ? 257 TYR A OH  1 
ATOM   1038  N  N   . ILE A 1 131 ? 46.910  -42.503  20.597  1.00 15.09  ? 258 ILE A N   1 
ATOM   1039  C  CA  . ILE A 1 131 ? 46.245  -42.241  19.328  1.00 16.50  ? 258 ILE A CA  1 
ATOM   1040  C  C   . ILE A 1 131 ? 45.310  -41.050  19.512  1.00 15.56  ? 258 ILE A C   1 
ATOM   1041  O  O   . ILE A 1 131 ? 44.409  -41.086  20.343  1.00 13.26  ? 258 ILE A O   1 
ATOM   1042  C  CB  . ILE A 1 131 ? 45.457  -43.453  18.795  1.00 16.70  ? 258 ILE A CB  1 
ATOM   1043  C  CG1 . ILE A 1 131 ? 46.223  -44.756  19.040  1.00 16.90  ? 258 ILE A CG1 1 
ATOM   1044  C  CG2 . ILE A 1 131 ? 45.181  -43.253  17.291  1.00 16.32  ? 258 ILE A CG2 1 
ATOM   1045  C  CD1 . ILE A 1 131 ? 47.590  -44.808  18.356  1.00 16.74  ? 258 ILE A CD1 1 
ATOM   1046  N  N   . ILE A 1 132 ? 45.559  -39.994  18.742  1.00 16.13  ? 259 ILE A N   1 
ATOM   1047  C  CA  . ILE A 1 132 ? 44.785  -38.764  18.817  1.00 17.11  ? 259 ILE A CA  1 
ATOM   1048  C  C   . ILE A 1 132 ? 43.963  -38.641  17.528  1.00 17.23  ? 259 ILE A C   1 
ATOM   1049  O  O   . ILE A 1 132 ? 44.507  -38.442  16.453  1.00 16.65  ? 259 ILE A O   1 
ATOM   1050  C  CB  . ILE A 1 132 ? 45.713  -37.531  19.016  1.00 17.80  ? 259 ILE A CB  1 
ATOM   1051  C  CG1 . ILE A 1 132 ? 46.732  -37.778  20.149  1.00 17.99  ? 259 ILE A CG1 1 
ATOM   1052  C  CG2 . ILE A 1 132 ? 44.896  -36.265  19.284  1.00 17.24  ? 259 ILE A CG2 1 
ATOM   1053  C  CD1 . ILE A 1 132 ? 46.154  -38.314  21.450  1.00 16.60  ? 259 ILE A CD1 1 
ATOM   1054  N  N   . GLY A 1 133 ? 42.648  -38.779  17.657  1.00 17.81  ? 260 GLY A N   1 
ATOM   1055  C  CA  . GLY A 1 133 ? 41.757  -38.846  16.517  1.00 17.54  ? 260 GLY A CA  1 
ATOM   1056  C  C   . GLY A 1 133 ? 41.248  -37.510  16.018  1.00 18.56  ? 260 GLY A C   1 
ATOM   1057  O  O   . GLY A 1 133 ? 41.026  -36.575  16.801  1.00 16.27  ? 260 GLY A O   1 
ATOM   1058  N  N   . ILE A 1 134 ? 41.056  -37.423  14.703  1.00 18.78  ? 261 ILE A N   1 
ATOM   1059  C  CA  . ILE A 1 134 ? 40.339  -36.291  14.107  1.00 18.94  ? 261 ILE A CA  1 
ATOM   1060  C  C   . ILE A 1 134 ? 39.331  -36.809  13.078  1.00 18.66  ? 261 ILE A C   1 
ATOM   1061  O  O   . ILE A 1 134 ? 39.489  -37.890  12.515  1.00 17.42  ? 261 ILE A O   1 
ATOM   1062  C  CB  . ILE A 1 134 ? 41.311  -35.241  13.469  1.00 19.62  ? 261 ILE A CB  1 
ATOM   1063  C  CG1 . ILE A 1 134 ? 40.572  -33.904  13.211  1.00 20.57  ? 261 ILE A CG1 1 
ATOM   1064  C  CG2 . ILE A 1 134 ? 41.939  -35.790  12.186  1.00 18.20  ? 261 ILE A CG2 1 
ATOM   1065  C  CD1 . ILE A 1 134 ? 41.455  -32.719  12.826  1.00 18.79  ? 261 ILE A CD1 1 
ATOM   1066  N  N   . GLY A 1 135 ? 38.280  -36.042  12.843  1.00 19.70  ? 262 GLY A N   1 
ATOM   1067  C  CA  . GLY A 1 135 ? 37.324  -36.393  11.800  1.00 21.90  ? 262 GLY A CA  1 
ATOM   1068  C  C   . GLY A 1 135 ? 36.241  -37.323  12.298  1.00 23.12  ? 262 GLY A C   1 
ATOM   1069  O  O   . GLY A 1 135 ? 36.235  -37.736  13.456  1.00 23.39  ? 262 GLY A O   1 
ATOM   1070  N  N   . LYS A 1 136 ? 35.334  -37.668  11.396  1.00 24.46  ? 263 LYS A N   1 
ATOM   1071  C  CA  . LYS A 1 136 ? 34.089  -38.324  11.757  1.00 25.30  ? 263 LYS A CA  1 
ATOM   1072  C  C   . LYS A 1 136 ? 34.082  -39.841  11.519  1.00 23.21  ? 263 LYS A C   1 
ATOM   1073  O  O   . LYS A 1 136 ? 33.084  -40.492  11.793  1.00 22.37  ? 263 LYS A O   1 
ATOM   1074  C  CB  . LYS A 1 136 ? 32.954  -37.661  10.977  1.00 28.79  ? 263 LYS A CB  1 
ATOM   1075  C  CG  . LYS A 1 136 ? 32.983  -36.134  11.060  1.00 31.07  ? 263 LYS A CG  1 
ATOM   1076  C  CD  . LYS A 1 136 ? 31.643  -35.516  10.693  1.00 32.92  ? 263 LYS A CD  1 
ATOM   1077  C  CE  . LYS A 1 136 ? 31.484  -34.119  11.301  1.00 33.71  ? 263 LYS A CE  1 
ATOM   1078  N  NZ  . LYS A 1 136 ? 30.153  -33.525  10.989  1.00 33.28  ? 263 LYS A NZ  1 
ATOM   1079  N  N   . HIS A 1 137 ? 35.180  -40.391  11.002  1.00 21.96  ? 264 HIS A N   1 
ATOM   1080  C  CA  . HIS A 1 137 ? 35.307  -41.836  10.771  1.00 20.27  ? 264 HIS A CA  1 
ATOM   1081  C  C   . HIS A 1 137 ? 36.343  -42.432  11.701  1.00 18.23  ? 264 HIS A C   1 
ATOM   1082  O  O   . HIS A 1 137 ? 36.855  -43.529  11.433  1.00 19.23  ? 264 HIS A O   1 
ATOM   1083  C  CB  . HIS A 1 137 ? 35.819  -42.136  9.355   1.00 20.56  ? 264 HIS A CB  1 
ATOM   1084  C  CG  . HIS A 1 137 ? 35.080  -41.450  8.262   1.00 20.24  ? 264 HIS A CG  1 
ATOM   1085  N  ND1 . HIS A 1 137 ? 34.179  -42.109  7.451   1.00 21.30  ? 264 HIS A ND1 1 
ATOM   1086  C  CD2 . HIS A 1 137 ? 35.169  -40.189  7.782   1.00 20.52  ? 264 HIS A CD2 1 
ATOM   1087  C  CE1 . HIS A 1 137 ? 33.716  -41.273  6.541   1.00 20.55  ? 264 HIS A CE1 1 
ATOM   1088  N  NE2 . HIS A 1 137 ? 34.296  -40.099  6.724   1.00 20.76  ? 264 HIS A NE2 1 
ATOM   1089  N  N   . PHE A 1 138 ? 36.698  -41.711  12.757  1.00 16.73  ? 265 PHE A N   1 
ATOM   1090  C  CA  . PHE A 1 138 ? 37.844  -42.103  13.579  1.00 17.16  ? 265 PHE A CA  1 
ATOM   1091  C  C   . PHE A 1 138 ? 37.537  -43.347  14.427  1.00 18.15  ? 265 PHE A C   1 
ATOM   1092  O  O   . PHE A 1 138 ? 38.307  -44.302  14.421  1.00 19.63  ? 265 PHE A O   1 
ATOM   1093  C  CB  . PHE A 1 138 ? 38.357  -40.924  14.436  1.00 15.89  ? 265 PHE A CB  1 
ATOM   1094  C  CG  . PHE A 1 138 ? 39.410  -41.322  15.446  1.00 14.49  ? 265 PHE A CG  1 
ATOM   1095  C  CD1 . PHE A 1 138 ? 40.658  -41.767  15.026  1.00 12.64  ? 265 PHE A CD1 1 
ATOM   1096  C  CD2 . PHE A 1 138 ? 39.136  -41.274  16.817  1.00 12.31  ? 265 PHE A CD2 1 
ATOM   1097  C  CE1 . PHE A 1 138 ? 41.637  -42.162  15.962  1.00 13.76  ? 265 PHE A CE1 1 
ATOM   1098  C  CE2 . PHE A 1 138 ? 40.105  -41.670  17.766  1.00 13.01  ? 265 PHE A CE2 1 
ATOM   1099  C  CZ  . PHE A 1 138 ? 41.358  -42.114  17.341  1.00 12.58  ? 265 PHE A CZ  1 
ATOM   1100  N  N   . GLN A 1 139 ? 36.418  -43.336  15.139  1.00 19.32  ? 266 GLN A N   1 
ATOM   1101  C  CA  . GLN A 1 139 ? 36.016  -44.475  15.966  1.00 19.81  ? 266 GLN A CA  1 
ATOM   1102  C  C   . GLN A 1 139 ? 34.776  -45.143  15.406  1.00 17.21  ? 266 GLN A C   1 
ATOM   1103  O  O   . GLN A 1 139 ? 33.652  -44.719  15.653  1.00 17.05  ? 266 GLN A O   1 
ATOM   1104  C  CB  . GLN A 1 139 ? 35.819  -44.055  17.429  1.00 23.04  ? 266 GLN A CB  1 
ATOM   1105  C  CG  . GLN A 1 139 ? 37.165  -43.821  18.125  1.00 25.98  ? 266 GLN A CG  1 
ATOM   1106  C  CD  . GLN A 1 139 ? 37.095  -43.864  19.621  1.00 29.49  ? 266 GLN A CD  1 
ATOM   1107  O  OE1 . GLN A 1 139 ? 38.050  -44.556  20.230  1.00 32.65  ? 266 GLN A OE1 1 
ATOM   1108  N  NE2 . GLN A 1 139 ? 36.212  -43.273  20.238  1.00 33.07  ? 266 GLN A NE2 1 
ATOM   1109  N  N   . THR A 1 140 ? 35.010  -46.185  14.621  1.00 15.57  ? 267 THR A N   1 
ATOM   1110  C  CA  . THR A 1 140 ? 33.955  -46.949  13.998  1.00 13.32  ? 267 THR A CA  1 
ATOM   1111  C  C   . THR A 1 140 ? 34.244  -48.427  14.167  1.00 14.83  ? 267 THR A C   1 
ATOM   1112  O  O   . THR A 1 140 ? 35.326  -48.820  14.608  1.00 16.07  ? 267 THR A O   1 
ATOM   1113  C  CB  . THR A 1 140 ? 33.880  -46.677  12.472  1.00 11.30  ? 267 THR A CB  1 
ATOM   1114  O  OG1 . THR A 1 140 ? 35.052  -47.207  11.843  1.00 9.28   ? 267 THR A OG1 1 
ATOM   1115  C  CG2 . THR A 1 140 ? 33.743  -45.179  12.156  1.00 8.76   ? 267 THR A CG2 1 
ATOM   1116  N  N   . LYS A 1 141 ? 33.263  -49.231  13.773  1.00 16.31  ? 268 LYS A N   1 
ATOM   1117  C  CA  . LYS A 1 141 ? 33.387  -50.682  13.628  1.00 16.68  ? 268 LYS A CA  1 
ATOM   1118  C  C   . LYS A 1 141 ? 34.674  -51.060  12.890  1.00 16.75  ? 268 LYS A C   1 
ATOM   1119  O  O   . LYS A 1 141 ? 35.421  -51.934  13.328  1.00 17.50  ? 268 LYS A O   1 
ATOM   1120  C  CB  . LYS A 1 141 ? 32.172  -51.192  12.843  1.00 17.83  ? 268 LYS A CB  1 
ATOM   1121  C  CG  . LYS A 1 141 ? 31.687  -52.581  13.202  1.00 18.57  ? 268 LYS A CG  1 
ATOM   1122  C  CD  . LYS A 1 141 ? 30.812  -53.169  12.086  1.00 18.56  ? 268 LYS A CD  1 
ATOM   1123  C  CE  . LYS A 1 141 ? 29.658  -52.239  11.704  1.00 18.96  ? 268 LYS A CE  1 
ATOM   1124  N  NZ  . LYS A 1 141 ? 28.563  -52.943  10.952  1.00 18.85  ? 268 LYS A NZ  1 
ATOM   1125  N  N   . GLU A 1 142 ? 34.934  -50.366  11.786  1.00 16.03  ? 269 GLU A N   1 
ATOM   1126  C  CA  . GLU A 1 142 ? 36.061  -50.671  10.900  1.00 15.44  ? 269 GLU A CA  1 
ATOM   1127  C  C   . GLU A 1 142 ? 37.422  -50.315  11.472  1.00 13.72  ? 269 GLU A C   1 
ATOM   1128  O  O   . GLU A 1 142 ? 38.410  -50.937  11.111  1.00 13.06  ? 269 GLU A O   1 
ATOM   1129  C  CB  . GLU A 1 142 ? 35.915  -49.926  9.563   1.00 16.56  ? 269 GLU A CB  1 
ATOM   1130  C  CG  . GLU A 1 142 ? 34.745  -50.384  8.701   1.00 18.00  ? 269 GLU A CG  1 
ATOM   1131  C  CD  . GLU A 1 142 ? 33.416  -49.714  9.055   1.00 18.69  ? 269 GLU A CD  1 
ATOM   1132  O  OE1 . GLU A 1 142 ? 33.426  -48.628  9.678   1.00 18.16  ? 269 GLU A OE1 1 
ATOM   1133  O  OE2 . GLU A 1 142 ? 32.361  -50.279  8.685   1.00 19.71  ? 269 GLU A OE2 1 
ATOM   1134  N  N   . SER A 1 143 ? 37.480  -49.296  12.325  1.00 13.19  ? 270 SER A N   1 
ATOM   1135  C  CA  . SER A 1 143 ? 38.752  -48.806  12.862  1.00 12.72  ? 270 SER A CA  1 
ATOM   1136  C  C   . SER A 1 143 ? 39.119  -49.404  14.211  1.00 12.53  ? 270 SER A C   1 
ATOM   1137  O  O   . SER A 1 143 ? 40.247  -49.291  14.637  1.00 13.09  ? 270 SER A O   1 
ATOM   1138  C  CB  . SER A 1 143 ? 38.717  -47.278  12.989  1.00 12.40  ? 270 SER A CB  1 
ATOM   1139  O  OG  . SER A 1 143 ? 37.907  -46.862  14.080  1.00 10.53  ? 270 SER A OG  1 
ATOM   1140  N  N   . GLN A 1 144 ? 38.168  -50.030  14.884  1.00 14.94  ? 271 GLN A N   1 
ATOM   1141  C  CA  . GLN A 1 144 ? 38.347  -50.412  16.283  1.00 17.47  ? 271 GLN A CA  1 
ATOM   1142  C  C   . GLN A 1 144 ? 39.542  -51.332  16.567  1.00 17.99  ? 271 GLN A C   1 
ATOM   1143  O  O   . GLN A 1 144 ? 40.280  -51.099  17.520  1.00 17.64  ? 271 GLN A O   1 
ATOM   1144  C  CB  . GLN A 1 144 ? 37.074  -51.068  16.814  1.00 19.52  ? 271 GLN A CB  1 
ATOM   1145  C  CG  . GLN A 1 144 ? 37.104  -51.304  18.313  1.00 21.51  ? 271 GLN A CG  1 
ATOM   1146  C  CD  . GLN A 1 144 ? 35.746  -51.669  18.860  1.00 23.41  ? 271 GLN A CD  1 
ATOM   1147  O  OE1 . GLN A 1 144 ? 34.867  -52.113  18.112  1.00 25.06  ? 271 GLN A OE1 1 
ATOM   1148  N  NE2 . GLN A 1 144 ? 35.556  -51.479  20.168  1.00 22.82  ? 271 GLN A NE2 1 
ATOM   1149  N  N   . GLU A 1 145 ? 39.713  -52.379  15.762  1.00 18.35  ? 272 GLU A N   1 
ATOM   1150  C  CA  . GLU A 1 145 ? 40.793  -53.349  15.986  1.00 19.55  ? 272 GLU A CA  1 
ATOM   1151  C  C   . GLU A 1 145 ? 42.169  -52.780  15.673  1.00 18.46  ? 272 GLU A C   1 
ATOM   1152  O  O   . GLU A 1 145 ? 43.138  -53.121  16.337  1.00 17.50  ? 272 GLU A O   1 
ATOM   1153  C  CB  . GLU A 1 145 ? 40.572  -54.632  15.176  1.00 20.50  ? 272 GLU A CB  1 
ATOM   1154  C  CG  . GLU A 1 145 ? 39.496  -55.521  15.766  1.00 22.75  ? 272 GLU A CG  1 
ATOM   1155  C  CD  . GLU A 1 145 ? 39.516  -56.948  15.222  1.00 24.77  ? 272 GLU A CD  1 
ATOM   1156  O  OE1 . GLU A 1 145 ? 40.384  -57.255  14.371  1.00 26.52  ? 272 GLU A OE1 1 
ATOM   1157  O  OE2 . GLU A 1 145 ? 38.662  -57.760  15.652  1.00 23.97  ? 272 GLU A OE2 1 
ATOM   1158  N  N   . THR A 1 146 ? 42.244  -51.916  14.667  1.00 18.41  ? 273 THR A N   1 
ATOM   1159  C  CA  . THR A 1 146 ? 43.497  -51.281  14.286  1.00 20.23  ? 273 THR A CA  1 
ATOM   1160  C  C   . THR A 1 146 ? 43.981  -50.303  15.349  1.00 20.23  ? 273 THR A C   1 
ATOM   1161  O  O   . THR A 1 146 ? 45.154  -50.289  15.700  1.00 22.06  ? 273 THR A O   1 
ATOM   1162  C  CB  . THR A 1 146 ? 43.345  -50.510  12.960  1.00 21.35  ? 273 THR A CB  1 
ATOM   1163  O  OG1 . THR A 1 146 ? 42.809  -51.380  11.950  1.00 22.05  ? 273 THR A OG1 1 
ATOM   1164  C  CG2 . THR A 1 146 ? 44.683  -49.962  12.508  1.00 20.32  ? 273 THR A CG2 1 
ATOM   1165  N  N   . LEU A 1 147 ? 43.077  -49.467  15.840  1.00 19.67  ? 274 LEU A N   1 
ATOM   1166  C  CA  . LEU A 1 147 ? 43.417  -48.493  16.876  1.00 19.85  ? 274 LEU A CA  1 
ATOM   1167  C  C   . LEU A 1 147 ? 43.787  -49.169  18.191  1.00 18.87  ? 274 LEU A C   1 
ATOM   1168  O  O   . LEU A 1 147 ? 44.641  -48.681  18.929  1.00 22.17  ? 274 LEU A O   1 
ATOM   1169  C  CB  . LEU A 1 147 ? 42.255  -47.528  17.110  1.00 20.31  ? 274 LEU A CB  1 
ATOM   1170  C  CG  . LEU A 1 147 ? 41.779  -46.720  15.892  1.00 20.39  ? 274 LEU A CG  1 
ATOM   1171  C  CD1 . LEU A 1 147 ? 40.619  -45.801  16.314  1.00 19.29  ? 274 LEU A CD1 1 
ATOM   1172  C  CD2 . LEU A 1 147 ? 42.921  -45.934  15.213  1.00 17.75  ? 274 LEU A CD2 1 
ATOM   1173  N  N   . HIS A 1 148 ? 43.135  -50.283  18.489  1.00 16.20  ? 275 HIS A N   1 
ATOM   1174  C  CA  . HIS A 1 148 ? 43.460  -51.066  19.674  1.00 15.28  ? 275 HIS A CA  1 
ATOM   1175  C  C   . HIS A 1 148 ? 44.869  -51.660  19.548  1.00 15.68  ? 275 HIS A C   1 
ATOM   1176  O  O   . HIS A 1 148 ? 45.636  -51.674  20.494  1.00 13.42  ? 275 HIS A O   1 
ATOM   1177  C  CB  . HIS A 1 148 ? 42.420  -52.171  19.860  1.00 13.78  ? 275 HIS A CB  1 
ATOM   1178  C  CG  . HIS A 1 148 ? 42.598  -52.955  21.118  1.00 12.97  ? 275 HIS A CG  1 
ATOM   1179  N  ND1 . HIS A 1 148 ? 41.919  -52.663  22.279  1.00 13.93  ? 275 HIS A ND1 1 
ATOM   1180  C  CD2 . HIS A 1 148 ? 43.381  -54.024  21.395  1.00 12.31  ? 275 HIS A CD2 1 
ATOM   1181  C  CE1 . HIS A 1 148 ? 42.275  -53.521  23.217  1.00 14.01  ? 275 HIS A CE1 1 
ATOM   1182  N  NE2 . HIS A 1 148 ? 43.170  -54.349  22.708  1.00 13.14  ? 275 HIS A NE2 1 
ATOM   1183  N  N   . LYS A 1 149 ? 45.194  -52.131  18.353  1.00 17.37  ? 276 LYS A N   1 
ATOM   1184  C  CA  . LYS A 1 149 ? 46.536  -52.593  18.025  1.00 19.86  ? 276 LYS A CA  1 
ATOM   1185  C  C   . LYS A 1 149 ? 47.596  -51.487  18.185  1.00 20.00  ? 276 LYS A C   1 
ATOM   1186  O  O   . LYS A 1 149 ? 48.667  -51.720  18.746  1.00 21.34  ? 276 LYS A O   1 
ATOM   1187  C  CB  . LYS A 1 149 ? 46.539  -53.125  16.589  1.00 21.52  ? 276 LYS A CB  1 
ATOM   1188  C  CG  . LYS A 1 149 ? 47.595  -54.149  16.299  1.00 23.15  ? 276 LYS A CG  1 
ATOM   1189  C  CD  . LYS A 1 149 ? 47.301  -54.879  14.995  1.00 25.00  ? 276 LYS A CD  1 
ATOM   1190  C  CE  . LYS A 1 149 ? 46.020  -55.739  15.088  1.00 26.01  ? 276 LYS A CE  1 
ATOM   1191  N  NZ  . LYS A 1 149 ? 46.097  -56.967  14.234  1.00 25.24  ? 276 LYS A NZ  1 
ATOM   1192  N  N   . PHE A 1 150 ? 47.293  -50.292  17.694  1.00 20.01  ? 277 PHE A N   1 
ATOM   1193  C  CA  . PHE A 1 150 ? 48.229  -49.169  17.757  1.00 20.81  ? 277 PHE A CA  1 
ATOM   1194  C  C   . PHE A 1 150 ? 48.468  -48.608  19.167  1.00 19.65  ? 277 PHE A C   1 
ATOM   1195  O  O   . PHE A 1 150 ? 49.583  -48.191  19.478  1.00 19.19  ? 277 PHE A O   1 
ATOM   1196  C  CB  . PHE A 1 150 ? 47.750  -48.012  16.867  1.00 22.00  ? 277 PHE A CB  1 
ATOM   1197  C  CG  . PHE A 1 150 ? 47.786  -48.295  15.382  1.00 23.63  ? 277 PHE A CG  1 
ATOM   1198  C  CD1 . PHE A 1 150 ? 48.549  -49.324  14.846  1.00 25.09  ? 277 PHE A CD1 1 
ATOM   1199  C  CD2 . PHE A 1 150 ? 47.075  -47.478  14.510  1.00 25.36  ? 277 PHE A CD2 1 
ATOM   1200  C  CE1 . PHE A 1 150 ? 48.580  -49.547  13.473  1.00 26.35  ? 277 PHE A CE1 1 
ATOM   1201  C  CE2 . PHE A 1 150 ? 47.097  -47.698  13.133  1.00 25.46  ? 277 PHE A CE2 1 
ATOM   1202  C  CZ  . PHE A 1 150 ? 47.852  -48.728  12.616  1.00 25.91  ? 277 PHE A CZ  1 
ATOM   1203  N  N   . ALA A 1 151 ? 47.429  -48.575  20.002  1.00 18.27  ? 278 ALA A N   1 
ATOM   1204  C  CA  . ALA A 1 151 ? 47.509  -47.876  21.282  1.00 17.44  ? 278 ALA A CA  1 
ATOM   1205  C  C   . ALA A 1 151 ? 48.258  -48.688  22.312  1.00 16.75  ? 278 ALA A C   1 
ATOM   1206  O  O   . ALA A 1 151 ? 48.290  -49.921  22.260  1.00 14.93  ? 278 ALA A O   1 
ATOM   1207  C  CB  . ALA A 1 151 ? 46.122  -47.519  21.808  1.00 18.52  ? 278 ALA A CB  1 
ATOM   1208  N  N   . SER A 1 152 ? 48.871  -47.977  23.250  1.00 15.41  ? 279 SER A N   1 
ATOM   1209  C  CA  . SER A 1 152 ? 49.402  -48.606  24.427  1.00 14.60  ? 279 SER A CA  1 
ATOM   1210  C  C   . SER A 1 152 ? 48.205  -49.132  25.210  1.00 16.10  ? 279 SER A C   1 
ATOM   1211  O  O   . SER A 1 152 ? 47.086  -48.654  25.024  1.00 15.46  ? 279 SER A O   1 
ATOM   1212  C  CB  . SER A 1 152 ? 50.219  -47.614  25.253  1.00 13.56  ? 279 SER A CB  1 
ATOM   1213  O  OG  . SER A 1 152 ? 51.512  -47.442  24.702  1.00 12.96  ? 279 SER A OG  1 
ATOM   1214  N  N   . LYS A 1 153 ? 48.444  -50.110  26.082  1.00 17.64  ? 280 LYS A N   1 
ATOM   1215  C  CA  . LYS A 1 153 ? 47.364  -50.803  26.779  1.00 18.37  ? 280 LYS A CA  1 
ATOM   1216  C  C   . LYS A 1 153 ? 47.301  -50.395  28.247  1.00 20.46  ? 280 LYS A C   1 
ATOM   1217  O  O   . LYS A 1 153 ? 48.335  -50.117  28.846  1.00 21.78  ? 280 LYS A O   1 
ATOM   1218  C  CB  . LYS A 1 153 ? 47.552  -52.316  26.669  1.00 16.50  ? 280 LYS A CB  1 
ATOM   1219  C  CG  . LYS A 1 153 ? 47.702  -52.810  25.243  1.00 16.15  ? 280 LYS A CG  1 
ATOM   1220  C  CD  . LYS A 1 153 ? 46.536  -52.382  24.359  1.00 15.13  ? 280 LYS A CD  1 
ATOM   1221  C  CE  . LYS A 1 153 ? 46.534  -53.147  23.047  1.00 14.88  ? 280 LYS A CE  1 
ATOM   1222  N  NZ  . LYS A 1 153 ? 47.534  -52.633  22.070  1.00 14.07  ? 280 LYS A NZ  1 
ATOM   1223  N  N   . PRO A 1 154 ? 46.086  -50.347  28.831  1.00 22.31  ? 281 PRO A N   1 
ATOM   1224  C  CA  . PRO A 1 154 ? 44.787  -50.534  28.164  1.00 22.31  ? 281 PRO A CA  1 
ATOM   1225  C  C   . PRO A 1 154 ? 44.467  -49.384  27.213  1.00 22.11  ? 281 PRO A C   1 
ATOM   1226  O  O   . PRO A 1 154 ? 44.706  -48.221  27.544  1.00 22.46  ? 281 PRO A O   1 
ATOM   1227  C  CB  . PRO A 1 154 ? 43.781  -50.593  29.323  1.00 23.57  ? 281 PRO A CB  1 
ATOM   1228  C  CG  . PRO A 1 154 ? 44.503  -50.107  30.529  1.00 23.28  ? 281 PRO A CG  1 
ATOM   1229  C  CD  . PRO A 1 154 ? 45.961  -50.333  30.299  1.00 23.26  ? 281 PRO A CD  1 
ATOM   1230  N  N   . ALA A 1 155 ? 43.947  -49.721  26.033  1.00 21.97  ? 282 ALA A N   1 
ATOM   1231  C  CA  . ALA A 1 155 ? 43.728  -48.745  24.960  1.00 19.85  ? 282 ALA A CA  1 
ATOM   1232  C  C   . ALA A 1 155 ? 42.773  -47.622  25.381  1.00 20.26  ? 282 ALA A C   1 
ATOM   1233  O  O   . ALA A 1 155 ? 42.910  -46.490  24.925  1.00 19.78  ? 282 ALA A O   1 
ATOM   1234  C  CB  . ALA A 1 155 ? 43.220  -49.450  23.700  1.00 18.85  ? 282 ALA A CB  1 
ATOM   1235  N  N   . SER A 1 156 ? 41.824  -47.935  26.264  1.00 20.51  ? 283 SER A N   1 
ATOM   1236  C  CA  . SER A 1 156 ? 40.909  -46.931  26.820  1.00 22.03  ? 283 SER A CA  1 
ATOM   1237  C  C   . SER A 1 156 ? 41.600  -45.691  27.436  1.00 22.98  ? 283 SER A C   1 
ATOM   1238  O  O   . SER A 1 156 ? 40.988  -44.630  27.524  1.00 21.88  ? 283 SER A O   1 
ATOM   1239  C  CB  . SER A 1 156 ? 39.972  -47.582  27.844  1.00 21.50  ? 283 SER A CB  1 
ATOM   1240  O  OG  . SER A 1 156 ? 40.690  -48.178  28.905  1.00 21.59  ? 283 SER A OG  1 
ATOM   1241  N  N   . GLU A 1 157 ? 42.868  -45.827  27.831  1.00 24.77  ? 284 GLU A N   1 
ATOM   1242  C  CA  . GLU A 1 157 ? 43.637  -44.729  28.433  1.00 26.21  ? 284 GLU A CA  1 
ATOM   1243  C  C   . GLU A 1 157 ? 44.543  -43.991  27.445  1.00 23.87  ? 284 GLU A C   1 
ATOM   1244  O  O   . GLU A 1 157 ? 45.147  -42.978  27.786  1.00 21.82  ? 284 GLU A O   1 
ATOM   1245  C  CB  . GLU A 1 157 ? 44.511  -45.285  29.566  1.00 30.17  ? 284 GLU A CB  1 
ATOM   1246  C  CG  . GLU A 1 157 ? 43.732  -45.960  30.702  1.00 33.37  ? 284 GLU A CG  1 
ATOM   1247  C  CD  . GLU A 1 157 ? 42.737  -45.017  31.383  1.00 36.54  ? 284 GLU A CD  1 
ATOM   1248  O  OE1 . GLU A 1 157 ? 43.014  -43.794  31.442  1.00 38.50  ? 284 GLU A OE1 1 
ATOM   1249  O  OE2 . GLU A 1 157 ? 41.679  -45.496  31.862  1.00 39.03  ? 284 GLU A OE2 1 
ATOM   1250  N  N   . PHE A 1 158 ? 44.666  -44.511  26.230  1.00 22.42  ? 285 PHE A N   1 
ATOM   1251  C  CA  . PHE A 1 158 ? 45.604  -43.943  25.266  1.00 21.26  ? 285 PHE A CA  1 
ATOM   1252  C  C   . PHE A 1 158 ? 44.960  -43.465  23.975  1.00 19.64  ? 285 PHE A C   1 
ATOM   1253  O  O   . PHE A 1 158 ? 45.599  -42.765  23.206  1.00 19.59  ? 285 PHE A O   1 
ATOM   1254  C  CB  . PHE A 1 158 ? 46.719  -44.945  24.979  1.00 19.83  ? 285 PHE A CB  1 
ATOM   1255  C  CG  . PHE A 1 158 ? 47.650  -45.120  26.126  1.00 18.55  ? 285 PHE A CG  1 
ATOM   1256  C  CD1 . PHE A 1 158 ? 48.655  -44.193  26.354  1.00 17.54  ? 285 PHE A CD1 1 
ATOM   1257  C  CD2 . PHE A 1 158 ? 47.502  -46.183  27.001  1.00 18.26  ? 285 PHE A CD2 1 
ATOM   1258  C  CE1 . PHE A 1 158 ? 49.514  -44.322  27.422  1.00 17.98  ? 285 PHE A CE1 1 
ATOM   1259  C  CE2 . PHE A 1 158 ? 48.372  -46.331  28.084  1.00 18.75  ? 285 PHE A CE2 1 
ATOM   1260  C  CZ  . PHE A 1 158 ? 49.378  -45.394  28.296  1.00 18.20  ? 285 PHE A CZ  1 
ATOM   1261  N  N   . VAL A 1 159 ? 43.708  -43.847  23.744  1.00 19.34  ? 286 VAL A N   1 
ATOM   1262  C  CA  . VAL A 1 159 ? 42.935  -43.332  22.618  1.00 19.27  ? 286 VAL A CA  1 
ATOM   1263  C  C   . VAL A 1 159 ? 42.203  -42.049  23.020  1.00 18.50  ? 286 VAL A C   1 
ATOM   1264  O  O   . VAL A 1 159 ? 41.413  -42.029  23.967  1.00 17.72  ? 286 VAL A O   1 
ATOM   1265  C  CB  . VAL A 1 159 ? 41.949  -44.380  22.099  1.00 19.28  ? 286 VAL A CB  1 
ATOM   1266  C  CG1 . VAL A 1 159 ? 41.144  -43.831  20.913  1.00 18.31  ? 286 VAL A CG1 1 
ATOM   1267  C  CG2 . VAL A 1 159 ? 42.712  -45.648  21.716  1.00 18.53  ? 286 VAL A CG2 1 
ATOM   1268  N  N   . LYS A 1 160 ? 42.495  -40.978  22.289  1.00 19.86  ? 287 LYS A N   1 
ATOM   1269  C  CA  . LYS A 1 160 ? 41.963  -39.648  22.570  1.00 19.94  ? 287 LYS A CA  1 
ATOM   1270  C  C   . LYS A 1 160 ? 41.430  -38.977  21.309  1.00 18.65  ? 287 LYS A C   1 
ATOM   1271  O  O   . LYS A 1 160 ? 41.723  -39.406  20.194  1.00 15.76  ? 287 LYS A O   1 
ATOM   1272  C  CB  . LYS A 1 160 ? 43.056  -38.769  23.180  1.00 22.20  ? 287 LYS A CB  1 
ATOM   1273  C  CG  . LYS A 1 160 ? 43.769  -39.371  24.403  1.00 24.79  ? 287 LYS A CG  1 
ATOM   1274  C  CD  . LYS A 1 160 ? 42.869  -39.407  25.622  1.00 27.49  ? 287 LYS A CD  1 
ATOM   1275  C  CE  . LYS A 1 160 ? 43.569  -40.032  26.840  1.00 28.88  ? 287 LYS A CE  1 
ATOM   1276  N  NZ  . LYS A 1 160 ? 44.855  -39.330  27.104  1.00 31.73  ? 287 LYS A NZ  1 
ATOM   1277  N  N   . ILE A 1 161 ? 40.663  -37.903  21.524  1.00 18.91  ? 288 ILE A N   1 
ATOM   1278  C  CA  . ILE A 1 161 ? 40.038  -37.093  20.478  1.00 17.09  ? 288 ILE A CA  1 
ATOM   1279  C  C   . ILE A 1 161 ? 40.679  -35.699  20.475  1.00 16.90  ? 288 ILE A C   1 
ATOM   1280  O  O   . ILE A 1 161 ? 40.638  -34.984  21.477  1.00 16.42  ? 288 ILE A O   1 
ATOM   1281  C  CB  . ILE A 1 161 ? 38.522  -36.974  20.732  1.00 17.12  ? 288 ILE A CB  1 
ATOM   1282  C  CG1 . ILE A 1 161 ? 37.898  -38.371  20.879  1.00 17.22  ? 288 ILE A CG1 1 
ATOM   1283  C  CG2 . ILE A 1 161 ? 37.814  -36.200  19.608  1.00 15.20  ? 288 ILE A CG2 1 
ATOM   1284  C  CD1 . ILE A 1 161 ? 38.183  -39.310  19.713  1.00 17.93  ? 288 ILE A CD1 1 
ATOM   1285  N  N   . LEU A 1 162 ? 41.273  -35.323  19.347  1.00 16.77  ? 289 LEU A N   1 
ATOM   1286  C  CA  . LEU A 1 162 ? 42.097  -34.111  19.266  1.00 18.48  ? 289 LEU A CA  1 
ATOM   1287  C  C   . LEU A 1 162 ? 41.360  -32.838  19.727  1.00 19.04  ? 289 LEU A C   1 
ATOM   1288  O  O   . LEU A 1 162 ? 41.931  -32.008  20.432  1.00 18.76  ? 289 LEU A O   1 
ATOM   1289  C  CB  . LEU A 1 162 ? 42.652  -33.930  17.841  1.00 18.20  ? 289 LEU A CB  1 
ATOM   1290  C  CG  . LEU A 1 162 ? 43.640  -32.776  17.608  1.00 17.74  ? 289 LEU A CG  1 
ATOM   1291  C  CD1 . LEU A 1 162 ? 44.469  -32.991  16.343  1.00 19.49  ? 289 LEU A CD1 1 
ATOM   1292  C  CD2 . LEU A 1 162 ? 42.917  -31.471  17.506  1.00 17.24  ? 289 LEU A CD2 1 
ATOM   1293  N  N   . ASP A 1 163 ? 40.103  -32.695  19.325  1.00 19.81  ? 290 ASP A N   1 
ATOM   1294  C  CA  . ASP A 1 163 ? 39.298  -31.547  19.720  1.00 21.42  ? 290 ASP A CA  1 
ATOM   1295  C  C   . ASP A 1 163 ? 39.145  -31.407  21.247  1.00 20.80  ? 290 ASP A C   1 
ATOM   1296  O  O   . ASP A 1 163 ? 39.124  -30.294  21.778  1.00 18.38  ? 290 ASP A O   1 
ATOM   1297  C  CB  . ASP A 1 163 ? 37.919  -31.616  19.071  1.00 23.52  ? 290 ASP A CB  1 
ATOM   1298  C  CG  . ASP A 1 163 ? 37.003  -30.524  19.567  1.00 27.11  ? 290 ASP A CG  1 
ATOM   1299  O  OD1 . ASP A 1 163 ? 36.925  -29.468  18.898  1.00 29.69  ? 290 ASP A OD1 1 
ATOM   1300  O  OD2 . ASP A 1 163 ? 36.394  -30.703  20.652  1.00 28.54  ? 290 ASP A OD2 1 
ATOM   1301  N  N   . THR A 1 164 ? 39.004  -32.539  21.927  1.00 20.46  ? 291 THR A N   1 
ATOM   1302  C  CA  . THR A 1 164 ? 39.003  -32.585  23.381  1.00 21.55  ? 291 THR A CA  1 
ATOM   1303  C  C   . THR A 1 164 ? 40.407  -32.373  23.940  1.00 21.34  ? 291 THR A C   1 
ATOM   1304  O  O   . THR A 1 164 ? 40.626  -31.527  24.803  1.00 21.37  ? 291 THR A O   1 
ATOM   1305  C  CB  . THR A 1 164 ? 38.493  -33.954  23.872  1.00 21.46  ? 291 THR A CB  1 
ATOM   1306  O  OG1 . THR A 1 164 ? 37.152  -34.145  23.413  1.00 22.31  ? 291 THR A OG1 1 
ATOM   1307  C  CG2 . THR A 1 164 ? 38.539  -34.050  25.383  1.00 20.05  ? 291 THR A CG2 1 
ATOM   1308  N  N   . PHE A 1 165 ? 41.346  -33.158  23.432  1.00 21.55  ? 292 PHE A N   1 
ATOM   1309  C  CA  . PHE A 1 165 ? 42.705  -33.215  23.963  1.00 23.19  ? 292 PHE A CA  1 
ATOM   1310  C  C   . PHE A 1 165 ? 43.468  -31.880  23.862  1.00 23.53  ? 292 PHE A C   1 
ATOM   1311  O  O   . PHE A 1 165 ? 44.233  -31.532  24.758  1.00 23.52  ? 292 PHE A O   1 
ATOM   1312  C  CB  . PHE A 1 165 ? 43.469  -34.340  23.251  1.00 23.67  ? 292 PHE A CB  1 
ATOM   1313  C  CG  . PHE A 1 165 ? 44.672  -34.823  23.992  1.00 25.52  ? 292 PHE A CG  1 
ATOM   1314  C  CD1 . PHE A 1 165 ? 44.547  -35.390  25.246  1.00 27.14  ? 292 PHE A CD1 1 
ATOM   1315  C  CD2 . PHE A 1 165 ? 45.933  -34.737  23.426  1.00 26.98  ? 292 PHE A CD2 1 
ATOM   1316  C  CE1 . PHE A 1 165 ? 45.657  -35.847  25.940  1.00 26.78  ? 292 PHE A CE1 1 
ATOM   1317  C  CE2 . PHE A 1 165 ? 47.046  -35.193  24.113  1.00 28.13  ? 292 PHE A CE2 1 
ATOM   1318  C  CZ  . PHE A 1 165 ? 46.902  -35.749  25.377  1.00 27.53  ? 292 PHE A CZ  1 
ATOM   1319  N  N   . GLU A 1 166 ? 43.227  -31.123  22.794  1.00 24.18  ? 293 GLU A N   1 
ATOM   1320  C  CA  . GLU A 1 166 ? 43.927  -29.851  22.567  1.00 25.23  ? 293 GLU A CA  1 
ATOM   1321  C  C   . GLU A 1 166 ? 43.569  -28.747  23.574  1.00 24.49  ? 293 GLU A C   1 
ATOM   1322  O  O   . GLU A 1 166 ? 44.292  -27.758  23.691  1.00 22.76  ? 293 GLU A O   1 
ATOM   1323  C  CB  . GLU A 1 166 ? 43.695  -29.356  21.130  1.00 26.31  ? 293 GLU A CB  1 
ATOM   1324  C  CG  . GLU A 1 166 ? 42.306  -28.805  20.861  1.00 27.83  ? 293 GLU A CG  1 
ATOM   1325  C  CD  . GLU A 1 166 ? 42.077  -28.416  19.403  1.00 29.49  ? 293 GLU A CD  1 
ATOM   1326  O  OE1 . GLU A 1 166 ? 42.991  -28.588  18.560  1.00 29.87  ? 293 GLU A OE1 1 
ATOM   1327  O  OE2 . GLU A 1 166 ? 40.967  -27.922  19.103  1.00 30.88  ? 293 GLU A OE2 1 
ATOM   1328  N  N   . LYS A 1 167 ? 42.466  -28.923  24.300  1.00 25.14  ? 294 LYS A N   1 
ATOM   1329  C  CA  . LYS A 1 167 ? 42.008  -27.939  25.285  1.00 25.82  ? 294 LYS A CA  1 
ATOM   1330  C  C   . LYS A 1 167 ? 42.581  -28.145  26.695  1.00 25.68  ? 294 LYS A C   1 
ATOM   1331  O  O   . LYS A 1 167 ? 42.367  -27.303  27.567  1.00 24.78  ? 294 LYS A O   1 
ATOM   1332  C  CB  . LYS A 1 167 ? 40.476  -27.927  25.329  1.00 26.60  ? 294 LYS A CB  1 
ATOM   1333  C  CG  . LYS A 1 167 ? 39.858  -27.566  23.982  1.00 27.58  ? 294 LYS A CG  1 
ATOM   1334  C  CD  . LYS A 1 167 ? 38.416  -28.022  23.842  1.00 29.06  ? 294 LYS A CD  1 
ATOM   1335  C  CE  . LYS A 1 167 ? 37.441  -27.091  24.529  1.00 30.56  ? 294 LYS A CE  1 
ATOM   1336  N  NZ  . LYS A 1 167 ? 36.136  -27.078  23.809  1.00 31.05  ? 294 LYS A NZ  1 
ATOM   1337  N  N   . LEU A 1 168 ? 43.316  -29.238  26.914  1.00 25.58  ? 295 LEU A N   1 
ATOM   1338  C  CA  . LEU A 1 168 ? 43.866  -29.540  28.246  1.00 26.42  ? 295 LEU A CA  1 
ATOM   1339  C  C   . LEU A 1 168 ? 45.138  -28.747  28.528  1.00 25.60  ? 295 LEU A C   1 
ATOM   1340  O  O   . LEU A 1 168 ? 46.129  -28.880  27.815  1.00 24.88  ? 295 LEU A O   1 
ATOM   1341  C  CB  . LEU A 1 168 ? 44.171  -31.040  28.396  1.00 26.46  ? 295 LEU A CB  1 
ATOM   1342  C  CG  . LEU A 1 168 ? 43.017  -32.010  28.129  1.00 26.95  ? 295 LEU A CG  1 
ATOM   1343  C  CD1 . LEU A 1 168 ? 43.493  -33.441  28.276  1.00 26.93  ? 295 LEU A CD1 1 
ATOM   1344  C  CD2 . LEU A 1 168 ? 41.832  -31.735  29.042  1.00 26.43  ? 295 LEU A CD2 1 
ATOM   1345  N  N   . LYS A 1 169 ? 45.116  -27.931  29.575  1.00 25.77  ? 296 LYS A N   1 
ATOM   1346  C  CA  . LYS A 1 169 ? 46.326  -27.236  30.004  1.00 25.79  ? 296 LYS A CA  1 
ATOM   1347  C  C   . LYS A 1 169 ? 47.319  -28.203  30.675  1.00 26.14  ? 296 LYS A C   1 
ATOM   1348  O  O   . LYS A 1 169 ? 48.538  -27.989  30.636  1.00 25.46  ? 296 LYS A O   1 
ATOM   1349  C  CB  . LYS A 1 169 ? 45.980  -26.057  30.918  1.00 25.63  ? 296 LYS A CB  1 
ATOM   1350  C  CG  . LYS A 1 169 ? 45.230  -24.929  30.194  1.00 25.28  ? 296 LYS A CG  1 
ATOM   1351  C  CD  . LYS A 1 169 ? 45.284  -23.626  30.982  1.00 24.38  ? 296 LYS A CD  1 
ATOM   1352  C  CE  . LYS A 1 169 ? 44.276  -22.604  30.475  1.00 23.86  ? 296 LYS A CE  1 
ATOM   1353  N  NZ  . LYS A 1 169 ? 44.126  -21.468  31.433  1.00 23.79  ? 296 LYS A NZ  1 
ATOM   1354  N  N   . ASP A 1 170 ? 46.784  -29.281  31.255  1.00 26.57  ? 297 ASP A N   1 
ATOM   1355  C  CA  . ASP A 1 170 ? 47.589  -30.338  31.897  1.00 26.57  ? 297 ASP A CA  1 
ATOM   1356  C  C   . ASP A 1 170 ? 48.153  -31.372  30.896  1.00 26.47  ? 297 ASP A C   1 
ATOM   1357  O  O   . ASP A 1 170 ? 48.579  -32.474  31.288  1.00 26.41  ? 297 ASP A O   1 
ATOM   1358  C  CB  . ASP A 1 170 ? 46.778  -31.032  33.016  1.00 27.04  ? 297 ASP A CB  1 
ATOM   1359  C  CG  . ASP A 1 170 ? 45.401  -31.552  32.545  1.00 27.81  ? 297 ASP A CG  1 
ATOM   1360  O  OD1 . ASP A 1 170 ? 44.501  -30.733  32.226  1.00 27.56  ? 297 ASP A OD1 1 
ATOM   1361  O  OD2 . ASP A 1 170 ? 45.203  -32.784  32.526  1.00 28.09  ? 297 ASP A OD2 1 
ATOM   1362  N  N   . LEU A 1 171 ? 48.185  -30.988  29.618  1.00 25.26  ? 298 LEU A N   1 
ATOM   1363  C  CA  . LEU A 1 171 ? 48.681  -31.830  28.523  1.00 24.85  ? 298 LEU A CA  1 
ATOM   1364  C  C   . LEU A 1 171 ? 50.136  -32.288  28.708  1.00 25.19  ? 298 LEU A C   1 
ATOM   1365  O  O   . LEU A 1 171 ? 50.439  -33.454  28.528  1.00 22.56  ? 298 LEU A O   1 
ATOM   1366  C  CB  . LEU A 1 171 ? 48.524  -31.079  27.191  1.00 23.74  ? 298 LEU A CB  1 
ATOM   1367  C  CG  . LEU A 1 171 ? 49.163  -31.643  25.925  1.00 23.64  ? 298 LEU A CG  1 
ATOM   1368  C  CD1 . LEU A 1 171 ? 48.990  -33.168  25.806  1.00 24.48  ? 298 LEU A CD1 1 
ATOM   1369  C  CD2 . LEU A 1 171 ? 48.574  -30.954  24.725  1.00 23.89  ? 298 LEU A CD2 1 
ATOM   1370  N  N   . CYS A 1 172 ? 51.021  -31.363  29.068  1.00 27.15  ? 299 CYS A N   1 
ATOM   1371  C  CA  . CYS A 1 172 ? 52.432  -31.676  29.275  1.00 29.66  ? 299 CYS A CA  1 
ATOM   1372  C  C   . CYS A 1 172 ? 52.643  -32.600  30.461  1.00 30.71  ? 299 CYS A C   1 
ATOM   1373  O  O   . CYS A 1 172 ? 53.568  -33.402  30.457  1.00 31.15  ? 299 CYS A O   1 
ATOM   1374  C  CB  . CYS A 1 172 ? 53.238  -30.401  29.506  1.00 31.72  ? 299 CYS A CB  1 
ATOM   1375  S  SG  . CYS A 1 172 ? 53.042  -29.158  28.211  1.00 34.71  ? 299 CYS A SG  1 
ATOM   1376  N  N   . THR A 1 173 ? 51.792  -32.475  31.478  1.00 32.38  ? 300 THR A N   1 
ATOM   1377  C  CA  . THR A 1 173 ? 51.846  -33.357  32.648  1.00 33.56  ? 300 THR A CA  1 
ATOM   1378  C  C   . THR A 1 173 ? 51.526  -34.808  32.292  1.00 34.53  ? 300 THR A C   1 
ATOM   1379  O  O   . THR A 1 173 ? 52.243  -35.718  32.709  1.00 34.21  ? 300 THR A O   1 
ATOM   1380  C  CB  . THR A 1 173 ? 50.861  -32.904  33.746  1.00 33.44  ? 300 THR A CB  1 
ATOM   1381  O  OG1 . THR A 1 173 ? 50.974  -31.488  33.942  1.00 33.96  ? 300 THR A OG1 1 
ATOM   1382  C  CG2 . THR A 1 173 ? 51.143  -33.632  35.062  1.00 33.59  ? 300 THR A CG2 1 
ATOM   1383  N  N   . GLU A 1 174 ? 50.458  -35.017  31.518  1.00 36.51  ? 301 GLU A N   1 
ATOM   1384  C  CA  . GLU A 1 174 ? 49.980  -36.374  31.220  1.00 37.68  ? 301 GLU A CA  1 
ATOM   1385  C  C   . GLU A 1 174 ? 50.939  -37.153  30.326  1.00 37.18  ? 301 GLU A C   1 
ATOM   1386  O  O   . GLU A 1 174 ? 51.187  -38.342  30.561  1.00 36.04  ? 301 GLU A O   1 
ATOM   1387  C  CB  . GLU A 1 174 ? 48.588  -36.363  30.574  1.00 38.74  ? 301 GLU A CB  1 
ATOM   1388  C  CG  . GLU A 1 174 ? 47.884  -37.736  30.671  1.00 39.70  ? 301 GLU A CG  1 
ATOM   1389  C  CD  . GLU A 1 174 ? 46.841  -37.993  29.580  1.00 40.34  ? 301 GLU A CD  1 
ATOM   1390  O  OE1 . GLU A 1 174 ? 46.213  -37.020  29.098  1.00 40.74  ? 301 GLU A OE1 1 
ATOM   1391  O  OE2 . GLU A 1 174 ? 46.635  -39.178  29.225  1.00 39.50  ? 301 GLU A OE2 1 
ATOM   1392  N  N   . LEU A 1 175 ? 51.469  -36.485  29.305  1.00 36.96  ? 302 LEU A N   1 
ATOM   1393  C  CA  . LEU A 1 175 ? 52.347  -37.140  28.335  1.00 37.70  ? 302 LEU A CA  1 
ATOM   1394  C  C   . LEU A 1 175 ? 53.672  -37.598  28.960  1.00 38.47  ? 302 LEU A C   1 
ATOM   1395  O  O   . LEU A 1 175 ? 54.305  -38.533  28.464  1.00 38.31  ? 302 LEU A O   1 
ATOM   1396  C  CB  . LEU A 1 175 ? 52.611  -36.214  27.147  1.00 37.88  ? 302 LEU A CB  1 
ATOM   1397  C  CG  . LEU A 1 175 ? 51.392  -35.826  26.311  1.00 37.44  ? 302 LEU A CG  1 
ATOM   1398  C  CD1 . LEU A 1 175 ? 51.772  -34.763  25.292  1.00 37.30  ? 302 LEU A CD1 1 
ATOM   1399  C  CD2 . LEU A 1 175 ? 50.794  -37.041  25.632  1.00 37.57  ? 302 LEU A CD2 1 
ATOM   1400  N  N   . GLN A 1 176 ? 54.079  -36.940  30.045  1.00 39.28  ? 303 GLN A N   1 
ATOM   1401  C  CA  . GLN A 1 176 ? 55.232  -37.372  30.840  1.00 40.11  ? 303 GLN A CA  1 
ATOM   1402  C  C   . GLN A 1 176 ? 55.016  -38.705  31.556  1.00 41.43  ? 303 GLN A C   1 
ATOM   1403  O  O   . GLN A 1 176 ? 55.976  -39.440  31.779  1.00 42.12  ? 303 GLN A O   1 
ATOM   1404  C  CB  . GLN A 1 176 ? 55.583  -36.323  31.899  1.00 40.35  ? 303 GLN A CB  1 
ATOM   1405  C  CG  . GLN A 1 176 ? 56.699  -35.374  31.526  1.00 40.19  ? 303 GLN A CG  1 
ATOM   1406  C  CD  . GLN A 1 176 ? 57.036  -34.427  32.665  1.00 39.84  ? 303 GLN A CD  1 
ATOM   1407  O  OE1 . GLN A 1 176 ? 56.143  -33.913  33.345  1.00 39.18  ? 303 GLN A OE1 1 
ATOM   1408  N  NE2 . GLN A 1 176 ? 58.328  -34.193  32.880  1.00 39.10  ? 303 GLN A NE2 1 
ATOM   1409  N  N   . LYS A 1 177 ? 53.775  -39.009  31.939  1.00 43.06  ? 304 LYS A N   1 
ATOM   1410  C  CA  . LYS A 1 177 ? 53.502  -40.186  32.778  1.00 44.39  ? 304 LYS A CA  1 
ATOM   1411  C  C   . LYS A 1 177 ? 54.241  -41.414  32.255  1.00 44.16  ? 304 LYS A C   1 
ATOM   1412  O  O   . LYS A 1 177 ? 54.172  -41.737  31.064  1.00 43.96  ? 304 LYS A O   1 
ATOM   1413  C  CB  . LYS A 1 177 ? 51.993  -40.475  32.909  1.00 46.12  ? 304 LYS A CB  1 
ATOM   1414  C  CG  . LYS A 1 177 ? 51.357  -41.366  31.818  1.00 47.27  ? 304 LYS A CG  1 
ATOM   1415  C  CD  . LYS A 1 177 ? 49.909  -41.716  32.174  1.00 48.07  ? 304 LYS A CD  1 
ATOM   1416  C  CE  . LYS A 1 177 ? 49.074  -42.074  30.947  1.00 48.35  ? 304 LYS A CE  1 
ATOM   1417  N  NZ  . LYS A 1 177 ? 48.585  -40.861  30.216  1.00 47.94  ? 304 LYS A NZ  1 
ATOM   1418  N  N   . LYS A 1 178 ? 54.963  -42.079  33.150  1.00 43.75  ? 305 LYS A N   1 
ATOM   1419  C  CA  . LYS A 1 178 ? 55.737  -43.265  32.787  1.00 43.16  ? 305 LYS A CA  1 
ATOM   1420  C  C   . LYS A 1 178 ? 55.182  -44.547  33.416  1.00 42.73  ? 305 LYS A C   1 
ATOM   1421  O  O   . LYS A 1 178 ? 55.590  -45.639  33.019  1.00 43.97  ? 305 LYS A O   1 
ATOM   1422  C  CB  . LYS A 1 178 ? 57.224  -43.067  33.109  1.00 42.69  ? 305 LYS A CB  1 
ATOM   1423  C  CG  . LYS A 1 178 ? 57.548  -42.748  34.564  1.00 43.05  ? 305 LYS A CG  1 
ATOM   1424  C  CD  . LYS A 1 178 ? 58.843  -41.942  34.702  1.00 43.04  ? 305 LYS A CD  1 
ATOM   1425  C  CE  . LYS A 1 178 ? 60.019  -42.596  33.990  1.00 43.09  ? 305 LYS A CE  1 
ATOM   1426  N  NZ  . LYS A 1 178 ? 61.326  -42.038  34.441  1.00 43.21  ? 305 LYS A NZ  1 
ATOM   1427  N  N   . ILE A 1 179 ? 54.249  -44.424  34.369  1.00 41.71  ? 306 ILE A N   1 
ATOM   1428  C  CA  . ILE A 1 179 ? 53.557  -45.595  34.926  1.00 41.09  ? 306 ILE A CA  1 
ATOM   1429  C  C   . ILE A 1 179 ? 52.093  -45.668  34.460  1.00 39.73  ? 306 ILE A C   1 
ATOM   1430  O  O   . ILE A 1 179 ? 51.403  -44.649  34.358  1.00 40.59  ? 306 ILE A O   1 
ATOM   1431  C  CB  . ILE A 1 179 ? 53.676  -45.681  36.492  1.00 42.19  ? 306 ILE A CB  1 
ATOM   1432  C  CG1 . ILE A 1 179 ? 52.535  -44.949  37.210  1.00 42.69  ? 306 ILE A CG1 1 
ATOM   1433  C  CG2 . ILE A 1 179 ? 55.048  -45.184  36.968  1.00 41.63  ? 306 ILE A CG2 1 
ATOM   1434  C  CD1 . ILE A 1 179 ? 51.261  -45.781  37.404  1.00 42.40  ? 306 ILE A CD1 1 
ATOM   1435  N  N   . TYR A 1 180 ? 51.641  -46.887  34.167  1.00 37.54  ? 307 TYR A N   1 
ATOM   1436  C  CA  . TYR A 1 180 ? 50.295  -47.142  33.641  1.00 35.36  ? 307 TYR A CA  1 
ATOM   1437  C  C   . TYR A 1 180 ? 50.078  -48.652  33.482  1.00 34.74  ? 307 TYR A C   1 
ATOM   1438  O  O   . TYR A 1 180 ? 48.940  -49.123  33.462  1.00 33.84  ? 307 TYR A O   1 
ATOM   1439  C  CB  . TYR A 1 180 ? 50.097  -46.458  32.280  1.00 34.60  ? 307 TYR A CB  1 
ATOM   1440  C  CG  . TYR A 1 180 ? 51.092  -46.908  31.243  1.00 34.05  ? 307 TYR A CG  1 
ATOM   1441  C  CD1 . TYR A 1 180 ? 50.811  -47.980  30.406  1.00 34.89  ? 307 TYR A CD1 1 
ATOM   1442  C  CD2 . TYR A 1 180 ? 52.324  -46.278  31.115  1.00 34.45  ? 307 TYR A CD2 1 
ATOM   1443  C  CE1 . TYR A 1 180 ? 51.736  -48.418  29.454  1.00 36.06  ? 307 TYR A CE1 1 
ATOM   1444  C  CE2 . TYR A 1 180 ? 53.258  -46.704  30.173  1.00 35.83  ? 307 TYR A CE2 1 
ATOM   1445  C  CZ  . TYR A 1 180 ? 52.959  -47.775  29.344  1.00 35.89  ? 307 TYR A CZ  1 
ATOM   1446  O  OH  . TYR A 1 180 ? 53.868  -48.197  28.406  1.00 35.03  ? 307 TYR A OH  1 
ATOM   1447  O  OXT . TYR A 1 180 ? 51.032  -49.435  33.347  1.00 32.58  ? 307 TYR A OXT 1 
ATOM   1448  N  N   . GLY B 1 1   ? 0.131   -80.209  34.294  1.00 22.55  ? 128 GLY B N   1 
ATOM   1449  C  CA  . GLY B 1 1   ? 0.359   -78.959  33.504  1.00 22.74  ? 128 GLY B CA  1 
ATOM   1450  C  C   . GLY B 1 1   ? 0.458   -79.210  32.005  1.00 23.41  ? 128 GLY B C   1 
ATOM   1451  O  O   . GLY B 1 1   ? 1.424   -79.818  31.531  1.00 25.04  ? 128 GLY B O   1 
ATOM   1452  N  N   . ASN B 1 2   ? -0.530  -78.725  31.256  1.00 22.21  ? 129 ASN B N   1 
ATOM   1453  C  CA  . ASN B 1 2   ? -0.600  -78.955  29.815  1.00 20.54  ? 129 ASN B CA  1 
ATOM   1454  C  C   . ASN B 1 2   ? 0.490   -78.247  29.022  1.00 20.44  ? 129 ASN B C   1 
ATOM   1455  O  O   . ASN B 1 2   ? 0.845   -77.109  29.321  1.00 20.43  ? 129 ASN B O   1 
ATOM   1456  C  CB  . ASN B 1 2   ? -1.972  -78.543  29.273  1.00 19.81  ? 129 ASN B CB  1 
ATOM   1457  C  CG  . ASN B 1 2   ? -3.071  -79.501  29.686  1.00 19.41  ? 129 ASN B CG  1 
ATOM   1458  O  OD1 . ASN B 1 2   ? -2.807  -80.555  30.261  1.00 19.18  ? 129 ASN B OD1 1 
ATOM   1459  N  ND2 . ASN B 1 2   ? -4.310  -79.142  29.386  1.00 18.27  ? 129 ASN B ND2 1 
ATOM   1460  N  N   . VAL B 1 3   ? 1.013   -78.941  28.014  1.00 19.69  ? 130 VAL B N   1 
ATOM   1461  C  CA  . VAL B 1 3   ? 1.971   -78.370  27.084  1.00 20.48  ? 130 VAL B CA  1 
ATOM   1462  C  C   . VAL B 1 3   ? 1.664   -78.824  25.650  1.00 20.72  ? 130 VAL B C   1 
ATOM   1463  O  O   . VAL B 1 3   ? 1.584   -80.026  25.375  1.00 20.04  ? 130 VAL B O   1 
ATOM   1464  C  CB  . VAL B 1 3   ? 3.434   -78.765  27.462  1.00 20.75  ? 130 VAL B CB  1 
ATOM   1465  C  CG1 . VAL B 1 3   ? 4.394   -78.434  26.332  1.00 19.13  ? 130 VAL B CG1 1 
ATOM   1466  C  CG2 . VAL B 1 3   ? 3.865   -78.062  28.759  1.00 20.99  ? 130 VAL B CG2 1 
ATOM   1467  N  N   . ASP B 1 4   ? 1.472   -77.850  24.757  1.00 20.72  ? 131 ASP B N   1 
ATOM   1468  C  CA  . ASP B 1 4   ? 1.432   -78.087  23.313  1.00 20.31  ? 131 ASP B CA  1 
ATOM   1469  C  C   . ASP B 1 4   ? 2.828   -77.799  22.778  1.00 20.19  ? 131 ASP B C   1 
ATOM   1470  O  O   . ASP B 1 4   ? 3.308   -76.651  22.833  1.00 19.77  ? 131 ASP B O   1 
ATOM   1471  C  CB  . ASP B 1 4   ? 0.417   -77.168  22.626  1.00 21.01  ? 131 ASP B CB  1 
ATOM   1472  C  CG  . ASP B 1 4   ? -1.022  -77.569  22.898  1.00 23.03  ? 131 ASP B CG  1 
ATOM   1473  O  OD1 . ASP B 1 4   ? -1.241  -78.668  23.458  1.00 24.89  ? 131 ASP B OD1 1 
ATOM   1474  O  OD2 . ASP B 1 4   ? -1.940  -76.795  22.543  1.00 21.74  ? 131 ASP B OD2 1 
ATOM   1475  N  N   . LEU B 1 5   ? 3.482   -78.845  22.279  1.00 17.95  ? 132 LEU B N   1 
ATOM   1476  C  CA  . LEU B 1 5   ? 4.859   -78.742  21.830  1.00 17.77  ? 132 LEU B CA  1 
ATOM   1477  C  C   . LEU B 1 5   ? 4.988   -79.012  20.332  1.00 16.82  ? 132 LEU B C   1 
ATOM   1478  O  O   . LEU B 1 5   ? 4.501   -80.024  19.833  1.00 15.82  ? 132 LEU B O   1 
ATOM   1479  C  CB  . LEU B 1 5   ? 5.740   -79.712  22.606  1.00 18.51  ? 132 LEU B CB  1 
ATOM   1480  C  CG  . LEU B 1 5   ? 7.249   -79.483  22.445  1.00 18.95  ? 132 LEU B CG  1 
ATOM   1481  C  CD1 . LEU B 1 5   ? 7.988   -79.745  23.762  1.00 18.72  ? 132 LEU B CD1 1 
ATOM   1482  C  CD2 . LEU B 1 5   ? 7.808   -80.341  21.310  1.00 19.62  ? 132 LEU B CD2 1 
ATOM   1483  N  N   . VAL B 1 6   ? 5.647   -78.095  19.632  1.00 14.69  ? 133 VAL B N   1 
ATOM   1484  C  CA  . VAL B 1 6   ? 5.939   -78.258  18.219  1.00 13.91  ? 133 VAL B CA  1 
ATOM   1485  C  C   . VAL B 1 6   ? 7.430   -78.542  18.014  1.00 13.11  ? 133 VAL B C   1 
ATOM   1486  O  O   . VAL B 1 6   ? 8.290   -77.787  18.510  1.00 10.13  ? 133 VAL B O   1 
ATOM   1487  C  CB  . VAL B 1 6   ? 5.542   -76.997  17.426  1.00 13.04  ? 133 VAL B CB  1 
ATOM   1488  C  CG1 . VAL B 1 6   ? 5.789   -77.211  15.913  1.00 13.78  ? 133 VAL B CG1 1 
ATOM   1489  C  CG2 . VAL B 1 6   ? 4.095   -76.667  17.683  1.00 11.68  ? 133 VAL B CG2 1 
ATOM   1490  N  N   . PHE B 1 7   ? 7.729   -79.644  17.319  1.00 12.34  ? 134 PHE B N   1 
ATOM   1491  C  CA  . PHE B 1 7   ? 9.083   -79.887  16.833  1.00 12.41  ? 134 PHE B CA  1 
ATOM   1492  C  C   . PHE B 1 7   ? 9.186   -79.214  15.467  1.00 13.36  ? 134 PHE B C   1 
ATOM   1493  O  O   . PHE B 1 7   ? 8.444   -79.557  14.546  1.00 13.95  ? 134 PHE B O   1 
ATOM   1494  C  CB  . PHE B 1 7   ? 9.389   -81.365  16.640  1.00 12.70  ? 134 PHE B CB  1 
ATOM   1495  C  CG  . PHE B 1 7   ? 9.260   -82.219  17.887  1.00 13.01  ? 134 PHE B CG  1 
ATOM   1496  C  CD1 . PHE B 1 7   ? 10.231  -82.184  18.881  1.00 12.14  ? 134 PHE B CD1 1 
ATOM   1497  C  CD2 . PHE B 1 7   ? 8.196   -83.117  18.028  1.00 12.92  ? 134 PHE B CD2 1 
ATOM   1498  C  CE1 . PHE B 1 7   ? 10.131  -82.997  20.005  1.00 11.36  ? 134 PHE B CE1 1 
ATOM   1499  C  CE2 . PHE B 1 7   ? 8.088   -83.927  19.160  1.00 12.17  ? 134 PHE B CE2 1 
ATOM   1500  C  CZ  . PHE B 1 7   ? 9.060   -83.868  20.145  1.00 10.81  ? 134 PHE B CZ  1 
ATOM   1501  N  N   . LEU B 1 8   ? 10.082  -78.241  15.351  1.00 13.23  ? 135 LEU B N   1 
ATOM   1502  C  CA  . LEU B 1 8   ? 10.423  -77.633  14.074  1.00 14.36  ? 135 LEU B CA  1 
ATOM   1503  C  C   . LEU B 1 8   ? 11.833  -78.114  13.685  1.00 13.82  ? 135 LEU B C   1 
ATOM   1504  O  O   . LEU B 1 8   ? 12.849  -77.623  14.215  1.00 11.57  ? 135 LEU B O   1 
ATOM   1505  C  CB  . LEU B 1 8   ? 10.379  -76.101  14.185  1.00 14.85  ? 135 LEU B CB  1 
ATOM   1506  C  CG  . LEU B 1 8   ? 10.659  -75.295  12.917  1.00 15.01  ? 135 LEU B CG  1 
ATOM   1507  C  CD1 . LEU B 1 8   ? 9.664   -75.682  11.795  1.00 12.73  ? 135 LEU B CD1 1 
ATOM   1508  C  CD2 . LEU B 1 8   ? 10.620  -73.784  13.238  1.00 14.53  ? 135 LEU B CD2 1 
ATOM   1509  N  N   . PHE B 1 9   ? 11.883  -79.063  12.752  1.00 12.02  ? 136 PHE B N   1 
ATOM   1510  C  CA  . PHE B 1 9   ? 13.118  -79.790  12.472  1.00 13.11  ? 136 PHE B CA  1 
ATOM   1511  C  C   . PHE B 1 9   ? 13.650  -79.591  11.050  1.00 12.99  ? 136 PHE B C   1 
ATOM   1512  O  O   . PHE B 1 9   ? 12.904  -79.568  10.065  1.00 13.93  ? 136 PHE B O   1 
ATOM   1513  C  CB  . PHE B 1 9   ? 12.969  -81.272  12.804  1.00 13.46  ? 136 PHE B CB  1 
ATOM   1514  C  CG  . PHE B 1 9   ? 11.975  -82.015  11.937  1.00 14.41  ? 136 PHE B CG  1 
ATOM   1515  C  CD1 . PHE B 1 9   ? 12.418  -82.888  10.944  1.00 14.97  ? 136 PHE B CD1 1 
ATOM   1516  C  CD2 . PHE B 1 9   ? 10.612  -81.878  12.141  1.00 14.14  ? 136 PHE B CD2 1 
ATOM   1517  C  CE1 . PHE B 1 9   ? 11.523  -83.602  10.165  1.00 13.59  ? 136 PHE B CE1 1 
ATOM   1518  C  CE2 . PHE B 1 9   ? 9.708   -82.579  11.354  1.00 14.98  ? 136 PHE B CE2 1 
ATOM   1519  C  CZ  . PHE B 1 9   ? 10.170  -83.450  10.366  1.00 14.66  ? 136 PHE B CZ  1 
ATOM   1520  N  N   . ASP B 1 10  ? 14.970  -79.475  10.986  1.00 14.36  ? 137 ASP B N   1 
ATOM   1521  C  CA  . ASP B 1 10  ? 15.708  -78.965  9.834   1.00 14.46  ? 137 ASP B CA  1 
ATOM   1522  C  C   . ASP B 1 10  ? 15.930  -80.065  8.810   1.00 13.53  ? 137 ASP B C   1 
ATOM   1523  O  O   . ASP B 1 10  ? 16.690  -81.003  9.046   1.00 16.36  ? 137 ASP B O   1 
ATOM   1524  C  CB  . ASP B 1 10  ? 17.038  -78.410  10.347  1.00 13.98  ? 137 ASP B CB  1 
ATOM   1525  C  CG  . ASP B 1 10  ? 17.827  -77.652  9.300   1.00 13.95  ? 137 ASP B CG  1 
ATOM   1526  O  OD1 . ASP B 1 10  ? 17.724  -77.940  8.082   1.00 13.69  ? 137 ASP B OD1 1 
ATOM   1527  O  OD2 . ASP B 1 10  ? 18.590  -76.765  9.733   1.00 15.51  ? 137 ASP B OD2 1 
ATOM   1528  N  N   . GLY B 1 11  ? 15.249  -79.951  7.674   1.00 12.49  ? 138 GLY B N   1 
ATOM   1529  C  CA  . GLY B 1 11  ? 15.355  -80.943  6.594   1.00 12.18  ? 138 GLY B CA  1 
ATOM   1530  C  C   . GLY B 1 11  ? 16.307  -80.572  5.467   1.00 10.25  ? 138 GLY B C   1 
ATOM   1531  O  O   . GLY B 1 11  ? 16.318  -81.218  4.417   1.00 9.58   ? 138 GLY B O   1 
ATOM   1532  N  N   . SER B 1 12  ? 17.112  -79.537  5.682   1.00 10.00  ? 139 SER B N   1 
ATOM   1533  C  CA  . SER B 1 12  ? 18.002  -79.022  4.639   1.00 10.89  ? 139 SER B CA  1 
ATOM   1534  C  C   . SER B 1 12  ? 19.223  -79.925  4.416   1.00 12.03  ? 139 SER B C   1 
ATOM   1535  O  O   . SER B 1 12  ? 19.578  -80.737  5.284   1.00 11.84  ? 139 SER B O   1 
ATOM   1536  C  CB  . SER B 1 12  ? 18.457  -77.609  4.995   1.00 9.79   ? 139 SER B CB  1 
ATOM   1537  O  OG  . SER B 1 12  ? 19.362  -77.624  6.076   1.00 10.10  ? 139 SER B OG  1 
ATOM   1538  N  N   . MET B 1 13  ? 19.877  -79.762  3.266   1.00 11.88  ? 140 MET B N   1 
ATOM   1539  C  CA  . MET B 1 13  ? 20.970  -80.662  2.884   1.00 13.32  ? 140 MET B CA  1 
ATOM   1540  C  C   . MET B 1 13  ? 22.287  -80.441  3.654   1.00 14.02  ? 140 MET B C   1 
ATOM   1541  O  O   . MET B 1 13  ? 23.194  -81.258  3.544   1.00 16.11  ? 140 MET B O   1 
ATOM   1542  C  CB  . MET B 1 13  ? 21.233  -80.567  1.373   1.00 12.81  ? 140 MET B CB  1 
ATOM   1543  C  CG  . MET B 1 13  ? 21.809  -81.835  0.783   1.00 12.67  ? 140 MET B CG  1 
ATOM   1544  S  SD  . MET B 1 13  ? 22.478  -81.585  -0.856  1.00 15.16  ? 140 MET B SD  1 
ATOM   1545  C  CE  . MET B 1 13  ? 20.974  -81.579  -1.852  1.00 13.18  ? 140 MET B CE  1 
ATOM   1546  N  N   . SER B 1 14  ? 22.412  -79.334  4.389   1.00 13.94  ? 141 SER B N   1 
ATOM   1547  C  CA  . SER B 1 14  ? 23.607  -79.093  5.210   1.00 14.62  ? 141 SER B CA  1 
ATOM   1548  C  C   . SER B 1 14  ? 23.802  -80.164  6.292   1.00 13.78  ? 141 SER B C   1 
ATOM   1549  O  O   . SER B 1 14  ? 24.926  -80.483  6.658   1.00 14.49  ? 141 SER B O   1 
ATOM   1550  C  CB  . SER B 1 14  ? 23.550  -77.713  5.871   1.00 14.18  ? 141 SER B CB  1 
ATOM   1551  O  OG  . SER B 1 14  ? 22.422  -77.605  6.711   1.00 14.76  ? 141 SER B OG  1 
ATOM   1552  N  N   . LEU B 1 15  ? 22.712  -80.718  6.804   1.00 13.64  ? 142 LEU B N   1 
ATOM   1553  C  CA  . LEU B 1 15  ? 22.816  -81.826  7.737   1.00 14.14  ? 142 LEU B CA  1 
ATOM   1554  C  C   . LEU B 1 15  ? 23.370  -83.075  7.048   1.00 13.08  ? 142 LEU B C   1 
ATOM   1555  O  O   . LEU B 1 15  ? 23.063  -83.360  5.886   1.00 13.18  ? 142 LEU B O   1 
ATOM   1556  C  CB  . LEU B 1 15  ? 21.461  -82.121  8.392   1.00 15.63  ? 142 LEU B CB  1 
ATOM   1557  C  CG  . LEU B 1 15  ? 21.048  -81.136  9.505   1.00 17.17  ? 142 LEU B CG  1 
ATOM   1558  C  CD1 . LEU B 1 15  ? 20.241  -79.934  8.984   1.00 16.45  ? 142 LEU B CD1 1 
ATOM   1559  C  CD2 . LEU B 1 15  ? 20.268  -81.857  10.552  1.00 17.31  ? 142 LEU B CD2 1 
ATOM   1560  N  N   . GLN B 1 16  ? 24.205  -83.803  7.775   1.00 12.32  ? 143 GLN B N   1 
ATOM   1561  C  CA  . GLN B 1 16  ? 24.666  -85.115  7.343   1.00 13.14  ? 143 GLN B CA  1 
ATOM   1562  C  C   . GLN B 1 16  ? 23.541  -86.107  7.549   1.00 10.75  ? 143 GLN B C   1 
ATOM   1563  O  O   . GLN B 1 16  ? 22.747  -85.950  8.465   1.00 11.22  ? 143 GLN B O   1 
ATOM   1564  C  CB  . GLN B 1 16  ? 25.901  -85.545  8.132   1.00 14.44  ? 143 GLN B CB  1 
ATOM   1565  C  CG  . GLN B 1 16  ? 26.969  -84.485  8.082   1.00 15.71  ? 143 GLN B CG  1 
ATOM   1566  C  CD  . GLN B 1 16  ? 28.338  -84.985  8.417   1.00 18.42  ? 143 GLN B CD  1 
ATOM   1567  O  OE1 . GLN B 1 16  ? 29.302  -84.557  7.809   1.00 25.10  ? 143 GLN B OE1 1 
ATOM   1568  N  NE2 . GLN B 1 16  ? 28.443  -85.871  9.386   1.00 18.08  ? 143 GLN B NE2 1 
ATOM   1569  N  N   . PRO B 1 17  ? 23.445  -87.109  6.674   1.00 9.51   ? 144 PRO B N   1 
ATOM   1570  C  CA  . PRO B 1 17  ? 22.356  -88.072  6.780   1.00 10.65  ? 144 PRO B CA  1 
ATOM   1571  C  C   . PRO B 1 17  ? 22.129  -88.609  8.214   1.00 10.56  ? 144 PRO B C   1 
ATOM   1572  O  O   . PRO B 1 17  ? 21.006  -88.630  8.687   1.00 9.89   ? 144 PRO B O   1 
ATOM   1573  C  CB  . PRO B 1 17  ? 22.798  -89.197  5.823   1.00 9.91   ? 144 PRO B CB  1 
ATOM   1574  C  CG  . PRO B 1 17  ? 23.649  -88.514  4.806   1.00 9.54   ? 144 PRO B CG  1 
ATOM   1575  C  CD  . PRO B 1 17  ? 24.346  -87.405  5.539   1.00 9.61   ? 144 PRO B CD  1 
ATOM   1576  N  N   . ASP B 1 18  ? 23.186  -89.046  8.882   1.00 12.51  ? 145 ASP B N   1 
ATOM   1577  C  CA  . ASP B 1 18  ? 23.072  -89.532  10.265  1.00 15.30  ? 145 ASP B CA  1 
ATOM   1578  C  C   . ASP B 1 18  ? 22.564  -88.485  11.262  1.00 14.69  ? 145 ASP B C   1 
ATOM   1579  O  O   . ASP B 1 18  ? 21.866  -88.825  12.224  1.00 14.20  ? 145 ASP B O   1 
ATOM   1580  C  CB  . ASP B 1 18  ? 24.412  -90.103  10.743  1.00 16.74  ? 145 ASP B CB  1 
ATOM   1581  C  CG  . ASP B 1 18  ? 24.741  -91.438  10.082  1.00 20.27  ? 145 ASP B CG  1 
ATOM   1582  O  OD1 . ASP B 1 18  ? 23.939  -91.892  9.228   1.00 20.87  ? 145 ASP B OD1 1 
ATOM   1583  O  OD2 . ASP B 1 18  ? 25.799  -92.039  10.414  1.00 23.38  ? 145 ASP B OD2 1 
ATOM   1584  N  N   . GLU B 1 19  ? 22.909  -87.224  11.025  1.00 13.09  ? 146 GLU B N   1 
ATOM   1585  C  CA  . GLU B 1 19  ? 22.454  -86.130  11.872  1.00 13.06  ? 146 GLU B CA  1 
ATOM   1586  C  C   . GLU B 1 19  ? 20.940  -85.969  11.747  1.00 14.15  ? 146 GLU B C   1 
ATOM   1587  O  O   . GLU B 1 19  ? 20.256  -85.823  12.755  1.00 14.35  ? 146 GLU B O   1 
ATOM   1588  C  CB  . GLU B 1 19  ? 23.190  -84.824  11.521  1.00 12.70  ? 146 GLU B CB  1 
ATOM   1589  C  CG  . GLU B 1 19  ? 24.657  -84.848  11.874  1.00 11.91  ? 146 GLU B CG  1 
ATOM   1590  C  CD  . GLU B 1 19  ? 25.464  -83.647  11.360  1.00 13.59  ? 146 GLU B CD  1 
ATOM   1591  O  OE1 . GLU B 1 19  ? 24.953  -82.821  10.574  1.00 11.00  ? 146 GLU B OE1 1 
ATOM   1592  O  OE2 . GLU B 1 19  ? 26.646  -83.531  11.769  1.00 14.85  ? 146 GLU B OE2 1 
ATOM   1593  N  N   . PHE B 1 20  ? 20.417  -86.039  10.521  1.00 14.95  ? 147 PHE B N   1 
ATOM   1594  C  CA  . PHE B 1 20  ? 18.961  -85.981  10.300  1.00 16.15  ? 147 PHE B CA  1 
ATOM   1595  C  C   . PHE B 1 20  ? 18.224  -87.179  10.894  1.00 15.59  ? 147 PHE B C   1 
ATOM   1596  O  O   . PHE B 1 20  ? 17.133  -87.037  11.436  1.00 16.59  ? 147 PHE B O   1 
ATOM   1597  C  CB  . PHE B 1 20  ? 18.621  -85.854  8.810   1.00 16.18  ? 147 PHE B CB  1 
ATOM   1598  C  CG  . PHE B 1 20  ? 17.138  -85.725  8.533   1.00 14.85  ? 147 PHE B CG  1 
ATOM   1599  C  CD1 . PHE B 1 20  ? 16.456  -84.570  8.876   1.00 15.74  ? 147 PHE B CD1 1 
ATOM   1600  C  CD2 . PHE B 1 20  ? 16.432  -86.760  7.932   1.00 14.95  ? 147 PHE B CD2 1 
ATOM   1601  C  CE1 . PHE B 1 20  ? 15.107  -84.437  8.625   1.00 14.47  ? 147 PHE B CE1 1 
ATOM   1602  C  CE2 . PHE B 1 20  ? 15.084  -86.636  7.680   1.00 14.39  ? 147 PHE B CE2 1 
ATOM   1603  C  CZ  . PHE B 1 20  ? 14.421  -85.467  8.027   1.00 14.71  ? 147 PHE B CZ  1 
ATOM   1604  N  N   . GLN B 1 21  ? 18.815  -88.357  10.801  1.00 17.57  ? 148 GLN B N   1 
ATOM   1605  C  CA  . GLN B 1 21  ? 18.261  -89.541  11.473  1.00 16.54  ? 148 GLN B CA  1 
ATOM   1606  C  C   . GLN B 1 21  ? 18.229  -89.377  13.009  1.00 16.95  ? 148 GLN B C   1 
ATOM   1607  O  O   . GLN B 1 21  ? 17.268  -89.778  13.660  1.00 17.31  ? 148 GLN B O   1 
ATOM   1608  C  CB  . GLN B 1 21  ? 19.053  -90.783  11.079  1.00 16.46  ? 148 GLN B CB  1 
ATOM   1609  C  CG  . GLN B 1 21  ? 18.420  -92.080  11.529  1.00 17.38  ? 148 GLN B CG  1 
ATOM   1610  C  CD  . GLN B 1 21  ? 16.970  -92.207  11.060  1.00 19.54  ? 148 GLN B CD  1 
ATOM   1611  O  OE1 . GLN B 1 21  ? 16.670  -92.053  9.863   1.00 19.46  ? 148 GLN B OE1 1 
ATOM   1612  N  NE2 . GLN B 1 21  ? 16.062  -92.467  12.007  1.00 18.64  ? 148 GLN B NE2 1 
ATOM   1613  N  N   . LYS B 1 22  ? 19.279  -88.802  13.588  1.00 17.84  ? 149 LYS B N   1 
ATOM   1614  C  CA  . LYS B 1 22  ? 19.278  -88.499  15.024  1.00 19.64  ? 149 LYS B CA  1 
ATOM   1615  C  C   . LYS B 1 22  ? 18.138  -87.545  15.433  1.00 17.87  ? 149 LYS B C   1 
ATOM   1616  O  O   . LYS B 1 22  ? 17.556  -87.699  16.502  1.00 17.17  ? 149 LYS B O   1 
ATOM   1617  C  CB  . LYS B 1 22  ? 20.626  -87.924  15.476  1.00 22.11  ? 149 LYS B CB  1 
ATOM   1618  C  CG  . LYS B 1 22  ? 21.671  -88.965  15.795  1.00 24.17  ? 149 LYS B CG  1 
ATOM   1619  C  CD  . LYS B 1 22  ? 23.053  -88.340  15.889  1.00 27.33  ? 149 LYS B CD  1 
ATOM   1620  C  CE  . LYS B 1 22  ? 24.135  -89.369  16.269  1.00 29.43  ? 149 LYS B CE  1 
ATOM   1621  N  NZ  . LYS B 1 22  ? 24.425  -90.362  15.168  1.00 30.93  ? 149 LYS B NZ  1 
ATOM   1622  N  N   . ILE B 1 23  ? 17.839  -86.567  14.583  1.00 16.46  ? 150 ILE B N   1 
ATOM   1623  C  CA  . ILE B 1 23  ? 16.732  -85.640  14.806  1.00 15.76  ? 150 ILE B CA  1 
ATOM   1624  C  C   . ILE B 1 23  ? 15.399  -86.385  14.836  1.00 15.79  ? 150 ILE B C   1 
ATOM   1625  O  O   . ILE B 1 23  ? 14.612  -86.210  15.769  1.00 16.29  ? 150 ILE B O   1 
ATOM   1626  C  CB  . ILE B 1 23  ? 16.703  -84.507  13.727  1.00 17.12  ? 150 ILE B CB  1 
ATOM   1627  C  CG1 . ILE B 1 23  ? 17.934  -83.587  13.870  1.00 15.98  ? 150 ILE B CG1 1 
ATOM   1628  C  CG2 . ILE B 1 23  ? 15.428  -83.669  13.841  1.00 16.91  ? 150 ILE B CG2 1 
ATOM   1629  C  CD1 . ILE B 1 23  ? 18.067  -82.560  12.750  1.00 16.23  ? 150 ILE B CD1 1 
ATOM   1630  N  N   . LEU B 1 24  ? 15.166  -87.236  13.836  1.00 15.46  ? 151 LEU B N   1 
ATOM   1631  C  CA  . LEU B 1 24  ? 13.981  -88.100  13.809  1.00 16.10  ? 151 LEU B CA  1 
ATOM   1632  C  C   . LEU B 1 24  ? 13.884  -88.938  15.070  1.00 15.56  ? 151 LEU B C   1 
ATOM   1633  O  O   . LEU B 1 24  ? 12.832  -89.008  15.699  1.00 15.28  ? 151 LEU B O   1 
ATOM   1634  C  CB  . LEU B 1 24  ? 13.984  -89.033  12.579  1.00 16.16  ? 151 LEU B CB  1 
ATOM   1635  C  CG  . LEU B 1 24  ? 13.868  -88.391  11.191  1.00 16.61  ? 151 LEU B CG  1 
ATOM   1636  C  CD1 . LEU B 1 24  ? 14.052  -89.425  10.062  1.00 14.17  ? 151 LEU B CD1 1 
ATOM   1637  C  CD2 . LEU B 1 24  ? 12.525  -87.657  11.038  1.00 16.00  ? 151 LEU B CD2 1 
ATOM   1638  N  N   . ASP B 1 25  ? 14.986  -89.581  15.434  1.00 16.59  ? 152 ASP B N   1 
ATOM   1639  C  CA  . ASP B 1 25  ? 15.019  -90.419  16.633  1.00 17.69  ? 152 ASP B CA  1 
ATOM   1640  C  C   . ASP B 1 25  ? 14.802  -89.626  17.917  1.00 17.21  ? 152 ASP B C   1 
ATOM   1641  O  O   . ASP B 1 25  ? 14.142  -90.095  18.839  1.00 19.26  ? 152 ASP B O   1 
ATOM   1642  C  CB  . ASP B 1 25  ? 16.333  -91.196  16.698  1.00 19.27  ? 152 ASP B CB  1 
ATOM   1643  C  CG  . ASP B 1 25  ? 16.420  -92.285  15.621  1.00 22.57  ? 152 ASP B CG  1 
ATOM   1644  O  OD1 . ASP B 1 25  ? 15.361  -92.676  15.067  1.00 23.43  ? 152 ASP B OD1 1 
ATOM   1645  O  OD2 . ASP B 1 25  ? 17.544  -92.753  15.334  1.00 24.08  ? 152 ASP B OD2 1 
ATOM   1646  N  N   . PHE B 1 26  ? 15.348  -88.419  17.967  1.00 16.68  ? 153 PHE B N   1 
ATOM   1647  C  CA  . PHE B 1 26  ? 15.182  -87.546  19.119  1.00 15.83  ? 153 PHE B CA  1 
ATOM   1648  C  C   . PHE B 1 26  ? 13.713  -87.192  19.328  1.00 15.04  ? 153 PHE B C   1 
ATOM   1649  O  O   . PHE B 1 26  ? 13.209  -87.276  20.440  1.00 14.36  ? 153 PHE B O   1 
ATOM   1650  C  CB  . PHE B 1 26  ? 16.014  -86.280  18.928  1.00 16.38  ? 153 PHE B CB  1 
ATOM   1651  C  CG  . PHE B 1 26  ? 15.741  -85.210  19.943  1.00 17.20  ? 153 PHE B CG  1 
ATOM   1652  C  CD1 . PHE B 1 26  ? 16.274  -85.295  21.219  1.00 16.41  ? 153 PHE B CD1 1 
ATOM   1653  C  CD2 . PHE B 1 26  ? 14.975  -84.096  19.611  1.00 16.23  ? 153 PHE B CD2 1 
ATOM   1654  C  CE1 . PHE B 1 26  ? 16.031  -84.300  22.164  1.00 15.93  ? 153 PHE B CE1 1 
ATOM   1655  C  CE2 . PHE B 1 26  ? 14.721  -83.109  20.554  1.00 15.56  ? 153 PHE B CE2 1 
ATOM   1656  C  CZ  . PHE B 1 26  ? 15.257  -83.210  21.829  1.00 15.34  ? 153 PHE B CZ  1 
ATOM   1657  N  N   . MET B 1 27  ? 13.034  -86.797  18.253  1.00 15.90  ? 154 MET B N   1 
ATOM   1658  C  CA  . MET B 1 27  ? 11.626  -86.405  18.339  1.00 16.14  ? 154 MET B CA  1 
ATOM   1659  C  C   . MET B 1 27  ? 10.775  -87.556  18.837  1.00 16.24  ? 154 MET B C   1 
ATOM   1660  O  O   . MET B 1 27  ? 9.911   -87.374  19.702  1.00 15.33  ? 154 MET B O   1 
ATOM   1661  C  CB  . MET B 1 27  ? 11.101  -85.922  16.989  1.00 15.37  ? 154 MET B CB  1 
ATOM   1662  C  CG  . MET B 1 27  ? 11.655  -84.575  16.565  1.00 16.00  ? 154 MET B CG  1 
ATOM   1663  S  SD  . MET B 1 27  ? 10.965  -83.971  15.006  1.00 16.80  ? 154 MET B SD  1 
ATOM   1664  C  CE  . MET B 1 27  ? 11.514  -85.199  13.812  1.00 12.46  ? 154 MET B CE  1 
ATOM   1665  N  N   . LYS B 1 28  ? 11.028  -88.741  18.288  1.00 17.81  ? 155 LYS B N   1 
ATOM   1666  C  CA  . LYS B 1 28  ? 10.294  -89.947  18.681  1.00 18.42  ? 155 LYS B CA  1 
ATOM   1667  C  C   . LYS B 1 28  ? 10.571  -90.342  20.127  1.00 18.00  ? 155 LYS B C   1 
ATOM   1668  O  O   . LYS B 1 28  ? 9.643   -90.724  20.849  1.00 17.52  ? 155 LYS B O   1 
ATOM   1669  C  CB  . LYS B 1 28  ? 10.596  -91.095  17.720  1.00 19.23  ? 155 LYS B CB  1 
ATOM   1670  C  CG  . LYS B 1 28  ? 10.015  -90.833  16.337  1.00 20.84  ? 155 LYS B CG  1 
ATOM   1671  C  CD  . LYS B 1 28  ? 10.078  -92.033  15.413  1.00 22.53  ? 155 LYS B CD  1 
ATOM   1672  C  CE  . LYS B 1 28  ? 11.494  -92.410  15.050  1.00 23.61  ? 155 LYS B CE  1 
ATOM   1673  N  NZ  . LYS B 1 28  ? 11.504  -93.170  13.777  1.00 24.97  ? 155 LYS B NZ  1 
ATOM   1674  N  N   . ASP B 1 29  ? 11.831  -90.226  20.555  1.00 16.94  ? 156 ASP B N   1 
ATOM   1675  C  CA  . ASP B 1 29  ? 12.188  -90.488  21.955  1.00 17.36  ? 156 ASP B CA  1 
ATOM   1676  C  C   . ASP B 1 29  ? 11.482  -89.570  22.948  1.00 16.28  ? 156 ASP B C   1 
ATOM   1677  O  O   . ASP B 1 29  ? 11.037  -90.015  24.012  1.00 15.69  ? 156 ASP B O   1 
ATOM   1678  C  CB  . ASP B 1 29  ? 13.689  -90.347  22.172  1.00 18.37  ? 156 ASP B CB  1 
ATOM   1679  C  CG  . ASP B 1 29  ? 14.483  -91.443  21.511  1.00 20.23  ? 156 ASP B CG  1 
ATOM   1680  O  OD1 . ASP B 1 29  ? 13.891  -92.477  21.128  1.00 20.46  ? 156 ASP B OD1 1 
ATOM   1681  O  OD2 . ASP B 1 29  ? 15.712  -91.260  21.374  1.00 20.99  ? 156 ASP B OD2 1 
ATOM   1682  N  N   . VAL B 1 30  ? 11.417  -88.288  22.617  1.00 15.75  ? 157 VAL B N   1 
ATOM   1683  C  CA  . VAL B 1 30  ? 10.796  -87.308  23.501  1.00 16.09  ? 157 VAL B CA  1 
ATOM   1684  C  C   . VAL B 1 30  ? 9.303   -87.601  23.622  1.00 16.04  ? 157 VAL B C   1 
ATOM   1685  O  O   . VAL B 1 30  ? 8.759   -87.606  24.725  1.00 15.87  ? 157 VAL B O   1 
ATOM   1686  C  CB  . VAL B 1 30  ? 11.030  -85.857  22.999  1.00 16.37  ? 157 VAL B CB  1 
ATOM   1687  C  CG1 . VAL B 1 30  ? 10.208  -84.864  23.816  1.00 15.25  ? 157 VAL B CG1 1 
ATOM   1688  C  CG2 . VAL B 1 30  ? 12.531  -85.498  23.037  1.00 13.59  ? 157 VAL B CG2 1 
ATOM   1689  N  N   . MET B 1 31  ? 8.651   -87.861  22.487  1.00 16.96  ? 158 MET B N   1 
ATOM   1690  C  CA  . MET B 1 31  ? 7.225   -88.217  22.469  1.00 16.95  ? 158 MET B CA  1 
ATOM   1691  C  C   . MET B 1 31  ? 6.951   -89.500  23.229  1.00 15.49  ? 158 MET B C   1 
ATOM   1692  O  O   . MET B 1 31  ? 5.943   -89.602  23.925  1.00 15.31  ? 158 MET B O   1 
ATOM   1693  C  CB  . MET B 1 31  ? 6.711   -88.365  21.043  1.00 18.46  ? 158 MET B CB  1 
ATOM   1694  C  CG  . MET B 1 31  ? 6.629   -87.065  20.269  1.00 19.83  ? 158 MET B CG  1 
ATOM   1695  S  SD  . MET B 1 31  ? 6.073   -87.337  18.567  1.00 21.33  ? 158 MET B SD  1 
ATOM   1696  C  CE  . MET B 1 31  ? 4.356   -87.063  18.737  1.00 22.93  ? 158 MET B CE  1 
ATOM   1697  N  N   . LYS B 1 32  ? 7.843   -90.478  23.103  1.00 16.26  ? 159 LYS B N   1 
ATOM   1698  C  CA  . LYS B 1 32  ? 7.698   -91.730  23.849  1.00 16.97  ? 159 LYS B CA  1 
ATOM   1699  C  C   . LYS B 1 32  ? 7.927   -91.494  25.346  1.00 18.98  ? 159 LYS B C   1 
ATOM   1700  O  O   . LYS B 1 32  ? 7.174   -92.014  26.172  1.00 20.55  ? 159 LYS B O   1 
ATOM   1701  C  CB  . LYS B 1 32  ? 8.639   -92.822  23.313  1.00 17.53  ? 159 LYS B CB  1 
ATOM   1702  C  CG  . LYS B 1 32  ? 8.236   -93.412  21.948  1.00 17.61  ? 159 LYS B CG  1 
ATOM   1703  C  CD  . LYS B 1 32  ? 9.406   -94.154  21.267  1.00 17.96  ? 159 LYS B CD  1 
ATOM   1704  C  CE  . LYS B 1 32  ? 9.122   -94.422  19.775  1.00 19.30  ? 159 LYS B CE  1 
ATOM   1705  N  NZ  . LYS B 1 32  ? 10.199  -95.168  19.031  1.00 17.82  ? 159 LYS B NZ  1 
ATOM   1706  N  N   . LYS B 1 33  ? 8.943   -90.702  25.692  1.00 19.19  ? 160 LYS B N   1 
ATOM   1707  C  CA  . LYS B 1 33  ? 9.248   -90.413  27.092  1.00 20.87  ? 160 LYS B CA  1 
ATOM   1708  C  C   . LYS B 1 33  ? 8.144   -89.559  27.727  1.00 21.20  ? 160 LYS B C   1 
ATOM   1709  O  O   . LYS B 1 33  ? 7.603   -89.913  28.775  1.00 21.84  ? 160 LYS B O   1 
ATOM   1710  C  CB  . LYS B 1 33  ? 10.613  -89.711  27.222  1.00 21.39  ? 160 LYS B CB  1 
ATOM   1711  C  CG  . LYS B 1 33  ? 11.125  -89.539  28.658  1.00 21.97  ? 160 LYS B CG  1 
ATOM   1712  C  CD  . LYS B 1 33  ? 12.441  -88.730  28.684  1.00 24.08  ? 160 LYS B CD  1 
ATOM   1713  C  CE  . LYS B 1 33  ? 13.250  -88.909  29.990  1.00 25.26  ? 160 LYS B CE  1 
ATOM   1714  N  NZ  . LYS B 1 33  ? 12.540  -88.491  31.248  1.00 26.09  ? 160 LYS B NZ  1 
ATOM   1715  N  N   . CYS B 1 34  ? 7.817   -88.442  27.084  1.00 20.36  ? 161 CYS B N   1 
ATOM   1716  C  CA  . CYS B 1 34  ? 6.793   -87.516  27.572  1.00 19.88  ? 161 CYS B CA  1 
ATOM   1717  C  C   . CYS B 1 34  ? 5.426   -87.877  26.994  1.00 20.48  ? 161 CYS B C   1 
ATOM   1718  O  O   . CYS B 1 34  ? 4.820   -87.090  26.255  1.00 20.19  ? 161 CYS B O   1 
ATOM   1719  C  CB  . CYS B 1 34  ? 7.183   -86.093  27.180  1.00 19.09  ? 161 CYS B CB  1 
ATOM   1720  S  SG  . CYS B 1 34  ? 8.872   -85.748  27.596  1.00 19.26  ? 161 CYS B SG  1 
ATOM   1721  N  N   . SER B 1 35  ? 4.942   -89.062  27.357  1.00 20.56  ? 162 SER B N   1 
ATOM   1722  C  CA  . SER B 1 35  ? 3.754   -89.644  26.735  1.00 22.08  ? 162 SER B CA  1 
ATOM   1723  C  C   . SER B 1 35  ? 2.434   -89.339  27.448  1.00 22.11  ? 162 SER B C   1 
ATOM   1724  O  O   . SER B 1 35  ? 1.376   -89.642  26.908  1.00 21.53  ? 162 SER B O   1 
ATOM   1725  C  CB  . SER B 1 35  ? 3.914   -91.168  26.625  1.00 22.29  ? 162 SER B CB  1 
ATOM   1726  O  OG  . SER B 1 35  ? 4.026   -91.759  27.920  1.00 22.75  ? 162 SER B OG  1 
ATOM   1727  N  N   . ASN B 1 36  ? 2.466   -88.765  28.648  1.00 23.24  ? 163 ASN B N   1 
ATOM   1728  C  CA  . ASN B 1 36  ? 1.206   -88.551  29.379  1.00 24.13  ? 163 ASN B CA  1 
ATOM   1729  C  C   . ASN B 1 36  ? 0.304   -87.477  28.730  1.00 22.97  ? 163 ASN B C   1 
ATOM   1730  O  O   . ASN B 1 36  ? 0.773   -86.626  27.961  1.00 22.07  ? 163 ASN B O   1 
ATOM   1731  C  CB  . ASN B 1 36  ? 1.453   -88.271  30.869  1.00 26.12  ? 163 ASN B CB  1 
ATOM   1732  C  CG  . ASN B 1 36  ? 1.629   -86.806  31.169  1.00 27.51  ? 163 ASN B CG  1 
ATOM   1733  O  OD1 . ASN B 1 36  ? 2.266   -86.082  30.413  1.00 30.71  ? 163 ASN B OD1 1 
ATOM   1734  N  ND2 . ASN B 1 36  ? 1.066   -86.356  32.284  1.00 29.14  ? 163 ASN B ND2 1 
ATOM   1735  N  N   . THR B 1 37  ? -0.985  -87.540  29.059  1.00 22.10  ? 164 THR B N   1 
ATOM   1736  C  CA  . THR B 1 37  ? -2.028  -86.738  28.408  1.00 22.02  ? 164 THR B CA  1 
ATOM   1737  C  C   . THR B 1 37  ? -1.790  -85.225  28.462  1.00 21.77  ? 164 THR B C   1 
ATOM   1738  O  O   . THR B 1 37  ? -2.298  -84.489  27.611  1.00 21.73  ? 164 THR B O   1 
ATOM   1739  C  CB  . THR B 1 37  ? -3.425  -87.033  29.013  1.00 22.52  ? 164 THR B CB  1 
ATOM   1740  O  OG1 . THR B 1 37  ? -3.731  -88.424  28.865  1.00 23.02  ? 164 THR B OG1 1 
ATOM   1741  C  CG2 . THR B 1 37  ? -4.509  -86.220  28.318  1.00 22.86  ? 164 THR B CG2 1 
ATOM   1742  N  N   . SER B 1 38  ? -1.024  -84.761  29.447  1.00 20.15  ? 165 SER B N   1 
ATOM   1743  C  CA  . SER B 1 38  ? -0.707  -83.343  29.547  1.00 20.24  ? 165 SER B CA  1 
ATOM   1744  C  C   . SER B 1 38  ? 0.065   -82.833  28.317  1.00 18.67  ? 165 SER B C   1 
ATOM   1745  O  O   . SER B 1 38  ? -0.070  -81.677  27.951  1.00 18.06  ? 165 SER B O   1 
ATOM   1746  C  CB  . SER B 1 38  ? 0.075   -83.049  30.834  1.00 21.11  ? 165 SER B CB  1 
ATOM   1747  O  OG  . SER B 1 38  ? 1.347   -83.675  30.819  1.00 22.18  ? 165 SER B OG  1 
ATOM   1748  N  N   . TYR B 1 39  ? 0.862   -83.696  27.690  1.00 16.96  ? 166 TYR B N   1 
ATOM   1749  C  CA  . TYR B 1 39  ? 1.600   -83.337  26.473  1.00 16.64  ? 166 TYR B CA  1 
ATOM   1750  C  C   . TYR B 1 39  ? 0.814   -83.625  25.179  1.00 16.26  ? 166 TYR B C   1 
ATOM   1751  O  O   . TYR B 1 39  ? 0.189   -84.672  25.035  1.00 15.95  ? 166 TYR B O   1 
ATOM   1752  C  CB  . TYR B 1 39  ? 2.935   -84.098  26.421  1.00 16.85  ? 166 TYR B CB  1 
ATOM   1753  C  CG  . TYR B 1 39  ? 4.061   -83.452  27.186  1.00 17.68  ? 166 TYR B CG  1 
ATOM   1754  C  CD1 . TYR B 1 39  ? 4.443   -83.907  28.453  1.00 17.90  ? 166 TYR B CD1 1 
ATOM   1755  C  CD2 . TYR B 1 39  ? 4.757   -82.385  26.629  1.00 19.51  ? 166 TYR B CD2 1 
ATOM   1756  C  CE1 . TYR B 1 39  ? 5.495   -83.298  29.142  1.00 19.47  ? 166 TYR B CE1 1 
ATOM   1757  C  CE2 . TYR B 1 39  ? 5.796   -81.779  27.292  1.00 20.91  ? 166 TYR B CE2 1 
ATOM   1758  C  CZ  . TYR B 1 39  ? 6.165   -82.230  28.550  1.00 21.22  ? 166 TYR B CZ  1 
ATOM   1759  O  OH  . TYR B 1 39  ? 7.212   -81.585  29.165  1.00 20.37  ? 166 TYR B OH  1 
ATOM   1760  N  N   . GLN B 1 40  ? 0.851   -82.677  24.251  1.00 16.99  ? 167 GLN B N   1 
ATOM   1761  C  CA  . GLN B 1 40  ? 0.449   -82.893  22.857  1.00 17.00  ? 167 GLN B CA  1 
ATOM   1762  C  C   . GLN B 1 40  ? 1.580   -82.403  21.975  1.00 17.12  ? 167 GLN B C   1 
ATOM   1763  O  O   . GLN B 1 40  ? 2.267   -81.428  22.323  1.00 17.15  ? 167 GLN B O   1 
ATOM   1764  C  CB  . GLN B 1 40  ? -0.791  -82.086  22.494  1.00 18.48  ? 167 GLN B CB  1 
ATOM   1765  C  CG  . GLN B 1 40  ? -2.078  -82.632  23.035  1.00 20.03  ? 167 GLN B CG  1 
ATOM   1766  C  CD  . GLN B 1 40  ? -3.300  -81.879  22.518  1.00 21.32  ? 167 GLN B CD  1 
ATOM   1767  O  OE1 . GLN B 1 40  ? -3.185  -80.796  21.908  1.00 19.68  ? 167 GLN B OE1 1 
ATOM   1768  N  NE2 . GLN B 1 40  ? -4.486  -82.451  22.766  1.00 19.92  ? 167 GLN B NE2 1 
ATOM   1769  N  N   . PHE B 1 41  ? 1.743   -83.055  20.823  1.00 15.52  ? 168 PHE B N   1 
ATOM   1770  C  CA  . PHE B 1 41  ? 2.839   -82.768  19.916  1.00 13.55  ? 168 PHE B CA  1 
ATOM   1771  C  C   . PHE B 1 41  ? 2.362   -82.512  18.496  1.00 12.30  ? 168 PHE B C   1 
ATOM   1772  O  O   . PHE B 1 41  ? 1.365   -83.059  18.058  1.00 12.20  ? 168 PHE B O   1 
ATOM   1773  C  CB  . PHE B 1 41  ? 3.844   -83.924  19.920  1.00 13.40  ? 168 PHE B CB  1 
ATOM   1774  C  CG  . PHE B 1 41  ? 4.470   -84.175  21.260  1.00 13.34  ? 168 PHE B CG  1 
ATOM   1775  C  CD1 . PHE B 1 41  ? 5.595   -83.472  21.656  1.00 13.57  ? 168 PHE B CD1 1 
ATOM   1776  C  CD2 . PHE B 1 41  ? 3.917   -85.107  22.136  1.00 14.69  ? 168 PHE B CD2 1 
ATOM   1777  C  CE1 . PHE B 1 41  ? 6.174   -83.702  22.904  1.00 14.44  ? 168 PHE B CE1 1 
ATOM   1778  C  CE2 . PHE B 1 41  ? 4.476   -85.342  23.377  1.00 14.43  ? 168 PHE B CE2 1 
ATOM   1779  C  CZ  . PHE B 1 41  ? 5.612   -84.639  23.767  1.00 14.46  ? 168 PHE B CZ  1 
ATOM   1780  N  N   . ALA B 1 42  ? 3.085   -81.635  17.807  1.00 13.63  ? 169 ALA B N   1 
ATOM   1781  C  CA  . ALA B 1 42  ? 2.996   -81.448  16.369  1.00 12.99  ? 169 ALA B CA  1 
ATOM   1782  C  C   . ALA B 1 42  ? 4.432   -81.437  15.843  1.00 14.52  ? 169 ALA B C   1 
ATOM   1783  O  O   . ALA B 1 42  ? 5.357   -81.170  16.606  1.00 16.17  ? 169 ALA B O   1 
ATOM   1784  C  CB  . ALA B 1 42  ? 2.303   -80.158  16.053  1.00 10.96  ? 169 ALA B CB  1 
ATOM   1785  N  N   . ALA B 1 43  ? 4.626   -81.764  14.563  1.00 14.31  ? 170 ALA B N   1 
ATOM   1786  C  CA  . ALA B 1 43  ? 5.957   -81.709  13.944  1.00 12.98  ? 170 ALA B CA  1 
ATOM   1787  C  C   . ALA B 1 43  ? 5.897   -81.072  12.568  1.00 12.55  ? 170 ALA B C   1 
ATOM   1788  O  O   . ALA B 1 43  ? 5.072   -81.452  11.735  1.00 13.03  ? 170 ALA B O   1 
ATOM   1789  C  CB  . ALA B 1 43  ? 6.591   -83.096  13.858  1.00 11.55  ? 170 ALA B CB  1 
ATOM   1790  N  N   . VAL B 1 44  ? 6.800   -80.118  12.344  1.00 12.99  ? 171 VAL B N   1 
ATOM   1791  C  CA  . VAL B 1 44  ? 6.912   -79.382  11.085  1.00 12.59  ? 171 VAL B CA  1 
ATOM   1792  C  C   . VAL B 1 44  ? 8.330   -79.517  10.550  1.00 13.14  ? 171 VAL B C   1 
ATOM   1793  O  O   . VAL B 1 44  ? 9.279   -79.137  11.228  1.00 13.70  ? 171 VAL B O   1 
ATOM   1794  C  CB  . VAL B 1 44  ? 6.614   -77.877  11.301  1.00 12.37  ? 171 VAL B CB  1 
ATOM   1795  C  CG1 . VAL B 1 44  ? 6.928   -77.038  10.026  1.00 11.39  ? 171 VAL B CG1 1 
ATOM   1796  C  CG2 . VAL B 1 44  ? 5.162   -77.681  11.761  1.00 10.41  ? 171 VAL B CG2 1 
ATOM   1797  N  N   . GLN B 1 45  ? 8.485   -80.074  9.351   1.00 13.74  ? 172 GLN B N   1 
ATOM   1798  C  CA  . GLN B 1 45  ? 9.790   -80.055  8.677   1.00 13.95  ? 172 GLN B CA  1 
ATOM   1799  C  C   . GLN B 1 45  ? 9.964   -78.724  7.930   1.00 13.45  ? 172 GLN B C   1 
ATOM   1800  O  O   . GLN B 1 45  ? 9.038   -78.239  7.295   1.00 12.31  ? 172 GLN B O   1 
ATOM   1801  C  CB  . GLN B 1 45  ? 9.957   -81.227  7.692   1.00 13.46  ? 172 GLN B CB  1 
ATOM   1802  C  CG  . GLN B 1 45  ? 11.403  -81.381  7.189   1.00 13.67  ? 172 GLN B CG  1 
ATOM   1803  C  CD  . GLN B 1 45  ? 11.581  -82.361  6.029   1.00 14.77  ? 172 GLN B CD  1 
ATOM   1804  O  OE1 . GLN B 1 45  ? 12.684  -82.498  5.503   1.00 14.82  ? 172 GLN B OE1 1 
ATOM   1805  N  NE2 . GLN B 1 45  ? 10.511  -83.054  5.640   1.00 15.05  ? 172 GLN B NE2 1 
ATOM   1806  N  N   . PHE B 1 46  ? 11.156  -78.145  8.014   1.00 14.09  ? 173 PHE B N   1 
ATOM   1807  C  CA  . PHE B 1 46  ? 11.482  -76.973  7.226   1.00 13.44  ? 173 PHE B CA  1 
ATOM   1808  C  C   . PHE B 1 46  ? 12.774  -77.166  6.423   1.00 13.86  ? 173 PHE B C   1 
ATOM   1809  O  O   . PHE B 1 46  ? 13.713  -77.861  6.844   1.00 13.55  ? 173 PHE B O   1 
ATOM   1810  C  CB  . PHE B 1 46  ? 11.554  -75.706  8.101   1.00 13.29  ? 173 PHE B CB  1 
ATOM   1811  C  CG  . PHE B 1 46  ? 12.809  -75.585  8.930   1.00 13.91  ? 173 PHE B CG  1 
ATOM   1812  C  CD1 . PHE B 1 46  ? 13.880  -74.837  8.479   1.00 12.03  ? 173 PHE B CD1 1 
ATOM   1813  C  CD2 . PHE B 1 46  ? 12.906  -76.210  10.172  1.00 15.09  ? 173 PHE B CD2 1 
ATOM   1814  C  CE1 . PHE B 1 46  ? 15.024  -74.718  9.241   1.00 13.52  ? 173 PHE B CE1 1 
ATOM   1815  C  CE2 . PHE B 1 46  ? 14.056  -76.084  10.941  1.00 14.07  ? 173 PHE B CE2 1 
ATOM   1816  C  CZ  . PHE B 1 46  ? 15.112  -75.338  10.472  1.00 13.84  ? 173 PHE B CZ  1 
ATOM   1817  N  N   . SER B 1 47  ? 12.788  -76.548  5.251   1.00 13.46  ? 174 SER B N   1 
ATOM   1818  C  CA  . SER B 1 47  ? 13.996  -76.392  4.476   1.00 13.26  ? 174 SER B CA  1 
ATOM   1819  C  C   . SER B 1 47  ? 13.807  -75.080  3.682   1.00 13.71  ? 174 SER B C   1 
ATOM   1820  O  O   . SER B 1 47  ? 13.801  -73.988  4.288   1.00 11.90  ? 174 SER B O   1 
ATOM   1821  C  CB  . SER B 1 47  ? 14.229  -77.646  3.634   1.00 12.72  ? 174 SER B CB  1 
ATOM   1822  O  OG  . SER B 1 47  ? 15.446  -77.587  2.942   1.00 12.61  ? 174 SER B OG  1 
ATOM   1823  N  N   . THR B 1 48  ? 13.618  -75.160  2.361   1.00 13.47  ? 175 THR B N   1 
ATOM   1824  C  CA  . THR B 1 48  ? 13.209  -73.987  1.596   1.00 10.38  ? 175 THR B CA  1 
ATOM   1825  C  C   . THR B 1 48  ? 11.774  -73.636  1.961   1.00 12.05  ? 175 THR B C   1 
ATOM   1826  O  O   . THR B 1 48  ? 11.425  -72.460  2.127   1.00 11.92  ? 175 THR B O   1 
ATOM   1827  C  CB  . THR B 1 48  ? 13.360  -74.215  0.093   1.00 10.06  ? 175 THR B CB  1 
ATOM   1828  O  OG1 . THR B 1 48  ? 14.753  -74.226  -0.228  1.00 8.37   ? 175 THR B OG1 1 
ATOM   1829  C  CG2 . THR B 1 48  ? 12.630  -73.094  -0.749  1.00 6.02   ? 175 THR B CG2 1 
ATOM   1830  N  N   . SER B 1 49  ? 10.964  -74.682  2.121   1.00 14.19  ? 176 SER B N   1 
ATOM   1831  C  CA  . SER B 1 49  ? 9.561   -74.575  2.496   1.00 12.74  ? 176 SER B CA  1 
ATOM   1832  C  C   . SER B 1 49  ? 9.286   -75.322  3.798   1.00 12.25  ? 176 SER B C   1 
ATOM   1833  O  O   . SER B 1 49  ? 10.183  -75.930  4.385   1.00 10.83  ? 176 SER B O   1 
ATOM   1834  C  CB  . SER B 1 49  ? 8.698   -75.198  1.406   1.00 12.42  ? 176 SER B CB  1 
ATOM   1835  O  OG  . SER B 1 49  ? 8.826   -74.499  0.222   1.00 13.88  ? 176 SER B OG  1 
ATOM   1836  N  N   . TYR B 1 50  ? 8.022   -75.289  4.222   1.00 12.52  ? 177 TYR B N   1 
ATOM   1837  C  CA  . TYR B 1 50  ? 7.609   -75.810  5.514   1.00 14.17  ? 177 TYR B CA  1 
ATOM   1838  C  C   . TYR B 1 50  ? 6.459   -76.770  5.272   1.00 14.56  ? 177 TYR B C   1 
ATOM   1839  O  O   . TYR B 1 50  ? 5.555   -76.491  4.481   1.00 15.50  ? 177 TYR B O   1 
ATOM   1840  C  CB  . TYR B 1 50  ? 7.207   -74.650  6.446   1.00 14.36  ? 177 TYR B CB  1 
ATOM   1841  C  CG  . TYR B 1 50  ? 8.015   -73.395  6.160   1.00 15.18  ? 177 TYR B CG  1 
ATOM   1842  C  CD1 . TYR B 1 50  ? 9.409   -73.417  6.249   1.00 16.92  ? 177 TYR B CD1 1 
ATOM   1843  C  CD2 . TYR B 1 50  ? 7.408   -72.224  5.745   1.00 15.34  ? 177 TYR B CD2 1 
ATOM   1844  C  CE1 . TYR B 1 50  ? 10.177  -72.300  5.957   1.00 17.72  ? 177 TYR B CE1 1 
ATOM   1845  C  CE2 . TYR B 1 50  ? 8.164   -71.093  5.450   1.00 16.54  ? 177 TYR B CE2 1 
ATOM   1846  C  CZ  . TYR B 1 50  ? 9.550   -71.137  5.562   1.00 18.62  ? 177 TYR B CZ  1 
ATOM   1847  O  OH  . TYR B 1 50  ? 10.319  -70.033  5.273   1.00 19.81  ? 177 TYR B OH  1 
ATOM   1848  N  N   . LYS B 1 51  ? 6.511   -77.920  5.925   1.00 14.81  ? 178 LYS B N   1 
ATOM   1849  C  CA  . LYS B 1 51  ? 5.406   -78.854  5.879   1.00 14.16  ? 178 LYS B CA  1 
ATOM   1850  C  C   . LYS B 1 51  ? 5.122   -79.360  7.286   1.00 13.35  ? 178 LYS B C   1 
ATOM   1851  O  O   . LYS B 1 51  ? 6.041   -79.806  7.994   1.00 12.59  ? 178 LYS B O   1 
ATOM   1852  C  CB  . LYS B 1 51  ? 5.740   -80.016  4.945   1.00 15.72  ? 178 LYS B CB  1 
ATOM   1853  C  CG  . LYS B 1 51  ? 4.605   -81.008  4.737   1.00 15.90  ? 178 LYS B CG  1 
ATOM   1854  C  CD  . LYS B 1 51  ? 5.024   -82.085  3.770   1.00 17.77  ? 178 LYS B CD  1 
ATOM   1855  C  CE  . LYS B 1 51  ? 3.934   -83.145  3.571   1.00 18.30  ? 178 LYS B CE  1 
ATOM   1856  N  NZ  . LYS B 1 51  ? 3.708   -83.917  4.839   1.00 18.98  ? 178 LYS B NZ  1 
ATOM   1857  N  N   . THR B 1 52  ? 3.852   -79.265  7.681   1.00 10.96  ? 179 THR B N   1 
ATOM   1858  C  CA  . THR B 1 52  ? 3.364   -79.920  8.870   1.00 10.25  ? 179 THR B CA  1 
ATOM   1859  C  C   . THR B 1 52  ? 3.270   -81.421  8.578   1.00 11.85  ? 179 THR B C   1 
ATOM   1860  O  O   . THR B 1 52  ? 2.410   -81.876  7.825   1.00 9.79   ? 179 THR B O   1 
ATOM   1861  C  CB  . THR B 1 52  ? 1.991   -79.365  9.321   1.00 8.52   ? 179 THR B CB  1 
ATOM   1862  O  OG1 . THR B 1 52  ? 2.103   -77.965  9.587   1.00 8.76   ? 179 THR B OG1 1 
ATOM   1863  C  CG2 . THR B 1 52  ? 1.522   -80.037  10.590  1.00 7.49   ? 179 THR B CG2 1 
ATOM   1864  N  N   . GLU B 1 53  ? 4.178   -82.179  9.181   1.00 12.94  ? 180 GLU B N   1 
ATOM   1865  C  CA  . GLU B 1 53  ? 4.222   -83.619  8.996   1.00 14.96  ? 180 GLU B CA  1 
ATOM   1866  C  C   . GLU B 1 53  ? 3.092   -84.279  9.791   1.00 15.19  ? 180 GLU B C   1 
ATOM   1867  O  O   . GLU B 1 53  ? 2.487   -85.234  9.332   1.00 15.05  ? 180 GLU B O   1 
ATOM   1868  C  CB  . GLU B 1 53  ? 5.600   -84.163  9.383   1.00 15.81  ? 180 GLU B CB  1 
ATOM   1869  C  CG  . GLU B 1 53  ? 6.753   -83.535  8.581   1.00 16.35  ? 180 GLU B CG  1 
ATOM   1870  C  CD  . GLU B 1 53  ? 6.762   -83.908  7.078   1.00 18.35  ? 180 GLU B CD  1 
ATOM   1871  O  OE1 . GLU B 1 53  ? 5.871   -84.668  6.600   1.00 17.51  ? 180 GLU B OE1 1 
ATOM   1872  O  OE2 . GLU B 1 53  ? 7.692   -83.446  6.372   1.00 17.34  ? 180 GLU B OE2 1 
ATOM   1873  N  N   . PHE B 1 54  ? 2.797   -83.740  10.968  1.00 16.82  ? 181 PHE B N   1 
ATOM   1874  C  CA  . PHE B 1 54  ? 1.561   -84.061  11.677  1.00 16.75  ? 181 PHE B CA  1 
ATOM   1875  C  C   . PHE B 1 54  ? 1.188   -82.936  12.647  1.00 15.19  ? 181 PHE B C   1 
ATOM   1876  O  O   . PHE B 1 54  ? 2.054   -82.273  13.182  1.00 12.51  ? 181 PHE B O   1 
ATOM   1877  C  CB  . PHE B 1 54  ? 1.679   -85.415  12.406  1.00 16.57  ? 181 PHE B CB  1 
ATOM   1878  C  CG  . PHE B 1 54  ? 2.634   -85.415  13.575  1.00 17.15  ? 181 PHE B CG  1 
ATOM   1879  C  CD1 . PHE B 1 54  ? 2.201   -85.051  14.845  1.00 17.81  ? 181 PHE B CD1 1 
ATOM   1880  C  CD2 . PHE B 1 54  ? 3.954   -85.814  13.415  1.00 16.56  ? 181 PHE B CD2 1 
ATOM   1881  C  CE1 . PHE B 1 54  ? 3.080   -85.058  15.924  1.00 17.42  ? 181 PHE B CE1 1 
ATOM   1882  C  CE2 . PHE B 1 54  ? 4.824   -85.840  14.497  1.00 16.55  ? 181 PHE B CE2 1 
ATOM   1883  C  CZ  . PHE B 1 54  ? 4.386   -85.456  15.747  1.00 16.34  ? 181 PHE B CZ  1 
ATOM   1884  N  N   . ASP B 1 55  ? -0.107  -82.727  12.863  1.00 17.71  ? 182 ASP B N   1 
ATOM   1885  C  CA  . ASP B 1 55  ? -0.576  -81.696  13.809  1.00 18.25  ? 182 ASP B CA  1 
ATOM   1886  C  C   . ASP B 1 55  ? -1.030  -82.321  15.131  1.00 15.68  ? 182 ASP B C   1 
ATOM   1887  O  O   . ASP B 1 55  ? -1.040  -83.538  15.274  1.00 15.08  ? 182 ASP B O   1 
ATOM   1888  C  CB  . ASP B 1 55  ? -1.689  -80.842  13.186  1.00 19.52  ? 182 ASP B CB  1 
ATOM   1889  C  CG  . ASP B 1 55  ? -2.804  -81.671  12.595  1.00 22.36  ? 182 ASP B CG  1 
ATOM   1890  O  OD1 . ASP B 1 55  ? -3.338  -82.559  13.293  1.00 23.86  ? 182 ASP B OD1 1 
ATOM   1891  O  OD2 . ASP B 1 55  ? -3.154  -81.426  11.419  1.00 25.98  ? 182 ASP B OD2 1 
ATOM   1892  N  N   . PHE B 1 56  ? -1.397  -81.479  16.088  1.00 15.33  ? 183 PHE B N   1 
ATOM   1893  C  CA  . PHE B 1 56  ? -1.851  -81.941  17.402  1.00 15.20  ? 183 PHE B CA  1 
ATOM   1894  C  C   . PHE B 1 56  ? -2.994  -82.942  17.330  1.00 14.44  ? 183 PHE B C   1 
ATOM   1895  O  O   . PHE B 1 56  ? -3.035  -83.886  18.115  1.00 12.77  ? 183 PHE B O   1 
ATOM   1896  C  CB  . PHE B 1 56  ? -2.276  -80.763  18.268  1.00 16.12  ? 183 PHE B CB  1 
ATOM   1897  C  CG  . PHE B 1 56  ? -1.180  -79.773  18.524  1.00 17.09  ? 183 PHE B CG  1 
ATOM   1898  C  CD1 . PHE B 1 56  ? -0.058  -80.135  19.265  1.00 17.95  ? 183 PHE B CD1 1 
ATOM   1899  C  CD2 . PHE B 1 56  ? -1.263  -78.477  18.023  1.00 18.28  ? 183 PHE B CD2 1 
ATOM   1900  C  CE1 . PHE B 1 56  ? 0.973   -79.209  19.497  1.00 18.37  ? 183 PHE B CE1 1 
ATOM   1901  C  CE2 . PHE B 1 56  ? -0.236  -77.546  18.252  1.00 17.86  ? 183 PHE B CE2 1 
ATOM   1902  C  CZ  . PHE B 1 56  ? 0.875   -77.915  18.988  1.00 17.66  ? 183 PHE B CZ  1 
ATOM   1903  N  N   . SER B 1 57  ? -3.918  -82.750  16.389  1.00 15.38  ? 184 SER B N   1 
ATOM   1904  C  CA  . SER B 1 57  ? -5.086  -83.635  16.310  1.00 15.99  ? 184 SER B CA  1 
ATOM   1905  C  C   . SER B 1 57  ? -4.701  -85.001  15.734  1.00 14.94  ? 184 SER B C   1 
ATOM   1906  O  O   . SER B 1 57  ? -5.257  -86.027  16.143  1.00 13.65  ? 184 SER B O   1 
ATOM   1907  C  CB  . SER B 1 57  ? -6.236  -82.981  15.528  1.00 16.78  ? 184 SER B CB  1 
ATOM   1908  O  OG  . SER B 1 57  ? -6.062  -83.134  14.138  1.00 19.44  ? 184 SER B OG  1 
ATOM   1909  N  N   . ASP B 1 58  ? -3.732  -85.017  14.816  1.00 13.90  ? 185 ASP B N   1 
ATOM   1910  C  CA  . ASP B 1 58  ? -3.175  -86.277  14.323  1.00 12.81  ? 185 ASP B CA  1 
ATOM   1911  C  C   . ASP B 1 58  ? -2.523  -87.014  15.481  1.00 11.84  ? 185 ASP B C   1 
ATOM   1912  O  O   . ASP B 1 58  ? -2.723  -88.224  15.645  1.00 11.57  ? 185 ASP B O   1 
ATOM   1913  C  CB  . ASP B 1 58  ? -2.118  -86.057  13.236  1.00 13.67  ? 185 ASP B CB  1 
ATOM   1914  C  CG  . ASP B 1 58  ? -2.658  -85.356  12.010  1.00 15.42  ? 185 ASP B CG  1 
ATOM   1915  O  OD1 . ASP B 1 58  ? -3.848  -85.556  11.684  1.00 17.41  ? 185 ASP B OD1 1 
ATOM   1916  O  OD2 . ASP B 1 58  ? -1.885  -84.600  11.368  1.00 15.33  ? 185 ASP B OD2 1 
ATOM   1917  N  N   . TYR B 1 59  ? -1.740  -86.285  16.278  1.00 11.26  ? 186 TYR B N   1 
ATOM   1918  C  CA  . TYR B 1 59  ? -1.026  -86.885  17.407  1.00 11.53  ? 186 TYR B CA  1 
ATOM   1919  C  C   . TYR B 1 59  ? -2.002  -87.581  18.352  1.00 13.77  ? 186 TYR B C   1 
ATOM   1920  O  O   . TYR B 1 59  ? -1.759  -88.700  18.788  1.00 13.45  ? 186 TYR B O   1 
ATOM   1921  C  CB  . TYR B 1 59  ? -0.202  -85.846  18.181  1.00 12.20  ? 186 TYR B CB  1 
ATOM   1922  C  CG  . TYR B 1 59  ? 0.347   -86.415  19.472  1.00 13.26  ? 186 TYR B CG  1 
ATOM   1923  C  CD1 . TYR B 1 59  ? 1.483   -87.229  19.461  1.00 12.61  ? 186 TYR B CD1 1 
ATOM   1924  C  CD2 . TYR B 1 59  ? -0.294  -86.189  20.697  1.00 12.33  ? 186 TYR B CD2 1 
ATOM   1925  C  CE1 . TYR B 1 59  ? 1.975   -87.797  20.625  1.00 12.37  ? 186 TYR B CE1 1 
ATOM   1926  C  CE2 . TYR B 1 59  ? 0.193   -86.753  21.866  1.00 12.50  ? 186 TYR B CE2 1 
ATOM   1927  C  CZ  . TYR B 1 59  ? 1.329   -87.564  21.819  1.00 13.34  ? 186 TYR B CZ  1 
ATOM   1928  O  OH  . TYR B 1 59  ? 1.835   -88.133  22.965  1.00 15.66  ? 186 TYR B OH  1 
ATOM   1929  N  N   . VAL B 1 60  ? -3.102  -86.902  18.661  1.00 15.32  ? 187 VAL B N   1 
ATOM   1930  C  CA  . VAL B 1 60  ? -4.106  -87.413  19.589  1.00 17.83  ? 187 VAL B CA  1 
ATOM   1931  C  C   . VAL B 1 60  ? -4.834  -88.653  19.041  1.00 18.57  ? 187 VAL B C   1 
ATOM   1932  O  O   . VAL B 1 60  ? -5.090  -89.603  19.780  1.00 17.46  ? 187 VAL B O   1 
ATOM   1933  C  CB  . VAL B 1 60  ? -5.135  -86.307  19.949  1.00 17.49  ? 187 VAL B CB  1 
ATOM   1934  C  CG1 . VAL B 1 60  ? -6.348  -86.902  20.640  1.00 17.90  ? 187 VAL B CG1 1 
ATOM   1935  C  CG2 . VAL B 1 60  ? -4.472  -85.249  20.815  1.00 16.54  ? 187 VAL B CG2 1 
ATOM   1936  N  N   . LYS B 1 61  ? -5.151  -88.635  17.751  1.00 20.28  ? 188 LYS B N   1 
ATOM   1937  C  CA  . LYS B 1 61  ? -5.834  -89.754  17.099  1.00 21.21  ? 188 LYS B CA  1 
ATOM   1938  C  C   . LYS B 1 61  ? -4.951  -91.005  17.016  1.00 21.70  ? 188 LYS B C   1 
ATOM   1939  O  O   . LYS B 1 61  ? -5.461  -92.115  17.115  1.00 21.77  ? 188 LYS B O   1 
ATOM   1940  C  CB  . LYS B 1 61  ? -6.320  -89.331  15.701  1.00 22.38  ? 188 LYS B CB  1 
ATOM   1941  C  CG  . LYS B 1 61  ? -6.760  -90.470  14.763  1.00 23.85  ? 188 LYS B CG  1 
ATOM   1942  C  CD  . LYS B 1 61  ? -7.282  -89.919  13.416  1.00 25.33  ? 188 LYS B CD  1 
ATOM   1943  C  CE  . LYS B 1 61  ? -8.785  -90.156  13.189  1.00 26.98  ? 188 LYS B CE  1 
ATOM   1944  N  NZ  . LYS B 1 61  ? -9.691  -89.752  14.318  1.00 27.85  ? 188 LYS B NZ  1 
ATOM   1945  N  N   . TRP B 1 62  ? -3.643  -90.833  16.830  1.00 22.98  ? 189 TRP B N   1 
ATOM   1946  C  CA  . TRP B 1 62  ? -2.721  -91.974  16.691  1.00 24.19  ? 189 TRP B CA  1 
ATOM   1947  C  C   . TRP B 1 62  ? -1.861  -92.236  17.920  1.00 22.46  ? 189 TRP B C   1 
ATOM   1948  O  O   . TRP B 1 62  ? -1.860  -93.341  18.450  1.00 25.57  ? 189 TRP B O   1 
ATOM   1949  C  CB  . TRP B 1 62  ? -1.844  -91.804  15.452  1.00 26.76  ? 189 TRP B CB  1 
ATOM   1950  C  CG  . TRP B 1 62  ? -2.670  -91.872  14.218  1.00 30.19  ? 189 TRP B CG  1 
ATOM   1951  C  CD1 . TRP B 1 62  ? -2.956  -90.850  13.359  1.00 31.84  ? 189 TRP B CD1 1 
ATOM   1952  C  CD2 . TRP B 1 62  ? -3.382  -93.016  13.733  1.00 32.19  ? 189 TRP B CD2 1 
ATOM   1953  N  NE1 . TRP B 1 62  ? -3.790  -91.295  12.358  1.00 32.18  ? 189 TRP B NE1 1 
ATOM   1954  C  CE2 . TRP B 1 62  ? -4.066  -92.619  12.565  1.00 32.39  ? 189 TRP B CE2 1 
ATOM   1955  C  CE3 . TRP B 1 62  ? -3.510  -94.342  14.175  1.00 33.60  ? 189 TRP B CE3 1 
ATOM   1956  C  CZ2 . TRP B 1 62  ? -4.852  -93.500  11.822  1.00 33.78  ? 189 TRP B CZ2 1 
ATOM   1957  C  CZ3 . TRP B 1 62  ? -4.298  -95.217  13.439  1.00 33.89  ? 189 TRP B CZ3 1 
ATOM   1958  C  CH2 . TRP B 1 62  ? -4.957  -94.791  12.273  1.00 33.94  ? 189 TRP B CH2 1 
ATOM   1959  N  N   . LYS B 1 63  ? -1.142  -91.225  18.374  1.00 20.75  ? 190 LYS B N   1 
ATOM   1960  C  CA  . LYS B 1 63  ? -0.249  -91.347  19.527  1.00 19.42  ? 190 LYS B CA  1 
ATOM   1961  C  C   . LYS B 1 63  ? 0.719   -92.523  19.357  1.00 17.97  ? 190 LYS B C   1 
ATOM   1962  O  O   . LYS B 1 63  ? 0.925   -93.326  20.269  1.00 18.08  ? 190 LYS B O   1 
ATOM   1963  C  CB  . LYS B 1 63  ? -1.049  -91.437  20.823  1.00 19.23  ? 190 LYS B CB  1 
ATOM   1964  C  CG  . LYS B 1 63  ? -0.266  -91.047  22.059  1.00 20.04  ? 190 LYS B CG  1 
ATOM   1965  C  CD  . LYS B 1 63  ? -1.185  -90.813  23.252  1.00 21.01  ? 190 LYS B CD  1 
ATOM   1966  C  CE  . LYS B 1 63  ? -0.408  -90.836  24.565  1.00 21.46  ? 190 LYS B CE  1 
ATOM   1967  N  NZ  . LYS B 1 63  ? -1.248  -90.448  25.743  1.00 21.09  ? 190 LYS B NZ  1 
ATOM   1968  N  N   . ASP B 1 64  ? 1.309   -92.589  18.165  1.00 15.60  ? 191 ASP B N   1 
ATOM   1969  C  CA  . ASP B 1 64  ? 2.304   -93.581  17.807  1.00 14.54  ? 191 ASP B CA  1 
ATOM   1970  C  C   . ASP B 1 64  ? 3.401   -92.800  17.080  1.00 13.92  ? 191 ASP B C   1 
ATOM   1971  O  O   . ASP B 1 64  ? 3.281   -92.524  15.888  1.00 12.01  ? 191 ASP B O   1 
ATOM   1972  C  CB  . ASP B 1 64  ? 1.658   -94.645  16.917  1.00 15.94  ? 191 ASP B CB  1 
ATOM   1973  C  CG  . ASP B 1 64  ? 2.651   -95.687  16.389  1.00 17.68  ? 191 ASP B CG  1 
ATOM   1974  O  OD1 . ASP B 1 64  ? 3.878   -95.539  16.572  1.00 18.73  ? 191 ASP B OD1 1 
ATOM   1975  O  OD2 . ASP B 1 64  ? 2.184   -96.664  15.756  1.00 17.85  ? 191 ASP B OD2 1 
ATOM   1976  N  N   . PRO B 1 65  ? 4.460   -92.401  17.813  1.00 13.32  ? 192 PRO B N   1 
ATOM   1977  C  CA  . PRO B 1 65  ? 5.473   -91.555  17.203  1.00 13.31  ? 192 PRO B CA  1 
ATOM   1978  C  C   . PRO B 1 65  ? 6.118   -92.156  15.955  1.00 12.81  ? 192 PRO B C   1 
ATOM   1979  O  O   . PRO B 1 65  ? 6.428   -91.423  15.030  1.00 14.00  ? 192 PRO B O   1 
ATOM   1980  C  CB  . PRO B 1 65  ? 6.488   -91.358  18.338  1.00 13.41  ? 192 PRO B CB  1 
ATOM   1981  C  CG  . PRO B 1 65  ? 5.666   -91.475  19.574  1.00 13.31  ? 192 PRO B CG  1 
ATOM   1982  C  CD  . PRO B 1 65  ? 4.681   -92.552  19.266  1.00 12.84  ? 192 PRO B CD  1 
ATOM   1983  N  N   . ASP B 1 66  ? 6.273   -93.476  15.921  1.00 13.47  ? 193 ASP B N   1 
ATOM   1984  C  CA  . ASP B 1 66  ? 6.871   -94.156  14.767  1.00 13.86  ? 193 ASP B CA  1 
ATOM   1985  C  C   . ASP B 1 66  ? 5.974   -94.063  13.526  1.00 14.61  ? 193 ASP B C   1 
ATOM   1986  O  O   . ASP B 1 66  ? 6.461   -93.810  12.419  1.00 15.15  ? 193 ASP B O   1 
ATOM   1987  C  CB  . ASP B 1 66  ? 7.169   -95.615  15.101  1.00 12.84  ? 193 ASP B CB  1 
ATOM   1988  C  CG  . ASP B 1 66  ? 8.206   -95.770  16.222  1.00 12.66  ? 193 ASP B CG  1 
ATOM   1989  O  OD1 . ASP B 1 66  ? 9.343   -95.286  16.055  1.00 14.50  ? 193 ASP B OD1 1 
ATOM   1990  O  OD2 . ASP B 1 66  ? 7.893   -96.394  17.262  1.00 11.38  ? 193 ASP B OD2 1 
ATOM   1991  N  N   . ALA B 1 67  ? 4.670   -94.254  13.709  1.00 13.38  ? 194 ALA B N   1 
ATOM   1992  C  CA  . ALA B 1 67  ? 3.720   -94.155  12.602  1.00 13.36  ? 194 ALA B CA  1 
ATOM   1993  C  C   . ALA B 1 67  ? 3.537   -92.701  12.118  1.00 13.58  ? 194 ALA B C   1 
ATOM   1994  O  O   . ALA B 1 67  ? 3.358   -92.459  10.921  1.00 12.55  ? 194 ALA B O   1 
ATOM   1995  C  CB  . ALA B 1 67  ? 2.373   -94.763  12.994  1.00 12.10  ? 194 ALA B CB  1 
ATOM   1996  N  N   . LEU B 1 68  ? 3.591   -91.744  13.043  1.00 13.21  ? 195 LEU B N   1 
ATOM   1997  C  CA  . LEU B 1 68  ? 3.343   -90.328  12.720  1.00 12.56  ? 195 LEU B CA  1 
ATOM   1998  C  C   . LEU B 1 68  ? 4.442   -89.725  11.844  1.00 13.91  ? 195 LEU B C   1 
ATOM   1999  O  O   . LEU B 1 68  ? 4.197   -88.793  11.058  1.00 14.38  ? 195 LEU B O   1 
ATOM   2000  C  CB  . LEU B 1 68  ? 3.221   -89.507  14.005  1.00 12.12  ? 195 LEU B CB  1 
ATOM   2001  C  CG  . LEU B 1 68  ? 1.936   -89.688  14.813  1.00 12.80  ? 195 LEU B CG  1 
ATOM   2002  C  CD1 . LEU B 1 68  ? 2.096   -89.093  16.212  1.00 11.33  ? 195 LEU B CD1 1 
ATOM   2003  C  CD2 . LEU B 1 68  ? 0.756   -89.058  14.063  1.00 12.09  ? 195 LEU B CD2 1 
ATOM   2004  N  N   . LEU B 1 69  ? 5.655   -90.236  12.014  1.00 12.81  ? 196 LEU B N   1 
ATOM   2005  C  CA  . LEU B 1 69  ? 6.803   -89.749  11.277  1.00 14.05  ? 196 LEU B CA  1 
ATOM   2006  C  C   . LEU B 1 69  ? 7.199   -90.688  10.140  1.00 13.65  ? 196 LEU B C   1 
ATOM   2007  O  O   . LEU B 1 69  ? 8.053   -90.347  9.343   1.00 16.83  ? 196 LEU B O   1 
ATOM   2008  C  CB  . LEU B 1 69  ? 7.978   -89.504  12.242  1.00 13.35  ? 196 LEU B CB  1 
ATOM   2009  C  CG  . LEU B 1 69  ? 7.778   -88.266  13.125  1.00 13.06  ? 196 LEU B CG  1 
ATOM   2010  C  CD1 . LEU B 1 69  ? 8.815   -88.179  14.281  1.00 13.58  ? 196 LEU B CD1 1 
ATOM   2011  C  CD2 . LEU B 1 69  ? 7.823   -87.018  12.254  1.00 12.09  ? 196 LEU B CD2 1 
ATOM   2012  N  N   . LYS B 1 70  ? 6.544   -91.841  10.054  1.00 13.40  ? 197 LYS B N   1 
ATOM   2013  C  CA  . LYS B 1 70  ? 6.798   -92.843  9.021   1.00 13.39  ? 197 LYS B CA  1 
ATOM   2014  C  C   . LYS B 1 70  ? 6.997   -92.282  7.608   1.00 14.46  ? 197 LYS B C   1 
ATOM   2015  O  O   . LYS B 1 70  ? 7.896   -92.724  6.883   1.00 15.47  ? 197 LYS B O   1 
ATOM   2016  C  CB  . LYS B 1 70  ? 5.641   -93.841  9.026   1.00 13.37  ? 197 LYS B CB  1 
ATOM   2017  C  CG  . LYS B 1 70  ? 5.638   -94.886  7.923   1.00 15.48  ? 197 LYS B CG  1 
ATOM   2018  C  CD  . LYS B 1 70  ? 6.079   -96.234  8.394   1.00 16.68  ? 197 LYS B CD  1 
ATOM   2019  C  CE  . LYS B 1 70  ? 5.732   -97.318  7.375   1.00 17.97  ? 197 LYS B CE  1 
ATOM   2020  N  NZ  . LYS B 1 70  ? 4.413   -97.990  7.633   1.00 18.78  ? 197 LYS B NZ  1 
ATOM   2021  N  N   . HIS B 1 71  ? 6.159   -91.333  7.210   1.00 13.70  ? 198 HIS B N   1 
ATOM   2022  C  CA  . HIS B 1 71  ? 6.104   -90.920  5.819   1.00 14.78  ? 198 HIS B CA  1 
ATOM   2023  C  C   . HIS B 1 71  ? 6.777   -89.581  5.538   1.00 14.27  ? 198 HIS B C   1 
ATOM   2024  O  O   . HIS B 1 71  ? 6.562   -88.984  4.497   1.00 15.22  ? 198 HIS B O   1 
ATOM   2025  C  CB  . HIS B 1 71  ? 4.648   -90.910  5.354   1.00 15.77  ? 198 HIS B CB  1 
ATOM   2026  C  CG  . HIS B 1 71  ? 3.999   -92.255  5.415   1.00 16.12  ? 198 HIS B CG  1 
ATOM   2027  N  ND1 . HIS B 1 71  ? 4.266   -93.248  4.500   1.00 15.69  ? 198 HIS B ND1 1 
ATOM   2028  C  CD2 . HIS B 1 71  ? 3.107   -92.776  6.290   1.00 15.84  ? 198 HIS B CD2 1 
ATOM   2029  C  CE1 . HIS B 1 71  ? 3.553   -94.319  4.799   1.00 16.11  ? 198 HIS B CE1 1 
ATOM   2030  N  NE2 . HIS B 1 71  ? 2.840   -94.057  5.879   1.00 16.27  ? 198 HIS B NE2 1 
ATOM   2031  N  N   . VAL B 1 72  ? 7.609   -89.123  6.457   1.00 15.57  ? 199 VAL B N   1 
ATOM   2032  C  CA  . VAL B 1 72  ? 8.342   -87.878  6.271   1.00 15.22  ? 199 VAL B CA  1 
ATOM   2033  C  C   . VAL B 1 72  ? 9.281   -88.008  5.075   1.00 13.37  ? 199 VAL B C   1 
ATOM   2034  O  O   . VAL B 1 72  ? 10.050  -88.944  4.984   1.00 12.08  ? 199 VAL B O   1 
ATOM   2035  C  CB  . VAL B 1 72  ? 9.129   -87.508  7.547   1.00 15.96  ? 199 VAL B CB  1 
ATOM   2036  C  CG1 . VAL B 1 72  ? 10.181  -86.449  7.244   1.00 17.38  ? 199 VAL B CG1 1 
ATOM   2037  C  CG2 . VAL B 1 72  ? 8.163   -87.046  8.639   1.00 14.98  ? 199 VAL B CG2 1 
ATOM   2038  N  N   . LYS B 1 73  ? 9.193   -87.063  4.155   1.00 12.64  ? 200 LYS B N   1 
ATOM   2039  C  CA  . LYS B 1 73  ? 10.058  -87.034  2.985   1.00 13.27  ? 200 LYS B CA  1 
ATOM   2040  C  C   . LYS B 1 73  ? 11.136  -85.960  3.193   1.00 12.37  ? 200 LYS B C   1 
ATOM   2041  O  O   . LYS B 1 73  ? 10.833  -84.801  3.439   1.00 11.37  ? 200 LYS B O   1 
ATOM   2042  C  CB  . LYS B 1 73  ? 9.213   -86.758  1.745   1.00 14.53  ? 200 LYS B CB  1 
ATOM   2043  C  CG  . LYS B 1 73  ? 9.977   -86.639  0.464   1.00 17.76  ? 200 LYS B CG  1 
ATOM   2044  C  CD  . LYS B 1 73  ? 10.655  -87.942  0.085   1.00 20.26  ? 200 LYS B CD  1 
ATOM   2045  C  CE  . LYS B 1 73  ? 11.410  -87.797  -1.240  1.00 20.50  ? 200 LYS B CE  1 
ATOM   2046  N  NZ  . LYS B 1 73  ? 11.733  -89.127  -1.832  1.00 19.91  ? 200 LYS B NZ  1 
ATOM   2047  N  N   . HIS B 1 74  ? 12.398  -86.367  3.128   1.00 11.99  ? 201 HIS B N   1 
ATOM   2048  C  CA  . HIS B 1 74  ? 13.502  -85.476  3.435   1.00 13.16  ? 201 HIS B CA  1 
ATOM   2049  C  C   . HIS B 1 74  ? 13.649  -84.414  2.342   1.00 13.87  ? 201 HIS B C   1 
ATOM   2050  O  O   . HIS B 1 74  ? 13.882  -84.742  1.177   1.00 13.83  ? 201 HIS B O   1 
ATOM   2051  C  CB  . HIS B 1 74  ? 14.791  -86.277  3.593   1.00 11.97  ? 201 HIS B CB  1 
ATOM   2052  C  CG  . HIS B 1 74  ? 15.847  -85.575  4.382   1.00 12.35  ? 201 HIS B CG  1 
ATOM   2053  N  ND1 . HIS B 1 74  ? 17.101  -86.107  4.573   1.00 11.67  ? 201 HIS B ND1 1 
ATOM   2054  C  CD2 . HIS B 1 74  ? 15.846  -84.375  5.010   1.00 13.60  ? 201 HIS B CD2 1 
ATOM   2055  C  CE1 . HIS B 1 74  ? 17.824  -85.274  5.301   1.00 14.20  ? 201 HIS B CE1 1 
ATOM   2056  N  NE2 . HIS B 1 74  ? 17.084  -84.217  5.586   1.00 13.64  ? 201 HIS B NE2 1 
ATOM   2057  N  N   . MET B 1 75  ? 13.523  -83.146  2.723   1.00 13.09  ? 202 MET B N   1 
ATOM   2058  C  CA  . MET B 1 75  ? 13.467  -82.057  1.744   1.00 14.19  ? 202 MET B CA  1 
ATOM   2059  C  C   . MET B 1 75  ? 14.814  -81.828  1.077   1.00 13.76  ? 202 MET B C   1 
ATOM   2060  O  O   . MET B 1 75  ? 14.895  -81.834  -0.134  1.00 13.20  ? 202 MET B O   1 
ATOM   2061  C  CB  . MET B 1 75  ? 12.983  -80.768  2.408   1.00 15.55  ? 202 MET B CB  1 
ATOM   2062  C  CG  . MET B 1 75  ? 11.509  -80.790  2.750   1.00 15.99  ? 202 MET B CG  1 
ATOM   2063  S  SD  . MET B 1 75  ? 11.013  -79.472  3.872   1.00 16.71  ? 202 MET B SD  1 
ATOM   2064  C  CE  . MET B 1 75  ? 9.233   -79.764  3.822   1.00 14.15  ? 202 MET B CE  1 
ATOM   2065  N  N   . LEU B 1 76  ? 15.859  -81.616  1.884   1.00 13.20  ? 203 LEU B N   1 
ATOM   2066  C  CA  . LEU B 1 76  ? 17.258  -81.541  1.403   1.00 12.02  ? 203 LEU B CA  1 
ATOM   2067  C  C   . LEU B 1 76  ? 17.535  -80.325  0.520   1.00 9.62   ? 203 LEU B C   1 
ATOM   2068  O  O   . LEU B 1 76  ? 18.342  -80.391  -0.414  1.00 6.41   ? 203 LEU B O   1 
ATOM   2069  C  CB  . LEU B 1 76  ? 17.686  -82.845  0.684   1.00 10.71  ? 203 LEU B CB  1 
ATOM   2070  C  CG  . LEU B 1 76  ? 17.776  -84.093  1.572   1.00 10.84  ? 203 LEU B CG  1 
ATOM   2071  C  CD1 . LEU B 1 76  ? 18.011  -85.395  0.761   1.00 8.03   ? 203 LEU B CD1 1 
ATOM   2072  C  CD2 . LEU B 1 76  ? 18.876  -83.868  2.589   1.00 11.69  ? 203 LEU B CD2 1 
ATOM   2073  N  N   . LEU B 1 77  ? 16.883  -79.215  0.846   1.00 8.77   ? 204 LEU B N   1 
ATOM   2074  C  CA  . LEU B 1 77  ? 17.089  -77.969  0.142   1.00 8.57   ? 204 LEU B CA  1 
ATOM   2075  C  C   . LEU B 1 77  ? 17.701  -76.925  1.101   1.00 10.07  ? 204 LEU B C   1 
ATOM   2076  O  O   . LEU B 1 77  ? 18.626  -77.260  1.844   1.00 9.98   ? 204 LEU B O   1 
ATOM   2077  C  CB  . LEU B 1 77  ? 15.782  -77.517  -0.508  1.00 8.30   ? 204 LEU B CB  1 
ATOM   2078  C  CG  . LEU B 1 77  ? 15.151  -78.502  -1.501  1.00 7.40   ? 204 LEU B CG  1 
ATOM   2079  C  CD1 . LEU B 1 77  ? 13.858  -77.905  -2.078  1.00 7.55   ? 204 LEU B CD1 1 
ATOM   2080  C  CD2 . LEU B 1 77  ? 16.114  -78.845  -2.638  1.00 6.42   ? 204 LEU B CD2 1 
ATOM   2081  N  N   . LEU B 1 78  ? 17.219  -75.680  1.094   1.00 9.96   ? 205 LEU B N   1 
ATOM   2082  C  CA  . LEU B 1 78  ? 17.882  -74.598  1.836   1.00 10.74  ? 205 LEU B CA  1 
ATOM   2083  C  C   . LEU B 1 78  ? 17.410  -74.525  3.289   1.00 13.35  ? 205 LEU B C   1 
ATOM   2084  O  O   . LEU B 1 78  ? 16.810  -75.485  3.772   1.00 16.08  ? 205 LEU B O   1 
ATOM   2085  C  CB  . LEU B 1 78  ? 17.694  -73.267  1.105   1.00 11.16  ? 205 LEU B CB  1 
ATOM   2086  C  CG  . LEU B 1 78  ? 18.296  -73.219  -0.298  1.00 10.73  ? 205 LEU B CG  1 
ATOM   2087  C  CD1 . LEU B 1 78  ? 17.935  -71.905  -1.033  1.00 8.55   ? 205 LEU B CD1 1 
ATOM   2088  C  CD2 . LEU B 1 78  ? 19.804  -73.407  -0.207  1.00 10.10  ? 205 LEU B CD2 1 
ATOM   2089  N  N   . THR B 1 79  ? 17.689  -73.418  3.993   1.00 14.77  ? 206 THR B N   1 
ATOM   2090  C  CA  . THR B 1 79  ? 17.423  -73.324  5.449   1.00 15.27  ? 206 THR B CA  1 
ATOM   2091  C  C   . THR B 1 79  ? 16.690  -72.032  5.894   1.00 14.18  ? 206 THR B C   1 
ATOM   2092  O  O   . THR B 1 79  ? 17.249  -71.178  6.573   1.00 13.65  ? 206 THR B O   1 
ATOM   2093  C  CB  . THR B 1 79  ? 18.738  -73.500  6.233   1.00 14.56  ? 206 THR B CB  1 
ATOM   2094  O  OG1 . THR B 1 79  ? 19.454  -74.596  5.671   1.00 15.02  ? 206 THR B OG1 1 
ATOM   2095  C  CG2 . THR B 1 79  ? 18.473  -73.808  7.707   1.00 13.53  ? 206 THR B CG2 1 
ATOM   2096  N  N   . ASN B 1 80  ? 15.421  -71.920  5.519   1.00 14.13  ? 207 ASN B N   1 
ATOM   2097  C  CA  . ASN B 1 80  ? 14.650  -70.716  5.779   1.00 15.32  ? 207 ASN B CA  1 
ATOM   2098  C  C   . ASN B 1 80  ? 14.005  -70.743  7.162   1.00 15.63  ? 207 ASN B C   1 
ATOM   2099  O  O   . ASN B 1 80  ? 12.777  -70.787  7.300   1.00 14.89  ? 207 ASN B O   1 
ATOM   2100  C  CB  . ASN B 1 80  ? 13.615  -70.511  4.672   1.00 15.83  ? 207 ASN B CB  1 
ATOM   2101  C  CG  . ASN B 1 80  ? 14.261  -70.217  3.343   1.00 16.13  ? 207 ASN B CG  1 
ATOM   2102  O  OD1 . ASN B 1 80  ? 15.346  -69.626  3.296   1.00 15.76  ? 207 ASN B OD1 1 
ATOM   2103  N  ND2 . ASN B 1 80  ? 13.613  -70.636  2.250   1.00 14.15  ? 207 ASN B ND2 1 
ATOM   2104  N  N   . THR B 1 81  ? 14.861  -70.713  8.182   1.00 16.47  ? 208 THR B N   1 
ATOM   2105  C  CA  . THR B 1 81  ? 14.427  -70.925  9.553   1.00 18.29  ? 208 THR B CA  1 
ATOM   2106  C  C   . THR B 1 81  ? 13.505  -69.802  10.053  1.00 18.62  ? 208 THR B C   1 
ATOM   2107  O  O   . THR B 1 81  ? 12.526  -70.063  10.746  1.00 16.46  ? 208 THR B O   1 
ATOM   2108  C  CB  . THR B 1 81  ? 15.623  -71.105  10.501  1.00 18.42  ? 208 THR B CB  1 
ATOM   2109  O  OG1 . THR B 1 81  ? 16.602  -71.967  9.895   1.00 17.56  ? 208 THR B OG1 1 
ATOM   2110  C  CG2 . THR B 1 81  ? 15.161  -71.704  11.827  1.00 15.97  ? 208 THR B CG2 1 
ATOM   2111  N  N   . PHE B 1 82  ? 13.799  -68.563  9.667   1.00 20.11  ? 209 PHE B N   1 
ATOM   2112  C  CA  . PHE B 1 82  ? 12.972  -67.424  10.076  1.00 20.94  ? 209 PHE B CA  1 
ATOM   2113  C  C   . PHE B 1 82  ? 11.535  -67.572  9.587   1.00 19.80  ? 209 PHE B C   1 
ATOM   2114  O  O   . PHE B 1 82  ? 10.594  -67.393  10.362  1.00 19.35  ? 209 PHE B O   1 
ATOM   2115  C  CB  . PHE B 1 82  ? 13.547  -66.109  9.562   1.00 22.21  ? 209 PHE B CB  1 
ATOM   2116  C  CG  . PHE B 1 82  ? 14.699  -65.586  10.369  1.00 23.59  ? 209 PHE B CG  1 
ATOM   2117  C  CD1 . PHE B 1 82  ? 15.999  -65.993  10.097  1.00 24.65  ? 209 PHE B CD1 1 
ATOM   2118  C  CD2 . PHE B 1 82  ? 14.483  -64.658  11.382  1.00 24.93  ? 209 PHE B CD2 1 
ATOM   2119  C  CE1 . PHE B 1 82  ? 17.077  -65.485  10.834  1.00 25.51  ? 209 PHE B CE1 1 
ATOM   2120  C  CE2 . PHE B 1 82  ? 15.547  -64.146  12.125  1.00 25.46  ? 209 PHE B CE2 1 
ATOM   2121  C  CZ  . PHE B 1 82  ? 16.847  -64.561  11.851  1.00 25.63  ? 209 PHE B CZ  1 
ATOM   2122  N  N   . GLY B 1 83  ? 11.368  -67.896  8.308   1.00 17.35  ? 210 GLY B N   1 
ATOM   2123  C  CA  . GLY B 1 83  ? 10.034  -68.086  7.749   1.00 17.53  ? 210 GLY B CA  1 
ATOM   2124  C  C   . GLY B 1 83  ? 9.321   -69.272  8.380   1.00 17.70  ? 210 GLY B C   1 
ATOM   2125  O  O   . GLY B 1 83  ? 8.094   -69.263  8.546   1.00 15.66  ? 210 GLY B O   1 
ATOM   2126  N  N   . ALA B 1 84  ? 10.111  -70.291  8.720   1.00 17.22  ? 211 ALA B N   1 
ATOM   2127  C  CA  . ALA B 1 84  ? 9.625   -71.501  9.374   1.00 16.66  ? 211 ALA B CA  1 
ATOM   2128  C  C   . ALA B 1 84  ? 9.047   -71.204  10.759  1.00 16.51  ? 211 ALA B C   1 
ATOM   2129  O  O   . ALA B 1 84  ? 7.977   -71.703  11.109  1.00 15.60  ? 211 ALA B O   1 
ATOM   2130  C  CB  . ALA B 1 84  ? 10.757  -72.527  9.489   1.00 15.52  ? 211 ALA B CB  1 
ATOM   2131  N  N   . ILE B 1 85  ? 9.765   -70.406  11.546  1.00 16.43  ? 212 ILE B N   1 
ATOM   2132  C  CA  . ILE B 1 85  ? 9.323   -70.074  12.898  1.00 16.47  ? 212 ILE B CA  1 
ATOM   2133  C  C   . ILE B 1 85  ? 8.020   -69.288  12.841  1.00 16.38  ? 212 ILE B C   1 
ATOM   2134  O  O   . ILE B 1 85  ? 7.084   -69.549  13.606  1.00 16.20  ? 212 ILE B O   1 
ATOM   2135  C  CB  . ILE B 1 85  ? 10.401  -69.292  13.677  1.00 16.73  ? 212 ILE B CB  1 
ATOM   2136  C  CG1 . ILE B 1 85  ? 11.636  -70.189  13.912  1.00 16.75  ? 212 ILE B CG1 1 
ATOM   2137  C  CG2 . ILE B 1 85  ? 9.838   -68.805  15.002  1.00 15.33  ? 212 ILE B CG2 1 
ATOM   2138  C  CD1 . ILE B 1 85  ? 12.840  -69.479  14.548  1.00 15.83  ? 212 ILE B CD1 1 
ATOM   2139  N  N   . ASN B 1 86  ? 7.961   -68.341  11.910  1.00 16.04  ? 213 ASN B N   1 
ATOM   2140  C  CA  . ASN B 1 86  ? 6.756   -67.565  11.661  1.00 15.26  ? 213 ASN B CA  1 
ATOM   2141  C  C   . ASN B 1 86  ? 5.582   -68.430  11.208  1.00 14.74  ? 213 ASN B C   1 
ATOM   2142  O  O   . ASN B 1 86  ? 4.438   -68.203  11.607  1.00 14.70  ? 213 ASN B O   1 
ATOM   2143  C  CB  . ASN B 1 86  ? 7.051   -66.468  10.637  1.00 16.26  ? 213 ASN B CB  1 
ATOM   2144  C  CG  . ASN B 1 86  ? 7.670   -65.233  11.276  1.00 16.51  ? 213 ASN B CG  1 
ATOM   2145  O  OD1 . ASN B 1 86  ? 7.106   -64.668  12.216  1.00 17.70  ? 213 ASN B OD1 1 
ATOM   2146  N  ND2 . ASN B 1 86  ? 8.824   -64.811  10.773  1.00 15.04  ? 213 ASN B ND2 1 
ATOM   2147  N  N   . TYR B 1 87  ? 5.878   -69.434  10.395  1.00 14.96  ? 214 TYR B N   1 
ATOM   2148  C  CA  . TYR B 1 87  ? 4.882   -70.386  9.946   1.00 14.77  ? 214 TYR B CA  1 
ATOM   2149  C  C   . TYR B 1 87  ? 4.289   -71.119  11.133  1.00 14.35  ? 214 TYR B C   1 
ATOM   2150  O  O   . TYR B 1 87  ? 3.074   -71.276  11.209  1.00 14.57  ? 214 TYR B O   1 
ATOM   2151  C  CB  . TYR B 1 87  ? 5.487   -71.373  8.937   1.00 15.22  ? 214 TYR B CB  1 
ATOM   2152  C  CG  . TYR B 1 87  ? 4.593   -72.541  8.547   1.00 17.04  ? 214 TYR B CG  1 
ATOM   2153  C  CD1 . TYR B 1 87  ? 3.642   -72.422  7.531   1.00 18.45  ? 214 TYR B CD1 1 
ATOM   2154  C  CD2 . TYR B 1 87  ? 4.725   -73.779  9.176   1.00 16.95  ? 214 TYR B CD2 1 
ATOM   2155  C  CE1 . TYR B 1 87  ? 2.840   -73.504  7.173   1.00 18.54  ? 214 TYR B CE1 1 
ATOM   2156  C  CE2 . TYR B 1 87  ? 3.935   -74.852  8.829   1.00 17.53  ? 214 TYR B CE2 1 
ATOM   2157  C  CZ  . TYR B 1 87  ? 3.001   -74.723  7.832   1.00 19.65  ? 214 TYR B CZ  1 
ATOM   2158  O  OH  . TYR B 1 87  ? 2.225   -75.825  7.505   1.00 22.12  ? 214 TYR B OH  1 
ATOM   2159  N  N   . VAL B 1 88  ? 5.132   -71.556  12.061  1.00 14.26  ? 215 VAL B N   1 
ATOM   2160  C  CA  . VAL B 1 88  ? 4.640   -72.301  13.222  1.00 16.26  ? 215 VAL B CA  1 
ATOM   2161  C  C   . VAL B 1 88  ? 3.743   -71.399  14.066  1.00 17.96  ? 215 VAL B C   1 
ATOM   2162  O  O   . VAL B 1 88  ? 2.602   -71.755  14.393  1.00 19.30  ? 215 VAL B O   1 
ATOM   2163  C  CB  . VAL B 1 88  ? 5.798   -72.894  14.073  1.00 15.21  ? 215 VAL B CB  1 
ATOM   2164  C  CG1 . VAL B 1 88  ? 5.315   -73.265  15.482  1.00 13.69  ? 215 VAL B CG1 1 
ATOM   2165  C  CG2 . VAL B 1 88  ? 6.413   -74.112  13.366  1.00 13.36  ? 215 VAL B CG2 1 
ATOM   2166  N  N   . ALA B 1 89  ? 4.271   -70.222  14.385  1.00 18.72  ? 216 ALA B N   1 
ATOM   2167  C  CA  . ALA B 1 89  ? 3.580   -69.224  15.199  1.00 19.46  ? 216 ALA B CA  1 
ATOM   2168  C  C   . ALA B 1 89  ? 2.186   -68.889  14.687  1.00 20.45  ? 216 ALA B C   1 
ATOM   2169  O  O   . ALA B 1 89  ? 1.256   -68.730  15.494  1.00 20.78  ? 216 ALA B O   1 
ATOM   2170  C  CB  . ALA B 1 89  ? 4.419   -67.950  15.294  1.00 18.26  ? 216 ALA B CB  1 
ATOM   2171  N  N   . THR B 1 90  ? 2.031   -68.787  13.365  1.00 19.92  ? 217 THR B N   1 
ATOM   2172  C  CA  . THR B 1 90  ? 0.735   -68.405  12.792  1.00 19.90  ? 217 THR B CA  1 
ATOM   2173  C  C   . THR B 1 90  ? -0.121  -69.564  12.229  1.00 20.49  ? 217 THR B C   1 
ATOM   2174  O  O   . THR B 1 90  ? -1.346  -69.438  12.194  1.00 21.54  ? 217 THR B O   1 
ATOM   2175  C  CB  . THR B 1 90  ? 0.896   -67.300  11.729  1.00 19.36  ? 217 THR B CB  1 
ATOM   2176  O  OG1 . THR B 1 90  ? 1.634   -67.801  10.616  1.00 20.78  ? 217 THR B OG1 1 
ATOM   2177  C  CG2 . THR B 1 90  ? 1.631   -66.094  12.319  1.00 18.91  ? 217 THR B CG2 1 
ATOM   2178  N  N   . GLU B 1 91  ? 0.496   -70.674  11.818  1.00 20.07  ? 218 GLU B N   1 
ATOM   2179  C  CA  . GLU B 1 91  ? -0.225  -71.756  11.108  1.00 21.93  ? 218 GLU B CA  1 
ATOM   2180  C  C   . GLU B 1 91  ? -0.366  -73.094  11.847  1.00 21.13  ? 218 GLU B C   1 
ATOM   2181  O  O   . GLU B 1 91  ? -1.089  -73.978  11.379  1.00 20.93  ? 218 GLU B O   1 
ATOM   2182  C  CB  . GLU B 1 91  ? 0.453   -72.054  9.767   1.00 24.69  ? 218 GLU B CB  1 
ATOM   2183  C  CG  . GLU B 1 91  ? 0.572   -70.871  8.827   1.00 26.66  ? 218 GLU B CG  1 
ATOM   2184  C  CD  . GLU B 1 91  ? -0.764  -70.433  8.272   1.00 28.19  ? 218 GLU B CD  1 
ATOM   2185  O  OE1 . GLU B 1 91  ? -1.757  -71.171  8.445   1.00 29.36  ? 218 GLU B OE1 1 
ATOM   2186  O  OE2 . GLU B 1 91  ? -0.818  -69.349  7.654   1.00 29.48  ? 218 GLU B OE2 1 
ATOM   2187  N  N   . VAL B 1 92  ? 0.313   -73.263  12.977  1.00 20.52  ? 219 VAL B N   1 
ATOM   2188  C  CA  . VAL B 1 92  ? 0.329   -74.564  13.665  1.00 20.91  ? 219 VAL B CA  1 
ATOM   2189  C  C   . VAL B 1 92  ? -0.317  -74.536  15.055  1.00 20.29  ? 219 VAL B C   1 
ATOM   2190  O  O   . VAL B 1 92  ? -0.956  -75.501  15.460  1.00 21.02  ? 219 VAL B O   1 
ATOM   2191  C  CB  . VAL B 1 92  ? 1.776   -75.131  13.736  1.00 21.02  ? 219 VAL B CB  1 
ATOM   2192  C  CG1 . VAL B 1 92  ? 1.796   -76.529  14.357  1.00 19.39  ? 219 VAL B CG1 1 
ATOM   2193  C  CG2 . VAL B 1 92  ? 2.404   -75.152  12.343  1.00 20.11  ? 219 VAL B CG2 1 
ATOM   2194  N  N   . PHE B 1 93  ? -0.164  -73.435  15.781  1.00 21.70  ? 220 PHE B N   1 
ATOM   2195  C  CA  . PHE B 1 93  ? -0.745  -73.314  17.119  1.00 22.07  ? 220 PHE B CA  1 
ATOM   2196  C  C   . PHE B 1 93  ? -2.187  -72.818  17.014  1.00 24.10  ? 220 PHE B C   1 
ATOM   2197  O  O   . PHE B 1 93  ? -2.521  -71.721  17.464  1.00 24.10  ? 220 PHE B O   1 
ATOM   2198  C  CB  . PHE B 1 93  ? 0.104   -72.389  17.999  1.00 21.32  ? 220 PHE B CB  1 
ATOM   2199  C  CG  . PHE B 1 93  ? 1.295   -73.062  18.620  1.00 20.21  ? 220 PHE B CG  1 
ATOM   2200  C  CD1 . PHE B 1 93  ? 1.127   -74.012  19.618  1.00 20.32  ? 220 PHE B CD1 1 
ATOM   2201  C  CD2 . PHE B 1 93  ? 2.579   -72.726  18.236  1.00 20.50  ? 220 PHE B CD2 1 
ATOM   2202  C  CE1 . PHE B 1 93  ? 2.220   -74.633  20.206  1.00 20.68  ? 220 PHE B CE1 1 
ATOM   2203  C  CE2 . PHE B 1 93  ? 3.686   -73.338  18.823  1.00 20.89  ? 220 PHE B CE2 1 
ATOM   2204  C  CZ  . PHE B 1 93  ? 3.509   -74.289  19.806  1.00 21.08  ? 220 PHE B CZ  1 
ATOM   2205  N  N   . ARG B 1 94  ? -3.030  -73.661  16.423  1.00 25.65  ? 221 ARG B N   1 
ATOM   2206  C  CA  . ARG B 1 94  ? -4.414  -73.339  16.117  1.00 26.00  ? 221 ARG B CA  1 
ATOM   2207  C  C   . ARG B 1 94  ? -5.330  -74.300  16.848  1.00 26.83  ? 221 ARG B C   1 
ATOM   2208  O  O   . ARG B 1 94  ? -5.079  -75.507  16.863  1.00 24.66  ? 221 ARG B O   1 
ATOM   2209  C  CB  . ARG B 1 94  ? -4.674  -73.535  14.628  1.00 26.69  ? 221 ARG B CB  1 
ATOM   2210  C  CG  . ARG B 1 94  ? -3.846  -72.692  13.708  1.00 27.65  ? 221 ARG B CG  1 
ATOM   2211  C  CD  . ARG B 1 94  ? -4.326  -71.261  13.681  1.00 28.74  ? 221 ARG B CD  1 
ATOM   2212  N  NE  . ARG B 1 94  ? -3.876  -70.598  12.457  1.00 29.71  ? 221 ARG B NE  1 
ATOM   2213  C  CZ  . ARG B 1 94  ? -4.645  -69.880  11.637  1.00 28.62  ? 221 ARG B CZ  1 
ATOM   2214  N  NH1 . ARG B 1 94  ? -5.939  -69.692  11.876  1.00 27.89  ? 221 ARG B NH1 1 
ATOM   2215  N  NH2 . ARG B 1 94  ? -4.097  -69.339  10.557  1.00 28.64  ? 221 ARG B NH2 1 
ATOM   2216  N  N   . GLU B 1 95  ? -6.409  -73.773  17.423  1.00 28.84  ? 222 GLU B N   1 
ATOM   2217  C  CA  . GLU B 1 95  ? -7.475  -74.613  17.943  1.00 30.72  ? 222 GLU B CA  1 
ATOM   2218  C  C   . GLU B 1 95  ? -8.034  -75.473  16.808  1.00 31.82  ? 222 GLU B C   1 
ATOM   2219  O  O   . GLU B 1 95  ? -8.431  -76.625  17.021  1.00 31.54  ? 222 GLU B O   1 
ATOM   2220  C  CB  . GLU B 1 95  ? -8.587  -73.764  18.541  1.00 32.18  ? 222 GLU B CB  1 
ATOM   2221  C  CG  . GLU B 1 95  ? -9.597  -74.559  19.352  1.00 33.50  ? 222 GLU B CG  1 
ATOM   2222  C  CD  . GLU B 1 95  ? -11.017 -74.402  18.836  1.00 35.15  ? 222 GLU B CD  1 
ATOM   2223  O  OE1 . GLU B 1 95  ? -11.859 -73.817  19.554  1.00 36.39  ? 222 GLU B OE1 1 
ATOM   2224  O  OE2 . GLU B 1 95  ? -11.288 -74.867  17.706  1.00 36.29  ? 222 GLU B OE2 1 
ATOM   2225  N  N   . GLU B 1 96  ? -8.047  -74.899  15.604  1.00 32.64  ? 223 GLU B N   1 
ATOM   2226  C  CA  . GLU B 1 96  ? -8.450  -75.599  14.383  1.00 33.14  ? 223 GLU B CA  1 
ATOM   2227  C  C   . GLU B 1 96  ? -7.773  -76.957  14.239  1.00 31.32  ? 223 GLU B C   1 
ATOM   2228  O  O   . GLU B 1 96  ? -8.439  -77.957  13.965  1.00 32.31  ? 223 GLU B O   1 
ATOM   2229  C  CB  . GLU B 1 96  ? -8.132  -74.748  13.142  1.00 35.10  ? 223 GLU B CB  1 
ATOM   2230  C  CG  . GLU B 1 96  ? -9.013  -73.495  12.969  1.00 36.97  ? 223 GLU B CG  1 
ATOM   2231  C  CD  . GLU B 1 96  ? -8.312  -72.183  13.343  1.00 38.05  ? 223 GLU B CD  1 
ATOM   2232  O  OE1 . GLU B 1 96  ? -7.918  -72.001  14.521  1.00 39.01  ? 223 GLU B OE1 1 
ATOM   2233  O  OE2 . GLU B 1 96  ? -8.182  -71.317  12.452  1.00 38.49  ? 223 GLU B OE2 1 
ATOM   2234  N  N   . LEU B 1 97  ? -6.454  -76.983  14.425  1.00 28.81  ? 224 LEU B N   1 
ATOM   2235  C  CA  . LEU B 1 97  ? -5.659  -78.208  14.262  1.00 26.71  ? 224 LEU B CA  1 
ATOM   2236  C  C   . LEU B 1 97  ? -5.337  -78.925  15.579  1.00 24.99  ? 224 LEU B C   1 
ATOM   2237  O  O   . LEU B 1 97  ? -4.407  -79.732  15.634  1.00 24.85  ? 224 LEU B O   1 
ATOM   2238  C  CB  . LEU B 1 97  ? -4.356  -77.889  13.535  1.00 26.97  ? 224 LEU B CB  1 
ATOM   2239  C  CG  . LEU B 1 97  ? -4.489  -77.135  12.216  1.00 26.95  ? 224 LEU B CG  1 
ATOM   2240  C  CD1 . LEU B 1 97  ? -3.106  -76.874  11.659  1.00 26.63  ? 224 LEU B CD1 1 
ATOM   2241  C  CD2 . LEU B 1 97  ? -5.349  -77.929  11.235  1.00 26.21  ? 224 LEU B CD2 1 
ATOM   2242  N  N   . GLY B 1 98  ? -6.100  -78.630  16.630  1.00 23.41  ? 225 GLY B N   1 
ATOM   2243  C  CA  . GLY B 1 98  ? -6.032  -79.379  17.885  1.00 22.56  ? 225 GLY B CA  1 
ATOM   2244  C  C   . GLY B 1 98  ? -5.272  -78.720  19.025  1.00 22.12  ? 225 GLY B C   1 
ATOM   2245  O  O   . GLY B 1 98  ? -5.036  -79.359  20.058  1.00 20.88  ? 225 GLY B O   1 
ATOM   2246  N  N   . ALA B 1 99  ? -4.889  -77.453  18.862  1.00 22.15  ? 226 ALA B N   1 
ATOM   2247  C  CA  . ALA B 1 99  ? -4.150  -76.746  19.922  1.00 22.03  ? 226 ALA B CA  1 
ATOM   2248  C  C   . ALA B 1 99  ? -5.074  -76.491  21.095  1.00 21.25  ? 226 ALA B C   1 
ATOM   2249  O  O   . ALA B 1 99  ? -6.274  -76.356  20.919  1.00 22.23  ? 226 ALA B O   1 
ATOM   2250  C  CB  . ALA B 1 99  ? -3.552  -75.439  19.418  1.00 20.40  ? 226 ALA B CB  1 
ATOM   2251  N  N   . ARG B 1 100 ? -4.506  -76.433  22.292  1.00 21.23  ? 227 ARG B N   1 
ATOM   2252  C  CA  . ARG B 1 100 ? -5.286  -76.256  23.506  1.00 20.18  ? 227 ARG B CA  1 
ATOM   2253  C  C   . ARG B 1 100 ? -5.117  -74.837  24.028  1.00 20.91  ? 227 ARG B C   1 
ATOM   2254  O  O   . ARG B 1 100 ? -3.992  -74.374  24.204  1.00 20.00  ? 227 ARG B O   1 
ATOM   2255  C  CB  . ARG B 1 100 ? -4.857  -77.259  24.568  1.00 18.98  ? 227 ARG B CB  1 
ATOM   2256  C  CG  . ARG B 1 100 ? -5.341  -78.667  24.291  1.00 18.35  ? 227 ARG B CG  1 
ATOM   2257  C  CD  . ARG B 1 100 ? -4.780  -79.645  25.310  1.00 17.99  ? 227 ARG B CD  1 
ATOM   2258  N  NE  . ARG B 1 100 ? -3.326  -79.700  25.222  1.00 17.73  ? 227 ARG B NE  1 
ATOM   2259  C  CZ  . ARG B 1 100 ? -2.542  -80.484  25.961  1.00 18.17  ? 227 ARG B CZ  1 
ATOM   2260  N  NH1 . ARG B 1 100 ? -3.048  -81.308  26.867  1.00 16.83  ? 227 ARG B NH1 1 
ATOM   2261  N  NH2 . ARG B 1 100 ? -1.229  -80.439  25.781  1.00 19.48  ? 227 ARG B NH2 1 
ATOM   2262  N  N   . PRO B 1 101 ? -6.240  -74.140  24.283  1.00 21.09  ? 228 PRO B N   1 
ATOM   2263  C  CA  . PRO B 1 101 ? -6.122  -72.749  24.691  1.00 21.61  ? 228 PRO B CA  1 
ATOM   2264  C  C   . PRO B 1 101 ? -5.392  -72.579  26.022  1.00 22.85  ? 228 PRO B C   1 
ATOM   2265  O  O   . PRO B 1 101 ? -4.668  -71.603  26.195  1.00 24.09  ? 228 PRO B O   1 
ATOM   2266  C  CB  . PRO B 1 101 ? -7.575  -72.284  24.789  1.00 22.22  ? 228 PRO B CB  1 
ATOM   2267  C  CG  . PRO B 1 101 ? -8.383  -73.533  24.948  1.00 22.07  ? 228 PRO B CG  1 
ATOM   2268  C  CD  . PRO B 1 101 ? -7.643  -74.580  24.191  1.00 21.38  ? 228 PRO B CD  1 
ATOM   2269  N  N   . ASP B 1 102 ? -5.562  -73.528  26.939  1.00 23.96  ? 229 ASP B N   1 
ATOM   2270  C  CA  . ASP B 1 102 ? -4.944  -73.434  28.265  1.00 24.86  ? 229 ASP B CA  1 
ATOM   2271  C  C   . ASP B 1 102 ? -3.474  -73.877  28.298  1.00 23.66  ? 229 ASP B C   1 
ATOM   2272  O  O   . ASP B 1 102 ? -2.784  -73.655  29.293  1.00 24.61  ? 229 ASP B O   1 
ATOM   2273  C  CB  . ASP B 1 102 ? -5.758  -74.231  29.299  1.00 25.82  ? 229 ASP B CB  1 
ATOM   2274  C  CG  . ASP B 1 102 ? -5.645  -75.741  29.109  1.00 27.06  ? 229 ASP B CG  1 
ATOM   2275  O  OD1 . ASP B 1 102 ? -4.534  -76.291  29.271  1.00 28.11  ? 229 ASP B OD1 1 
ATOM   2276  O  OD2 . ASP B 1 102 ? -6.672  -76.382  28.808  1.00 27.47  ? 229 ASP B OD2 1 
ATOM   2277  N  N   . ALA B 1 103 ? -2.997  -74.495  27.223  1.00 22.30  ? 230 ALA B N   1 
ATOM   2278  C  CA  . ALA B 1 103 ? -1.684  -75.130  27.237  1.00 20.86  ? 230 ALA B CA  1 
ATOM   2279  C  C   . ALA B 1 103 ? -0.570  -74.119  26.999  1.00 21.09  ? 230 ALA B C   1 
ATOM   2280  O  O   . ALA B 1 103 ? -0.730  -73.159  26.247  1.00 18.74  ? 230 ALA B O   1 
ATOM   2281  C  CB  . ALA B 1 103 ? -1.616  -76.247  26.204  1.00 19.29  ? 230 ALA B CB  1 
ATOM   2282  N  N   . THR B 1 104 ? 0.553   -74.354  27.672  1.00 21.62  ? 231 THR B N   1 
ATOM   2283  C  CA  . THR B 1 104 ? 1.787   -73.644  27.434  1.00 20.97  ? 231 THR B CA  1 
ATOM   2284  C  C   . THR B 1 104 ? 2.283   -74.031  26.043  1.00 20.86  ? 231 THR B C   1 
ATOM   2285  O  O   . THR B 1 104 ? 2.367   -75.221  25.725  1.00 20.91  ? 231 THR B O   1 
ATOM   2286  C  CB  . THR B 1 104 ? 2.857   -74.044  28.485  1.00 21.21  ? 231 THR B CB  1 
ATOM   2287  O  OG1 . THR B 1 104 ? 2.350   -73.818  29.807  1.00 22.37  ? 231 THR B OG1 1 
ATOM   2288  C  CG2 . THR B 1 104 ? 4.136   -73.249  28.301  1.00 20.69  ? 231 THR B CG2 1 
ATOM   2289  N  N   . LYS B 1 105 ? 2.594   -73.022  25.224  1.00 19.79  ? 232 LYS B N   1 
ATOM   2290  C  CA  . LYS B 1 105 ? 3.147   -73.222  23.885  1.00 18.75  ? 232 LYS B CA  1 
ATOM   2291  C  C   . LYS B 1 105 ? 4.670   -73.332  23.946  1.00 17.35  ? 232 LYS B C   1 
ATOM   2292  O  O   . LYS B 1 105 ? 5.348   -72.425  24.431  1.00 16.54  ? 232 LYS B O   1 
ATOM   2293  C  CB  . LYS B 1 105 ? 2.752   -72.076  22.951  1.00 19.41  ? 232 LYS B CB  1 
ATOM   2294  C  CG  . LYS B 1 105 ? 1.250   -71.940  22.682  1.00 19.63  ? 232 LYS B CG  1 
ATOM   2295  C  CD  . LYS B 1 105 ? 0.975   -70.867  21.605  1.00 21.24  ? 232 LYS B CD  1 
ATOM   2296  C  CE  . LYS B 1 105 ? -0.524  -70.484  21.520  1.00 23.15  ? 232 LYS B CE  1 
ATOM   2297  N  NZ  . LYS B 1 105 ? -0.880  -69.562  20.377  1.00 22.47  ? 232 LYS B NZ  1 
ATOM   2298  N  N   . VAL B 1 106 ? 5.194   -74.458  23.463  1.00 16.57  ? 233 VAL B N   1 
ATOM   2299  C  CA  . VAL B 1 106 ? 6.632   -74.707  23.433  1.00 16.24  ? 233 VAL B CA  1 
ATOM   2300  C  C   . VAL B 1 106 ? 7.072   -75.145  22.034  1.00 18.68  ? 233 VAL B C   1 
ATOM   2301  O  O   . VAL B 1 106 ? 6.441   -76.002  21.388  1.00 17.79  ? 233 VAL B O   1 
ATOM   2302  C  CB  . VAL B 1 106 ? 7.038   -75.769  24.472  1.00 15.52  ? 233 VAL B CB  1 
ATOM   2303  C  CG1 . VAL B 1 106 ? 8.506   -76.141  24.335  1.00 13.50  ? 233 VAL B CG1 1 
ATOM   2304  C  CG2 . VAL B 1 106 ? 6.731   -75.260  25.896  1.00 15.55  ? 233 VAL B CG2 1 
ATOM   2305  N  N   . LEU B 1 107 ? 8.162   -74.539  21.578  1.00 18.85  ? 234 LEU B N   1 
ATOM   2306  C  CA  . LEU B 1 107 ? 8.741   -74.844  20.289  1.00 19.12  ? 234 LEU B CA  1 
ATOM   2307  C  C   . LEU B 1 107 ? 10.159  -75.387  20.491  1.00 17.97  ? 234 LEU B C   1 
ATOM   2308  O  O   . LEU B 1 107 ? 10.969  -74.780  21.176  1.00 17.53  ? 234 LEU B O   1 
ATOM   2309  C  CB  . LEU B 1 107 ? 8.717   -73.576  19.434  1.00 19.80  ? 234 LEU B CB  1 
ATOM   2310  C  CG  . LEU B 1 107 ? 9.147   -73.558  17.958  1.00 21.94  ? 234 LEU B CG  1 
ATOM   2311  C  CD1 . LEU B 1 107 ? 8.752   -74.792  17.132  1.00 18.53  ? 234 LEU B CD1 1 
ATOM   2312  C  CD2 . LEU B 1 107 ? 8.585   -72.263  17.332  1.00 22.92  ? 234 LEU B CD2 1 
ATOM   2313  N  N   . ILE B 1 108 ? 10.425  -76.566  19.931  1.00 17.89  ? 235 ILE B N   1 
ATOM   2314  C  CA  . ILE B 1 108 ? 11.764  -77.134  19.897  1.00 17.84  ? 235 ILE B CA  1 
ATOM   2315  C  C   . ILE B 1 108 ? 12.280  -77.014  18.466  1.00 17.92  ? 235 ILE B C   1 
ATOM   2316  O  O   . ILE B 1 108 ? 11.864  -77.753  17.567  1.00 17.07  ? 235 ILE B O   1 
ATOM   2317  C  CB  . ILE B 1 108 ? 11.798  -78.612  20.356  1.00 18.59  ? 235 ILE B CB  1 
ATOM   2318  C  CG1 . ILE B 1 108 ? 11.299  -78.735  21.804  1.00 20.78  ? 235 ILE B CG1 1 
ATOM   2319  C  CG2 . ILE B 1 108 ? 13.222  -79.177  20.265  1.00 17.75  ? 235 ILE B CG2 1 
ATOM   2320  C  CD1 . ILE B 1 108 ? 11.380  -80.159  22.362  1.00 21.77  ? 235 ILE B CD1 1 
ATOM   2321  N  N   . ILE B 1 109 ? 13.178  -76.063  18.264  1.00 17.26  ? 236 ILE B N   1 
ATOM   2322  C  CA  . ILE B 1 109 ? 13.752  -75.830  16.954  1.00 18.02  ? 236 ILE B CA  1 
ATOM   2323  C  C   . ILE B 1 109 ? 15.038  -76.622  16.892  1.00 17.01  ? 236 ILE B C   1 
ATOM   2324  O  O   . ILE B 1 109 ? 15.963  -76.374  17.671  1.00 15.92  ? 236 ILE B O   1 
ATOM   2325  C  CB  . ILE B 1 109 ? 14.043  -74.336  16.695  1.00 18.95  ? 236 ILE B CB  1 
ATOM   2326  C  CG1 . ILE B 1 109 ? 12.808  -73.484  17.001  1.00 17.22  ? 236 ILE B CG1 1 
ATOM   2327  C  CG2 . ILE B 1 109 ? 14.477  -74.146  15.233  1.00 20.98  ? 236 ILE B CG2 1 
ATOM   2328  C  CD1 . ILE B 1 109 ? 13.102  -72.046  17.251  1.00 16.35  ? 236 ILE B CD1 1 
ATOM   2329  N  N   . ILE B 1 110 ? 15.076  -77.600  15.986  1.00 16.56  ? 237 ILE B N   1 
ATOM   2330  C  CA  . ILE B 1 110 ? 16.208  -78.492  15.869  1.00 15.16  ? 237 ILE B CA  1 
ATOM   2331  C  C   . ILE B 1 110 ? 16.921  -78.181  14.544  1.00 15.85  ? 237 ILE B C   1 
ATOM   2332  O  O   . ILE B 1 110 ? 16.342  -78.322  13.464  1.00 17.03  ? 237 ILE B O   1 
ATOM   2333  C  CB  . ILE B 1 110 ? 15.749  -79.966  15.938  1.00 13.81  ? 237 ILE B CB  1 
ATOM   2334  C  CG1 . ILE B 1 110 ? 14.742  -80.170  17.074  1.00 12.85  ? 237 ILE B CG1 1 
ATOM   2335  C  CG2 . ILE B 1 110 ? 16.942  -80.885  16.135  1.00 13.95  ? 237 ILE B CG2 1 
ATOM   2336  C  CD1 . ILE B 1 110 ? 13.816  -81.362  16.875  1.00 11.81  ? 237 ILE B CD1 1 
ATOM   2337  N  N   . THR B 1 111 ? 18.177  -77.762  14.630  1.00 15.77  ? 238 THR B N   1 
ATOM   2338  C  CA  . THR B 1 111 ? 18.880  -77.232  13.473  1.00 17.03  ? 238 THR B CA  1 
ATOM   2339  C  C   . THR B 1 111 ? 20.392  -77.305  13.676  1.00 18.22  ? 238 THR B C   1 
ATOM   2340  O  O   . THR B 1 111 ? 20.850  -77.699  14.739  1.00 19.69  ? 238 THR B O   1 
ATOM   2341  C  CB  . THR B 1 111 ? 18.417  -75.778  13.197  1.00 17.56  ? 238 THR B CB  1 
ATOM   2342  O  OG1 . THR B 1 111 ? 18.829  -75.356  11.886  1.00 16.98  ? 238 THR B OG1 1 
ATOM   2343  C  CG2 . THR B 1 111 ? 18.936  -74.837  14.285  1.00 16.22  ? 238 THR B CG2 1 
ATOM   2344  N  N   . ASP B 1 112 ? 21.161  -76.916  12.658  1.00 19.09  ? 239 ASP B N   1 
ATOM   2345  C  CA  . ASP B 1 112 ? 22.612  -77.142  12.650  1.00 18.40  ? 239 ASP B CA  1 
ATOM   2346  C  C   . ASP B 1 112 ? 23.485  -75.891  12.518  1.00 18.52  ? 239 ASP B C   1 
ATOM   2347  O  O   . ASP B 1 112 ? 24.694  -76.000  12.283  1.00 18.32  ? 239 ASP B O   1 
ATOM   2348  C  CB  . ASP B 1 112 ? 22.957  -78.120  11.532  1.00 18.49  ? 239 ASP B CB  1 
ATOM   2349  C  CG  . ASP B 1 112 ? 22.914  -77.481  10.127  1.00 18.71  ? 239 ASP B CG  1 
ATOM   2350  O  OD1 . ASP B 1 112 ? 22.479  -76.320  9.968   1.00 19.26  ? 239 ASP B OD1 1 
ATOM   2351  O  OD2 . ASP B 1 112 ? 23.307  -78.172  9.167   1.00 20.04  ? 239 ASP B OD2 1 
ATOM   2352  N  N   . GLY B 1 113 ? 22.882  -74.716  12.675  1.00 18.98  ? 240 GLY B N   1 
ATOM   2353  C  CA  . GLY B 1 113 ? 23.573  -73.459  12.413  1.00 19.91  ? 240 GLY B CA  1 
ATOM   2354  C  C   . GLY B 1 113 ? 22.637  -72.358  11.936  1.00 21.35  ? 240 GLY B C   1 
ATOM   2355  O  O   . GLY B 1 113 ? 21.434  -72.372  12.231  1.00 20.46  ? 240 GLY B O   1 
ATOM   2356  N  N   . GLU B 1 114 ? 23.192  -71.400  11.195  1.00 22.84  ? 241 GLU B N   1 
ATOM   2357  C  CA  . GLU B 1 114 ? 22.455  -70.188  10.824  1.00 24.03  ? 241 GLU B CA  1 
ATOM   2358  C  C   . GLU B 1 114 ? 21.480  -70.434  9.670   1.00 22.79  ? 241 GLU B C   1 
ATOM   2359  O  O   . GLU B 1 114 ? 21.528  -71.478  9.013   1.00 23.71  ? 241 GLU B O   1 
ATOM   2360  C  CB  . GLU B 1 114 ? 23.415  -69.017  10.531  1.00 25.68  ? 241 GLU B CB  1 
ATOM   2361  C  CG  . GLU B 1 114 ? 24.169  -69.048  9.187   1.00 27.32  ? 241 GLU B CG  1 
ATOM   2362  C  CD  . GLU B 1 114 ? 25.546  -69.696  9.256   1.00 28.56  ? 241 GLU B CD  1 
ATOM   2363  O  OE1 . GLU B 1 114 ? 25.746  -70.635  10.067  1.00 28.22  ? 241 GLU B OE1 1 
ATOM   2364  O  OE2 . GLU B 1 114 ? 26.429  -69.266  8.470   1.00 30.24  ? 241 GLU B OE2 1 
ATOM   2365  N  N   . ALA B 1 115 ? 20.597  -69.465  9.444   1.00 20.19  ? 242 ALA B N   1 
ATOM   2366  C  CA  . ALA B 1 115 ? 19.566  -69.567  8.421   1.00 19.22  ? 242 ALA B CA  1 
ATOM   2367  C  C   . ALA B 1 115 ? 20.021  -68.969  7.097   1.00 18.32  ? 242 ALA B C   1 
ATOM   2368  O  O   . ALA B 1 115 ? 20.917  -68.133  7.054   1.00 14.76  ? 242 ALA B O   1 
ATOM   2369  C  CB  . ALA B 1 115 ? 18.283  -68.886  8.893   1.00 18.63  ? 242 ALA B CB  1 
ATOM   2370  N  N   . THR B 1 116 ? 19.385  -69.424  6.023   1.00 18.85  ? 243 THR B N   1 
ATOM   2371  C  CA  . THR B 1 116 ? 19.550  -68.851  4.698   1.00 20.95  ? 243 THR B CA  1 
ATOM   2372  C  C   . THR B 1 116 ? 18.872  -67.491  4.627   1.00 21.14  ? 243 THR B C   1 
ATOM   2373  O  O   . THR B 1 116 ? 19.382  -66.571  3.994   1.00 23.28  ? 243 THR B O   1 
ATOM   2374  C  CB  . THR B 1 116 ? 18.890  -69.734  3.618   1.00 21.71  ? 243 THR B CB  1 
ATOM   2375  O  OG1 . THR B 1 116 ? 19.266  -71.102  3.810   1.00 22.66  ? 243 THR B OG1 1 
ATOM   2376  C  CG2 . THR B 1 116 ? 19.286  -69.269  2.214   1.00 21.14  ? 243 THR B CG2 1 
ATOM   2377  N  N   . ASP B 1 117 ? 17.717  -67.383  5.277   1.00 20.16  ? 244 ASP B N   1 
ATOM   2378  C  CA  . ASP B 1 117 ? 16.899  -66.179  5.230   1.00 20.42  ? 244 ASP B CA  1 
ATOM   2379  C  C   . ASP B 1 117 ? 17.127  -65.319  6.474   1.00 20.22  ? 244 ASP B C   1 
ATOM   2380  O  O   . ASP B 1 117 ? 17.991  -65.608  7.294   1.00 20.61  ? 244 ASP B O   1 
ATOM   2381  C  CB  . ASP B 1 117 ? 15.406  -66.550  5.064   1.00 19.66  ? 244 ASP B CB  1 
ATOM   2382  C  CG  . ASP B 1 117 ? 14.820  -67.279  6.280   1.00 19.33  ? 244 ASP B CG  1 
ATOM   2383  O  OD1 . ASP B 1 117 ? 15.576  -67.763  7.151   1.00 17.19  ? 244 ASP B OD1 1 
ATOM   2384  O  OD2 . ASP B 1 117 ? 13.578  -67.382  6.354   1.00 20.31  ? 244 ASP B OD2 1 
ATOM   2385  N  N   . SER B 1 118 ? 16.338  -64.266  6.604   1.00 19.87  ? 245 SER B N   1 
ATOM   2386  C  CA  . SER B 1 118 ? 16.445  -63.359  7.730   1.00 20.43  ? 245 SER B CA  1 
ATOM   2387  C  C   . SER B 1 118 ? 15.097  -62.698  7.966   1.00 20.94  ? 245 SER B C   1 
ATOM   2388  O  O   . SER B 1 118 ? 14.133  -62.957  7.243   1.00 21.14  ? 245 SER B O   1 
ATOM   2389  C  CB  . SER B 1 118 ? 17.492  -62.294  7.424   1.00 20.88  ? 245 SER B CB  1 
ATOM   2390  O  OG  . SER B 1 118 ? 17.193  -61.653  6.193   1.00 20.69  ? 245 SER B OG  1 
ATOM   2391  N  N   . GLY B 1 119 ? 15.037  -61.844  8.980   1.00 21.31  ? 246 GLY B N   1 
ATOM   2392  C  CA  . GLY B 1 119 ? 13.846  -61.053  9.242   1.00 22.20  ? 246 GLY B CA  1 
ATOM   2393  C  C   . GLY B 1 119 ? 13.595  -60.895  10.725  1.00 23.18  ? 246 GLY B C   1 
ATOM   2394  O  O   . GLY B 1 119 ? 14.470  -60.422  11.465  1.00 24.62  ? 246 GLY B O   1 
ATOM   2395  N  N   . ASN B 1 120 ? 12.392  -61.269  11.155  1.00 22.24  ? 247 ASN B N   1 
ATOM   2396  C  CA  . ASN B 1 120 ? 12.030  -61.229  12.568  1.00 21.78  ? 247 ASN B CA  1 
ATOM   2397  C  C   . ASN B 1 120 ? 11.039  -62.330  12.908  1.00 20.39  ? 247 ASN B C   1 
ATOM   2398  O  O   . ASN B 1 120 ? 10.293  -62.804  12.049  1.00 18.80  ? 247 ASN B O   1 
ATOM   2399  C  CB  . ASN B 1 120 ? 11.458  -59.865  12.960  1.00 20.98  ? 247 ASN B CB  1 
ATOM   2400  C  CG  . ASN B 1 120 ? 10.039  -59.666  12.475  1.00 22.04  ? 247 ASN B CG  1 
ATOM   2401  O  OD1 . ASN B 1 120 ? 9.079   -60.151  13.082  1.00 21.99  ? 247 ASN B OD1 1 
ATOM   2402  N  ND2 . ASN B 1 120 ? 9.897   -58.942  11.376  1.00 22.62  ? 247 ASN B ND2 1 
ATOM   2403  N  N   . ILE B 1 121 ? 11.049  -62.718  14.178  1.00 19.91  ? 248 ILE B N   1 
ATOM   2404  C  CA  . ILE B 1 121 ? 10.153  -63.735  14.692  1.00 20.01  ? 248 ILE B CA  1 
ATOM   2405  C  C   . ILE B 1 121 ? 9.309   -63.153  15.832  1.00 18.92  ? 248 ILE B C   1 
ATOM   2406  O  O   . ILE B 1 121 ? 9.039   -63.830  16.833  1.00 17.34  ? 248 ILE B O   1 
ATOM   2407  C  CB  . ILE B 1 121 ? 10.948  -64.989  15.129  1.00 21.64  ? 248 ILE B CB  1 
ATOM   2408  C  CG1 . ILE B 1 121 ? 12.023  -64.628  16.168  1.00 22.05  ? 248 ILE B CG1 1 
ATOM   2409  C  CG2 . ILE B 1 121 ? 11.596  -65.646  13.897  1.00 21.09  ? 248 ILE B CG2 1 
ATOM   2410  C  CD1 . ILE B 1 121 ? 12.352  -65.759  17.124  1.00 22.66  ? 248 ILE B CD1 1 
ATOM   2411  N  N   . ASP B 1 122 ? 8.889   -61.896  15.660  1.00 17.70  ? 249 ASP B N   1 
ATOM   2412  C  CA  . ASP B 1 122 ? 8.005   -61.233  16.615  1.00 18.33  ? 249 ASP B CA  1 
ATOM   2413  C  C   . ASP B 1 122 ? 6.748   -62.063  16.889  1.00 17.20  ? 249 ASP B C   1 
ATOM   2414  O  O   . ASP B 1 122 ? 6.278   -62.121  18.016  1.00 17.20  ? 249 ASP B O   1 
ATOM   2415  C  CB  . ASP B 1 122 ? 7.568   -59.853  16.103  1.00 20.02  ? 249 ASP B CB  1 
ATOM   2416  C  CG  . ASP B 1 122 ? 8.697   -58.818  16.103  1.00 21.46  ? 249 ASP B CG  1 
ATOM   2417  O  OD1 . ASP B 1 122 ? 9.840   -59.118  16.518  1.00 22.45  ? 249 ASP B OD1 1 
ATOM   2418  O  OD2 . ASP B 1 122 ? 8.423   -57.681  15.672  1.00 22.07  ? 249 ASP B OD2 1 
ATOM   2419  N  N   . ALA B 1 123 ? 6.200   -62.701  15.857  1.00 16.02  ? 250 ALA B N   1 
ATOM   2420  C  CA  . ALA B 1 123 ? 4.924   -63.416  15.997  1.00 15.85  ? 250 ALA B CA  1 
ATOM   2421  C  C   . ALA B 1 123 ? 5.030   -64.622  16.919  1.00 16.25  ? 250 ALA B C   1 
ATOM   2422  O  O   . ALA B 1 123 ? 4.025   -65.078  17.455  1.00 17.53  ? 250 ALA B O   1 
ATOM   2423  C  CB  . ALA B 1 123 ? 4.404   -63.838  14.648  1.00 15.49  ? 250 ALA B CB  1 
ATOM   2424  N  N   . ALA B 1 124 ? 6.250   -65.128  17.099  1.00 16.87  ? 251 ALA B N   1 
ATOM   2425  C  CA  . ALA B 1 124 ? 6.530   -66.242  17.997  1.00 16.63  ? 251 ALA B CA  1 
ATOM   2426  C  C   . ALA B 1 124 ? 6.977   -65.822  19.410  1.00 17.69  ? 251 ALA B C   1 
ATOM   2427  O  O   . ALA B 1 124 ? 7.413   -66.667  20.193  1.00 17.67  ? 251 ALA B O   1 
ATOM   2428  C  CB  . ALA B 1 124 ? 7.602   -67.145  17.366  1.00 14.85  ? 251 ALA B CB  1 
ATOM   2429  N  N   . LYS B 1 125 ? 6.880   -64.547  19.768  1.00 20.13  ? 252 LYS B N   1 
ATOM   2430  C  CA  . LYS B 1 125 ? 7.443   -64.136  21.061  1.00 23.24  ? 252 LYS B CA  1 
ATOM   2431  C  C   . LYS B 1 125 ? 6.705   -64.676  22.289  1.00 22.28  ? 252 LYS B C   1 
ATOM   2432  O  O   . LYS B 1 125 ? 7.319   -64.840  23.337  1.00 21.88  ? 252 LYS B O   1 
ATOM   2433  C  CB  . LYS B 1 125 ? 7.615   -62.614  21.150  1.00 27.19  ? 252 LYS B CB  1 
ATOM   2434  C  CG  . LYS B 1 125 ? 8.738   -62.026  20.240  1.00 29.98  ? 252 LYS B CG  1 
ATOM   2435  C  CD  . LYS B 1 125 ? 9.906   -62.999  19.972  1.00 31.72  ? 252 LYS B CD  1 
ATOM   2436  C  CE  . LYS B 1 125 ? 11.096  -62.286  19.344  1.00 33.51  ? 252 LYS B CE  1 
ATOM   2437  N  NZ  . LYS B 1 125 ? 12.294  -63.179  19.224  1.00 35.27  ? 252 LYS B NZ  1 
ATOM   2438  N  N   . ASP B 1 126 ? 5.420   -64.995  22.158  1.00 22.09  ? 253 ASP B N   1 
ATOM   2439  C  CA  . ASP B 1 126 ? 4.666   -65.616  23.260  1.00 21.74  ? 253 ASP B CA  1 
ATOM   2440  C  C   . ASP B 1 126 ? 4.908   -67.127  23.374  1.00 20.86  ? 253 ASP B C   1 
ATOM   2441  O  O   . ASP B 1 126 ? 4.320   -67.793  24.230  1.00 21.25  ? 253 ASP B O   1 
ATOM   2442  C  CB  . ASP B 1 126 ? 3.163   -65.359  23.101  1.00 22.58  ? 253 ASP B CB  1 
ATOM   2443  C  CG  . ASP B 1 126 ? 2.785   -63.888  23.275  1.00 24.65  ? 253 ASP B CG  1 
ATOM   2444  O  OD1 . ASP B 1 126 ? 3.665   -63.057  23.602  1.00 25.37  ? 253 ASP B OD1 1 
ATOM   2445  O  OD2 . ASP B 1 126 ? 1.584   -63.565  23.111  1.00 26.28  ? 253 ASP B OD2 1 
ATOM   2446  N  N   . ILE B 1 127 ? 5.750   -67.674  22.502  1.00 19.30  ? 254 ILE B N   1 
ATOM   2447  C  CA  . ILE B 1 127 ? 6.052   -69.097  22.497  1.00 17.95  ? 254 ILE B CA  1 
ATOM   2448  C  C   . ILE B 1 127 ? 7.391   -69.308  23.190  1.00 18.45  ? 254 ILE B C   1 
ATOM   2449  O  O   . ILE B 1 127 ? 8.313   -68.503  23.012  1.00 19.32  ? 254 ILE B O   1 
ATOM   2450  C  CB  . ILE B 1 127 ? 6.114   -69.629  21.052  1.00 18.72  ? 254 ILE B CB  1 
ATOM   2451  C  CG1 . ILE B 1 127 ? 4.783   -69.350  20.336  1.00 18.10  ? 254 ILE B CG1 1 
ATOM   2452  C  CG2 . ILE B 1 127 ? 6.456   -71.141  21.027  1.00 18.59  ? 254 ILE B CG2 1 
ATOM   2453  C  CD1 . ILE B 1 127 ? 4.786   -69.713  18.860  1.00 18.20  ? 254 ILE B CD1 1 
ATOM   2454  N  N   . ILE B 1 128 ? 7.499   -70.368  23.994  1.00 17.36  ? 255 ILE B N   1 
ATOM   2455  C  CA  . ILE B 1 128 ? 8.765   -70.694  24.656  1.00 15.19  ? 255 ILE B CA  1 
ATOM   2456  C  C   . ILE B 1 128 ? 9.604   -71.492  23.672  1.00 15.26  ? 255 ILE B C   1 
ATOM   2457  O  O   . ILE B 1 128 ? 9.211   -72.581  23.243  1.00 15.32  ? 255 ILE B O   1 
ATOM   2458  C  CB  . ILE B 1 128 ? 8.570   -71.452  25.986  1.00 13.62  ? 255 ILE B CB  1 
ATOM   2459  C  CG1 . ILE B 1 128 ? 7.757   -70.598  26.961  1.00 13.74  ? 255 ILE B CG1 1 
ATOM   2460  C  CG2 . ILE B 1 128 ? 9.915   -71.764  26.616  1.00 12.88  ? 255 ILE B CG2 1 
ATOM   2461  C  CD1 . ILE B 1 128 ? 7.376   -71.294  28.270  1.00 14.08  ? 255 ILE B CD1 1 
ATOM   2462  N  N   . ARG B 1 129 ? 10.759  -70.941  23.312  1.00 16.26  ? 256 ARG B N   1 
ATOM   2463  C  CA  . ARG B 1 129 ? 11.572  -71.478  22.221  1.00 17.08  ? 256 ARG B CA  1 
ATOM   2464  C  C   . ARG B 1 129 ? 12.907  -72.024  22.717  1.00 16.35  ? 256 ARG B C   1 
ATOM   2465  O  O   . ARG B 1 129 ? 13.725  -71.302  23.292  1.00 15.92  ? 256 ARG B O   1 
ATOM   2466  C  CB  . ARG B 1 129 ? 11.767  -70.408  21.134  1.00 18.54  ? 256 ARG B CB  1 
ATOM   2467  C  CG  . ARG B 1 129 ? 10.423  -69.856  20.623  1.00 20.65  ? 256 ARG B CG  1 
ATOM   2468  C  CD  . ARG B 1 129 ? 10.495  -68.587  19.773  1.00 21.91  ? 256 ARG B CD  1 
ATOM   2469  N  NE  . ARG B 1 129 ? 11.534  -67.646  20.190  1.00 23.96  ? 256 ARG B NE  1 
ATOM   2470  C  CZ  . ARG B 1 129 ? 11.404  -66.694  21.109  1.00 22.05  ? 256 ARG B CZ  1 
ATOM   2471  N  NH1 . ARG B 1 129 ? 10.264  -66.470  21.735  1.00 21.67  ? 256 ARG B NH1 1 
ATOM   2472  N  NH2 . ARG B 1 129 ? 12.448  -65.938  21.374  1.00 23.07  ? 256 ARG B NH2 1 
ATOM   2473  N  N   . TYR B 1 130 ? 13.091  -73.324  22.506  1.00 17.37  ? 257 TYR B N   1 
ATOM   2474  C  CA  . TYR B 1 130 ? 14.353  -74.009  22.749  1.00 16.53  ? 257 TYR B CA  1 
ATOM   2475  C  C   . TYR B 1 130 ? 15.048  -74.228  21.409  1.00 17.80  ? 257 TYR B C   1 
ATOM   2476  O  O   . TYR B 1 130 ? 14.391  -74.513  20.409  1.00 19.85  ? 257 TYR B O   1 
ATOM   2477  C  CB  . TYR B 1 130 ? 14.092  -75.369  23.384  1.00 15.54  ? 257 TYR B CB  1 
ATOM   2478  C  CG  . TYR B 1 130 ? 13.552  -75.340  24.797  1.00 13.73  ? 257 TYR B CG  1 
ATOM   2479  C  CD1 . TYR B 1 130 ? 14.367  -75.672  25.879  1.00 13.65  ? 257 TYR B CD1 1 
ATOM   2480  C  CD2 . TYR B 1 130 ? 12.231  -75.004  25.055  1.00 12.66  ? 257 TYR B CD2 1 
ATOM   2481  C  CE1 . TYR B 1 130 ? 13.880  -75.660  27.176  1.00 13.27  ? 257 TYR B CE1 1 
ATOM   2482  C  CE2 . TYR B 1 130 ? 11.730  -74.990  26.359  1.00 12.43  ? 257 TYR B CE2 1 
ATOM   2483  C  CZ  . TYR B 1 130 ? 12.559  -75.324  27.419  1.00 13.30  ? 257 TYR B CZ  1 
ATOM   2484  O  OH  . TYR B 1 130 ? 12.084  -75.315  28.733  1.00 13.66  ? 257 TYR B OH  1 
ATOM   2485  N  N   . ILE B 1 131 ? 16.369  -74.097  21.388  1.00 18.50  ? 258 ILE B N   1 
ATOM   2486  C  CA  . ILE B 1 131 ? 17.154  -74.416  20.209  1.00 19.70  ? 258 ILE B CA  1 
ATOM   2487  C  C   . ILE B 1 131 ? 18.027  -75.624  20.523  1.00 20.22  ? 258 ILE B C   1 
ATOM   2488  O  O   . ILE B 1 131 ? 18.818  -75.593  21.472  1.00 20.53  ? 258 ILE B O   1 
ATOM   2489  C  CB  . ILE B 1 131 ? 18.060  -73.253  19.782  1.00 20.74  ? 258 ILE B CB  1 
ATOM   2490  C  CG1 . ILE B 1 131 ? 17.271  -71.943  19.747  1.00 22.50  ? 258 ILE B CG1 1 
ATOM   2491  C  CG2 . ILE B 1 131 ? 18.694  -73.552  18.416  1.00 20.05  ? 258 ILE B CG2 1 
ATOM   2492  C  CD1 . ILE B 1 131 ? 16.012  -71.983  18.887  1.00 24.58  ? 258 ILE B CD1 1 
ATOM   2493  N  N   . ILE B 1 132 ? 17.868  -76.684  19.736  1.00 19.64  ? 259 ILE B N   1 
ATOM   2494  C  CA  . ILE B 1 132 ? 18.588  -77.933  19.949  1.00 19.33  ? 259 ILE B CA  1 
ATOM   2495  C  C   . ILE B 1 132 ? 19.534  -78.132  18.778  1.00 17.89  ? 259 ILE B C   1 
ATOM   2496  O  O   . ILE B 1 132 ? 19.110  -78.367  17.642  1.00 18.86  ? 259 ILE B O   1 
ATOM   2497  C  CB  . ILE B 1 132 ? 17.618  -79.142  20.073  1.00 20.76  ? 259 ILE B CB  1 
ATOM   2498  C  CG1 . ILE B 1 132 ? 16.454  -78.833  21.037  1.00 21.62  ? 259 ILE B CG1 1 
ATOM   2499  C  CG2 . ILE B 1 132 ? 18.350  -80.397  20.510  1.00 20.40  ? 259 ILE B CG2 1 
ATOM   2500  C  CD1 . ILE B 1 132 ? 16.841  -78.414  22.405  1.00 20.61  ? 259 ILE B CD1 1 
ATOM   2501  N  N   . GLY B 1 133 ? 20.824  -78.015  19.058  1.00 18.05  ? 260 GLY B N   1 
ATOM   2502  C  CA  . GLY B 1 133 ? 21.845  -78.079  18.025  1.00 17.27  ? 260 GLY B CA  1 
ATOM   2503  C  C   . GLY B 1 133 ? 22.362  -79.467  17.716  1.00 17.14  ? 260 GLY B C   1 
ATOM   2504  O  O   . GLY B 1 133 ? 22.454  -80.324  18.598  1.00 17.49  ? 260 GLY B O   1 
ATOM   2505  N  N   . ILE B 1 134 ? 22.719  -79.673  16.451  1.00 16.83  ? 261 ILE B N   1 
ATOM   2506  C  CA  . ILE B 1 134 ? 23.495  -80.833  16.037  1.00 15.67  ? 261 ILE B CA  1 
ATOM   2507  C  C   . ILE B 1 134 ? 24.446  -80.371  14.937  1.00 15.88  ? 261 ILE B C   1 
ATOM   2508  O  O   . ILE B 1 134 ? 24.191  -79.373  14.268  1.00 15.68  ? 261 ILE B O   1 
ATOM   2509  C  CB  . ILE B 1 134 ? 22.568  -82.025  15.602  1.00 16.71  ? 261 ILE B CB  1 
ATOM   2510  C  CG1 . ILE B 1 134 ? 23.382  -83.296  15.361  1.00 16.58  ? 261 ILE B CG1 1 
ATOM   2511  C  CG2 . ILE B 1 134 ? 21.709  -81.691  14.361  1.00 13.73  ? 261 ILE B CG2 1 
ATOM   2512  C  CD1 . ILE B 1 134 ? 22.520  -84.529  15.185  1.00 15.73  ? 261 ILE B CD1 1 
ATOM   2513  N  N   . GLY B 1 135 ? 25.564  -81.065  14.781  1.00 16.98  ? 262 GLY B N   1 
ATOM   2514  C  CA  . GLY B 1 135 ? 26.512  -80.755  13.715  1.00 17.64  ? 262 GLY B CA  1 
ATOM   2515  C  C   . GLY B 1 135 ? 27.748  -80.017  14.193  1.00 18.66  ? 262 GLY B C   1 
ATOM   2516  O  O   . GLY B 1 135 ? 27.771  -79.455  15.283  1.00 19.12  ? 262 GLY B O   1 
ATOM   2517  N  N   . LYS B 1 136 ? 28.779  -80.029  13.359  1.00 19.80  ? 263 LYS B N   1 
ATOM   2518  C  CA  . LYS B 1 136 ? 30.048  -79.414  13.690  1.00 21.88  ? 263 LYS B CA  1 
ATOM   2519  C  C   . LYS B 1 136 ? 30.041  -77.891  13.468  1.00 21.38  ? 263 LYS B C   1 
ATOM   2520  O  O   . LYS B 1 136 ? 30.954  -77.202  13.909  1.00 22.19  ? 263 LYS B O   1 
ATOM   2521  C  CB  . LYS B 1 136 ? 31.160  -80.050  12.851  1.00 24.16  ? 263 LYS B CB  1 
ATOM   2522  C  CG  . LYS B 1 136 ? 31.467  -81.522  13.182  1.00 25.57  ? 263 LYS B CG  1 
ATOM   2523  C  CD  . LYS B 1 136 ? 32.575  -81.686  14.231  1.00 26.45  ? 263 LYS B CD  1 
ATOM   2524  C  CE  . LYS B 1 136 ? 33.920  -81.135  13.732  1.00 27.49  ? 263 LYS B CE  1 
ATOM   2525  N  NZ  . LYS B 1 136 ? 35.107  -81.756  14.386  1.00 27.72  ? 263 LYS B NZ  1 
ATOM   2526  N  N   . HIS B 1 137 ? 29.024  -77.370  12.783  1.00 19.49  ? 264 HIS B N   1 
ATOM   2527  C  CA  . HIS B 1 137 ? 28.949  -75.945  12.473  1.00 18.77  ? 264 HIS B CA  1 
ATOM   2528  C  C   . HIS B 1 137 ? 27.883  -75.221  13.306  1.00 19.86  ? 264 HIS B C   1 
ATOM   2529  O  O   . HIS B 1 137 ? 27.600  -74.049  13.069  1.00 21.16  ? 264 HIS B O   1 
ATOM   2530  C  CB  . HIS B 1 137 ? 28.641  -75.766  10.976  1.00 18.00  ? 264 HIS B CB  1 
ATOM   2531  C  CG  . HIS B 1 137 ? 29.654  -76.390  10.060  1.00 17.75  ? 264 HIS B CG  1 
ATOM   2532  N  ND1 . HIS B 1 137 ? 30.750  -75.703  9.577   1.00 17.26  ? 264 HIS B ND1 1 
ATOM   2533  C  CD2 . HIS B 1 137 ? 29.727  -77.635  9.527   1.00 17.16  ? 264 HIS B CD2 1 
ATOM   2534  C  CE1 . HIS B 1 137 ? 31.455  -76.499  8.789   1.00 16.25  ? 264 HIS B CE1 1 
ATOM   2535  N  NE2 . HIS B 1 137 ? 30.858  -77.677  8.745   1.00 16.40  ? 264 HIS B NE2 1 
ATOM   2536  N  N   . PHE B 1 138 ? 27.281  -75.918  14.268  1.00 21.33  ? 265 PHE B N   1 
ATOM   2537  C  CA  . PHE B 1 138 ? 26.154  -75.370  15.021  1.00 22.17  ? 265 PHE B CA  1 
ATOM   2538  C  C   . PHE B 1 138 ? 26.529  -74.170  15.903  1.00 23.24  ? 265 PHE B C   1 
ATOM   2539  O  O   . PHE B 1 138 ? 25.780  -73.201  15.986  1.00 22.84  ? 265 PHE B O   1 
ATOM   2540  C  CB  . PHE B 1 138 ? 25.477  -76.459  15.854  1.00 22.50  ? 265 PHE B CB  1 
ATOM   2541  C  CG  . PHE B 1 138 ? 24.495  -75.924  16.848  1.00 22.74  ? 265 PHE B CG  1 
ATOM   2542  C  CD1 . PHE B 1 138 ? 23.277  -75.420  16.429  1.00 23.96  ? 265 PHE B CD1 1 
ATOM   2543  C  CD2 . PHE B 1 138 ? 24.800  -75.894  18.200  1.00 24.11  ? 265 PHE B CD2 1 
ATOM   2544  C  CE1 . PHE B 1 138 ? 22.364  -74.912  17.337  1.00 23.65  ? 265 PHE B CE1 1 
ATOM   2545  C  CE2 . PHE B 1 138 ? 23.897  -75.379  19.122  1.00 25.07  ? 265 PHE B CE2 1 
ATOM   2546  C  CZ  . PHE B 1 138 ? 22.676  -74.888  18.686  1.00 25.05  ? 265 PHE B CZ  1 
ATOM   2547  N  N   . GLN B 1 139 ? 27.668  -74.217  16.569  1.00 25.60  ? 266 GLN B N   1 
ATOM   2548  C  CA  . GLN B 1 139 ? 28.083  -73.049  17.336  1.00 29.29  ? 266 GLN B CA  1 
ATOM   2549  C  C   . GLN B 1 139 ? 29.402  -72.487  16.851  1.00 28.85  ? 266 GLN B C   1 
ATOM   2550  O  O   . GLN B 1 139 ? 30.483  -72.936  17.221  1.00 29.51  ? 266 GLN B O   1 
ATOM   2551  C  CB  . GLN B 1 139 ? 28.064  -73.317  18.839  1.00 32.03  ? 266 GLN B CB  1 
ATOM   2552  C  CG  . GLN B 1 139 ? 26.694  -72.975  19.445  1.00 34.73  ? 266 GLN B CG  1 
ATOM   2553  C  CD  . GLN B 1 139 ? 26.656  -73.156  20.937  1.00 37.38  ? 266 GLN B CD  1 
ATOM   2554  O  OE1 . GLN B 1 139 ? 27.188  -74.134  21.466  1.00 39.56  ? 266 GLN B OE1 1 
ATOM   2555  N  NE2 . GLN B 1 139 ? 26.029  -72.208  21.637  1.00 38.61  ? 266 GLN B NE2 1 
ATOM   2556  N  N   . THR B 1 140 ? 29.264  -71.503  15.977  1.00 28.94  ? 267 THR B N   1 
ATOM   2557  C  CA  . THR B 1 140 ? 30.370  -70.711  15.483  1.00 28.95  ? 267 THR B CA  1 
ATOM   2558  C  C   . THR B 1 140 ? 29.969  -69.242  15.708  1.00 30.08  ? 267 THR B C   1 
ATOM   2559  O  O   . THR B 1 140 ? 28.902  -68.964  16.259  1.00 31.43  ? 267 THR B O   1 
ATOM   2560  C  CB  . THR B 1 140 ? 30.631  -71.036  13.989  1.00 27.41  ? 267 THR B CB  1 
ATOM   2561  O  OG1 . THR B 1 140 ? 29.528  -70.592  13.192  1.00 25.33  ? 267 THR B OG1 1 
ATOM   2562  C  CG2 . THR B 1 140 ? 30.807  -72.550  13.787  1.00 26.43  ? 267 THR B CG2 1 
ATOM   2563  N  N   . LYS B 1 141 ? 30.809  -68.300  15.306  1.00 30.66  ? 268 LYS B N   1 
ATOM   2564  C  CA  . LYS B 1 141 ? 30.417  -66.894  15.383  1.00 30.45  ? 268 LYS B CA  1 
ATOM   2565  C  C   . LYS B 1 141 ? 29.458  -66.577  14.225  1.00 29.22  ? 268 LYS B C   1 
ATOM   2566  O  O   . LYS B 1 141 ? 28.606  -65.697  14.342  1.00 29.41  ? 268 LYS B O   1 
ATOM   2567  C  CB  . LYS B 1 141 ? 31.648  -65.977  15.388  1.00 30.69  ? 268 LYS B CB  1 
ATOM   2568  C  CG  . LYS B 1 141 ? 31.499  -64.724  16.264  1.00 30.37  ? 268 LYS B CG  1 
ATOM   2569  C  CD  . LYS B 1 141 ? 32.807  -64.357  16.968  1.00 30.17  ? 268 LYS B CD  1 
ATOM   2570  C  CE  . LYS B 1 141 ? 33.937  -64.044  15.986  1.00 30.07  ? 268 LYS B CE  1 
ATOM   2571  N  NZ  . LYS B 1 141 ? 35.220  -63.737  16.685  1.00 29.69  ? 268 LYS B NZ  1 
ATOM   2572  N  N   . GLU B 1 142 ? 29.584  -67.315  13.123  1.00 28.01  ? 269 GLU B N   1 
ATOM   2573  C  CA  . GLU B 1 142 ? 28.609  -67.233  12.035  1.00 28.03  ? 269 GLU B CA  1 
ATOM   2574  C  C   . GLU B 1 142 ? 27.156  -67.465  12.519  1.00 27.32  ? 269 GLU B C   1 
ATOM   2575  O  O   . GLU B 1 142 ? 26.235  -66.850  11.987  1.00 28.65  ? 269 GLU B O   1 
ATOM   2576  C  CB  . GLU B 1 142 ? 28.953  -68.217  10.888  1.00 28.10  ? 269 GLU B CB  1 
ATOM   2577  C  CG  . GLU B 1 142 ? 29.985  -67.710  9.836   1.00 28.16  ? 269 GLU B CG  1 
ATOM   2578  C  CD  . GLU B 1 142 ? 31.438  -68.168  10.081  1.00 28.27  ? 269 GLU B CD  1 
ATOM   2579  O  OE1 . GLU B 1 142 ? 31.678  -68.963  11.013  1.00 28.63  ? 269 GLU B OE1 1 
ATOM   2580  O  OE2 . GLU B 1 142 ? 32.348  -67.736  9.325   1.00 26.78  ? 269 GLU B OE2 1 
ATOM   2581  N  N   . SER B 1 143 ? 26.952  -68.331  13.517  1.00 25.44  ? 270 SER B N   1 
ATOM   2582  C  CA  . SER B 1 143 ? 25.596  -68.750  13.919  1.00 25.10  ? 270 SER B CA  1 
ATOM   2583  C  C   . SER B 1 143 ? 25.163  -68.317  15.321  1.00 25.50  ? 270 SER B C   1 
ATOM   2584  O  O   . SER B 1 143 ? 23.962  -68.291  15.617  1.00 24.20  ? 270 SER B O   1 
ATOM   2585  C  CB  . SER B 1 143 ? 25.466  -70.266  13.822  1.00 24.16  ? 270 SER B CB  1 
ATOM   2586  O  OG  . SER B 1 143 ? 25.986  -70.880  14.980  1.00 23.88  ? 270 SER B OG  1 
ATOM   2587  N  N   . GLN B 1 144 ? 26.137  -68.011  16.175  1.00 26.54  ? 271 GLN B N   1 
ATOM   2588  C  CA  . GLN B 1 144 ? 25.903  -67.495  17.528  1.00 27.43  ? 271 GLN B CA  1 
ATOM   2589  C  C   . GLN B 1 144 ? 24.759  -66.485  17.567  1.00 27.06  ? 271 GLN B C   1 
ATOM   2590  O  O   . GLN B 1 144 ? 23.856  -66.580  18.395  1.00 27.88  ? 271 GLN B O   1 
ATOM   2591  C  CB  . GLN B 1 144 ? 27.195  -66.837  18.033  1.00 28.67  ? 271 GLN B CB  1 
ATOM   2592  C  CG  . GLN B 1 144 ? 27.122  -66.154  19.405  1.00 29.90  ? 271 GLN B CG  1 
ATOM   2593  C  CD  . GLN B 1 144 ? 28.456  -65.537  19.815  1.00 30.71  ? 271 GLN B CD  1 
ATOM   2594  O  OE1 . GLN B 1 144 ? 29.295  -65.212  18.969  1.00 31.34  ? 271 GLN B OE1 1 
ATOM   2595  N  NE2 . GLN B 1 144 ? 28.655  -65.371  21.118  1.00 31.44  ? 271 GLN B NE2 1 
ATOM   2596  N  N   . GLU B 1 145 ? 24.810  -65.534  16.646  1.00 27.08  ? 272 GLU B N   1 
ATOM   2597  C  CA  . GLU B 1 145 ? 23.866  -64.425  16.579  1.00 27.60  ? 272 GLU B CA  1 
ATOM   2598  C  C   . GLU B 1 145 ? 22.454  -64.918  16.279  1.00 25.75  ? 272 GLU B C   1 
ATOM   2599  O  O   . GLU B 1 145 ? 21.509  -64.551  16.964  1.00 25.32  ? 272 GLU B O   1 
ATOM   2600  C  CB  . GLU B 1 145 ? 24.325  -63.448  15.487  1.00 29.83  ? 272 GLU B CB  1 
ATOM   2601  C  CG  . GLU B 1 145 ? 24.001  -61.986  15.718  1.00 31.22  ? 272 GLU B CG  1 
ATOM   2602  C  CD  . GLU B 1 145 ? 24.546  -61.104  14.603  1.00 33.04  ? 272 GLU B CD  1 
ATOM   2603  O  OE1 . GLU B 1 145 ? 24.752  -61.621  13.478  1.00 34.92  ? 272 GLU B OE1 1 
ATOM   2604  O  OE2 . GLU B 1 145 ? 24.773  -59.900  14.843  1.00 33.70  ? 272 GLU B OE2 1 
ATOM   2605  N  N   . THR B 1 146 ? 22.323  -65.755  15.255  1.00 25.23  ? 273 THR B N   1 
ATOM   2606  C  CA  . THR B 1 146 ? 21.030  -66.314  14.861  1.00 24.71  ? 273 THR B CA  1 
ATOM   2607  C  C   . THR B 1 146 ? 20.386  -67.169  15.957  1.00 23.04  ? 273 THR B C   1 
ATOM   2608  O  O   . THR B 1 146 ? 19.178  -67.071  16.211  1.00 21.01  ? 273 THR B O   1 
ATOM   2609  C  CB  . THR B 1 146 ? 21.169  -67.195  13.607  1.00 26.11  ? 273 THR B CB  1 
ATOM   2610  O  OG1 . THR B 1 146 ? 21.829  -66.457  12.571  1.00 27.33  ? 273 THR B OG1 1 
ATOM   2611  C  CG2 . THR B 1 146 ? 19.797  -67.654  13.115  1.00 25.40  ? 273 THR B CG2 1 
ATOM   2612  N  N   . LEU B 1 147 ? 21.197  -68.008  16.595  1.00 22.08  ? 274 LEU B N   1 
ATOM   2613  C  CA  . LEU B 1 147 ? 20.709  -68.914  17.635  1.00 22.16  ? 274 LEU B CA  1 
ATOM   2614  C  C   . LEU B 1 147 ? 20.207  -68.147  18.865  1.00 21.93  ? 274 LEU B C   1 
ATOM   2615  O  O   . LEU B 1 147 ? 19.184  -68.506  19.442  1.00 22.80  ? 274 LEU B O   1 
ATOM   2616  C  CB  . LEU B 1 147 ? 21.796  -69.921  18.035  1.00 22.26  ? 274 LEU B CB  1 
ATOM   2617  C  CG  . LEU B 1 147 ? 22.280  -70.910  16.959  1.00 21.65  ? 274 LEU B CG  1 
ATOM   2618  C  CD1 . LEU B 1 147 ? 23.340  -71.813  17.558  1.00 22.29  ? 274 LEU B CD1 1 
ATOM   2619  C  CD2 . LEU B 1 147 ? 21.159  -71.748  16.364  1.00 20.01  ? 274 LEU B CD2 1 
ATOM   2620  N  N   . HIS B 1 148 ? 20.915  -67.094  19.259  1.00 20.74  ? 275 HIS B N   1 
ATOM   2621  C  CA  A HIS B 1 148 ? 20.481  -66.213  20.347  0.50 20.59  ? 275 HIS B CA  1 
ATOM   2622  C  CA  B HIS B 1 148 ? 20.444  -66.282  20.370  0.50 20.86  ? 275 HIS B CA  1 
ATOM   2623  C  C   . HIS B 1 148 ? 19.136  -65.572  20.006  1.00 21.12  ? 275 HIS B C   1 
ATOM   2624  O  O   . HIS B 1 148 ? 18.245  -65.447  20.857  1.00 22.56  ? 275 HIS B O   1 
ATOM   2625  C  CB  A HIS B 1 148 ? 21.536  -65.121  20.601  0.50 19.69  ? 275 HIS B CB  1 
ATOM   2626  C  CB  B HIS B 1 148 ? 21.525  -65.310  20.855  0.50 20.32  ? 275 HIS B CB  1 
ATOM   2627  C  CG  A HIS B 1 148 ? 21.060  -63.995  21.470  0.50 19.10  ? 275 HIS B CG  1 
ATOM   2628  C  CG  B HIS B 1 148 ? 22.463  -65.919  21.853  0.50 20.24  ? 275 HIS B CG  1 
ATOM   2629  N  ND1 A HIS B 1 148 ? 21.249  -63.975  22.836  0.50 18.73  ? 275 HIS B ND1 1 
ATOM   2630  N  ND1 B HIS B 1 148 ? 22.795  -65.302  23.041  0.50 20.05  ? 275 HIS B ND1 1 
ATOM   2631  C  CD2 A HIS B 1 148 ? 20.411  -62.845  21.164  0.50 18.52  ? 275 HIS B CD2 1 
ATOM   2632  C  CD2 B HIS B 1 148 ? 23.115  -67.107  21.851  0.50 19.88  ? 275 HIS B CD2 1 
ATOM   2633  C  CE1 A HIS B 1 148 ? 20.730  -62.867  23.334  0.50 18.59  ? 275 HIS B CE1 1 
ATOM   2634  C  CE1 B HIS B 1 148 ? 23.625  -66.075  23.718  0.50 20.15  ? 275 HIS B CE1 1 
ATOM   2635  N  NE2 A HIS B 1 148 ? 20.215  -62.165  22.340  0.50 18.54  ? 275 HIS B NE2 1 
ATOM   2636  N  NE2 B HIS B 1 148 ? 23.835  -67.177  23.019  0.50 19.88  ? 275 HIS B NE2 1 
ATOM   2637  N  N   . LYS B 1 149 ? 19.001  -65.148  18.752  1.00 19.95  ? 276 LYS B N   1 
ATOM   2638  C  CA  . LYS B 1 149 ? 17.768  -64.527  18.292  1.00 19.55  ? 276 LYS B CA  1 
ATOM   2639  C  C   . LYS B 1 149 ? 16.553  -65.476  18.410  1.00 18.83  ? 276 LYS B C   1 
ATOM   2640  O  O   . LYS B 1 149 ? 15.492  -65.079  18.882  1.00 18.13  ? 276 LYS B O   1 
ATOM   2641  C  CB  . LYS B 1 149 ? 17.941  -64.037  16.852  1.00 20.77  ? 276 LYS B CB  1 
ATOM   2642  C  CG  . LYS B 1 149 ? 16.949  -62.960  16.446  1.00 22.01  ? 276 LYS B CG  1 
ATOM   2643  C  CD  . LYS B 1 149 ? 17.296  -62.387  15.085  1.00 22.63  ? 276 LYS B CD  1 
ATOM   2644  C  CE  . LYS B 1 149 ? 16.415  -61.201  14.722  1.00 23.01  ? 276 LYS B CE  1 
ATOM   2645  N  NZ  . LYS B 1 149 ? 16.926  -60.514  13.497  1.00 23.13  ? 276 LYS B NZ  1 
ATOM   2646  N  N   . PHE B 1 150 ? 16.727  -66.731  18.002  1.00 18.68  ? 277 PHE B N   1 
ATOM   2647  C  CA  . PHE B 1 150 ? 15.638  -67.713  17.996  1.00 17.31  ? 277 PHE B CA  1 
ATOM   2648  C  C   . PHE B 1 150 ? 15.248  -68.179  19.400  1.00 16.60  ? 277 PHE B C   1 
ATOM   2649  O  O   . PHE B 1 150 ? 14.078  -68.487  19.660  1.00 17.04  ? 277 PHE B O   1 
ATOM   2650  C  CB  . PHE B 1 150 ? 16.023  -68.953  17.172  1.00 17.87  ? 277 PHE B CB  1 
ATOM   2651  C  CG  . PHE B 1 150 ? 16.242  -68.695  15.690  1.00 17.77  ? 277 PHE B CG  1 
ATOM   2652  C  CD1 . PHE B 1 150 ? 15.653  -67.618  15.032  1.00 17.88  ? 277 PHE B CD1 1 
ATOM   2653  C  CD2 . PHE B 1 150 ? 17.010  -69.580  14.942  1.00 18.41  ? 277 PHE B CD2 1 
ATOM   2654  C  CE1 . PHE B 1 150 ? 15.847  -67.418  13.670  1.00 18.62  ? 277 PHE B CE1 1 
ATOM   2655  C  CE2 . PHE B 1 150 ? 17.204  -69.386  13.567  1.00 18.09  ? 277 PHE B CE2 1 
ATOM   2656  C  CZ  . PHE B 1 150 ? 16.627  -68.306  12.936  1.00 18.19  ? 277 PHE B CZ  1 
ATOM   2657  N  N   . ALA B 1 151 ? 16.226  -68.252  20.295  1.00 13.58  ? 278 ALA B N   1 
ATOM   2658  C  CA  . ALA B 1 151 ? 15.998  -68.811  21.615  1.00 12.78  ? 278 ALA B CA  1 
ATOM   2659  C  C   . ALA B 1 151 ? 15.244  -67.822  22.516  1.00 12.16  ? 278 ALA B C   1 
ATOM   2660  O  O   . ALA B 1 151 ? 15.397  -66.601  22.398  1.00 11.11  ? 278 ALA B O   1 
ATOM   2661  C  CB  . ALA B 1 151 ? 17.332  -69.213  22.252  1.00 12.11  ? 278 ALA B CB  1 
ATOM   2662  N  N   . SER B 1 152 ? 14.410  -68.367  23.397  1.00 10.82  ? 279 SER B N   1 
ATOM   2663  C  CA  . SER B 1 152 ? 13.862  -67.608  24.507  1.00 8.30   ? 279 SER B CA  1 
ATOM   2664  C  C   . SER B 1 152 ? 15.019  -67.098  25.385  1.00 8.11   ? 279 SER B C   1 
ATOM   2665  O  O   . SER B 1 152 ? 16.134  -67.634  25.334  1.00 6.98   ? 279 SER B O   1 
ATOM   2666  C  CB  . SER B 1 152 ? 12.883  -68.472  25.323  1.00 7.76   ? 279 SER B CB  1 
ATOM   2667  O  OG  . SER B 1 152 ? 11.612  -68.536  24.697  1.00 5.96   ? 279 SER B OG  1 
ATOM   2668  N  N   . LYS B 1 153 ? 14.749  -66.059  26.174  1.00 8.57   ? 280 LYS B N   1 
ATOM   2669  C  CA  . LYS B 1 153 ? 15.775  -65.398  26.987  1.00 9.50   ? 280 LYS B CA  1 
ATOM   2670  C  C   . LYS B 1 153 ? 15.585  -65.727  28.465  1.00 7.58   ? 280 LYS B C   1 
ATOM   2671  O  O   . LYS B 1 153 ? 14.458  -65.687  28.958  1.00 7.15   ? 280 LYS B O   1 
ATOM   2672  C  CB  . LYS B 1 153 ? 15.732  -63.879  26.766  1.00 10.40  ? 280 LYS B CB  1 
ATOM   2673  C  CG  . LYS B 1 153 ? 15.826  -63.462  25.287  1.00 12.14  ? 280 LYS B CG  1 
ATOM   2674  C  CD  . LYS B 1 153 ? 17.081  -64.001  24.614  1.00 13.38  ? 280 LYS B CD  1 
ATOM   2675  C  CE  . LYS B 1 153 ? 17.225  -63.487  23.172  1.00 15.53  ? 280 LYS B CE  1 
ATOM   2676  N  NZ  . LYS B 1 153 ? 16.276  -64.130  22.200  1.00 16.73  ? 280 LYS B NZ  1 
ATOM   2677  N  N   . PRO B 1 154 ? 16.683  -66.037  29.183  1.00 6.90   ? 281 PRO B N   1 
ATOM   2678  C  CA  . PRO B 1 154 ? 18.084  -66.013  28.738  1.00 8.26   ? 281 PRO B CA  1 
ATOM   2679  C  C   . PRO B 1 154 ? 18.454  -67.176  27.824  1.00 9.83   ? 281 PRO B C   1 
ATOM   2680  O  O   . PRO B 1 154 ? 18.171  -68.331  28.160  1.00 10.17  ? 281 PRO B O   1 
ATOM   2681  C  CB  . PRO B 1 154 ? 18.868  -66.115  30.052  1.00 6.76   ? 281 PRO B CB  1 
ATOM   2682  C  CG  . PRO B 1 154 ? 17.965  -66.839  30.954  1.00 7.06   ? 281 PRO B CG  1 
ATOM   2683  C  CD  . PRO B 1 154 ? 16.579  -66.394  30.606  1.00 6.26   ? 281 PRO B CD  1 
ATOM   2684  N  N   . ALA B 1 155 ? 19.099  -66.863  26.699  1.00 10.47  ? 282 ALA B N   1 
ATOM   2685  C  CA  . ALA B 1 155 ? 19.488  -67.874  25.696  1.00 12.77  ? 282 ALA B CA  1 
ATOM   2686  C  C   . ALA B 1 155 ? 20.304  -69.022  26.284  1.00 13.76  ? 282 ALA B C   1 
ATOM   2687  O  O   . ALA B 1 155 ? 20.167  -70.171  25.851  1.00 15.43  ? 282 ALA B O   1 
ATOM   2688  C  CB  . ALA B 1 155 ? 20.248  -67.221  24.529  1.00 11.20  ? 282 ALA B CB  1 
ATOM   2689  N  N   . SER B 1 156 ? 21.113  -68.720  27.297  1.00 15.32  ? 283 SER B N   1 
ATOM   2690  C  CA  . SER B 1 156 ? 21.931  -69.737  27.966  1.00 17.07  ? 283 SER B CA  1 
ATOM   2691  C  C   . SER B 1 156 ? 21.121  -70.860  28.620  1.00 18.51  ? 283 SER B C   1 
ATOM   2692  O  O   . SER B 1 156 ? 21.669  -71.922  28.899  1.00 19.72  ? 283 SER B O   1 
ATOM   2693  C  CB  . SER B 1 156 ? 22.832  -69.084  29.009  1.00 16.70  ? 283 SER B CB  1 
ATOM   2694  O  OG  . SER B 1 156 ? 22.052  -68.374  29.947  1.00 17.55  ? 283 SER B OG  1 
ATOM   2695  N  N   . GLU B 1 157 ? 19.835  -70.626  28.873  1.00 19.86  ? 284 GLU B N   1 
ATOM   2696  C  CA  . GLU B 1 157 ? 18.944  -71.664  29.386  1.00 21.01  ? 284 GLU B CA  1 
ATOM   2697  C  C   . GLU B 1 157 ? 18.140  -72.358  28.283  1.00 21.35  ? 284 GLU B C   1 
ATOM   2698  O  O   . GLU B 1 157 ? 17.481  -73.373  28.537  1.00 21.46  ? 284 GLU B O   1 
ATOM   2699  C  CB  . GLU B 1 157 ? 17.971  -71.071  30.399  1.00 22.30  ? 284 GLU B CB  1 
ATOM   2700  C  CG  . GLU B 1 157 ? 18.633  -70.415  31.599  1.00 24.57  ? 284 GLU B CG  1 
ATOM   2701  C  CD  . GLU B 1 157 ? 19.584  -71.337  32.331  1.00 26.24  ? 284 GLU B CD  1 
ATOM   2702  O  OE1 . GLU B 1 157 ? 19.321  -72.561  32.393  1.00 28.06  ? 284 GLU B OE1 1 
ATOM   2703  O  OE2 . GLU B 1 157 ? 20.600  -70.831  32.850  1.00 27.75  ? 284 GLU B OE2 1 
ATOM   2704  N  N   . PHE B 1 158 ? 18.173  -71.815  27.071  1.00 20.19  ? 285 PHE B N   1 
ATOM   2705  C  CA  . PHE B 1 158 ? 17.317  -72.329  25.998  1.00 19.68  ? 285 PHE B CA  1 
ATOM   2706  C  C   . PHE B 1 158 ? 18.067  -72.863  24.779  1.00 18.81  ? 285 PHE B C   1 
ATOM   2707  O  O   . PHE B 1 158 ? 17.486  -73.566  23.961  1.00 19.24  ? 285 PHE B O   1 
ATOM   2708  C  CB  . PHE B 1 158 ? 16.298  -71.261  25.595  1.00 18.82  ? 285 PHE B CB  1 
ATOM   2709  C  CG  . PHE B 1 158 ? 15.251  -71.031  26.629  1.00 17.63  ? 285 PHE B CG  1 
ATOM   2710  C  CD1 . PHE B 1 158 ? 14.147  -71.873  26.712  1.00 16.76  ? 285 PHE B CD1 1 
ATOM   2711  C  CD2 . PHE B 1 158 ? 15.381  -70.003  27.548  1.00 17.13  ? 285 PHE B CD2 1 
ATOM   2712  C  CE1 . PHE B 1 158 ? 13.172  -71.674  27.683  1.00 16.83  ? 285 PHE B CE1 1 
ATOM   2713  C  CE2 . PHE B 1 158 ? 14.417  -69.801  28.530  1.00 17.22  ? 285 PHE B CE2 1 
ATOM   2714  C  CZ  . PHE B 1 158 ? 13.307  -70.645  28.594  1.00 16.93  ? 285 PHE B CZ  1 
ATOM   2715  N  N   . VAL B 1 159 ? 19.344  -72.521  24.654  1.00 18.85  ? 286 VAL B N   1 
ATOM   2716  C  CA  . VAL B 1 159 ? 20.178  -73.100  23.619  1.00 18.87  ? 286 VAL B CA  1 
ATOM   2717  C  C   . VAL B 1 159 ? 20.791  -74.377  24.175  1.00 19.38  ? 286 VAL B C   1 
ATOM   2718  O  O   . VAL B 1 159 ? 21.510  -74.329  25.167  1.00 19.15  ? 286 VAL B O   1 
ATOM   2719  C  CB  . VAL B 1 159 ? 21.251  -72.112  23.144  1.00 17.88  ? 286 VAL B CB  1 
ATOM   2720  C  CG1 . VAL B 1 159 ? 22.196  -72.784  22.149  1.00 16.39  ? 286 VAL B CG1 1 
ATOM   2721  C  CG2 . VAL B 1 159 ? 20.574  -70.895  22.522  1.00 16.48  ? 286 VAL B CG2 1 
ATOM   2722  N  N   . LYS B 1 160 ? 20.474  -75.506  23.539  1.00 19.54  ? 287 LYS B N   1 
ATOM   2723  C  CA  . LYS B 1 160 ? 20.876  -76.835  24.005  1.00 20.34  ? 287 LYS B CA  1 
ATOM   2724  C  C   . LYS B 1 160 ? 21.613  -77.605  22.917  1.00 19.48  ? 287 LYS B C   1 
ATOM   2725  O  O   . LYS B 1 160 ? 21.608  -77.219  21.750  1.00 20.28  ? 287 LYS B O   1 
ATOM   2726  C  CB  . LYS B 1 160 ? 19.639  -77.637  24.410  1.00 22.70  ? 287 LYS B CB  1 
ATOM   2727  C  CG  . LYS B 1 160 ? 18.773  -76.976  25.490  1.00 24.42  ? 287 LYS B CG  1 
ATOM   2728  C  CD  . LYS B 1 160 ? 19.396  -77.133  26.877  1.00 25.38  ? 287 LYS B CD  1 
ATOM   2729  C  CE  . LYS B 1 160 ? 18.662  -76.324  27.958  1.00 26.07  ? 287 LYS B CE  1 
ATOM   2730  N  NZ  . LYS B 1 160 ? 17.214  -76.255  27.694  1.00 27.23  ? 287 LYS B NZ  1 
ATOM   2731  N  N   . ILE B 1 161 ? 22.254  -78.698  23.312  1.00 19.07  ? 288 ILE B N   1 
ATOM   2732  C  CA  . ILE B 1 161 ? 22.900  -79.620  22.371  1.00 17.08  ? 288 ILE B CA  1 
ATOM   2733  C  C   . ILE B 1 161 ? 22.126  -80.947  22.428  1.00 16.23  ? 288 ILE B C   1 
ATOM   2734  O  O   . ILE B 1 161 ? 21.974  -81.552  23.498  1.00 13.46  ? 288 ILE B O   1 
ATOM   2735  C  CB  . ILE B 1 161 ? 24.397  -79.830  22.718  1.00 18.05  ? 288 ILE B CB  1 
ATOM   2736  C  CG1 . ILE B 1 161 ? 25.111  -78.476  22.842  1.00 19.74  ? 288 ILE B CG1 1 
ATOM   2737  C  CG2 . ILE B 1 161 ? 25.102  -80.674  21.653  1.00 17.40  ? 288 ILE B CG2 1 
ATOM   2738  C  CD1 . ILE B 1 161 ? 26.306  -78.490  23.777  1.00 20.94  ? 288 ILE B CD1 1 
ATOM   2739  N  N   . LEU B 1 162 ? 21.619  -81.382  21.277  1.00 15.51  ? 289 LEU B N   1 
ATOM   2740  C  CA  . LEU B 1 162 ? 20.823  -82.604  21.200  1.00 15.98  ? 289 LEU B CA  1 
ATOM   2741  C  C   . LEU B 1 162 ? 21.498  -83.761  21.943  1.00 16.79  ? 289 LEU B C   1 
ATOM   2742  O  O   . LEU B 1 162 ? 20.853  -84.487  22.695  1.00 16.76  ? 289 LEU B O   1 
ATOM   2743  C  CB  . LEU B 1 162 ? 20.565  -82.987  19.736  1.00 15.04  ? 289 LEU B CB  1 
ATOM   2744  C  CG  . LEU B 1 162 ? 19.569  -84.131  19.496  1.00 15.08  ? 289 LEU B CG  1 
ATOM   2745  C  CD1 . LEU B 1 162 ? 18.905  -84.025  18.123  1.00 14.32  ? 289 LEU B CD1 1 
ATOM   2746  C  CD2 . LEU B 1 162 ? 20.233  -85.486  19.670  1.00 13.74  ? 289 LEU B CD2 1 
ATOM   2747  N  N   . ASP B 1 163 ? 22.802  -83.909  21.734  1.00 16.83  ? 290 ASP B N   1 
ATOM   2748  C  CA  . ASP B 1 163 ? 23.573  -85.013  22.299  1.00 17.50  ? 290 ASP B CA  1 
ATOM   2749  C  C   . ASP B 1 163 ? 23.522  -85.104  23.836  1.00 16.05  ? 290 ASP B C   1 
ATOM   2750  O  O   . ASP B 1 163 ? 23.379  -86.184  24.389  1.00 17.70  ? 290 ASP B O   1 
ATOM   2751  C  CB  . ASP B 1 163 ? 25.023  -84.880  21.851  1.00 19.99  ? 290 ASP B CB  1 
ATOM   2752  C  CG  . ASP B 1 163 ? 25.839  -86.061  22.231  1.00 23.12  ? 290 ASP B CG  1 
ATOM   2753  O  OD1 . ASP B 1 163 ? 25.525  -87.159  21.722  1.00 26.33  ? 290 ASP B OD1 1 
ATOM   2754  O  OD2 . ASP B 1 163 ? 26.778  -85.902  23.044  1.00 25.21  ? 290 ASP B OD2 1 
ATOM   2755  N  N   . THR B 1 164 ? 23.655  -83.976  24.520  1.00 14.47  ? 291 THR B N   1 
ATOM   2756  C  CA  . THR B 1 164 ? 23.576  -83.946  25.981  1.00 13.24  ? 291 THR B CA  1 
ATOM   2757  C  C   . THR B 1 164 ? 22.126  -83.785  26.487  1.00 11.60  ? 291 THR B C   1 
ATOM   2758  O  O   . THR B 1 164 ? 21.748  -84.351  27.502  1.00 9.43   ? 291 THR B O   1 
ATOM   2759  C  CB  . THR B 1 164 ? 24.481  -82.825  26.551  1.00 12.65  ? 291 THR B CB  1 
ATOM   2760  O  OG1 . THR B 1 164 ? 24.140  -81.574  25.942  1.00 13.19  ? 291 THR B OG1 1 
ATOM   2761  C  CG2 . THR B 1 164 ? 25.950  -83.141  26.290  1.00 11.58  ? 291 THR B CG2 1 
ATOM   2762  N  N   . PHE B 1 165 ? 21.323  -83.018  25.761  1.00 13.31  ? 292 PHE B N   1 
ATOM   2763  C  CA  . PHE B 1 165 ? 19.945  -82.734  26.158  1.00 13.25  ? 292 PHE B CA  1 
ATOM   2764  C  C   . PHE B 1 165 ? 19.069  -83.986  26.212  1.00 13.46  ? 292 PHE B C   1 
ATOM   2765  O  O   . PHE B 1 165 ? 18.260  -84.145  27.143  1.00 15.27  ? 292 PHE B O   1 
ATOM   2766  C  CB  . PHE B 1 165 ? 19.321  -81.697  25.213  1.00 14.14  ? 292 PHE B CB  1 
ATOM   2767  C  CG  . PHE B 1 165 ? 18.032  -81.116  25.723  1.00 17.02  ? 292 PHE B CG  1 
ATOM   2768  C  CD1 . PHE B 1 165 ? 17.998  -80.412  26.917  1.00 17.73  ? 292 PHE B CD1 1 
ATOM   2769  C  CD2 . PHE B 1 165 ? 16.852  -81.280  25.022  1.00 19.02  ? 292 PHE B CD2 1 
ATOM   2770  C  CE1 . PHE B 1 165 ? 16.828  -79.885  27.399  1.00 18.07  ? 292 PHE B CE1 1 
ATOM   2771  C  CE2 . PHE B 1 165 ? 15.668  -80.750  25.506  1.00 20.18  ? 292 PHE B CE2 1 
ATOM   2772  C  CZ  . PHE B 1 165 ? 15.662  -80.050  26.699  1.00 19.80  ? 292 PHE B CZ  1 
ATOM   2773  N  N   . GLU B 1 166 ? 19.234  -84.872  25.229  1.00 11.53  ? 293 GLU B N   1 
ATOM   2774  C  CA  . GLU B 1 166 ? 18.418  -86.080  25.135  1.00 11.82  ? 293 GLU B CA  1 
ATOM   2775  C  C   . GLU B 1 166 ? 18.633  -87.072  26.292  1.00 12.46  ? 293 GLU B C   1 
ATOM   2776  O  O   . GLU B 1 166 ? 17.775  -87.906  26.546  1.00 13.01  ? 293 GLU B O   1 
ATOM   2777  C  CB  . GLU B 1 166 ? 18.606  -86.776  23.767  1.00 11.62  ? 293 GLU B CB  1 
ATOM   2778  C  CG  . GLU B 1 166 ? 19.947  -87.502  23.534  1.00 12.74  ? 293 GLU B CG  1 
ATOM   2779  C  CD  . GLU B 1 166 ? 20.024  -88.202  22.161  1.00 13.99  ? 293 GLU B CD  1 
ATOM   2780  O  OE1 . GLU B 1 166 ? 18.970  -88.588  21.595  1.00 15.10  ? 293 GLU B OE1 1 
ATOM   2781  O  OE2 . GLU B 1 166 ? 21.147  -88.374  21.644  1.00 14.11  ? 293 GLU B OE2 1 
ATOM   2782  N  N   . LYS B 1 167 ? 19.766  -86.977  26.987  1.00 12.95  ? 294 LYS B N   1 
ATOM   2783  C  CA  . LYS B 1 167 ? 20.070  -87.870  28.102  1.00 12.84  ? 294 LYS B CA  1 
ATOM   2784  C  C   . LYS B 1 167 ? 19.460  -87.416  29.428  1.00 12.88  ? 294 LYS B C   1 
ATOM   2785  O  O   . LYS B 1 167 ? 19.570  -88.135  30.412  1.00 12.71  ? 294 LYS B O   1 
ATOM   2786  C  CB  . LYS B 1 167 ? 21.585  -87.959  28.325  1.00 14.17  ? 294 LYS B CB  1 
ATOM   2787  C  CG  . LYS B 1 167 ? 22.425  -88.415  27.146  1.00 14.94  ? 294 LYS B CG  1 
ATOM   2788  C  CD  . LYS B 1 167 ? 23.929  -88.189  27.415  1.00 15.44  ? 294 LYS B CD  1 
ATOM   2789  C  CE  . LYS B 1 167 ? 24.474  -89.122  28.501  1.00 15.97  ? 294 LYS B CE  1 
ATOM   2790  N  NZ  . LYS B 1 167 ? 24.123  -88.684  29.877  1.00 16.10  ? 294 LYS B NZ  1 
ATOM   2791  N  N   . LEU B 1 168 ? 18.861  -86.227  29.483  1.00 13.34  ? 295 LEU B N   1 
ATOM   2792  C  CA  . LEU B 1 168 ? 18.362  -85.696  30.762  1.00 14.41  ? 295 LEU B CA  1 
ATOM   2793  C  C   . LEU B 1 168 ? 17.235  -86.551  31.346  1.00 15.61  ? 295 LEU B C   1 
ATOM   2794  O  O   . LEU B 1 168 ? 16.202  -86.772  30.703  1.00 16.24  ? 295 LEU B O   1 
ATOM   2795  C  CB  . LEU B 1 168 ? 17.881  -84.250  30.619  1.00 13.91  ? 295 LEU B CB  1 
ATOM   2796  C  CG  . LEU B 1 168 ? 18.976  -83.192  30.493  1.00 14.32  ? 295 LEU B CG  1 
ATOM   2797  C  CD1 . LEU B 1 168 ? 18.325  -81.837  30.250  1.00 12.75  ? 295 LEU B CD1 1 
ATOM   2798  C  CD2 . LEU B 1 168 ? 19.886  -83.172  31.735  1.00 13.00  ? 295 LEU B CD2 1 
ATOM   2799  N  N   . LYS B 1 169 ? 17.454  -87.033  32.563  1.00 16.46  ? 296 LYS B N   1 
ATOM   2800  C  CA  . LYS B 1 169 ? 16.477  -87.848  33.268  1.00 18.62  ? 296 LYS B CA  1 
ATOM   2801  C  C   . LYS B 1 169 ? 15.158  -87.104  33.414  1.00 19.09  ? 296 LYS B C   1 
ATOM   2802  O  O   . LYS B 1 169 ? 14.090  -87.682  33.230  1.00 19.49  ? 296 LYS B O   1 
ATOM   2803  C  CB  . LYS B 1 169 ? 17.012  -88.232  34.656  1.00 19.32  ? 296 LYS B CB  1 
ATOM   2804  C  CG  . LYS B 1 169 ? 16.067  -89.105  35.459  1.00 20.49  ? 296 LYS B CG  1 
ATOM   2805  C  CD  . LYS B 1 169 ? 16.680  -89.572  36.774  1.00 20.66  ? 296 LYS B CD  1 
ATOM   2806  C  CE  . LYS B 1 169 ? 15.891  -90.736  37.362  1.00 20.78  ? 296 LYS B CE  1 
ATOM   2807  N  NZ  . LYS B 1 169 ? 16.660  -91.437  38.427  1.00 21.42  ? 296 LYS B NZ  1 
ATOM   2808  N  N   . ASP B 1 170 ? 15.253  -85.815  33.725  1.00 19.90  ? 297 ASP B N   1 
ATOM   2809  C  CA  . ASP B 1 170 ? 14.092  -84.977  34.018  1.00 21.11  ? 297 ASP B CA  1 
ATOM   2810  C  C   . ASP B 1 170 ? 13.680  -84.142  32.810  1.00 20.82  ? 297 ASP B C   1 
ATOM   2811  O  O   . ASP B 1 170 ? 13.290  -82.980  32.961  1.00 21.09  ? 297 ASP B O   1 
ATOM   2812  C  CB  . ASP B 1 170 ? 14.390  -84.070  35.237  1.00 23.15  ? 297 ASP B CB  1 
ATOM   2813  C  CG  . ASP B 1 170 ? 15.662  -83.220  35.072  1.00 24.63  ? 297 ASP B CG  1 
ATOM   2814  O  OD1 . ASP B 1 170 ? 16.353  -83.313  34.032  1.00 26.33  ? 297 ASP B OD1 1 
ATOM   2815  O  OD2 . ASP B 1 170 ? 15.977  -82.449  36.001  1.00 26.12  ? 297 ASP B OD2 1 
ATOM   2816  N  N   . LEU B 1 171 ? 13.738  -84.745  31.619  1.00 20.08  ? 298 LEU B N   1 
ATOM   2817  C  CA  . LEU B 1 171 ? 13.483  -84.032  30.367  1.00 19.84  ? 298 LEU B CA  1 
ATOM   2818  C  C   . LEU B 1 171 ? 12.053  -83.485  30.257  1.00 19.95  ? 298 LEU B C   1 
ATOM   2819  O  O   . LEU B 1 171 ? 11.848  -82.343  29.827  1.00 18.53  ? 298 LEU B O   1 
ATOM   2820  C  CB  . LEU B 1 171 ? 13.766  -84.946  29.174  1.00 20.05  ? 298 LEU B CB  1 
ATOM   2821  C  CG  . LEU B 1 171 ? 13.697  -84.311  27.786  1.00 20.23  ? 298 LEU B CG  1 
ATOM   2822  C  CD1 . LEU B 1 171 ? 14.900  -83.413  27.552  1.00 21.40  ? 298 LEU B CD1 1 
ATOM   2823  C  CD2 . LEU B 1 171 ? 13.639  -85.369  26.733  1.00 20.04  ? 298 LEU B CD2 1 
ATOM   2824  N  N   . CYS B 1 172 ? 11.070  -84.300  30.624  1.00 19.78  ? 299 CYS B N   1 
ATOM   2825  C  CA  . CYS B 1 172 ? 9.684   -83.891  30.493  1.00 21.70  ? 299 CYS B CA  1 
ATOM   2826  C  C   . CYS B 1 172 ? 9.333   -82.772  31.479  1.00 23.12  ? 299 CYS B C   1 
ATOM   2827  O  O   . CYS B 1 172 ? 8.571   -81.870  31.137  1.00 22.75  ? 299 CYS B O   1 
ATOM   2828  C  CB  . CYS B 1 172 ? 8.737   -85.082  30.654  1.00 21.47  ? 299 CYS B CB  1 
ATOM   2829  S  SG  . CYS B 1 172 ? 9.044   -86.474  29.525  1.00 22.18  ? 299 CYS B SG  1 
ATOM   2830  N  N   . THR B 1 173 ? 9.894   -82.812  32.690  1.00 25.75  ? 300 THR B N   1 
ATOM   2831  C  CA  . THR B 1 173 ? 9.696   -81.710  33.646  1.00 27.01  ? 300 THR B CA  1 
ATOM   2832  C  C   . THR B 1 173 ? 10.438  -80.460  33.182  1.00 27.35  ? 300 THR B C   1 
ATOM   2833  O  O   . THR B 1 173 ? 9.968   -79.352  33.401  1.00 28.84  ? 300 THR B O   1 
ATOM   2834  C  CB  . THR B 1 173 ? 10.127  -82.073  35.083  1.00 28.43  ? 300 THR B CB  1 
ATOM   2835  O  OG1 . THR B 1 173 ? 11.385  -82.744  35.046  1.00 30.91  ? 300 THR B OG1 1 
ATOM   2836  C  CG2 . THR B 1 173 ? 9.099   -82.986  35.755  1.00 28.51  ? 300 THR B CG2 1 
ATOM   2837  N  N   . GLU B 1 174 ? 11.571  -80.635  32.508  1.00 27.71  ? 301 GLU B N   1 
ATOM   2838  C  CA  . GLU B 1 174 ? 12.316  -79.504  31.955  1.00 28.80  ? 301 GLU B CA  1 
ATOM   2839  C  C   . GLU B 1 174 ? 11.536  -78.739  30.883  1.00 28.31  ? 301 GLU B C   1 
ATOM   2840  O  O   . GLU B 1 174 ? 11.493  -77.512  30.902  1.00 30.40  ? 301 GLU B O   1 
ATOM   2841  C  CB  . GLU B 1 174 ? 13.652  -79.965  31.370  1.00 31.65  ? 301 GLU B CB  1 
ATOM   2842  C  CG  . GLU B 1 174 ? 14.698  -78.860  31.302  1.00 34.50  ? 301 GLU B CG  1 
ATOM   2843  C  CD  . GLU B 1 174 ? 15.238  -78.477  32.679  1.00 36.72  ? 301 GLU B CD  1 
ATOM   2844  O  OE1 . GLU B 1 174 ? 15.660  -79.387  33.431  1.00 38.37  ? 301 GLU B OE1 1 
ATOM   2845  O  OE2 . GLU B 1 174 ? 15.235  -77.269  33.011  1.00 38.24  ? 301 GLU B OE2 1 
ATOM   2846  N  N   . LEU B 1 175 ? 10.925  -79.458  29.945  1.00 26.63  ? 302 LEU B N   1 
ATOM   2847  C  CA  . LEU B 1 175 ? 10.149  -78.814  28.884  1.00 24.96  ? 302 LEU B CA  1 
ATOM   2848  C  C   . LEU B 1 175 ? 8.854   -78.170  29.396  1.00 23.90  ? 302 LEU B C   1 
ATOM   2849  O  O   . LEU B 1 175 ? 8.278   -77.326  28.706  1.00 23.42  ? 302 LEU B O   1 
ATOM   2850  C  CB  . LEU B 1 175 ? 9.840   -79.809  27.762  1.00 24.59  ? 302 LEU B CB  1 
ATOM   2851  C  CG  . LEU B 1 175 ? 11.040  -80.356  26.985  1.00 24.49  ? 302 LEU B CG  1 
ATOM   2852  C  CD1 . LEU B 1 175 ? 10.609  -81.516  26.097  1.00 24.90  ? 302 LEU B CD1 1 
ATOM   2853  C  CD2 . LEU B 1 175 ? 11.712  -79.263  26.161  1.00 23.75  ? 302 LEU B CD2 1 
ATOM   2854  N  N   . GLN B 1 176 ? 8.408   -78.572  30.589  1.00 23.15  ? 303 GLN B N   1 
ATOM   2855  C  CA  . GLN B 1 176 ? 7.238   -77.972  31.263  1.00 24.06  ? 303 GLN B CA  1 
ATOM   2856  C  C   . GLN B 1 176 ? 7.543   -76.677  32.032  1.00 23.77  ? 303 GLN B C   1 
ATOM   2857  O  O   . GLN B 1 176 ? 6.631   -76.023  32.527  1.00 21.90  ? 303 GLN B O   1 
ATOM   2858  C  CB  . GLN B 1 176 ? 6.629   -78.980  32.251  1.00 24.79  ? 303 GLN B CB  1 
ATOM   2859  C  CG  . GLN B 1 176 ? 5.804   -80.052  31.593  1.00 25.72  ? 303 GLN B CG  1 
ATOM   2860  C  CD  . GLN B 1 176 ? 5.353   -81.132  32.553  1.00 26.38  ? 303 GLN B CD  1 
ATOM   2861  O  OE1 . GLN B 1 176 ? 6.150   -81.681  33.315  1.00 27.62  ? 303 GLN B OE1 1 
ATOM   2862  N  NE2 . GLN B 1 176 ? 4.068   -81.461  32.504  1.00 26.70  ? 303 GLN B NE2 1 
ATOM   2863  N  N   . LYS B 1 177 ? 8.825   -76.347  32.172  1.00 24.61  ? 304 LYS B N   1 
ATOM   2864  C  CA  . LYS B 1 177 ? 9.274   -75.144  32.882  1.00 24.09  ? 304 LYS B CA  1 
ATOM   2865  C  C   . LYS B 1 177 ? 8.568   -73.918  32.340  1.00 22.63  ? 304 LYS B C   1 
ATOM   2866  O  O   . LYS B 1 177 ? 8.463   -73.758  31.135  1.00 22.17  ? 304 LYS B O   1 
ATOM   2867  C  CB  . LYS B 1 177 ? 10.785  -74.995  32.699  1.00 26.42  ? 304 LYS B CB  1 
ATOM   2868  C  CG  . LYS B 1 177 ? 11.373  -73.600  32.870  1.00 29.22  ? 304 LYS B CG  1 
ATOM   2869  C  CD  . LYS B 1 177 ? 12.900  -73.644  32.707  1.00 30.72  ? 304 LYS B CD  1 
ATOM   2870  C  CE  . LYS B 1 177 ? 13.314  -73.855  31.250  1.00 32.01  ? 304 LYS B CE  1 
ATOM   2871  N  NZ  . LYS B 1 177 ? 14.132  -75.100  31.042  1.00 32.23  ? 304 LYS B NZ  1 
ATOM   2872  N  N   . LYS B 1 178 ? 8.082   -73.057  33.229  1.00 21.43  ? 305 LYS B N   1 
ATOM   2873  C  CA  . LYS B 1 178 ? 7.411   -71.818  32.809  1.00 19.36  ? 305 LYS B CA  1 
ATOM   2874  C  C   . LYS B 1 178 ? 7.935   -70.549  33.467  1.00 16.97  ? 305 LYS B C   1 
ATOM   2875  O  O   . LYS B 1 178 ? 7.649   -69.454  32.993  1.00 14.45  ? 305 LYS B O   1 
ATOM   2876  C  CB  . LYS B 1 178 ? 5.905   -71.926  33.019  1.00 19.33  ? 305 LYS B CB  1 
ATOM   2877  C  CG  . LYS B 1 178 ? 5.464   -72.268  34.416  1.00 18.99  ? 305 LYS B CG  1 
ATOM   2878  C  CD  . LYS B 1 178 ? 3.953   -72.303  34.460  1.00 18.81  ? 305 LYS B CD  1 
ATOM   2879  C  CE  . LYS B 1 178 ? 3.439   -73.320  35.435  1.00 19.22  ? 305 LYS B CE  1 
ATOM   2880  N  NZ  . LYS B 1 178 ? 2.020   -73.607  35.110  1.00 20.57  ? 305 LYS B NZ  1 
ATOM   2881  N  N   . ILE B 1 179 ? 8.687   -70.699  34.554  1.00 15.75  ? 306 ILE B N   1 
ATOM   2882  C  CA  . ILE B 1 179 ? 9.385   -69.588  35.180  1.00 14.82  ? 306 ILE B CA  1 
ATOM   2883  C  C   . ILE B 1 179 ? 10.852  -69.660  34.755  1.00 15.28  ? 306 ILE B C   1 
ATOM   2884  O  O   . ILE B 1 179 ? 11.504  -70.704  34.906  1.00 16.79  ? 306 ILE B O   1 
ATOM   2885  C  CB  . ILE B 1 179 ? 9.274   -69.636  36.715  1.00 13.87  ? 306 ILE B CB  1 
ATOM   2886  C  CG1 . ILE B 1 179 ? 7.812   -69.836  37.142  1.00 13.48  ? 306 ILE B CG1 1 
ATOM   2887  C  CG2 . ILE B 1 179 ? 9.839   -68.357  37.330  1.00 12.87  ? 306 ILE B CG2 1 
ATOM   2888  C  CD1 . ILE B 1 179 ? 6.828   -68.875  36.493  1.00 11.64  ? 306 ILE B CD1 1 
ATOM   2889  N  N   . TYR B 1 180 ? 11.353  -68.560  34.197  1.00 13.94  ? 307 TYR B N   1 
ATOM   2890  C  CA  . TYR B 1 180 ? 12.696  -68.529  33.617  1.00 13.83  ? 307 TYR B CA  1 
ATOM   2891  C  C   . TYR B 1 180 ? 13.190  -67.107  33.382  1.00 13.00  ? 307 TYR B C   1 
ATOM   2892  O  O   . TYR B 1 180 ? 14.381  -66.933  33.088  1.00 10.54  ? 307 TYR B O   1 
ATOM   2893  C  CB  . TYR B 1 180 ? 12.725  -69.301  32.296  1.00 13.73  ? 307 TYR B CB  1 
ATOM   2894  C  CG  . TYR B 1 180 ? 11.752  -68.796  31.245  1.00 14.43  ? 307 TYR B CG  1 
ATOM   2895  C  CD1 . TYR B 1 180 ? 12.156  -67.866  30.291  1.00 14.74  ? 307 TYR B CD1 1 
ATOM   2896  C  CD2 . TYR B 1 180 ? 10.439  -69.257  31.194  1.00 13.82  ? 307 TYR B CD2 1 
ATOM   2897  C  CE1 . TYR B 1 180 ? 11.283  -67.404  29.313  1.00 14.34  ? 307 TYR B CE1 1 
ATOM   2898  C  CE2 . TYR B 1 180 ? 9.548   -68.790  30.224  1.00 13.94  ? 307 TYR B CE2 1 
ATOM   2899  C  CZ  . TYR B 1 180 ? 9.984   -67.864  29.276  1.00 14.43  ? 307 TYR B CZ  1 
ATOM   2900  O  OH  . TYR B 1 180 ? 9.138   -67.397  28.277  1.00 13.65  ? 307 TYR B OH  1 
ATOM   2901  O  OXT . TYR B 1 180 ? 12.413  -66.139  33.480  1.00 10.98  ? 307 TYR B OXT 1 
ATOM   2902  N  N   . GLU C 2 1   ? 42.488  -59.768  -9.307  1.00 31.60  ? 1   GLU H N   1 
ATOM   2903  C  CA  . GLU C 2 1   ? 42.071  -58.444  -9.841  1.00 31.25  ? 1   GLU H CA  1 
ATOM   2904  C  C   . GLU C 2 1   ? 40.879  -57.898  -9.056  1.00 29.70  ? 1   GLU H C   1 
ATOM   2905  O  O   . GLU C 2 1   ? 39.974  -58.649  -8.685  1.00 29.61  ? 1   GLU H O   1 
ATOM   2906  C  CB  . GLU C 2 1   ? 41.700  -58.576  -11.318 1.00 32.89  ? 1   GLU H CB  1 
ATOM   2907  C  CG  . GLU C 2 1   ? 41.638  -57.251  -12.071 1.00 34.43  ? 1   GLU H CG  1 
ATOM   2908  C  CD  . GLU C 2 1   ? 40.533  -57.226  -13.113 1.00 35.90  ? 1   GLU H CD  1 
ATOM   2909  O  OE1 . GLU C 2 1   ? 40.425  -58.205  -13.888 1.00 36.42  ? 1   GLU H OE1 1 
ATOM   2910  O  OE2 . GLU C 2 1   ? 39.773  -56.228  -13.153 1.00 36.43  ? 1   GLU H OE2 1 
ATOM   2911  N  N   . VAL C 2 2   ? 40.886  -56.589  -8.812  1.00 28.30  ? 2   VAL H N   1 
ATOM   2912  C  CA  . VAL C 2 2   ? 39.768  -55.900  -8.152  1.00 26.50  ? 2   VAL H CA  1 
ATOM   2913  C  C   . VAL C 2 2   ? 38.798  -55.328  -9.190  1.00 24.29  ? 2   VAL H C   1 
ATOM   2914  O  O   . VAL C 2 2   ? 39.222  -54.763  -10.197 1.00 23.71  ? 2   VAL H O   1 
ATOM   2915  C  CB  . VAL C 2 2   ? 40.259  -54.769  -7.216  1.00 26.42  ? 2   VAL H CB  1 
ATOM   2916  C  CG1 . VAL C 2 2   ? 41.340  -55.291  -6.284  1.00 26.26  ? 2   VAL H CG1 1 
ATOM   2917  C  CG2 . VAL C 2 2   ? 40.772  -53.584  -8.019  1.00 27.16  ? 2   VAL H CG2 1 
ATOM   2918  N  N   . GLN C 2 3   ? 37.500  -55.470  -8.926  1.00 22.46  ? 3   GLN H N   1 
ATOM   2919  C  CA  . GLN C 2 3   ? 36.459  -55.101  -9.885  1.00 22.14  ? 3   GLN H CA  1 
ATOM   2920  C  C   . GLN C 2 3   ? 35.172  -54.603  -9.230  1.00 19.47  ? 3   GLN H C   1 
ATOM   2921  O  O   . GLN C 2 3   ? 34.822  -54.999  -8.117  1.00 17.84  ? 3   GLN H O   1 
ATOM   2922  C  CB  . GLN C 2 3   ? 36.084  -56.309  -10.759 1.00 24.19  ? 3   GLN H CB  1 
ATOM   2923  C  CG  . GLN C 2 3   ? 37.058  -56.609  -11.893 1.00 26.28  ? 3   GLN H CG  1 
ATOM   2924  C  CD  . GLN C 2 3   ? 36.361  -57.088  -13.164 1.00 27.93  ? 3   GLN H CD  1 
ATOM   2925  O  OE1 . GLN C 2 3   ? 35.182  -57.468  -13.141 1.00 28.80  ? 3   GLN H OE1 1 
ATOM   2926  N  NE2 . GLN C 2 3   ? 37.086  -57.060  -14.284 1.00 28.16  ? 3   GLN H NE2 1 
ATOM   2927  N  N   . LEU C 2 4   ? 34.469  -53.746  -9.961  1.00 17.41  ? 4   LEU H N   1 
ATOM   2928  C  CA  . LEU C 2 4   ? 33.118  -53.346  -9.633  1.00 16.48  ? 4   LEU H CA  1 
ATOM   2929  C  C   . LEU C 2 4   ? 32.245  -53.696  -10.845 1.00 18.05  ? 4   LEU H C   1 
ATOM   2930  O  O   . LEU C 2 4   ? 32.521  -53.243  -11.948 1.00 19.45  ? 4   LEU H O   1 
ATOM   2931  C  CB  . LEU C 2 4   ? 33.076  -51.845  -9.307  1.00 14.46  ? 4   LEU H CB  1 
ATOM   2932  C  CG  . LEU C 2 4   ? 33.756  -51.434  -7.981  1.00 13.31  ? 4   LEU H CG  1 
ATOM   2933  C  CD1 . LEU C 2 4   ? 33.807  -49.904  -7.799  1.00 11.21  ? 4   LEU H CD1 1 
ATOM   2934  C  CD2 . LEU C 2 4   ? 33.081  -52.080  -6.786  1.00 10.52  ? 4   LEU H CD2 1 
ATOM   2935  N  N   . LEU C 2 5   ? 31.227  -54.533  -10.654 1.00 18.63  ? 5   LEU H N   1 
ATOM   2936  C  CA  . LEU C 2 5   ? 30.359  -54.952  -11.762 1.00 20.15  ? 5   LEU H CA  1 
ATOM   2937  C  C   . LEU C 2 5   ? 28.920  -54.499  -11.526 1.00 20.31  ? 5   LEU H C   1 
ATOM   2938  O  O   . LEU C 2 5   ? 28.249  -54.979  -10.609 1.00 19.06  ? 5   LEU H O   1 
ATOM   2939  C  CB  . LEU C 2 5   ? 30.410  -56.476  -11.959 1.00 21.44  ? 5   LEU H CB  1 
ATOM   2940  C  CG  . LEU C 2 5   ? 29.725  -57.017  -13.235 1.00 23.24  ? 5   LEU H CG  1 
ATOM   2941  C  CD1 . LEU C 2 5   ? 30.394  -56.508  -14.524 1.00 22.89  ? 5   LEU H CD1 1 
ATOM   2942  C  CD2 . LEU C 2 5   ? 29.688  -58.550  -13.240 1.00 23.60  ? 5   LEU H CD2 1 
ATOM   2943  N  N   . GLU C 2 6   ? 28.467  -53.555  -12.350 1.00 21.16  ? 6   GLU H N   1 
ATOM   2944  C  CA  . GLU C 2 6   ? 27.109  -53.051  -12.281 1.00 21.23  ? 6   GLU H CA  1 
ATOM   2945  C  C   . GLU C 2 6   ? 26.178  -53.983  -13.038 1.00 20.26  ? 6   GLU H C   1 
ATOM   2946  O  O   . GLU C 2 6   ? 26.596  -54.684  -13.954 1.00 18.63  ? 6   GLU H O   1 
ATOM   2947  C  CB  . GLU C 2 6   ? 26.985  -51.639  -12.883 1.00 23.18  ? 6   GLU H CB  1 
ATOM   2948  C  CG  . GLU C 2 6   ? 27.764  -50.522  -12.158 1.00 23.61  ? 6   GLU H CG  1 
ATOM   2949  C  CD  . GLU C 2 6   ? 29.146  -50.323  -12.727 1.00 25.08  ? 6   GLU H CD  1 
ATOM   2950  O  OE1 . GLU C 2 6   ? 29.706  -51.308  -13.276 1.00 25.55  ? 6   GLU H OE1 1 
ATOM   2951  O  OE2 . GLU C 2 6   ? 29.673  -49.184  -12.649 1.00 24.56  ? 6   GLU H OE2 1 
ATOM   2952  N  N   . SER C 2 7   ? 24.916  -53.988  -12.620 1.00 20.10  ? 7   SER H N   1 
ATOM   2953  C  CA  . SER C 2 7   ? 23.832  -54.602  -13.369 1.00 19.83  ? 7   SER H CA  1 
ATOM   2954  C  C   . SER C 2 7   ? 22.557  -53.873  -12.997 1.00 19.18  ? 7   SER H C   1 
ATOM   2955  O  O   . SER C 2 7   ? 22.549  -53.096  -12.055 1.00 18.97  ? 7   SER H O   1 
ATOM   2956  C  CB  . SER C 2 7   ? 23.719  -56.093  -13.044 1.00 20.25  ? 7   SER H CB  1 
ATOM   2957  O  OG  . SER C 2 7   ? 23.683  -56.296  -11.644 1.00 21.18  ? 7   SER H OG  1 
ATOM   2958  N  N   . GLY C 2 8   ? 21.489  -54.110  -13.749 1.00 20.26  ? 8   GLY H N   1 
ATOM   2959  C  CA  . GLY C 2 8   ? 20.177  -53.537  -13.435 1.00 20.32  ? 8   GLY H CA  1 
ATOM   2960  C  C   . GLY C 2 8   ? 19.702  -52.485  -14.421 1.00 19.97  ? 8   GLY H C   1 
ATOM   2961  O  O   . GLY C 2 8   ? 18.528  -52.134  -14.432 1.00 19.57  ? 8   GLY H O   1 
ATOM   2962  N  N   . GLY C 2 9   ? 20.608  -51.971  -15.246 1.00 19.90  ? 9   GLY H N   1 
ATOM   2963  C  CA  . GLY C 2 9   ? 20.239  -50.978  -16.250 1.00 19.84  ? 9   GLY H CA  1 
ATOM   2964  C  C   . GLY C 2 9   ? 19.121  -51.476  -17.159 1.00 19.83  ? 9   GLY H C   1 
ATOM   2965  O  O   . GLY C 2 9   ? 18.979  -52.678  -17.403 1.00 18.68  ? 9   GLY H O   1 
ATOM   2966  N  N   . GLY C 2 10  ? 18.318  -50.551  -17.665 1.00 18.88  ? 10  GLY H N   1 
ATOM   2967  C  CA  . GLY C 2 10  ? 17.234  -50.922  -18.546 1.00 17.81  ? 10  GLY H CA  1 
ATOM   2968  C  C   . GLY C 2 10  ? 16.452  -49.723  -19.023 1.00 17.71  ? 10  GLY H C   1 
ATOM   2969  O  O   . GLY C 2 10  ? 16.829  -48.581  -18.766 1.00 16.13  ? 10  GLY H O   1 
ATOM   2970  N  N   . LEU C 2 11  ? 15.361  -50.004  -19.731 1.00 17.02  ? 11  LEU H N   1 
ATOM   2971  C  CA  . LEU C 2 11  ? 14.465  -48.977  -20.207 1.00 17.35  ? 11  LEU H CA  1 
ATOM   2972  C  C   . LEU C 2 11  ? 13.308  -48.875  -19.215 1.00 18.50  ? 11  LEU H C   1 
ATOM   2973  O  O   . LEU C 2 11  ? 12.703  -49.888  -18.862 1.00 18.05  ? 11  LEU H O   1 
ATOM   2974  C  CB  . LEU C 2 11  ? 13.966  -49.330  -21.613 1.00 17.32  ? 11  LEU H CB  1 
ATOM   2975  C  CG  . LEU C 2 11  ? 12.842  -48.473  -22.202 1.00 17.46  ? 11  LEU H CG  1 
ATOM   2976  C  CD1 . LEU C 2 11  ? 13.310  -47.028  -22.402 1.00 17.44  ? 11  LEU H CD1 1 
ATOM   2977  C  CD2 . LEU C 2 11  ? 12.336  -49.103  -23.505 1.00 16.74  ? 11  LEU H CD2 1 
ATOM   2978  N  N   . VAL C 2 12  ? 13.027  -47.654  -18.764 1.00 19.61  ? 12  VAL H N   1 
ATOM   2979  C  CA  . VAL C 2 12  ? 11.912  -47.362  -17.853 1.00 21.55  ? 12  VAL H CA  1 
ATOM   2980  C  C   . VAL C 2 12  ? 11.113  -46.193  -18.419 1.00 21.27  ? 12  VAL H C   1 
ATOM   2981  O  O   . VAL C 2 12  ? 11.685  -45.298  -19.039 1.00 20.09  ? 12  VAL H O   1 
ATOM   2982  C  CB  . VAL C 2 12  ? 12.421  -46.941  -16.441 1.00 22.39  ? 12  VAL H CB  1 
ATOM   2983  C  CG1 . VAL C 2 12  ? 11.291  -46.934  -15.446 1.00 23.29  ? 12  VAL H CG1 1 
ATOM   2984  C  CG2 . VAL C 2 12  ? 13.534  -47.864  -15.965 1.00 23.37  ? 12  VAL H CG2 1 
ATOM   2985  N  N   . GLN C 2 13  ? 9.800   -46.197  -18.207 1.00 22.38  ? 13  GLN H N   1 
ATOM   2986  C  CA  . GLN C 2 13  ? 8.980   -45.020  -18.517 1.00 22.81  ? 13  GLN H CA  1 
ATOM   2987  C  C   . GLN C 2 13  ? 9.175   -43.929  -17.460 1.00 21.11  ? 13  GLN H C   1 
ATOM   2988  O  O   . GLN C 2 13  ? 9.520   -44.237  -16.318 1.00 21.47  ? 13  GLN H O   1 
ATOM   2989  C  CB  . GLN C 2 13  ? 7.504   -45.383  -18.601 1.00 24.31  ? 13  GLN H CB  1 
ATOM   2990  C  CG  . GLN C 2 13  ? 7.111   -45.972  -19.929 1.00 26.28  ? 13  GLN H CG  1 
ATOM   2991  C  CD  . GLN C 2 13  ? 5.626   -46.198  -20.019 1.00 28.69  ? 13  GLN H CD  1 
ATOM   2992  O  OE1 . GLN C 2 13  ? 5.062   -46.991  -19.258 1.00 30.24  ? 13  GLN H OE1 1 
ATOM   2993  N  NE2 . GLN C 2 13  ? 4.971   -45.500  -20.947 1.00 30.23  ? 13  GLN H NE2 1 
ATOM   2994  N  N   . PRO C 2 14  ? 8.954   -42.652  -17.834 1.00 18.50  ? 14  PRO H N   1 
ATOM   2995  C  CA  . PRO C 2 14  ? 9.054   -41.584  -16.842 1.00 17.40  ? 14  PRO H CA  1 
ATOM   2996  C  C   . PRO C 2 14  ? 8.062   -41.799  -15.707 1.00 16.79  ? 14  PRO H C   1 
ATOM   2997  O  O   . PRO C 2 14  ? 6.935   -42.246  -15.946 1.00 17.28  ? 14  PRO H O   1 
ATOM   2998  C  CB  . PRO C 2 14  ? 8.710   -40.316  -17.639 1.00 17.33  ? 14  PRO H CB  1 
ATOM   2999  C  CG  . PRO C 2 14  ? 8.902   -40.688  -19.069 1.00 17.07  ? 14  PRO H CG  1 
ATOM   3000  C  CD  . PRO C 2 14  ? 8.542   -42.133  -19.150 1.00 17.64  ? 14  PRO H CD  1 
ATOM   3001  N  N   . GLY C 2 15  ? 8.489   -41.503  -14.484 1.00 16.59  ? 15  GLY H N   1 
ATOM   3002  C  CA  . GLY C 2 15  ? 7.685   -41.779  -13.299 1.00 16.36  ? 15  GLY H CA  1 
ATOM   3003  C  C   . GLY C 2 15  ? 7.977   -43.148  -12.704 1.00 16.89  ? 15  GLY H C   1 
ATOM   3004  O  O   . GLY C 2 15  ? 7.681   -43.397  -11.536 1.00 16.85  ? 15  GLY H O   1 
ATOM   3005  N  N   . GLY C 2 16  ? 8.573   -44.036  -13.497 1.00 17.87  ? 16  GLY H N   1 
ATOM   3006  C  CA  . GLY C 2 16  ? 8.854   -45.395  -13.056 1.00 18.57  ? 16  GLY H CA  1 
ATOM   3007  C  C   . GLY C 2 16  ? 10.067  -45.499  -12.155 1.00 19.83  ? 16  GLY H C   1 
ATOM   3008  O  O   . GLY C 2 16  ? 10.693  -44.493  -11.802 1.00 19.52  ? 16  GLY H O   1 
ATOM   3009  N  N   . SER C 2 17  ? 10.395  -46.736  -11.789 1.00 21.10  ? 17  SER H N   1 
ATOM   3010  C  CA  . SER C 2 17  ? 11.516  -47.019  -10.910 1.00 21.29  ? 17  SER H CA  1 
ATOM   3011  C  C   . SER C 2 17  ? 12.410  -48.143  -11.443 1.00 21.48  ? 17  SER H C   1 
ATOM   3012  O  O   . SER C 2 17  ? 11.993  -48.949  -12.279 1.00 20.09  ? 17  SER H O   1 
ATOM   3013  C  CB  . SER C 2 17  ? 11.000  -47.398  -9.531  1.00 22.26  ? 17  SER H CB  1 
ATOM   3014  O  OG  . SER C 2 17  ? 10.439  -48.688  -9.563  1.00 24.16  ? 17  SER H OG  1 
ATOM   3015  N  N   . LEU C 2 18  ? 13.644  -48.175  -10.945 1.00 20.78  ? 18  LEU H N   1 
ATOM   3016  C  CA  . LEU C 2 18  ? 14.617  -49.186  -11.322 1.00 21.71  ? 18  LEU H CA  1 
ATOM   3017  C  C   . LEU C 2 18  ? 15.685  -49.301  -10.227 1.00 21.88  ? 18  LEU H C   1 
ATOM   3018  O  O   . LEU C 2 18  ? 16.176  -48.285  -9.733  1.00 21.14  ? 18  LEU H O   1 
ATOM   3019  C  CB  . LEU C 2 18  ? 15.275  -48.802  -12.653 1.00 22.87  ? 18  LEU H CB  1 
ATOM   3020  C  CG  . LEU C 2 18  ? 15.989  -49.913  -13.427 1.00 23.68  ? 18  LEU H CG  1 
ATOM   3021  C  CD1 . LEU C 2 18  ? 14.975  -50.906  -14.004 1.00 23.37  ? 18  LEU H CD1 1 
ATOM   3022  C  CD2 . LEU C 2 18  ? 16.838  -49.329  -14.535 1.00 23.97  ? 18  LEU H CD2 1 
ATOM   3023  N  N   . ARG C 2 19  ? 16.038  -50.532  -9.853  1.00 21.51  ? 19  ARG H N   1 
ATOM   3024  C  CA  . ARG C 2 19  ? 17.134  -50.775  -8.916  1.00 21.60  ? 19  ARG H CA  1 
ATOM   3025  C  C   . ARG C 2 19  ? 18.434  -51.204  -9.620  1.00 21.19  ? 19  ARG H C   1 
ATOM   3026  O  O   . ARG C 2 19  ? 18.460  -52.170  -10.378 1.00 19.31  ? 19  ARG H O   1 
ATOM   3027  C  CB  . ARG C 2 19  ? 16.731  -51.839  -7.912  1.00 23.52  ? 19  ARG H CB  1 
ATOM   3028  C  CG  . ARG C 2 19  ? 17.610  -51.869  -6.670  1.00 25.31  ? 19  ARG H CG  1 
ATOM   3029  C  CD  . ARG C 2 19  ? 17.567  -53.237  -6.021  1.00 27.05  ? 19  ARG H CD  1 
ATOM   3030  N  NE  . ARG C 2 19  ? 17.906  -53.180  -4.603  1.00 29.64  ? 19  ARG H NE  1 
ATOM   3031  C  CZ  . ARG C 2 19  ? 18.082  -54.244  -3.821  1.00 31.11  ? 19  ARG H CZ  1 
ATOM   3032  N  NH1 . ARG C 2 19  ? 17.962  -55.474  -4.316  1.00 31.20  ? 19  ARG H NH1 1 
ATOM   3033  N  NH2 . ARG C 2 19  ? 18.388  -54.076  -2.535  1.00 31.61  ? 19  ARG H NH2 1 
ATOM   3034  N  N   . LEU C 2 20  ? 19.518  -50.483  -9.356  1.00 22.54  ? 20  LEU H N   1 
ATOM   3035  C  CA  . LEU C 2 20  ? 20.841  -50.885  -9.834  1.00 22.53  ? 20  LEU H CA  1 
ATOM   3036  C  C   . LEU C 2 20  ? 21.590  -51.649  -8.741  1.00 21.74  ? 20  LEU H C   1 
ATOM   3037  O  O   . LEU C 2 20  ? 21.379  -51.410  -7.551  1.00 19.05  ? 20  LEU H O   1 
ATOM   3038  C  CB  . LEU C 2 20  ? 21.655  -49.662  -10.260 1.00 22.91  ? 20  LEU H CB  1 
ATOM   3039  C  CG  . LEU C 2 20  ? 21.023  -48.722  -11.287 1.00 22.99  ? 20  LEU H CG  1 
ATOM   3040  C  CD1 . LEU C 2 20  ? 22.004  -47.615  -11.617 1.00 23.76  ? 20  LEU H CD1 1 
ATOM   3041  C  CD2 . LEU C 2 20  ? 20.607  -49.463  -12.544 1.00 23.39  ? 20  LEU H CD2 1 
ATOM   3042  N  N   . SER C 2 21  ? 22.454  -52.575  -9.157  1.00 21.34  ? 21  SER H N   1 
ATOM   3043  C  CA  . SER C 2 21  ? 23.356  -53.266  -8.242  1.00 21.36  ? 21  SER H CA  1 
ATOM   3044  C  C   . SER C 2 21  ? 24.802  -53.117  -8.714  1.00 21.52  ? 21  SER H C   1 
ATOM   3045  O  O   . SER C 2 21  ? 25.071  -52.927  -9.907  1.00 19.35  ? 21  SER H O   1 
ATOM   3046  C  CB  . SER C 2 21  ? 23.003  -54.748  -8.130  1.00 21.71  ? 21  SER H CB  1 
ATOM   3047  O  OG  . SER C 2 21  ? 21.675  -54.927  -7.664  1.00 23.98  ? 21  SER H OG  1 
ATOM   3048  N  N   . CYS C 2 22  ? 25.721  -53.215  -7.758  1.00 21.66  ? 22  CYS H N   1 
ATOM   3049  C  CA  . CYS C 2 22  ? 27.141  -53.111  -8.019  1.00 23.05  ? 22  CYS H CA  1 
ATOM   3050  C  C   . CYS C 2 22  ? 27.869  -54.103  -7.110  1.00 21.91  ? 22  CYS H C   1 
ATOM   3051  O  O   . CYS C 2 22  ? 28.045  -53.866  -5.909  1.00 20.35  ? 22  CYS H O   1 
ATOM   3052  C  CB  . CYS C 2 22  ? 27.607  -51.659  -7.817  1.00 25.49  ? 22  CYS H CB  1 
ATOM   3053  S  SG  . CYS C 2 22  ? 29.397  -51.402  -7.725  1.00 29.48  ? 22  CYS H SG  1 
ATOM   3054  N  N   . ALA C 2 23  ? 28.264  -55.231  -7.696  1.00 20.41  ? 23  ALA H N   1 
ATOM   3055  C  CA  . ALA C 2 23  ? 29.005  -56.264  -6.976  1.00 19.26  ? 23  ALA H CA  1 
ATOM   3056  C  C   . ALA C 2 23  ? 30.488  -55.918  -6.959  1.00 17.59  ? 23  ALA H C   1 
ATOM   3057  O  O   . ALA C 2 23  ? 31.087  -55.659  -8.002  1.00 17.63  ? 23  ALA H O   1 
ATOM   3058  C  CB  . ALA C 2 23  ? 28.772  -57.638  -7.614  1.00 17.56  ? 23  ALA H CB  1 
ATOM   3059  N  N   . ALA C 2 24  ? 31.064  -55.890  -5.761  1.00 17.70  ? 24  ALA H N   1 
ATOM   3060  C  CA  . ALA C 2 24  ? 32.499  -55.705  -5.589  1.00 16.37  ? 24  ALA H CA  1 
ATOM   3061  C  C   . ALA C 2 24  ? 33.133  -57.070  -5.490  1.00 15.93  ? 24  ALA H C   1 
ATOM   3062  O  O   . ALA C 2 24  ? 32.537  -57.995  -4.953  1.00 16.13  ? 24  ALA H O   1 
ATOM   3063  C  CB  . ALA C 2 24  ? 32.800  -54.901  -4.330  1.00 15.83  ? 24  ALA H CB  1 
ATOM   3064  N  N   . SER C 2 25  ? 34.344  -57.191  -6.025  1.00 17.17  ? 25  SER H N   1 
ATOM   3065  C  CA  . SER C 2 25  ? 35.159  -58.385  -5.844  1.00 16.62  ? 25  SER H CA  1 
ATOM   3066  C  C   . SER C 2 25  ? 36.630  -58.003  -5.724  1.00 14.37  ? 25  SER H C   1 
ATOM   3067  O  O   . SER C 2 25  ? 37.082  -57.036  -6.328  1.00 13.98  ? 25  SER H O   1 
ATOM   3068  C  CB  . SER C 2 25  ? 34.965  -59.349  -7.016  1.00 18.21  ? 25  SER H CB  1 
ATOM   3069  O  OG  . SER C 2 25  ? 35.091  -58.659  -8.243  1.00 19.73  ? 25  SER H OG  1 
ATOM   3070  N  N   . GLY C 2 26  ? 37.364  -58.762  -4.922  1.00 13.18  ? 26  GLY H N   1 
ATOM   3071  C  CA  . GLY C 2 26  ? 38.812  -58.626  -4.840  1.00 12.31  ? 26  GLY H CA  1 
ATOM   3072  C  C   . GLY C 2 26  ? 39.326  -57.631  -3.823  1.00 11.02  ? 26  GLY H C   1 
ATOM   3073  O  O   . GLY C 2 26  ? 40.530  -57.485  -3.693  1.00 10.15  ? 26  GLY H O   1 
ATOM   3074  N  N   . PHE C 2 27  ? 38.443  -56.929  -3.111  1.00 10.97  ? 27  PHE H N   1 
ATOM   3075  C  CA  . PHE C 2 27  ? 38.905  -55.980  -2.083  1.00 11.26  ? 27  PHE H CA  1 
ATOM   3076  C  C   . PHE C 2 27  ? 37.946  -55.807  -0.910  1.00 12.45  ? 27  PHE H C   1 
ATOM   3077  O  O   . PHE C 2 27  ? 36.822  -56.333  -0.925  1.00 12.99  ? 27  PHE H O   1 
ATOM   3078  C  CB  . PHE C 2 27  ? 39.263  -54.626  -2.718  1.00 11.31  ? 27  PHE H CB  1 
ATOM   3079  C  CG  . PHE C 2 27  ? 38.081  -53.765  -3.075  1.00 10.40  ? 27  PHE H CG  1 
ATOM   3080  C  CD1 . PHE C 2 27  ? 37.752  -52.667  -2.296  1.00 10.56  ? 27  PHE H CD1 1 
ATOM   3081  C  CD2 . PHE C 2 27  ? 37.323  -54.034  -4.207  1.00 10.44  ? 27  PHE H CD2 1 
ATOM   3082  C  CE1 . PHE C 2 27  ? 36.654  -51.860  -2.620  1.00 11.56  ? 27  PHE H CE1 1 
ATOM   3083  C  CE2 . PHE C 2 27  ? 36.236  -53.236  -4.548  1.00 11.69  ? 27  PHE H CE2 1 
ATOM   3084  C  CZ  . PHE C 2 27  ? 35.891  -52.148  -3.752  1.00 11.45  ? 27  PHE H CZ  1 
ATOM   3085  N  N   . THR C 2 28  ? 38.388  -55.077  0.114   1.00 13.96  ? 28  THR H N   1 
ATOM   3086  C  CA  . THR C 2 28  ? 37.610  -54.967  1.354   1.00 14.20  ? 28  THR H CA  1 
ATOM   3087  C  C   . THR C 2 28  ? 36.588  -53.854  1.236   1.00 14.95  ? 28  THR H C   1 
ATOM   3088  O  O   . THR C 2 28  ? 36.719  -52.776  1.831   1.00 15.74  ? 28  THR H O   1 
ATOM   3089  C  CB  . THR C 2 28  ? 38.491  -54.791  2.590   1.00 14.43  ? 28  THR H CB  1 
ATOM   3090  O  OG1 . THR C 2 28  ? 39.541  -55.762  2.558   1.00 15.68  ? 28  THR H OG1 1 
ATOM   3091  C  CG2 . THR C 2 28  ? 37.667  -55.000  3.863   1.00 14.85  ? 28  THR H CG2 1 
ATOM   3092  N  N   . PHE C 2 29  ? 35.558  -54.162  0.460   1.00 14.10  ? 29  PHE H N   1 
ATOM   3093  C  CA  . PHE C 2 29  ? 34.451  -53.264  0.168   1.00 14.18  ? 29  PHE H CA  1 
ATOM   3094  C  C   . PHE C 2 29  ? 33.892  -52.547  1.397   1.00 13.41  ? 29  PHE H C   1 
ATOM   3095  O  O   . PHE C 2 29  ? 33.603  -51.358  1.338   1.00 12.24  ? 29  PHE H O   1 
ATOM   3096  C  CB  . PHE C 2 29  ? 33.377  -54.089  -0.540  1.00 14.11  ? 29  PHE H CB  1 
ATOM   3097  C  CG  . PHE C 2 29  ? 32.065  -53.390  -0.740  1.00 13.81  ? 29  PHE H CG  1 
ATOM   3098  C  CD1 . PHE C 2 29  ? 31.845  -52.618  -1.865  1.00 13.05  ? 29  PHE H CD1 1 
ATOM   3099  C  CD2 . PHE C 2 29  ? 31.011  -53.603  0.147   1.00 13.93  ? 29  PHE H CD2 1 
ATOM   3100  C  CE1 . PHE C 2 29  ? 30.616  -52.019  -2.088  1.00 12.67  ? 29  PHE H CE1 1 
ATOM   3101  C  CE2 . PHE C 2 29  ? 29.775  -53.000  -0.058  1.00 14.16  ? 29  PHE H CE2 1 
ATOM   3102  C  CZ  . PHE C 2 29  ? 29.580  -52.202  -1.175  1.00 14.58  ? 29  PHE H CZ  1 
ATOM   3103  N  N   . SER C 2 30  ? 33.779  -53.261  2.511   1.00 13.72  ? 30  SER H N   1 
ATOM   3104  C  CA  . SER C 2 30  ? 33.196  -52.702  3.730   1.00 15.02  ? 30  SER H CA  1 
ATOM   3105  C  C   . SER C 2 30  ? 33.982  -51.543  4.359   1.00 15.03  ? 30  SER H C   1 
ATOM   3106  O  O   . SER C 2 30  ? 33.449  -50.843  5.214   1.00 15.14  ? 30  SER H O   1 
ATOM   3107  C  CB  . SER C 2 30  ? 32.999  -53.806  4.774   1.00 15.54  ? 30  SER H CB  1 
ATOM   3108  O  OG  . SER C 2 30  ? 34.225  -54.459  5.050   1.00 16.33  ? 30  SER H OG  1 
ATOM   3109  N  N   . ARG C 2 31  ? 35.228  -51.328  3.946   1.00 15.39  ? 31  ARG H N   1 
ATOM   3110  C  CA  . ARG C 2 31  ? 36.006  -50.185  4.453   1.00 16.05  ? 31  ARG H CA  1 
ATOM   3111  C  C   . ARG C 2 31  ? 35.806  -48.898  3.678   1.00 14.92  ? 31  ARG H C   1 
ATOM   3112  O  O   . ARG C 2 31  ? 36.245  -47.850  4.133   1.00 13.67  ? 31  ARG H O   1 
ATOM   3113  C  CB  . ARG C 2 31  ? 37.497  -50.503  4.458   1.00 16.53  ? 31  ARG H CB  1 
ATOM   3114  C  CG  . ARG C 2 31  ? 37.858  -51.519  5.484   1.00 19.08  ? 31  ARG H CG  1 
ATOM   3115  C  CD  . ARG C 2 31  ? 39.348  -51.746  5.554   1.00 20.94  ? 31  ARG H CD  1 
ATOM   3116  N  NE  . ARG C 2 31  ? 39.685  -52.217  6.889   1.00 23.82  ? 31  ARG H NE  1 
ATOM   3117  C  CZ  . ARG C 2 31  ? 40.896  -52.185  7.435   1.00 25.51  ? 31  ARG H CZ  1 
ATOM   3118  N  NH1 . ARG C 2 31  ? 41.947  -51.707  6.764   1.00 26.14  ? 31  ARG H NH1 1 
ATOM   3119  N  NH2 . ARG C 2 31  ? 41.047  -52.637  8.674   1.00 25.41  ? 31  ARG H NH2 1 
ATOM   3120  N  N   . TYR C 2 32  ? 35.158  -48.978  2.516   1.00 14.31  ? 32  TYR H N   1 
ATOM   3121  C  CA  . TYR C 2 32  ? 35.152  -47.875  1.553   1.00 13.85  ? 32  TYR H CA  1 
ATOM   3122  C  C   . TYR C 2 32  ? 33.842  -47.116  1.458   1.00 12.95  ? 32  TYR H C   1 
ATOM   3123  O  O   . TYR C 2 32  ? 32.789  -47.727  1.404   1.00 13.04  ? 32  TYR H O   1 
ATOM   3124  C  CB  . TYR C 2 32  ? 35.471  -48.415  0.148   1.00 13.37  ? 32  TYR H CB  1 
ATOM   3125  C  CG  . TYR C 2 32  ? 36.908  -48.762  -0.025  1.00 11.74  ? 32  TYR H CG  1 
ATOM   3126  C  CD1 . TYR C 2 32  ? 37.792  -47.852  -0.585  1.00 11.00  ? 32  TYR H CD1 1 
ATOM   3127  C  CD2 . TYR C 2 32  ? 37.401  -49.985  0.400   1.00 11.49  ? 32  TYR H CD2 1 
ATOM   3128  C  CE1 . TYR C 2 32  ? 39.122  -48.157  -0.732  1.00 10.21  ? 32  TYR H CE1 1 
ATOM   3129  C  CE2 . TYR C 2 32  ? 38.746  -50.300  0.259   1.00 10.56  ? 32  TYR H CE2 1 
ATOM   3130  C  CZ  . TYR C 2 32  ? 39.594  -49.378  -0.311  1.00 9.66   ? 32  TYR H CZ  1 
ATOM   3131  O  OH  . TYR C 2 32  ? 40.920  -49.656  -0.460  1.00 10.50  ? 32  TYR H OH  1 
ATOM   3132  N  N   . VAL C 2 33  ? 33.924  -45.786  1.402   1.00 12.13  ? 33  VAL H N   1 
ATOM   3133  C  CA  . VAL C 2 33  ? 32.834  -44.987  0.866   1.00 10.62  ? 33  VAL H CA  1 
ATOM   3134  C  C   . VAL C 2 33  ? 32.646  -45.391  -0.601  1.00 12.29  ? 33  VAL H C   1 
ATOM   3135  O  O   . VAL C 2 33  ? 33.626  -45.509  -1.363  1.00 11.75  ? 33  VAL H O   1 
ATOM   3136  C  CB  . VAL C 2 33  ? 33.094  -43.460  0.944   1.00 10.19  ? 33  VAL H CB  1 
ATOM   3137  C  CG1 . VAL C 2 33  ? 31.983  -42.698  0.210   1.00 9.62   ? 33  VAL H CG1 1 
ATOM   3138  C  CG2 . VAL C 2 33  ? 33.232  -42.974  2.413   1.00 8.51   ? 33  VAL H CG2 1 
ATOM   3139  N  N   . MET C 2 34  ? 31.386  -45.619  -0.979  1.00 13.43  ? 34  MET H N   1 
ATOM   3140  C  CA  . MET C 2 34  ? 31.019  -46.039  -2.324  1.00 14.15  ? 34  MET H CA  1 
ATOM   3141  C  C   . MET C 2 34  ? 30.107  -45.006  -2.955  1.00 15.22  ? 34  MET H C   1 
ATOM   3142  O  O   . MET C 2 34  ? 29.289  -44.400  -2.258  1.00 15.93  ? 34  MET H O   1 
ATOM   3143  C  CB  . MET C 2 34  ? 30.315  -47.382  -2.255  1.00 14.87  ? 34  MET H CB  1 
ATOM   3144  C  CG  . MET C 2 34  ? 31.237  -48.520  -1.800  1.00 14.32  ? 34  MET H CG  1 
ATOM   3145  S  SD  . MET C 2 34  ? 32.595  -48.826  -2.942  1.00 13.60  ? 34  MET H SD  1 
ATOM   3146  C  CE  . MET C 2 34  ? 31.717  -49.029  -4.508  1.00 10.67  ? 34  MET H CE  1 
ATOM   3147  N  N   . TRP C 2 35  ? 30.268  -44.813  -4.266  1.00 16.32  ? 35  TRP H N   1 
ATOM   3148  C  CA  . TRP C 2 35  ? 29.593  -43.746  -5.030  1.00 16.87  ? 35  TRP H CA  1 
ATOM   3149  C  C   . TRP C 2 35  ? 28.803  -44.289  -6.216  1.00 18.07  ? 35  TRP H C   1 
ATOM   3150  O  O   . TRP C 2 35  ? 29.153  -45.328  -6.792  1.00 17.66  ? 35  TRP H O   1 
ATOM   3151  C  CB  . TRP C 2 35  ? 30.617  -42.763  -5.620  1.00 15.50  ? 35  TRP H CB  1 
ATOM   3152  C  CG  . TRP C 2 35  ? 31.522  -42.112  -4.624  1.00 14.08  ? 35  TRP H CG  1 
ATOM   3153  C  CD1 . TRP C 2 35  ? 32.529  -42.704  -3.933  1.00 13.22  ? 35  TRP H CD1 1 
ATOM   3154  C  CD2 . TRP C 2 35  ? 31.518  -40.734  -4.229  1.00 13.72  ? 35  TRP H CD2 1 
ATOM   3155  N  NE1 . TRP C 2 35  ? 33.150  -41.793  -3.120  1.00 12.78  ? 35  TRP H NE1 1 
ATOM   3156  C  CE2 . TRP C 2 35  ? 32.548  -40.572  -3.278  1.00 13.80  ? 35  TRP H CE2 1 
ATOM   3157  C  CE3 . TRP C 2 35  ? 30.753  -39.620  -4.594  1.00 13.27  ? 35  TRP H CE3 1 
ATOM   3158  C  CZ2 . TRP C 2 35  ? 32.827  -39.340  -2.678  1.00 13.55  ? 35  TRP H CZ2 1 
ATOM   3159  C  CZ3 . TRP C 2 35  ? 31.020  -38.398  -3.988  1.00 13.48  ? 35  TRP H CZ3 1 
ATOM   3160  C  CH2 . TRP C 2 35  ? 32.050  -38.270  -3.041  1.00 14.47  ? 35  TRP H CH2 1 
ATOM   3161  N  N   . TRP C 2 36  ? 27.742  -43.570  -6.576  1.00 17.39  ? 36  TRP H N   1 
ATOM   3162  C  CA  . TRP C 2 36  ? 27.162  -43.661  -7.917  1.00 16.44  ? 36  TRP H CA  1 
ATOM   3163  C  C   . TRP C 2 36  ? 27.444  -42.348  -8.642  1.00 14.87  ? 36  TRP H C   1 
ATOM   3164  O  O   . TRP C 2 36  ? 27.215  -41.257  -8.116  1.00 13.83  ? 36  TRP H O   1 
ATOM   3165  C  CB  . TRP C 2 36  ? 25.654  -43.956  -7.889  1.00 14.91  ? 36  TRP H CB  1 
ATOM   3166  C  CG  . TRP C 2 36  ? 25.328  -45.330  -7.418  1.00 14.51  ? 36  TRP H CG  1 
ATOM   3167  C  CD1 . TRP C 2 36  ? 24.947  -45.687  -6.166  1.00 15.54  ? 36  TRP H CD1 1 
ATOM   3168  C  CD2 . TRP C 2 36  ? 25.335  -46.539  -8.196  1.00 14.97  ? 36  TRP H CD2 1 
ATOM   3169  N  NE1 . TRP C 2 36  ? 24.717  -47.045  -6.105  1.00 16.00  ? 36  TRP H NE1 1 
ATOM   3170  C  CE2 . TRP C 2 36  ? 24.947  -47.590  -7.338  1.00 14.98  ? 36  TRP H CE2 1 
ATOM   3171  C  CE3 . TRP C 2 36  ? 25.624  -46.832  -9.536  1.00 14.58  ? 36  TRP H CE3 1 
ATOM   3172  C  CZ2 . TRP C 2 36  ? 24.851  -48.911  -7.770  1.00 15.38  ? 36  TRP H CZ2 1 
ATOM   3173  C  CZ3 . TRP C 2 36  ? 25.529  -48.141  -9.969  1.00 14.86  ? 36  TRP H CZ3 1 
ATOM   3174  C  CH2 . TRP C 2 36  ? 25.144  -49.168  -9.087  1.00 16.14  ? 36  TRP H CH2 1 
ATOM   3175  N  N   . VAL C 2 37  ? 27.969  -42.479  -9.849  1.00 15.69  ? 37  VAL H N   1 
ATOM   3176  C  CA  . VAL C 2 37  ? 28.357  -41.353  -10.677 1.00 15.12  ? 37  VAL H CA  1 
ATOM   3177  C  C   . VAL C 2 37  ? 27.789  -41.654  -12.032 1.00 14.64  ? 37  VAL H C   1 
ATOM   3178  O  O   . VAL C 2 37  ? 27.982  -42.759  -12.534 1.00 14.29  ? 37  VAL H O   1 
ATOM   3179  C  CB  . VAL C 2 37  ? 29.901  -41.254  -10.796 1.00 14.59  ? 37  VAL H CB  1 
ATOM   3180  C  CG1 . VAL C 2 37  ? 30.309  -40.146  -11.749 1.00 13.56  ? 37  VAL H CG1 1 
ATOM   3181  C  CG2 . VAL C 2 37  ? 30.530  -41.053  -9.430  1.00 14.27  ? 37  VAL H CG2 1 
ATOM   3182  N  N   . ARG C 2 38  ? 27.110  -40.680  -12.631 1.00 14.91  ? 38  ARG H N   1 
ATOM   3183  C  CA  . ARG C 2 38  ? 26.503  -40.879  -13.942 1.00 14.43  ? 38  ARG H CA  1 
ATOM   3184  C  C   . ARG C 2 38  ? 27.070  -39.976  -15.037 1.00 14.82  ? 38  ARG H C   1 
ATOM   3185  O  O   . ARG C 2 38  ? 27.620  -38.907  -14.782 1.00 15.75  ? 38  ARG H O   1 
ATOM   3186  C  CB  . ARG C 2 38  ? 24.988  -40.720  -13.858 1.00 14.72  ? 38  ARG H CB  1 
ATOM   3187  C  CG  . ARG C 2 38  ? 24.519  -39.315  -13.551 1.00 15.32  ? 38  ARG H CG  1 
ATOM   3188  C  CD  . ARG C 2 38  ? 23.024  -39.290  -13.306 1.00 15.91  ? 38  ARG H CD  1 
ATOM   3189  N  NE  . ARG C 2 38  ? 22.529  -37.923  -13.137 1.00 16.91  ? 38  ARG H NE  1 
ATOM   3190  C  CZ  . ARG C 2 38  ? 21.270  -37.605  -12.826 1.00 17.07  ? 38  ARG H CZ  1 
ATOM   3191  N  NH1 . ARG C 2 38  ? 20.340  -38.548  -12.664 1.00 16.06  ? 38  ARG H NH1 1 
ATOM   3192  N  NH2 . ARG C 2 38  ? 20.938  -36.327  -12.695 1.00 16.60  ? 38  ARG H NH2 1 
ATOM   3193  N  N   . GLN C 2 39  ? 26.919  -40.432  -16.270 1.00 15.44  ? 39  GLN H N   1 
ATOM   3194  C  CA  . GLN C 2 39  ? 27.387  -39.702  -17.429 1.00 16.07  ? 39  GLN H CA  1 
ATOM   3195  C  C   . GLN C 2 39  ? 26.316  -39.793  -18.504 1.00 15.69  ? 39  GLN H C   1 
ATOM   3196  O  O   . GLN C 2 39  ? 26.076  -40.855  -19.063 1.00 13.76  ? 39  GLN H O   1 
ATOM   3197  C  CB  . GLN C 2 39  ? 28.711  -40.284  -17.922 1.00 15.41  ? 39  GLN H CB  1 
ATOM   3198  C  CG  . GLN C 2 39  ? 29.357  -39.502  -19.048 1.00 16.26  ? 39  GLN H CG  1 
ATOM   3199  C  CD  . GLN C 2 39  ? 30.789  -39.940  -19.299 1.00 16.49  ? 39  GLN H CD  1 
ATOM   3200  O  OE1 . GLN C 2 39  ? 31.103  -41.127  -19.220 1.00 17.27  ? 39  GLN H OE1 1 
ATOM   3201  N  NE2 . GLN C 2 39  ? 31.660  -38.987  -19.601 1.00 14.55  ? 39  GLN H NE2 1 
ATOM   3202  N  N   . ALA C 2 40  ? 25.656  -38.672  -18.765 1.00 17.86  ? 40  ALA H N   1 
ATOM   3203  C  CA  . ALA C 2 40  ? 24.685  -38.596  -19.848 1.00 19.82  ? 40  ALA H CA  1 
ATOM   3204  C  C   . ALA C 2 40  ? 25.426  -38.705  -21.181 1.00 20.93  ? 40  ALA H C   1 
ATOM   3205  O  O   . ALA C 2 40  ? 26.594  -38.313  -21.273 1.00 20.53  ? 40  ALA H O   1 
ATOM   3206  C  CB  . ALA C 2 40  ? 23.884  -37.291  -19.770 1.00 19.23  ? 40  ALA H CB  1 
ATOM   3207  N  N   . PRO C 2 41  ? 24.764  -39.270  -22.206 1.00 22.74  ? 41  PRO H N   1 
ATOM   3208  C  CA  . PRO C 2 41  ? 25.385  -39.445  -23.519 1.00 23.56  ? 41  PRO H CA  1 
ATOM   3209  C  C   . PRO C 2 41  ? 26.128  -38.194  -23.983 1.00 23.11  ? 41  PRO H C   1 
ATOM   3210  O  O   . PRO C 2 41  ? 25.531  -37.117  -24.073 1.00 21.83  ? 41  PRO H O   1 
ATOM   3211  C  CB  . PRO C 2 41  ? 24.189  -39.731  -24.439 1.00 24.35  ? 41  PRO H CB  1 
ATOM   3212  C  CG  . PRO C 2 41  ? 23.166  -40.361  -23.543 1.00 24.19  ? 41  PRO H CG  1 
ATOM   3213  C  CD  . PRO C 2 41  ? 23.377  -39.781  -22.172 1.00 23.74  ? 41  PRO H CD  1 
ATOM   3214  N  N   . GLY C 2 42  ? 27.425  -38.344  -24.241 1.00 23.18  ? 42  GLY H N   1 
ATOM   3215  C  CA  . GLY C 2 42  ? 28.273  -37.236  -24.683 1.00 23.34  ? 42  GLY H CA  1 
ATOM   3216  C  C   . GLY C 2 42  ? 28.418  -36.077  -23.703 1.00 22.88  ? 42  GLY H C   1 
ATOM   3217  O  O   . GLY C 2 42  ? 28.640  -34.945  -24.119 1.00 23.75  ? 42  GLY H O   1 
ATOM   3218  N  N   . LYS C 2 43  ? 28.290  -36.350  -22.408 1.00 21.82  ? 43  LYS H N   1 
ATOM   3219  C  CA  . LYS C 2 43  ? 28.443  -35.318  -21.377 1.00 21.72  ? 43  LYS H CA  1 
ATOM   3220  C  C   . LYS C 2 43  ? 29.562  -35.706  -20.414 1.00 21.00  ? 43  LYS H C   1 
ATOM   3221  O  O   . LYS C 2 43  ? 30.253  -36.710  -20.619 1.00 21.74  ? 43  LYS H O   1 
ATOM   3222  C  CB  . LYS C 2 43  ? 27.142  -35.123  -20.586 1.00 21.61  ? 43  LYS H CB  1 
ATOM   3223  C  CG  . LYS C 2 43  ? 25.874  -35.057  -21.409 1.00 22.15  ? 43  LYS H CG  1 
ATOM   3224  C  CD  . LYS C 2 43  ? 25.857  -33.904  -22.394 1.00 22.17  ? 43  LYS H CD  1 
ATOM   3225  C  CE  . LYS C 2 43  ? 24.557  -33.907  -23.186 1.00 22.25  ? 43  LYS H CE  1 
ATOM   3226  N  NZ  . LYS C 2 43  ? 24.310  -32.593  -23.839 1.00 22.60  ? 43  LYS H NZ  1 
ATOM   3227  N  N   . GLY C 2 44  ? 29.731  -34.908  -19.363 1.00 19.40  ? 44  GLY H N   1 
ATOM   3228  C  CA  . GLY C 2 44  ? 30.701  -35.202  -18.316 1.00 18.26  ? 44  GLY H CA  1 
ATOM   3229  C  C   . GLY C 2 44  ? 30.171  -36.064  -17.186 1.00 17.18  ? 44  GLY H C   1 
ATOM   3230  O  O   . GLY C 2 44  ? 29.064  -36.604  -17.239 1.00 17.18  ? 44  GLY H O   1 
ATOM   3231  N  N   . LEU C 2 45  ? 30.980  -36.177  -16.146 1.00 16.22  ? 45  LEU H N   1 
ATOM   3232  C  CA  . LEU C 2 45  ? 30.708  -37.079  -15.056 1.00 17.08  ? 45  LEU H CA  1 
ATOM   3233  C  C   . LEU C 2 45  ? 30.062  -36.291  -13.925 1.00 17.46  ? 45  LEU H C   1 
ATOM   3234  O  O   . LEU C 2 45  ? 30.552  -35.229  -13.551 1.00 18.60  ? 45  LEU H O   1 
ATOM   3235  C  CB  . LEU C 2 45  ? 32.012  -37.733  -14.601 1.00 17.46  ? 45  LEU H CB  1 
ATOM   3236  C  CG  . LEU C 2 45  ? 32.655  -38.632  -15.663 1.00 17.43  ? 45  LEU H CG  1 
ATOM   3237  C  CD1 . LEU C 2 45  ? 34.160  -38.687  -15.497 1.00 17.50  ? 45  LEU H CD1 1 
ATOM   3238  C  CD2 . LEU C 2 45  ? 32.046  -40.030  -15.618 1.00 17.11  ? 45  LEU H CD2 1 
ATOM   3239  N  N   . GLU C 2 46  ? 28.952  -36.810  -13.411 1.00 17.93  ? 46  GLU H N   1 
ATOM   3240  C  CA  . GLU C 2 46  ? 28.177  -36.164  -12.353 1.00 18.27  ? 46  GLU H CA  1 
ATOM   3241  C  C   . GLU C 2 46  ? 27.973  -37.162  -11.212 1.00 15.55  ? 46  GLU H C   1 
ATOM   3242  O  O   . GLU C 2 46  ? 27.310  -38.178  -11.400 1.00 13.25  ? 46  GLU H O   1 
ATOM   3243  C  CB  . GLU C 2 46  ? 26.810  -35.729  -12.906 1.00 19.93  ? 46  GLU H CB  1 
ATOM   3244  C  CG  . GLU C 2 46  ? 25.927  -34.983  -11.894 1.00 22.94  ? 46  GLU H CG  1 
ATOM   3245  C  CD  . GLU C 2 46  ? 24.460  -34.853  -12.315 1.00 25.22  ? 46  GLU H CD  1 
ATOM   3246  O  OE1 . GLU C 2 46  ? 24.086  -35.349  -13.399 1.00 24.91  ? 46  GLU H OE1 1 
ATOM   3247  O  OE2 . GLU C 2 46  ? 23.674  -34.239  -11.546 1.00 27.28  ? 46  GLU H OE2 1 
ATOM   3248  N  N   . TRP C 2 47  ? 28.527  -36.878  -10.037 1.00 15.44  ? 47  TRP H N   1 
ATOM   3249  C  CA  . TRP C 2 47  ? 28.254  -37.725  -8.867  1.00 16.22  ? 47  TRP H CA  1 
ATOM   3250  C  C   . TRP C 2 47  ? 26.784  -37.545  -8.451  1.00 15.27  ? 47  TRP H C   1 
ATOM   3251  O  O   . TRP C 2 47  ? 26.244  -36.435  -8.475  1.00 13.03  ? 47  TRP H O   1 
ATOM   3252  C  CB  . TRP C 2 47  ? 29.236  -37.480  -7.695  1.00 15.75  ? 47  TRP H CB  1 
ATOM   3253  C  CG  . TRP C 2 47  ? 28.925  -36.311  -6.812  1.00 17.67  ? 47  TRP H CG  1 
ATOM   3254  C  CD1 . TRP C 2 47  ? 29.412  -35.043  -6.936  1.00 17.93  ? 47  TRP H CD1 1 
ATOM   3255  C  CD2 . TRP C 2 47  ? 28.070  -36.300  -5.656  1.00 18.40  ? 47  TRP H CD2 1 
ATOM   3256  N  NE1 . TRP C 2 47  ? 28.908  -34.245  -5.949  1.00 18.34  ? 47  TRP H NE1 1 
ATOM   3257  C  CE2 . TRP C 2 47  ? 28.078  -34.985  -5.150  1.00 19.04  ? 47  TRP H CE2 1 
ATOM   3258  C  CE3 . TRP C 2 47  ? 27.293  -37.268  -5.010  1.00 17.71  ? 47  TRP H CE3 1 
ATOM   3259  C  CZ2 . TRP C 2 47  ? 27.337  -34.609  -4.023  1.00 19.62  ? 47  TRP H CZ2 1 
ATOM   3260  C  CZ3 . TRP C 2 47  ? 26.569  -36.904  -3.895  1.00 18.58  ? 47  TRP H CZ3 1 
ATOM   3261  C  CH2 . TRP C 2 47  ? 26.589  -35.582  -3.411  1.00 19.46  ? 47  TRP H CH2 1 
ATOM   3262  N  N   . VAL C 2 48  ? 26.150  -38.656  -8.101  1.00 15.44  ? 48  VAL H N   1 
ATOM   3263  C  CA  . VAL C 2 48  ? 24.725  -38.690  -7.798  1.00 17.03  ? 48  VAL H CA  1 
ATOM   3264  C  C   . VAL C 2 48  ? 24.496  -38.989  -6.327  1.00 16.66  ? 48  VAL H C   1 
ATOM   3265  O  O   . VAL C 2 48  ? 23.658  -38.360  -5.679  1.00 16.88  ? 48  VAL H O   1 
ATOM   3266  C  CB  . VAL C 2 48  ? 24.025  -39.767  -8.664  1.00 18.86  ? 48  VAL H CB  1 
ATOM   3267  C  CG1 . VAL C 2 48  ? 22.564  -39.835  -8.362  1.00 20.88  ? 48  VAL H CG1 1 
ATOM   3268  C  CG2 . VAL C 2 48  ? 24.229  -39.448  -10.136 1.00 21.64  ? 48  VAL H CG2 1 
ATOM   3269  N  N   . SER C 2 49  ? 25.247  -39.951  -5.794  1.00 17.33  ? 49  SER H N   1 
ATOM   3270  C  CA  . SER C 2 49  ? 25.071  -40.374  -4.408  1.00 17.45  ? 49  SER H CA  1 
ATOM   3271  C  C   . SER C 2 49  ? 26.308  -41.069  -3.856  1.00 16.28  ? 49  SER H C   1 
ATOM   3272  O  O   . SER C 2 49  ? 27.067  -41.698  -4.598  1.00 16.64  ? 49  SER H O   1 
ATOM   3273  C  CB  . SER C 2 49  ? 23.859  -41.318  -4.294  1.00 17.61  ? 49  SER H CB  1 
ATOM   3274  O  OG  . SER C 2 49  ? 23.512  -41.518  -2.925  1.00 18.64  ? 49  SER H OG  1 
ATOM   3275  N  N   . TYR C 2 50  ? 26.510  -40.949  -2.550  1.00 16.53  ? 50  TYR H N   1 
ATOM   3276  C  CA  . TYR C 2 50  ? 27.490  -41.783  -1.863  1.00 16.05  ? 50  TYR H CA  1 
ATOM   3277  C  C   . TYR C 2 50  ? 27.043  -42.166  -0.466  1.00 16.30  ? 50  TYR H C   1 
ATOM   3278  O  O   . TYR C 2 50  ? 26.117  -41.573  0.093   1.00 17.26  ? 50  TYR H O   1 
ATOM   3279  C  CB  . TYR C 2 50  ? 28.884  -41.136  -1.868  1.00 16.55  ? 50  TYR H CB  1 
ATOM   3280  C  CG  . TYR C 2 50  ? 29.045  -39.873  -1.060  1.00 16.47  ? 50  TYR H CG  1 
ATOM   3281  C  CD1 . TYR C 2 50  ? 29.554  -39.919  0.226   1.00 18.07  ? 50  TYR H CD1 1 
ATOM   3282  C  CD2 . TYR C 2 50  ? 28.730  -38.628  -1.592  1.00 17.93  ? 50  TYR H CD2 1 
ATOM   3283  C  CE1 . TYR C 2 50  ? 29.725  -38.766  0.974   1.00 18.06  ? 50  TYR H CE1 1 
ATOM   3284  C  CE2 . TYR C 2 50  ? 28.887  -37.459  -0.840  1.00 17.16  ? 50  TYR H CE2 1 
ATOM   3285  C  CZ  . TYR C 2 50  ? 29.387  -37.545  0.437   1.00 17.81  ? 50  TYR H CZ  1 
ATOM   3286  O  OH  . TYR C 2 50  ? 29.556  -36.422  1.202   1.00 20.12  ? 50  TYR H OH  1 
ATOM   3287  N  N   . ILE C 2 51  ? 27.718  -43.176  0.073   1.00 17.00  ? 51  ILE H N   1 
ATOM   3288  C  CA  . ILE C 2 51  ? 27.336  -43.827  1.311   1.00 14.60  ? 51  ILE H CA  1 
ATOM   3289  C  C   . ILE C 2 51  ? 28.585  -44.292  2.065   1.00 15.47  ? 51  ILE H C   1 
ATOM   3290  O  O   . ILE C 2 51  ? 29.556  -44.793  1.457   1.00 12.00  ? 51  ILE H O   1 
ATOM   3291  C  CB  . ILE C 2 51  ? 26.401  -45.031  1.029   1.00 14.32  ? 51  ILE H CB  1 
ATOM   3292  C  CG1 . ILE C 2 51  ? 25.783  -45.578  2.340   1.00 13.66  ? 51  ILE H CG1 1 
ATOM   3293  C  CG2 . ILE C 2 51  ? 27.131  -46.101  0.240   1.00 14.32  ? 51  ILE H CG2 1 
ATOM   3294  C  CD1 . ILE C 2 51  ? 24.723  -46.630  2.123   1.00 11.34  ? 51  ILE H CD1 1 
ATOM   3295  N  N   . TRP C 2 52  ? 28.558  -44.099  3.386   1.00 14.78  ? 52  TRP H N   1 
ATOM   3296  C  CA  . TRP C 2 52  ? 29.681  -44.441  4.257   1.00 16.17  ? 52  TRP H CA  1 
ATOM   3297  C  C   . TRP C 2 52  ? 29.820  -45.959  4.367   1.00 15.05  ? 52  TRP H C   1 
ATOM   3298  O  O   . TRP C 2 52  ? 28.889  -46.686  4.053   1.00 15.51  ? 52  TRP H O   1 
ATOM   3299  C  CB  . TRP C 2 52  ? 29.484  -43.829  5.657   1.00 17.76  ? 52  TRP H CB  1 
ATOM   3300  C  CG  . TRP C 2 52  ? 29.848  -42.388  5.760   1.00 18.67  ? 52  TRP H CG  1 
ATOM   3301  C  CD1 . TRP C 2 52  ? 29.937  -41.489  4.741   1.00 19.95  ? 52  TRP H CD1 1 
ATOM   3302  C  CD2 . TRP C 2 52  ? 30.125  -41.660  6.961   1.00 19.56  ? 52  TRP H CD2 1 
ATOM   3303  N  NE1 . TRP C 2 52  ? 30.271  -40.251  5.231   1.00 20.10  ? 52  TRP H NE1 1 
ATOM   3304  C  CE2 . TRP C 2 52  ? 30.395  -40.330  6.591   1.00 19.92  ? 52  TRP H CE2 1 
ATOM   3305  C  CE3 . TRP C 2 52  ? 30.184  -42.009  8.312   1.00 20.95  ? 52  TRP H CE3 1 
ATOM   3306  C  CZ2 . TRP C 2 52  ? 30.728  -39.345  7.522   1.00 20.76  ? 52  TRP H CZ2 1 
ATOM   3307  C  CZ3 . TRP C 2 52  ? 30.512  -41.022  9.244   1.00 21.91  ? 52  TRP H CZ3 1 
ATOM   3308  C  CH2 . TRP C 2 52  ? 30.773  -39.706  8.840   1.00 21.47  ? 52  TRP H CH2 1 
ATOM   3309  N  N   . PRO C 2 53  ? 30.991  -46.441  4.807   1.00 16.99  ? 53  PRO H N   1 
ATOM   3310  C  CA  . PRO C 2 53  ? 31.220  -47.873  4.982   1.00 17.85  ? 53  PRO H CA  1 
ATOM   3311  C  C   . PRO C 2 53  ? 30.163  -48.549  5.857   1.00 20.27  ? 53  PRO H C   1 
ATOM   3312  O  O   . PRO C 2 53  ? 29.654  -49.599  5.482   1.00 21.58  ? 53  PRO H O   1 
ATOM   3313  C  CB  . PRO C 2 53  ? 32.581  -47.917  5.667   1.00 17.15  ? 53  PRO H CB  1 
ATOM   3314  C  CG  . PRO C 2 53  ? 33.261  -46.696  5.244   1.00 17.15  ? 53  PRO H CG  1 
ATOM   3315  C  CD  . PRO C 2 53  ? 32.205  -45.658  5.109   1.00 17.62  ? 53  PRO H CD  1 
ATOM   3316  N  N   . SER C 2 54  ? 29.861  -47.923  6.995   1.00 22.17  ? 54  SER H N   1 
ATOM   3317  C  CA  . SER C 2 54  ? 28.875  -48.381  7.973   1.00 25.56  ? 54  SER H CA  1 
ATOM   3318  C  C   . SER C 2 54  ? 28.233  -47.186  8.673   1.00 25.22  ? 54  SER H C   1 
ATOM   3319  O  O   . SER C 2 54  ? 28.710  -46.053  8.565   1.00 22.83  ? 54  SER H O   1 
ATOM   3320  C  CB  . SER C 2 54  ? 29.543  -49.230  9.062   1.00 27.37  ? 54  SER H CB  1 
ATOM   3321  O  OG  . SER C 2 54  ? 30.107  -50.406  8.517   1.00 30.92  ? 54  SER H OG  1 
ATOM   3322  N  N   . GLY C 2 55  ? 27.163  -47.463  9.413   1.00 26.48  ? 55  GLY H N   1 
ATOM   3323  C  CA  . GLY C 2 55  ? 26.451  -46.433  10.179  1.00 27.22  ? 55  GLY H CA  1 
ATOM   3324  C  C   . GLY C 2 55  ? 25.263  -45.848  9.430   1.00 27.16  ? 55  GLY H C   1 
ATOM   3325  O  O   . GLY C 2 55  ? 24.299  -45.408  10.055  1.00 28.90  ? 55  GLY H O   1 
ATOM   3326  N  N   . GLY C 2 56  ? 25.349  -45.808  8.099   1.00 25.71  ? 56  GLY H N   1 
ATOM   3327  C  CA  . GLY C 2 56  ? 24.204  -45.488  7.252   1.00 24.51  ? 56  GLY H CA  1 
ATOM   3328  C  C   . GLY C 2 56  ? 24.075  -44.053  6.769   1.00 22.89  ? 56  GLY H C   1 
ATOM   3329  O  O   . GLY C 2 56  ? 23.018  -43.677  6.262   1.00 23.68  ? 56  GLY H O   1 
ATOM   3330  N  N   . ASN C 2 57  ? 25.126  -43.248  6.910   1.00 20.95  ? 57  ASN H N   1 
ATOM   3331  C  CA  . ASN C 2 57  ? 25.131  -41.902  6.331   1.00 18.93  ? 57  ASN H CA  1 
ATOM   3332  C  C   . ASN C 2 57  ? 25.048  -41.994  4.813   1.00 18.18  ? 57  ASN H C   1 
ATOM   3333  O  O   . ASN C 2 57  ? 25.854  -42.689  4.195   1.00 15.07  ? 57  ASN H O   1 
ATOM   3334  C  CB  . ASN C 2 57  ? 26.399  -41.133  6.702   1.00 19.23  ? 57  ASN H CB  1 
ATOM   3335  C  CG  . ASN C 2 57  ? 26.463  -40.772  8.165   1.00 19.87  ? 57  ASN H CG  1 
ATOM   3336  O  OD1 . ASN C 2 57  ? 25.570  -41.100  8.952   1.00 19.42  ? 57  ASN H OD1 1 
ATOM   3337  N  ND2 . ASN C 2 57  ? 27.532  -40.089  8.541   1.00 21.43  ? 57  ASN H ND2 1 
ATOM   3338  N  N   . THR C 2 58  ? 24.071  -41.297  4.226   1.00 17.49  ? 58  THR H N   1 
ATOM   3339  C  CA  . THR C 2 58  ? 23.902  -41.242  2.776   1.00 17.70  ? 58  THR H CA  1 
ATOM   3340  C  C   . THR C 2 58  ? 23.844  -39.791  2.313   1.00 17.31  ? 58  THR H C   1 
ATOM   3341  O  O   . THR C 2 58  ? 23.472  -38.902  3.075   1.00 18.24  ? 58  THR H O   1 
ATOM   3342  C  CB  . THR C 2 58  ? 22.634  -41.990  2.321   1.00 17.27  ? 58  THR H CB  1 
ATOM   3343  O  OG1 . THR C 2 58  ? 21.469  -41.351  2.856   1.00 17.28  ? 58  THR H OG1 1 
ATOM   3344  C  CG2 . THR C 2 58  ? 22.682  -43.450  2.775   1.00 16.13  ? 58  THR H CG2 1 
ATOM   3345  N  N   . TYR C 2 59  ? 24.238  -39.556  1.067   1.00 17.00  ? 59  TYR H N   1 
ATOM   3346  C  CA  . TYR C 2 59  ? 24.355  -38.195  0.526   1.00 16.16  ? 59  TYR H CA  1 
ATOM   3347  C  C   . TYR C 2 59  ? 23.895  -38.206  -0.919  1.00 16.27  ? 59  TYR H C   1 
ATOM   3348  O  O   . TYR C 2 59  ? 24.095  -39.184  -1.628  1.00 14.95  ? 59  TYR H O   1 
ATOM   3349  C  CB  . TYR C 2 59  ? 25.806  -37.689  0.619   1.00 15.40  ? 59  TYR H CB  1 
ATOM   3350  C  CG  . TYR C 2 59  ? 26.342  -37.719  2.028   1.00 14.41  ? 59  TYR H CG  1 
ATOM   3351  C  CD1 . TYR C 2 59  ? 26.217  -36.624  2.866   1.00 14.01  ? 59  TYR H CD1 1 
ATOM   3352  C  CD2 . TYR C 2 59  ? 26.932  -38.869  2.536   1.00 15.29  ? 59  TYR H CD2 1 
ATOM   3353  C  CE1 . TYR C 2 59  ? 26.688  -36.667  4.177   1.00 14.59  ? 59  TYR H CE1 1 
ATOM   3354  C  CE2 . TYR C 2 59  ? 27.396  -38.921  3.838   1.00 15.47  ? 59  TYR H CE2 1 
ATOM   3355  C  CZ  . TYR C 2 59  ? 27.276  -37.821  4.646   1.00 14.46  ? 59  TYR H CZ  1 
ATOM   3356  O  OH  . TYR C 2 59  ? 27.736  -37.895  5.927   1.00 16.43  ? 59  TYR H OH  1 
ATOM   3357  N  N   . TYR C 2 60  ? 23.272  -37.116  -1.342  1.00 16.49  ? 60  TYR H N   1 
ATOM   3358  C  CA  . TYR C 2 60  ? 22.662  -37.051  -2.655  1.00 16.80  ? 60  TYR H CA  1 
ATOM   3359  C  C   . TYR C 2 60  ? 22.874  -35.689  -3.297  1.00 16.72  ? 60  TYR H C   1 
ATOM   3360  O  O   . TYR C 2 60  ? 22.913  -34.657  -2.610  1.00 16.69  ? 60  TYR H O   1 
ATOM   3361  C  CB  . TYR C 2 60  ? 21.162  -37.345  -2.556  1.00 16.51  ? 60  TYR H CB  1 
ATOM   3362  C  CG  . TYR C 2 60  ? 20.820  -38.704  -1.969  1.00 16.42  ? 60  TYR H CG  1 
ATOM   3363  C  CD1 . TYR C 2 60  ? 20.803  -39.850  -2.770  1.00 16.82  ? 60  TYR H CD1 1 
ATOM   3364  C  CD2 . TYR C 2 60  ? 20.491  -38.840  -0.616  1.00 16.86  ? 60  TYR H CD2 1 
ATOM   3365  C  CE1 . TYR C 2 60  ? 20.486  -41.098  -2.235  1.00 16.53  ? 60  TYR H CE1 1 
ATOM   3366  C  CE2 . TYR C 2 60  ? 20.168  -40.074  -0.076  1.00 16.33  ? 60  TYR H CE2 1 
ATOM   3367  C  CZ  . TYR C 2 60  ? 20.161  -41.196  -0.891  1.00 16.87  ? 60  TYR H CZ  1 
ATOM   3368  O  OH  . TYR C 2 60  ? 19.845  -42.418  -0.361  1.00 17.29  ? 60  TYR H OH  1 
ATOM   3369  N  N   . ALA C 2 61  ? 23.019  -35.697  -4.620  1.00 16.60  ? 61  ALA H N   1 
ATOM   3370  C  CA  . ALA C 2 61  ? 23.096  -34.471  -5.395  1.00 15.70  ? 61  ALA H CA  1 
ATOM   3371  C  C   . ALA C 2 61  ? 21.707  -33.891  -5.429  1.00 16.06  ? 61  ALA H C   1 
ATOM   3372  O  O   . ALA C 2 61  ? 20.723  -34.634  -5.411  1.00 15.78  ? 61  ALA H O   1 
ATOM   3373  C  CB  . ALA C 2 61  ? 23.602  -34.746  -6.809  1.00 15.33  ? 61  ALA H CB  1 
ATOM   3374  N  N   . ASP C 2 62  ? 21.628  -32.563  -5.456  1.00 17.57  ? 62  ASP H N   1 
ATOM   3375  C  CA  . ASP C 2 62  ? 20.349  -31.864  -5.490  1.00 18.49  ? 62  ASP H CA  1 
ATOM   3376  C  C   . ASP C 2 62  ? 19.446  -32.453  -6.567  1.00 18.60  ? 62  ASP H C   1 
ATOM   3377  O  O   . ASP C 2 62  ? 18.256  -32.659  -6.330  1.00 18.87  ? 62  ASP H O   1 
ATOM   3378  C  CB  . ASP C 2 62  ? 20.562  -30.367  -5.741  1.00 19.89  ? 62  ASP H CB  1 
ATOM   3379  C  CG  . ASP C 2 62  ? 21.133  -29.642  -4.527  1.00 21.16  ? 62  ASP H CG  1 
ATOM   3380  O  OD1 . ASP C 2 62  ? 21.456  -30.323  -3.530  1.00 21.47  ? 62  ASP H OD1 1 
ATOM   3381  O  OD2 . ASP C 2 62  ? 21.250  -28.390  -4.568  1.00 21.87  ? 62  ASP H OD2 1 
ATOM   3382  N  N   . SER C 2 63  ? 20.033  -32.754  -7.726  1.00 18.58  ? 63  SER H N   1 
ATOM   3383  C  CA  . SER C 2 63  ? 19.300  -33.266  -8.886  1.00 19.28  ? 63  SER H CA  1 
ATOM   3384  C  C   . SER C 2 63  ? 18.487  -34.531  -8.614  1.00 19.48  ? 63  SER H C   1 
ATOM   3385  O  O   . SER C 2 63  ? 17.461  -34.729  -9.247  1.00 19.45  ? 63  SER H O   1 
ATOM   3386  C  CB  . SER C 2 63  ? 20.263  -33.530  -10.055 1.00 20.18  ? 63  SER H CB  1 
ATOM   3387  O  OG  . SER C 2 63  ? 21.313  -34.413  -9.683  1.00 21.92  ? 63  SER H OG  1 
ATOM   3388  N  N   . VAL C 2 64  ? 18.935  -35.370  -7.679  1.00 19.66  ? 64  VAL H N   1 
ATOM   3389  C  CA  . VAL C 2 64  ? 18.300  -36.675  -7.430  1.00 19.41  ? 64  VAL H CA  1 
ATOM   3390  C  C   . VAL C 2 64  ? 17.654  -36.820  -6.046  1.00 20.23  ? 64  VAL H C   1 
ATOM   3391  O  O   . VAL C 2 64  ? 17.064  -37.865  -5.745  1.00 20.54  ? 64  VAL H O   1 
ATOM   3392  C  CB  . VAL C 2 64  ? 19.320  -37.840  -7.626  1.00 18.68  ? 64  VAL H CB  1 
ATOM   3393  C  CG1 . VAL C 2 64  ? 19.791  -37.909  -9.082  1.00 17.21  ? 64  VAL H CG1 1 
ATOM   3394  C  CG2 . VAL C 2 64  ? 20.501  -37.697  -6.684  1.00 17.42  ? 64  VAL H CG2 1 
ATOM   3395  N  N   . LYS C 2 65  ? 17.741  -35.782  -5.218  1.00 20.57  ? 65  LYS H N   1 
ATOM   3396  C  CA  . LYS C 2 65  ? 17.340  -35.888  -3.808  1.00 22.02  ? 65  LYS H CA  1 
ATOM   3397  C  C   . LYS C 2 65  ? 15.824  -36.137  -3.630  1.00 20.12  ? 65  LYS H C   1 
ATOM   3398  O  O   . LYS C 2 65  ? 14.998  -35.512  -4.288  1.00 18.48  ? 65  LYS H O   1 
ATOM   3399  C  CB  . LYS C 2 65  ? 17.784  -34.641  -3.035  1.00 24.30  ? 65  LYS H CB  1 
ATOM   3400  C  CG  . LYS C 2 65  ? 17.838  -34.823  -1.523  1.00 26.66  ? 65  LYS H CG  1 
ATOM   3401  C  CD  . LYS C 2 65  ? 18.374  -33.567  -0.815  1.00 28.98  ? 65  LYS H CD  1 
ATOM   3402  C  CE  . LYS C 2 65  ? 19.916  -33.530  -0.743  1.00 30.73  ? 65  LYS H CE  1 
ATOM   3403  N  NZ  . LYS C 2 65  ? 20.590  -33.248  -2.055  1.00 31.16  ? 65  LYS H NZ  1 
ATOM   3404  N  N   . GLY C 2 66  ? 15.482  -37.079  -2.753  1.00 18.72  ? 66  GLY H N   1 
ATOM   3405  C  CA  . GLY C 2 66  ? 14.098  -37.496  -2.543  1.00 17.61  ? 66  GLY H CA  1 
ATOM   3406  C  C   . GLY C 2 66  ? 13.722  -38.696  -3.389  1.00 18.18  ? 66  GLY H C   1 
ATOM   3407  O  O   . GLY C 2 66  ? 12.950  -39.549  -2.956  1.00 18.79  ? 66  GLY H O   1 
ATOM   3408  N  N   . ARG C 2 67  ? 14.298  -38.777  -4.588  1.00 17.69  ? 67  ARG H N   1 
ATOM   3409  C  CA  . ARG C 2 67  ? 13.876  -39.729  -5.616  1.00 16.83  ? 67  ARG H CA  1 
ATOM   3410  C  C   . ARG C 2 67  ? 14.719  -41.005  -5.631  1.00 15.22  ? 67  ARG H C   1 
ATOM   3411  O  O   . ARG C 2 67  ? 14.224  -42.077  -5.988  1.00 13.35  ? 67  ARG H O   1 
ATOM   3412  C  CB  . ARG C 2 67  ? 13.934  -39.045  -6.991  1.00 16.83  ? 67  ARG H CB  1 
ATOM   3413  C  CG  . ARG C 2 67  ? 13.107  -37.777  -7.052  1.00 17.48  ? 67  ARG H CG  1 
ATOM   3414  C  CD  . ARG C 2 67  ? 13.019  -37.181  -8.452  1.00 18.20  ? 67  ARG H CD  1 
ATOM   3415  N  NE  . ARG C 2 67  ? 14.336  -36.879  -9.016  1.00 17.92  ? 67  ARG H NE  1 
ATOM   3416  C  CZ  . ARG C 2 67  ? 14.943  -37.595  -9.963  1.00 18.06  ? 67  ARG H CZ  1 
ATOM   3417  N  NH1 . ARG C 2 67  ? 14.366  -38.670  -10.499 1.00 17.65  ? 67  ARG H NH1 1 
ATOM   3418  N  NH2 . ARG C 2 67  ? 16.141  -37.222  -10.388 1.00 17.08  ? 67  ARG H NH2 1 
ATOM   3419  N  N   . PHE C 2 68  ? 15.992  -40.876  -5.259  1.00 15.38  ? 68  PHE H N   1 
ATOM   3420  C  CA  . PHE C 2 68  ? 16.950  -41.985  -5.299  1.00 14.92  ? 68  PHE H CA  1 
ATOM   3421  C  C   . PHE C 2 68  ? 17.347  -42.367  -3.874  1.00 15.27  ? 68  PHE H C   1 
ATOM   3422  O  O   . PHE C 2 68  ? 17.488  -41.499  -3.011  1.00 14.66  ? 68  PHE H O   1 
ATOM   3423  C  CB  . PHE C 2 68  ? 18.213  -41.587  -6.074  1.00 14.78  ? 68  PHE H CB  1 
ATOM   3424  C  CG  . PHE C 2 68  ? 18.045  -41.501  -7.583  1.00 14.88  ? 68  PHE H CG  1 
ATOM   3425  C  CD1 . PHE C 2 68  ? 16.794  -41.504  -8.201  1.00 15.03  ? 68  PHE H CD1 1 
ATOM   3426  C  CD2 . PHE C 2 68  ? 19.179  -41.379  -8.388  1.00 15.65  ? 68  PHE H CD2 1 
ATOM   3427  C  CE1 . PHE C 2 68  ? 16.676  -41.402  -9.588  1.00 15.45  ? 68  PHE H CE1 1 
ATOM   3428  C  CE2 . PHE C 2 68  ? 19.079  -41.284  -9.780  1.00 15.52  ? 68  PHE H CE2 1 
ATOM   3429  C  CZ  . PHE C 2 68  ? 17.826  -41.298  -10.385 1.00 16.18  ? 68  PHE H CZ  1 
ATOM   3430  N  N   . THR C 2 69  ? 17.533  -43.664  -3.636  1.00 15.62  ? 69  THR H N   1 
ATOM   3431  C  CA  . THR C 2 69  ? 18.024  -44.162  -2.353  1.00 15.56  ? 69  THR H CA  1 
ATOM   3432  C  C   . THR C 2 69  ? 19.230  -45.047  -2.573  1.00 15.47  ? 69  THR H C   1 
ATOM   3433  O  O   . THR C 2 69  ? 19.147  -46.061  -3.277  1.00 16.24  ? 69  THR H O   1 
ATOM   3434  C  CB  . THR C 2 69  ? 16.958  -44.973  -1.625  1.00 15.22  ? 69  THR H CB  1 
ATOM   3435  O  OG1 . THR C 2 69  ? 15.733  -44.246  -1.654  1.00 15.93  ? 69  THR H OG1 1 
ATOM   3436  C  CG2 . THR C 2 69  ? 17.361  -45.244  -0.174  1.00 13.22  ? 69  THR H CG2 1 
ATOM   3437  N  N   . ILE C 2 70  ? 20.356  -44.658  -1.986  1.00 15.62  ? 70  ILE H N   1 
ATOM   3438  C  CA  . ILE C 2 70  ? 21.572  -45.461  -2.082  1.00 15.28  ? 70  ILE H CA  1 
ATOM   3439  C  C   . ILE C 2 70  ? 21.591  -46.361  -0.868  1.00 15.21  ? 70  ILE H C   1 
ATOM   3440  O  O   . ILE C 2 70  ? 21.110  -45.981  0.192   1.00 14.42  ? 70  ILE H O   1 
ATOM   3441  C  CB  . ILE C 2 70  ? 22.857  -44.580  -2.151  1.00 14.79  ? 70  ILE H CB  1 
ATOM   3442  C  CG1 . ILE C 2 70  ? 24.068  -45.425  -2.527  1.00 13.91  ? 70  ILE H CG1 1 
ATOM   3443  C  CG2 . ILE C 2 70  ? 23.113  -43.850  -0.818  1.00 14.69  ? 70  ILE H CG2 1 
ATOM   3444  C  CD1 . ILE C 2 70  ? 25.366  -44.638  -2.631  1.00 12.12  ? 70  ILE H CD1 1 
ATOM   3445  N  N   . SER C 2 71  ? 22.139  -47.559  -1.024  1.00 16.95  ? 71  SER H N   1 
ATOM   3446  C  CA  . SER C 2 71  ? 22.269  -48.495  0.103   1.00 16.01  ? 71  SER H CA  1 
ATOM   3447  C  C   . SER C 2 71  ? 23.346  -49.525  -0.203  1.00 15.12  ? 71  SER H C   1 
ATOM   3448  O  O   . SER C 2 71  ? 23.881  -49.557  -1.323  1.00 15.52  ? 71  SER H O   1 
ATOM   3449  C  CB  . SER C 2 71  ? 20.936  -49.173  0.405   1.00 15.64  ? 71  SER H CB  1 
ATOM   3450  O  OG  . SER C 2 71  ? 20.443  -49.841  -0.735  1.00 16.52  ? 71  SER H OG  1 
ATOM   3451  N  N   . ARG C 2 72  ? 23.684  -50.335  0.799   1.00 12.80  ? 72  ARG H N   1 
ATOM   3452  C  CA  . ARG C 2 72  ? 24.753  -51.325  0.660   1.00 12.09  ? 72  ARG H CA  1 
ATOM   3453  C  C   . ARG C 2 72  ? 24.521  -52.564  1.538   1.00 12.35  ? 72  ARG H C   1 
ATOM   3454  O  O   . ARG C 2 72  ? 24.030  -52.465  2.658   1.00 8.11   ? 72  ARG H O   1 
ATOM   3455  C  CB  . ARG C 2 72  ? 26.110  -50.699  0.995   1.00 11.28  ? 72  ARG H CB  1 
ATOM   3456  C  CG  . ARG C 2 72  ? 26.334  -50.385  2.485   1.00 9.37   ? 72  ARG H CG  1 
ATOM   3457  C  CD  . ARG C 2 72  ? 27.502  -49.424  2.670   1.00 10.35  ? 72  ARG H CD  1 
ATOM   3458  N  NE  . ARG C 2 72  ? 28.785  -50.028  2.302   1.00 11.33  ? 72  ARG H NE  1 
ATOM   3459  C  CZ  . ARG C 2 72  ? 29.875  -49.350  1.921   1.00 12.59  ? 72  ARG H CZ  1 
ATOM   3460  N  NH1 . ARG C 2 72  ? 29.871  -48.021  1.799   1.00 12.78  ? 72  ARG H NH1 1 
ATOM   3461  N  NH2 . ARG C 2 72  ? 30.978  -50.019  1.622   1.00 12.06  ? 72  ARG H NH2 1 
ATOM   3462  N  N   . ASP C 2 73  ? 24.880  -53.726  1.001   1.00 13.57  ? 73  ASP H N   1 
ATOM   3463  C  CA  . ASP C 2 73  ? 24.877  -54.965  1.752   1.00 13.30  ? 73  ASP H CA  1 
ATOM   3464  C  C   . ASP C 2 73  ? 26.338  -55.396  1.870   1.00 13.83  ? 73  ASP H C   1 
ATOM   3465  O  O   . ASP C 2 73  ? 26.898  -55.982  0.952   1.00 15.45  ? 73  ASP H O   1 
ATOM   3466  C  CB  . ASP C 2 73  ? 24.014  -56.011  1.039   1.00 12.81  ? 73  ASP H CB  1 
ATOM   3467  C  CG  . ASP C 2 73  ? 23.845  -57.290  1.845   1.00 13.67  ? 73  ASP H CG  1 
ATOM   3468  O  OD1 . ASP C 2 73  ? 24.659  -57.536  2.762   1.00 14.45  ? 73  ASP H OD1 1 
ATOM   3469  O  OD2 . ASP C 2 73  ? 22.889  -58.055  1.562   1.00 13.40  ? 73  ASP H OD2 1 
ATOM   3470  N  N   . ASN C 2 74  ? 26.956  -55.080  3.001   1.00 14.51  ? 74  ASN H N   1 
ATOM   3471  C  CA  . ASN C 2 74  ? 28.365  -55.391  3.222   1.00 16.12  ? 74  ASN H CA  1 
ATOM   3472  C  C   . ASN C 2 74  ? 28.665  -56.891  3.317   1.00 16.55  ? 74  ASN H C   1 
ATOM   3473  O  O   . ASN C 2 74  ? 29.803  -57.309  3.088   1.00 18.84  ? 74  ASN H O   1 
ATOM   3474  C  CB  . ASN C 2 74  ? 28.895  -54.657  4.465   1.00 16.99  ? 74  ASN H CB  1 
ATOM   3475  C  CG  . ASN C 2 74  ? 29.257  -53.194  4.186   1.00 17.77  ? 74  ASN H CG  1 
ATOM   3476  O  OD1 . ASN C 2 74  ? 29.196  -52.731  3.046   1.00 16.30  ? 74  ASN H OD1 1 
ATOM   3477  N  ND2 . ASN C 2 74  ? 29.648  -52.467  5.234   1.00 16.95  ? 74  ASN H ND2 1 
ATOM   3478  N  N   . SER C 2 75  ? 27.656  -57.700  3.635   1.00 14.98  ? 75  SER H N   1 
ATOM   3479  C  CA  . SER C 2 75  ? 27.833  -59.152  3.677   1.00 14.44  ? 75  SER H CA  1 
ATOM   3480  C  C   . SER C 2 75  ? 27.891  -59.786  2.274   1.00 14.44  ? 75  SER H C   1 
ATOM   3481  O  O   . SER C 2 75  ? 28.413  -60.877  2.125   1.00 14.95  ? 75  SER H O   1 
ATOM   3482  C  CB  . SER C 2 75  ? 26.730  -59.809  4.513   1.00 13.39  ? 75  SER H CB  1 
ATOM   3483  O  OG  . SER C 2 75  ? 25.472  -59.698  3.875   1.00 13.00  ? 75  SER H OG  1 
ATOM   3484  N  N   . LYS C 2 76  ? 27.364  -59.103  1.260   1.00 14.72  ? 76  LYS H N   1 
ATOM   3485  C  CA  . LYS C 2 76  ? 27.452  -59.562  -0.133  1.00 14.86  ? 76  LYS H CA  1 
ATOM   3486  C  C   . LYS C 2 76  ? 28.435  -58.744  -0.957  1.00 15.48  ? 76  LYS H C   1 
ATOM   3487  O  O   . LYS C 2 76  ? 28.621  -59.022  -2.148  1.00 16.69  ? 76  LYS H O   1 
ATOM   3488  C  CB  . LYS C 2 76  ? 26.088  -59.459  -0.806  1.00 15.48  ? 76  LYS H CB  1 
ATOM   3489  C  CG  . LYS C 2 76  ? 25.063  -60.411  -0.277  1.00 15.82  ? 76  LYS H CG  1 
ATOM   3490  C  CD  . LYS C 2 76  ? 23.766  -60.276  -1.042  1.00 16.55  ? 76  LYS H CD  1 
ATOM   3491  C  CE  . LYS C 2 76  ? 22.683  -61.116  -0.408  1.00 16.98  ? 76  LYS H CE  1 
ATOM   3492  N  NZ  . LYS C 2 76  ? 21.434  -61.028  -1.202  1.00 18.77  ? 76  LYS H NZ  1 
ATOM   3493  N  N   . ASN C 2 77  ? 29.052  -57.743  -0.324  1.00 14.89  ? 77  ASN H N   1 
ATOM   3494  C  CA  . ASN C 2 77  ? 29.894  -56.750  -1.001  1.00 14.48  ? 77  ASN H CA  1 
ATOM   3495  C  C   . ASN C 2 77  ? 29.206  -56.102  -2.184  1.00 13.98  ? 77  ASN H C   1 
ATOM   3496  O  O   . ASN C 2 77  ? 29.774  -55.994  -3.270  1.00 15.34  ? 77  ASN H O   1 
ATOM   3497  C  CB  . ASN C 2 77  ? 31.244  -57.340  -1.411  1.00 14.57  ? 77  ASN H CB  1 
ATOM   3498  C  CG  . ASN C 2 77  ? 32.188  -57.470  -0.246  1.00 14.87  ? 77  ASN H CG  1 
ATOM   3499  O  OD1 . ASN C 2 77  ? 31.864  -57.069  0.881   1.00 15.52  ? 77  ASN H OD1 1 
ATOM   3500  N  ND2 . ASN C 2 77  ? 33.374  -58.012  -0.507  1.00 13.38  ? 77  ASN H ND2 1 
ATOM   3501  N  N   . THR C 2 78  ? 27.988  -55.638  -1.936  1.00 12.91  ? 78  THR H N   1 
ATOM   3502  C  CA  . THR C 2 78  ? 27.124  -55.128  -2.977  1.00 13.84  ? 78  THR H CA  1 
ATOM   3503  C  C   . THR C 2 78  ? 26.586  -53.743  -2.612  1.00 12.79  ? 78  THR H C   1 
ATOM   3504  O  O   . THR C 2 78  ? 26.293  -53.458  -1.456  1.00 13.19  ? 78  THR H O   1 
ATOM   3505  C  CB  . THR C 2 78  ? 25.972  -56.125  -3.270  1.00 15.46  ? 78  THR H CB  1 
ATOM   3506  O  OG1 . THR C 2 78  ? 26.524  -57.382  -3.713  1.00 16.21  ? 78  THR H OG1 1 
ATOM   3507  C  CG2 . THR C 2 78  ? 25.060  -55.583  -4.354  1.00 16.86  ? 78  THR H CG2 1 
ATOM   3508  N  N   . LEU C 2 79  ? 26.495  -52.893  -3.624  1.00 12.67  ? 79  LEU H N   1 
ATOM   3509  C  CA  . LEU C 2 79  ? 25.997  -51.534  -3.510  1.00 13.67  ? 79  LEU H CA  1 
ATOM   3510  C  C   . LEU C 2 79  ? 24.735  -51.439  -4.349  1.00 14.46  ? 79  LEU H C   1 
ATOM   3511  O  O   . LEU C 2 79  ? 24.653  -52.046  -5.417  1.00 14.08  ? 79  LEU H O   1 
ATOM   3512  C  CB  . LEU C 2 79  ? 27.052  -50.555  -4.039  1.00 13.64  ? 79  LEU H CB  1 
ATOM   3513  C  CG  . LEU C 2 79  ? 26.740  -49.056  -4.018  1.00 13.49  ? 79  LEU H CG  1 
ATOM   3514  C  CD1 . LEU C 2 79  ? 26.765  -48.524  -2.573  1.00 12.93  ? 79  LEU H CD1 1 
ATOM   3515  C  CD2 . LEU C 2 79  ? 27.720  -48.292  -4.917  1.00 11.35  ? 79  LEU H CD2 1 
ATOM   3516  N  N   . TYR C 2 80  ? 23.748  -50.691  -3.867  1.00 16.02  ? 80  TYR H N   1 
ATOM   3517  C  CA  . TYR C 2 80  ? 22.481  -50.541  -4.599  1.00 16.73  ? 80  TYR H CA  1 
ATOM   3518  C  C   . TYR C 2 80  ? 22.136  -49.084  -4.831  1.00 15.84  ? 80  TYR H C   1 
ATOM   3519  O  O   . TYR C 2 80  ? 22.613  -48.213  -4.122  1.00 16.95  ? 80  TYR H O   1 
ATOM   3520  C  CB  . TYR C 2 80  ? 21.323  -51.210  -3.854  1.00 16.18  ? 80  TYR H CB  1 
ATOM   3521  C  CG  . TYR C 2 80  ? 21.602  -52.637  -3.502  1.00 17.15  ? 80  TYR H CG  1 
ATOM   3522  C  CD1 . TYR C 2 80  ? 21.431  -53.654  -4.444  1.00 17.30  ? 80  TYR H CD1 1 
ATOM   3523  C  CD2 . TYR C 2 80  ? 22.064  -52.980  -2.232  1.00 17.87  ? 80  TYR H CD2 1 
ATOM   3524  C  CE1 . TYR C 2 80  ? 21.709  -54.973  -4.132  1.00 16.41  ? 80  TYR H CE1 1 
ATOM   3525  C  CE2 . TYR C 2 80  ? 22.328  -54.298  -1.905  1.00 17.75  ? 80  TYR H CE2 1 
ATOM   3526  C  CZ  . TYR C 2 80  ? 22.148  -55.288  -2.858  1.00 17.05  ? 80  TYR H CZ  1 
ATOM   3527  O  OH  . TYR C 2 80  ? 22.422  -56.588  -2.535  1.00 16.43  ? 80  TYR H OH  1 
ATOM   3528  N  N   . LEU C 2 81  ? 21.328  -48.845  -5.857  1.00 15.72  ? 81  LEU H N   1 
ATOM   3529  C  CA  . LEU C 2 81  ? 20.668  -47.569  -6.066  1.00 14.79  ? 81  LEU H CA  1 
ATOM   3530  C  C   . LEU C 2 81  ? 19.219  -47.820  -6.462  1.00 15.51  ? 81  LEU H C   1 
ATOM   3531  O  O   . LEU C 2 81  ? 18.942  -48.373  -7.536  1.00 14.72  ? 81  LEU H O   1 
ATOM   3532  C  CB  . LEU C 2 81  ? 21.371  -46.781  -7.159  1.00 15.20  ? 81  LEU H CB  1 
ATOM   3533  C  CG  . LEU C 2 81  ? 20.898  -45.354  -7.412  1.00 14.95  ? 81  LEU H CG  1 
ATOM   3534  C  CD1 . LEU C 2 81  ? 21.141  -44.490  -6.171  1.00 13.90  ? 81  LEU H CD1 1 
ATOM   3535  C  CD2 . LEU C 2 81  ? 21.636  -44.808  -8.638  1.00 14.18  ? 81  LEU H CD2 1 
ATOM   3536  N  N   . GLN C 2 82  ? 18.300  -47.407  -5.592  1.00 14.91  ? 82  GLN H N   1 
ATOM   3537  C  CA  . GLN C 2 82  ? 16.883  -47.483  -5.893  1.00 15.25  ? 82  GLN H CA  1 
ATOM   3538  C  C   . GLN C 2 82  ? 16.481  -46.136  -6.454  1.00 15.50  ? 82  GLN H C   1 
ATOM   3539  O  O   . GLN C 2 82  ? 16.526  -45.126  -5.767  1.00 13.95  ? 82  GLN H O   1 
ATOM   3540  C  CB  . GLN C 2 82  ? 16.077  -47.836  -4.632  1.00 15.83  ? 82  GLN H CB  1 
ATOM   3541  C  CG  . GLN C 2 82  ? 14.564  -47.841  -4.808  1.00 15.70  ? 82  GLN H CG  1 
ATOM   3542  C  CD  . GLN C 2 82  ? 14.124  -48.778  -5.899  1.00 16.06  ? 82  GLN H CD  1 
ATOM   3543  O  OE1 . GLN C 2 82  ? 14.483  -49.952  -5.898  1.00 16.02  ? 82  GLN H OE1 1 
ATOM   3544  N  NE2 . GLN C 2 82  ? 13.358  -48.261  -6.854  1.00 16.42  ? 82  GLN H NE2 1 
ATOM   3545  N  N   . MET C 2 83  ? 16.109  -46.130  -7.724  1.00 18.84  ? 83  MET H N   1 
ATOM   3546  C  CA  . MET C 2 83  ? 15.744  -44.915  -8.426  1.00 20.70  ? 83  MET H CA  1 
ATOM   3547  C  C   . MET C 2 83  ? 14.250  -44.922  -8.635  1.00 20.82  ? 83  MET H C   1 
ATOM   3548  O  O   . MET C 2 83  ? 13.732  -45.849  -9.232  1.00 21.16  ? 83  MET H O   1 
ATOM   3549  C  CB  . MET C 2 83  ? 16.443  -44.876  -9.783  1.00 22.33  ? 83  MET H CB  1 
ATOM   3550  C  CG  . MET C 2 83  ? 17.954  -44.935  -9.716  1.00 22.52  ? 83  MET H CG  1 
ATOM   3551  S  SD  . MET C 2 83  ? 18.688  -45.008  -11.360 1.00 26.33  ? 83  MET H SD  1 
ATOM   3552  C  CE  . MET C 2 83  ? 18.132  -46.614  -11.910 1.00 25.65  ? 83  MET H CE  1 
ATOM   3553  N  N   . ASN C 2 84  ? 13.570  -43.897  -8.125  1.00 22.54  ? 84  ASN H N   1 
ATOM   3554  C  CA  . ASN C 2 84  ? 12.114  -43.741  -8.270  1.00 22.94  ? 84  ASN H CA  1 
ATOM   3555  C  C   . ASN C 2 84  ? 11.785  -42.408  -8.937  1.00 22.36  ? 84  ASN H C   1 
ATOM   3556  O  O   . ASN C 2 84  ? 12.654  -41.534  -9.046  1.00 21.44  ? 84  ASN H O   1 
ATOM   3557  C  CB  . ASN C 2 84  ? 11.432  -43.807  -6.903  1.00 23.81  ? 84  ASN H CB  1 
ATOM   3558  C  CG  . ASN C 2 84  ? 11.608  -45.154  -6.225  1.00 25.38  ? 84  ASN H CG  1 
ATOM   3559  O  OD1 . ASN C 2 84  ? 11.298  -46.188  -6.795  1.00 28.05  ? 84  ASN H OD1 1 
ATOM   3560  N  ND2 . ASN C 2 84  ? 12.090  -45.142  -4.995  1.00 27.11  ? 84  ASN H ND2 1 
ATOM   3561  N  N   . SER C 2 85  ? 10.538  -42.254  -9.381  1.00 22.20  ? 85  SER H N   1 
ATOM   3562  C  CA  . SER C 2 85  ? 10.098  -41.032  -10.071 1.00 21.85  ? 85  SER H CA  1 
ATOM   3563  C  C   . SER C 2 85  ? 11.111  -40.647  -11.150 1.00 21.97  ? 85  SER H C   1 
ATOM   3564  O  O   . SER C 2 85  ? 11.557  -39.496  -11.227 1.00 21.38  ? 85  SER H O   1 
ATOM   3565  C  CB  . SER C 2 85  ? 9.951   -39.880  -9.079  1.00 21.65  ? 85  SER H CB  1 
ATOM   3566  O  OG  . SER C 2 85  ? 9.223   -40.278  -7.939  1.00 22.99  ? 85  SER H OG  1 
ATOM   3567  N  N   . LEU C 2 86  ? 11.485  -41.628  -11.965 1.00 20.82  ? 86  LEU H N   1 
ATOM   3568  C  CA  . LEU C 2 86  ? 12.560  -41.445  -12.914 1.00 20.68  ? 86  LEU H CA  1 
ATOM   3569  C  C   . LEU C 2 86  ? 12.131  -40.455  -13.981 1.00 20.88  ? 86  LEU H C   1 
ATOM   3570  O  O   . LEU C 2 86  ? 10.969  -40.433  -14.382 1.00 22.44  ? 86  LEU H O   1 
ATOM   3571  C  CB  . LEU C 2 86  ? 12.989  -42.787  -13.528 1.00 21.14  ? 86  LEU H CB  1 
ATOM   3572  C  CG  . LEU C 2 86  ? 14.021  -43.594  -12.723 1.00 21.31  ? 86  LEU H CG  1 
ATOM   3573  C  CD1 . LEU C 2 86  ? 14.120  -45.028  -13.232 1.00 21.30  ? 86  LEU H CD1 1 
ATOM   3574  C  CD2 . LEU C 2 86  ? 15.391  -42.918  -12.766 1.00 20.52  ? 86  LEU H CD2 1 
ATOM   3575  N  N   . ARG C 2 87  ? 13.076  -39.625  -14.408 1.00 21.09  ? 87  ARG H N   1 
ATOM   3576  C  CA  . ARG C 2 87  ? 12.842  -38.599  -15.420 1.00 21.91  ? 87  ARG H CA  1 
ATOM   3577  C  C   . ARG C 2 87  ? 13.708  -38.854  -16.646 1.00 20.69  ? 87  ARG H C   1 
ATOM   3578  O  O   . ARG C 2 87  ? 14.702  -39.571  -16.573 1.00 18.74  ? 87  ARG H O   1 
ATOM   3579  C  CB  . ARG C 2 87  ? 13.168  -37.225  -14.843 1.00 23.47  ? 87  ARG H CB  1 
ATOM   3580  C  CG  . ARG C 2 87  ? 12.204  -36.788  -13.762 1.00 24.76  ? 87  ARG H CG  1 
ATOM   3581  C  CD  . ARG C 2 87  ? 12.856  -35.845  -12.754 1.00 26.43  ? 87  ARG H CD  1 
ATOM   3582  N  NE  . ARG C 2 87  ? 11.877  -35.359  -11.778 1.00 28.25  ? 87  ARG H NE  1 
ATOM   3583  C  CZ  . ARG C 2 87  ? 12.127  -34.460  -10.827 1.00 28.78  ? 87  ARG H CZ  1 
ATOM   3584  N  NH1 . ARG C 2 87  ? 13.335  -33.924  -10.697 1.00 28.89  ? 87  ARG H NH1 1 
ATOM   3585  N  NH2 . ARG C 2 87  ? 11.156  -34.095  -10.000 1.00 29.19  ? 87  ARG H NH2 1 
ATOM   3586  N  N   . ALA C 2 88  ? 13.314  -38.258  -17.766 1.00 20.08  ? 88  ALA H N   1 
ATOM   3587  C  CA  . ALA C 2 88  ? 14.066  -38.342  -19.012 1.00 20.19  ? 88  ALA H CA  1 
ATOM   3588  C  C   . ALA C 2 88  ? 15.527  -37.931  -18.824 1.00 18.83  ? 88  ALA H C   1 
ATOM   3589  O  O   . ALA C 2 88  ? 16.427  -38.573  -19.363 1.00 19.20  ? 88  ALA H O   1 
ATOM   3590  C  CB  . ALA C 2 88  ? 13.404  -37.473  -20.081 1.00 20.00  ? 88  ALA H CB  1 
ATOM   3591  N  N   . GLU C 2 89  ? 15.751  -36.883  -18.033 1.00 18.24  ? 89  GLU H N   1 
ATOM   3592  C  CA  . GLU C 2 89  ? 17.098  -36.356  -17.791 1.00 18.17  ? 89  GLU H CA  1 
ATOM   3593  C  C   . GLU C 2 89  ? 17.943  -37.223  -16.855 1.00 16.56  ? 89  GLU H C   1 
ATOM   3594  O  O   . GLU C 2 89  ? 19.107  -36.943  -16.643 1.00 17.51  ? 89  GLU H O   1 
ATOM   3595  C  CB  . GLU C 2 89  ? 17.052  -34.913  -17.260 1.00 18.80  ? 89  GLU H CB  1 
ATOM   3596  C  CG  . GLU C 2 89  ? 16.415  -34.739  -15.887 1.00 20.40  ? 89  GLU H CG  1 
ATOM   3597  C  CD  . GLU C 2 89  ? 14.965  -34.253  -15.935 1.00 23.27  ? 89  GLU H CD  1 
ATOM   3598  O  OE1 . GLU C 2 89  ? 14.299  -34.363  -16.999 1.00 24.75  ? 89  GLU H OE1 1 
ATOM   3599  O  OE2 . GLU C 2 89  ? 14.485  -33.766  -14.885 1.00 25.20  ? 89  GLU H OE2 1 
ATOM   3600  N  N   . ASP C 2 90  ? 17.356  -38.260  -16.281 1.00 16.52  ? 90  ASP H N   1 
ATOM   3601  C  CA  . ASP C 2 90  ? 18.116  -39.257  -15.536 1.00 15.60  ? 90  ASP H CA  1 
ATOM   3602  C  C   . ASP C 2 90  ? 18.785  -40.248  -16.484 1.00 16.23  ? 90  ASP H C   1 
ATOM   3603  O  O   . ASP C 2 90  ? 19.575  -41.093  -16.049 1.00 17.34  ? 90  ASP H O   1 
ATOM   3604  C  CB  . ASP C 2 90  ? 17.204  -40.011  -14.564 1.00 14.34  ? 90  ASP H CB  1 
ATOM   3605  C  CG  . ASP C 2 90  ? 16.579  -39.094  -13.518 1.00 14.89  ? 90  ASP H CG  1 
ATOM   3606  O  OD1 . ASP C 2 90  ? 17.282  -38.171  -13.035 1.00 13.34  ? 90  ASP H OD1 1 
ATOM   3607  O  OD2 . ASP C 2 90  ? 15.385  -39.301  -13.179 1.00 14.49  ? 90  ASP H OD2 1 
ATOM   3608  N  N   . THR C 2 91  ? 18.462  -40.159  -17.774 1.00 15.40  ? 91  THR H N   1 
ATOM   3609  C  CA  . THR C 2 91  ? 19.081  -41.026  -18.770 1.00 14.19  ? 91  THR H CA  1 
ATOM   3610  C  C   . THR C 2 91  ? 20.582  -40.809  -18.803 1.00 15.81  ? 91  THR H C   1 
ATOM   3611  O  O   . THR C 2 91  ? 21.051  -39.678  -18.954 1.00 15.72  ? 91  THR H O   1 
ATOM   3612  C  CB  . THR C 2 91  ? 18.465  -40.803  -20.155 1.00 12.58  ? 91  THR H CB  1 
ATOM   3613  O  OG1 . THR C 2 91  ? 17.130  -41.326  -20.141 1.00 10.28  ? 91  THR H OG1 1 
ATOM   3614  C  CG2 . THR C 2 91  ? 19.291  -41.484  -21.254 1.00 8.67   ? 91  THR H CG2 1 
ATOM   3615  N  N   . ALA C 2 92  ? 21.321  -41.906  -18.635 1.00 17.30  ? 92  ALA H N   1 
ATOM   3616  C  CA  . ALA C 2 92  ? 22.772  -41.878  -18.551 1.00 17.05  ? 92  ALA H CA  1 
ATOM   3617  C  C   . ALA C 2 92  ? 23.344  -43.280  -18.324 1.00 17.99  ? 92  ALA H C   1 
ATOM   3618  O  O   . ALA C 2 92  ? 22.615  -44.229  -17.983 1.00 18.18  ? 92  ALA H O   1 
ATOM   3619  C  CB  . ALA C 2 92  ? 23.214  -40.963  -17.409 1.00 17.13  ? 92  ALA H CB  1 
ATOM   3620  N  N   . VAL C 2 93  ? 24.653  -43.393  -18.523 1.00 16.40  ? 93  VAL H N   1 
ATOM   3621  C  CA  . VAL C 2 93  ? 25.426  -44.513  -18.005 1.00 17.62  ? 93  VAL H CA  1 
ATOM   3622  C  C   . VAL C 2 93  ? 25.680  -44.232  -16.512 1.00 18.51  ? 93  VAL H C   1 
ATOM   3623  O  O   . VAL C 2 93  ? 26.172  -43.157  -16.145 1.00 17.88  ? 93  VAL H O   1 
ATOM   3624  C  CB  . VAL C 2 93  ? 26.778  -44.691  -18.765 1.00 16.56  ? 93  VAL H CB  1 
ATOM   3625  C  CG1 . VAL C 2 93  ? 27.585  -45.848  -18.184 1.00 14.89  ? 93  VAL H CG1 1 
ATOM   3626  C  CG2 . VAL C 2 93  ? 26.525  -44.929  -20.256 1.00 14.93  ? 93  VAL H CG2 1 
ATOM   3627  N  N   . TYR C 2 94  ? 25.322  -45.188  -15.658 1.00 18.94  ? 94  TYR H N   1 
ATOM   3628  C  CA  . TYR C 2 94  ? 25.599  -45.080  -14.224 1.00 18.35  ? 94  TYR H CA  1 
ATOM   3629  C  C   . TYR C 2 94  ? 26.787  -45.958  -13.864 1.00 18.09  ? 94  TYR H C   1 
ATOM   3630  O  O   . TYR C 2 94  ? 26.800  -47.156  -14.166 1.00 18.69  ? 94  TYR H O   1 
ATOM   3631  C  CB  . TYR C 2 94  ? 24.366  -45.457  -13.405 1.00 18.64  ? 94  TYR H CB  1 
ATOM   3632  C  CG  . TYR C 2 94  ? 23.290  -44.383  -13.435 1.00 17.95  ? 94  TYR H CG  1 
ATOM   3633  C  CD1 . TYR C 2 94  ? 22.991  -43.639  -12.303 1.00 17.72  ? 94  TYR H CD1 1 
ATOM   3634  C  CD2 . TYR C 2 94  ? 22.591  -44.103  -14.611 1.00 17.89  ? 94  TYR H CD2 1 
ATOM   3635  C  CE1 . TYR C 2 94  ? 22.016  -42.651  -12.327 1.00 17.72  ? 94  TYR H CE1 1 
ATOM   3636  C  CE2 . TYR C 2 94  ? 21.627  -43.123  -14.653 1.00 17.78  ? 94  TYR H CE2 1 
ATOM   3637  C  CZ  . TYR C 2 94  ? 21.338  -42.392  -13.503 1.00 18.25  ? 94  TYR H CZ  1 
ATOM   3638  O  OH  . TYR C 2 94  ? 20.371  -41.410  -13.532 1.00 17.53  ? 94  TYR H OH  1 
ATOM   3639  N  N   . TYR C 2 95  ? 27.794  -45.343  -13.249 1.00 16.66  ? 95  TYR H N   1 
ATOM   3640  C  CA  . TYR C 2 95  ? 28.942  -46.062  -12.705 1.00 16.67  ? 95  TYR H CA  1 
ATOM   3641  C  C   . TYR C 2 95  ? 28.885  -46.078  -11.178 1.00 17.78  ? 95  TYR H C   1 
ATOM   3642  O  O   . TYR C 2 95  ? 28.460  -45.097  -10.553 1.00 15.40  ? 95  TYR H O   1 
ATOM   3643  C  CB  . TYR C 2 95  ? 30.253  -45.385  -13.112 1.00 16.98  ? 95  TYR H CB  1 
ATOM   3644  C  CG  . TYR C 2 95  ? 30.501  -45.238  -14.602 1.00 17.30  ? 95  TYR H CG  1 
ATOM   3645  C  CD1 . TYR C 2 95  ? 31.053  -46.276  -15.336 1.00 16.87  ? 95  TYR H CD1 1 
ATOM   3646  C  CD2 . TYR C 2 95  ? 30.218  -44.043  -15.264 1.00 16.39  ? 95  TYR H CD2 1 
ATOM   3647  C  CE1 . TYR C 2 95  ? 31.297  -46.140  -16.696 1.00 17.83  ? 95  TYR H CE1 1 
ATOM   3648  C  CE2 . TYR C 2 95  ? 30.456  -43.899  -16.616 1.00 16.23  ? 95  TYR H CE2 1 
ATOM   3649  C  CZ  . TYR C 2 95  ? 31.002  -44.947  -17.330 1.00 17.46  ? 95  TYR H CZ  1 
ATOM   3650  O  OH  . TYR C 2 95  ? 31.256  -44.816  -18.683 1.00 15.81  ? 95  TYR H OH  1 
ATOM   3651  N  N   . CYS C 2 96  ? 29.330  -47.181  -10.578 1.00 19.67  ? 96  CYS H N   1 
ATOM   3652  C  CA  . CYS C 2 96  ? 29.687  -47.174  -9.158  1.00 21.05  ? 96  CYS H CA  1 
ATOM   3653  C  C   . CYS C 2 96  ? 31.200  -47.050  -9.053  1.00 18.14  ? 96  CYS H C   1 
ATOM   3654  O  O   . CYS C 2 96  ? 31.941  -47.482  -9.946  1.00 17.03  ? 96  CYS H O   1 
ATOM   3655  C  CB  . CYS C 2 96  ? 29.177  -48.415  -8.417  1.00 24.83  ? 96  CYS H CB  1 
ATOM   3656  S  SG  . CYS C 2 96  ? 29.845  -49.908  -9.054  1.00 29.52  ? 96  CYS H SG  1 
ATOM   3657  N  N   . ALA C 2 97  ? 31.645  -46.427  -7.967  1.00 16.04  ? 97  ALA H N   1 
ATOM   3658  C  CA  . ALA C 2 97  ? 33.057  -46.163  -7.740  1.00 14.19  ? 97  ALA H CA  1 
ATOM   3659  C  C   . ALA C 2 97  ? 33.362  -46.143  -6.250  1.00 13.68  ? 97  ALA H C   1 
ATOM   3660  O  O   . ALA C 2 97  ? 32.494  -45.816  -5.443  1.00 14.31  ? 97  ALA H O   1 
ATOM   3661  C  CB  . ALA C 2 97  ? 33.478  -44.829  -8.396  1.00 11.43  ? 97  ALA H CB  1 
ATOM   3662  N  N   . SER C 2 98  ? 34.597  -46.508  -5.900  1.00 12.78  ? 98  SER H N   1 
ATOM   3663  C  CA  . SER C 2 98  ? 35.051  -46.500  -4.525  1.00 12.14  ? 98  SER H CA  1 
ATOM   3664  C  C   . SER C 2 98  ? 35.900  -45.241  -4.267  1.00 13.61  ? 98  SER H C   1 
ATOM   3665  O  O   . SER C 2 98  ? 36.547  -44.718  -5.179  1.00 13.72  ? 98  SER H O   1 
ATOM   3666  C  CB  . SER C 2 98  ? 35.857  -47.768  -4.247  1.00 12.87  ? 98  SER H CB  1 
ATOM   3667  O  OG  . SER C 2 98  ? 36.993  -47.847  -5.103  1.00 11.23  ? 98  SER H OG  1 
ATOM   3668  N  N   . SER C 2 99  ? 35.877  -44.763  -3.027  1.00 13.89  ? 99  SER H N   1 
ATOM   3669  C  CA  . SER C 2 99  ? 36.689  -43.619  -2.600  1.00 13.70  ? 99  SER H CA  1 
ATOM   3670  C  C   . SER C 2 99  ? 38.145  -44.023  -2.468  1.00 13.30  ? 99  SER H C   1 
ATOM   3671  O  O   . SER C 2 99  ? 38.464  -44.996  -1.794  1.00 10.99  ? 99  SER H O   1 
ATOM   3672  C  CB  . SER C 2 99  ? 36.226  -43.092  -1.222  1.00 13.87  ? 99  SER H CB  1 
ATOM   3673  O  OG  . SER C 2 99  ? 35.388  -41.961  -1.312  1.00 11.89  ? 99  SER H OG  1 
ATOM   3674  N  N   . TYR C 2 100 ? 39.027  -43.252  -3.092  1.00 13.44  ? 100 TYR H N   1 
ATOM   3675  C  CA  . TYR C 2 100 ? 40.445  -43.368  -2.848  1.00 13.07  ? 100 TYR H CA  1 
ATOM   3676  C  C   . TYR C 2 100 ? 40.722  -43.123  -1.356  1.00 12.19  ? 100 TYR H C   1 
ATOM   3677  O  O   . TYR C 2 100 ? 40.119  -42.234  -0.747  1.00 10.42  ? 100 TYR H O   1 
ATOM   3678  C  CB  . TYR C 2 100 ? 41.193  -42.376  -3.747  1.00 14.13  ? 100 TYR H CB  1 
ATOM   3679  C  CG  . TYR C 2 100 ? 42.700  -42.312  -3.575  1.00 13.87  ? 100 TYR H CG  1 
ATOM   3680  C  CD1 . TYR C 2 100 ? 43.524  -43.284  -4.126  1.00 15.72  ? 100 TYR H CD1 1 
ATOM   3681  C  CD2 . TYR C 2 100 ? 43.294  -41.257  -2.896  1.00 13.54  ? 100 TYR H CD2 1 
ATOM   3682  C  CE1 . TYR C 2 100 ? 44.910  -43.218  -3.987  1.00 15.02  ? 100 TYR H CE1 1 
ATOM   3683  C  CE2 . TYR C 2 100 ? 44.669  -41.173  -2.753  1.00 14.27  ? 100 TYR H CE2 1 
ATOM   3684  C  CZ  . TYR C 2 100 ? 45.476  -42.158  -3.298  1.00 15.13  ? 100 TYR H CZ  1 
ATOM   3685  O  OH  . TYR C 2 100 ? 46.846  -42.076  -3.156  1.00 13.50  ? 100 TYR H OH  1 
ATOM   3686  N  N   . ASP C 2 101 ? 41.592  -43.958  -0.782  1.00 11.94  ? 101 ASP H N   1 
ATOM   3687  C  CA  . ASP C 2 101 ? 42.014  -43.872  0.622   1.00 13.12  ? 101 ASP H CA  1 
ATOM   3688  C  C   . ASP C 2 101 ? 40.834  -44.014  1.597   1.00 12.11  ? 101 ASP H C   1 
ATOM   3689  O  O   . ASP C 2 101 ? 40.756  -43.313  2.615   1.00 12.96  ? 101 ASP H O   1 
ATOM   3690  C  CB  . ASP C 2 101 ? 42.792  -42.563  0.871   1.00 14.75  ? 101 ASP H CB  1 
ATOM   3691  C  CG  . ASP C 2 101 ? 43.606  -42.600  2.158   1.00 14.28  ? 101 ASP H CG  1 
ATOM   3692  O  OD1 . ASP C 2 101 ? 44.330  -43.584  2.391   1.00 15.32  ? 101 ASP H OD1 1 
ATOM   3693  O  OD2 . ASP C 2 101 ? 43.499  -41.652  2.952   1.00 14.17  ? 101 ASP H OD2 1 
ATOM   3694  N  N   . PHE C 2 102 ? 39.936  -44.942  1.269   1.00 11.56  ? 102 PHE H N   1 
ATOM   3695  C  CA  . PHE C 2 102 ? 38.722  -45.238  2.038   1.00 12.32  ? 102 PHE H CA  1 
ATOM   3696  C  C   . PHE C 2 102 ? 37.620  -44.162  1.954   1.00 11.91  ? 102 PHE H C   1 
ATOM   3697  O  O   . PHE C 2 102 ? 36.479  -44.498  1.651   1.00 14.47  ? 102 PHE H O   1 
ATOM   3698  C  CB  . PHE C 2 102 ? 39.030  -45.576  3.504   1.00 12.60  ? 102 PHE H CB  1 
ATOM   3699  C  CG  . PHE C 2 102 ? 39.990  -46.749  3.691   1.00 12.33  ? 102 PHE H CG  1 
ATOM   3700  C  CD1 . PHE C 2 102 ? 39.904  -47.893  2.891   1.00 11.39  ? 102 PHE H CD1 1 
ATOM   3701  C  CD2 . PHE C 2 102 ? 40.948  -46.713  4.702   1.00 12.72  ? 102 PHE H CD2 1 
ATOM   3702  C  CE1 . PHE C 2 102 ? 40.755  -48.960  3.060   1.00 11.00  ? 102 PHE H CE1 1 
ATOM   3703  C  CE2 . PHE C 2 102 ? 41.822  -47.801  4.902   1.00 12.64  ? 102 PHE H CE2 1 
ATOM   3704  C  CZ  . PHE C 2 102 ? 41.723  -48.926  4.073   1.00 13.28  ? 102 PHE H CZ  1 
ATOM   3705  N  N   . TRP C 2 103 ? 37.923  -42.895  2.227   1.00 10.54  ? 103 TRP H N   1 
ATOM   3706  C  CA  . TRP C 2 103 ? 36.872  -41.865  2.165   1.00 10.25  ? 103 TRP H CA  1 
ATOM   3707  C  C   . TRP C 2 103 ? 37.330  -40.489  1.704   1.00 7.14   ? 103 TRP H C   1 
ATOM   3708  O  O   . TRP C 2 103 ? 36.778  -39.483  2.120   1.00 5.80   ? 103 TRP H O   1 
ATOM   3709  C  CB  . TRP C 2 103 ? 36.130  -41.758  3.508   1.00 13.00  ? 103 TRP H CB  1 
ATOM   3710  C  CG  . TRP C 2 103 ? 37.027  -41.637  4.656   1.00 14.06  ? 103 TRP H CG  1 
ATOM   3711  C  CD1 . TRP C 2 103 ? 37.759  -40.557  4.990   1.00 16.68  ? 103 TRP H CD1 1 
ATOM   3712  C  CD2 . TRP C 2 103 ? 37.305  -42.639  5.631   1.00 15.02  ? 103 TRP H CD2 1 
ATOM   3713  N  NE1 . TRP C 2 103 ? 38.482  -40.808  6.128   1.00 19.09  ? 103 TRP H NE1 1 
ATOM   3714  C  CE2 . TRP C 2 103 ? 38.229  -42.093  6.533   1.00 18.14  ? 103 TRP H CE2 1 
ATOM   3715  C  CE3 . TRP C 2 103 ? 36.859  -43.940  5.833   1.00 16.09  ? 103 TRP H CE3 1 
ATOM   3716  C  CZ2 . TRP C 2 103 ? 38.725  -42.808  7.621   1.00 18.19  ? 103 TRP H CZ2 1 
ATOM   3717  C  CZ3 . TRP C 2 103 ? 37.349  -44.648  6.903   1.00 17.12  ? 103 TRP H CZ3 1 
ATOM   3718  C  CH2 . TRP C 2 103 ? 38.276  -44.084  7.785   1.00 18.02  ? 103 TRP H CH2 1 
ATOM   3719  N  N   . SER C 2 104 ? 38.319  -40.441  0.822   1.00 5.55   ? 104 SER H N   1 
ATOM   3720  C  CA  . SER C 2 104 ? 38.650  -39.187  0.175   1.00 5.01   ? 104 SER H CA  1 
ATOM   3721  C  C   . SER C 2 104 ? 37.562  -38.889  -0.848  1.00 4.30   ? 104 SER H C   1 
ATOM   3722  O  O   . SER C 2 104 ? 36.650  -39.704  -1.065  1.00 3.02   ? 104 SER H O   1 
ATOM   3723  C  CB  . SER C 2 104 ? 40.034  -39.229  -0.495  1.00 4.19   ? 104 SER H CB  1 
ATOM   3724  O  OG  . SER C 2 104 ? 39.946  -39.796  -1.791  1.00 4.87   ? 104 SER H OG  1 
ATOM   3725  N  N   . ASN C 2 105 ? 37.668  -37.717  -1.469  1.00 4.50   ? 105 ASN H N   1 
ATOM   3726  C  CA  . ASN C 2 105 ? 36.776  -37.316  -2.562  1.00 4.53   ? 105 ASN H CA  1 
ATOM   3727  C  C   . ASN C 2 105 ? 37.401  -37.537  -3.950  1.00 3.59   ? 105 ASN H C   1 
ATOM   3728  O  O   . ASN C 2 105 ? 36.928  -37.005  -4.935  1.00 5.04   ? 105 ASN H O   1 
ATOM   3729  C  CB  . ASN C 2 105 ? 36.351  -35.861  -2.350  1.00 4.84   ? 105 ASN H CB  1 
ATOM   3730  C  CG  . ASN C 2 105 ? 35.273  -35.734  -1.310  1.00 2.72   ? 105 ASN H CG  1 
ATOM   3731  O  OD1 . ASN C 2 105 ? 34.229  -36.343  -1.445  1.00 4.09   ? 105 ASN H OD1 1 
ATOM   3732  N  ND2 . ASN C 2 105 ? 35.515  -34.950  -0.275  1.00 2.00   ? 105 ASN H ND2 1 
ATOM   3733  N  N   . ALA C 2 106 ? 38.468  -38.327  -4.008  1.00 4.38   ? 106 ALA H N   1 
ATOM   3734  C  CA  . ALA C 2 106 ? 38.994  -38.851  -5.268  1.00 4.84   ? 106 ALA H CA  1 
ATOM   3735  C  C   . ALA C 2 106 ? 38.507  -40.282  -5.416  1.00 7.68   ? 106 ALA H C   1 
ATOM   3736  O  O   . ALA C 2 106 ? 38.147  -40.928  -4.429  1.00 7.80   ? 106 ALA H O   1 
ATOM   3737  C  CB  . ALA C 2 106 ? 40.501  -38.812  -5.283  1.00 2.64   ? 106 ALA H CB  1 
ATOM   3738  N  N   . PHE C 2 107 ? 38.504  -40.773  -6.651  1.00 10.26  ? 107 PHE H N   1 
ATOM   3739  C  CA  . PHE C 2 107 ? 38.001  -42.115  -6.954  1.00 11.60  ? 107 PHE H CA  1 
ATOM   3740  C  C   . PHE C 2 107 ? 39.134  -43.083  -7.204  1.00 11.24  ? 107 PHE H C   1 
ATOM   3741  O  O   . PHE C 2 107 ? 40.120  -42.747  -7.870  1.00 9.43   ? 107 PHE H O   1 
ATOM   3742  C  CB  . PHE C 2 107 ? 37.050  -42.077  -8.157  1.00 12.28  ? 107 PHE H CB  1 
ATOM   3743  C  CG  . PHE C 2 107 ? 35.907  -41.118  -7.971  1.00 13.12  ? 107 PHE H CG  1 
ATOM   3744  C  CD1 . PHE C 2 107 ? 34.787  -41.486  -7.227  1.00 13.09  ? 107 PHE H CD1 1 
ATOM   3745  C  CD2 . PHE C 2 107 ? 35.978  -39.824  -8.479  1.00 13.53  ? 107 PHE H CD2 1 
ATOM   3746  C  CE1 . PHE C 2 107 ? 33.735  -40.595  -7.023  1.00 12.74  ? 107 PHE H CE1 1 
ATOM   3747  C  CE2 . PHE C 2 107 ? 34.921  -38.924  -8.287  1.00 13.87  ? 107 PHE H CE2 1 
ATOM   3748  C  CZ  . PHE C 2 107 ? 33.792  -39.320  -7.560  1.00 12.78  ? 107 PHE H CZ  1 
ATOM   3749  N  N   . ASP C 2 108 ? 38.970  -44.285  -6.654  1.00 11.23  ? 108 ASP H N   1 
ATOM   3750  C  CA  . ASP C 2 108 ? 39.951  -45.353  -6.754  1.00 12.03  ? 108 ASP H CA  1 
ATOM   3751  C  C   . ASP C 2 108 ? 39.557  -46.304  -7.886  1.00 11.68  ? 108 ASP H C   1 
ATOM   3752  O  O   . ASP C 2 108 ? 40.216  -46.339  -8.932  1.00 13.10  ? 108 ASP H O   1 
ATOM   3753  C  CB  . ASP C 2 108 ? 40.035  -46.073  -5.410  1.00 13.26  ? 108 ASP H CB  1 
ATOM   3754  C  CG  . ASP C 2 108 ? 41.098  -47.140  -5.366  1.00 14.36  ? 108 ASP H CG  1 
ATOM   3755  O  OD1 . ASP C 2 108 ? 42.008  -47.162  -6.210  1.00 16.50  ? 108 ASP H OD1 1 
ATOM   3756  O  OD2 . ASP C 2 108 ? 41.039  -47.962  -4.441  1.00 17.64  ? 108 ASP H OD2 1 
ATOM   3757  N  N   . ILE C 2 109 ? 38.474  -47.044  -7.687  1.00 10.30  ? 109 ILE H N   1 
ATOM   3758  C  CA  . ILE C 2 109 ? 37.988  -48.010  -8.668  1.00 12.49  ? 109 ILE H CA  1 
ATOM   3759  C  C   . ILE C 2 109 ? 36.640  -47.568  -9.225  1.00 11.34  ? 109 ILE H C   1 
ATOM   3760  O  O   . ILE C 2 109 ? 35.791  -47.100  -8.479  1.00 7.19   ? 109 ILE H O   1 
ATOM   3761  C  CB  . ILE C 2 109 ? 37.801  -49.429  -8.048  1.00 14.11  ? 109 ILE H CB  1 
ATOM   3762  C  CG1 . ILE C 2 109 ? 39.117  -49.951  -7.473  1.00 15.47  ? 109 ILE H CG1 1 
ATOM   3763  C  CG2 . ILE C 2 109 ? 37.257  -50.428  -9.100  1.00 13.81  ? 109 ILE H CG2 1 
ATOM   3764  C  CD1 . ILE C 2 109 ? 38.917  -51.002  -6.421  1.00 17.06  ? 109 ILE H CD1 1 
ATOM   3765  N  N   . TRP C 2 110 ? 36.482  -47.747  -10.539 1.00 11.39  ? 110 TRP H N   1 
ATOM   3766  C  CA  . TRP C 2 110 ? 35.247  -47.514  -11.268 1.00 11.08  ? 110 TRP H CA  1 
ATOM   3767  C  C   . TRP C 2 110 ? 34.694  -48.839  -11.780 1.00 12.11  ? 110 TRP H C   1 
ATOM   3768  O  O   . TRP C 2 110 ? 35.462  -49.725  -12.153 1.00 11.75  ? 110 TRP H O   1 
ATOM   3769  C  CB  . TRP C 2 110 ? 35.533  -46.643  -12.492 1.00 10.62  ? 110 TRP H CB  1 
ATOM   3770  C  CG  . TRP C 2 110 ? 35.934  -45.270  -12.185 1.00 8.12   ? 110 TRP H CG  1 
ATOM   3771  C  CD1 . TRP C 2 110 ? 37.167  -44.846  -11.802 1.00 7.75   ? 110 TRP H CD1 1 
ATOM   3772  C  CD2 . TRP C 2 110 ? 35.107  -44.110  -12.253 1.00 8.91   ? 110 TRP H CD2 1 
ATOM   3773  N  NE1 . TRP C 2 110 ? 37.160  -43.482  -11.608 1.00 8.19   ? 110 TRP H NE1 1 
ATOM   3774  C  CE2 . TRP C 2 110 ? 35.905  -43.006  -11.876 1.00 8.02   ? 110 TRP H CE2 1 
ATOM   3775  C  CE3 . TRP C 2 110 ? 33.763  -43.893  -12.579 1.00 10.24  ? 110 TRP H CE3 1 
ATOM   3776  C  CZ2 . TRP C 2 110 ? 35.409  -41.707  -11.830 1.00 7.25   ? 110 TRP H CZ2 1 
ATOM   3777  C  CZ3 . TRP C 2 110 ? 33.269  -42.591  -12.524 1.00 9.43   ? 110 TRP H CZ3 1 
ATOM   3778  C  CH2 . TRP C 2 110 ? 34.093  -41.520  -12.149 1.00 8.01   ? 110 TRP H CH2 1 
ATOM   3779  N  N   . GLY C 2 111 ? 33.370  -48.962  -11.830 1.00 14.01  ? 111 GLY H N   1 
ATOM   3780  C  CA  . GLY C 2 111 ? 32.723  -50.102  -12.498 1.00 15.17  ? 111 GLY H CA  1 
ATOM   3781  C  C   . GLY C 2 111 ? 32.657  -49.943  -14.020 1.00 16.48  ? 111 GLY H C   1 
ATOM   3782  O  O   . GLY C 2 111 ? 33.151  -48.960  -14.572 1.00 15.27  ? 111 GLY H O   1 
ATOM   3783  N  N   . GLN C 2 112 ? 32.043  -50.911  -14.699 1.00 18.30  ? 112 GLN H N   1 
ATOM   3784  C  CA  . GLN C 2 112 ? 32.006  -50.917  -16.175 1.00 19.58  ? 112 GLN H CA  1 
ATOM   3785  C  C   . GLN C 2 112 ? 30.921  -50.003  -16.703 1.00 18.21  ? 112 GLN H C   1 
ATOM   3786  O  O   . GLN C 2 112 ? 30.980  -49.574  -17.848 1.00 18.83  ? 112 GLN H O   1 
ATOM   3787  C  CB  . GLN C 2 112 ? 31.883  -52.336  -16.800 1.00 22.31  ? 112 GLN H CB  1 
ATOM   3788  C  CG  . GLN C 2 112 ? 31.249  -53.474  -15.956 1.00 26.11  ? 112 GLN H CG  1 
ATOM   3789  C  CD  . GLN C 2 112 ? 29.740  -53.656  -16.166 1.00 28.92  ? 112 GLN H CD  1 
ATOM   3790  O  OE1 . GLN C 2 112 ? 28.920  -53.053  -15.476 1.00 30.75  ? 112 GLN H OE1 1 
ATOM   3791  N  NE2 . GLN C 2 112 ? 29.378  -54.521  -17.108 1.00 31.53  ? 112 GLN H NE2 1 
ATOM   3792  N  N   . GLY C 2 113 ? 29.939  -49.689  -15.865 1.00 17.65  ? 113 GLY H N   1 
ATOM   3793  C  CA  . GLY C 2 113 ? 28.815  -48.874  -16.281 1.00 17.67  ? 113 GLY H CA  1 
ATOM   3794  C  C   . GLY C 2 113 ? 27.619  -49.747  -16.599 1.00 18.96  ? 113 GLY H C   1 
ATOM   3795  O  O   . GLY C 2 113 ? 27.768  -50.891  -17.035 1.00 20.41  ? 113 GLY H O   1 
ATOM   3796  N  N   . THR C 2 114 ? 26.429  -49.214  -16.341 1.00 18.78  ? 114 THR H N   1 
ATOM   3797  C  CA  . THR C 2 114 ? 25.181  -49.827  -16.779 1.00 19.47  ? 114 THR H CA  1 
ATOM   3798  C  C   . THR C 2 114 ? 24.291  -48.687  -17.307 1.00 18.88  ? 114 THR H C   1 
ATOM   3799  O  O   . THR C 2 114 ? 24.297  -47.583  -16.755 1.00 20.26  ? 114 THR H O   1 
ATOM   3800  C  CB  . THR C 2 114 ? 24.511  -50.659  -15.637 1.00 20.15  ? 114 THR H CB  1 
ATOM   3801  O  OG1 . THR C 2 114 ? 23.522  -51.533  -16.195 1.00 21.61  ? 114 THR H OG1 1 
ATOM   3802  C  CG2 . THR C 2 114 ? 23.866  -49.757  -14.565 1.00 18.59  ? 114 THR H CG2 1 
ATOM   3803  N  N   . MET C 2 115 ? 23.570  -48.931  -18.393 1.00 17.23  ? 115 MET H N   1 
ATOM   3804  C  CA  . MET C 2 115 ? 22.833  -47.856  -19.062 1.00 17.46  ? 115 MET H CA  1 
ATOM   3805  C  C   . MET C 2 115 ? 21.408  -47.796  -18.557 1.00 15.80  ? 115 MET H C   1 
ATOM   3806  O  O   . MET C 2 115 ? 20.727  -48.818  -18.473 1.00 14.49  ? 115 MET H O   1 
ATOM   3807  C  CB  . MET C 2 115 ? 22.827  -48.047  -20.578 1.00 19.84  ? 115 MET H CB  1 
ATOM   3808  C  CG  . MET C 2 115 ? 22.133  -46.911  -21.356 1.00 22.26  ? 115 MET H CG  1 
ATOM   3809  S  SD  . MET C 2 115 ? 23.016  -45.335  -21.243 1.00 25.55  ? 115 MET H SD  1 
ATOM   3810  C  CE  . MET C 2 115 ? 21.779  -44.186  -21.839 1.00 22.42  ? 115 MET H CE  1 
ATOM   3811  N  N   . VAL C 2 116 ? 20.968  -46.588  -18.217 1.00 15.15  ? 116 VAL H N   1 
ATOM   3812  C  CA  . VAL C 2 116 ? 19.598  -46.349  -17.791 1.00 13.97  ? 116 VAL H CA  1 
ATOM   3813  C  C   . VAL C 2 116 ? 18.970  -45.376  -18.775 1.00 14.42  ? 116 VAL H C   1 
ATOM   3814  O  O   . VAL C 2 116 ? 19.518  -44.300  -19.040 1.00 14.77  ? 116 VAL H O   1 
ATOM   3815  C  CB  . VAL C 2 116 ? 19.537  -45.784  -16.361 1.00 13.20  ? 116 VAL H CB  1 
ATOM   3816  C  CG1 . VAL C 2 116 ? 18.111  -45.379  -16.000 1.00 12.11  ? 116 VAL H CG1 1 
ATOM   3817  C  CG2 . VAL C 2 116 ? 20.075  -46.812  -15.380 1.00 11.96  ? 116 VAL H CG2 1 
ATOM   3818  N  N   . THR C 2 117 ? 17.838  -45.787  -19.339 1.00 13.73  ? 117 THR H N   1 
ATOM   3819  C  CA  . THR C 2 117 ? 17.126  -45.000  -20.338 1.00 12.93  ? 117 THR H CA  1 
ATOM   3820  C  C   . THR C 2 117 ? 15.718  -44.747  -19.823 1.00 11.58  ? 117 THR H C   1 
ATOM   3821  O  O   . THR C 2 117 ? 15.012  -45.682  -19.453 1.00 10.27  ? 117 THR H O   1 
ATOM   3822  C  CB  . THR C 2 117 ? 17.055  -45.740  -21.691 1.00 12.67  ? 117 THR H CB  1 
ATOM   3823  O  OG1 . THR C 2 117 ? 18.369  -46.165  -22.071 1.00 11.78  ? 117 THR H OG1 1 
ATOM   3824  C  CG2 . THR C 2 117 ? 16.469  -44.829  -22.773 1.00 11.24  ? 117 THR H CG2 1 
ATOM   3825  N  N   . VAL C 2 118 ? 15.336  -43.478  -19.765 1.00 11.59  ? 118 VAL H N   1 
ATOM   3826  C  CA  . VAL C 2 118 ? 14.012  -43.102  -19.295 1.00 13.54  ? 118 VAL H CA  1 
ATOM   3827  C  C   . VAL C 2 118 ? 13.307  -42.397  -20.443 1.00 14.77  ? 118 VAL H C   1 
ATOM   3828  O  O   . VAL C 2 118 ? 13.764  -41.351  -20.910 1.00 13.73  ? 118 VAL H O   1 
ATOM   3829  C  CB  . VAL C 2 118 ? 14.060  -42.200  -18.037 1.00 13.06  ? 118 VAL H CB  1 
ATOM   3830  C  CG1 . VAL C 2 118 ? 12.638  -41.990  -17.464 1.00 12.81  ? 118 VAL H CG1 1 
ATOM   3831  C  CG2 . VAL C 2 118 ? 14.977  -42.812  -16.970 1.00 12.60  ? 118 VAL H CG2 1 
ATOM   3832  N  N   . SER C 2 119 ? 12.205  -42.988  -20.904 1.00 15.64  ? 119 SER H N   1 
ATOM   3833  C  CA  . SER C 2 119 ? 11.520  -42.501  -22.097 1.00 16.33  ? 119 SER H CA  1 
ATOM   3834  C  C   . SER C 2 119 ? 10.104  -43.045  -22.214 1.00 16.00  ? 119 SER H C   1 
ATOM   3835  O  O   . SER C 2 119 ? 9.832   -44.195  -21.867 1.00 16.09  ? 119 SER H O   1 
ATOM   3836  C  CB  . SER C 2 119 ? 12.323  -42.872  -23.356 1.00 16.69  ? 119 SER H CB  1 
ATOM   3837  O  OG  . SER C 2 119 ? 11.674  -42.435  -24.545 1.00 16.57  ? 119 SER H OG  1 
ATOM   3838  N  N   . SER C 2 120 ? 9.202   -42.209  -22.715 1.00 15.95  ? 120 SER H N   1 
ATOM   3839  C  CA  . SER C 2 120 ? 7.858   -42.662  -23.053 1.00 17.34  ? 120 SER H CA  1 
ATOM   3840  C  C   . SER C 2 120 ? 7.833   -43.533  -24.322 1.00 16.69  ? 120 SER H C   1 
ATOM   3841  O  O   . SER C 2 120 ? 6.831   -44.189  -24.593 1.00 16.42  ? 120 SER H O   1 
ATOM   3842  C  CB  . SER C 2 120 ? 6.900   -41.467  -23.206 1.00 17.81  ? 120 SER H CB  1 
ATOM   3843  O  OG  . SER C 2 120 ? 7.412   -40.502  -24.104 1.00 18.39  ? 120 SER H OG  1 
ATOM   3844  N  N   . ALA C 2 121 ? 8.921   -43.544  -25.092 1.00 15.76  ? 121 ALA H N   1 
ATOM   3845  C  CA  . ALA C 2 121 ? 8.981   -44.361  -26.303 1.00 16.11  ? 121 ALA H CA  1 
ATOM   3846  C  C   . ALA C 2 121 ? 8.936   -45.851  -25.958 1.00 15.56  ? 121 ALA H C   1 
ATOM   3847  O  O   . ALA C 2 121 ? 9.669   -46.321  -25.093 1.00 16.30  ? 121 ALA H O   1 
ATOM   3848  C  CB  . ALA C 2 121 ? 10.254  -44.033  -27.124 1.00 15.82  ? 121 ALA H CB  1 
ATOM   3849  N  N   . SER C 2 122 ? 8.074   -46.587  -26.644 1.00 15.12  ? 122 SER H N   1 
ATOM   3850  C  CA  . SER C 2 122 ? 7.971   -48.031  -26.452 1.00 15.53  ? 122 SER H CA  1 
ATOM   3851  C  C   . SER C 2 122 ? 9.011   -48.776  -27.287 1.00 13.24  ? 122 SER H C   1 
ATOM   3852  O  O   . SER C 2 122 ? 9.439   -48.290  -28.329 1.00 11.31  ? 122 SER H O   1 
ATOM   3853  C  CB  . SER C 2 122 ? 6.573   -48.519  -26.814 1.00 15.70  ? 122 SER H CB  1 
ATOM   3854  O  OG  . SER C 2 122 ? 5.661   -48.174  -25.791 1.00 18.90  ? 122 SER H OG  1 
ATOM   3855  N  N   . THR C 2 123 ? 9.398   -49.961  -26.819 1.00 13.45  ? 123 THR H N   1 
ATOM   3856  C  CA  . THR C 2 123 ? 10.335  -50.821  -27.547 1.00 14.56  ? 123 THR H CA  1 
ATOM   3857  C  C   . THR C 2 123 ? 9.763   -51.164  -28.921 1.00 14.55  ? 123 THR H C   1 
ATOM   3858  O  O   . THR C 2 123 ? 8.554   -51.438  -29.054 1.00 15.58  ? 123 THR H O   1 
ATOM   3859  C  CB  . THR C 2 123 ? 10.671  -52.121  -26.750 1.00 14.01  ? 123 THR H CB  1 
ATOM   3860  O  OG1 . THR C 2 123 ? 11.341  -51.767  -25.535 1.00 13.36  ? 123 THR H OG1 1 
ATOM   3861  C  CG2 . THR C 2 123 ? 11.581  -53.068  -27.557 1.00 13.06  ? 123 THR H CG2 1 
ATOM   3862  N  N   . LYS C 2 124 ? 10.628  -51.136  -29.933 1.00 13.79  ? 124 LYS H N   1 
ATOM   3863  C  CA  . LYS C 2 124 ? 10.189  -51.279  -31.320 1.00 14.49  ? 124 LYS H CA  1 
ATOM   3864  C  C   . LYS C 2 124 ? 11.336  -51.656  -32.251 1.00 13.55  ? 124 LYS H C   1 
ATOM   3865  O  O   . LYS C 2 124 ? 12.417  -51.056  -32.202 1.00 12.81  ? 124 LYS H O   1 
ATOM   3866  C  CB  . LYS C 2 124 ? 9.571   -49.964  -31.803 1.00 16.52  ? 124 LYS H CB  1 
ATOM   3867  C  CG  . LYS C 2 124 ? 9.018   -49.986  -33.222 1.00 17.74  ? 124 LYS H CG  1 
ATOM   3868  C  CD  . LYS C 2 124 ? 8.307   -48.674  -33.539 1.00 19.35  ? 124 LYS H CD  1 
ATOM   3869  C  CE  . LYS C 2 124 ? 7.735   -48.667  -34.944 1.00 20.72  ? 124 LYS H CE  1 
ATOM   3870  N  NZ  . LYS C 2 124 ? 8.099   -47.416  -35.680 1.00 22.11  ? 124 LYS H NZ  1 
ATOM   3871  N  N   . GLY C 2 125 ? 11.083  -52.646  -33.106 1.00 12.05  ? 125 GLY H N   1 
ATOM   3872  C  CA  . GLY C 2 125 ? 12.027  -53.046  -34.133 1.00 11.12  ? 125 GLY H CA  1 
ATOM   3873  C  C   . GLY C 2 125 ? 12.110  -51.995  -35.228 1.00 10.39  ? 125 GLY H C   1 
ATOM   3874  O  O   . GLY C 2 125 ? 11.174  -51.211  -35.413 1.00 9.31   ? 125 GLY H O   1 
ATOM   3875  N  N   . PRO C 2 126 ? 13.236  -51.962  -35.955 1.00 10.45  ? 126 PRO H N   1 
ATOM   3876  C  CA  . PRO C 2 126 ? 13.405  -51.009  -37.054 1.00 11.35  ? 126 PRO H CA  1 
ATOM   3877  C  C   . PRO C 2 126 ? 12.725  -51.392  -38.369 1.00 10.38  ? 126 PRO H C   1 
ATOM   3878  O  O   . PRO C 2 126 ? 12.454  -52.568  -38.625 1.00 9.44   ? 126 PRO H O   1 
ATOM   3879  C  CB  . PRO C 2 126 ? 14.913  -51.024  -37.282 1.00 10.72  ? 126 PRO H CB  1 
ATOM   3880  C  CG  . PRO C 2 126 ? 15.300  -52.412  -36.936 1.00 11.50  ? 126 PRO H CG  1 
ATOM   3881  C  CD  . PRO C 2 126 ? 14.459  -52.750  -35.733 1.00 10.52  ? 126 PRO H CD  1 
ATOM   3882  N  N   . SER C 2 127 ? 12.476  -50.377  -39.189 1.00 10.78  ? 127 SER H N   1 
ATOM   3883  C  CA  . SER C 2 127 ? 12.275  -50.553  -40.627 1.00 10.06  ? 127 SER H CA  1 
ATOM   3884  C  C   . SER C 2 127 ? 13.636  -50.457  -41.312 1.00 7.61   ? 127 SER H C   1 
ATOM   3885  O  O   . SER C 2 127 ? 14.417  -49.555  -41.030 1.00 7.11   ? 127 SER H O   1 
ATOM   3886  C  CB  . SER C 2 127 ? 11.357  -49.460  -41.164 1.00 10.82  ? 127 SER H CB  1 
ATOM   3887  O  OG  . SER C 2 127 ? 10.109  -49.474  -40.482 1.00 13.52  ? 127 SER H OG  1 
ATOM   3888  N  N   . VAL C 2 128 ? 13.929  -51.398  -42.195 1.00 6.39   ? 128 VAL H N   1 
ATOM   3889  C  CA  . VAL C 2 128 ? 15.199  -51.401  -42.911 1.00 5.75   ? 128 VAL H CA  1 
ATOM   3890  C  C   . VAL C 2 128 ? 14.927  -51.097  -44.374 1.00 5.12   ? 128 VAL H C   1 
ATOM   3891  O  O   . VAL C 2 128 ? 14.248  -51.864  -45.042 1.00 8.51   ? 128 VAL H O   1 
ATOM   3892  C  CB  . VAL C 2 128 ? 15.969  -52.741  -42.716 1.00 3.44   ? 128 VAL H CB  1 
ATOM   3893  C  CG1 . VAL C 2 128 ? 17.345  -52.687  -43.363 1.00 2.00   ? 128 VAL H CG1 1 
ATOM   3894  C  CG2 . VAL C 2 128 ? 16.121  -53.020  -41.236 1.00 3.29   ? 128 VAL H CG2 1 
ATOM   3895  N  N   . PHE C 2 129 ? 15.437  -49.958  -44.851 1.00 4.87   ? 129 PHE H N   1 
ATOM   3896  C  CA  . PHE C 2 129 ? 15.307  -49.555  -46.255 1.00 4.37   ? 129 PHE H CA  1 
ATOM   3897  C  C   . PHE C 2 129 ? 16.650  -49.615  -47.003 1.00 5.37   ? 129 PHE H C   1 
ATOM   3898  O  O   . PHE C 2 129 ? 17.691  -49.299  -46.440 1.00 4.10   ? 129 PHE H O   1 
ATOM   3899  C  CB  . PHE C 2 129 ? 14.719  -48.146  -46.341 1.00 4.03   ? 129 PHE H CB  1 
ATOM   3900  C  CG  . PHE C 2 129 ? 13.395  -47.995  -45.623 1.00 3.96   ? 129 PHE H CG  1 
ATOM   3901  C  CD1 . PHE C 2 129 ? 12.303  -48.770  -45.987 1.00 3.68   ? 129 PHE H CD1 1 
ATOM   3902  C  CD2 . PHE C 2 129 ? 13.247  -47.083  -44.586 1.00 3.63   ? 129 PHE H CD2 1 
ATOM   3903  C  CE1 . PHE C 2 129 ? 11.072  -48.641  -45.325 1.00 4.13   ? 129 PHE H CE1 1 
ATOM   3904  C  CE2 . PHE C 2 129 ? 12.021  -46.944  -43.922 1.00 4.54   ? 129 PHE H CE2 1 
ATOM   3905  C  CZ  . PHE C 2 129 ? 10.931  -47.733  -44.293 1.00 3.64   ? 129 PHE H CZ  1 
ATOM   3906  N  N   . PRO C 2 130 ? 16.628  -50.026  -48.282 1.00 8.20   ? 130 PRO H N   1 
ATOM   3907  C  CA  . PRO C 2 130 ? 17.875  -50.075  -49.034 1.00 9.48   ? 130 PRO H CA  1 
ATOM   3908  C  C   . PRO C 2 130 ? 18.262  -48.695  -49.551 1.00 10.47  ? 130 PRO H C   1 
ATOM   3909  O  O   . PRO C 2 130 ? 17.392  -47.943  -50.004 1.00 12.61  ? 130 PRO H O   1 
ATOM   3910  C  CB  . PRO C 2 130 ? 17.524  -50.987  -50.221 1.00 9.58   ? 130 PRO H CB  1 
ATOM   3911  C  CG  . PRO C 2 130 ? 16.073  -50.705  -50.480 1.00 8.99   ? 130 PRO H CG  1 
ATOM   3912  C  CD  . PRO C 2 130 ? 15.465  -50.411  -49.118 1.00 8.84   ? 130 PRO H CD  1 
ATOM   3913  N  N   . LEU C 2 131 ? 19.549  -48.373  -49.461 1.00 9.33   ? 131 LEU H N   1 
ATOM   3914  C  CA  . LEU C 2 131 ? 20.133  -47.231  -50.144 1.00 9.22   ? 131 LEU H CA  1 
ATOM   3915  C  C   . LEU C 2 131 ? 20.827  -47.803  -51.383 1.00 9.82   ? 131 LEU H C   1 
ATOM   3916  O  O   . LEU C 2 131 ? 21.959  -48.298  -51.306 1.00 8.07   ? 131 LEU H O   1 
ATOM   3917  C  CB  . LEU C 2 131 ? 21.123  -46.509  -49.230 1.00 9.72   ? 131 LEU H CB  1 
ATOM   3918  C  CG  . LEU C 2 131 ? 20.550  -45.963  -47.913 1.00 9.74   ? 131 LEU H CG  1 
ATOM   3919  C  CD1 . LEU C 2 131 ? 21.651  -45.721  -46.906 1.00 10.33  ? 131 LEU H CD1 1 
ATOM   3920  C  CD2 . LEU C 2 131 ? 19.754  -44.703  -48.147 1.00 9.61   ? 131 LEU H CD2 1 
ATOM   3921  N  N   . ALA C 2 132 ? 20.125  -47.758  -52.514 1.00 11.08  ? 132 ALA H N   1 
ATOM   3922  C  CA  . ALA C 2 132 ? 20.540  -48.496  -53.712 1.00 12.83  ? 132 ALA H CA  1 
ATOM   3923  C  C   . ALA C 2 132 ? 21.740  -47.844  -54.376 1.00 13.78  ? 132 ALA H C   1 
ATOM   3924  O  O   . ALA C 2 132 ? 21.867  -46.626  -54.358 1.00 15.35  ? 132 ALA H O   1 
ATOM   3925  C  CB  . ALA C 2 132 ? 19.380  -48.624  -54.715 1.00 11.18  ? 132 ALA H CB  1 
ATOM   3926  N  N   . PRO C 2 133 ? 22.639  -48.657  -54.951 1.00 15.84  ? 133 PRO H N   1 
ATOM   3927  C  CA  . PRO C 2 133 ? 23.750  -48.086  -55.703 1.00 16.20  ? 133 PRO H CA  1 
ATOM   3928  C  C   . PRO C 2 133 ? 23.269  -47.561  -57.049 1.00 15.80  ? 133 PRO H C   1 
ATOM   3929  O  O   . PRO C 2 133 ? 22.464  -48.229  -57.701 1.00 15.91  ? 133 PRO H O   1 
ATOM   3930  C  CB  . PRO C 2 133 ? 24.696  -49.278  -55.887 1.00 16.50  ? 133 PRO H CB  1 
ATOM   3931  C  CG  . PRO C 2 133 ? 23.798  -50.460  -55.910 1.00 17.19  ? 133 PRO H CG  1 
ATOM   3932  C  CD  . PRO C 2 133 ? 22.673  -50.133  -54.953 1.00 16.85  ? 133 PRO H CD  1 
ATOM   3933  N  N   . SER C 2 141 ? 34.009  -47.486  -61.635 1.00 24.18  ? 141 SER H N   1 
ATOM   3934  C  CA  . SER C 2 141 ? 34.732  -47.173  -60.416 1.00 25.77  ? 141 SER H CA  1 
ATOM   3935  C  C   . SER C 2 141 ? 34.139  -47.994  -59.254 1.00 25.24  ? 141 SER H C   1 
ATOM   3936  O  O   . SER C 2 141 ? 33.858  -49.186  -59.409 1.00 25.33  ? 141 SER H O   1 
ATOM   3937  C  CB  . SER C 2 141 ? 34.680  -45.654  -60.140 1.00 26.87  ? 141 SER H CB  1 
ATOM   3938  O  OG  . SER C 2 141 ? 35.112  -44.900  -61.268 1.00 26.72  ? 141 SER H OG  1 
ATOM   3939  N  N   . THR C 2 142 ? 33.960  -47.373  -58.093 1.00 24.20  ? 142 THR H N   1 
ATOM   3940  C  CA  . THR C 2 142 ? 33.328  -48.054  -56.976 1.00 23.51  ? 142 THR H CA  1 
ATOM   3941  C  C   . THR C 2 142 ? 31.923  -47.507  -56.784 1.00 21.40  ? 142 THR H C   1 
ATOM   3942  O  O   . THR C 2 142 ? 31.659  -46.343  -57.069 1.00 21.35  ? 142 THR H O   1 
ATOM   3943  C  CB  . THR C 2 142 ? 34.141  -47.927  -55.670 1.00 23.27  ? 142 THR H CB  1 
ATOM   3944  O  OG1 . THR C 2 142 ? 33.700  -46.786  -54.926 1.00 23.14  ? 142 THR H OG1 1 
ATOM   3945  C  CG2 . THR C 2 142 ? 35.649  -47.845  -55.976 1.00 22.89  ? 142 THR H CG2 1 
ATOM   3946  N  N   . ALA C 2 143 ? 31.031  -48.373  -56.318 1.00 19.11  ? 143 ALA H N   1 
ATOM   3947  C  CA  . ALA C 2 143 ? 29.657  -48.006  -56.026 1.00 18.00  ? 143 ALA H CA  1 
ATOM   3948  C  C   . ALA C 2 143 ? 29.454  -47.976  -54.512 1.00 17.15  ? 143 ALA H C   1 
ATOM   3949  O  O   . ALA C 2 143 ? 29.982  -48.819  -53.791 1.00 14.52  ? 143 ALA H O   1 
ATOM   3950  C  CB  . ALA C 2 143 ? 28.700  -49.002  -56.675 1.00 17.23  ? 143 ALA H CB  1 
ATOM   3951  N  N   . ALA C 2 144 ? 28.713  -46.981  -54.038 1.00 18.26  ? 144 ALA H N   1 
ATOM   3952  C  CA  . ALA C 2 144 ? 28.273  -46.933  -52.646 1.00 19.47  ? 144 ALA H CA  1 
ATOM   3953  C  C   . ALA C 2 144 ? 26.852  -47.487  -52.561 1.00 19.30  ? 144 ALA H C   1 
ATOM   3954  O  O   . ALA C 2 144 ? 26.006  -47.198  -53.403 1.00 17.97  ? 144 ALA H O   1 
ATOM   3955  C  CB  . ALA C 2 144 ? 28.331  -45.511  -52.102 1.00 18.68  ? 144 ALA H CB  1 
ATOM   3956  N  N   . LEU C 2 145 ? 26.618  -48.336  -51.575 1.00 20.09  ? 145 LEU H N   1 
ATOM   3957  C  CA  . LEU C 2 145 ? 25.268  -48.773  -51.250 1.00 21.35  ? 145 LEU H CA  1 
ATOM   3958  C  C   . LEU C 2 145 ? 25.137  -48.889  -49.742 1.00 19.35  ? 145 LEU H C   1 
ATOM   3959  O  O   . LEU C 2 145 ? 26.131  -48.838  -49.026 1.00 18.49  ? 145 LEU H O   1 
ATOM   3960  C  CB  . LEU C 2 145 ? 24.911  -50.086  -51.956 1.00 23.10  ? 145 LEU H CB  1 
ATOM   3961  C  CG  . LEU C 2 145 ? 25.734  -51.373  -51.803 1.00 23.99  ? 145 LEU H CG  1 
ATOM   3962  C  CD1 . LEU C 2 145 ? 25.415  -52.124  -50.533 1.00 23.39  ? 145 LEU H CD1 1 
ATOM   3963  C  CD2 . LEU C 2 145 ? 25.438  -52.264  -52.995 1.00 24.41  ? 145 LEU H CD2 1 
ATOM   3964  N  N   . GLY C 2 146 ? 23.907  -49.002  -49.261 1.00 19.42  ? 146 GLY H N   1 
ATOM   3965  C  CA  . GLY C 2 146 ? 23.681  -49.063  -47.823 1.00 19.54  ? 146 GLY H CA  1 
ATOM   3966  C  C   . GLY C 2 146 ? 22.293  -49.512  -47.403 1.00 20.32  ? 146 GLY H C   1 
ATOM   3967  O  O   . GLY C 2 146 ? 21.480  -49.955  -48.219 1.00 17.76  ? 146 GLY H O   1 
ATOM   3968  N  N   . CYS C 2 147 ? 22.049  -49.395  -46.103 1.00 21.72  ? 147 CYS H N   1 
ATOM   3969  C  CA  . CYS C 2 147 ? 20.756  -49.683  -45.502 1.00 22.13  ? 147 CYS H CA  1 
ATOM   3970  C  C   . CYS C 2 147 ? 20.433  -48.542  -44.557 1.00 19.51  ? 147 CYS H C   1 
ATOM   3971  O  O   . CYS C 2 147 ? 21.281  -48.125  -43.778 1.00 20.25  ? 147 CYS H O   1 
ATOM   3972  C  CB  . CYS C 2 147 ? 20.788  -51.016  -44.732 1.00 23.94  ? 147 CYS H CB  1 
ATOM   3973  S  SG  . CYS C 2 147 ? 20.626  -52.447  -45.834 1.00 28.92  ? 147 CYS H SG  1 
ATOM   3974  N  N   . LEU C 2 148 ? 19.209  -48.036  -44.636 1.00 18.25  ? 148 LEU H N   1 
ATOM   3975  C  CA  . LEU C 2 148 ? 18.709  -47.068  -43.667 1.00 17.43  ? 148 LEU H CA  1 
ATOM   3976  C  C   . LEU C 2 148 ? 17.907  -47.851  -42.637 1.00 16.52  ? 148 LEU H C   1 
ATOM   3977  O  O   . LEU C 2 148 ? 16.874  -48.415  -42.962 1.00 16.77  ? 148 LEU H O   1 
ATOM   3978  C  CB  . LEU C 2 148 ? 17.857  -45.999  -44.362 1.00 15.62  ? 148 LEU H CB  1 
ATOM   3979  C  CG  . LEU C 2 148 ? 17.065  -44.975  -43.540 1.00 14.39  ? 148 LEU H CG  1 
ATOM   3980  C  CD1 . LEU C 2 148 ? 17.953  -44.135  -42.608 1.00 12.61  ? 148 LEU H CD1 1 
ATOM   3981  C  CD2 . LEU C 2 148 ? 16.261  -44.082  -44.494 1.00 12.87  ? 148 LEU H CD2 1 
ATOM   3982  N  N   . VAL C 2 149 ? 18.412  -47.901  -41.404 1.00 17.19  ? 149 VAL H N   1 
ATOM   3983  C  CA  . VAL C 2 149 ? 17.756  -48.597  -40.305 1.00 16.63  ? 149 VAL H CA  1 
ATOM   3984  C  C   . VAL C 2 149 ? 16.987  -47.589  -39.452 1.00 18.23  ? 149 VAL H C   1 
ATOM   3985  O  O   . VAL C 2 149 ? 17.563  -46.870  -38.628 1.00 19.02  ? 149 VAL H O   1 
ATOM   3986  C  CB  . VAL C 2 149 ? 18.776  -49.368  -39.472 1.00 17.05  ? 149 VAL H CB  1 
ATOM   3987  C  CG1 . VAL C 2 149 ? 18.080  -50.209  -38.400 1.00 16.38  ? 149 VAL H CG1 1 
ATOM   3988  C  CG2 . VAL C 2 149 ? 19.622  -50.248  -40.386 1.00 17.94  ? 149 VAL H CG2 1 
ATOM   3989  N  N   . LYS C 2 150 ? 15.674  -47.549  -39.649 1.00 19.78  ? 150 LYS H N   1 
ATOM   3990  C  CA  . LYS C 2 150 ? 14.864  -46.438  -39.179 1.00 20.49  ? 150 LYS H CA  1 
ATOM   3991  C  C   . LYS C 2 150 ? 13.793  -46.816  -38.150 1.00 20.62  ? 150 LYS H C   1 
ATOM   3992  O  O   . LYS C 2 150 ? 13.234  -47.924  -38.181 1.00 19.87  ? 150 LYS H O   1 
ATOM   3993  C  CB  . LYS C 2 150 ? 14.203  -45.770  -40.386 1.00 21.96  ? 150 LYS H CB  1 
ATOM   3994  C  CG  . LYS C 2 150 ? 13.847  -44.312  -40.159 1.00 22.66  ? 150 LYS H CG  1 
ATOM   3995  C  CD  . LYS C 2 150 ? 13.361  -43.648  -41.428 1.00 22.38  ? 150 LYS H CD  1 
ATOM   3996  C  CE  . LYS C 2 150 ? 13.063  -42.187  -41.195 1.00 22.24  ? 150 LYS H CE  1 
ATOM   3997  N  NZ  . LYS C 2 150 ? 11.960  -42.004  -40.234 1.00 22.86  ? 150 LYS H NZ  1 
ATOM   3998  N  N   . ASP C 2 151 ? 13.522  -45.864  -37.249 1.00 21.04  ? 151 ASP H N   1 
ATOM   3999  C  CA  . ASP C 2 151 ? 12.386  -45.902  -36.307 1.00 20.42  ? 151 ASP H CA  1 
ATOM   4000  C  C   . ASP C 2 151 ? 12.401  -47.098  -35.341 1.00 19.77  ? 151 ASP H C   1 
ATOM   4001  O  O   . ASP C 2 151 ? 11.451  -47.875  -35.255 1.00 20.88  ? 151 ASP H O   1 
ATOM   4002  C  CB  . ASP C 2 151 ? 11.056  -45.805  -37.083 1.00 21.30  ? 151 ASP H CB  1 
ATOM   4003  C  CG  . ASP C 2 151 ? 10.889  -44.459  -37.804 1.00 22.89  ? 151 ASP H CG  1 
ATOM   4004  O  OD1 . ASP C 2 151 ? 11.470  -43.433  -37.371 1.00 23.52  ? 151 ASP H OD1 1 
ATOM   4005  O  OD2 . ASP C 2 151 ? 10.164  -44.423  -38.814 1.00 23.93  ? 151 ASP H OD2 1 
ATOM   4006  N  N   . TYR C 2 152 ? 13.499  -47.236  -34.611 1.00 20.31  ? 152 TYR H N   1 
ATOM   4007  C  CA  . TYR C 2 152 ? 13.648  -48.304  -33.633 1.00 18.16  ? 152 TYR H CA  1 
ATOM   4008  C  C   . TYR C 2 152 ? 13.996  -47.728  -32.278 1.00 18.38  ? 152 TYR H C   1 
ATOM   4009  O  O   . TYR C 2 152 ? 14.543  -46.624  -32.167 1.00 18.46  ? 152 TYR H O   1 
ATOM   4010  C  CB  . TYR C 2 152 ? 14.734  -49.284  -34.060 1.00 18.73  ? 152 TYR H CB  1 
ATOM   4011  C  CG  . TYR C 2 152 ? 16.152  -48.728  -34.011 1.00 18.62  ? 152 TYR H CG  1 
ATOM   4012  C  CD1 . TYR C 2 152 ? 16.920  -48.819  -32.850 1.00 17.59  ? 152 TYR H CD1 1 
ATOM   4013  C  CD2 . TYR C 2 152 ? 16.720  -48.115  -35.124 1.00 18.20  ? 152 TYR H CD2 1 
ATOM   4014  C  CE1 . TYR C 2 152 ? 18.205  -48.316  -32.804 1.00 17.35  ? 152 TYR H CE1 1 
ATOM   4015  C  CE2 . TYR C 2 152 ? 18.020  -47.610  -35.090 1.00 17.26  ? 152 TYR H CE2 1 
ATOM   4016  C  CZ  . TYR C 2 152 ? 18.760  -47.723  -33.936 1.00 18.12  ? 152 TYR H CZ  1 
ATOM   4017  O  OH  . TYR C 2 152 ? 20.048  -47.213  -33.900 1.00 18.53  ? 152 TYR H OH  1 
ATOM   4018  N  N   . PHE C 2 153 ? 13.694  -48.507  -31.247 1.00 18.91  ? 153 PHE H N   1 
ATOM   4019  C  CA  . PHE C 2 153 ? 13.918  -48.097  -29.876 1.00 18.22  ? 153 PHE H CA  1 
ATOM   4020  C  C   . PHE C 2 153 ? 13.862  -49.321  -28.949 1.00 17.95  ? 153 PHE H C   1 
ATOM   4021  O  O   . PHE C 2 153 ? 13.061  -50.233  -29.177 1.00 16.48  ? 153 PHE H O   1 
ATOM   4022  C  CB  . PHE C 2 153 ? 12.850  -47.080  -29.459 1.00 18.41  ? 153 PHE H CB  1 
ATOM   4023  C  CG  . PHE C 2 153 ? 13.146  -46.410  -28.169 1.00 17.93  ? 153 PHE H CG  1 
ATOM   4024  C  CD1 . PHE C 2 153 ? 14.017  -45.328  -28.126 1.00 17.82  ? 153 PHE H CD1 1 
ATOM   4025  C  CD2 . PHE C 2 153 ? 12.581  -46.868  -26.990 1.00 17.45  ? 153 PHE H CD2 1 
ATOM   4026  C  CE1 . PHE C 2 153 ? 14.312  -44.703  -26.921 1.00 17.40  ? 153 PHE H CE1 1 
ATOM   4027  C  CE2 . PHE C 2 153 ? 12.869  -46.247  -25.783 1.00 18.00  ? 153 PHE H CE2 1 
ATOM   4028  C  CZ  . PHE C 2 153 ? 13.740  -45.167  -25.748 1.00 17.55  ? 153 PHE H CZ  1 
ATOM   4029  N  N   . PRO C 2 154 ? 14.735  -49.362  -27.923 1.00 17.91  ? 154 PRO H N   1 
ATOM   4030  C  CA  . PRO C 2 154 ? 15.850  -48.468  -27.682 1.00 18.35  ? 154 PRO H CA  1 
ATOM   4031  C  C   . PRO C 2 154 ? 17.081  -48.938  -28.469 1.00 19.54  ? 154 PRO H C   1 
ATOM   4032  O  O   . PRO C 2 154 ? 16.997  -49.898  -29.239 1.00 17.73  ? 154 PRO H O   1 
ATOM   4033  C  CB  . PRO C 2 154 ? 16.071  -48.609  -26.178 1.00 18.06  ? 154 PRO H CB  1 
ATOM   4034  C  CG  . PRO C 2 154 ? 15.725  -50.010  -25.905 1.00 18.09  ? 154 PRO H CG  1 
ATOM   4035  C  CD  . PRO C 2 154 ? 14.659  -50.402  -26.883 1.00 18.04  ? 154 PRO H CD  1 
ATOM   4036  N  N   . GLU C 2 155 ? 18.203  -48.250  -28.275 1.00 21.18  ? 155 GLU H N   1 
ATOM   4037  C  CA  . GLU C 2 155 ? 19.484  -48.673  -28.822 1.00 23.26  ? 155 GLU H CA  1 
ATOM   4038  C  C   . GLU C 2 155 ? 19.882  -49.951  -28.037 1.00 21.72  ? 155 GLU H C   1 
ATOM   4039  O  O   . GLU C 2 155 ? 19.412  -50.153  -26.909 1.00 21.66  ? 155 GLU H O   1 
ATOM   4040  C  CB  . GLU C 2 155 ? 20.501  -47.519  -28.676 1.00 25.45  ? 155 GLU H CB  1 
ATOM   4041  C  CG  . GLU C 2 155 ? 21.737  -47.526  -29.606 1.00 30.75  ? 155 GLU H CG  1 
ATOM   4042  C  CD  . GLU C 2 155 ? 21.407  -47.518  -31.107 1.00 34.60  ? 155 GLU H CD  1 
ATOM   4043  O  OE1 . GLU C 2 155 ? 20.406  -46.872  -31.473 1.00 39.17  ? 155 GLU H OE1 1 
ATOM   4044  O  OE2 . GLU C 2 155 ? 22.145  -48.136  -31.924 1.00 34.60  ? 155 GLU H OE2 1 
ATOM   4045  N  N   . PRO C 2 156 ? 20.731  -50.826  -28.620 1.00 20.06  ? 156 PRO H N   1 
ATOM   4046  C  CA  . PRO C 2 156 ? 21.374  -50.699  -29.921 1.00 19.29  ? 156 PRO H CA  1 
ATOM   4047  C  C   . PRO C 2 156 ? 20.786  -51.555  -31.035 1.00 19.68  ? 156 PRO H C   1 
ATOM   4048  O  O   . PRO C 2 156 ? 20.039  -52.498  -30.778 1.00 18.41  ? 156 PRO H O   1 
ATOM   4049  C  CB  . PRO C 2 156 ? 22.800  -51.161  -29.624 1.00 18.39  ? 156 PRO H CB  1 
ATOM   4050  C  CG  . PRO C 2 156 ? 22.595  -52.275  -28.611 1.00 18.48  ? 156 PRO H CG  1 
ATOM   4051  C  CD  . PRO C 2 156 ? 21.308  -51.957  -27.863 1.00 18.05  ? 156 PRO H CD  1 
ATOM   4052  N  N   . VAL C 2 157 ? 21.125  -51.181  -32.268 1.00 20.15  ? 157 VAL H N   1 
ATOM   4053  C  CA  . VAL C 2 157 ? 21.127  -52.108  -33.384 1.00 20.74  ? 157 VAL H CA  1 
ATOM   4054  C  C   . VAL C 2 157 ? 22.574  -52.451  -33.745 1.00 20.68  ? 157 VAL H C   1 
ATOM   4055  O  O   . VAL C 2 157 ? 23.483  -51.664  -33.515 1.00 19.76  ? 157 VAL H O   1 
ATOM   4056  C  CB  . VAL C 2 157 ? 20.399  -51.556  -34.645 1.00 20.85  ? 157 VAL H CB  1 
ATOM   4057  C  CG1 . VAL C 2 157 ? 18.867  -51.570  -34.445 1.00 18.90  ? 157 VAL H CG1 1 
ATOM   4058  C  CG2 . VAL C 2 157 ? 20.927  -50.181  -35.028 1.00 20.17  ? 157 VAL H CG2 1 
ATOM   4059  N  N   . THR C 2 158 ? 22.778  -53.649  -34.282 1.00 21.79  ? 158 THR H N   1 
ATOM   4060  C  CA  . THR C 2 158 ? 24.034  -53.995  -34.935 1.00 22.26  ? 158 THR H CA  1 
ATOM   4061  C  C   . THR C 2 158 ? 23.744  -54.259  -36.411 1.00 21.59  ? 158 THR H C   1 
ATOM   4062  O  O   . THR C 2 158 ? 22.671  -54.765  -36.753 1.00 21.16  ? 158 THR H O   1 
ATOM   4063  C  CB  . THR C 2 158 ? 24.672  -55.238  -34.311 1.00 23.34  ? 158 THR H CB  1 
ATOM   4064  O  OG1 . THR C 2 158 ? 23.887  -56.392  -34.627 1.00 24.45  ? 158 THR H OG1 1 
ATOM   4065  C  CG2 . THR C 2 158 ? 24.756  -55.093  -32.796 1.00 23.57  ? 158 THR H CG2 1 
ATOM   4066  N  N   . VAL C 2 159 ? 24.693  -53.880  -37.267 1.00 20.84  ? 159 VAL H N   1 
ATOM   4067  C  CA  . VAL C 2 159 ? 24.630  -54.134  -38.699 1.00 19.47  ? 159 VAL H CA  1 
ATOM   4068  C  C   . VAL C 2 159 ? 25.913  -54.822  -39.163 1.00 20.36  ? 159 VAL H C   1 
ATOM   4069  O  O   . VAL C 2 159 ? 27.022  -54.417  -38.807 1.00 20.89  ? 159 VAL H O   1 
ATOM   4070  C  CB  . VAL C 2 159 ? 24.474  -52.826  -39.508 1.00 19.15  ? 159 VAL H CB  1 
ATOM   4071  C  CG1 . VAL C 2 159 ? 24.212  -53.141  -40.994 1.00 17.25  ? 159 VAL H CG1 1 
ATOM   4072  C  CG2 . VAL C 2 159 ? 23.350  -51.944  -38.922 1.00 17.77  ? 159 VAL H CG2 1 
ATOM   4073  N  N   . SER C 2 160 ? 25.750  -55.878  -39.946 1.00 20.34  ? 160 SER H N   1 
ATOM   4074  C  CA  . SER C 2 160 ? 26.851  -56.471  -40.689 1.00 20.07  ? 160 SER H CA  1 
ATOM   4075  C  C   . SER C 2 160 ? 26.415  -56.612  -42.148 1.00 18.86  ? 160 SER H C   1 
ATOM   4076  O  O   . SER C 2 160 ? 25.238  -56.441  -42.465 1.00 17.22  ? 160 SER H O   1 
ATOM   4077  C  CB  . SER C 2 160 ? 27.209  -57.829  -40.106 1.00 20.16  ? 160 SER H CB  1 
ATOM   4078  O  OG  . SER C 2 160 ? 26.121  -58.720  -40.237 1.00 21.18  ? 160 SER H OG  1 
ATOM   4079  N  N   . TRP C 2 161 ? 27.371  -56.902  -43.029 1.00 18.74  ? 161 TRP H N   1 
ATOM   4080  C  CA  . TRP C 2 161 ? 27.087  -57.097  -44.451 1.00 18.19  ? 161 TRP H CA  1 
ATOM   4081  C  C   . TRP C 2 161 ? 27.496  -58.489  -44.895 1.00 17.85  ? 161 TRP H C   1 
ATOM   4082  O  O   . TRP C 2 161 ? 28.581  -58.957  -44.560 1.00 17.78  ? 161 TRP H O   1 
ATOM   4083  C  CB  . TRP C 2 161 ? 27.794  -56.036  -45.293 1.00 17.84  ? 161 TRP H CB  1 
ATOM   4084  C  CG  . TRP C 2 161 ? 27.159  -54.704  -45.148 1.00 18.51  ? 161 TRP H CG  1 
ATOM   4085  C  CD1 . TRP C 2 161 ? 27.405  -53.777  -44.170 1.00 19.00  ? 161 TRP H CD1 1 
ATOM   4086  C  CD2 . TRP C 2 161 ? 26.137  -54.143  -45.984 1.00 18.66  ? 161 TRP H CD2 1 
ATOM   4087  N  NE1 . TRP C 2 161 ? 26.614  -52.668  -44.359 1.00 18.88  ? 161 TRP H NE1 1 
ATOM   4088  C  CE2 . TRP C 2 161 ? 25.819  -52.871  -45.458 1.00 18.70  ? 161 TRP H CE2 1 
ATOM   4089  C  CE3 . TRP C 2 161 ? 25.460  -54.591  -47.124 1.00 17.90  ? 161 TRP H CE3 1 
ATOM   4090  C  CZ2 . TRP C 2 161 ? 24.860  -52.048  -46.034 1.00 19.05  ? 161 TRP H CZ2 1 
ATOM   4091  C  CZ3 . TRP C 2 161 ? 24.500  -53.774  -47.693 1.00 18.15  ? 161 TRP H CZ3 1 
ATOM   4092  C  CH2 . TRP C 2 161 ? 24.213  -52.515  -47.154 1.00 19.48  ? 161 TRP H CH2 1 
ATOM   4093  N  N   . ASN C 2 162 ? 26.610  -59.148  -45.643 1.00 19.24  ? 162 ASN H N   1 
ATOM   4094  C  CA  . ASN C 2 162 ? 26.861  -60.488  -46.179 1.00 18.15  ? 162 ASN H CA  1 
ATOM   4095  C  C   . ASN C 2 162 ? 27.359  -61.457  -45.115 1.00 19.61  ? 162 ASN H C   1 
ATOM   4096  O  O   . ASN C 2 162 ? 28.283  -62.247  -45.350 1.00 18.64  ? 162 ASN H O   1 
ATOM   4097  C  CB  . ASN C 2 162 ? 27.844  -60.418  -47.346 1.00 17.07  ? 162 ASN H CB  1 
ATOM   4098  C  CG  . ASN C 2 162 ? 27.282  -59.685  -48.530 1.00 15.90  ? 162 ASN H CG  1 
ATOM   4099  O  OD1 . ASN C 2 162 ? 26.199  -59.115  -48.466 1.00 16.44  ? 162 ASN H OD1 1 
ATOM   4100  N  ND2 . ASN C 2 162 ? 28.015  -59.689  -49.620 1.00 14.88  ? 162 ASN H ND2 1 
ATOM   4101  N  N   . SER C 2 163 ? 26.732  -61.366  -43.943 1.00 19.68  ? 163 SER H N   1 
ATOM   4102  C  CA  . SER C 2 163 ? 27.005  -62.243  -42.805 1.00 19.58  ? 163 SER H CA  1 
ATOM   4103  C  C   . SER C 2 163 ? 28.396  -62.067  -42.227 1.00 18.27  ? 163 SER H C   1 
ATOM   4104  O  O   . SER C 2 163 ? 28.927  -62.989  -41.599 1.00 18.46  ? 163 SER H O   1 
ATOM   4105  C  CB  . SER C 2 163 ? 26.771  -63.718  -43.168 1.00 20.22  ? 163 SER H CB  1 
ATOM   4106  O  OG  . SER C 2 163 ? 25.553  -63.882  -43.873 1.00 21.10  ? 163 SER H OG  1 
ATOM   4107  N  N   . GLY C 2 164 ? 28.975  -60.884  -42.409 1.00 17.27  ? 164 GLY H N   1 
ATOM   4108  C  CA  . GLY C 2 164 ? 30.306  -60.596  -41.874 1.00 17.43  ? 164 GLY H CA  1 
ATOM   4109  C  C   . GLY C 2 164 ? 31.410  -60.914  -42.862 1.00 17.58  ? 164 GLY H C   1 
ATOM   4110  O  O   . GLY C 2 164 ? 32.584  -60.644  -42.593 1.00 17.23  ? 164 GLY H O   1 
ATOM   4111  N  N   . ALA C 2 165 ? 31.032  -61.474  -44.014 1.00 17.80  ? 165 ALA H N   1 
ATOM   4112  C  CA  . ALA C 2 165 ? 31.974  -61.771  -45.093 1.00 18.31  ? 165 ALA H CA  1 
ATOM   4113  C  C   . ALA C 2 165 ? 32.439  -60.504  -45.801 1.00 18.41  ? 165 ALA H C   1 
ATOM   4114  O  O   . ALA C 2 165 ? 33.475  -60.516  -46.456 1.00 20.12  ? 165 ALA H O   1 
ATOM   4115  C  CB  . ALA C 2 165 ? 31.360  -62.755  -46.104 1.00 17.89  ? 165 ALA H CB  1 
ATOM   4116  N  N   . LEU C 2 166 ? 31.678  -59.420  -45.674 1.00 18.39  ? 166 LEU H N   1 
ATOM   4117  C  CA  . LEU C 2 166 ? 32.066  -58.121  -46.233 1.00 18.80  ? 166 LEU H CA  1 
ATOM   4118  C  C   . LEU C 2 166 ? 32.273  -57.128  -45.083 1.00 18.99  ? 166 LEU H C   1 
ATOM   4119  O  O   . LEU C 2 166 ? 31.311  -56.748  -44.406 1.00 16.91  ? 166 LEU H O   1 
ATOM   4120  C  CB  . LEU C 2 166 ? 30.988  -57.619  -47.208 1.00 18.66  ? 166 LEU H CB  1 
ATOM   4121  C  CG  . LEU C 2 166 ? 31.129  -56.213  -47.821 1.00 18.16  ? 166 LEU H CG  1 
ATOM   4122  C  CD1 . LEU C 2 166 ? 32.423  -56.087  -48.614 1.00 15.63  ? 166 LEU H CD1 1 
ATOM   4123  C  CD2 . LEU C 2 166 ? 29.919  -55.888  -48.681 1.00 14.92  ? 166 LEU H CD2 1 
ATOM   4124  N  N   . THR C 2 167 ? 33.535  -56.737  -44.871 1.00 20.07  ? 167 THR H N   1 
ATOM   4125  C  CA  . THR C 2 167 ? 33.930  -55.836  -43.777 1.00 20.71  ? 167 THR H CA  1 
ATOM   4126  C  C   . THR C 2 167 ? 34.666  -54.581  -44.240 1.00 21.37  ? 167 THR H C   1 
ATOM   4127  O  O   . THR C 2 167 ? 34.446  -53.511  -43.687 1.00 25.04  ? 167 THR H O   1 
ATOM   4128  C  CB  . THR C 2 167 ? 34.817  -56.561  -42.739 1.00 21.09  ? 167 THR H CB  1 
ATOM   4129  O  OG1 . THR C 2 167 ? 35.854  -57.294  -43.410 1.00 20.48  ? 167 THR H OG1 1 
ATOM   4130  C  CG2 . THR C 2 167 ? 33.968  -57.521  -41.881 1.00 20.24  ? 167 THR H CG2 1 
ATOM   4131  N  N   . SER C 2 168 ? 35.552  -54.709  -45.222 1.00 21.23  ? 168 SER H N   1 
ATOM   4132  C  CA  . SER C 2 168 ? 36.245  -53.553  -45.801 1.00 21.41  ? 168 SER H CA  1 
ATOM   4133  C  C   . SER C 2 168 ? 35.280  -52.549  -46.427 1.00 21.63  ? 168 SER H C   1 
ATOM   4134  O  O   . SER C 2 168 ? 34.351  -52.931  -47.145 1.00 19.80  ? 168 SER H O   1 
ATOM   4135  C  CB  . SER C 2 168 ? 37.236  -54.003  -46.867 1.00 21.90  ? 168 SER H CB  1 
ATOM   4136  O  OG  . SER C 2 168 ? 38.142  -54.954  -46.339 1.00 24.48  ? 168 SER H OG  1 
ATOM   4137  N  N   . GLY C 2 169 ? 35.506  -51.266  -46.146 1.00 21.07  ? 169 GLY H N   1 
ATOM   4138  C  CA  . GLY C 2 169 ? 34.686  -50.194  -46.716 1.00 20.89  ? 169 GLY H CA  1 
ATOM   4139  C  C   . GLY C 2 169 ? 33.349  -49.950  -46.021 1.00 19.39  ? 169 GLY H C   1 
ATOM   4140  O  O   . GLY C 2 169 ? 32.534  -49.164  -46.508 1.00 17.16  ? 169 GLY H O   1 
ATOM   4141  N  N   . VAL C 2 170 ? 33.126  -50.614  -44.887 1.00 18.44  ? 170 VAL H N   1 
ATOM   4142  C  CA  . VAL C 2 170 ? 31.862  -50.503  -44.169 1.00 18.36  ? 170 VAL H CA  1 
ATOM   4143  C  C   . VAL C 2 170 ? 31.896  -49.371  -43.138 1.00 18.24  ? 170 VAL H C   1 
ATOM   4144  O  O   . VAL C 2 170 ? 32.823  -49.273  -42.331 1.00 18.70  ? 170 VAL H O   1 
ATOM   4145  C  CB  . VAL C 2 170 ? 31.471  -51.843  -43.484 1.00 17.63  ? 170 VAL H CB  1 
ATOM   4146  C  CG1 . VAL C 2 170 ? 30.240  -51.666  -42.599 1.00 15.21  ? 170 VAL H CG1 1 
ATOM   4147  C  CG2 . VAL C 2 170 ? 31.212  -52.924  -44.531 1.00 16.77  ? 170 VAL H CG2 1 
ATOM   4148  N  N   . HIS C 2 171 ? 30.875  -48.515  -43.186 1.00 18.04  ? 171 HIS H N   1 
ATOM   4149  C  CA  . HIS C 2 171 ? 30.656  -47.494  -42.171 1.00 18.16  ? 171 HIS H CA  1 
ATOM   4150  C  C   . HIS C 2 171 ? 29.225  -47.516  -41.673 1.00 17.83  ? 171 HIS H C   1 
ATOM   4151  O  O   . HIS C 2 171 ? 28.298  -47.158  -42.406 1.00 18.20  ? 171 HIS H O   1 
ATOM   4152  C  CB  . HIS C 2 171 ? 30.972  -46.107  -42.721 1.00 18.34  ? 171 HIS H CB  1 
ATOM   4153  C  CG  . HIS C 2 171 ? 32.432  -45.858  -42.925 1.00 19.28  ? 171 HIS H CG  1 
ATOM   4154  N  ND1 . HIS C 2 171 ? 33.001  -45.741  -44.176 1.00 19.14  ? 171 HIS H ND1 1 
ATOM   4155  C  CD2 . HIS C 2 171 ? 33.441  -45.701  -42.036 1.00 19.67  ? 171 HIS H CD2 1 
ATOM   4156  C  CE1 . HIS C 2 171 ? 34.296  -45.514  -44.048 1.00 19.98  ? 171 HIS H CE1 1 
ATOM   4157  N  NE2 . HIS C 2 171 ? 34.590  -45.488  -42.761 1.00 19.68  ? 171 HIS H NE2 1 
ATOM   4158  N  N   . THR C 2 172 ? 29.051  -47.944  -40.427 1.00 18.50  ? 172 THR H N   1 
ATOM   4159  C  CA  . THR C 2 172 ? 27.756  -47.873  -39.754 1.00 20.00  ? 172 THR H CA  1 
ATOM   4160  C  C   . THR C 2 172 ? 27.814  -46.654  -38.860 1.00 17.48  ? 172 THR H C   1 
ATOM   4161  O  O   . THR C 2 172 ? 28.663  -46.587  -37.972 1.00 18.61  ? 172 THR H O   1 
ATOM   4162  C  CB  . THR C 2 172 ? 27.471  -49.155  -38.925 1.00 21.37  ? 172 THR H CB  1 
ATOM   4163  O  OG1 . THR C 2 172 ? 27.593  -50.306  -39.776 1.00 23.78  ? 172 THR H OG1 1 
ATOM   4164  C  CG2 . THR C 2 172 ? 26.074  -49.121  -38.313 1.00 19.11  ? 172 THR H CG2 1 
ATOM   4165  N  N   . PHE C 2 173 ? 26.939  -45.684  -39.106 1.00 14.72  ? 173 PHE H N   1 
ATOM   4166  C  CA  . PHE C 2 173 ? 26.990  -44.415  -38.377 1.00 14.05  ? 173 PHE H CA  1 
ATOM   4167  C  C   . PHE C 2 173 ? 26.364  -44.515  -36.985 1.00 15.32  ? 173 PHE H C   1 
ATOM   4168  O  O   . PHE C 2 173 ? 25.542  -45.395  -36.743 1.00 14.24  ? 173 PHE H O   1 
ATOM   4169  C  CB  . PHE C 2 173 ? 26.330  -43.307  -39.194 1.00 13.52  ? 173 PHE H CB  1 
ATOM   4170  C  CG  . PHE C 2 173 ? 27.053  -43.011  -40.468 1.00 13.35  ? 173 PHE H CG  1 
ATOM   4171  C  CD1 . PHE C 2 173 ? 28.111  -42.135  -40.482 1.00 13.33  ? 173 PHE H CD1 1 
ATOM   4172  C  CD2 . PHE C 2 173 ? 26.709  -43.655  -41.650 1.00 14.23  ? 173 PHE H CD2 1 
ATOM   4173  C  CE1 . PHE C 2 173 ? 28.798  -41.893  -41.648 1.00 13.27  ? 173 PHE H CE1 1 
ATOM   4174  C  CE2 . PHE C 2 173 ? 27.399  -43.404  -42.831 1.00 12.55  ? 173 PHE H CE2 1 
ATOM   4175  C  CZ  . PHE C 2 173 ? 28.435  -42.528  -42.821 1.00 12.78  ? 173 PHE H CZ  1 
ATOM   4176  N  N   . PRO C 2 174 ? 26.772  -43.627  -36.056 1.00 14.21  ? 174 PRO H N   1 
ATOM   4177  C  CA  . PRO C 2 174 ? 26.076  -43.579  -34.758 1.00 16.22  ? 174 PRO H CA  1 
ATOM   4178  C  C   . PRO C 2 174 ? 24.579  -43.316  -34.940 1.00 16.34  ? 174 PRO H C   1 
ATOM   4179  O  O   . PRO C 2 174 ? 24.196  -42.611  -35.871 1.00 14.84  ? 174 PRO H O   1 
ATOM   4180  C  CB  . PRO C 2 174 ? 26.726  -42.394  -34.027 1.00 14.13  ? 174 PRO H CB  1 
ATOM   4181  C  CG  . PRO C 2 174 ? 28.013  -42.151  -34.719 1.00 15.06  ? 174 PRO H CG  1 
ATOM   4182  C  CD  . PRO C 2 174 ? 27.959  -42.763  -36.094 1.00 14.77  ? 174 PRO H CD  1 
ATOM   4183  N  N   . ALA C 2 175 ? 23.762  -43.877  -34.051 1.00 17.57  ? 175 ALA H N   1 
ATOM   4184  C  CA  . ALA C 2 175 ? 22.312  -43.655  -34.063 1.00 17.58  ? 175 ALA H CA  1 
ATOM   4185  C  C   . ALA C 2 175 ? 22.027  -42.201  -33.752 1.00 18.72  ? 175 ALA H C   1 
ATOM   4186  O  O   . ALA C 2 175 ? 22.745  -41.582  -32.979 1.00 20.08  ? 175 ALA H O   1 
ATOM   4187  C  CB  . ALA C 2 175 ? 21.614  -44.558  -33.041 1.00 16.05  ? 175 ALA H CB  1 
ATOM   4188  N  N   . VAL C 2 176 ? 20.995  -41.653  -34.379 1.00 20.13  ? 176 VAL H N   1 
ATOM   4189  C  CA  . VAL C 2 176 ? 20.523  -40.317  -34.058 1.00 21.28  ? 176 VAL H CA  1 
ATOM   4190  C  C   . VAL C 2 176 ? 19.103  -40.451  -33.518 1.00 21.23  ? 176 VAL H C   1 
ATOM   4191  O  O   . VAL C 2 176 ? 18.261  -41.136  -34.109 1.00 21.72  ? 176 VAL H O   1 
ATOM   4192  C  CB  . VAL C 2 176 ? 20.537  -39.370  -35.297 1.00 22.81  ? 176 VAL H CB  1 
ATOM   4193  C  CG1 . VAL C 2 176 ? 19.333  -39.666  -36.250 1.00 23.26  ? 176 VAL H CG1 1 
ATOM   4194  C  CG2 . VAL C 2 176 ? 20.522  -37.910  -34.858 1.00 23.06  ? 176 VAL H CG2 1 
ATOM   4195  N  N   . LEU C 2 177 ? 18.854  -39.815  -32.381 1.00 21.02  ? 177 LEU H N   1 
ATOM   4196  C  CA  . LEU C 2 177 ? 17.518  -39.726  -31.830 1.00 20.87  ? 177 LEU H CA  1 
ATOM   4197  C  C   . LEU C 2 177 ? 16.739  -38.684  -32.641 1.00 21.09  ? 177 LEU H C   1 
ATOM   4198  O  O   . LEU C 2 177 ? 17.116  -37.513  -32.708 1.00 20.21  ? 177 LEU H O   1 
ATOM   4199  C  CB  . LEU C 2 177 ? 17.569  -39.359  -30.341 1.00 19.50  ? 177 LEU H CB  1 
ATOM   4200  C  CG  . LEU C 2 177 ? 16.273  -39.529  -29.539 1.00 19.32  ? 177 LEU H CG  1 
ATOM   4201  C  CD1 . LEU C 2 177 ? 15.774  -40.969  -29.564 1.00 18.06  ? 177 LEU H CD1 1 
ATOM   4202  C  CD2 . LEU C 2 177 ? 16.500  -39.051  -28.096 1.00 18.17  ? 177 LEU H CD2 1 
ATOM   4203  N  N   . GLN C 2 178 ? 15.672  -39.137  -33.288 1.00 21.82  ? 178 GLN H N   1 
ATOM   4204  C  CA  . GLN C 2 178 ? 14.808  -38.256  -34.059 1.00 22.29  ? 178 GLN H CA  1 
ATOM   4205  C  C   . GLN C 2 178 ? 13.850  -37.574  -33.107 1.00 20.54  ? 178 GLN H C   1 
ATOM   4206  O  O   . GLN C 2 178 ? 13.715  -37.979  -31.957 1.00 21.47  ? 178 GLN H O   1 
ATOM   4207  C  CB  . GLN C 2 178 ? 14.016  -39.054  -35.094 1.00 22.92  ? 178 GLN H CB  1 
ATOM   4208  C  CG  . GLN C 2 178 ? 14.876  -39.818  -36.081 1.00 24.27  ? 178 GLN H CG  1 
ATOM   4209  C  CD  . GLN C 2 178 ? 14.111  -40.918  -36.775 1.00 25.69  ? 178 GLN H CD  1 
ATOM   4210  O  OE1 . GLN C 2 178 ? 13.917  -40.885  -37.994 1.00 27.73  ? 178 GLN H OE1 1 
ATOM   4211  N  NE2 . GLN C 2 178 ? 13.658  -41.903  -36.000 1.00 25.45  ? 178 GLN H NE2 1 
ATOM   4212  N  N   . SER C 2 179 ? 13.175  -36.547  -33.599 1.00 19.76  ? 179 SER H N   1 
ATOM   4213  C  CA  . SER C 2 179 ? 12.182  -35.817  -32.808 1.00 20.09  ? 179 SER H CA  1 
ATOM   4214  C  C   . SER C 2 179 ? 11.023  -36.705  -32.332 1.00 18.92  ? 179 SER H C   1 
ATOM   4215  O  O   . SER C 2 179 ? 10.422  -36.438  -31.301 1.00 19.30  ? 179 SER H O   1 
ATOM   4216  C  CB  . SER C 2 179 ? 11.658  -34.620  -33.611 1.00 20.78  ? 179 SER H CB  1 
ATOM   4217  O  OG  . SER C 2 179 ? 11.824  -34.835  -35.006 1.00 22.09  ? 179 SER H OG  1 
ATOM   4218  N  N   . SER C 2 180 ? 10.735  -37.771  -33.071 1.00 17.98  ? 180 SER H N   1 
ATOM   4219  C  CA  . SER C 2 180 ? 9.734   -38.756  -32.658 1.00 17.65  ? 180 SER H CA  1 
ATOM   4220  C  C   . SER C 2 180 ? 10.053  -39.501  -31.348 1.00 18.92  ? 180 SER H C   1 
ATOM   4221  O  O   . SER C 2 180 ? 9.162   -40.136  -30.779 1.00 20.24  ? 180 SER H O   1 
ATOM   4222  C  CB  . SER C 2 180 ? 9.536   -39.796  -33.767 1.00 16.81  ? 180 SER H CB  1 
ATOM   4223  O  OG  . SER C 2 180 ? 10.724  -40.540  -34.017 1.00 16.09  ? 180 SER H OG  1 
ATOM   4224  N  N   . GLY C 2 181 ? 11.304  -39.441  -30.883 1.00 18.65  ? 181 GLY H N   1 
ATOM   4225  C  CA  . GLY C 2 181 ? 11.758  -40.259  -29.756 1.00 18.38  ? 181 GLY H CA  1 
ATOM   4226  C  C   . GLY C 2 181 ? 12.304  -41.628  -30.163 1.00 19.60  ? 181 GLY H C   1 
ATOM   4227  O  O   . GLY C 2 181 ? 12.676  -42.426  -29.296 1.00 19.93  ? 181 GLY H O   1 
ATOM   4228  N  N   . LEU C 2 182 ? 12.362  -41.900  -31.471 1.00 19.39  ? 182 LEU H N   1 
ATOM   4229  C  CA  . LEU C 2 182 ? 12.868  -43.178  -31.993 1.00 19.06  ? 182 LEU H CA  1 
ATOM   4230  C  C   . LEU C 2 182 ? 14.194  -42.951  -32.676 1.00 18.86  ? 182 LEU H C   1 
ATOM   4231  O  O   . LEU C 2 182 ? 14.434  -41.874  -33.216 1.00 20.03  ? 182 LEU H O   1 
ATOM   4232  C  CB  . LEU C 2 182 ? 11.890  -43.791  -33.004 1.00 17.85  ? 182 LEU H CB  1 
ATOM   4233  C  CG  . LEU C 2 182 ? 10.430  -43.962  -32.563 1.00 17.06  ? 182 LEU H CG  1 
ATOM   4234  C  CD1 . LEU C 2 182 ? 9.571   -44.327  -33.786 1.00 15.26  ? 182 LEU H CD1 1 
ATOM   4235  C  CD2 . LEU C 2 182 ? 10.282  -44.982  -31.426 1.00 14.40  ? 182 LEU H CD2 1 
ATOM   4236  N  N   . TYR C 2 183 ? 15.053  -43.967  -32.672 1.00 19.58  ? 183 TYR H N   1 
ATOM   4237  C  CA  . TYR C 2 183 ? 16.379  -43.845  -33.296 1.00 18.00  ? 183 TYR H CA  1 
ATOM   4238  C  C   . TYR C 2 183 ? 16.381  -44.164  -34.781 1.00 18.81  ? 183 TYR H C   1 
ATOM   4239  O  O   . TYR C 2 183 ? 15.475  -44.823  -35.308 1.00 15.46  ? 183 TYR H O   1 
ATOM   4240  C  CB  . TYR C 2 183 ? 17.403  -44.738  -32.608 1.00 18.18  ? 183 TYR H CB  1 
ATOM   4241  C  CG  . TYR C 2 183 ? 17.849  -44.203  -31.280 1.00 19.92  ? 183 TYR H CG  1 
ATOM   4242  C  CD1 . TYR C 2 183 ? 18.724  -43.122  -31.212 1.00 20.68  ? 183 TYR H CD1 1 
ATOM   4243  C  CD2 . TYR C 2 183 ? 17.403  -44.775  -30.086 1.00 20.27  ? 183 TYR H CD2 1 
ATOM   4244  C  CE1 . TYR C 2 183 ? 19.133  -42.626  -30.002 1.00 21.60  ? 183 TYR H CE1 1 
ATOM   4245  C  CE2 . TYR C 2 183 ? 17.815  -44.292  -28.878 1.00 20.93  ? 183 TYR H CE2 1 
ATOM   4246  C  CZ  . TYR C 2 183 ? 18.682  -43.216  -28.843 1.00 21.82  ? 183 TYR H CZ  1 
ATOM   4247  O  OH  . TYR C 2 183 ? 19.101  -42.715  -27.645 1.00 25.31  ? 183 TYR H OH  1 
ATOM   4248  N  N   . SER C 2 184 ? 17.437  -43.689  -35.438 1.00 19.89  ? 184 SER H N   1 
ATOM   4249  C  CA  . SER C 2 184 ? 17.690  -43.991  -36.835 1.00 19.58  ? 184 SER H CA  1 
ATOM   4250  C  C   . SER C 2 184 ? 19.194  -43.947  -37.149 1.00 18.88  ? 184 SER H C   1 
ATOM   4251  O  O   . SER C 2 184 ? 19.936  -43.162  -36.570 1.00 18.01  ? 184 SER H O   1 
ATOM   4252  C  CB  . SER C 2 184 ? 16.949  -42.992  -37.705 1.00 19.77  ? 184 SER H CB  1 
ATOM   4253  O  OG  . SER C 2 184 ? 17.154  -43.282  -39.065 1.00 21.62  ? 184 SER H OG  1 
ATOM   4254  N  N   . LEU C 2 185 ? 19.633  -44.815  -38.054 1.00 20.41  ? 185 LEU H N   1 
ATOM   4255  C  CA  . LEU C 2 185 ? 20.996  -44.746  -38.601 1.00 20.13  ? 185 LEU H CA  1 
ATOM   4256  C  C   . LEU C 2 185 ? 21.065  -45.329  -40.005 1.00 19.66  ? 185 LEU H C   1 
ATOM   4257  O  O   . LEU C 2 185 ? 20.132  -45.987  -40.462 1.00 18.98  ? 185 LEU H O   1 
ATOM   4258  C  CB  . LEU C 2 185 ? 22.009  -45.437  -37.678 1.00 18.88  ? 185 LEU H CB  1 
ATOM   4259  C  CG  . LEU C 2 185 ? 21.859  -46.927  -37.341 1.00 18.24  ? 185 LEU H CG  1 
ATOM   4260  C  CD1 . LEU C 2 185 ? 22.300  -47.809  -38.503 1.00 17.63  ? 185 LEU H CD1 1 
ATOM   4261  C  CD2 . LEU C 2 185 ? 22.673  -47.244  -36.090 1.00 16.24  ? 185 LEU H CD2 1 
ATOM   4262  N  N   . SER C 2 186 ? 22.165  -45.028  -40.688 1.00 20.38  ? 186 SER H N   1 
ATOM   4263  C  CA  . SER C 2 186 ? 22.515  -45.669  -41.952 1.00 20.75  ? 186 SER H CA  1 
ATOM   4264  C  C   . SER C 2 186 ? 23.811  -46.457  -41.773 1.00 19.47  ? 186 SER H C   1 
ATOM   4265  O  O   . SER C 2 186 ? 24.651  -46.110  -40.959 1.00 17.34  ? 186 SER H O   1 
ATOM   4266  C  CB  . SER C 2 186 ? 22.674  -44.643  -43.080 1.00 20.50  ? 186 SER H CB  1 
ATOM   4267  O  OG  . SER C 2 186 ? 21.409  -44.260  -43.593 1.00 21.39  ? 186 SER H OG  1 
ATOM   4268  N  N   . SER C 2 187 ? 23.914  -47.556  -42.503 1.00 19.46  ? 187 SER H N   1 
ATOM   4269  C  CA  . SER C 2 187 ? 25.157  -48.271  -42.678 1.00 21.11  ? 187 SER H CA  1 
ATOM   4270  C  C   . SER C 2 187 ? 25.393  -48.328  -44.183 1.00 20.99  ? 187 SER H C   1 
ATOM   4271  O  O   . SER C 2 187 ? 24.497  -48.715  -44.944 1.00 19.56  ? 187 SER H O   1 
ATOM   4272  C  CB  . SER C 2 187 ? 25.072  -49.689  -42.112 1.00 22.02  ? 187 SER H CB  1 
ATOM   4273  O  OG  . SER C 2 187 ? 26.348  -50.316  -42.143 1.00 23.11  ? 187 SER H OG  1 
ATOM   4274  N  N   . VAL C 2 188 ? 26.599  -47.947  -44.591 1.00 20.78  ? 188 VAL H N   1 
ATOM   4275  C  CA  . VAL C 2 188 ? 26.963  -47.853  -45.996 1.00 19.31  ? 188 VAL H CA  1 
ATOM   4276  C  C   . VAL C 2 188 ? 28.209  -48.672  -46.259 1.00 18.40  ? 188 VAL H C   1 
ATOM   4277  O  O   . VAL C 2 188 ? 29.025  -48.867  -45.353 1.00 18.35  ? 188 VAL H O   1 
ATOM   4278  C  CB  . VAL C 2 188 ? 27.226  -46.380  -46.389 1.00 19.43  ? 188 VAL H CB  1 
ATOM   4279  C  CG1 . VAL C 2 188 ? 25.973  -45.536  -46.120 1.00 17.45  ? 188 VAL H CG1 1 
ATOM   4280  C  CG2 . VAL C 2 188 ? 28.439  -45.821  -45.637 1.00 17.46  ? 188 VAL H CG2 1 
ATOM   4281  N  N   . VAL C 2 189 ? 28.344  -49.169  -47.490 1.00 16.60  ? 189 VAL H N   1 
ATOM   4282  C  CA  . VAL C 2 189 ? 29.570  -49.844  -47.915 1.00 15.55  ? 189 VAL H CA  1 
ATOM   4283  C  C   . VAL C 2 189 ? 29.876  -49.483  -49.368 1.00 15.14  ? 189 VAL H C   1 
ATOM   4284  O  O   . VAL C 2 189 ? 28.969  -49.311  -50.167 1.00 14.27  ? 189 VAL H O   1 
ATOM   4285  C  CB  . VAL C 2 189 ? 29.489  -51.390  -47.722 1.00 15.50  ? 189 VAL H CB  1 
ATOM   4286  C  CG1 . VAL C 2 189 ? 28.431  -51.999  -48.610 1.00 13.97  ? 189 VAL H CG1 1 
ATOM   4287  C  CG2 . VAL C 2 189 ? 30.857  -52.040  -47.968 1.00 14.62  ? 189 VAL H CG2 1 
ATOM   4288  N  N   . THR C 2 190 ? 31.155  -49.329  -49.692 1.00 16.27  ? 190 THR H N   1 
ATOM   4289  C  CA  . THR C 2 190 ? 31.571  -49.066  -51.074 1.00 16.85  ? 190 THR H CA  1 
ATOM   4290  C  C   . THR C 2 190 ? 32.157  -50.346  -51.631 1.00 16.75  ? 190 THR H C   1 
ATOM   4291  O  O   . THR C 2 190 ? 32.911  -51.033  -50.938 1.00 18.72  ? 190 THR H O   1 
ATOM   4292  C  CB  . THR C 2 190 ? 32.596  -47.928  -51.186 1.00 16.49  ? 190 THR H CB  1 
ATOM   4293  O  OG1 . THR C 2 190 ? 33.775  -48.267  -50.454 1.00 17.73  ? 190 THR H OG1 1 
ATOM   4294  C  CG2 . THR C 2 190 ? 32.028  -46.628  -50.639 1.00 16.14  ? 190 THR H CG2 1 
ATOM   4295  N  N   . VAL C 2 191 ? 31.785  -50.666  -52.869 1.00 15.87  ? 191 VAL H N   1 
ATOM   4296  C  CA  . VAL C 2 191 ? 32.143  -51.925  -53.518 1.00 15.32  ? 191 VAL H CA  1 
ATOM   4297  C  C   . VAL C 2 191 ? 32.482  -51.647  -54.982 1.00 16.14  ? 191 VAL H C   1 
ATOM   4298  O  O   . VAL C 2 191 ? 32.090  -50.613  -55.528 1.00 13.69  ? 191 VAL H O   1 
ATOM   4299  C  CB  . VAL C 2 191 ? 30.959  -52.948  -53.473 1.00 15.96  ? 191 VAL H CB  1 
ATOM   4300  C  CG1 . VAL C 2 191 ? 30.548  -53.256  -52.042 1.00 13.76  ? 191 VAL H CG1 1 
ATOM   4301  C  CG2 . VAL C 2 191 ? 29.754  -52.441  -54.293 1.00 14.87  ? 191 VAL H CG2 1 
ATOM   4302  N  N   . PRO C 2 192 ? 33.206  -52.570  -55.635 1.00 18.21  ? 192 PRO H N   1 
ATOM   4303  C  CA  . PRO C 2 192 ? 33.437  -52.349  -57.070 1.00 18.80  ? 192 PRO H CA  1 
ATOM   4304  C  C   . PRO C 2 192 ? 32.118  -52.458  -57.842 1.00 19.94  ? 192 PRO H C   1 
ATOM   4305  O  O   . PRO C 2 192 ? 31.338  -53.398  -57.632 1.00 18.85  ? 192 PRO H O   1 
ATOM   4306  C  CB  . PRO C 2 192 ? 34.404  -53.477  -57.464 1.00 17.67  ? 192 PRO H CB  1 
ATOM   4307  C  CG  . PRO C 2 192 ? 34.831  -54.129  -56.167 1.00 17.73  ? 192 PRO H CG  1 
ATOM   4308  C  CD  . PRO C 2 192 ? 33.761  -53.853  -55.171 1.00 17.86  ? 192 PRO H CD  1 
ATOM   4309  N  N   . SER C 2 193 ? 31.871  -51.488  -58.712 1.00 21.20  ? 193 SER H N   1 
ATOM   4310  C  CA  . SER C 2 193 ? 30.645  -51.456  -59.507 1.00 23.01  ? 193 SER H CA  1 
ATOM   4311  C  C   . SER C 2 193 ? 30.467  -52.696  -60.392 1.00 23.25  ? 193 SER H C   1 
ATOM   4312  O  O   . SER C 2 193 ? 29.340  -53.090  -60.703 1.00 23.00  ? 193 SER H O   1 
ATOM   4313  C  CB  . SER C 2 193 ? 30.637  -50.202  -60.373 1.00 23.33  ? 193 SER H CB  1 
ATOM   4314  O  OG  . SER C 2 193 ? 31.858  -50.104  -61.077 1.00 24.44  ? 193 SER H OG  1 
ATOM   4315  N  N   . SER C 2 194 ? 31.571  -53.314  -60.798 1.00 24.27  ? 194 SER H N   1 
ATOM   4316  C  CA  . SER C 2 194 ? 31.489  -54.527  -61.617 1.00 25.80  ? 194 SER H CA  1 
ATOM   4317  C  C   . SER C 2 194 ? 30.948  -55.736  -60.829 1.00 25.69  ? 194 SER H C   1 
ATOM   4318  O  O   . SER C 2 194 ? 30.504  -56.714  -61.435 1.00 25.93  ? 194 SER H O   1 
ATOM   4319  C  CB  . SER C 2 194 ? 32.847  -54.852  -62.246 1.00 25.62  ? 194 SER H CB  1 
ATOM   4320  O  OG  . SER C 2 194 ? 33.885  -54.737  -61.297 1.00 25.93  ? 194 SER H OG  1 
ATOM   4321  N  N   . SER C 2 195 ? 30.974  -55.663  -59.497 1.00 23.62  ? 195 SER H N   1 
ATOM   4322  C  CA  . SER C 2 195 ? 30.476  -56.752  -58.655 1.00 23.39  ? 195 SER H CA  1 
ATOM   4323  C  C   . SER C 2 195 ? 28.945  -56.763  -58.493 1.00 22.52  ? 195 SER H C   1 
ATOM   4324  O  O   . SER C 2 195 ? 28.370  -57.740  -58.008 1.00 22.53  ? 195 SER H O   1 
ATOM   4325  C  CB  . SER C 2 195 ? 31.134  -56.673  -57.276 1.00 24.56  ? 195 SER H CB  1 
ATOM   4326  O  OG  . SER C 2 195 ? 30.548  -55.652  -56.463 1.00 25.41  ? 195 SER H OG  1 
ATOM   4327  N  N   . LEU C 2 196 ? 28.292  -55.674  -58.884 1.00 21.47  ? 196 LEU H N   1 
ATOM   4328  C  CA  . LEU C 2 196 ? 26.858  -55.515  -58.669 1.00 20.61  ? 196 LEU H CA  1 
ATOM   4329  C  C   . LEU C 2 196 ? 26.007  -56.543  -59.407 1.00 19.39  ? 196 LEU H C   1 
ATOM   4330  O  O   . LEU C 2 196 ? 24.896  -56.838  -58.976 1.00 18.95  ? 196 LEU H O   1 
ATOM   4331  C  CB  . LEU C 2 196 ? 26.409  -54.112  -59.084 1.00 20.77  ? 196 LEU H CB  1 
ATOM   4332  C  CG  . LEU C 2 196 ? 26.926  -52.912  -58.291 1.00 20.44  ? 196 LEU H CG  1 
ATOM   4333  C  CD1 . LEU C 2 196 ? 26.310  -51.645  -58.852 1.00 19.09  ? 196 LEU H CD1 1 
ATOM   4334  C  CD2 . LEU C 2 196 ? 26.625  -53.051  -56.795 1.00 19.17  ? 196 LEU H CD2 1 
ATOM   4335  N  N   . GLY C 2 197 ? 26.522  -57.066  -60.518 1.00 18.72  ? 197 GLY H N   1 
ATOM   4336  C  CA  . GLY C 2 197 ? 25.830  -58.089  -61.302 1.00 17.47  ? 197 GLY H CA  1 
ATOM   4337  C  C   . GLY C 2 197 ? 26.242  -59.527  -61.008 1.00 17.94  ? 197 GLY H C   1 
ATOM   4338  O  O   . GLY C 2 197 ? 25.684  -60.462  -61.598 1.00 16.71  ? 197 GLY H O   1 
ATOM   4339  N  N   . THR C 2 198 ? 27.221  -59.716  -60.119 1.00 17.27  ? 198 THR H N   1 
ATOM   4340  C  CA  . THR C 2 198 ? 27.745  -61.058  -59.822 1.00 16.46  ? 198 THR H CA  1 
ATOM   4341  C  C   . THR C 2 198 ? 27.821  -61.387  -58.326 1.00 16.93  ? 198 THR H C   1 
ATOM   4342  O  O   . THR C 2 198 ? 28.364  -62.424  -57.951 1.00 16.85  ? 198 THR H O   1 
ATOM   4343  C  CB  . THR C 2 198 ? 29.154  -61.255  -60.441 1.00 15.92  ? 198 THR H CB  1 
ATOM   4344  O  OG1 . THR C 2 198 ? 30.063  -60.315  -59.873 1.00 15.96  ? 198 THR H OG1 1 
ATOM   4345  C  CG2 . THR C 2 198 ? 29.130  -61.067  -61.951 1.00 15.12  ? 198 THR H CG2 1 
ATOM   4346  N  N   . LYS C 2 199 ? 27.282  -60.508  -57.480 1.00 17.92  ? 199 LYS H N   1 
ATOM   4347  C  CA  . LYS C 2 199 ? 27.282  -60.680  -56.025 1.00 17.38  ? 199 LYS H CA  1 
ATOM   4348  C  C   . LYS C 2 199 ? 26.019  -60.056  -55.443 1.00 16.87  ? 199 LYS H C   1 
ATOM   4349  O  O   . LYS C 2 199 ? 25.533  -59.051  -55.957 1.00 14.73  ? 199 LYS H O   1 
ATOM   4350  C  CB  . LYS C 2 199 ? 28.481  -59.985  -55.382 1.00 18.69  ? 199 LYS H CB  1 
ATOM   4351  C  CG  . LYS C 2 199 ? 29.855  -60.545  -55.756 1.00 19.49  ? 199 LYS H CG  1 
ATOM   4352  C  CD  . LYS C 2 199 ? 30.967  -59.564  -55.390 1.00 19.69  ? 199 LYS H CD  1 
ATOM   4353  C  CE  . LYS C 2 199 ? 31.580  -59.861  -54.084 1.00 20.51  ? 199 LYS H CE  1 
ATOM   4354  N  NZ  . LYS C 2 199 ? 30.623  -60.408  -53.098 1.00 22.26  ? 199 LYS H NZ  1 
ATOM   4355  N  N   . THR C 2 200 ? 25.503  -60.666  -54.375 1.00 16.99  ? 200 THR H N   1 
ATOM   4356  C  CA  . THR C 2 200 ? 24.334  -60.180  -53.647 1.00 16.59  ? 200 THR H CA  1 
ATOM   4357  C  C   . THR C 2 200 ? 24.853  -59.442  -52.427 1.00 16.01  ? 200 THR H C   1 
ATOM   4358  O  O   . THR C 2 200 ? 25.699  -59.962  -51.703 1.00 14.79  ? 200 THR H O   1 
ATOM   4359  C  CB  . THR C 2 200 ? 23.430  -61.358  -53.164 1.00 17.15  ? 200 THR H CB  1 
ATOM   4360  O  OG1 . THR C 2 200 ? 23.075  -62.194  -54.268 1.00 16.40  ? 200 THR H OG1 1 
ATOM   4361  C  CG2 . THR C 2 200 ? 22.153  -60.851  -52.494 1.00 17.65  ? 200 THR H CG2 1 
ATOM   4362  N  N   . TYR C 2 201 ? 24.354  -58.230  -52.206 1.00 16.22  ? 201 TYR H N   1 
ATOM   4363  C  CA  . TYR C 2 201 ? 24.709  -57.444  -51.024 1.00 15.08  ? 201 TYR H CA  1 
ATOM   4364  C  C   . TYR C 2 201 ? 23.516  -57.383  -50.077 1.00 15.79  ? 201 TYR H C   1 
ATOM   4365  O  O   . TYR C 2 201 ? 22.456  -56.878  -50.447 1.00 15.02  ? 201 TYR H O   1 
ATOM   4366  C  CB  . TYR C 2 201 ? 25.205  -56.047  -51.422 1.00 13.29  ? 201 TYR H CB  1 
ATOM   4367  C  CG  . TYR C 2 201 ? 26.530  -56.112  -52.143 1.00 12.62  ? 201 TYR H CG  1 
ATOM   4368  C  CD1 . TYR C 2 201 ? 27.688  -56.457  -51.457 1.00 13.22  ? 201 TYR H CD1 1 
ATOM   4369  C  CD2 . TYR C 2 201 ? 26.622  -55.888  -53.514 1.00 12.17  ? 201 TYR H CD2 1 
ATOM   4370  C  CE1 . TYR C 2 201 ? 28.917  -56.555  -52.098 1.00 12.76  ? 201 TYR H CE1 1 
ATOM   4371  C  CE2 . TYR C 2 201 ? 27.850  -55.989  -54.178 1.00 12.54  ? 201 TYR H CE2 1 
ATOM   4372  C  CZ  . TYR C 2 201 ? 29.000  -56.320  -53.457 1.00 12.75  ? 201 TYR H CZ  1 
ATOM   4373  O  OH  . TYR C 2 201 ? 30.229  -56.422  -54.071 1.00 9.77   ? 201 TYR H OH  1 
ATOM   4374  N  N   . THR C 2 202 ? 23.710  -57.930  -48.870 1.00 16.63  ? 202 THR H N   1 
ATOM   4375  C  CA  . THR C 2 202 ? 22.670  -58.049  -47.852 1.00 17.55  ? 202 THR H CA  1 
ATOM   4376  C  C   . THR C 2 202 ? 23.168  -57.416  -46.565 1.00 18.89  ? 202 THR H C   1 
ATOM   4377  O  O   . THR C 2 202 ? 24.277  -57.718  -46.108 1.00 17.20  ? 202 THR H O   1 
ATOM   4378  C  CB  . THR C 2 202 ? 22.342  -59.523  -47.517 1.00 18.30  ? 202 THR H CB  1 
ATOM   4379  O  OG1 . THR C 2 202 ? 22.002  -60.256  -48.710 1.00 21.11  ? 202 THR H OG1 1 
ATOM   4380  C  CG2 . THR C 2 202 ? 21.182  -59.609  -46.483 1.00 15.01  ? 202 THR H CG2 1 
ATOM   4381  N  N   . CYS C 2 203 ? 22.352  -56.552  -45.967 1.00 19.40  ? 203 CYS H N   1 
ATOM   4382  C  CA  . CYS C 2 203 ? 22.677  -56.037  -44.648 1.00 20.89  ? 203 CYS H CA  1 
ATOM   4383  C  C   . CYS C 2 203 ? 21.904  -56.826  -43.591 1.00 19.62  ? 203 CYS H C   1 
ATOM   4384  O  O   . CYS C 2 203 ? 20.670  -56.996  -43.666 1.00 19.01  ? 203 CYS H O   1 
ATOM   4385  C  CB  . CYS C 2 203 ? 22.412  -54.533  -44.556 1.00 23.54  ? 203 CYS H CB  1 
ATOM   4386  S  SG  . CYS C 2 203 ? 20.711  -54.079  -44.616 1.00 25.96  ? 203 CYS H SG  1 
ATOM   4387  N  N   . ASN C 2 204 ? 22.649  -57.336  -42.620 1.00 17.34  ? 204 ASN H N   1 
ATOM   4388  C  CA  . ASN C 2 204 ? 22.076  -58.130  -41.551 1.00 16.61  ? 204 ASN H CA  1 
ATOM   4389  C  C   . ASN C 2 204 ? 21.917  -57.182  -40.364 1.00 17.23  ? 204 ASN H C   1 
ATOM   4390  O  O   . ASN C 2 204 ? 22.899  -56.798  -39.736 1.00 17.35  ? 204 ASN H O   1 
ATOM   4391  C  CB  . ASN C 2 204 ? 23.000  -59.307  -41.209 1.00 14.94  ? 204 ASN H CB  1 
ATOM   4392  C  CG  . ASN C 2 204 ? 23.622  -59.953  -42.451 1.00 15.11  ? 204 ASN H CG  1 
ATOM   4393  O  OD1 . ASN C 2 204 ? 24.834  -59.838  -42.690 1.00 13.82  ? 204 ASN H OD1 1 
ATOM   4394  N  ND2 . ASN C 2 204 ? 22.790  -60.622  -43.256 1.00 13.64  ? 204 ASN H ND2 1 
ATOM   4395  N  N   . VAL C 2 205 ? 20.684  -56.784  -40.089 1.00 18.02  ? 205 VAL H N   1 
ATOM   4396  C  CA  . VAL C 2 205 ? 20.375  -55.866  -38.997 1.00 18.96  ? 205 VAL H CA  1 
ATOM   4397  C  C   . VAL C 2 205 ? 19.804  -56.621  -37.800 1.00 19.27  ? 205 VAL H C   1 
ATOM   4398  O  O   . VAL C 2 205 ? 18.804  -57.332  -37.928 1.00 20.29  ? 205 VAL H O   1 
ATOM   4399  C  CB  . VAL C 2 205 ? 19.348  -54.807  -39.446 1.00 18.96  ? 205 VAL H CB  1 
ATOM   4400  C  CG1 . VAL C 2 205 ? 18.958  -53.885  -38.268 1.00 16.95  ? 205 VAL H CG1 1 
ATOM   4401  C  CG2 . VAL C 2 205 ? 19.913  -54.012  -40.630 1.00 19.25  ? 205 VAL H CG2 1 
ATOM   4402  N  N   . ASP C 2 206 ? 20.428  -56.430  -36.642 1.00 19.74  ? 206 ASP H N   1 
ATOM   4403  C  CA  . ASP C 2 206 ? 20.017  -57.076  -35.393 1.00 21.50  ? 206 ASP H CA  1 
ATOM   4404  C  C   . ASP C 2 206 ? 19.546  -56.017  -34.394 1.00 19.92  ? 206 ASP H C   1 
ATOM   4405  O  O   . ASP C 2 206 ? 20.250  -55.032  -34.149 1.00 19.89  ? 206 ASP H O   1 
ATOM   4406  C  CB  . ASP C 2 206 ? 21.201  -57.848  -34.804 1.00 23.37  ? 206 ASP H CB  1 
ATOM   4407  C  CG  . ASP C 2 206 ? 20.811  -59.207  -34.276 1.00 26.46  ? 206 ASP H CG  1 
ATOM   4408  O  OD1 . ASP C 2 206 ? 20.168  -59.281  -33.199 1.00 28.34  ? 206 ASP H OD1 1 
ATOM   4409  O  OD2 . ASP C 2 206 ? 21.166  -60.207  -34.941 1.00 28.64  ? 206 ASP H OD2 1 
ATOM   4410  N  N   . HIS C 2 207 ? 18.362  -56.224  -33.827 1.00 18.53  ? 207 HIS H N   1 
ATOM   4411  C  CA  . HIS C 2 207 ? 17.845  -55.380  -32.746 1.00 17.70  ? 207 HIS H CA  1 
ATOM   4412  C  C   . HIS C 2 207 ? 17.377  -56.279  -31.599 1.00 17.77  ? 207 HIS H C   1 
ATOM   4413  O  O   . HIS C 2 207 ? 16.228  -56.740  -31.572 1.00 17.80  ? 207 HIS H O   1 
ATOM   4414  C  CB  . HIS C 2 207 ? 16.710  -54.488  -33.257 1.00 17.16  ? 207 HIS H CB  1 
ATOM   4415  C  CG  . HIS C 2 207 ? 16.204  -53.503  -32.250 1.00 16.56  ? 207 HIS H CG  1 
ATOM   4416  N  ND1 . HIS C 2 207 ? 14.924  -53.555  -31.740 1.00 16.60  ? 207 HIS H ND1 1 
ATOM   4417  C  CD2 . HIS C 2 207 ? 16.801  -52.437  -31.665 1.00 16.73  ? 207 HIS H CD2 1 
ATOM   4418  C  CE1 . HIS C 2 207 ? 14.760  -52.564  -30.878 1.00 17.55  ? 207 HIS H CE1 1 
ATOM   4419  N  NE2 . HIS C 2 207 ? 15.883  -51.870  -30.814 1.00 16.12  ? 207 HIS H NE2 1 
ATOM   4420  N  N   . LYS C 2 208 ? 18.276  -56.518  -30.650 1.00 17.55  ? 208 LYS H N   1 
ATOM   4421  C  CA  . LYS C 2 208 ? 18.018  -57.467  -29.567 1.00 18.33  ? 208 LYS H CA  1 
ATOM   4422  C  C   . LYS C 2 208 ? 16.871  -57.088  -28.615 1.00 17.07  ? 208 LYS H C   1 
ATOM   4423  O  O   . LYS C 2 208 ? 16.156  -57.981  -28.144 1.00 17.67  ? 208 LYS H O   1 
ATOM   4424  C  CB  . LYS C 2 208 ? 19.304  -57.751  -28.778 1.00 20.52  ? 208 LYS H CB  1 
ATOM   4425  C  CG  . LYS C 2 208 ? 19.196  -58.930  -27.794 1.00 23.32  ? 208 LYS H CG  1 
ATOM   4426  C  CD  . LYS C 2 208 ? 18.898  -60.264  -28.509 1.00 25.41  ? 208 LYS H CD  1 
ATOM   4427  C  CE  . LYS C 2 208 ? 18.774  -61.426  -27.535 1.00 26.24  ? 208 LYS H CE  1 
ATOM   4428  N  NZ  . LYS C 2 208 ? 17.605  -61.240  -26.626 1.00 27.78  ? 208 LYS H NZ  1 
ATOM   4429  N  N   . PRO C 2 209 ? 16.677  -55.780  -28.329 1.00 15.14  ? 209 PRO H N   1 
ATOM   4430  C  CA  . PRO C 2 209 ? 15.554  -55.388  -27.457 1.00 13.74  ? 209 PRO H CA  1 
ATOM   4431  C  C   . PRO C 2 209 ? 14.157  -55.802  -27.944 1.00 13.39  ? 209 PRO H C   1 
ATOM   4432  O  O   . PRO C 2 209 ? 13.264  -56.004  -27.122 1.00 14.26  ? 209 PRO H O   1 
ATOM   4433  C  CB  . PRO C 2 209 ? 15.668  -53.865  -27.413 1.00 13.61  ? 209 PRO H CB  1 
ATOM   4434  C  CG  . PRO C 2 209 ? 17.125  -53.602  -27.599 1.00 14.01  ? 209 PRO H CG  1 
ATOM   4435  C  CD  . PRO C 2 209 ? 17.567  -54.634  -28.603 1.00 14.45  ? 209 PRO H CD  1 
ATOM   4436  N  N   . SER C 2 210 ? 13.963  -55.921  -29.255 1.00 11.67  ? 210 SER H N   1 
ATOM   4437  C  CA  . SER C 2 210 ? 12.681  -56.395  -29.804 1.00 10.23  ? 210 SER H CA  1 
ATOM   4438  C  C   . SER C 2 210 ? 12.774  -57.823  -30.336 1.00 8.84   ? 210 SER H C   1 
ATOM   4439  O  O   . SER C 2 210 ? 11.815  -58.326  -30.895 1.00 7.03   ? 210 SER H O   1 
ATOM   4440  C  CB  . SER C 2 210 ? 12.192  -55.469  -30.923 1.00 9.64   ? 210 SER H CB  1 
ATOM   4441  O  OG  . SER C 2 210 ? 13.053  -55.553  -32.042 1.00 9.59   ? 210 SER H OG  1 
ATOM   4442  N  N   . ASN C 2 211 ? 13.924  -58.471  -30.154 1.00 9.95   ? 211 ASN H N   1 
ATOM   4443  C  CA  . ASN C 2 211 ? 14.157  -59.824  -30.683 1.00 9.94   ? 211 ASN H CA  1 
ATOM   4444  C  C   . ASN C 2 211 ? 13.954  -59.883  -32.200 1.00 8.18   ? 211 ASN H C   1 
ATOM   4445  O  O   . ASN C 2 211 ? 13.362  -60.818  -32.736 1.00 7.20   ? 211 ASN H O   1 
ATOM   4446  C  CB  . ASN C 2 211 ? 13.280  -60.857  -29.956 1.00 10.13  ? 211 ASN H CB  1 
ATOM   4447  C  CG  . ASN C 2 211 ? 13.726  -61.090  -28.533 1.00 11.61  ? 211 ASN H CG  1 
ATOM   4448  O  OD1 . ASN C 2 211 ? 14.888  -61.407  -28.285 1.00 13.25  ? 211 ASN H OD1 1 
ATOM   4449  N  ND2 . ASN C 2 211 ? 12.810  -60.944  -27.591 1.00 11.49  ? 211 ASN H ND2 1 
ATOM   4450  N  N   . THR C 2 212 ? 14.467  -58.861  -32.871 1.00 7.70   ? 212 THR H N   1 
ATOM   4451  C  CA  . THR C 2 212 ? 14.316  -58.695  -34.297 1.00 9.82   ? 212 THR H CA  1 
ATOM   4452  C  C   . THR C 2 212 ? 15.657  -58.936  -35.003 1.00 13.51  ? 212 THR H C   1 
ATOM   4453  O  O   . THR C 2 212 ? 16.698  -58.417  -34.585 1.00 13.94  ? 212 THR H O   1 
ATOM   4454  C  CB  . THR C 2 212 ? 13.780  -57.271  -34.610 1.00 10.03  ? 212 THR H CB  1 
ATOM   4455  O  OG1 . THR C 2 212 ? 12.486  -57.114  -34.008 1.00 10.13  ? 212 THR H OG1 1 
ATOM   4456  C  CG2 . THR C 2 212 ? 13.668  -57.023  -36.131 1.00 9.21   ? 212 THR H CG2 1 
ATOM   4457  N  N   . LYS C 2 213 ? 15.612  -59.754  -36.053 1.00 16.29  ? 213 LYS H N   1 
ATOM   4458  C  CA  . LYS C 2 213 ? 16.753  -60.018  -36.931 1.00 18.73  ? 213 LYS H CA  1 
ATOM   4459  C  C   . LYS C 2 213 ? 16.254  -59.935  -38.366 1.00 19.18  ? 213 LYS H C   1 
ATOM   4460  O  O   . LYS C 2 213 ? 15.401  -60.726  -38.790 1.00 18.36  ? 213 LYS H O   1 
ATOM   4461  C  CB  . LYS C 2 213 ? 17.350  -61.407  -36.684 1.00 19.96  ? 213 LYS H CB  1 
ATOM   4462  C  CG  . LYS C 2 213 ? 18.048  -61.571  -35.352 1.00 21.44  ? 213 LYS H CG  1 
ATOM   4463  C  CD  . LYS C 2 213 ? 18.612  -62.989  -35.178 1.00 22.93  ? 213 LYS H CD  1 
ATOM   4464  C  CE  . LYS C 2 213 ? 17.530  -63.981  -34.747 1.00 23.05  ? 213 LYS H CE  1 
ATOM   4465  N  NZ  . LYS C 2 213 ? 17.992  -65.403  -34.782 1.00 23.08  ? 213 LYS H NZ  1 
ATOM   4466  N  N   . VAL C 2 214 ? 16.799  -58.972  -39.099 1.00 20.07  ? 214 VAL H N   1 
ATOM   4467  C  CA  . VAL C 2 214 ? 16.347  -58.651  -40.444 1.00 20.89  ? 214 VAL H CA  1 
ATOM   4468  C  C   . VAL C 2 214 ? 17.530  -58.663  -41.411 1.00 20.94  ? 214 VAL H C   1 
ATOM   4469  O  O   . VAL C 2 214 ? 18.588  -58.099  -41.128 1.00 19.06  ? 214 VAL H O   1 
ATOM   4470  C  CB  . VAL C 2 214 ? 15.676  -57.252  -40.455 1.00 21.77  ? 214 VAL H CB  1 
ATOM   4471  C  CG1 . VAL C 2 214 ? 15.654  -56.663  -41.859 1.00 21.88  ? 214 VAL H CG1 1 
ATOM   4472  C  CG2 . VAL C 2 214 ? 14.267  -57.342  -39.848 1.00 21.66  ? 214 VAL H CG2 1 
ATOM   4473  N  N   . ASP C 2 215 ? 17.335  -59.328  -42.543 1.00 20.53  ? 215 ASP H N   1 
ATOM   4474  C  CA  . ASP C 2 215 ? 18.273  -59.295  -43.644 1.00 20.67  ? 215 ASP H CA  1 
ATOM   4475  C  C   . ASP C 2 215 ? 17.599  -58.580  -44.796 1.00 20.49  ? 215 ASP H C   1 
ATOM   4476  O  O   . ASP C 2 215 ? 16.466  -58.891  -45.146 1.00 22.42  ? 215 ASP H O   1 
ATOM   4477  C  CB  . ASP C 2 215 ? 18.653  -60.710  -44.067 1.00 21.18  ? 215 ASP H CB  1 
ATOM   4478  C  CG  . ASP C 2 215 ? 19.322  -61.485  -42.963 1.00 22.88  ? 215 ASP H CG  1 
ATOM   4479  O  OD1 . ASP C 2 215 ? 20.163  -60.909  -42.231 1.00 23.64  ? 215 ASP H OD1 1 
ATOM   4480  O  OD2 . ASP C 2 215 ? 19.003  -62.683  -42.827 1.00 25.52  ? 215 ASP H OD2 1 
ATOM   4481  N  N   . LYS C 2 216 ? 18.290  -57.616  -45.389 1.00 19.15  ? 216 LYS H N   1 
ATOM   4482  C  CA  . LYS C 2 216 ? 17.703  -56.844  -46.460 1.00 17.19  ? 216 LYS H CA  1 
ATOM   4483  C  C   . LYS C 2 216 ? 18.647  -56.848  -47.635 1.00 15.83  ? 216 LYS H C   1 
ATOM   4484  O  O   . LYS C 2 216 ? 19.787  -56.377  -47.544 1.00 14.33  ? 216 LYS H O   1 
ATOM   4485  C  CB  . LYS C 2 216 ? 17.403  -55.418  -46.005 1.00 17.77  ? 216 LYS H CB  1 
ATOM   4486  C  CG  . LYS C 2 216 ? 16.674  -54.571  -47.049 1.00 19.36  ? 216 LYS H CG  1 
ATOM   4487  C  CD  . LYS C 2 216 ? 15.232  -55.008  -47.246 1.00 20.73  ? 216 LYS H CD  1 
ATOM   4488  C  CE  . LYS C 2 216 ? 14.650  -54.450  -48.532 1.00 22.44  ? 216 LYS H CE  1 
ATOM   4489  N  NZ  . LYS C 2 216 ? 13.160  -54.617  -48.609 1.00 23.55  ? 216 LYS H NZ  1 
ATOM   4490  N  N   . ARG C 2 217 ? 18.161  -57.414  -48.731 1.00 14.09  ? 217 ARG H N   1 
ATOM   4491  C  CA  . ARG C 2 217 ? 18.858  -57.392  -49.997 1.00 14.10  ? 217 ARG H CA  1 
ATOM   4492  C  C   . ARG C 2 217 ? 18.811  -55.967  -50.555 1.00 13.83  ? 217 ARG H C   1 
ATOM   4493  O  O   . ARG C 2 217 ? 17.742  -55.358  -50.666 1.00 14.39  ? 217 ARG H O   1 
ATOM   4494  C  CB  . ARG C 2 217 ? 18.194  -58.382  -50.958 1.00 14.89  ? 217 ARG H CB  1 
ATOM   4495  C  CG  . ARG C 2 217 ? 18.943  -58.626  -52.237 1.00 16.87  ? 217 ARG H CG  1 
ATOM   4496  C  CD  . ARG C 2 217 ? 18.264  -59.688  -53.061 1.00 19.20  ? 217 ARG H CD  1 
ATOM   4497  N  NE  . ARG C 2 217 ? 17.008  -59.225  -53.648 1.00 22.03  ? 217 ARG H NE  1 
ATOM   4498  C  CZ  . ARG C 2 217 ? 16.146  -60.012  -54.295 1.00 26.14  ? 217 ARG H CZ  1 
ATOM   4499  N  NH1 . ARG C 2 217 ? 16.392  -61.310  -54.437 1.00 27.55  ? 217 ARG H NH1 1 
ATOM   4500  N  NH2 . ARG C 2 217 ? 15.022  -59.503  -54.809 1.00 27.51  ? 217 ARG H NH2 1 
ATOM   4501  N  N   . VAL C 2 218 ? 19.981  -55.428  -50.875 1.00 13.01  ? 218 VAL H N   1 
ATOM   4502  C  CA  . VAL C 2 218 ? 20.099  -54.122  -51.491 1.00 11.44  ? 218 VAL H CA  1 
ATOM   4503  C  C   . VAL C 2 218 ? 20.565  -54.371  -52.905 1.00 12.63  ? 218 VAL H C   1 
ATOM   4504  O  O   . VAL C 2 218 ? 21.691  -54.816  -53.130 1.00 13.27  ? 218 VAL H O   1 
ATOM   4505  C  CB  . VAL C 2 218 ? 21.125  -53.226  -50.738 1.00 11.68  ? 218 VAL H CB  1 
ATOM   4506  C  CG1 . VAL C 2 218 ? 21.255  -51.868  -51.407 1.00 8.44   ? 218 VAL H CG1 1 
ATOM   4507  C  CG2 . VAL C 2 218 ? 20.739  -53.087  -49.235 1.00 8.91   ? 218 VAL H CG2 1 
ATOM   4508  N  N   . GLU C 2 219 ? 19.698  -54.109  -53.869 1.00 15.39  ? 219 GLU H N   1 
ATOM   4509  C  CA  . GLU C 2 219 ? 20.054  -54.336  -55.263 1.00 16.67  ? 219 GLU H CA  1 
ATOM   4510  C  C   . GLU C 2 219 ? 20.060  -53.064  -56.085 1.00 16.21  ? 219 GLU H C   1 
ATOM   4511  O  O   . GLU C 2 219 ? 19.542  -52.029  -55.687 1.00 15.80  ? 219 GLU H O   1 
ATOM   4512  C  CB  . GLU C 2 219 ? 19.164  -55.404  -55.902 1.00 18.51  ? 219 GLU H CB  1 
ATOM   4513  C  CG  . GLU C 2 219 ? 17.673  -55.114  -55.943 1.00 20.23  ? 219 GLU H CG  1 
ATOM   4514  C  CD  . GLU C 2 219 ? 16.875  -56.365  -56.303 1.00 22.40  ? 219 GLU H CD  1 
ATOM   4515  O  OE1 . GLU C 2 219 ? 17.083  -57.391  -55.617 1.00 24.55  ? 219 GLU H OE1 1 
ATOM   4516  O  OE2 . GLU C 2 219 ? 16.062  -56.335  -57.259 1.00 21.45  ? 219 GLU H OE2 1 
ATOM   4517  N  N   . SER C 2 220 ? 20.692  -53.167  -57.239 1.00 17.67  ? 220 SER H N   1 
ATOM   4518  C  CA  . SER C 2 220 ? 20.811  -52.062  -58.163 1.00 18.73  ? 220 SER H CA  1 
ATOM   4519  C  C   . SER C 2 220 ? 19.443  -51.710  -58.731 1.00 18.12  ? 220 SER H C   1 
ATOM   4520  O  O   . SER C 2 220 ? 18.694  -52.594  -59.148 1.00 18.17  ? 220 SER H O   1 
ATOM   4521  C  CB  . SER C 2 220 ? 21.770  -52.490  -59.262 1.00 19.48  ? 220 SER H CB  1 
ATOM   4522  O  OG  . SER C 2 220 ? 22.661  -53.461  -58.718 1.00 20.19  ? 220 SER H OG  1 
ATOM   4523  O  OXT . SER C 2 220 ? 19.048  -50.545  -58.761 1.00 17.59  ? 220 SER H OXT 1 
ATOM   4524  N  N   . ILE D 3 3   ? 32.801  -25.915  -6.348  1.00 20.76  ? 2   ILE L N   1 
ATOM   4525  C  CA  . ILE D 3 3   ? 34.062  -25.574  -7.084  1.00 20.48  ? 2   ILE L CA  1 
ATOM   4526  C  C   . ILE D 3 3   ? 33.918  -25.991  -8.540  1.00 21.86  ? 2   ILE L C   1 
ATOM   4527  O  O   . ILE D 3 3   ? 33.581  -27.135  -8.817  1.00 23.10  ? 2   ILE L O   1 
ATOM   4528  C  CB  . ILE D 3 3   ? 35.322  -26.258  -6.467  1.00 18.85  ? 2   ILE L CB  1 
ATOM   4529  C  CG1 . ILE D 3 3   ? 35.507  -25.837  -5.000  1.00 18.47  ? 2   ILE L CG1 1 
ATOM   4530  C  CG2 . ILE D 3 3   ? 36.576  -25.926  -7.287  1.00 18.05  ? 2   ILE L CG2 1 
ATOM   4531  C  CD1 . ILE D 3 3   ? 36.437  -26.732  -4.184  1.00 17.02  ? 2   ILE L CD1 1 
ATOM   4532  N  N   . GLN D 3 4   ? 34.165  -25.059  -9.460  1.00 22.79  ? 3   GLN L N   1 
ATOM   4533  C  CA  . GLN D 3 4   ? 34.068  -25.336  -10.895 1.00 24.47  ? 3   GLN L CA  1 
ATOM   4534  C  C   . GLN D 3 4   ? 35.452  -25.583  -11.476 1.00 22.81  ? 3   GLN L C   1 
ATOM   4535  O  O   . GLN D 3 4   ? 36.402  -24.869  -11.164 1.00 21.18  ? 3   GLN L O   1 
ATOM   4536  C  CB  . GLN D 3 4   ? 33.407  -24.172  -11.646 1.00 27.15  ? 3   GLN L CB  1 
ATOM   4537  C  CG  . GLN D 3 4   ? 31.890  -24.110  -11.526 1.00 29.35  ? 3   GLN L CG  1 
ATOM   4538  C  CD  . GLN D 3 4   ? 31.411  -23.650  -10.160 1.00 31.54  ? 3   GLN L CD  1 
ATOM   4539  O  OE1 . GLN D 3 4   ? 31.876  -22.635  -9.624  1.00 33.11  ? 3   GLN L OE1 1 
ATOM   4540  N  NE2 . GLN D 3 4   ? 30.459  -24.387  -9.593  1.00 32.88  ? 3   GLN L NE2 1 
ATOM   4541  N  N   . MET D 3 5   ? 35.550  -26.602  -12.324 1.00 22.12  ? 4   MET L N   1 
ATOM   4542  C  CA  . MET D 3 5   ? 36.795  -26.948  -13.003 1.00 21.70  ? 4   MET L CA  1 
ATOM   4543  C  C   . MET D 3 5   ? 36.662  -26.643  -14.484 1.00 21.01  ? 4   MET L C   1 
ATOM   4544  O  O   . MET D 3 5   ? 35.733  -27.102  -15.130 1.00 20.37  ? 4   MET L O   1 
ATOM   4545  C  CB  . MET D 3 5   ? 37.106  -28.433  -12.815 1.00 20.22  ? 4   MET L CB  1 
ATOM   4546  C  CG  . MET D 3 5   ? 37.139  -28.874  -11.351 1.00 20.06  ? 4   MET L CG  1 
ATOM   4547  S  SD  . MET D 3 5   ? 38.327  -27.968  -10.340 1.00 18.05  ? 4   MET L SD  1 
ATOM   4548  C  CE  . MET D 3 5   ? 39.862  -28.233  -11.194 1.00 18.16  ? 4   MET L CE  1 
ATOM   4549  N  N   . THR D 3 6   ? 37.594  -25.859  -15.010 1.00 22.15  ? 5   THR L N   1 
ATOM   4550  C  CA  . THR D 3 6   ? 37.590  -25.489  -16.420 1.00 22.78  ? 5   THR L CA  1 
ATOM   4551  C  C   . THR D 3 6   ? 38.814  -26.086  -17.107 1.00 23.28  ? 5   THR L C   1 
ATOM   4552  O  O   . THR D 3 6   ? 39.940  -25.693  -16.812 1.00 24.81  ? 5   THR L O   1 
ATOM   4553  C  CB  . THR D 3 6   ? 37.605  -23.955  -16.593 1.00 22.29  ? 5   THR L CB  1 
ATOM   4554  O  OG1 . THR D 3 6   ? 36.580  -23.371  -15.783 1.00 22.06  ? 5   THR L OG1 1 
ATOM   4555  C  CG2 . THR D 3 6   ? 37.372  -23.565  -18.057 1.00 21.60  ? 5   THR L CG2 1 
ATOM   4556  N  N   . GLN D 3 7   ? 38.587  -27.033  -18.016 1.00 22.70  ? 6   GLN L N   1 
ATOM   4557  C  CA  . GLN D 3 7   ? 39.666  -27.629  -18.808 1.00 21.92  ? 6   GLN L CA  1 
ATOM   4558  C  C   . GLN D 3 7   ? 39.772  -26.968  -20.150 1.00 21.28  ? 6   GLN L C   1 
ATOM   4559  O  O   . GLN D 3 7   ? 38.766  -26.602  -20.742 1.00 22.97  ? 6   GLN L O   1 
ATOM   4560  C  CB  . GLN D 3 7   ? 39.416  -29.111  -19.067 1.00 20.50  ? 6   GLN L CB  1 
ATOM   4561  C  CG  . GLN D 3 7   ? 39.752  -29.993  -17.939 1.00 20.23  ? 6   GLN L CG  1 
ATOM   4562  C  CD  . GLN D 3 7   ? 39.519  -31.445  -18.272 1.00 18.70  ? 6   GLN L CD  1 
ATOM   4563  O  OE1 . GLN D 3 7   ? 38.653  -32.083  -17.681 1.00 16.97  ? 6   GLN L OE1 1 
ATOM   4564  N  NE2 . GLN D 3 7   ? 40.281  -31.974  -19.229 1.00 16.22  ? 6   GLN L NE2 1 
ATOM   4565  N  N   . SER D 3 8   ? 40.990  -26.839  -20.649 1.00 22.11  ? 7   SER L N   1 
ATOM   4566  C  CA  . SER D 3 8   ? 41.184  -26.425  -22.031 1.00 23.12  ? 7   SER L CA  1 
ATOM   4567  C  C   . SER D 3 8   ? 42.408  -27.125  -22.623 1.00 23.13  ? 7   SER L C   1 
ATOM   4568  O  O   . SER D 3 8   ? 43.337  -27.474  -21.889 1.00 23.80  ? 7   SER L O   1 
ATOM   4569  C  CB  . SER D 3 8   ? 41.304  -24.905  -22.140 1.00 23.64  ? 7   SER L CB  1 
ATOM   4570  O  OG  . SER D 3 8   ? 42.409  -24.426  -21.410 1.00 25.05  ? 7   SER L OG  1 
ATOM   4571  N  N   . PRO D 3 9   ? 42.378  -27.412  -23.938 1.00 22.99  ? 8   PRO L N   1 
ATOM   4572  C  CA  . PRO D 3 9   ? 41.233  -27.236  -24.821 1.00 21.63  ? 8   PRO L CA  1 
ATOM   4573  C  C   . PRO D 3 9   ? 40.252  -28.384  -24.625 1.00 21.69  ? 8   PRO L C   1 
ATOM   4574  O  O   . PRO D 3 9   ? 40.584  -29.374  -23.975 1.00 22.61  ? 8   PRO L O   1 
ATOM   4575  C  CB  . PRO D 3 9   ? 41.861  -27.312  -26.207 1.00 22.37  ? 8   PRO L CB  1 
ATOM   4576  C  CG  . PRO D 3 9   ? 42.991  -28.311  -26.033 1.00 23.14  ? 8   PRO L CG  1 
ATOM   4577  C  CD  . PRO D 3 9   ? 43.471  -28.152  -24.605 1.00 22.68  ? 8   PRO L CD  1 
ATOM   4578  N  N   . SER D 3 10  ? 39.055  -28.239  -25.180 1.00 22.09  ? 9   SER L N   1 
ATOM   4579  C  CA  . SER D 3 10  ? 38.052  -29.307  -25.203 1.00 22.67  ? 9   SER L CA  1 
ATOM   4580  C  C   . SER D 3 10  ? 38.429  -30.399  -26.193 1.00 22.19  ? 9   SER L C   1 
ATOM   4581  O  O   . SER D 3 10  ? 37.979  -31.533  -26.068 1.00 21.96  ? 9   SER L O   1 
ATOM   4582  C  CB  . SER D 3 10  ? 36.678  -28.739  -25.593 1.00 23.20  ? 9   SER L CB  1 
ATOM   4583  O  OG  . SER D 3 10  ? 36.276  -27.727  -24.683 1.00 24.09  ? 9   SER L OG  1 
ATOM   4584  N  N   . SER D 3 11  ? 39.223  -30.051  -27.201 1.00 22.31  ? 10  SER L N   1 
ATOM   4585  C  CA  . SER D 3 11  ? 39.733  -31.054  -28.133 1.00 23.88  ? 10  SER L CA  1 
ATOM   4586  C  C   . SER D 3 11  ? 41.046  -30.632  -28.785 1.00 23.06  ? 10  SER L C   1 
ATOM   4587  O  O   . SER D 3 11  ? 41.283  -29.454  -29.030 1.00 21.22  ? 10  SER L O   1 
ATOM   4588  C  CB  . SER D 3 11  ? 38.688  -31.391  -29.205 1.00 23.34  ? 10  SER L CB  1 
ATOM   4589  O  OG  . SER D 3 11  ? 38.519  -30.318  -30.101 1.00 24.60  ? 10  SER L OG  1 
ATOM   4590  N  N   . LEU D 3 12  ? 41.906  -31.610  -29.039 1.00 24.75  ? 11  LEU L N   1 
ATOM   4591  C  CA  . LEU D 3 12  ? 43.144  -31.358  -29.760 1.00 26.63  ? 11  LEU L CA  1 
ATOM   4592  C  C   . LEU D 3 12  ? 43.461  -32.515  -30.687 1.00 24.97  ? 11  LEU L C   1 
ATOM   4593  O  O   . LEU D 3 12  ? 43.149  -33.666  -30.377 1.00 24.34  ? 11  LEU L O   1 
ATOM   4594  C  CB  . LEU D 3 12  ? 44.301  -31.086  -28.781 1.00 28.46  ? 11  LEU L CB  1 
ATOM   4595  C  CG  . LEU D 3 12  ? 45.084  -32.240  -28.155 1.00 30.44  ? 11  LEU L CG  1 
ATOM   4596  C  CD1 . LEU D 3 12  ? 46.224  -32.699  -29.060 1.00 31.27  ? 11  LEU L CD1 1 
ATOM   4597  C  CD2 . LEU D 3 12  ? 45.646  -31.808  -26.815 1.00 31.21  ? 11  LEU L CD2 1 
ATOM   4598  N  N   . SER D 3 13  ? 44.048  -32.180  -31.834 1.00 24.02  ? 12  SER L N   1 
ATOM   4599  C  CA  . SER D 3 13  ? 44.559  -33.153  -32.794 1.00 23.53  ? 12  SER L CA  1 
ATOM   4600  C  C   . SER D 3 13  ? 46.073  -33.152  -32.698 1.00 22.63  ? 12  SER L C   1 
ATOM   4601  O  O   . SER D 3 13  ? 46.698  -32.096  -32.732 1.00 22.94  ? 12  SER L O   1 
ATOM   4602  C  CB  . SER D 3 13  ? 44.153  -32.789  -34.225 1.00 24.10  ? 12  SER L CB  1 
ATOM   4603  O  OG  . SER D 3 13  ? 42.853  -33.259  -34.540 1.00 25.45  ? 12  SER L OG  1 
ATOM   4604  N  N   . ALA D 3 14  ? 46.668  -34.330  -32.591 1.00 22.39  ? 13  ALA L N   1 
ATOM   4605  C  CA  . ALA D 3 14  ? 48.121  -34.432  -32.460 1.00 23.29  ? 13  ALA L CA  1 
ATOM   4606  C  C   . ALA D 3 14  ? 48.622  -35.688  -33.125 1.00 21.96  ? 13  ALA L C   1 
ATOM   4607  O  O   . ALA D 3 14  ? 47.859  -36.627  -33.361 1.00 20.86  ? 13  ALA L O   1 
ATOM   4608  C  CB  . ALA D 3 14  ? 48.545  -34.407  -30.979 1.00 22.36  ? 13  ALA L CB  1 
ATOM   4609  N  N   . SER D 3 15  ? 49.912  -35.693  -33.432 1.00 21.08  ? 14  SER L N   1 
ATOM   4610  C  CA  . SER D 3 15  ? 50.534  -36.849  -34.048 1.00 20.70  ? 14  SER L CA  1 
ATOM   4611  C  C   . SER D 3 15  ? 51.153  -37.750  -33.006 1.00 20.18  ? 14  SER L C   1 
ATOM   4612  O  O   . SER D 3 15  ? 51.564  -37.296  -31.931 1.00 19.47  ? 14  SER L O   1 
ATOM   4613  C  CB  . SER D 3 15  ? 51.612  -36.418  -35.026 1.00 19.63  ? 14  SER L CB  1 
ATOM   4614  O  OG  . SER D 3 15  ? 51.069  -35.534  -35.970 1.00 21.61  ? 14  SER L OG  1 
ATOM   4615  N  N   . VAL D 3 16  ? 51.215  -39.033  -33.346 1.00 18.91  ? 15  VAL L N   1 
ATOM   4616  C  CA  . VAL D 3 16  ? 51.990  -40.005  -32.594 1.00 18.60  ? 15  VAL L CA  1 
ATOM   4617  C  C   . VAL D 3 16  ? 53.414  -39.462  -32.370 1.00 18.98  ? 15  VAL L C   1 
ATOM   4618  O  O   . VAL D 3 16  ? 54.104  -39.062  -33.324 1.00 19.68  ? 15  VAL L O   1 
ATOM   4619  C  CB  . VAL D 3 16  ? 52.038  -41.358  -33.357 1.00 18.25  ? 15  VAL L CB  1 
ATOM   4620  C  CG1 . VAL D 3 16  ? 52.969  -42.350  -32.664 1.00 16.47  ? 15  VAL L CG1 1 
ATOM   4621  C  CG2 . VAL D 3 16  ? 50.621  -41.921  -33.508 1.00 16.19  ? 15  VAL L CG2 1 
ATOM   4622  N  N   . GLY D 3 17  ? 53.830  -39.411  -31.107 1.00 18.92  ? 16  GLY L N   1 
ATOM   4623  C  CA  . GLY D 3 17  ? 55.153  -38.899  -30.744 1.00 17.79  ? 16  GLY L CA  1 
ATOM   4624  C  C   . GLY D 3 17  ? 55.171  -37.447  -30.300 1.00 18.62  ? 16  GLY L C   1 
ATOM   4625  O  O   . GLY D 3 17  ? 56.174  -36.976  -29.755 1.00 17.96  ? 16  GLY L O   1 
ATOM   4626  N  N   . ASP D 3 18  ? 54.073  -36.730  -30.529 1.00 19.97  ? 17  ASP L N   1 
ATOM   4627  C  CA  . ASP D 3 18  ? 53.963  -35.337  -30.097 1.00 21.67  ? 17  ASP L CA  1 
ATOM   4628  C  C   . ASP D 3 18  ? 53.865  -35.212  -28.584 1.00 22.68  ? 17  ASP L C   1 
ATOM   4629  O  O   . ASP D 3 18  ? 53.400  -36.120  -27.896 1.00 20.48  ? 17  ASP L O   1 
ATOM   4630  C  CB  . ASP D 3 18  ? 52.725  -34.661  -30.710 1.00 22.65  ? 17  ASP L CB  1 
ATOM   4631  C  CG  . ASP D 3 18  ? 52.925  -34.251  -32.155 1.00 24.22  ? 17  ASP L CG  1 
ATOM   4632  O  OD1 . ASP D 3 18  ? 54.056  -34.357  -32.687 1.00 24.71  ? 17  ASP L OD1 1 
ATOM   4633  O  OD2 . ASP D 3 18  ? 51.933  -33.810  -32.766 1.00 27.74  ? 17  ASP L OD2 1 
ATOM   4634  N  N   . ARG D 3 19  ? 54.312  -34.064  -28.090 1.00 24.64  ? 18  ARG L N   1 
ATOM   4635  C  CA  . ARG D 3 19  ? 54.069  -33.651  -26.723 1.00 26.99  ? 18  ARG L CA  1 
ATOM   4636  C  C   . ARG D 3 19  ? 52.720  -32.934  -26.611 1.00 27.19  ? 18  ARG L C   1 
ATOM   4637  O  O   . ARG D 3 19  ? 52.496  -31.960  -27.311 1.00 28.12  ? 18  ARG L O   1 
ATOM   4638  C  CB  . ARG D 3 19  ? 55.168  -32.691  -26.296 1.00 28.36  ? 18  ARG L CB  1 
ATOM   4639  C  CG  . ARG D 3 19  ? 54.981  -32.147  -24.889 1.00 30.04  ? 18  ARG L CG  1 
ATOM   4640  C  CD  . ARG D 3 19  ? 56.012  -31.096  -24.554 1.00 30.87  ? 18  ARG L CD  1 
ATOM   4641  N  NE  . ARG D 3 19  ? 56.465  -31.288  -23.187 1.00 32.74  ? 18  ARG L NE  1 
ATOM   4642  C  CZ  . ARG D 3 19  ? 57.285  -32.263  -22.802 1.00 33.77  ? 18  ARG L CZ  1 
ATOM   4643  N  NH1 . ARG D 3 19  ? 57.763  -33.148  -23.685 1.00 33.99  ? 18  ARG L NH1 1 
ATOM   4644  N  NH2 . ARG D 3 19  ? 57.625  -32.355  -21.524 1.00 34.51  ? 18  ARG L NH2 1 
ATOM   4645  N  N   . VAL D 3 20  ? 51.825  -33.392  -25.738 1.00 28.22  ? 19  VAL L N   1 
ATOM   4646  C  CA  . VAL D 3 20  ? 50.557  -32.666  -25.512 1.00 28.31  ? 19  VAL L CA  1 
ATOM   4647  C  C   . VAL D 3 20  ? 50.438  -32.163  -24.070 1.00 26.74  ? 19  VAL L C   1 
ATOM   4648  O  O   . VAL D 3 20  ? 50.911  -32.804  -23.141 1.00 24.53  ? 19  VAL L O   1 
ATOM   4649  C  CB  . VAL D 3 20  ? 49.270  -33.489  -25.910 1.00 28.45  ? 19  VAL L CB  1 
ATOM   4650  C  CG1 . VAL D 3 20  ? 49.558  -34.417  -27.072 1.00 29.58  ? 19  VAL L CG1 1 
ATOM   4651  C  CG2 . VAL D 3 20  ? 48.699  -34.256  -24.738 1.00 29.30  ? 19  VAL L CG2 1 
ATOM   4652  N  N   . THR D 3 21  ? 49.793  -31.008  -23.920 1.00 26.32  ? 20  THR L N   1 
ATOM   4653  C  CA  . THR D 3 21  ? 49.546  -30.387  -22.626 1.00 26.46  ? 20  THR L CA  1 
ATOM   4654  C  C   . THR D 3 21  ? 48.072  -29.985  -22.493 1.00 25.89  ? 20  THR L C   1 
ATOM   4655  O  O   . THR D 3 21  ? 47.530  -29.263  -23.333 1.00 25.79  ? 20  THR L O   1 
ATOM   4656  C  CB  . THR D 3 21  ? 50.435  -29.161  -22.444 1.00 26.74  ? 20  THR L CB  1 
ATOM   4657  O  OG1 . THR D 3 21  ? 51.784  -29.596  -22.243 1.00 27.64  ? 20  THR L OG1 1 
ATOM   4658  C  CG2 . THR D 3 21  ? 49.999  -28.349  -21.242 1.00 27.77  ? 20  THR L CG2 1 
ATOM   4659  N  N   . ILE D 3 22  ? 47.434  -30.480  -21.441 1.00 24.66  ? 21  ILE L N   1 
ATOM   4660  C  CA  . ILE D 3 22  ? 46.061  -30.151  -21.130 1.00 24.97  ? 21  ILE L CA  1 
ATOM   4661  C  C   . ILE D 3 22  ? 46.078  -29.363  -19.829 1.00 24.51  ? 21  ILE L C   1 
ATOM   4662  O  O   . ILE D 3 22  ? 46.805  -29.709  -18.894 1.00 24.01  ? 21  ILE L O   1 
ATOM   4663  C  CB  . ILE D 3 22  ? 45.206  -31.419  -20.960 1.00 27.28  ? 21  ILE L CB  1 
ATOM   4664  C  CG1 . ILE D 3 22  ? 45.328  -32.314  -22.202 1.00 27.37  ? 21  ILE L CG1 1 
ATOM   4665  C  CG2 . ILE D 3 22  ? 43.721  -31.041  -20.686 1.00 27.79  ? 21  ILE L CG2 1 
ATOM   4666  C  CD1 . ILE D 3 22  ? 44.675  -33.667  -22.054 1.00 25.90  ? 21  ILE L CD1 1 
ATOM   4667  N  N   . THR D 3 23  ? 45.302  -28.286  -19.778 1.00 23.68  ? 22  THR L N   1 
ATOM   4668  C  CA  . THR D 3 23  ? 45.271  -27.440  -18.598 1.00 23.34  ? 22  THR L CA  1 
ATOM   4669  C  C   . THR D 3 23  ? 43.937  -27.524  -17.887 1.00 22.39  ? 22  THR L C   1 
ATOM   4670  O  O   . THR D 3 23  ? 42.908  -27.820  -18.483 1.00 21.68  ? 22  THR L O   1 
ATOM   4671  C  CB  . THR D 3 23  ? 45.581  -25.975  -18.936 1.00 24.16  ? 22  THR L CB  1 
ATOM   4672  O  OG1 . THR D 3 23  ? 44.564  -25.454  -19.796 1.00 26.02  ? 22  THR L OG1 1 
ATOM   4673  C  CG2 . THR D 3 23  ? 46.940  -25.862  -19.616 1.00 23.52  ? 22  THR L CG2 1 
ATOM   4674  N  N   . CYS D 3 24  ? 43.973  -27.265  -16.593 1.00 23.37  ? 23  CYS L N   1 
ATOM   4675  C  CA  . CYS D 3 24  ? 42.795  -27.352  -15.758 1.00 24.96  ? 23  CYS L CA  1 
ATOM   4676  C  C   . CYS D 3 24  ? 42.858  -26.199  -14.769 1.00 24.54  ? 23  CYS L C   1 
ATOM   4677  O  O   . CYS D 3 24  ? 43.864  -26.020  -14.092 1.00 25.81  ? 23  CYS L O   1 
ATOM   4678  C  CB  . CYS D 3 24  ? 42.760  -28.721  -15.061 1.00 25.98  ? 23  CYS L CB  1 
ATOM   4679  S  SG  . CYS D 3 24  ? 41.440  -28.929  -13.864 1.00 29.39  ? 23  CYS L SG  1 
ATOM   4680  N  N   . ARG D 3 25  ? 41.804  -25.393  -14.725 1.00 25.20  ? 24  ARG L N   1 
ATOM   4681  C  CA  . ARG D 3 25  ? 41.729  -24.257  -13.801 1.00 25.53  ? 24  ARG L CA  1 
ATOM   4682  C  C   . ARG D 3 25  ? 40.616  -24.450  -12.766 1.00 22.33  ? 24  ARG L C   1 
ATOM   4683  O  O   . ARG D 3 25  ? 39.481  -24.757  -13.130 1.00 19.39  ? 24  ARG L O   1 
ATOM   4684  C  CB  . ARG D 3 25  ? 41.466  -22.960  -14.568 1.00 27.68  ? 24  ARG L CB  1 
ATOM   4685  C  CG  . ARG D 3 25  ? 42.261  -21.771  -14.052 1.00 30.69  ? 24  ARG L CG  1 
ATOM   4686  C  CD  . ARG D 3 25  ? 41.465  -20.487  -13.955 1.00 33.44  ? 24  ARG L CD  1 
ATOM   4687  N  NE  . ARG D 3 25  ? 40.598  -20.233  -15.111 1.00 36.66  ? 24  ARG L NE  1 
ATOM   4688  C  CZ  . ARG D 3 25  ? 39.268  -20.392  -15.131 1.00 38.96  ? 24  ARG L CZ  1 
ATOM   4689  N  NH1 . ARG D 3 25  ? 38.588  -20.118  -16.247 1.00 39.30  ? 24  ARG L NH1 1 
ATOM   4690  N  NH2 . ARG D 3 25  ? 38.605  -20.828  -14.055 1.00 39.57  ? 24  ARG L NH2 1 
ATOM   4691  N  N   . ALA D 3 26  ? 40.943  -24.240  -11.492 1.00 21.22  ? 25  ALA L N   1 
ATOM   4692  C  CA  . ALA D 3 26  ? 39.956  -24.293  -10.396 1.00 21.84  ? 25  ALA L CA  1 
ATOM   4693  C  C   . ALA D 3 26  ? 39.383  -22.899  -10.081 1.00 21.30  ? 25  ALA L C   1 
ATOM   4694  O  O   . ALA D 3 26  ? 40.127  -21.918  -10.034 1.00 21.94  ? 25  ALA L O   1 
ATOM   4695  C  CB  . ALA D 3 26  ? 40.591  -24.904  -9.128  1.00 19.41  ? 25  ALA L CB  1 
ATOM   4696  N  N   . SER D 3 27  ? 38.071  -22.831  -9.836  1.00 20.60  ? 26  SER L N   1 
ATOM   4697  C  CA  . SER D 3 27  ? 37.394  -21.578  -9.483  1.00 20.39  ? 26  SER L CA  1 
ATOM   4698  C  C   . SER D 3 27  ? 37.893  -20.956  -8.175  1.00 20.77  ? 26  SER L C   1 
ATOM   4699  O  O   . SER D 3 27  ? 37.829  -19.744  -8.000  1.00 19.60  ? 26  SER L O   1 
ATOM   4700  C  CB  . SER D 3 27  ? 35.884  -21.798  -9.398  1.00 20.17  ? 26  SER L CB  1 
ATOM   4701  O  OG  . SER D 3 27  ? 35.582  -22.828  -8.485  1.00 20.05  ? 26  SER L OG  1 
ATOM   4702  N  N   . GLN D 3 28  ? 38.361  -21.796  -7.256  1.00 22.23  ? 27  GLN L N   1 
ATOM   4703  C  CA  . GLN D 3 28  ? 39.048  -21.345  -6.050  1.00 22.53  ? 27  GLN L CA  1 
ATOM   4704  C  C   . GLN D 3 28  ? 40.274  -22.232  -5.823  1.00 23.28  ? 27  GLN L C   1 
ATOM   4705  O  O   . GLN D 3 28  ? 40.448  -23.242  -6.510  1.00 23.96  ? 27  GLN L O   1 
ATOM   4706  C  CB  . GLN D 3 28  ? 38.109  -21.400  -4.850  1.00 23.51  ? 27  GLN L CB  1 
ATOM   4707  C  CG  . GLN D 3 28  ? 37.751  -22.804  -4.391  1.00 25.21  ? 27  GLN L CG  1 
ATOM   4708  C  CD  . GLN D 3 28  ? 36.689  -22.806  -3.300  1.00 27.09  ? 27  GLN L CD  1 
ATOM   4709  O  OE1 . GLN D 3 28  ? 35.569  -22.328  -3.503  1.00 29.52  ? 27  GLN L OE1 1 
ATOM   4710  N  NE2 . GLN D 3 28  ? 37.031  -23.356  -2.147  1.00 26.71  ? 27  GLN L NE2 1 
ATOM   4711  N  N   . SER D 3 29  ? 41.111  -21.857  -4.857  1.00 22.46  ? 28  SER L N   1 
ATOM   4712  C  CA  . SER D 3 29  ? 42.343  -22.591  -4.571  1.00 22.43  ? 28  SER L CA  1 
ATOM   4713  C  C   . SER D 3 29  ? 42.055  -23.958  -3.941  1.00 21.56  ? 28  SER L C   1 
ATOM   4714  O  O   . SER D 3 29  ? 41.308  -24.045  -2.981  1.00 23.22  ? 28  SER L O   1 
ATOM   4715  C  CB  . SER D 3 29  ? 43.239  -21.773  -3.646  1.00 23.70  ? 28  SER L CB  1 
ATOM   4716  O  OG  . SER D 3 29  ? 44.540  -22.326  -3.596  1.00 25.42  ? 28  SER L OG  1 
ATOM   4717  N  N   . ILE D 3 30  ? 42.648  -25.018  -4.494  1.00 20.02  ? 29  ILE L N   1 
ATOM   4718  C  CA  . ILE D 3 30  ? 42.414  -26.394  -4.026  1.00 17.76  ? 29  ILE L CA  1 
ATOM   4719  C  C   . ILE D 3 30  ? 43.719  -27.105  -3.628  1.00 15.84  ? 29  ILE L C   1 
ATOM   4720  O  O   . ILE D 3 30  ? 43.762  -28.321  -3.540  1.00 12.87  ? 29  ILE L O   1 
ATOM   4721  C  CB  . ILE D 3 30  ? 41.653  -27.234  -5.095  1.00 16.91  ? 29  ILE L CB  1 
ATOM   4722  C  CG1 . ILE D 3 30  ? 42.460  -27.307  -6.416  1.00 17.17  ? 29  ILE L CG1 1 
ATOM   4723  C  CG2 . ILE D 3 30  ? 40.256  -26.651  -5.316  1.00 15.98  ? 29  ILE L CG2 1 
ATOM   4724  C  CD1 . ILE D 3 30  ? 41.828  -28.151  -7.529  1.00 16.19  ? 29  ILE L CD1 1 
ATOM   4725  N  N   . GLY D 3 31  ? 44.778  -26.336  -3.387  1.00 17.63  ? 30  GLY L N   1 
ATOM   4726  C  CA  . GLY D 3 31  ? 46.089  -26.895  -3.043  1.00 17.61  ? 30  GLY L CA  1 
ATOM   4727  C  C   . GLY D 3 31  ? 46.532  -27.906  -4.085  1.00 18.98  ? 30  GLY L C   1 
ATOM   4728  O  O   . GLY D 3 31  ? 46.603  -27.582  -5.281  1.00 20.38  ? 30  GLY L O   1 
ATOM   4729  N  N   . SER D 3 32  ? 46.807  -29.135  -3.643  1.00 18.14  ? 31  SER L N   1 
ATOM   4730  C  CA  . SER D 3 32  ? 47.124  -30.227  -4.566  1.00 17.87  ? 31  SER L CA  1 
ATOM   4731  C  C   . SER D 3 32  ? 46.013  -31.280  -4.651  1.00 18.51  ? 31  SER L C   1 
ATOM   4732  O  O   . SER D 3 32  ? 46.266  -32.394  -5.114  1.00 20.24  ? 31  SER L O   1 
ATOM   4733  C  CB  . SER D 3 32  ? 48.439  -30.888  -4.171  1.00 16.80  ? 31  SER L CB  1 
ATOM   4734  O  OG  . SER D 3 32  ? 49.487  -29.936  -4.190  1.00 18.75  ? 31  SER L OG  1 
ATOM   4735  N  N   . TYR D 3 33  ? 44.788  -30.931  -4.238  1.00 17.81  ? 32  TYR L N   1 
ATOM   4736  C  CA  . TYR D 3 33  ? 43.664  -31.869  -4.302  1.00 18.09  ? 32  TYR L CA  1 
ATOM   4737  C  C   . TYR D 3 33  ? 43.084  -31.960  -5.729  1.00 18.75  ? 32  TYR L C   1 
ATOM   4738  O  O   . TYR D 3 33  ? 41.903  -31.686  -5.949  1.00 18.94  ? 32  TYR L O   1 
ATOM   4739  C  CB  . TYR D 3 33  ? 42.559  -31.464  -3.329  1.00 17.70  ? 32  TYR L CB  1 
ATOM   4740  C  CG  . TYR D 3 33  ? 42.846  -31.675  -1.861  1.00 17.63  ? 32  TYR L CG  1 
ATOM   4741  C  CD1 . TYR D 3 33  ? 42.303  -32.764  -1.179  1.00 17.76  ? 32  TYR L CD1 1 
ATOM   4742  C  CD2 . TYR D 3 33  ? 43.616  -30.761  -1.131  1.00 17.68  ? 32  TYR L CD2 1 
ATOM   4743  C  CE1 . TYR D 3 33  ? 42.538  -32.958  0.193   1.00 16.69  ? 32  TYR L CE1 1 
ATOM   4744  C  CE2 . TYR D 3 33  ? 43.858  -30.946  0.246   1.00 16.69  ? 32  TYR L CE2 1 
ATOM   4745  C  CZ  . TYR D 3 33  ? 43.316  -32.047  0.895   1.00 17.47  ? 32  TYR L CZ  1 
ATOM   4746  O  OH  . TYR D 3 33  ? 43.542  -32.246  2.248   1.00 17.24  ? 32  TYR L OH  1 
ATOM   4747  N  N   . LEU D 3 34  ? 43.909  -32.362  -6.692  1.00 18.63  ? 33  LEU L N   1 
ATOM   4748  C  CA  . LEU D 3 34  ? 43.501  -32.385  -8.099  1.00 18.15  ? 33  LEU L CA  1 
ATOM   4749  C  C   . LEU D 3 34  ? 43.967  -33.689  -8.716  1.00 17.73  ? 33  LEU L C   1 
ATOM   4750  O  O   . LEU D 3 34  ? 45.132  -34.057  -8.587  1.00 18.28  ? 33  LEU L O   1 
ATOM   4751  C  CB  . LEU D 3 34  ? 44.096  -31.184  -8.844  1.00 18.89  ? 33  LEU L CB  1 
ATOM   4752  C  CG  . LEU D 3 34  ? 43.598  -30.846  -10.266 1.00 18.54  ? 33  LEU L CG  1 
ATOM   4753  C  CD1 . LEU D 3 34  ? 44.300  -31.714  -11.341 1.00 17.17  ? 33  LEU L CD1 1 
ATOM   4754  C  CD2 . LEU D 3 34  ? 42.075  -30.953  -10.355 1.00 17.02  ? 33  LEU L CD2 1 
ATOM   4755  N  N   . ASN D 3 35  ? 43.053  -34.383  -9.385  1.00 17.03  ? 34  ASN L N   1 
ATOM   4756  C  CA  . ASN D 3 35  ? 43.311  -35.716  -9.901  1.00 16.67  ? 34  ASN L CA  1 
ATOM   4757  C  C   . ASN D 3 35  ? 42.962  -35.807  -11.385 1.00 18.16  ? 34  ASN L C   1 
ATOM   4758  O  O   . ASN D 3 35  ? 42.134  -35.040  -11.883 1.00 18.56  ? 34  ASN L O   1 
ATOM   4759  C  CB  . ASN D 3 35  ? 42.502  -36.718  -9.081  1.00 16.69  ? 34  ASN L CB  1 
ATOM   4760  C  CG  . ASN D 3 35  ? 42.550  -36.411  -7.575  1.00 17.95  ? 34  ASN L CG  1 
ATOM   4761  O  OD1 . ASN D 3 35  ? 43.566  -36.658  -6.917  1.00 18.68  ? 34  ASN L OD1 1 
ATOM   4762  N  ND2 . ASN D 3 35  ? 41.450  -35.868  -7.029  1.00 15.26  ? 34  ASN L ND2 1 
ATOM   4763  N  N   . TRP D 3 36  ? 43.586  -36.744  -12.094 1.00 18.94  ? 35  TRP L N   1 
ATOM   4764  C  CA  . TRP D 3 36  ? 43.361  -36.881  -13.541 1.00 19.35  ? 35  TRP L CA  1 
ATOM   4765  C  C   . TRP D 3 36  ? 42.942  -38.290  -13.882 1.00 19.09  ? 35  TRP L C   1 
ATOM   4766  O  O   . TRP D 3 36  ? 43.504  -39.234  -13.348 1.00 19.15  ? 35  TRP L O   1 
ATOM   4767  C  CB  . TRP D 3 36  ? 44.620  -36.540  -14.352 1.00 18.89  ? 35  TRP L CB  1 
ATOM   4768  C  CG  . TRP D 3 36  ? 45.020  -35.086  -14.357 1.00 17.72  ? 35  TRP L CG  1 
ATOM   4769  C  CD1 . TRP D 3 36  ? 45.900  -34.482  -13.514 1.00 18.59  ? 35  TRP L CD1 1 
ATOM   4770  C  CD2 . TRP D 3 36  ? 44.587  -34.068  -15.281 1.00 18.24  ? 35  TRP L CD2 1 
ATOM   4771  N  NE1 . TRP D 3 36  ? 46.044  -33.156  -13.849 1.00 17.61  ? 35  TRP L NE1 1 
ATOM   4772  C  CE2 . TRP D 3 36  ? 45.242  -32.877  -14.926 1.00 17.46  ? 35  TRP L CE2 1 
ATOM   4773  C  CE3 . TRP D 3 36  ? 43.701  -34.052  -16.376 1.00 19.27  ? 35  TRP L CE3 1 
ATOM   4774  C  CZ2 . TRP D 3 36  ? 45.040  -31.666  -15.622 1.00 18.91  ? 35  TRP L CZ2 1 
ATOM   4775  C  CZ3 . TRP D 3 36  ? 43.496  -32.850  -17.059 1.00 18.65  ? 35  TRP L CZ3 1 
ATOM   4776  C  CH2 . TRP D 3 36  ? 44.169  -31.674  -16.677 1.00 18.18  ? 35  TRP L CH2 1 
ATOM   4777  N  N   . TYR D 3 37  ? 41.956  -38.402  -14.780 1.00 19.30  ? 36  TYR L N   1 
ATOM   4778  C  CA  . TYR D 3 37  ? 41.395  -39.670  -15.229 1.00 18.83  ? 36  TYR L CA  1 
ATOM   4779  C  C   . TYR D 3 37  ? 41.400  -39.733  -16.752 1.00 19.44  ? 36  TYR L C   1 
ATOM   4780  O  O   . TYR D 3 37  ? 41.225  -38.711  -17.429 1.00 17.01  ? 36  TYR L O   1 
ATOM   4781  C  CB  . TYR D 3 37  ? 39.948  -39.832  -14.740 1.00 20.34  ? 36  TYR L CB  1 
ATOM   4782  C  CG  . TYR D 3 37  ? 39.814  -39.764  -13.240 1.00 19.92  ? 36  TYR L CG  1 
ATOM   4783  C  CD1 . TYR D 3 37  ? 39.910  -40.908  -12.459 1.00 21.51  ? 36  TYR L CD1 1 
ATOM   4784  C  CD2 . TYR D 3 37  ? 39.612  -38.561  -12.609 1.00 21.06  ? 36  TYR L CD2 1 
ATOM   4785  C  CE1 . TYR D 3 37  ? 39.800  -40.851  -11.068 1.00 21.97  ? 36  TYR L CE1 1 
ATOM   4786  C  CE2 . TYR D 3 37  ? 39.499  -38.487  -11.225 1.00 22.19  ? 36  TYR L CE2 1 
ATOM   4787  C  CZ  . TYR D 3 37  ? 39.596  -39.627  -10.464 1.00 20.88  ? 36  TYR L CZ  1 
ATOM   4788  O  OH  . TYR D 3 37  ? 39.491  -39.523  -9.111  1.00 21.36  ? 36  TYR L OH  1 
ATOM   4789  N  N   . GLN D 3 38  ? 41.617  -40.941  -17.270 1.00 18.96  ? 37  GLN L N   1 
ATOM   4790  C  CA  . GLN D 3 38  ? 41.543  -41.226  -18.694 1.00 19.61  ? 37  GLN L CA  1 
ATOM   4791  C  C   . GLN D 3 38  ? 40.309  -42.087  -18.929 1.00 19.77  ? 37  GLN L C   1 
ATOM   4792  O  O   . GLN D 3 38  ? 40.054  -43.042  -18.184 1.00 19.79  ? 37  GLN L O   1 
ATOM   4793  C  CB  . GLN D 3 38  ? 42.807  -41.963  -19.157 1.00 20.63  ? 37  GLN L CB  1 
ATOM   4794  C  CG  . GLN D 3 38  ? 42.794  -42.455  -20.612 1.00 21.08  ? 37  GLN L CG  1 
ATOM   4795  C  CD  . GLN D 3 38  ? 43.981  -43.358  -20.922 1.00 21.12  ? 37  GLN L CD  1 
ATOM   4796  O  OE1 . GLN D 3 38  ? 44.047  -44.491  -20.454 1.00 19.58  ? 37  GLN L OE1 1 
ATOM   4797  N  NE2 . GLN D 3 38  ? 44.933  -42.848  -21.703 1.00 20.79  ? 37  GLN L NE2 1 
ATOM   4798  N  N   . GLN D 3 39  ? 39.542  -41.737  -19.958 1.00 19.34  ? 38  GLN L N   1 
ATOM   4799  C  CA  . GLN D 3 39  ? 38.399  -42.529  -20.383 1.00 19.73  ? 38  GLN L CA  1 
ATOM   4800  C  C   . GLN D 3 39  ? 38.493  -42.803  -21.883 1.00 19.47  ? 38  GLN L C   1 
ATOM   4801  O  O   . GLN D 3 39  ? 38.330  -41.907  -22.702 1.00 18.78  ? 38  GLN L O   1 
ATOM   4802  C  CB  . GLN D 3 39  ? 37.077  -41.822  -20.059 1.00 20.32  ? 38  GLN L CB  1 
ATOM   4803  C  CG  . GLN D 3 39  ? 35.846  -42.694  -20.315 1.00 20.39  ? 38  GLN L CG  1 
ATOM   4804  C  CD  . GLN D 3 39  ? 34.537  -42.006  -19.960 1.00 21.08  ? 38  GLN L CD  1 
ATOM   4805  O  OE1 . GLN D 3 39  ? 34.395  -40.793  -20.137 1.00 22.61  ? 38  GLN L OE1 1 
ATOM   4806  N  NE2 . GLN D 3 39  ? 33.565  -42.781  -19.475 1.00 17.31  ? 38  GLN L NE2 1 
ATOM   4807  N  N   . LYS D 3 40  ? 38.760  -44.052  -22.226 1.00 19.82  ? 39  LYS L N   1 
ATOM   4808  C  CA  . LYS D 3 40  ? 38.725  -44.496  -23.607 1.00 21.85  ? 39  LYS L CA  1 
ATOM   4809  C  C   . LYS D 3 40  ? 37.270  -44.707  -24.008 1.00 23.13  ? 39  LYS L C   1 
ATOM   4810  O  O   . LYS D 3 40  ? 36.397  -44.898  -23.141 1.00 20.46  ? 39  LYS L O   1 
ATOM   4811  C  CB  . LYS D 3 40  ? 39.569  -45.763  -23.778 1.00 21.84  ? 39  LYS L CB  1 
ATOM   4812  C  CG  . LYS D 3 40  ? 41.028  -45.533  -23.342 1.00 21.98  ? 39  LYS L CG  1 
ATOM   4813  C  CD  . LYS D 3 40  ? 41.941  -46.692  -23.659 1.00 23.15  ? 39  LYS L CD  1 
ATOM   4814  C  CE  . LYS D 3 40  ? 43.339  -46.416  -23.141 1.00 23.76  ? 39  LYS L CE  1 
ATOM   4815  N  NZ  . LYS D 3 40  ? 44.292  -47.493  -23.475 1.00 24.14  ? 39  LYS L NZ  1 
ATOM   4816  N  N   . THR D 3 41  ? 36.998  -44.629  -25.310 1.00 24.41  ? 40  THR L N   1 
ATOM   4817  C  CA  . THR D 3 41  ? 35.616  -44.674  -25.784 1.00 27.01  ? 40  THR L CA  1 
ATOM   4818  C  C   . THR D 3 41  ? 34.957  -46.002  -25.405 1.00 26.00  ? 40  THR L C   1 
ATOM   4819  O  O   . THR D 3 41  ? 35.548  -47.068  -25.579 1.00 26.59  ? 40  THR L O   1 
ATOM   4820  C  CB  . THR D 3 41  ? 35.501  -44.423  -27.313 1.00 29.34  ? 40  THR L CB  1 
ATOM   4821  O  OG1 . THR D 3 41  ? 36.632  -44.991  -27.981 1.00 31.08  ? 40  THR L OG1 1 
ATOM   4822  C  CG2 . THR D 3 41  ? 35.442  -42.920  -27.614 1.00 30.37  ? 40  THR L CG2 1 
ATOM   4823  N  N   . GLY D 3 42  ? 33.747  -45.909  -24.855 1.00 24.47  ? 41  GLY L N   1 
ATOM   4824  C  CA  . GLY D 3 42  ? 32.976  -47.073  -24.412 1.00 22.99  ? 41  GLY L CA  1 
ATOM   4825  C  C   . GLY D 3 42  ? 33.337  -47.599  -23.032 1.00 22.37  ? 41  GLY L C   1 
ATOM   4826  O  O   . GLY D 3 42  ? 32.711  -48.532  -22.541 1.00 20.80  ? 41  GLY L O   1 
ATOM   4827  N  N   . LYS D 3 43  ? 34.332  -46.988  -22.392 1.00 22.72  ? 42  LYS L N   1 
ATOM   4828  C  CA  . LYS D 3 43  ? 34.901  -47.528  -21.169 1.00 21.40  ? 42  LYS L CA  1 
ATOM   4829  C  C   . LYS D 3 43  ? 34.695  -46.580  -20.005 1.00 21.52  ? 42  LYS L C   1 
ATOM   4830  O  O   . LYS D 3 43  ? 34.344  -45.405  -20.183 1.00 19.26  ? 42  LYS L O   1 
ATOM   4831  C  CB  . LYS D 3 43  ? 36.398  -47.797  -21.352 1.00 22.00  ? 42  LYS L CB  1 
ATOM   4832  C  CG  . LYS D 3 43  ? 36.757  -48.641  -22.569 1.00 22.85  ? 42  LYS L CG  1 
ATOM   4833  C  CD  . LYS D 3 43  ? 36.051  -49.996  -22.573 1.00 23.31  ? 42  LYS L CD  1 
ATOM   4834  C  CE  . LYS D 3 43  ? 36.326  -50.759  -23.851 1.00 23.62  ? 42  LYS L CE  1 
ATOM   4835  N  NZ  . LYS D 3 43  ? 35.620  -52.069  -23.863 1.00 24.46  ? 42  LYS L NZ  1 
ATOM   4836  N  N   . ALA D 3 44  ? 34.916  -47.119  -18.810 1.00 20.77  ? 43  ALA L N   1 
ATOM   4837  C  CA  . ALA D 3 44  ? 34.819  -46.358  -17.587 1.00 20.72  ? 43  ALA L CA  1 
ATOM   4838  C  C   . ALA D 3 44  ? 36.055  -45.466  -17.472 1.00 21.70  ? 43  ALA L C   1 
ATOM   4839  O  O   . ALA D 3 44  ? 37.062  -45.707  -18.139 1.00 22.34  ? 43  ALA L O   1 
ATOM   4840  C  CB  . ALA D 3 44  ? 34.731  -47.298  -16.400 1.00 18.65  ? 43  ALA L CB  1 
ATOM   4841  N  N   . PRO D 3 45  ? 35.982  -44.416  -16.640 1.00 22.34  ? 44  PRO L N   1 
ATOM   4842  C  CA  . PRO D 3 45  ? 37.200  -43.661  -16.340 1.00 21.59  ? 44  PRO L CA  1 
ATOM   4843  C  C   . PRO D 3 45  ? 38.254  -44.495  -15.596 1.00 21.37  ? 44  PRO L C   1 
ATOM   4844  O  O   . PRO D 3 45  ? 37.950  -45.529  -15.020 1.00 19.85  ? 44  PRO L O   1 
ATOM   4845  C  CB  . PRO D 3 45  ? 36.706  -42.513  -15.462 1.00 21.04  ? 44  PRO L CB  1 
ATOM   4846  C  CG  . PRO D 3 45  ? 35.255  -42.423  -15.717 1.00 22.42  ? 44  PRO L CG  1 
ATOM   4847  C  CD  . PRO D 3 45  ? 34.783  -43.791  -16.059 1.00 22.18  ? 44  PRO L CD  1 
ATOM   4848  N  N   . LYS D 3 46  ? 39.494  -44.034  -15.646 1.00 23.25  ? 45  LYS L N   1 
ATOM   4849  C  CA  . LYS D 3 46  ? 40.604  -44.703  -15.001 1.00 24.20  ? 45  LYS L CA  1 
ATOM   4850  C  C   . LYS D 3 46  ? 41.591  -43.651  -14.512 1.00 22.67  ? 45  LYS L C   1 
ATOM   4851  O  O   . LYS D 3 46  ? 41.963  -42.741  -15.262 1.00 20.67  ? 45  LYS L O   1 
ATOM   4852  C  CB  . LYS D 3 46  ? 41.283  -45.650  -15.974 1.00 26.82  ? 45  LYS L CB  1 
ATOM   4853  C  CG  . LYS D 3 46  ? 42.288  -46.568  -15.323 1.00 30.01  ? 45  LYS L CG  1 
ATOM   4854  C  CD  . LYS D 3 46  ? 43.113  -47.318  -16.366 1.00 32.84  ? 45  LYS L CD  1 
ATOM   4855  C  CE  . LYS D 3 46  ? 44.605  -47.149  -16.109 1.00 34.78  ? 45  LYS L CE  1 
ATOM   4856  N  NZ  . LYS D 3 46  ? 44.959  -45.696  -16.031 1.00 36.12  ? 45  LYS L NZ  1 
ATOM   4857  N  N   . ALA D 3 47  ? 42.001  -43.789  -13.253 1.00 20.50  ? 46  ALA L N   1 
ATOM   4858  C  CA  . ALA D 3 47  ? 42.897  -42.837  -12.611 1.00 18.80  ? 46  ALA L CA  1 
ATOM   4859  C  C   . ALA D 3 47  ? 44.295  -42.910  -13.216 1.00 20.36  ? 46  ALA L C   1 
ATOM   4860  O  O   . ALA D 3 47  ? 44.889  -44.003  -13.329 1.00 20.28  ? 46  ALA L O   1 
ATOM   4861  C  CB  . ALA D 3 47  ? 42.950  -43.098  -11.105 1.00 16.68  ? 46  ALA L CB  1 
ATOM   4862  N  N   . LEU D 3 48  ? 44.806  -41.747  -13.630 1.00 20.41  ? 47  LEU L N   1 
ATOM   4863  C  CA  . LEU D 3 48  ? 46.200  -41.609  -14.056 1.00 20.51  ? 47  LEU L CA  1 
ATOM   4864  C  C   . LEU D 3 48  ? 47.059  -41.026  -12.944 1.00 19.76  ? 47  LEU L C   1 
ATOM   4865  O  O   . LEU D 3 48  ? 48.189  -41.483  -12.699 1.00 18.53  ? 47  LEU L O   1 
ATOM   4866  C  CB  . LEU D 3 48  ? 46.298  -40.664  -15.251 1.00 21.56  ? 47  LEU L CB  1 
ATOM   4867  C  CG  . LEU D 3 48  ? 45.619  -41.096  -16.536 1.00 23.24  ? 47  LEU L CG  1 
ATOM   4868  C  CD1 . LEU D 3 48  ? 45.747  -39.994  -17.566 1.00 22.61  ? 47  LEU L CD1 1 
ATOM   4869  C  CD2 . LEU D 3 48  ? 46.221  -42.408  -17.034 1.00 21.43  ? 47  LEU L CD2 1 
ATOM   4870  N  N   . ILE D 3 49  ? 46.530  -39.981  -12.312 1.00 19.12  ? 48  ILE L N   1 
ATOM   4871  C  CA  . ILE D 3 49  ? 47.291  -39.131  -11.395 1.00 19.17  ? 48  ILE L CA  1 
ATOM   4872  C  C   . ILE D 3 49  ? 46.425  -38.694  -10.218 1.00 19.14  ? 48  ILE L C   1 
ATOM   4873  O  O   . ILE D 3 49  ? 45.281  -38.274  -10.399 1.00 17.75  ? 48  ILE L O   1 
ATOM   4874  C  CB  . ILE D 3 49  ? 47.812  -37.861  -12.122 1.00 20.42  ? 48  ILE L CB  1 
ATOM   4875  C  CG1 . ILE D 3 49  ? 48.862  -38.229  -13.184 1.00 21.20  ? 48  ILE L CG1 1 
ATOM   4876  C  CG2 . ILE D 3 49  ? 48.418  -36.862  -11.141 1.00 20.16  ? 48  ILE L CG2 1 
ATOM   4877  C  CD1 . ILE D 3 49  ? 48.964  -37.234  -14.283 1.00 21.52  ? 48  ILE L CD1 1 
ATOM   4878  N  N   . TYR D 3 50  ? 46.989  -38.813  -9.020  1.00 19.64  ? 49  TYR L N   1 
ATOM   4879  C  CA  . TYR D 3 50  ? 46.402  -38.295  -7.798  1.00 17.77  ? 49  TYR L CA  1 
ATOM   4880  C  C   . TYR D 3 50  ? 47.277  -37.162  -7.246  1.00 18.78  ? 49  TYR L C   1 
ATOM   4881  O  O   . TYR D 3 50  ? 48.472  -37.083  -7.539  1.00 18.84  ? 49  TYR L O   1 
ATOM   4882  C  CB  . TYR D 3 50  ? 46.314  -39.409  -6.762  1.00 17.48  ? 49  TYR L CB  1 
ATOM   4883  C  CG  . TYR D 3 50  ? 45.317  -40.509  -7.090  1.00 18.20  ? 49  TYR L CG  1 
ATOM   4884  C  CD1 . TYR D 3 50  ? 43.951  -40.238  -7.171  1.00 17.22  ? 49  TYR L CD1 1 
ATOM   4885  C  CD2 . TYR D 3 50  ? 45.736  -41.818  -7.302  1.00 18.87  ? 49  TYR L CD2 1 
ATOM   4886  C  CE1 . TYR D 3 50  ? 43.035  -41.228  -7.452  1.00 17.74  ? 49  TYR L CE1 1 
ATOM   4887  C  CE2 . TYR D 3 50  ? 44.814  -42.842  -7.592  1.00 19.30  ? 49  TYR L CE2 1 
ATOM   4888  C  CZ  . TYR D 3 50  ? 43.464  -42.543  -7.658  1.00 19.04  ? 49  TYR L CZ  1 
ATOM   4889  O  OH  . TYR D 3 50  ? 42.549  -43.544  -7.937  1.00 15.35  ? 49  TYR L OH  1 
ATOM   4890  N  N   . ALA D 3 51  ? 46.679  -36.288  -6.442  1.00 18.20  ? 50  ALA L N   1 
ATOM   4891  C  CA  . ALA D 3 51  ? 47.425  -35.261  -5.704  1.00 17.41  ? 50  ALA L CA  1 
ATOM   4892  C  C   . ALA D 3 51  ? 48.330  -34.403  -6.615  1.00 17.49  ? 50  ALA L C   1 
ATOM   4893  O  O   . ALA D 3 51  ? 49.466  -34.072  -6.256  1.00 13.95  ? 50  ALA L O   1 
ATOM   4894  C  CB  . ALA D 3 51  ? 48.227  -35.897  -4.555  1.00 14.61  ? 50  ALA L CB  1 
ATOM   4895  N  N   . ALA D 3 52  ? 47.794  -34.066  -7.794  1.00 18.56  ? 51  ALA L N   1 
ATOM   4896  C  CA  . ALA D 3 52  ? 48.392  -33.128  -8.772  1.00 18.78  ? 51  ALA L CA  1 
ATOM   4897  C  C   . ALA D 3 52  ? 49.522  -33.732  -9.593  1.00 19.37  ? 51  ALA L C   1 
ATOM   4898  O  O   . ALA D 3 52  ? 49.589  -33.509  -10.798 1.00 18.33  ? 51  ALA L O   1 
ATOM   4899  C  CB  . ALA D 3 52  ? 48.853  -31.802  -8.093  1.00 16.22  ? 51  ALA L CB  1 
ATOM   4900  N  N   . SER D 3 53  ? 50.420  -34.470  -8.940  1.00 20.63  ? 52  SER L N   1 
ATOM   4901  C  CA  . SER D 3 53  ? 51.622  -34.965  -9.601  1.00 20.77  ? 52  SER L CA  1 
ATOM   4902  C  C   . SER D 3 53  ? 51.991  -36.415  -9.302  1.00 20.26  ? 52  SER L C   1 
ATOM   4903  O  O   . SER D 3 53  ? 53.004  -36.895  -9.803  1.00 20.52  ? 52  SER L O   1 
ATOM   4904  C  CB  . SER D 3 53  ? 52.808  -34.052  -9.246  1.00 20.95  ? 52  SER L CB  1 
ATOM   4905  O  OG  . SER D 3 53  ? 53.120  -34.146  -7.878  1.00 21.39  ? 52  SER L OG  1 
ATOM   4906  N  N   . SER D 3 54  ? 51.196  -37.121  -8.508  1.00 20.89  ? 53  SER L N   1 
ATOM   4907  C  CA  . SER D 3 54  ? 51.525  -38.508  -8.183  1.00 22.79  ? 53  SER L CA  1 
ATOM   4908  C  C   . SER D 3 54  ? 50.930  -39.468  -9.230  1.00 24.14  ? 53  SER L C   1 
ATOM   4909  O  O   . SER D 3 54  ? 49.704  -39.593  -9.371  1.00 23.24  ? 53  SER L O   1 
ATOM   4910  C  CB  . SER D 3 54  ? 51.060  -38.872  -6.777  1.00 23.35  ? 53  SER L CB  1 
ATOM   4911  O  OG  . SER D 3 54  ? 51.275  -40.248  -6.545  1.00 25.21  ? 53  SER L OG  1 
ATOM   4912  N  N   . LEU D 3 55  ? 51.821  -40.137  -9.955  1.00 24.82  ? 54  LEU L N   1 
ATOM   4913  C  CA  . LEU D 3 55  ? 51.438  -41.019  -11.050 1.00 26.27  ? 54  LEU L CA  1 
ATOM   4914  C  C   . LEU D 3 55  ? 50.988  -42.362  -10.484 1.00 26.00  ? 54  LEU L C   1 
ATOM   4915  O  O   . LEU D 3 55  ? 51.714  -42.981  -9.711  1.00 27.41  ? 54  LEU L O   1 
ATOM   4916  C  CB  . LEU D 3 55  ? 52.633  -41.200  -11.989 1.00 26.35  ? 54  LEU L CB  1 
ATOM   4917  C  CG  . LEU D 3 55  ? 52.404  -41.831  -13.358 1.00 27.99  ? 54  LEU L CG  1 
ATOM   4918  C  CD1 . LEU D 3 55  ? 51.577  -40.893  -14.236 1.00 29.65  ? 54  LEU L CD1 1 
ATOM   4919  C  CD2 . LEU D 3 55  ? 53.731  -42.155  -14.032 1.00 26.79  ? 54  LEU L CD2 1 
ATOM   4920  N  N   . GLN D 3 56  ? 49.788  -42.799  -10.846 1.00 26.01  ? 55  GLN L N   1 
ATOM   4921  C  CA  . GLN D 3 56  ? 49.245  -44.074  -10.355 1.00 26.23  ? 55  GLN L CA  1 
ATOM   4922  C  C   . GLN D 3 56  ? 50.047  -45.246  -10.915 1.00 25.69  ? 55  GLN L C   1 
ATOM   4923  O  O   . GLN D 3 56  ? 50.564  -45.184  -12.026 1.00 24.36  ? 55  GLN L O   1 
ATOM   4924  C  CB  . GLN D 3 56  ? 47.741  -44.170  -10.677 1.00 28.48  ? 55  GLN L CB  1 
ATOM   4925  C  CG  . GLN D 3 56  ? 47.124  -45.572  -10.860 1.00 30.52  ? 55  GLN L CG  1 
ATOM   4926  C  CD  . GLN D 3 56  ? 46.960  -46.375  -9.570  1.00 31.29  ? 55  GLN L CD  1 
ATOM   4927  O  OE1 . GLN D 3 56  ? 47.356  -47.546  -9.512  1.00 32.51  ? 55  GLN L OE1 1 
ATOM   4928  N  NE2 . GLN D 3 56  ? 46.359  -45.767  -8.547  1.00 28.76  ? 55  GLN L NE2 1 
ATOM   4929  N  N   . SER D 3 57  ? 50.176  -46.299  -10.112 1.00 26.51  ? 56  SER L N   1 
ATOM   4930  C  CA  . SER D 3 57  ? 50.943  -47.483  -10.481 1.00 27.53  ? 56  SER L CA  1 
ATOM   4931  C  C   . SER D 3 57  ? 50.415  -48.097  -11.765 1.00 26.31  ? 56  SER L C   1 
ATOM   4932  O  O   . SER D 3 57  ? 49.206  -48.120  -11.999 1.00 25.52  ? 56  SER L O   1 
ATOM   4933  C  CB  . SER D 3 57  ? 50.910  -48.521  -9.354  1.00 29.21  ? 56  SER L CB  1 
ATOM   4934  O  OG  . SER D 3 57  ? 49.694  -48.420  -8.627  1.00 32.14  ? 56  SER L OG  1 
ATOM   4935  N  N   . GLY D 3 58  ? 51.335  -48.574  -12.599 1.00 25.20  ? 57  GLY L N   1 
ATOM   4936  C  CA  . GLY D 3 58  ? 50.983  -49.118  -13.902 1.00 24.43  ? 57  GLY L CA  1 
ATOM   4937  C  C   . GLY D 3 58  ? 50.702  -48.093  -14.989 1.00 23.86  ? 57  GLY L C   1 
ATOM   4938  O  O   . GLY D 3 58  ? 50.569  -48.463  -16.143 1.00 26.29  ? 57  GLY L O   1 
ATOM   4939  N  N   . VAL D 3 59  ? 50.587  -46.812  -14.648 1.00 23.39  ? 58  VAL L N   1 
ATOM   4940  C  CA  . VAL D 3 59  ? 50.399  -45.773  -15.665 1.00 21.33  ? 58  VAL L CA  1 
ATOM   4941  C  C   . VAL D 3 59  ? 51.763  -45.478  -16.271 1.00 20.83  ? 58  VAL L C   1 
ATOM   4942  O  O   . VAL D 3 59  ? 52.736  -45.338  -15.535 1.00 19.14  ? 58  VAL L O   1 
ATOM   4943  C  CB  . VAL D 3 59  ? 49.789  -44.488  -15.077 1.00 20.76  ? 58  VAL L CB  1 
ATOM   4944  C  CG1 . VAL D 3 59  ? 49.716  -43.377  -16.123 1.00 18.79  ? 58  VAL L CG1 1 
ATOM   4945  C  CG2 . VAL D 3 59  ? 48.414  -44.789  -14.494 1.00 20.82  ? 58  VAL L CG2 1 
ATOM   4946  N  N   . PRO D 3 60  ? 51.845  -45.398  -17.615 1.00 19.33  ? 59  PRO L N   1 
ATOM   4947  C  CA  . PRO D 3 60  ? 53.145  -45.215  -18.256 1.00 19.59  ? 59  PRO L CA  1 
ATOM   4948  C  C   . PRO D 3 60  ? 53.840  -43.921  -17.845 1.00 20.27  ? 59  PRO L C   1 
ATOM   4949  O  O   . PRO D 3 60  ? 53.184  -42.930  -17.542 1.00 20.29  ? 59  PRO L O   1 
ATOM   4950  C  CB  . PRO D 3 60  ? 52.818  -45.181  -19.753 1.00 19.30  ? 59  PRO L CB  1 
ATOM   4951  C  CG  . PRO D 3 60  ? 51.457  -45.707  -19.891 1.00 19.70  ? 59  PRO L CG  1 
ATOM   4952  C  CD  . PRO D 3 60  ? 50.751  -45.495  -18.591 1.00 19.27  ? 59  PRO L CD  1 
ATOM   4953  N  N   . SER D 3 61  ? 55.169  -43.940  -17.886 1.00 22.28  ? 60  SER L N   1 
ATOM   4954  C  CA  . SER D 3 61  ? 55.996  -42.808  -17.442 1.00 23.01  ? 60  SER L CA  1 
ATOM   4955  C  C   . SER D 3 61  ? 55.784  -41.531  -18.255 1.00 22.24  ? 60  SER L C   1 
ATOM   4956  O  O   . SER D 3 61  ? 56.050  -40.437  -17.772 1.00 21.38  ? 60  SER L O   1 
ATOM   4957  C  CB  . SER D 3 61  ? 57.475  -43.202  -17.478 1.00 22.51  ? 60  SER L CB  1 
ATOM   4958  O  OG  . SER D 3 61  ? 57.865  -43.606  -18.773 1.00 25.34  ? 60  SER L OG  1 
ATOM   4959  N  N   . ARG D 3 62  ? 55.295  -41.682  -19.484 1.00 22.41  ? 61  ARG L N   1 
ATOM   4960  C  CA  . ARG D 3 62  ? 55.059  -40.548  -20.366 1.00 22.26  ? 61  ARG L CA  1 
ATOM   4961  C  C   . ARG D 3 62  ? 53.998  -39.565  -19.856 1.00 22.01  ? 61  ARG L C   1 
ATOM   4962  O  O   . ARG D 3 62  ? 53.986  -38.427  -20.297 1.00 21.81  ? 61  ARG L O   1 
ATOM   4963  C  CB  . ARG D 3 62  ? 54.745  -41.021  -21.798 1.00 22.69  ? 61  ARG L CB  1 
ATOM   4964  C  CG  . ARG D 3 62  ? 53.473  -41.836  -21.965 1.00 22.98  ? 61  ARG L CG  1 
ATOM   4965  C  CD  . ARG D 3 62  ? 53.283  -42.287  -23.414 1.00 23.11  ? 61  ARG L CD  1 
ATOM   4966  N  NE  . ARG D 3 62  ? 52.089  -43.113  -23.566 1.00 22.62  ? 61  ARG L NE  1 
ATOM   4967  C  CZ  . ARG D 3 62  ? 52.048  -44.434  -23.394 1.00 24.36  ? 61  ARG L CZ  1 
ATOM   4968  N  NH1 . ARG D 3 62  ? 53.127  -45.125  -23.034 1.00 25.25  ? 61  ARG L NH1 1 
ATOM   4969  N  NH2 . ARG D 3 62  ? 50.897  -45.079  -23.557 1.00 24.99  ? 61  ARG L NH2 1 
ATOM   4970  N  N   . PHE D 3 63  ? 53.124  -39.989  -18.940 1.00 22.88  ? 62  PHE L N   1 
ATOM   4971  C  CA  . PHE D 3 63  ? 52.164  -39.067  -18.298 1.00 24.32  ? 62  PHE L CA  1 
ATOM   4972  C  C   . PHE D 3 63  ? 52.781  -38.395  -17.066 1.00 23.20  ? 62  PHE L C   1 
ATOM   4973  O  O   . PHE D 3 63  ? 53.421  -39.048  -16.247 1.00 24.95  ? 62  PHE L O   1 
ATOM   4974  C  CB  . PHE D 3 63  ? 50.873  -39.782  -17.855 1.00 24.02  ? 62  PHE L CB  1 
ATOM   4975  C  CG  . PHE D 3 63  ? 50.044  -40.331  -18.985 1.00 23.46  ? 62  PHE L CG  1 
ATOM   4976  C  CD1 . PHE D 3 63  ? 48.988  -39.602  -19.505 1.00 23.75  ? 62  PHE L CD1 1 
ATOM   4977  C  CD2 . PHE D 3 63  ? 50.303  -41.591  -19.504 1.00 23.99  ? 62  PHE L CD2 1 
ATOM   4978  C  CE1 . PHE D 3 63  ? 48.204  -40.116  -20.536 1.00 24.93  ? 62  PHE L CE1 1 
ATOM   4979  C  CE2 . PHE D 3 63  ? 49.535  -42.115  -20.545 1.00 24.32  ? 62  PHE L CE2 1 
ATOM   4980  C  CZ  . PHE D 3 63  ? 48.480  -41.372  -21.064 1.00 24.79  ? 62  PHE L CZ  1 
ATOM   4981  N  N   . SER D 3 64  ? 52.579  -37.092  -16.936 1.00 21.82  ? 63  SER L N   1 
ATOM   4982  C  CA  . SER D 3 64  ? 52.952  -36.388  -15.720 1.00 23.38  ? 63  SER L CA  1 
ATOM   4983  C  C   . SER D 3 64  ? 51.978  -35.248  -15.456 1.00 22.82  ? 63  SER L C   1 
ATOM   4984  O  O   . SER D 3 64  ? 51.388  -34.695  -16.383 1.00 23.12  ? 63  SER L O   1 
ATOM   4985  C  CB  . SER D 3 64  ? 54.392  -35.859  -15.793 1.00 22.95  ? 63  SER L CB  1 
ATOM   4986  O  OG  . SER D 3 64  ? 54.509  -34.859  -16.770 1.00 22.13  ? 63  SER L OG  1 
ATOM   4987  N  N   . GLY D 3 65  ? 51.821  -34.911  -14.183 1.00 21.32  ? 64  GLY L N   1 
ATOM   4988  C  CA  . GLY D 3 65  ? 50.970  -33.801  -13.793 1.00 21.96  ? 64  GLY L CA  1 
ATOM   4989  C  C   . GLY D 3 65  ? 51.742  -32.803  -12.967 1.00 21.38  ? 64  GLY L C   1 
ATOM   4990  O  O   . GLY D 3 65  ? 52.695  -33.163  -12.288 1.00 21.40  ? 64  GLY L O   1 
ATOM   4991  N  N   . SER D 3 66  ? 51.320  -31.547  -13.024 1.00 21.42  ? 65  SER L N   1 
ATOM   4992  C  CA  . SER D 3 66  ? 51.931  -30.491  -12.233 1.00 21.12  ? 65  SER L CA  1 
ATOM   4993  C  C   . SER D 3 66  ? 50.899  -29.445  -11.863 1.00 18.84  ? 65  SER L C   1 
ATOM   4994  O  O   . SER D 3 66  ? 49.801  -29.462  -12.381 1.00 17.39  ? 65  SER L O   1 
ATOM   4995  C  CB  . SER D 3 66  ? 53.080  -29.837  -13.015 1.00 22.37  ? 65  SER L CB  1 
ATOM   4996  O  OG  . SER D 3 66  ? 52.643  -29.493  -14.326 1.00 24.76  ? 65  SER L OG  1 
ATOM   4997  N  N   . GLY D 3 67  ? 51.286  -28.539  -10.963 1.00 20.18  ? 66  GLY L N   1 
ATOM   4998  C  CA  . GLY D 3 67  ? 50.470  -27.408  -10.555 1.00 20.06  ? 66  GLY L CA  1 
ATOM   4999  C  C   . GLY D 3 67  ? 50.003  -27.506  -9.114  1.00 21.36  ? 66  GLY L C   1 
ATOM   5000  O  O   . GLY D 3 67  ? 50.115  -28.548  -8.466  1.00 22.09  ? 66  GLY L O   1 
ATOM   5001  N  N   . SER D 3 68  ? 49.481  -26.393  -8.625  1.00 21.50  ? 67  SER L N   1 
ATOM   5002  C  CA  . SER D 3 68  ? 48.839  -26.314  -7.323  1.00 22.21  ? 67  SER L CA  1 
ATOM   5003  C  C   . SER D 3 68  ? 48.064  -24.994  -7.264  1.00 22.32  ? 67  SER L C   1 
ATOM   5004  O  O   . SER D 3 68  ? 48.192  -24.153  -8.157  1.00 21.82  ? 67  SER L O   1 
ATOM   5005  C  CB  . SER D 3 68  ? 49.870  -26.372  -6.208  1.00 22.45  ? 67  SER L CB  1 
ATOM   5006  O  OG  . SER D 3 68  ? 50.829  -25.365  -6.403  1.00 22.85  ? 67  SER L OG  1 
ATOM   5007  N  N   . GLY D 3 69  ? 47.257  -24.822  -6.221  1.00 21.61  ? 68  GLY L N   1 
ATOM   5008  C  CA  . GLY D 3 69  ? 46.377  -23.671  -6.124  1.00 20.87  ? 68  GLY L CA  1 
ATOM   5009  C  C   . GLY D 3 69  ? 45.184  -23.775  -7.061  1.00 20.69  ? 68  GLY L C   1 
ATOM   5010  O  O   . GLY D 3 69  ? 44.241  -24.528  -6.807  1.00 19.64  ? 68  GLY L O   1 
ATOM   5011  N  N   . THR D 3 70  ? 45.224  -23.009  -8.149  1.00 20.29  ? 69  THR L N   1 
ATOM   5012  C  CA  . THR D 3 70  ? 44.119  -22.974  -9.099  1.00 18.50  ? 69  THR L CA  1 
ATOM   5013  C  C   . THR D 3 70  ? 44.498  -23.473  -10.482 1.00 19.78  ? 69  THR L C   1 
ATOM   5014  O  O   . THR D 3 70  ? 43.614  -23.708  -11.293 1.00 22.60  ? 69  THR L O   1 
ATOM   5015  C  CB  . THR D 3 70  ? 43.552  -21.540  -9.253  1.00 16.90  ? 69  THR L CB  1 
ATOM   5016  O  OG1 . THR D 3 70  ? 44.553  -20.702  -9.830  1.00 17.00  ? 69  THR L OG1 1 
ATOM   5017  C  CG2 . THR D 3 70  ? 43.107  -20.961  -7.907  1.00 13.84  ? 69  THR L CG2 1 
ATOM   5018  N  N   . ASP D 3 71  ? 45.788  -23.639  -10.760 1.00 21.23  ? 70  ASP L N   1 
ATOM   5019  C  CA  . ASP D 3 71  ? 46.252  -23.918  -12.135 1.00 22.48  ? 70  ASP L CA  1 
ATOM   5020  C  C   . ASP D 3 71  ? 47.033  -25.229  -12.248 1.00 20.01  ? 70  ASP L C   1 
ATOM   5021  O  O   . ASP D 3 71  ? 48.065  -25.406  -11.613 1.00 19.91  ? 70  ASP L O   1 
ATOM   5022  C  CB  . ASP D 3 71  ? 47.086  -22.744  -12.654 1.00 23.10  ? 70  ASP L CB  1 
ATOM   5023  C  CG  . ASP D 3 71  ? 46.245  -21.497  -12.897 1.00 25.16  ? 70  ASP L CG  1 
ATOM   5024  O  OD1 . ASP D 3 71  ? 45.306  -21.556  -13.713 1.00 25.80  ? 70  ASP L OD1 1 
ATOM   5025  O  OD2 . ASP D 3 71  ? 46.522  -20.445  -12.282 1.00 28.02  ? 70  ASP L OD2 1 
ATOM   5026  N  N   . PHE D 3 72  ? 46.524  -26.138  -13.073 1.00 18.99  ? 71  PHE L N   1 
ATOM   5027  C  CA  . PHE D 3 72  ? 47.054  -27.498  -13.182 1.00 17.60  ? 71  PHE L CA  1 
ATOM   5028  C  C   . PHE D 3 72  ? 47.224  -27.901  -14.631 1.00 17.84  ? 71  PHE L C   1 
ATOM   5029  O  O   . PHE D 3 72  ? 46.516  -27.399  -15.511 1.00 17.62  ? 71  PHE L O   1 
ATOM   5030  C  CB  . PHE D 3 72  ? 46.104  -28.474  -12.478 1.00 17.32  ? 71  PHE L CB  1 
ATOM   5031  C  CG  . PHE D 3 72  ? 45.874  -28.135  -11.044 1.00 17.29  ? 71  PHE L CG  1 
ATOM   5032  C  CD1 . PHE D 3 72  ? 46.689  -28.660  -10.061 1.00 16.99  ? 71  PHE L CD1 1 
ATOM   5033  C  CD2 . PHE D 3 72  ? 44.881  -27.243  -10.680 1.00 17.64  ? 71  PHE L CD2 1 
ATOM   5034  C  CE1 . PHE D 3 72  ? 46.503  -28.333  -8.748  1.00 15.78  ? 71  PHE L CE1 1 
ATOM   5035  C  CE2 . PHE D 3 72  ? 44.696  -26.904  -9.363  1.00 16.79  ? 71  PHE L CE2 1 
ATOM   5036  C  CZ  . PHE D 3 72  ? 45.514  -27.452  -8.395  1.00 16.86  ? 71  PHE L CZ  1 
ATOM   5037  N  N   . THR D 3 73  ? 48.169  -28.803  -14.880 1.00 19.04  ? 72  THR L N   1 
ATOM   5038  C  CA  . THR D 3 73  ? 48.410  -29.309  -16.227 1.00 20.53  ? 72  THR L CA  1 
ATOM   5039  C  C   . THR D 3 73  ? 48.690  -30.821  -16.244 1.00 21.01  ? 72  THR L C   1 
ATOM   5040  O  O   . THR D 3 73  ? 49.301  -31.365  -15.317 1.00 19.17  ? 72  THR L O   1 
ATOM   5041  C  CB  . THR D 3 73  ? 49.590  -28.583  -16.903 1.00 22.39  ? 72  THR L CB  1 
ATOM   5042  O  OG1 . THR D 3 73  ? 50.813  -29.160  -16.455 1.00 26.89  ? 72  THR L OG1 1 
ATOM   5043  C  CG2 . THR D 3 73  ? 49.590  -27.107  -16.583 1.00 20.73  ? 72  THR L CG2 1 
ATOM   5044  N  N   . LEU D 3 74  ? 48.203  -31.489  -17.291 1.00 20.85  ? 73  LEU L N   1 
ATOM   5045  C  CA  . LEU D 3 74  ? 48.589  -32.866  -17.596 1.00 20.57  ? 73  LEU L CA  1 
ATOM   5046  C  C   . LEU D 3 74  ? 49.429  -32.822  -18.873 1.00 19.83  ? 73  LEU L C   1 
ATOM   5047  O  O   . LEU D 3 74  ? 49.061  -32.169  -19.845 1.00 18.17  ? 73  LEU L O   1 
ATOM   5048  C  CB  . LEU D 3 74  ? 47.357  -33.758  -17.784 1.00 21.79  ? 73  LEU L CB  1 
ATOM   5049  C  CG  . LEU D 3 74  ? 47.548  -35.235  -18.178 1.00 22.54  ? 73  LEU L CG  1 
ATOM   5050  C  CD1 . LEU D 3 74  ? 48.005  -36.082  -17.006 1.00 20.24  ? 73  LEU L CD1 1 
ATOM   5051  C  CD2 . LEU D 3 74  ? 46.250  -35.819  -18.764 1.00 21.90  ? 73  LEU L CD2 1 
ATOM   5052  N  N   . THR D 3 75  ? 50.569  -33.503  -18.854 1.00 19.58  ? 74  THR L N   1 
ATOM   5053  C  CA  . THR D 3 75  ? 51.457  -33.554  -20.004 1.00 18.43  ? 74  THR L CA  1 
ATOM   5054  C  C   . THR D 3 75  ? 51.672  -35.001  -20.405 1.00 19.04  ? 74  THR L C   1 
ATOM   5055  O  O   . THR D 3 75  ? 51.922  -35.853  -19.561 1.00 22.38  ? 74  THR L O   1 
ATOM   5056  C  CB  . THR D 3 75  ? 52.821  -32.903  -19.677 1.00 18.14  ? 74  THR L CB  1 
ATOM   5057  O  OG1 . THR D 3 75  ? 52.602  -31.559  -19.250 1.00 18.61  ? 74  THR L OG1 1 
ATOM   5058  C  CG2 . THR D 3 75  ? 53.742  -32.893  -20.889 1.00 15.18  ? 74  THR L CG2 1 
ATOM   5059  N  N   . ILE D 3 76  ? 51.538  -35.279  -21.693 1.00 19.48  ? 75  ILE L N   1 
ATOM   5060  C  CA  . ILE D 3 76  ? 51.941  -36.554  -22.269 1.00 18.70  ? 75  ILE L CA  1 
ATOM   5061  C  C   . ILE D 3 76  ? 53.163  -36.237  -23.121 1.00 19.01  ? 75  ILE L C   1 
ATOM   5062  O  O   . ILE D 3 76  ? 53.057  -35.494  -24.100 1.00 17.89  ? 75  ILE L O   1 
ATOM   5063  C  CB  . ILE D 3 76  ? 50.828  -37.157  -23.140 1.00 18.26  ? 75  ILE L CB  1 
ATOM   5064  C  CG1 . ILE D 3 76  ? 49.510  -37.225  -22.347 1.00 18.69  ? 75  ILE L CG1 1 
ATOM   5065  C  CG2 . ILE D 3 76  ? 51.247  -38.526  -23.647 1.00 16.63  ? 75  ILE L CG2 1 
ATOM   5066  C  CD1 . ILE D 3 76  ? 48.273  -37.522  -23.190 1.00 18.11  ? 75  ILE L CD1 1 
ATOM   5067  N  N   . SER D 3 77  ? 54.317  -36.782  -22.744 1.00 19.42  ? 76  SER L N   1 
ATOM   5068  C  CA  . SER D 3 77  ? 55.589  -36.377  -23.347 1.00 21.74  ? 76  SER L CA  1 
ATOM   5069  C  C   . SER D 3 77  ? 55.694  -36.800  -24.804 1.00 22.95  ? 76  SER L C   1 
ATOM   5070  O  O   . SER D 3 77  ? 56.339  -36.120  -25.609 1.00 23.13  ? 76  SER L O   1 
ATOM   5071  C  CB  . SER D 3 77  ? 56.784  -36.930  -22.555 1.00 22.39  ? 76  SER L CB  1 
ATOM   5072  O  OG  . SER D 3 77  ? 56.679  -38.330  -22.350 1.00 23.93  ? 76  SER L OG  1 
ATOM   5073  N  N   . SER D 3 78  ? 55.058  -37.920  -25.137 1.00 23.02  ? 77  SER L N   1 
ATOM   5074  C  CA  . SER D 3 78  ? 55.162  -38.487  -26.467 1.00 22.85  ? 77  SER L CA  1 
ATOM   5075  C  C   . SER D 3 78  ? 53.966  -39.403  -26.717 1.00 23.02  ? 77  SER L C   1 
ATOM   5076  O  O   . SER D 3 78  ? 53.944  -40.547  -26.253 1.00 25.84  ? 77  SER L O   1 
ATOM   5077  C  CB  . SER D 3 78  ? 56.480  -39.257  -26.590 1.00 22.03  ? 77  SER L CB  1 
ATOM   5078  O  OG  . SER D 3 78  ? 56.581  -39.890  -27.847 1.00 22.24  ? 77  SER L OG  1 
ATOM   5079  N  N   . LEU D 3 79  ? 52.968  -38.890  -27.431 1.00 20.79  ? 78  LEU L N   1 
ATOM   5080  C  CA  . LEU D 3 79  ? 51.708  -39.617  -27.615 1.00 19.73  ? 78  LEU L CA  1 
ATOM   5081  C  C   . LEU D 3 79  ? 51.913  -40.957  -28.295 1.00 18.68  ? 78  LEU L C   1 
ATOM   5082  O  O   . LEU D 3 79  ? 52.691  -41.079  -29.265 1.00 16.65  ? 78  LEU L O   1 
ATOM   5083  C  CB  . LEU D 3 79  ? 50.730  -38.824  -28.478 1.00 19.94  ? 78  LEU L CB  1 
ATOM   5084  C  CG  . LEU D 3 79  ? 49.899  -37.734  -27.834 1.00 21.54  ? 78  LEU L CG  1 
ATOM   5085  C  CD1 . LEU D 3 79  ? 49.226  -36.950  -28.955 1.00 22.89  ? 78  LEU L CD1 1 
ATOM   5086  C  CD2 . LEU D 3 79  ? 48.870  -38.334  -26.873 1.00 20.54  ? 78  LEU L CD2 1 
ATOM   5087  N  N   . GLN D 3 80  ? 51.194  -41.952  -27.791 1.00 17.71  ? 79  GLN L N   1 
ATOM   5088  C  CA  . GLN D 3 80  ? 51.057  -43.220  -28.480 1.00 18.42  ? 79  GLN L CA  1 
ATOM   5089  C  C   . GLN D 3 80  ? 49.610  -43.428  -28.895 1.00 17.22  ? 79  GLN L C   1 
ATOM   5090  O  O   . GLN D 3 80  ? 48.705  -42.742  -28.416 1.00 15.30  ? 79  GLN L O   1 
ATOM   5091  C  CB  . GLN D 3 80  ? 51.548  -44.351  -27.595 1.00 20.12  ? 79  GLN L CB  1 
ATOM   5092  C  CG  . GLN D 3 80  ? 53.022  -44.214  -27.281 1.00 22.08  ? 79  GLN L CG  1 
ATOM   5093  C  CD  . GLN D 3 80  ? 53.600  -45.417  -26.576 1.00 24.28  ? 79  GLN L CD  1 
ATOM   5094  O  OE1 . GLN D 3 80  ? 52.894  -46.376  -26.266 1.00 24.94  ? 79  GLN L OE1 1 
ATOM   5095  N  NE2 . GLN D 3 80  ? 54.904  -45.374  -26.317 1.00 26.52  ? 79  GLN L NE2 1 
ATOM   5096  N  N   . LEU D 3 81  ? 49.411  -44.374  -29.803 1.00 17.56  ? 80  LEU L N   1 
ATOM   5097  C  CA  . LEU D 3 81  ? 48.087  -44.665  -30.359 1.00 18.30  ? 80  LEU L CA  1 
ATOM   5098  C  C   . LEU D 3 81  ? 47.035  -44.916  -29.288 1.00 16.86  ? 80  LEU L C   1 
ATOM   5099  O  O   . LEU D 3 81  ? 45.903  -44.438  -29.393 1.00 15.34  ? 80  LEU L O   1 
ATOM   5100  C  CB  . LEU D 3 81  ? 48.160  -45.864  -31.310 1.00 18.82  ? 80  LEU L CB  1 
ATOM   5101  C  CG  . LEU D 3 81  ? 48.415  -45.427  -32.741 1.00 19.97  ? 80  LEU L CG  1 
ATOM   5102  C  CD1 . LEU D 3 81  ? 48.865  -46.603  -33.589 1.00 20.68  ? 80  LEU L CD1 1 
ATOM   5103  C  CD2 . LEU D 3 81  ? 47.139  -44.794  -33.284 1.00 20.10  ? 80  LEU L CD2 1 
ATOM   5104  N  N   . GLU D 3 82  ? 47.430  -45.659  -28.262 1.00 16.95  ? 81  GLU L N   1 
ATOM   5105  C  CA  . GLU D 3 82  ? 46.556  -45.967  -27.122 1.00 17.77  ? 81  GLU L CA  1 
ATOM   5106  C  C   . GLU D 3 82  ? 46.197  -44.734  -26.255 1.00 15.85  ? 81  GLU L C   1 
ATOM   5107  O  O   . GLU D 3 82  ? 45.301  -44.807  -25.430 1.00 13.26  ? 81  GLU L O   1 
ATOM   5108  C  CB  . GLU D 3 82  ? 47.175  -47.093  -26.268 1.00 19.33  ? 81  GLU L CB  1 
ATOM   5109  C  CG  . GLU D 3 82  ? 48.626  -46.863  -25.798 1.00 21.82  ? 81  GLU L CG  1 
ATOM   5110  C  CD  . GLU D 3 82  ? 49.698  -47.464  -26.733 1.00 25.57  ? 81  GLU L CD  1 
ATOM   5111  O  OE1 . GLU D 3 82  ? 50.615  -48.144  -26.212 1.00 28.13  ? 81  GLU L OE1 1 
ATOM   5112  O  OE2 . GLU D 3 82  ? 49.641  -47.264  -27.980 1.00 26.03  ? 81  GLU L OE2 1 
ATOM   5113  N  N   . ASP D 3 83  ? 46.872  -43.603  -26.463 1.00 15.19  ? 82  ASP L N   1 
ATOM   5114  C  CA  . ASP D 3 83  ? 46.606  -42.391  -25.676 1.00 14.98  ? 82  ASP L CA  1 
ATOM   5115  C  C   . ASP D 3 83  ? 45.477  -41.533  -26.216 1.00 14.74  ? 82  ASP L C   1 
ATOM   5116  O  O   . ASP D 3 83  ? 45.022  -40.604  -25.550 1.00 14.85  ? 82  ASP L O   1 
ATOM   5117  C  CB  . ASP D 3 83  ? 47.865  -41.533  -25.568 1.00 15.09  ? 82  ASP L CB  1 
ATOM   5118  C  CG  . ASP D 3 83  ? 48.994  -42.262  -24.906 1.00 15.32  ? 82  ASP L CG  1 
ATOM   5119  O  OD1 . ASP D 3 83  ? 48.709  -43.238  -24.187 1.00 15.28  ? 82  ASP L OD1 1 
ATOM   5120  O  OD2 . ASP D 3 83  ? 50.160  -41.869  -25.104 1.00 16.77  ? 82  ASP L OD2 1 
ATOM   5121  N  N   . PHE D 3 84  ? 45.010  -41.837  -27.415 1.00 15.66  ? 83  PHE L N   1 
ATOM   5122  C  CA  . PHE D 3 84  ? 43.941  -41.056  -27.995 1.00 15.89  ? 83  PHE L CA  1 
ATOM   5123  C  C   . PHE D 3 84  ? 42.634  -41.432  -27.296 1.00 15.40  ? 83  PHE L C   1 
ATOM   5124  O  O   . PHE D 3 84  ? 42.083  -42.500  -27.492 1.00 16.11  ? 83  PHE L O   1 
ATOM   5125  C  CB  . PHE D 3 84  ? 43.948  -41.217  -29.513 1.00 18.05  ? 83  PHE L CB  1 
ATOM   5126  C  CG  . PHE D 3 84  ? 45.195  -40.638  -30.154 1.00 18.72  ? 83  PHE L CG  1 
ATOM   5127  C  CD1 . PHE D 3 84  ? 45.269  -39.287  -30.475 1.00 18.54  ? 83  PHE L CD1 1 
ATOM   5128  C  CD2 . PHE D 3 84  ? 46.314  -41.428  -30.372 1.00 19.76  ? 83  PHE L CD2 1 
ATOM   5129  C  CE1 . PHE D 3 84  ? 46.421  -38.746  -31.046 1.00 18.94  ? 83  PHE L CE1 1 
ATOM   5130  C  CE2 . PHE D 3 84  ? 47.477  -40.894  -30.933 1.00 19.43  ? 83  PHE L CE2 1 
ATOM   5131  C  CZ  . PHE D 3 84  ? 47.529  -39.550  -31.267 1.00 18.88  ? 83  PHE L CZ  1 
ATOM   5132  N  N   . ALA D 3 85  ? 42.199  -40.543  -26.412 1.00 16.08  ? 84  ALA L N   1 
ATOM   5133  C  CA  . ALA D 3 85  ? 41.101  -40.788  -25.497 1.00 16.06  ? 84  ALA L CA  1 
ATOM   5134  C  C   . ALA D 3 85  ? 40.659  -39.434  -24.940 1.00 16.28  ? 84  ALA L C   1 
ATOM   5135  O  O   . ALA D 3 85  ? 41.176  -38.391  -25.360 1.00 13.96  ? 84  ALA L O   1 
ATOM   5136  C  CB  . ALA D 3 85  ? 41.567  -41.709  -24.351 1.00 16.03  ? 84  ALA L CB  1 
ATOM   5137  N  N   . THR D 3 86  ? 39.718  -39.461  -23.995 1.00 15.52  ? 85  THR L N   1 
ATOM   5138  C  CA  . THR D 3 86  ? 39.318  -38.262  -23.266 1.00 15.69  ? 85  THR L CA  1 
ATOM   5139  C  C   . THR D 3 86  ? 39.978  -38.239  -21.879 1.00 15.27  ? 85  THR L C   1 
ATOM   5140  O  O   . THR D 3 86  ? 40.161  -39.282  -21.233 1.00 13.43  ? 85  THR L O   1 
ATOM   5141  C  CB  . THR D 3 86  ? 37.766  -38.138  -23.181 1.00 15.84  ? 85  THR L CB  1 
ATOM   5142  O  OG1 . THR D 3 86  ? 37.242  -38.016  -24.510 1.00 15.59  ? 85  THR L OG1 1 
ATOM   5143  C  CG2 . THR D 3 86  ? 37.334  -36.910  -22.367 1.00 15.03  ? 85  THR L CG2 1 
ATOM   5144  N  N   . TYR D 3 87  ? 40.363  -37.040  -21.456 1.00 14.21  ? 86  TYR L N   1 
ATOM   5145  C  CA  . TYR D 3 87  ? 41.026  -36.827  -20.184 1.00 14.24  ? 86  TYR L CA  1 
ATOM   5146  C  C   . TYR D 3 87  ? 40.223  -35.802  -19.382 1.00 16.25  ? 86  TYR L C   1 
ATOM   5147  O  O   . TYR D 3 87  ? 39.795  -34.774  -19.920 1.00 17.64  ? 86  TYR L O   1 
ATOM   5148  C  CB  . TYR D 3 87  ? 42.482  -36.374  -20.405 1.00 14.27  ? 86  TYR L CB  1 
ATOM   5149  C  CG  . TYR D 3 87  ? 43.302  -37.428  -21.121 1.00 13.46  ? 86  TYR L CG  1 
ATOM   5150  C  CD1 . TYR D 3 87  ? 43.996  -38.408  -20.410 1.00 13.38  ? 86  TYR L CD1 1 
ATOM   5151  C  CD2 . TYR D 3 87  ? 43.357  -37.469  -22.506 1.00 12.58  ? 86  TYR L CD2 1 
ATOM   5152  C  CE1 . TYR D 3 87  ? 44.729  -39.394  -21.070 1.00 12.42  ? 86  TYR L CE1 1 
ATOM   5153  C  CE2 . TYR D 3 87  ? 44.073  -38.444  -23.168 1.00 11.47  ? 86  TYR L CE2 1 
ATOM   5154  C  CZ  . TYR D 3 87  ? 44.758  -39.413  -22.448 1.00 12.08  ? 86  TYR L CZ  1 
ATOM   5155  O  OH  . TYR D 3 87  ? 45.479  -40.394  -23.123 1.00 10.71  ? 86  TYR L OH  1 
ATOM   5156  N  N   . TYR D 3 88  ? 39.998  -36.118  -18.106 1.00 16.52  ? 87  TYR L N   1 
ATOM   5157  C  CA  . TYR D 3 88  ? 39.268  -35.261  -17.163 1.00 15.57  ? 87  TYR L CA  1 
ATOM   5158  C  C   . TYR D 3 88  ? 40.136  -34.953  -15.953 1.00 16.65  ? 87  TYR L C   1 
ATOM   5159  O  O   . TYR D 3 88  ? 40.768  -35.851  -15.384 1.00 16.11  ? 87  TYR L O   1 
ATOM   5160  C  CB  . TYR D 3 88  ? 38.023  -35.974  -16.626 1.00 14.89  ? 87  TYR L CB  1 
ATOM   5161  C  CG  . TYR D 3 88  ? 36.960  -36.313  -17.649 1.00 12.40  ? 87  TYR L CG  1 
ATOM   5162  C  CD1 . TYR D 3 88  ? 36.006  -35.375  -18.031 1.00 11.09  ? 87  TYR L CD1 1 
ATOM   5163  C  CD2 . TYR D 3 88  ? 36.890  -37.578  -18.203 1.00 12.34  ? 87  TYR L CD2 1 
ATOM   5164  C  CE1 . TYR D 3 88  ? 35.020  -35.679  -18.967 1.00 10.86  ? 87  TYR L CE1 1 
ATOM   5165  C  CE2 . TYR D 3 88  ? 35.902  -37.900  -19.141 1.00 13.33  ? 87  TYR L CE2 1 
ATOM   5166  C  CZ  . TYR D 3 88  ? 34.967  -36.945  -19.515 1.00 12.58  ? 87  TYR L CZ  1 
ATOM   5167  O  OH  . TYR D 3 88  ? 33.989  -37.274  -20.434 1.00 12.23  ? 87  TYR L OH  1 
ATOM   5168  N  N   . CYS D 3 89  ? 40.150  -33.693  -15.543 1.00 18.26  ? 88  CYS L N   1 
ATOM   5169  C  CA  . CYS D 3 89  ? 40.636  -33.344  -14.218 1.00 20.01  ? 88  CYS L CA  1 
ATOM   5170  C  C   . CYS D 3 89  ? 39.465  -33.398  -13.232 1.00 19.43  ? 88  CYS L C   1 
ATOM   5171  O  O   . CYS D 3 89  ? 38.309  -33.326  -13.623 1.00 18.83  ? 88  CYS L O   1 
ATOM   5172  C  CB  . CYS D 3 89  ? 41.326  -31.978  -14.201 1.00 20.33  ? 88  CYS L CB  1 
ATOM   5173  S  SG  . CYS D 3 89  ? 40.298  -30.547  -14.539 1.00 22.23  ? 88  CYS L SG  1 
ATOM   5174  N  N   . GLN D 3 90  ? 39.790  -33.545  -11.956 1.00 18.24  ? 89  GLN L N   1 
ATOM   5175  C  CA  . GLN D 3 90  ? 38.800  -33.709  -10.926 1.00 18.11  ? 89  GLN L CA  1 
ATOM   5176  C  C   . GLN D 3 90  ? 39.355  -33.261  -9.581  1.00 16.56  ? 89  GLN L C   1 
ATOM   5177  O  O   . GLN D 3 90  ? 40.393  -33.720  -9.132  1.00 14.12  ? 89  GLN L O   1 
ATOM   5178  C  CB  . GLN D 3 90  ? 38.335  -35.164  -10.855 1.00 19.64  ? 89  GLN L CB  1 
ATOM   5179  C  CG  . GLN D 3 90  ? 37.262  -35.437  -9.815  1.00 20.33  ? 89  GLN L CG  1 
ATOM   5180  C  CD  . GLN D 3 90  ? 37.795  -36.067  -8.521  1.00 19.85  ? 89  GLN L CD  1 
ATOM   5181  O  OE1 . GLN D 3 90  ? 38.600  -37.000  -8.549  1.00 18.72  ? 89  GLN L OE1 1 
ATOM   5182  N  NE2 . GLN D 3 90  ? 37.306  -35.577  -7.385  1.00 18.76  ? 89  GLN L NE2 1 
ATOM   5183  N  N   . GLN D 3 91  ? 38.594  -32.378  -8.951  1.00 15.45  ? 90  GLN L N   1 
ATOM   5184  C  CA  . GLN D 3 91  ? 38.934  -31.728  -7.702  1.00 15.51  ? 90  GLN L CA  1 
ATOM   5185  C  C   . GLN D 3 91  ? 38.408  -32.623  -6.569  1.00 13.89  ? 90  GLN L C   1 
ATOM   5186  O  O   . GLN D 3 91  ? 37.265  -33.066  -6.630  1.00 14.22  ? 90  GLN L O   1 
ATOM   5187  C  CB  . GLN D 3 91  ? 38.285  -30.330  -7.759  1.00 16.67  ? 90  GLN L CB  1 
ATOM   5188  C  CG  . GLN D 3 91  ? 38.051  -29.590  -6.504  1.00 18.68  ? 90  GLN L CG  1 
ATOM   5189  C  CD  . GLN D 3 91  ? 36.890  -30.095  -5.680  1.00 16.09  ? 90  GLN L CD  1 
ATOM   5190  O  OE1 . GLN D 3 91  ? 37.093  -30.421  -4.532  1.00 16.00  ? 90  GLN L OE1 1 
ATOM   5191  N  NE2 . GLN D 3 91  ? 35.684  -30.156  -6.252  1.00 14.21  ? 90  GLN L NE2 1 
ATOM   5192  N  N   . SER D 3 92  ? 39.265  -32.925  -5.582  1.00 13.00  ? 91  SER L N   1 
ATOM   5193  C  CA  . SER D 3 92  ? 38.908  -33.723  -4.388  1.00 9.90   ? 91  SER L CA  1 
ATOM   5194  C  C   . SER D 3 92  ? 39.025  -32.892  -3.105  1.00 8.74   ? 91  SER L C   1 
ATOM   5195  O  O   . SER D 3 92  ? 39.053  -33.429  -2.002  1.00 7.40   ? 91  SER L O   1 
ATOM   5196  C  CB  . SER D 3 92  ? 39.773  -34.994  -4.284  1.00 10.46  ? 91  SER L CB  1 
ATOM   5197  O  OG  . SER D 3 92  ? 41.186  -34.736  -4.260  1.00 11.03  ? 91  SER L OG  1 
ATOM   5198  N  N   . TYR D 3 93  ? 39.086  -31.577  -3.262  1.00 9.79   ? 92  TYR L N   1 
ATOM   5199  C  CA  . TYR D 3 93  ? 39.237  -30.661  -2.140  1.00 9.43   ? 92  TYR L CA  1 
ATOM   5200  C  C   . TYR D 3 93  ? 37.972  -30.645  -1.283  1.00 10.08  ? 92  TYR L C   1 
ATOM   5201  O  O   . TYR D 3 93  ? 38.045  -30.652  -0.045  1.00 7.76   ? 92  TYR L O   1 
ATOM   5202  C  CB  . TYR D 3 93  ? 39.567  -29.265  -2.666  1.00 8.99   ? 92  TYR L CB  1 
ATOM   5203  C  CG  . TYR D 3 93  ? 39.838  -28.234  -1.602  1.00 7.07   ? 92  TYR L CG  1 
ATOM   5204  C  CD1 . TYR D 3 93  ? 41.119  -28.053  -1.099  1.00 7.38   ? 92  TYR L CD1 1 
ATOM   5205  C  CD2 . TYR D 3 93  ? 38.821  -27.430  -1.113  1.00 8.55   ? 92  TYR L CD2 1 
ATOM   5206  C  CE1 . TYR D 3 93  ? 41.381  -27.115  -0.133  1.00 7.09   ? 92  TYR L CE1 1 
ATOM   5207  C  CE2 . TYR D 3 93  ? 39.068  -26.473  -0.134  1.00 8.47   ? 92  TYR L CE2 1 
ATOM   5208  C  CZ  . TYR D 3 93  ? 40.349  -26.327  0.355   1.00 8.04   ? 92  TYR L CZ  1 
ATOM   5209  O  OH  . TYR D 3 93  ? 40.613  -25.391  1.321   1.00 8.70   ? 92  TYR L OH  1 
ATOM   5210  N  N   . SER D 3 94  ? 36.823  -30.616  -1.953  1.00 11.26  ? 93  SER L N   1 
ATOM   5211  C  CA  . SER D 3 94  ? 35.531  -30.880  -1.325  1.00 15.43  ? 93  SER L CA  1 
ATOM   5212  C  C   . SER D 3 94  ? 34.844  -31.969  -2.145  1.00 15.45  ? 93  SER L C   1 
ATOM   5213  O  O   . SER D 3 94  ? 35.517  -32.711  -2.874  1.00 16.45  ? 93  SER L O   1 
ATOM   5214  C  CB  . SER D 3 94  ? 34.694  -29.596  -1.259  1.00 18.08  ? 93  SER L CB  1 
ATOM   5215  O  OG  . SER D 3 94  ? 34.443  -29.138  -2.572  1.00 23.40  ? 93  SER L OG  1 
ATOM   5216  N  N   . THR D 3 95  ? 33.524  -32.100  -2.041  1.00 16.26  ? 94  THR L N   1 
ATOM   5217  C  CA  . THR D 3 95  ? 32.853  -33.165  -2.778  1.00 17.07  ? 94  THR L CA  1 
ATOM   5218  C  C   . THR D 3 95  ? 33.095  -32.965  -4.270  1.00 16.24  ? 94  THR L C   1 
ATOM   5219  O  O   . THR D 3 95  ? 33.091  -31.834  -4.758  1.00 17.33  ? 94  THR L O   1 
ATOM   5220  C  CB  . THR D 3 95  ? 31.349  -33.302  -2.450  1.00 18.34  ? 94  THR L CB  1 
ATOM   5221  O  OG1 . THR D 3 95  ? 30.712  -32.035  -2.565  1.00 19.97  ? 94  THR L OG1 1 
ATOM   5222  C  CG2 . THR D 3 95  ? 31.150  -33.860  -1.027  1.00 18.92  ? 94  THR L CG2 1 
ATOM   5223  N  N   . PRO D 3 96  ? 33.318  -34.068  -4.988  1.00 14.48  ? 95  PRO L N   1 
ATOM   5224  C  CA  . PRO D 3 96  ? 33.988  -34.010  -6.270  1.00 15.32  ? 95  PRO L CA  1 
ATOM   5225  C  C   . PRO D 3 96  ? 33.290  -33.198  -7.355  1.00 14.28  ? 95  PRO L C   1 
ATOM   5226  O  O   . PRO D 3 96  ? 32.076  -33.175  -7.443  1.00 16.80  ? 95  PRO L O   1 
ATOM   5227  C  CB  . PRO D 3 96  ? 34.130  -35.492  -6.674  1.00 15.82  ? 95  PRO L CB  1 
ATOM   5228  C  CG  . PRO D 3 96  ? 33.156  -36.221  -5.875  1.00 16.45  ? 95  PRO L CG  1 
ATOM   5229  C  CD  . PRO D 3 96  ? 32.958  -35.445  -4.609  1.00 15.94  ? 95  PRO L CD  1 
ATOM   5230  N  N   . SER D 3 97  ? 34.086  -32.510  -8.154  1.00 14.42  ? 96  SER L N   1 
ATOM   5231  C  CA  . SER D 3 97  ? 33.614  -31.941  -9.404  1.00 15.17  ? 96  SER L CA  1 
ATOM   5232  C  C   . SER D 3 97  ? 34.685  -32.187  -10.467 1.00 15.18  ? 96  SER L C   1 
ATOM   5233  O  O   . SER D 3 97  ? 35.873  -32.327  -10.153 1.00 14.73  ? 96  SER L O   1 
ATOM   5234  C  CB  . SER D 3 97  ? 33.294  -30.451  -9.251  1.00 13.82  ? 96  SER L CB  1 
ATOM   5235  O  OG  . SER D 3 97  ? 34.418  -29.748  -8.769  1.00 14.78  ? 96  SER L OG  1 
ATOM   5236  N  N   . PHE D 3 98  ? 34.240  -32.263  -11.718 1.00 15.69  ? 97  PHE L N   1 
ATOM   5237  C  CA  . PHE D 3 98  ? 35.091  -32.609  -12.847 1.00 15.59  ? 97  PHE L CA  1 
ATOM   5238  C  C   . PHE D 3 98  ? 35.193  -31.472  -13.849 1.00 15.18  ? 97  PHE L C   1 
ATOM   5239  O  O   . PHE D 3 98  ? 34.309  -30.630  -13.932 1.00 13.52  ? 97  PHE L O   1 
ATOM   5240  C  CB  . PHE D 3 98  ? 34.512  -33.815  -13.579 1.00 16.45  ? 97  PHE L CB  1 
ATOM   5241  C  CG  . PHE D 3 98  ? 34.528  -35.089  -12.780 1.00 16.80  ? 97  PHE L CG  1 
ATOM   5242  C  CD1 . PHE D 3 98  ? 35.481  -36.061  -13.029 1.00 18.12  ? 97  PHE L CD1 1 
ATOM   5243  C  CD2 . PHE D 3 98  ? 33.585  -35.322  -11.794 1.00 17.63  ? 97  PHE L CD2 1 
ATOM   5244  C  CE1 . PHE D 3 98  ? 35.483  -37.243  -12.321 1.00 17.87  ? 97  PHE L CE1 1 
ATOM   5245  C  CE2 . PHE D 3 98  ? 33.589  -36.506  -11.063 1.00 17.18  ? 97  PHE L CE2 1 
ATOM   5246  C  CZ  . PHE D 3 98  ? 34.539  -37.465  -11.330 1.00 17.37  ? 97  PHE L CZ  1 
ATOM   5247  N  N   . GLY D 3 99  ? 36.288  -31.459  -14.611 1.00 15.99  ? 98  GLY L N   1 
ATOM   5248  C  CA  . GLY D 3 99  ? 36.381  -30.628  -15.796 1.00 15.85  ? 98  GLY L CA  1 
ATOM   5249  C  C   . GLY D 3 99  ? 35.505  -31.256  -16.865 1.00 16.18  ? 98  GLY L C   1 
ATOM   5250  O  O   . GLY D 3 99  ? 35.046  -32.388  -16.719 1.00 16.90  ? 98  GLY L O   1 
ATOM   5251  N  N   . GLN D 3 100 ? 35.277  -30.524  -17.947 1.00 16.83  ? 99  GLN L N   1 
ATOM   5252  C  CA  . GLN D 3 100 ? 34.390  -30.989  -19.004 1.00 17.50  ? 99  GLN L CA  1 
ATOM   5253  C  C   . GLN D 3 100 ? 35.046  -32.008  -19.948 1.00 14.76  ? 99  GLN L C   1 
ATOM   5254  O  O   . GLN D 3 100 ? 34.379  -32.567  -20.805 1.00 13.16  ? 99  GLN L O   1 
ATOM   5255  C  CB  . GLN D 3 100 ? 33.823  -29.802  -19.786 1.00 20.81  ? 99  GLN L CB  1 
ATOM   5256  C  CG  . GLN D 3 100 ? 34.775  -29.166  -20.809 1.00 24.22  ? 99  GLN L CG  1 
ATOM   5257  C  CD  . GLN D 3 100 ? 35.965  -28.455  -20.185 1.00 26.22  ? 99  GLN L CD  1 
ATOM   5258  O  OE1 . GLN D 3 100 ? 36.009  -28.197  -18.959 1.00 26.45  ? 99  GLN L OE1 1 
ATOM   5259  N  NE2 . GLN D 3 100 ? 36.938  -28.119  -21.032 1.00 25.99  ? 99  GLN L NE2 1 
ATOM   5260  N  N   . GLY D 3 101 ? 36.343  -32.243  -19.781 1.00 13.79  ? 100 GLY L N   1 
ATOM   5261  C  CA  . GLY D 3 101 ? 37.065  -33.205  -20.585 1.00 13.42  ? 100 GLY L CA  1 
ATOM   5262  C  C   . GLY D 3 101 ? 37.812  -32.620  -21.779 1.00 13.29  ? 100 GLY L C   1 
ATOM   5263  O  O   . GLY D 3 101 ? 37.423  -31.596  -22.346 1.00 11.34  ? 100 GLY L O   1 
ATOM   5264  N  N   . THR D 3 102 ? 38.901  -33.293  -22.145 1.00 14.57  ? 101 THR L N   1 
ATOM   5265  C  CA  . THR D 3 102 ? 39.664  -32.977  -23.343 1.00 15.76  ? 101 THR L CA  1 
ATOM   5266  C  C   . THR D 3 102 ? 39.787  -34.234  -24.192 1.00 15.78  ? 101 THR L C   1 
ATOM   5267  O  O   . THR D 3 102 ? 40.407  -35.212  -23.763 1.00 13.15  ? 101 THR L O   1 
ATOM   5268  C  CB  . THR D 3 102 ? 41.083  -32.477  -22.993 1.00 15.48  ? 101 THR L CB  1 
ATOM   5269  O  OG1 . THR D 3 102 ? 40.984  -31.273  -22.225 1.00 15.90  ? 101 THR L OG1 1 
ATOM   5270  C  CG2 . THR D 3 102 ? 41.902  -32.207  -24.259 1.00 13.74  ? 101 THR L CG2 1 
ATOM   5271  N  N   . LYS D 3 103 ? 39.205  -34.195  -25.395 1.00 16.05  ? 102 LYS L N   1 
ATOM   5272  C  CA  . LYS D 3 103 ? 39.282  -35.317  -26.329 1.00 15.98  ? 102 LYS L CA  1 
ATOM   5273  C  C   . LYS D 3 103 ? 40.497  -35.158  -27.245 1.00 14.84  ? 102 LYS L C   1 
ATOM   5274  O  O   . LYS D 3 103 ? 40.628  -34.153  -27.932 1.00 14.11  ? 102 LYS L O   1 
ATOM   5275  C  CB  . LYS D 3 103 ? 38.001  -35.414  -27.155 1.00 17.42  ? 102 LYS L CB  1 
ATOM   5276  C  CG  . LYS D 3 103 ? 37.914  -36.681  -28.012 1.00 18.75  ? 102 LYS L CG  1 
ATOM   5277  C  CD  . LYS D 3 103 ? 36.469  -36.970  -28.485 1.00 18.71  ? 102 LYS L CD  1 
ATOM   5278  C  CE  . LYS D 3 103 ? 36.439  -38.055  -29.569 1.00 18.62  ? 102 LYS L CE  1 
ATOM   5279  N  NZ  . LYS D 3 103 ? 35.064  -38.329  -30.094 1.00 18.99  ? 102 LYS L NZ  1 
ATOM   5280  N  N   . VAL D 3 104 ? 41.375  -36.159  -27.240 1.00 13.78  ? 103 VAL L N   1 
ATOM   5281  C  CA  . VAL D 3 104 ? 42.628  -36.121  -27.978 1.00 12.94  ? 103 VAL L CA  1 
ATOM   5282  C  C   . VAL D 3 104 ? 42.523  -37.041  -29.190 1.00 13.55  ? 103 VAL L C   1 
ATOM   5283  O  O   . VAL D 3 104 ? 42.334  -38.248  -29.051 1.00 12.10  ? 103 VAL L O   1 
ATOM   5284  C  CB  . VAL D 3 104 ? 43.818  -36.543  -27.073 1.00 13.34  ? 103 VAL L CB  1 
ATOM   5285  C  CG1 . VAL D 3 104 ? 45.155  -36.490  -27.839 1.00 11.71  ? 103 VAL L CG1 1 
ATOM   5286  C  CG2 . VAL D 3 104 ? 43.862  -35.660  -25.827 1.00 12.45  ? 103 VAL L CG2 1 
ATOM   5287  N  N   . GLU D 3 105 ? 42.634  -36.460  -30.380 1.00 14.78  ? 104 GLU L N   1 
ATOM   5288  C  CA  . GLU D 3 105 ? 42.489  -37.213  -31.623 1.00 16.57  ? 104 GLU L CA  1 
ATOM   5289  C  C   . GLU D 3 105 ? 43.744  -37.181  -32.476 1.00 15.74  ? 104 GLU L C   1 
ATOM   5290  O  O   . GLU D 3 105 ? 44.651  -36.388  -32.229 1.00 12.93  ? 104 GLU L O   1 
ATOM   5291  C  CB  . GLU D 3 105 ? 41.274  -36.713  -32.408 1.00 18.02  ? 104 GLU L CB  1 
ATOM   5292  C  CG  . GLU D 3 105 ? 40.028  -37.514  -32.059 1.00 21.09  ? 104 GLU L CG  1 
ATOM   5293  C  CD  . GLU D 3 105 ? 38.736  -36.740  -32.229 1.00 23.46  ? 104 GLU L CD  1 
ATOM   5294  O  OE1 . GLU D 3 105 ? 38.525  -35.790  -31.437 1.00 25.14  ? 104 GLU L OE1 1 
ATOM   5295  O  OE2 . GLU D 3 105 ? 37.927  -37.111  -33.121 1.00 23.02  ? 104 GLU L OE2 1 
ATOM   5296  N  N   . ILE D 3 106 ? 43.778  -38.061  -33.473 1.00 16.21  ? 105 ILE L N   1 
ATOM   5297  C  CA  . ILE D 3 106 ? 44.962  -38.256  -34.293 1.00 17.97  ? 105 ILE L CA  1 
ATOM   5298  C  C   . ILE D 3 106 ? 44.974  -37.300  -35.490 1.00 18.50  ? 105 ILE L C   1 
ATOM   5299  O  O   . ILE D 3 106 ? 43.991  -37.193  -36.229 1.00 19.48  ? 105 ILE L O   1 
ATOM   5300  C  CB  . ILE D 3 106 ? 45.090  -39.722  -34.796 1.00 18.73  ? 105 ILE L CB  1 
ATOM   5301  C  CG1 . ILE D 3 106 ? 44.952  -40.708  -33.635 1.00 20.52  ? 105 ILE L CG1 1 
ATOM   5302  C  CG2 . ILE D 3 106 ? 46.451  -39.943  -35.476 1.00 17.40  ? 105 ILE L CG2 1 
ATOM   5303  C  CD1 . ILE D 3 106 ? 44.513  -42.094  -34.064 1.00 21.96  ? 105 ILE L CD1 1 
ATOM   5304  N  N   . LYS D 3 107 ? 46.111  -36.635  -35.666 1.00 18.38  ? 106 LYS L N   1 
ATOM   5305  C  CA  . LYS D 3 107 ? 46.371  -35.745  -36.787 1.00 19.39  ? 106 LYS L CA  1 
ATOM   5306  C  C   . LYS D 3 107 ? 46.929  -36.566  -37.971 1.00 19.19  ? 106 LYS L C   1 
ATOM   5307  O  O   . LYS D 3 107 ? 47.818  -37.412  -37.799 1.00 17.80  ? 106 LYS L O   1 
ATOM   5308  C  CB  . LYS D 3 107 ? 47.395  -34.677  -36.348 1.00 21.54  ? 106 LYS L CB  1 
ATOM   5309  C  CG  . LYS D 3 107 ? 47.383  -33.364  -37.124 1.00 23.11  ? 106 LYS L CG  1 
ATOM   5310  C  CD  . LYS D 3 107 ? 48.758  -32.670  -37.093 1.00 25.25  ? 106 LYS L CD  1 
ATOM   5311  C  CE  . LYS D 3 107 ? 49.308  -32.457  -35.670 1.00 27.61  ? 106 LYS L CE  1 
ATOM   5312  N  NZ  . LYS D 3 107 ? 50.781  -32.096  -35.618 1.00 28.69  ? 106 LYS L NZ  1 
ATOM   5313  N  N   . ARG D 3 108 ? 46.397  -36.318  -39.169 1.00 18.70  ? 107 ARG L N   1 
ATOM   5314  C  CA  . ARG D 3 108 ? 46.924  -36.917  -40.388 1.00 16.85  ? 107 ARG L CA  1 
ATOM   5315  C  C   . ARG D 3 108 ? 46.783  -35.925  -41.535 1.00 17.37  ? 107 ARG L C   1 
ATOM   5316  O  O   . ARG D 3 108 ? 46.257  -34.826  -41.338 1.00 17.53  ? 107 ARG L O   1 
ATOM   5317  C  CB  . ARG D 3 108 ? 46.178  -38.207  -40.695 1.00 16.23  ? 107 ARG L CB  1 
ATOM   5318  C  CG  . ARG D 3 108 ? 44.658  -38.026  -40.766 1.00 17.28  ? 107 ARG L CG  1 
ATOM   5319  C  CD  . ARG D 3 108 ? 44.048  -38.944  -41.784 1.00 17.59  ? 107 ARG L CD  1 
ATOM   5320  N  NE  . ARG D 3 108 ? 44.500  -38.623  -43.137 1.00 18.82  ? 107 ARG L NE  1 
ATOM   5321  C  CZ  . ARG D 3 108 ? 44.560  -39.494  -44.146 1.00 19.82  ? 107 ARG L CZ  1 
ATOM   5322  N  NH1 . ARG D 3 108 ? 44.217  -40.770  -43.994 1.00 19.47  ? 107 ARG L NH1 1 
ATOM   5323  N  NH2 . ARG D 3 108 ? 44.983  -39.088  -45.329 1.00 20.89  ? 107 ARG L NH2 1 
ATOM   5324  N  N   . THR D 3 109 ? 47.254  -36.313  -42.721 1.00 17.08  ? 108 THR L N   1 
ATOM   5325  C  CA  . THR D 3 109 ? 47.149  -35.486  -43.921 1.00 17.93  ? 108 THR L CA  1 
ATOM   5326  C  C   . THR D 3 109 ? 45.686  -35.219  -44.296 1.00 17.91  ? 108 THR L C   1 
ATOM   5327  O  O   . THR D 3 109 ? 44.847  -36.109  -44.228 1.00 18.89  ? 108 THR L O   1 
ATOM   5328  C  CB  . THR D 3 109 ? 47.849  -36.169  -45.129 1.00 19.47  ? 108 THR L CB  1 
ATOM   5329  O  OG1 . THR D 3 109 ? 49.245  -36.343  -44.849 1.00 20.46  ? 108 THR L OG1 1 
ATOM   5330  C  CG2 . THR D 3 109 ? 47.705  -35.321  -46.419 1.00 20.77  ? 108 THR L CG2 1 
ATOM   5331  N  N   . VAL D 3 110 ? 45.399  -33.991  -44.709 1.00 16.76  ? 109 VAL L N   1 
ATOM   5332  C  CA  . VAL D 3 110 ? 44.083  -33.617  -45.230 1.00 16.04  ? 109 VAL L CA  1 
ATOM   5333  C  C   . VAL D 3 110 ? 43.615  -34.527  -46.367 1.00 15.70  ? 109 VAL L C   1 
ATOM   5334  O  O   . VAL D 3 110 ? 44.333  -34.742  -47.332 1.00 16.19  ? 109 VAL L O   1 
ATOM   5335  C  CB  . VAL D 3 110 ? 44.099  -32.164  -45.769 1.00 16.27  ? 109 VAL L CB  1 
ATOM   5336  C  CG1 . VAL D 3 110 ? 42.791  -31.829  -46.463 1.00 13.36  ? 109 VAL L CG1 1 
ATOM   5337  C  CG2 . VAL D 3 110 ? 44.427  -31.170  -44.622 1.00 16.00  ? 109 VAL L CG2 1 
ATOM   5338  N  N   . ALA D 3 111 ? 42.399  -35.045  -46.239 1.00 15.58  ? 110 ALA L N   1 
ATOM   5339  C  CA  . ALA D 3 111 ? 41.809  -35.930  -47.220 1.00 14.47  ? 110 ALA L CA  1 
ATOM   5340  C  C   . ALA D 3 111 ? 40.427  -35.402  -47.589 1.00 15.71  ? 110 ALA L C   1 
ATOM   5341  O  O   . ALA D 3 111 ? 39.597  -35.119  -46.713 1.00 14.28  ? 110 ALA L O   1 
ATOM   5342  C  CB  . ALA D 3 111 ? 41.715  -37.332  -46.666 1.00 13.00  ? 110 ALA L CB  1 
ATOM   5343  N  N   . ALA D 3 112 ? 40.199  -35.253  -48.893 1.00 15.86  ? 111 ALA L N   1 
ATOM   5344  C  CA  . ALA D 3 112 ? 38.906  -34.837  -49.416 1.00 15.98  ? 111 ALA L CA  1 
ATOM   5345  C  C   . ALA D 3 112 ? 37.885  -35.984  -49.325 1.00 17.00  ? 111 ALA L C   1 
ATOM   5346  O  O   . ALA D 3 112 ? 38.227  -37.150  -49.585 1.00 18.08  ? 111 ALA L O   1 
ATOM   5347  C  CB  . ALA D 3 112 ? 39.045  -34.373  -50.859 1.00 14.57  ? 111 ALA L CB  1 
ATOM   5348  N  N   . PRO D 3 113 ? 36.628  -35.654  -48.978 1.00 16.69  ? 112 PRO L N   1 
ATOM   5349  C  CA  . PRO D 3 113 ? 35.556  -36.660  -49.000 1.00 18.42  ? 112 PRO L CA  1 
ATOM   5350  C  C   . PRO D 3 113 ? 35.131  -37.079  -50.409 1.00 19.65  ? 112 PRO L C   1 
ATOM   5351  O  O   . PRO D 3 113 ? 35.248  -36.301  -51.359 1.00 19.81  ? 112 PRO L O   1 
ATOM   5352  C  CB  . PRO D 3 113 ? 34.385  -35.953  -48.295 1.00 17.48  ? 112 PRO L CB  1 
ATOM   5353  C  CG  . PRO D 3 113 ? 34.640  -34.502  -48.490 1.00 18.12  ? 112 PRO L CG  1 
ATOM   5354  C  CD  . PRO D 3 113 ? 36.127  -34.311  -48.624 1.00 16.67  ? 112 PRO L CD  1 
ATOM   5355  N  N   . SER D 3 114 ? 34.661  -38.316  -50.532 1.00 21.21  ? 113 SER L N   1 
ATOM   5356  C  CA  . SER D 3 114 ? 33.926  -38.756  -51.710 1.00 21.43  ? 113 SER L CA  1 
ATOM   5357  C  C   . SER D 3 114 ? 32.472  -38.645  -51.335 1.00 20.07  ? 113 SER L C   1 
ATOM   5358  O  O   . SER D 3 114 ? 32.086  -39.011  -50.217 1.00 22.43  ? 113 SER L O   1 
ATOM   5359  C  CB  . SER D 3 114 ? 34.241  -40.213  -52.041 1.00 23.36  ? 113 SER L CB  1 
ATOM   5360  O  OG  . SER D 3 114 ? 35.587  -40.357  -52.422 1.00 25.10  ? 113 SER L OG  1 
ATOM   5361  N  N   . VAL D 3 115 ? 31.658  -38.150  -52.253 1.00 18.71  ? 114 VAL L N   1 
ATOM   5362  C  CA  . VAL D 3 115 ? 30.284  -37.806  -51.916 1.00 16.97  ? 114 VAL L CA  1 
ATOM   5363  C  C   . VAL D 3 115 ? 29.310  -38.621  -52.748 1.00 17.00  ? 114 VAL L C   1 
ATOM   5364  O  O   . VAL D 3 115 ? 29.489  -38.795  -53.957 1.00 16.10  ? 114 VAL L O   1 
ATOM   5365  C  CB  . VAL D 3 115 ? 30.016  -36.290  -52.076 1.00 16.52  ? 114 VAL L CB  1 
ATOM   5366  C  CG1 . VAL D 3 115 ? 28.611  -35.922  -51.551 1.00 12.78  ? 114 VAL L CG1 1 
ATOM   5367  C  CG2 . VAL D 3 115 ? 31.131  -35.467  -51.373 1.00 14.92  ? 114 VAL L CG2 1 
ATOM   5368  N  N   . PHE D 3 116 ? 28.299  -39.149  -52.064 1.00 15.99  ? 115 PHE L N   1 
ATOM   5369  C  CA  . PHE D 3 116 ? 27.244  -39.921  -52.684 1.00 16.36  ? 115 PHE L CA  1 
ATOM   5370  C  C   . PHE D 3 116 ? 25.895  -39.405  -52.182 1.00 16.16  ? 115 PHE L C   1 
ATOM   5371  O  O   . PHE D 3 116 ? 25.781  -38.974  -51.035 1.00 15.59  ? 115 PHE L O   1 
ATOM   5372  C  CB  . PHE D 3 116 ? 27.402  -41.400  -52.326 1.00 16.88  ? 115 PHE L CB  1 
ATOM   5373  C  CG  . PHE D 3 116 ? 28.741  -41.967  -52.681 1.00 17.01  ? 115 PHE L CG  1 
ATOM   5374  C  CD1 . PHE D 3 116 ? 28.932  -42.624  -53.888 1.00 17.80  ? 115 PHE L CD1 1 
ATOM   5375  C  CD2 . PHE D 3 116 ? 29.820  -41.833  -51.810 1.00 17.06  ? 115 PHE L CD2 1 
ATOM   5376  C  CE1 . PHE D 3 116 ? 30.190  -43.139  -54.223 1.00 18.69  ? 115 PHE L CE1 1 
ATOM   5377  C  CE2 . PHE D 3 116 ? 31.068  -42.338  -52.131 1.00 16.59  ? 115 PHE L CE2 1 
ATOM   5378  C  CZ  . PHE D 3 116 ? 31.263  -42.985  -53.335 1.00 17.83  ? 115 PHE L CZ  1 
ATOM   5379  N  N   . ILE D 3 117 ? 24.888  -39.444  -53.051 1.00 15.55  ? 116 ILE L N   1 
ATOM   5380  C  CA  . ILE D 3 117 ? 23.511  -39.102  -52.682 1.00 15.34  ? 116 ILE L CA  1 
ATOM   5381  C  C   . ILE D 3 117 ? 22.578  -40.297  -52.980 1.00 15.38  ? 116 ILE L C   1 
ATOM   5382  O  O   . ILE D 3 117 ? 22.775  -41.015  -53.960 1.00 14.19  ? 116 ILE L O   1 
ATOM   5383  C  CB  . ILE D 3 117 ? 23.051  -37.792  -53.403 1.00 15.10  ? 116 ILE L CB  1 
ATOM   5384  C  CG1 . ILE D 3 117 ? 21.778  -37.230  -52.758 1.00 14.46  ? 116 ILE L CG1 1 
ATOM   5385  C  CG2 . ILE D 3 117 ? 22.897  -37.991  -54.932 1.00 11.04  ? 116 ILE L CG2 1 
ATOM   5386  C  CD1 . ILE D 3 117 ? 21.376  -35.871  -53.292 1.00 14.52  ? 116 ILE L CD1 1 
ATOM   5387  N  N   . PHE D 3 118 ? 21.609  -40.532  -52.098 1.00 16.11  ? 117 PHE L N   1 
ATOM   5388  C  CA  . PHE D 3 118 ? 20.632  -41.621  -52.257 1.00 14.80  ? 117 PHE L CA  1 
ATOM   5389  C  C   . PHE D 3 118 ? 19.232  -41.063  -52.109 1.00 13.17  ? 117 PHE L C   1 
ATOM   5390  O  O   . PHE D 3 118 ? 18.928  -40.454  -51.089 1.00 12.54  ? 117 PHE L O   1 
ATOM   5391  C  CB  . PHE D 3 118 ? 20.812  -42.697  -51.182 1.00 14.37  ? 117 PHE L CB  1 
ATOM   5392  C  CG  . PHE D 3 118 ? 22.147  -43.327  -51.190 1.00 13.83  ? 117 PHE L CG  1 
ATOM   5393  C  CD1 . PHE D 3 118 ? 22.394  -44.429  -51.976 1.00 13.58  ? 117 PHE L CD1 1 
ATOM   5394  C  CD2 . PHE D 3 118 ? 23.168  -42.811  -50.414 1.00 13.97  ? 117 PHE L CD2 1 
ATOM   5395  C  CE1 . PHE D 3 118 ? 23.643  -45.013  -51.984 1.00 14.43  ? 117 PHE L CE1 1 
ATOM   5396  C  CE2 . PHE D 3 118 ? 24.405  -43.386  -50.423 1.00 14.09  ? 117 PHE L CE2 1 
ATOM   5397  C  CZ  . PHE D 3 118 ? 24.649  -44.488  -51.207 1.00 14.11  ? 117 PHE L CZ  1 
ATOM   5398  N  N   . PRO D 3 119 ? 18.373  -41.281  -53.112 1.00 14.56  ? 118 PRO L N   1 
ATOM   5399  C  CA  . PRO D 3 119 ? 16.967  -40.930  -52.961 1.00 15.06  ? 118 PRO L CA  1 
ATOM   5400  C  C   . PRO D 3 119 ? 16.286  -41.822  -51.932 1.00 15.48  ? 118 PRO L C   1 
ATOM   5401  O  O   . PRO D 3 119 ? 16.801  -42.896  -51.617 1.00 13.09  ? 118 PRO L O   1 
ATOM   5402  C  CB  . PRO D 3 119 ? 16.360  -41.214  -54.346 1.00 15.72  ? 118 PRO L CB  1 
ATOM   5403  C  CG  . PRO D 3 119 ? 17.467  -41.470  -55.258 1.00 16.17  ? 118 PRO L CG  1 
ATOM   5404  C  CD  . PRO D 3 119 ? 18.683  -41.813  -54.450 1.00 16.03  ? 118 PRO L CD  1 
ATOM   5405  N  N   . PRO D 3 120 ? 15.118  -41.396  -51.427 1.00 17.28  ? 119 PRO L N   1 
ATOM   5406  C  CA  . PRO D 3 120 ? 14.296  -42.317  -50.629 1.00 17.16  ? 119 PRO L CA  1 
ATOM   5407  C  C   . PRO D 3 120 ? 13.985  -43.585  -51.404 1.00 16.08  ? 119 PRO L C   1 
ATOM   5408  O  O   . PRO D 3 120 ? 13.832  -43.551  -52.628 1.00 16.57  ? 119 PRO L O   1 
ATOM   5409  C  CB  . PRO D 3 120 ? 12.999  -41.527  -50.375 1.00 17.15  ? 119 PRO L CB  1 
ATOM   5410  C  CG  . PRO D 3 120 ? 13.014  -40.411  -51.340 1.00 17.06  ? 119 PRO L CG  1 
ATOM   5411  C  CD  . PRO D 3 120 ? 14.444  -40.103  -51.647 1.00 17.48  ? 119 PRO L CD  1 
ATOM   5412  N  N   . SER D 3 121 ? 13.902  -44.699  -50.698 1.00 15.17  ? 120 SER L N   1 
ATOM   5413  C  CA  . SER D 3 121 ? 13.579  -45.949  -51.337 1.00 15.06  ? 120 SER L CA  1 
ATOM   5414  C  C   . SER D 3 121 ? 12.089  -45.940  -51.671 1.00 13.58  ? 120 SER L C   1 
ATOM   5415  O  O   . SER D 3 121 ? 11.302  -45.236  -51.045 1.00 12.66  ? 120 SER L O   1 
ATOM   5416  C  CB  . SER D 3 121 ? 13.945  -47.123  -50.425 1.00 16.37  ? 120 SER L CB  1 
ATOM   5417  O  OG  . SER D 3 121 ? 13.085  -47.198  -49.298 1.00 18.74  ? 120 SER L OG  1 
ATOM   5418  N  N   . ASP D 3 122 ? 11.709  -46.711  -52.673 1.00 14.55  ? 121 ASP L N   1 
ATOM   5419  C  CA  . ASP D 3 122 ? 10.296  -46.864  -53.024 1.00 16.22  ? 121 ASP L CA  1 
ATOM   5420  C  C   . ASP D 3 122 ? 9.486   -47.530  -51.908 1.00 15.36  ? 121 ASP L C   1 
ATOM   5421  O  O   . ASP D 3 122 ? 8.289   -47.254  -51.746 1.00 14.51  ? 121 ASP L O   1 
ATOM   5422  C  CB  . ASP D 3 122 ? 10.168  -47.656  -54.320 1.00 17.57  ? 121 ASP L CB  1 
ATOM   5423  C  CG  . ASP D 3 122 ? 10.631  -46.860  -55.519 1.00 20.27  ? 121 ASP L CG  1 
ATOM   5424  O  OD1 . ASP D 3 122 ? 10.258  -45.661  -55.622 1.00 22.89  ? 121 ASP L OD1 1 
ATOM   5425  O  OD2 . ASP D 3 122 ? 11.362  -47.422  -56.356 1.00 21.12  ? 121 ASP L OD2 1 
ATOM   5426  N  N   . GLU D 3 123 ? 10.149  -48.403  -51.154 1.00 15.10  ? 122 GLU L N   1 
ATOM   5427  C  CA  . GLU D 3 123 ? 9.553   -49.036  -49.988 1.00 15.72  ? 122 GLU L CA  1 
ATOM   5428  C  C   . GLU D 3 123 ? 9.228   -48.000  -48.906 1.00 14.53  ? 122 GLU L C   1 
ATOM   5429  O  O   . GLU D 3 123 ? 8.142   -48.020  -48.348 1.00 12.80  ? 122 GLU L O   1 
ATOM   5430  C  CB  . GLU D 3 123 ? 10.489  -50.109  -49.431 1.00 17.82  ? 122 GLU L CB  1 
ATOM   5431  C  CG  . GLU D 3 123 ? 9.819   -51.040  -48.417 1.00 21.48  ? 122 GLU L CG  1 
ATOM   5432  C  CD  . GLU D 3 123 ? 10.795  -51.981  -47.703 1.00 23.65  ? 122 GLU L CD  1 
ATOM   5433  O  OE1 . GLU D 3 123 ? 12.000  -52.020  -48.063 1.00 24.87  ? 122 GLU L OE1 1 
ATOM   5434  O  OE2 . GLU D 3 123 ? 10.341  -52.679  -46.763 1.00 25.81  ? 122 GLU L OE2 1 
ATOM   5435  N  N   . GLN D 3 124 ? 10.162  -47.091  -48.616 1.00 16.02  ? 123 GLN L N   1 
ATOM   5436  C  CA  . GLN D 3 124 ? 9.919   -46.049  -47.611 1.00 15.28  ? 123 GLN L CA  1 
ATOM   5437  C  C   . GLN D 3 124 ? 8.717   -45.176  -47.983 1.00 14.86  ? 123 GLN L C   1 
ATOM   5438  O  O   . GLN D 3 124 ? 7.944   -44.780  -47.109 1.00 14.27  ? 123 GLN L O   1 
ATOM   5439  C  CB  . GLN D 3 124 ? 11.138  -45.157  -47.408 1.00 15.64  ? 123 GLN L CB  1 
ATOM   5440  C  CG  . GLN D 3 124 ? 10.954  -44.218  -46.211 1.00 16.90  ? 123 GLN L CG  1 
ATOM   5441  C  CD  . GLN D 3 124 ? 12.087  -43.231  -45.986 1.00 16.65  ? 123 GLN L CD  1 
ATOM   5442  O  OE1 . GLN D 3 124 ? 12.833  -42.866  -46.898 1.00 15.14  ? 123 GLN L OE1 1 
ATOM   5443  N  NE2 . GLN D 3 124 ? 12.188  -42.763  -44.756 1.00 17.77  ? 123 GLN L NE2 1 
ATOM   5444  N  N   . LEU D 3 125 ? 8.564   -44.898  -49.276 1.00 14.97  ? 124 LEU L N   1 
ATOM   5445  C  CA  . LEU D 3 125 ? 7.496   -44.030  -49.772 1.00 16.86  ? 124 LEU L CA  1 
ATOM   5446  C  C   . LEU D 3 125 ? 6.095   -44.632  -49.660 1.00 17.15  ? 124 LEU L C   1 
ATOM   5447  O  O   . LEU D 3 125 ? 5.112   -43.938  -49.916 1.00 19.56  ? 124 LEU L O   1 
ATOM   5448  C  CB  . LEU D 3 125 ? 7.756   -43.615  -51.227 1.00 17.06  ? 124 LEU L CB  1 
ATOM   5449  C  CG  . LEU D 3 125 ? 9.021   -42.803  -51.521 1.00 16.75  ? 124 LEU L CG  1 
ATOM   5450  C  CD1 . LEU D 3 125 ? 9.221   -42.707  -53.015 1.00 15.92  ? 124 LEU L CD1 1 
ATOM   5451  C  CD2 . LEU D 3 125 ? 8.945   -41.408  -50.886 1.00 17.35  ? 124 LEU L CD2 1 
ATOM   5452  N  N   . LYS D 3 126 ? 5.995   -45.911  -49.307 1.00 17.25  ? 125 LYS L N   1 
ATOM   5453  C  CA  . LYS D 3 126 ? 4.728   -46.470  -48.817 1.00 17.90  ? 125 LYS L CA  1 
ATOM   5454  C  C   . LYS D 3 126 ? 4.228   -45.724  -47.574 1.00 17.34  ? 125 LYS L C   1 
ATOM   5455  O  O   . LYS D 3 126 ? 3.029   -45.642  -47.347 1.00 15.97  ? 125 LYS L O   1 
ATOM   5456  C  CB  . LYS D 3 126 ? 4.884   -47.943  -48.463 1.00 18.86  ? 125 LYS L CB  1 
ATOM   5457  C  CG  . LYS D 3 126 ? 4.999   -48.894  -49.636 1.00 19.66  ? 125 LYS L CG  1 
ATOM   5458  C  CD  . LYS D 3 126 ? 5.375   -50.282  -49.124 1.00 21.26  ? 125 LYS L CD  1 
ATOM   5459  C  CE  . LYS D 3 126 ? 4.719   -51.382  -49.929 1.00 23.55  ? 125 LYS L CE  1 
ATOM   5460  N  NZ  . LYS D 3 126 ? 4.979   -52.735  -49.318 1.00 25.59  ? 125 LYS L NZ  1 
ATOM   5461  N  N   . SER D 3 127 ? 5.160   -45.209  -46.770 1.00 18.92  ? 126 SER L N   1 
ATOM   5462  C  CA  . SER D 3 127 ? 4.847   -44.347  -45.618 1.00 19.83  ? 126 SER L CA  1 
ATOM   5463  C  C   . SER D 3 127 ? 4.621   -42.882  -46.039 1.00 21.76  ? 126 SER L C   1 
ATOM   5464  O  O   . SER D 3 127 ? 4.589   -42.540  -47.235 1.00 22.44  ? 126 SER L O   1 
ATOM   5465  C  CB  . SER D 3 127 ? 5.973   -44.418  -44.567 1.00 19.93  ? 126 SER L CB  1 
ATOM   5466  O  OG  . SER D 3 127 ? 7.116   -43.628  -44.926 1.00 19.32  ? 126 SER L OG  1 
ATOM   5467  N  N   . GLY D 3 128 ? 4.466   -42.019  -45.042 1.00 22.43  ? 127 GLY L N   1 
ATOM   5468  C  CA  . GLY D 3 128 ? 4.228   -40.602  -45.281 1.00 23.01  ? 127 GLY L CA  1 
ATOM   5469  C  C   . GLY D 3 128 ? 5.487   -39.765  -45.233 1.00 23.69  ? 127 GLY L C   1 
ATOM   5470  O  O   . GLY D 3 128 ? 5.412   -38.546  -45.353 1.00 23.47  ? 127 GLY L O   1 
ATOM   5471  N  N   . THR D 3 129 ? 6.647   -40.401  -45.062 1.00 24.29  ? 128 THR L N   1 
ATOM   5472  C  CA  . THR D 3 129 ? 7.898   -39.657  -44.991 1.00 24.90  ? 128 THR L CA  1 
ATOM   5473  C  C   . THR D 3 129 ? 8.929   -40.155  -46.010 1.00 23.83  ? 128 THR L C   1 
ATOM   5474  O  O   . THR D 3 129 ? 8.881   -41.304  -46.457 1.00 23.47  ? 128 THR L O   1 
ATOM   5475  C  CB  . THR D 3 129 ? 8.483   -39.665  -43.557 1.00 26.16  ? 128 THR L CB  1 
ATOM   5476  O  OG1 . THR D 3 129 ? 8.824   -41.000  -43.179 1.00 28.83  ? 128 THR L OG1 1 
ATOM   5477  C  CG2 . THR D 3 129 ? 7.481   -39.108  -42.572 1.00 24.93  ? 128 THR L CG2 1 
ATOM   5478  N  N   . ALA D 3 130 ? 9.835   -39.250  -46.382 1.00 22.89  ? 129 ALA L N   1 
ATOM   5479  C  CA  . ALA D 3 130 ? 10.906  -39.515  -47.339 1.00 21.26  ? 129 ALA L CA  1 
ATOM   5480  C  C   . ALA D 3 130 ? 12.233  -39.085  -46.722 1.00 20.94  ? 129 ALA L C   1 
ATOM   5481  O  O   . ALA D 3 130 ? 12.357  -37.967  -46.221 1.00 22.47  ? 129 ALA L O   1 
ATOM   5482  C  CB  . ALA D 3 130 ? 10.668  -38.754  -48.635 1.00 19.69  ? 129 ALA L CB  1 
ATOM   5483  N  N   . SER D 3 131 ? 13.214  -39.981  -46.754 1.00 19.28  ? 130 SER L N   1 
ATOM   5484  C  CA  . SER D 3 131 ? 14.547  -39.673  -46.286 1.00 18.70  ? 130 SER L CA  1 
ATOM   5485  C  C   . SER D 3 131 ? 15.480  -39.613  -47.486 1.00 20.09  ? 130 SER L C   1 
ATOM   5486  O  O   . SER D 3 131 ? 15.475  -40.511  -48.333 1.00 20.20  ? 130 SER L O   1 
ATOM   5487  C  CB  . SER D 3 131 ? 15.021  -40.719  -45.274 1.00 17.11  ? 130 SER L CB  1 
ATOM   5488  O  OG  . SER D 3 131 ? 14.016  -40.960  -44.293 1.00 14.46  ? 130 SER L OG  1 
ATOM   5489  N  N   . VAL D 3 132 ? 16.250  -38.530  -47.571 1.00 22.01  ? 131 VAL L N   1 
ATOM   5490  C  CA  . VAL D 3 132 ? 17.294  -38.396  -48.578 1.00 22.50  ? 131 VAL L CA  1 
ATOM   5491  C  C   . VAL D 3 132 ? 18.636  -38.406  -47.851 1.00 22.92  ? 131 VAL L C   1 
ATOM   5492  O  O   . VAL D 3 132 ? 18.872  -37.612  -46.943 1.00 24.71  ? 131 VAL L O   1 
ATOM   5493  C  CB  . VAL D 3 132 ? 17.130  -37.094  -49.400 1.00 22.96  ? 131 VAL L CB  1 
ATOM   5494  C  CG1 . VAL D 3 132 ? 17.907  -37.188  -50.725 1.00 21.97  ? 131 VAL L CG1 1 
ATOM   5495  C  CG2 . VAL D 3 132 ? 15.653  -36.811  -49.656 1.00 22.33  ? 131 VAL L CG2 1 
ATOM   5496  N  N   . VAL D 3 133 ? 19.510  -39.325  -48.234 1.00 22.68  ? 132 VAL L N   1 
ATOM   5497  C  CA  . VAL D 3 133 ? 20.783  -39.488  -47.549 1.00 21.38  ? 132 VAL L CA  1 
ATOM   5498  C  C   . VAL D 3 133 ? 21.913  -39.007  -48.438 1.00 21.53  ? 132 VAL L C   1 
ATOM   5499  O  O   . VAL D 3 133 ? 21.963  -39.351  -49.620 1.00 20.90  ? 132 VAL L O   1 
ATOM   5500  C  CB  . VAL D 3 133 ? 21.021  -40.962  -47.151 1.00 20.92  ? 132 VAL L CB  1 
ATOM   5501  C  CG1 . VAL D 3 133 ? 22.375  -41.124  -46.445 1.00 18.01  ? 132 VAL L CG1 1 
ATOM   5502  C  CG2 . VAL D 3 133 ? 19.869  -41.456  -46.278 1.00 20.81  ? 132 VAL L CG2 1 
ATOM   5503  N  N   . CYS D 3 134 ? 22.803  -38.208  -47.846 1.00 22.52  ? 133 CYS L N   1 
ATOM   5504  C  CA  . CYS D 3 134 ? 24.030  -37.765  -48.471 1.00 24.06  ? 133 CYS L CA  1 
ATOM   5505  C  C   . CYS D 3 134 ? 25.192  -38.301  -47.660 1.00 23.23  ? 133 CYS L C   1 
ATOM   5506  O  O   . CYS D 3 134 ? 25.195  -38.166  -46.444 1.00 23.14  ? 133 CYS L O   1 
ATOM   5507  C  CB  . CYS D 3 134 ? 24.097  -36.248  -48.471 1.00 27.09  ? 133 CYS L CB  1 
ATOM   5508  S  SG  . CYS D 3 134 ? 25.442  -35.545  -49.438 1.00 30.66  ? 133 CYS L SG  1 
ATOM   5509  N  N   . LEU D 3 135 ? 26.174  -38.897  -48.338 1.00 22.55  ? 134 LEU L N   1 
ATOM   5510  C  CA  . LEU D 3 135 ? 27.301  -39.546  -47.685 1.00 21.32  ? 134 LEU L CA  1 
ATOM   5511  C  C   . LEU D 3 135 ? 28.602  -38.838  -48.035 1.00 21.28  ? 134 LEU L C   1 
ATOM   5512  O  O   . LEU D 3 135 ? 28.895  -38.610  -49.217 1.00 18.43  ? 134 LEU L O   1 
ATOM   5513  C  CB  . LEU D 3 135 ? 27.375  -40.996  -48.135 1.00 22.77  ? 134 LEU L CB  1 
ATOM   5514  C  CG  . LEU D 3 135 ? 28.600  -41.820  -47.731 1.00 24.06  ? 134 LEU L CG  1 
ATOM   5515  C  CD1 . LEU D 3 135 ? 28.681  -41.975  -46.195 1.00 24.47  ? 134 LEU L CD1 1 
ATOM   5516  C  CD2 . LEU D 3 135 ? 28.562  -43.175  -48.430 1.00 22.97  ? 134 LEU L CD2 1 
ATOM   5517  N  N   . LEU D 3 136 ? 29.365  -38.486  -46.998 1.00 19.75  ? 135 LEU L N   1 
ATOM   5518  C  CA  . LEU D 3 136 ? 30.721  -37.969  -47.150 1.00 18.21  ? 135 LEU L CA  1 
ATOM   5519  C  C   . LEU D 3 136 ? 31.661  -39.034  -46.619 1.00 18.73  ? 135 LEU L C   1 
ATOM   5520  O  O   . LEU D 3 136 ? 31.615  -39.376  -45.438 1.00 20.05  ? 135 LEU L O   1 
ATOM   5521  C  CB  . LEU D 3 136 ? 30.907  -36.664  -46.379 1.00 17.15  ? 135 LEU L CB  1 
ATOM   5522  C  CG  . LEU D 3 136 ? 30.246  -35.395  -46.927 1.00 16.83  ? 135 LEU L CG  1 
ATOM   5523  C  CD1 . LEU D 3 136 ? 28.710  -35.537  -47.073 1.00 15.16  ? 135 LEU L CD1 1 
ATOM   5524  C  CD2 . LEU D 3 136 ? 30.601  -34.189  -46.040 1.00 16.52  ? 135 LEU L CD2 1 
ATOM   5525  N  N   . ASN D 3 137 ? 32.502  -39.577  -47.491 1.00 18.33  ? 136 ASN L N   1 
ATOM   5526  C  CA  . ASN D 3 137 ? 33.283  -40.752  -47.148 1.00 19.07  ? 136 ASN L CA  1 
ATOM   5527  C  C   . ASN D 3 137 ? 34.788  -40.487  -47.062 1.00 18.31  ? 136 ASN L C   1 
ATOM   5528  O  O   . ASN D 3 137 ? 35.378  -39.926  -48.002 1.00 15.28  ? 136 ASN L O   1 
ATOM   5529  C  CB  . ASN D 3 137 ? 33.011  -41.846  -48.177 1.00 21.42  ? 136 ASN L CB  1 
ATOM   5530  C  CG  . ASN D 3 137 ? 32.996  -43.237  -47.574 1.00 23.35  ? 136 ASN L CG  1 
ATOM   5531  O  OD1 . ASN D 3 137 ? 32.542  -43.440  -46.452 1.00 23.88  ? 136 ASN L OD1 1 
ATOM   5532  N  ND2 . ASN D 3 137 ? 33.461  -44.213  -48.341 1.00 26.39  ? 136 ASN L ND2 1 
ATOM   5533  N  N   . ASN D 3 138 ? 35.382  -40.900  -45.930 1.00 16.79  ? 137 ASN L N   1 
ATOM   5534  C  CA  . ASN D 3 138 ? 36.838  -40.936  -45.727 1.00 17.19  ? 137 ASN L CA  1 
ATOM   5535  C  C   . ASN D 3 138 ? 37.540  -39.584  -45.922 1.00 16.92  ? 137 ASN L C   1 
ATOM   5536  O  O   . ASN D 3 138 ? 38.340  -39.395  -46.841 1.00 14.46  ? 137 ASN L O   1 
ATOM   5537  C  CB  . ASN D 3 138 ? 37.472  -41.990  -46.638 1.00 17.83  ? 137 ASN L CB  1 
ATOM   5538  C  CG  . ASN D 3 138 ? 36.930  -43.393  -46.384 1.00 19.28  ? 137 ASN L CG  1 
ATOM   5539  O  OD1 . ASN D 3 138 ? 36.850  -43.847  -45.250 1.00 21.70  ? 137 ASN L OD1 1 
ATOM   5540  N  ND2 . ASN D 3 138 ? 36.574  -44.082  -47.445 1.00 19.74  ? 137 ASN L ND2 1 
ATOM   5541  N  N   . PHE D 3 139 ? 37.249  -38.646  -45.040 1.00 15.90  ? 138 PHE L N   1 
ATOM   5542  C  CA  . PHE D 3 139 ? 37.852  -37.328  -45.134 1.00 15.39  ? 138 PHE L CA  1 
ATOM   5543  C  C   . PHE D 3 139 ? 38.575  -36.950  -43.838 1.00 15.87  ? 138 PHE L C   1 
ATOM   5544  O  O   . PHE D 3 139 ? 38.318  -37.518  -42.775 1.00 16.06  ? 138 PHE L O   1 
ATOM   5545  C  CB  . PHE D 3 139 ? 36.786  -36.291  -45.506 1.00 15.01  ? 138 PHE L CB  1 
ATOM   5546  C  CG  . PHE D 3 139 ? 35.644  -36.199  -44.522 1.00 15.04  ? 138 PHE L CG  1 
ATOM   5547  C  CD1 . PHE D 3 139 ? 35.696  -35.298  -43.471 1.00 15.87  ? 138 PHE L CD1 1 
ATOM   5548  C  CD2 . PHE D 3 139 ? 34.523  -37.013  -44.654 1.00 15.90  ? 138 PHE L CD2 1 
ATOM   5549  C  CE1 . PHE D 3 139 ? 34.653  -35.205  -42.554 1.00 16.88  ? 138 PHE L CE1 1 
ATOM   5550  C  CE2 . PHE D 3 139 ? 33.478  -36.935  -43.752 1.00 16.70  ? 138 PHE L CE2 1 
ATOM   5551  C  CZ  . PHE D 3 139 ? 33.535  -36.021  -42.699 1.00 17.89  ? 138 PHE L CZ  1 
ATOM   5552  N  N   . TYR D 3 140 ? 39.494  -35.996  -43.953 1.00 17.10  ? 139 TYR L N   1 
ATOM   5553  C  CA  . TYR D 3 140 ? 40.156  -35.383  -42.803 1.00 15.69  ? 139 TYR L CA  1 
ATOM   5554  C  C   . TYR D 3 140 ? 40.525  -33.949  -43.190 1.00 15.91  ? 139 TYR L C   1 
ATOM   5555  O  O   . TYR D 3 140 ? 40.995  -33.728  -44.298 1.00 13.89  ? 139 TYR L O   1 
ATOM   5556  C  CB  . TYR D 3 140 ? 41.422  -36.157  -42.385 1.00 16.05  ? 139 TYR L CB  1 
ATOM   5557  C  CG  . TYR D 3 140 ? 41.980  -35.630  -41.090 1.00 15.17  ? 139 TYR L CG  1 
ATOM   5558  C  CD1 . TYR D 3 140 ? 41.555  -36.144  -39.874 1.00 14.79  ? 139 TYR L CD1 1 
ATOM   5559  C  CD2 . TYR D 3 140 ? 42.867  -34.554  -41.076 1.00 14.67  ? 139 TYR L CD2 1 
ATOM   5560  C  CE1 . TYR D 3 140 ? 42.030  -35.638  -38.685 1.00 14.70  ? 139 TYR L CE1 1 
ATOM   5561  C  CE2 . TYR D 3 140 ? 43.348  -34.043  -39.889 1.00 14.38  ? 139 TYR L CE2 1 
ATOM   5562  C  CZ  . TYR D 3 140 ? 42.925  -34.591  -38.697 1.00 14.09  ? 139 TYR L CZ  1 
ATOM   5563  O  OH  . TYR D 3 140 ? 43.376  -34.082  -37.511 1.00 16.41  ? 139 TYR L OH  1 
ATOM   5564  N  N   . PRO D 3 141 ? 40.336  -32.972  -42.278 1.00 17.12  ? 140 PRO L N   1 
ATOM   5565  C  CA  . PRO D 3 141 ? 39.818  -33.080  -40.904 1.00 18.49  ? 140 PRO L CA  1 
ATOM   5566  C  C   . PRO D 3 141 ? 38.288  -33.194  -40.830 1.00 19.78  ? 140 PRO L C   1 
ATOM   5567  O  O   . PRO D 3 141 ? 37.608  -33.224  -41.864 1.00 19.11  ? 140 PRO L O   1 
ATOM   5568  C  CB  . PRO D 3 141 ? 40.306  -31.786  -40.249 1.00 18.20  ? 140 PRO L CB  1 
ATOM   5569  C  CG  . PRO D 3 141 ? 40.339  -30.804  -41.361 1.00 18.12  ? 140 PRO L CG  1 
ATOM   5570  C  CD  . PRO D 3 141 ? 40.714  -31.587  -42.607 1.00 17.36  ? 140 PRO L CD  1 
ATOM   5571  N  N   . ARG D 3 142 ? 37.780  -33.272  -39.603 1.00 21.90  ? 141 ARG L N   1 
ATOM   5572  C  CA  . ARG D 3 142 ? 36.367  -33.524  -39.323 1.00 24.47  ? 141 ARG L CA  1 
ATOM   5573  C  C   . ARG D 3 142 ? 35.422  -32.413  -39.786 1.00 23.89  ? 141 ARG L C   1 
ATOM   5574  O  O   . ARG D 3 142 ? 34.308  -32.708  -40.214 1.00 24.71  ? 141 ARG L O   1 
ATOM   5575  C  CB  . ARG D 3 142 ? 36.179  -33.790  -37.820 1.00 26.86  ? 141 ARG L CB  1 
ATOM   5576  C  CG  . ARG D 3 142 ? 34.744  -34.152  -37.381 1.00 29.90  ? 141 ARG L CG  1 
ATOM   5577  C  CD  . ARG D 3 142 ? 34.768  -35.132  -36.193 1.00 33.34  ? 141 ARG L CD  1 
ATOM   5578  N  NE  . ARG D 3 142 ? 33.572  -35.080  -35.344 1.00 36.35  ? 141 ARG L NE  1 
ATOM   5579  C  CZ  . ARG D 3 142 ? 33.102  -36.089  -34.592 1.00 38.68  ? 141 ARG L CZ  1 
ATOM   5580  N  NH1 . ARG D 3 142 ? 33.699  -37.289  -34.560 1.00 38.47  ? 141 ARG L NH1 1 
ATOM   5581  N  NH2 . ARG D 3 142 ? 32.000  -35.899  -33.864 1.00 39.34  ? 141 ARG L NH2 1 
ATOM   5582  N  N   . GLU D 3 143 ? 35.853  -31.153  -39.703 1.00 23.62  ? 142 GLU L N   1 
ATOM   5583  C  CA  . GLU D 3 143 ? 35.016  -30.018  -40.119 1.00 24.53  ? 142 GLU L CA  1 
ATOM   5584  C  C   . GLU D 3 143 ? 34.566  -30.191  -41.581 1.00 23.74  ? 142 GLU L C   1 
ATOM   5585  O  O   . GLU D 3 143 ? 35.387  -30.363  -42.478 1.00 23.15  ? 142 GLU L O   1 
ATOM   5586  C  CB  . GLU D 3 143 ? 35.751  -28.676  -39.930 1.00 25.80  ? 142 GLU L CB  1 
ATOM   5587  C  CG  . GLU D 3 143 ? 34.903  -27.436  -40.273 1.00 28.54  ? 142 GLU L CG  1 
ATOM   5588  C  CD  . GLU D 3 143 ? 35.692  -26.112  -40.291 1.00 31.87  ? 142 GLU L CD  1 
ATOM   5589  O  OE1 . GLU D 3 143 ? 36.927  -26.102  -40.054 1.00 33.63  ? 142 GLU L OE1 1 
ATOM   5590  O  OE2 . GLU D 3 143 ? 35.067  -25.058  -40.552 1.00 33.60  ? 142 GLU L OE2 1 
ATOM   5591  N  N   . ALA D 3 144 ? 33.257  -30.168  -41.791 1.00 23.34  ? 143 ALA L N   1 
ATOM   5592  C  CA  . ALA D 3 144 ? 32.660  -30.296  -43.117 1.00 24.49  ? 143 ALA L CA  1 
ATOM   5593  C  C   . ALA D 3 144 ? 31.300  -29.622  -43.108 1.00 24.87  ? 143 ALA L C   1 
ATOM   5594  O  O   . ALA D 3 144 ? 30.600  -29.655  -42.100 1.00 24.91  ? 143 ALA L O   1 
ATOM   5595  C  CB  . ALA D 3 144 ? 32.505  -31.754  -43.487 1.00 23.60  ? 143 ALA L CB  1 
ATOM   5596  N  N   . LYS D 3 145 ? 30.933  -29.002  -44.223 1.00 25.92  ? 144 LYS L N   1 
ATOM   5597  C  CA  . LYS D 3 145 ? 29.638  -28.345  -44.345 1.00 26.23  ? 144 LYS L CA  1 
ATOM   5598  C  C   . LYS D 3 145 ? 28.796  -29.042  -45.400 1.00 25.24  ? 144 LYS L C   1 
ATOM   5599  O  O   . LYS D 3 145 ? 29.257  -29.277  -46.520 1.00 25.16  ? 144 LYS L O   1 
ATOM   5600  C  CB  . LYS D 3 145 ? 29.815  -26.881  -44.715 1.00 28.75  ? 144 LYS L CB  1 
ATOM   5601  C  CG  . LYS D 3 145 ? 28.508  -26.101  -44.806 1.00 31.05  ? 144 LYS L CG  1 
ATOM   5602  C  CD  . LYS D 3 145 ? 28.746  -24.595  -44.746 1.00 32.87  ? 144 LYS L CD  1 
ATOM   5603  C  CE  . LYS D 3 145 ? 27.483  -23.824  -45.110 1.00 34.40  ? 144 LYS L CE  1 
ATOM   5604  N  NZ  . LYS D 3 145 ? 26.252  -24.419  -44.494 1.00 35.16  ? 144 LYS L NZ  1 
ATOM   5605  N  N   . VAL D 3 146 ? 27.564  -29.371  -45.029 1.00 23.81  ? 145 VAL L N   1 
ATOM   5606  C  CA  . VAL D 3 146 ? 26.618  -30.015  -45.934 1.00 24.60  ? 145 VAL L CA  1 
ATOM   5607  C  C   . VAL D 3 146 ? 25.359  -29.164  -46.039 1.00 23.83  ? 145 VAL L C   1 
ATOM   5608  O  O   . VAL D 3 146 ? 24.646  -29.001  -45.055 1.00 21.67  ? 145 VAL L O   1 
ATOM   5609  C  CB  . VAL D 3 146 ? 26.231  -31.432  -45.446 1.00 24.45  ? 145 VAL L CB  1 
ATOM   5610  C  CG1 . VAL D 3 146 ? 25.255  -32.073  -46.408 1.00 24.96  ? 145 VAL L CG1 1 
ATOM   5611  C  CG2 . VAL D 3 146 ? 27.474  -32.306  -45.281 1.00 24.48  ? 145 VAL L CG2 1 
ATOM   5612  N  N   . GLN D 3 147 ? 25.107  -28.617  -47.228 1.00 24.69  ? 146 GLN L N   1 
ATOM   5613  C  CA  . GLN D 3 147 ? 23.884  -27.867  -47.498 1.00 25.70  ? 146 GLN L CA  1 
ATOM   5614  C  C   . GLN D 3 147 ? 22.968  -28.646  -48.443 1.00 25.06  ? 146 GLN L C   1 
ATOM   5615  O  O   . GLN D 3 147 ? 23.413  -29.195  -49.449 1.00 25.20  ? 146 GLN L O   1 
ATOM   5616  C  CB  . GLN D 3 147 ? 24.201  -26.490  -48.092 1.00 27.02  ? 146 GLN L CB  1 
ATOM   5617  C  CG  . GLN D 3 147 ? 24.916  -25.566  -47.125 1.00 29.01  ? 146 GLN L CG  1 
ATOM   5618  C  CD  . GLN D 3 147 ? 24.586  -24.093  -47.343 1.00 30.55  ? 146 GLN L CD  1 
ATOM   5619  O  OE1 . GLN D 3 147 ? 23.788  -23.511  -46.602 1.00 31.32  ? 146 GLN L OE1 1 
ATOM   5620  N  NE2 . GLN D 3 147 ? 25.198  -23.486  -48.360 1.00 30.80  ? 146 GLN L NE2 1 
ATOM   5621  N  N   . TRP D 3 148 ? 21.684  -28.675  -48.106 1.00 24.19  ? 147 TRP L N   1 
ATOM   5622  C  CA  . TRP D 3 148 ? 20.667  -29.317  -48.925 1.00 22.79  ? 147 TRP L CA  1 
ATOM   5623  C  C   . TRP D 3 148 ? 19.886  -28.305  -49.761 1.00 22.90  ? 147 TRP L C   1 
ATOM   5624  O  O   . TRP D 3 148 ? 19.467  -27.262  -49.258 1.00 20.87  ? 147 TRP L O   1 
ATOM   5625  C  CB  . TRP D 3 148 ? 19.700  -30.066  -48.027 1.00 22.61  ? 147 TRP L CB  1 
ATOM   5626  C  CG  . TRP D 3 148 ? 20.247  -31.333  -47.527 1.00 23.37  ? 147 TRP L CG  1 
ATOM   5627  C  CD1 . TRP D 3 148 ? 20.793  -31.563  -46.300 1.00 24.32  ? 147 TRP L CD1 1 
ATOM   5628  C  CD2 . TRP D 3 148 ? 20.309  -32.570  -48.237 1.00 22.98  ? 147 TRP L CD2 1 
ATOM   5629  N  NE1 . TRP D 3 148 ? 21.185  -32.870  -46.200 1.00 24.69  ? 147 TRP L NE1 1 
ATOM   5630  C  CE2 . TRP D 3 148 ? 20.906  -33.513  -47.376 1.00 23.84  ? 147 TRP L CE2 1 
ATOM   5631  C  CE3 . TRP D 3 148 ? 19.915  -32.975  -49.517 1.00 22.86  ? 147 TRP L CE3 1 
ATOM   5632  C  CZ2 . TRP D 3 148 ? 21.109  -34.845  -47.747 1.00 23.11  ? 147 TRP L CZ2 1 
ATOM   5633  C  CZ3 . TRP D 3 148 ? 20.137  -34.298  -49.893 1.00 23.04  ? 147 TRP L CZ3 1 
ATOM   5634  C  CH2 . TRP D 3 148 ? 20.727  -35.214  -49.009 1.00 22.39  ? 147 TRP L CH2 1 
ATOM   5635  N  N   . LYS D 3 149 ? 19.679  -28.632  -51.033 1.00 24.35  ? 148 LYS L N   1 
ATOM   5636  C  CA  . LYS D 3 149 ? 18.869  -27.807  -51.927 1.00 24.85  ? 148 LYS L CA  1 
ATOM   5637  C  C   . LYS D 3 149 ? 17.767  -28.648  -52.590 1.00 25.44  ? 148 LYS L C   1 
ATOM   5638  O  O   . LYS D 3 149 ? 18.038  -29.725  -53.138 1.00 23.57  ? 148 LYS L O   1 
ATOM   5639  C  CB  . LYS D 3 149 ? 19.751  -27.141  -52.981 1.00 25.51  ? 148 LYS L CB  1 
ATOM   5640  C  CG  . LYS D 3 149 ? 20.396  -25.837  -52.518 1.00 26.83  ? 148 LYS L CG  1 
ATOM   5641  C  CD  . LYS D 3 149 ? 21.174  -25.149  -53.648 1.00 27.45  ? 148 LYS L CD  1 
ATOM   5642  C  CE  . LYS D 3 149 ? 21.421  -23.667  -53.342 1.00 28.48  ? 148 LYS L CE  1 
ATOM   5643  N  NZ  . LYS D 3 149 ? 22.217  -22.937  -54.399 1.00 28.06  ? 148 LYS L NZ  1 
ATOM   5644  N  N   . VAL D 3 150 ? 16.529  -28.156  -52.504 1.00 25.41  ? 149 VAL L N   1 
ATOM   5645  C  CA  . VAL D 3 150 ? 15.380  -28.779  -53.153 1.00 25.62  ? 149 VAL L CA  1 
ATOM   5646  C  C   . VAL D 3 150 ? 14.834  -27.805  -54.184 1.00 25.50  ? 149 VAL L C   1 
ATOM   5647  O  O   . VAL D 3 150 ? 14.406  -26.709  -53.831 1.00 26.53  ? 149 VAL L O   1 
ATOM   5648  C  CB  . VAL D 3 150 ? 14.289  -29.146  -52.132 1.00 25.67  ? 149 VAL L CB  1 
ATOM   5649  C  CG1 . VAL D 3 150 ? 13.029  -29.643  -52.843 1.00 23.93  ? 149 VAL L CG1 1 
ATOM   5650  C  CG2 . VAL D 3 150 ? 14.825  -30.199  -51.147 1.00 25.36  ? 149 VAL L CG2 1 
ATOM   5651  N  N   . ASP D 3 151 ? 14.863  -28.206  -55.455 1.00 26.00  ? 150 ASP L N   1 
ATOM   5652  C  CA  . ASP D 3 151 ? 14.621  -27.294  -56.590 1.00 26.14  ? 150 ASP L CA  1 
ATOM   5653  C  C   . ASP D 3 151 ? 15.406  -25.985  -56.429 1.00 26.80  ? 150 ASP L C   1 
ATOM   5654  O  O   . ASP D 3 151 ? 14.901  -24.897  -56.726 1.00 27.47  ? 150 ASP L O   1 
ATOM   5655  C  CB  . ASP D 3 151 ? 13.120  -27.012  -56.768 1.00 25.27  ? 150 ASP L CB  1 
ATOM   5656  C  CG  . ASP D 3 151 ? 12.337  -28.227  -57.263 1.00 24.95  ? 150 ASP L CG  1 
ATOM   5657  O  OD1 . ASP D 3 151 ? 12.886  -29.047  -58.034 1.00 25.00  ? 150 ASP L OD1 1 
ATOM   5658  O  OD2 . ASP D 3 151 ? 11.152  -28.352  -56.893 1.00 23.63  ? 150 ASP L OD2 1 
ATOM   5659  N  N   . ASN D 3 152 ? 16.642  -26.109  -55.947 1.00 27.79  ? 151 ASN L N   1 
ATOM   5660  C  CA  . ASN D 3 152 ? 17.555  -24.972  -55.730 1.00 28.43  ? 151 ASN L CA  1 
ATOM   5661  C  C   . ASN D 3 152 ? 17.154  -24.040  -54.565 1.00 28.54  ? 151 ASN L C   1 
ATOM   5662  O  O   . ASN D 3 152 ? 17.755  -22.980  -54.378 1.00 28.22  ? 151 ASN L O   1 
ATOM   5663  C  CB  . ASN D 3 152 ? 17.743  -24.172  -57.036 1.00 28.41  ? 151 ASN L CB  1 
ATOM   5664  C  CG  . ASN D 3 152 ? 19.143  -23.565  -57.169 1.00 28.73  ? 151 ASN L CG  1 
ATOM   5665  O  OD1 . ASN D 3 152 ? 19.930  -23.556  -56.224 1.00 28.51  ? 151 ASN L OD1 1 
ATOM   5666  N  ND2 . ASN D 3 152 ? 19.449  -23.052  -58.355 1.00 28.82  ? 151 ASN L ND2 1 
ATOM   5667  N  N   . ALA D 3 153 ? 16.146  -24.439  -53.788 1.00 28.73  ? 152 ALA L N   1 
ATOM   5668  C  CA  . ALA D 3 153 ? 15.793  -23.754  -52.546 1.00 27.67  ? 152 ALA L CA  1 
ATOM   5669  C  C   . ALA D 3 153 ? 16.607  -24.376  -51.410 1.00 27.42  ? 152 ALA L C   1 
ATOM   5670  O  O   . ALA D 3 153 ? 16.579  -25.589  -51.216 1.00 27.27  ? 152 ALA L O   1 
ATOM   5671  C  CB  . ALA D 3 153 ? 14.310  -23.893  -52.266 1.00 25.97  ? 152 ALA L CB  1 
ATOM   5672  N  N   . LEU D 3 154 ? 17.328  -23.536  -50.670 1.00 27.26  ? 153 LEU L N   1 
ATOM   5673  C  CA  . LEU D 3 154 ? 18.154  -23.985  -49.553 1.00 26.79  ? 153 LEU L CA  1 
ATOM   5674  C  C   . LEU D 3 154 ? 17.283  -24.443  -48.390 1.00 26.48  ? 153 LEU L C   1 
ATOM   5675  O  O   . LEU D 3 154 ? 16.334  -23.759  -48.003 1.00 26.13  ? 153 LEU L O   1 
ATOM   5676  C  CB  . LEU D 3 154 ? 19.093  -22.866  -49.093 1.00 27.07  ? 153 LEU L CB  1 
ATOM   5677  C  CG  . LEU D 3 154 ? 19.978  -23.140  -47.869 1.00 27.55  ? 153 LEU L CG  1 
ATOM   5678  C  CD1 . LEU D 3 154 ? 20.923  -24.325  -48.105 1.00 28.03  ? 153 LEU L CD1 1 
ATOM   5679  C  CD2 . LEU D 3 154 ? 20.760  -21.879  -47.495 1.00 27.02  ? 153 LEU L CD2 1 
ATOM   5680  N  N   . GLN D 3 155 ? 17.639  -25.596  -47.830 1.00 26.39  ? 154 GLN L N   1 
ATOM   5681  C  CA  . GLN D 3 155 ? 16.886  -26.229  -46.757 1.00 26.19  ? 154 GLN L CA  1 
ATOM   5682  C  C   . GLN D 3 155 ? 17.514  -25.932  -45.401 1.00 26.73  ? 154 GLN L C   1 
ATOM   5683  O  O   . GLN D 3 155 ? 18.724  -25.728  -45.312 1.00 29.38  ? 154 GLN L O   1 
ATOM   5684  C  CB  . GLN D 3 155 ? 16.855  -27.738  -46.994 1.00 25.46  ? 154 GLN L CB  1 
ATOM   5685  C  CG  . GLN D 3 155 ? 16.193  -28.131  -48.319 1.00 25.07  ? 154 GLN L CG  1 
ATOM   5686  C  CD  . GLN D 3 155 ? 14.711  -27.788  -48.352 1.00 23.51  ? 154 GLN L CD  1 
ATOM   5687  O  OE1 . GLN D 3 155 ? 13.924  -28.352  -47.595 1.00 22.68  ? 154 GLN L OE1 1 
ATOM   5688  N  NE2 . GLN D 3 155 ? 14.329  -26.863  -49.228 1.00 21.11  ? 154 GLN L NE2 1 
ATOM   5689  N  N   . SER D 3 156 ? 16.689  -25.890  -44.355 1.00 26.04  ? 155 SER L N   1 
ATOM   5690  C  CA  . SER D 3 156 ? 17.181  -25.729  -42.981 1.00 24.98  ? 155 SER L CA  1 
ATOM   5691  C  C   . SER D 3 156 ? 16.183  -26.247  -41.944 1.00 23.28  ? 155 SER L C   1 
ATOM   5692  O  O   . SER D 3 156 ? 14.974  -26.177  -42.144 1.00 23.33  ? 155 SER L O   1 
ATOM   5693  C  CB  . SER D 3 156 ? 17.528  -24.267  -42.698 1.00 25.45  ? 155 SER L CB  1 
ATOM   5694  O  OG  . SER D 3 156 ? 16.422  -23.432  -42.948 1.00 26.35  ? 155 SER L OG  1 
ATOM   5695  N  N   . GLY D 3 157 ? 16.705  -26.788  -40.846 1.00 21.76  ? 156 GLY L N   1 
ATOM   5696  C  CA  . GLY D 3 157 ? 15.878  -27.363  -39.786 1.00 20.74  ? 156 GLY L CA  1 
ATOM   5697  C  C   . GLY D 3 157 ? 15.348  -28.771  -40.043 1.00 21.19  ? 156 GLY L C   1 
ATOM   5698  O  O   . GLY D 3 157 ? 14.732  -29.358  -39.152 1.00 22.27  ? 156 GLY L O   1 
ATOM   5699  N  N   . ASN D 3 158 ? 15.590  -29.327  -41.234 1.00 18.75  ? 157 ASN L N   1 
ATOM   5700  C  CA  . ASN D 3 158 ? 15.019  -30.626  -41.614 1.00 19.27  ? 157 ASN L CA  1 
ATOM   5701  C  C   . ASN D 3 158 ? 16.068  -31.700  -41.977 1.00 18.46  ? 157 ASN L C   1 
ATOM   5702  O  O   . ASN D 3 158 ? 15.770  -32.659  -42.691 1.00 16.17  ? 157 ASN L O   1 
ATOM   5703  C  CB  . ASN D 3 158 ? 14.003  -30.441  -42.767 1.00 18.92  ? 157 ASN L CB  1 
ATOM   5704  C  CG  . ASN D 3 158 ? 14.617  -29.773  -43.992 1.00 17.71  ? 157 ASN L CG  1 
ATOM   5705  O  OD1 . ASN D 3 158 ? 15.736  -29.263  -43.933 1.00 18.36  ? 157 ASN L OD1 1 
ATOM   5706  N  ND2 . ASN D 3 158 ? 13.893  -29.778  -45.097 1.00 15.28  ? 157 ASN L ND2 1 
ATOM   5707  N  N   . SER D 3 159 ? 17.286  -31.540  -41.471 1.00 19.11  ? 158 SER L N   1 
ATOM   5708  C  CA  . SER D 3 159 ? 18.344  -32.525  -41.683 1.00 20.85  ? 158 SER L CA  1 
ATOM   5709  C  C   . SER D 3 159 ? 19.109  -32.816  -40.394 1.00 21.90  ? 158 SER L C   1 
ATOM   5710  O  O   . SER D 3 159 ? 19.240  -31.944  -39.533 1.00 21.53  ? 158 SER L O   1 
ATOM   5711  C  CB  . SER D 3 159 ? 19.316  -32.034  -42.754 1.00 22.07  ? 158 SER L CB  1 
ATOM   5712  O  OG  . SER D 3 159 ? 20.022  -30.891  -42.301 1.00 21.57  ? 158 SER L OG  1 
ATOM   5713  N  N   . GLN D 3 160 ? 19.608  -34.044  -40.270 1.00 22.35  ? 159 GLN L N   1 
ATOM   5714  C  CA  . GLN D 3 160 ? 20.452  -34.432  -39.140 1.00 23.45  ? 159 GLN L CA  1 
ATOM   5715  C  C   . GLN D 3 160 ? 21.741  -35.055  -39.653 1.00 23.20  ? 159 GLN L C   1 
ATOM   5716  O  O   . GLN D 3 160 ? 21.745  -35.781  -40.659 1.00 23.72  ? 159 GLN L O   1 
ATOM   5717  C  CB  . GLN D 3 160 ? 19.720  -35.414  -38.218 1.00 24.83  ? 159 GLN L CB  1 
ATOM   5718  C  CG  . GLN D 3 160 ? 18.788  -34.755  -37.210 1.00 26.59  ? 159 GLN L CG  1 
ATOM   5719  C  CD  . GLN D 3 160 ? 18.035  -35.761  -36.330 1.00 28.10  ? 159 GLN L CD  1 
ATOM   5720  O  OE1 . GLN D 3 160 ? 17.268  -36.594  -36.825 1.00 30.09  ? 159 GLN L OE1 1 
ATOM   5721  N  NE2 . GLN D 3 160 ? 18.234  -35.667  -35.018 1.00 28.10  ? 159 GLN L NE2 1 
ATOM   5722  N  N   . GLU D 3 161 ? 22.834  -34.765  -38.959 1.00 22.85  ? 160 GLU L N   1 
ATOM   5723  C  CA  . GLU D 3 161 ? 24.144  -35.291  -39.309 1.00 22.95  ? 160 GLU L CA  1 
ATOM   5724  C  C   . GLU D 3 161 ? 24.602  -36.335  -38.309 1.00 21.30  ? 160 GLU L C   1 
ATOM   5725  O  O   . GLU D 3 161 ? 24.157  -36.342  -37.167 1.00 21.01  ? 160 GLU L O   1 
ATOM   5726  C  CB  . GLU D 3 161 ? 25.165  -34.163  -39.358 1.00 25.09  ? 160 GLU L CB  1 
ATOM   5727  C  CG  . GLU D 3 161 ? 24.966  -33.214  -40.529 1.00 27.19  ? 160 GLU L CG  1 
ATOM   5728  C  CD  . GLU D 3 161 ? 26.159  -32.301  -40.753 1.00 28.97  ? 160 GLU L CD  1 
ATOM   5729  O  OE1 . GLU D 3 161 ? 27.106  -32.315  -39.926 1.00 31.49  ? 160 GLU L OE1 1 
ATOM   5730  O  OE2 . GLU D 3 161 ? 26.149  -31.561  -41.760 1.00 29.99  ? 160 GLU L OE2 1 
ATOM   5731  N  N   . SER D 3 162 ? 25.481  -37.227  -38.754 1.00 20.33  ? 161 SER L N   1 
ATOM   5732  C  CA  . SER D 3 162 ? 26.110  -38.192  -37.861 1.00 19.53  ? 161 SER L CA  1 
ATOM   5733  C  C   . SER D 3 162 ? 27.503  -38.529  -38.381 1.00 19.27  ? 161 SER L C   1 
ATOM   5734  O  O   . SER D 3 162 ? 27.675  -38.859  -39.568 1.00 18.99  ? 161 SER L O   1 
ATOM   5735  C  CB  . SER D 3 162 ? 25.250  -39.450  -37.735 1.00 20.54  ? 161 SER L CB  1 
ATOM   5736  O  OG  . SER D 3 162 ? 25.841  -40.387  -36.855 1.00 21.92  ? 161 SER L OG  1 
ATOM   5737  N  N   . VAL D 3 163 ? 28.494  -38.410  -37.495 1.00 17.76  ? 162 VAL L N   1 
ATOM   5738  C  CA  . VAL D 3 163 ? 29.891  -38.620  -37.848 1.00 17.33  ? 162 VAL L CA  1 
ATOM   5739  C  C   . VAL D 3 163 ? 30.415  -39.845  -37.119 1.00 16.59  ? 162 VAL L C   1 
ATOM   5740  O  O   . VAL D 3 163 ? 30.172  -40.027  -35.926 1.00 16.34  ? 162 VAL L O   1 
ATOM   5741  C  CB  . VAL D 3 163 ? 30.777  -37.392  -37.488 1.00 18.43  ? 162 VAL L CB  1 
ATOM   5742  C  CG1 . VAL D 3 163 ? 32.173  -37.521  -38.129 1.00 17.61  ? 162 VAL L CG1 1 
ATOM   5743  C  CG2 . VAL D 3 163 ? 30.120  -36.116  -37.940 1.00 18.38  ? 162 VAL L CG2 1 
ATOM   5744  N  N   . THR D 3 164 ? 31.125  -40.691  -37.850 1.00 17.15  ? 163 THR L N   1 
ATOM   5745  C  CA  . THR D 3 164 ? 31.786  -41.841  -37.262 1.00 18.63  ? 163 THR L CA  1 
ATOM   5746  C  C   . THR D 3 164 ? 32.944  -41.366  -36.397 1.00 19.13  ? 163 THR L C   1 
ATOM   5747  O  O   . THR D 3 164 ? 33.443  -40.249  -36.567 1.00 19.45  ? 163 THR L O   1 
ATOM   5748  C  CB  . THR D 3 164 ? 32.347  -42.778  -38.351 1.00 19.76  ? 163 THR L CB  1 
ATOM   5749  O  OG1 . THR D 3 164 ? 33.230  -42.043  -39.213 1.00 20.79  ? 163 THR L OG1 1 
ATOM   5750  C  CG2 . THR D 3 164 ? 31.217  -43.387  -39.186 1.00 20.84  ? 163 THR L CG2 1 
ATOM   5751  N  N   . GLU D 3 165 ? 33.366  -42.218  -35.469 1.00 19.63  ? 164 GLU L N   1 
ATOM   5752  C  CA  . GLU D 3 165 ? 34.639  -42.031  -34.787 1.00 20.99  ? 164 GLU L CA  1 
ATOM   5753  C  C   . GLU D 3 165 ? 35.777  -42.259  -35.779 1.00 20.56  ? 164 GLU L C   1 
ATOM   5754  O  O   . GLU D 3 165 ? 35.603  -42.906  -36.815 1.00 19.86  ? 164 GLU L O   1 
ATOM   5755  C  CB  . GLU D 3 165 ? 34.773  -42.977  -33.591 1.00 23.82  ? 164 GLU L CB  1 
ATOM   5756  C  CG  . GLU D 3 165 ? 33.846  -42.621  -32.410 1.00 27.28  ? 164 GLU L CG  1 
ATOM   5757  C  CD  . GLU D 3 165 ? 34.191  -41.270  -31.768 1.00 31.44  ? 164 GLU L CD  1 
ATOM   5758  O  OE1 . GLU D 3 165 ? 35.195  -41.188  -31.013 1.00 33.89  ? 164 GLU L OE1 1 
ATOM   5759  O  OE2 . GLU D 3 165 ? 33.457  -40.285  -32.020 1.00 33.68  ? 164 GLU L OE2 1 
ATOM   5760  N  N   . GLN D 3 166 ? 36.938  -41.707  -35.459 1.00 19.69  ? 165 GLN L N   1 
ATOM   5761  C  CA  . GLN D 3 166 ? 38.098  -41.790  -36.336 1.00 20.97  ? 165 GLN L CA  1 
ATOM   5762  C  C   . GLN D 3 166 ? 38.389  -43.243  -36.710 1.00 22.33  ? 165 GLN L C   1 
ATOM   5763  O  O   . GLN D 3 166 ? 38.416  -44.114  -35.853 1.00 21.45  ? 165 GLN L O   1 
ATOM   5764  C  CB  . GLN D 3 166 ? 39.313  -41.165  -35.650 1.00 20.84  ? 165 GLN L CB  1 
ATOM   5765  C  CG  . GLN D 3 166 ? 40.183  -40.407  -36.577 1.00 21.20  ? 165 GLN L CG  1 
ATOM   5766  C  CD  . GLN D 3 166 ? 41.129  -39.449  -35.904 1.00 19.61  ? 165 GLN L CD  1 
ATOM   5767  O  OE1 . GLN D 3 166 ? 41.316  -39.468  -34.694 1.00 20.13  ? 165 GLN L OE1 1 
ATOM   5768  N  NE2 . GLN D 3 166 ? 41.746  -38.605  -36.704 1.00 20.42  ? 165 GLN L NE2 1 
ATOM   5769  N  N   . ASP D 3 167 ? 38.581  -43.497  -38.000 1.00 24.49  ? 166 ASP L N   1 
ATOM   5770  C  CA  . ASP D 3 167 ? 38.880  -44.837  -38.488 1.00 24.53  ? 166 ASP L CA  1 
ATOM   5771  C  C   . ASP D 3 167 ? 40.169  -45.387  -37.865 1.00 25.62  ? 166 ASP L C   1 
ATOM   5772  O  O   . ASP D 3 167 ? 41.161  -44.668  -37.741 1.00 23.38  ? 166 ASP L O   1 
ATOM   5773  C  CB  . ASP D 3 167 ? 39.006  -44.799  -40.002 1.00 24.93  ? 166 ASP L CB  1 
ATOM   5774  C  CG  . ASP D 3 167 ? 39.261  -46.161  -40.598 1.00 26.37  ? 166 ASP L CG  1 
ATOM   5775  O  OD1 . ASP D 3 167 ? 40.399  -46.672  -40.466 1.00 28.14  ? 166 ASP L OD1 1 
ATOM   5776  O  OD2 . ASP D 3 167 ? 38.326  -46.712  -41.217 1.00 27.18  ? 166 ASP L OD2 1 
ATOM   5777  N  N   . SER D 3 168 ? 40.150  -46.665  -37.488 1.00 26.73  ? 167 SER L N   1 
ATOM   5778  C  CA  . SER D 3 168 ? 41.284  -47.266  -36.782 1.00 29.25  ? 167 SER L CA  1 
ATOM   5779  C  C   . SER D 3 168 ? 42.497  -47.434  -37.689 1.00 30.09  ? 167 SER L C   1 
ATOM   5780  O  O   . SER D 3 168 ? 43.633  -47.330  -37.235 1.00 30.07  ? 167 SER L O   1 
ATOM   5781  C  CB  . SER D 3 168 ? 40.902  -48.619  -36.164 1.00 29.90  ? 167 SER L CB  1 
ATOM   5782  O  OG  . SER D 3 168 ? 40.566  -49.575  -37.157 1.00 30.71  ? 167 SER L OG  1 
ATOM   5783  N  N   . LYS D 3 169 ? 42.261  -47.693  -38.969 1.00 30.83  ? 168 LYS L N   1 
ATOM   5784  C  CA  . LYS D 3 169 ? 43.363  -47.860  -39.903 1.00 32.06  ? 168 LYS L CA  1 
ATOM   5785  C  C   . LYS D 3 169 ? 43.873  -46.510  -40.399 1.00 29.80  ? 168 LYS L C   1 
ATOM   5786  O  O   . LYS D 3 169 ? 45.027  -46.168  -40.151 1.00 31.44  ? 168 LYS L O   1 
ATOM   5787  C  CB  . LYS D 3 169 ? 42.960  -48.764  -41.071 1.00 34.51  ? 168 LYS L CB  1 
ATOM   5788  C  CG  . LYS D 3 169 ? 42.635  -50.201  -40.646 1.00 36.05  ? 168 LYS L CG  1 
ATOM   5789  C  CD  . LYS D 3 169 ? 41.949  -50.980  -41.766 1.00 37.54  ? 168 LYS L CD  1 
ATOM   5790  C  CE  . LYS D 3 169 ? 41.503  -52.360  -41.299 1.00 38.28  ? 168 LYS L CE  1 
ATOM   5791  N  NZ  . LYS D 3 169 ? 42.650  -53.158  -40.765 1.00 38.89  ? 168 LYS L NZ  1 
ATOM   5792  N  N   . ASP D 3 170 ? 43.012  -45.734  -41.055 1.00 26.86  ? 169 ASP L N   1 
ATOM   5793  C  CA  . ASP D 3 170 ? 43.460  -44.539  -41.783 1.00 24.17  ? 169 ASP L CA  1 
ATOM   5794  C  C   . ASP D 3 170 ? 43.202  -43.192  -41.098 1.00 21.29  ? 169 ASP L C   1 
ATOM   5795  O  O   . ASP D 3 170 ? 43.561  -42.166  -41.645 1.00 20.45  ? 169 ASP L O   1 
ATOM   5796  C  CB  . ASP D 3 170 ? 42.880  -44.531  -43.210 1.00 24.91  ? 169 ASP L CB  1 
ATOM   5797  C  CG  . ASP D 3 170 ? 41.360  -44.358  -43.253 1.00 26.23  ? 169 ASP L CG  1 
ATOM   5798  O  OD1 . ASP D 3 170 ? 40.757  -43.803  -42.314 1.00 25.65  ? 169 ASP L OD1 1 
ATOM   5799  O  OD2 . ASP D 3 170 ? 40.760  -44.764  -44.269 1.00 28.27  ? 169 ASP L OD2 1 
ATOM   5800  N  N   . SER D 3 171 ? 42.568  -43.201  -39.929 1.00 18.96  ? 170 SER L N   1 
ATOM   5801  C  CA  . SER D 3 171 ? 42.286  -41.996  -39.134 1.00 17.07  ? 170 SER L CA  1 
ATOM   5802  C  C   . SER D 3 171 ? 41.336  -40.975  -39.781 1.00 17.19  ? 170 SER L C   1 
ATOM   5803  O  O   . SER D 3 171 ? 41.226  -39.831  -39.312 1.00 17.09  ? 170 SER L O   1 
ATOM   5804  C  CB  . SER D 3 171 ? 43.577  -41.293  -38.695 1.00 18.18  ? 170 SER L CB  1 
ATOM   5805  O  OG  . SER D 3 171 ? 44.434  -42.157  -37.970 1.00 19.60  ? 170 SER L OG  1 
ATOM   5806  N  N   . THR D 3 172 ? 40.630  -41.379  -40.829 1.00 17.45  ? 171 THR L N   1 
ATOM   5807  C  CA  . THR D 3 172 ? 39.652  -40.503  -41.483 1.00 16.42  ? 171 THR L CA  1 
ATOM   5808  C  C   . THR D 3 172 ? 38.308  -40.556  -40.765 1.00 16.18  ? 171 THR L C   1 
ATOM   5809  O  O   . THR D 3 172 ? 38.068  -41.421  -39.917 1.00 16.56  ? 171 THR L O   1 
ATOM   5810  C  CB  . THR D 3 172 ? 39.439  -40.898  -42.950 1.00 16.48  ? 171 THR L CB  1 
ATOM   5811  O  OG1 . THR D 3 172 ? 38.846  -42.205  -43.016 1.00 15.60  ? 171 THR L OG1 1 
ATOM   5812  C  CG2 . THR D 3 172 ? 40.778  -40.879  -43.722 1.00 14.03  ? 171 THR L CG2 1 
ATOM   5813  N  N   . TYR D 3 173 ? 37.452  -39.594  -41.092 1.00 16.65  ? 172 TYR L N   1 
ATOM   5814  C  CA  . TYR D 3 173 ? 36.070  -39.574  -40.645 1.00 16.45  ? 172 TYR L CA  1 
ATOM   5815  C  C   . TYR D 3 173 ? 35.143  -39.825  -41.840 1.00 18.17  ? 172 TYR L C   1 
ATOM   5816  O  O   . TYR D 3 173 ? 35.533  -39.621  -43.006 1.00 18.51  ? 172 TYR L O   1 
ATOM   5817  C  CB  . TYR D 3 173 ? 35.728  -38.221  -40.011 1.00 17.42  ? 172 TYR L CB  1 
ATOM   5818  C  CG  . TYR D 3 173 ? 36.552  -37.897  -38.795 1.00 18.22  ? 172 TYR L CG  1 
ATOM   5819  C  CD1 . TYR D 3 173 ? 36.150  -38.317  -37.522 1.00 19.05  ? 172 TYR L CD1 1 
ATOM   5820  C  CD2 . TYR D 3 173 ? 37.737  -37.178  -38.906 1.00 18.11  ? 172 TYR L CD2 1 
ATOM   5821  C  CE1 . TYR D 3 173 ? 36.914  -38.024  -36.389 1.00 18.13  ? 172 TYR L CE1 1 
ATOM   5822  C  CE2 . TYR D 3 173 ? 38.498  -36.887  -37.792 1.00 18.82  ? 172 TYR L CE2 1 
ATOM   5823  C  CZ  . TYR D 3 173 ? 38.083  -37.314  -36.533 1.00 19.21  ? 172 TYR L CZ  1 
ATOM   5824  O  OH  . TYR D 3 173 ? 38.854  -37.023  -35.427 1.00 21.75  ? 172 TYR L OH  1 
ATOM   5825  N  N   . SER D 3 174 ? 33.930  -40.287  -41.541 1.00 16.72  ? 173 SER L N   1 
ATOM   5826  C  CA  . SER D 3 174 ? 32.852  -40.353  -42.522 1.00 17.04  ? 173 SER L CA  1 
ATOM   5827  C  C   . SER D 3 174 ? 31.608  -39.705  -41.906 1.00 17.25  ? 173 SER L C   1 
ATOM   5828  O  O   . SER D 3 174 ? 31.453  -39.659  -40.689 1.00 18.19  ? 173 SER L O   1 
ATOM   5829  C  CB  . SER D 3 174 ? 32.570  -41.802  -42.956 1.00 17.08  ? 173 SER L CB  1 
ATOM   5830  O  OG  . SER D 3 174 ? 33.584  -42.307  -43.809 1.00 15.01  ? 173 SER L OG  1 
ATOM   5831  N  N   . LEU D 3 175 ? 30.730  -39.199  -42.754 1.00 17.41  ? 174 LEU L N   1 
ATOM   5832  C  CA  . LEU D 3 175 ? 29.581  -38.449  -42.295 1.00 19.12  ? 174 LEU L CA  1 
ATOM   5833  C  C   . LEU D 3 175 ? 28.347  -38.726  -43.167 1.00 20.41  ? 174 LEU L C   1 
ATOM   5834  O  O   . LEU D 3 175 ? 28.446  -38.845  -44.398 1.00 21.07  ? 174 LEU L O   1 
ATOM   5835  C  CB  . LEU D 3 175 ? 29.927  -36.954  -42.285 1.00 18.98  ? 174 LEU L CB  1 
ATOM   5836  C  CG  . LEU D 3 175 ? 28.850  -35.962  -41.839 1.00 19.05  ? 174 LEU L CG  1 
ATOM   5837  C  CD1 . LEU D 3 175 ? 29.496  -34.742  -41.186 1.00 18.21  ? 174 LEU L CD1 1 
ATOM   5838  C  CD2 . LEU D 3 175 ? 27.909  -35.555  -42.996 1.00 18.78  ? 174 LEU L CD2 1 
ATOM   5839  N  N   . SER D 3 176 ? 27.200  -38.869  -42.503 1.00 21.31  ? 175 SER L N   1 
ATOM   5840  C  CA  . SER D 3 176 ? 25.894  -38.960  -43.161 1.00 20.78  ? 175 SER L CA  1 
ATOM   5841  C  C   . SER D 3 176 ? 25.117  -37.701  -42.811 1.00 20.61  ? 175 SER L C   1 
ATOM   5842  O  O   . SER D 3 176 ? 25.124  -37.252  -41.657 1.00 21.04  ? 175 SER L O   1 
ATOM   5843  C  CB  . SER D 3 176 ? 25.117  -40.208  -42.705 1.00 21.04  ? 175 SER L CB  1 
ATOM   5844  O  OG  . SER D 3 176 ? 24.576  -40.080  -41.382 1.00 21.82  ? 175 SER L OG  1 
ATOM   5845  N  N   . SER D 3 177 ? 24.495  -37.104  -43.817 1.00 20.36  ? 176 SER L N   1 
ATOM   5846  C  CA  . SER D 3 177 ? 23.506  -36.058  -43.595 1.00 20.84  ? 176 SER L CA  1 
ATOM   5847  C  C   . SER D 3 177 ? 22.187  -36.576  -44.148 1.00 20.04  ? 176 SER L C   1 
ATOM   5848  O  O   . SER D 3 177 ? 22.116  -37.007  -45.304 1.00 20.07  ? 176 SER L O   1 
ATOM   5849  C  CB  . SER D 3 177 ? 23.905  -34.767  -44.294 1.00 21.80  ? 176 SER L CB  1 
ATOM   5850  O  OG  . SER D 3 177 ? 22.895  -33.794  -44.128 1.00 22.96  ? 176 SER L OG  1 
ATOM   5851  N  N   . THR D 3 178 ? 21.154  -36.572  -43.316 1.00 18.70  ? 177 THR L N   1 
ATOM   5852  C  CA  . THR D 3 178 ? 19.869  -37.127  -43.715 1.00 17.23  ? 177 THR L CA  1 
ATOM   5853  C  C   . THR D 3 178 ? 18.824  -36.023  -43.715 1.00 16.91  ? 177 THR L C   1 
ATOM   5854  O  O   . THR D 3 178 ? 18.608  -35.383  -42.704 1.00 16.79  ? 177 THR L O   1 
ATOM   5855  C  CB  . THR D 3 178 ? 19.462  -38.297  -42.806 1.00 16.41  ? 177 THR L CB  1 
ATOM   5856  O  OG1 . THR D 3 178 ? 20.503  -39.285  -42.825 1.00 17.00  ? 177 THR L OG1 1 
ATOM   5857  C  CG2 . THR D 3 178 ? 18.178  -38.927  -43.280 1.00 14.64  ? 177 THR L CG2 1 
ATOM   5858  N  N   . LEU D 3 179 ? 18.230  -35.793  -44.887 1.00 17.74  ? 178 LEU L N   1 
ATOM   5859  C  CA  . LEU D 3 179 ? 17.141  -34.848  -45.089 1.00 18.21  ? 178 LEU L CA  1 
ATOM   5860  C  C   . LEU D 3 179 ? 15.816  -35.584  -44.936 1.00 19.30  ? 178 LEU L C   1 
ATOM   5861  O  O   . LEU D 3 179 ? 15.584  -36.602  -45.607 1.00 19.02  ? 178 LEU L O   1 
ATOM   5862  C  CB  . LEU D 3 179 ? 17.227  -34.247  -46.498 1.00 17.28  ? 178 LEU L CB  1 
ATOM   5863  C  CG  . LEU D 3 179 ? 16.212  -33.161  -46.874 1.00 16.76  ? 178 LEU L CG  1 
ATOM   5864  C  CD1 . LEU D 3 179 ? 16.350  -31.938  -45.956 1.00 15.14  ? 178 LEU L CD1 1 
ATOM   5865  C  CD2 . LEU D 3 179 ? 16.369  -32.761  -48.340 1.00 14.74  ? 178 LEU L CD2 1 
ATOM   5866  N  N   . THR D 3 180 ? 14.957  -35.075  -44.056 1.00 19.46  ? 179 THR L N   1 
ATOM   5867  C  CA  . THR D 3 180 ? 13.657  -35.686  -43.797 1.00 20.01  ? 179 THR L CA  1 
ATOM   5868  C  C   . THR D 3 180 ? 12.544  -34.778  -44.301 1.00 19.38  ? 179 THR L C   1 
ATOM   5869  O  O   . THR D 3 180 ? 12.451  -33.622  -43.906 1.00 18.63  ? 179 THR L O   1 
ATOM   5870  C  CB  . THR D 3 180 ? 13.444  -35.980  -42.301 1.00 19.86  ? 179 THR L CB  1 
ATOM   5871  O  OG1 . THR D 3 180 ? 14.481  -36.856  -41.847 1.00 20.70  ? 179 THR L OG1 1 
ATOM   5872  C  CG2 . THR D 3 180 ? 12.071  -36.662  -42.065 1.00 18.29  ? 179 THR L CG2 1 
ATOM   5873  N  N   . LEU D 3 181 ? 11.718  -35.321  -45.191 1.00 18.88  ? 180 LEU L N   1 
ATOM   5874  C  CA  . LEU D 3 181 ? 10.593  -34.596  -45.767 1.00 19.30  ? 180 LEU L CA  1 
ATOM   5875  C  C   . LEU D 3 181 ? 9.354   -35.455  -45.651 1.00 17.68  ? 180 LEU L C   1 
ATOM   5876  O  O   . LEU D 3 181 ? 9.448   -36.669  -45.451 1.00 17.95  ? 180 LEU L O   1 
ATOM   5877  C  CB  . LEU D 3 181 ? 10.847  -34.301  -47.249 1.00 19.90  ? 180 LEU L CB  1 
ATOM   5878  C  CG  . LEU D 3 181 ? 12.154  -33.591  -47.593 1.00 20.56  ? 180 LEU L CG  1 
ATOM   5879  C  CD1 . LEU D 3 181 ? 12.481  -33.773  -49.066 1.00 20.11  ? 180 LEU L CD1 1 
ATOM   5880  C  CD2 . LEU D 3 181 ? 12.071  -32.114  -47.219 1.00 20.22  ? 180 LEU L CD2 1 
ATOM   5881  N  N   . SER D 3 182 ? 8.196   -34.825  -45.782 1.00 16.15  ? 181 SER L N   1 
ATOM   5882  C  CA  . SER D 3 182 ? 6.955   -35.562  -45.976 1.00 15.93  ? 181 SER L CA  1 
ATOM   5883  C  C   . SER D 3 182 ? 6.951   -36.059  -47.417 1.00 16.41  ? 181 SER L C   1 
ATOM   5884  O  O   . SER D 3 182 ? 7.573   -35.446  -48.292 1.00 16.69  ? 181 SER L O   1 
ATOM   5885  C  CB  . SER D 3 182 ? 5.744   -34.665  -45.717 1.00 15.52  ? 181 SER L CB  1 
ATOM   5886  O  OG  . SER D 3 182 ? 5.653   -33.621  -46.676 1.00 14.89  ? 181 SER L OG  1 
ATOM   5887  N  N   . LYS D 3 183 ? 6.279   -37.177  -47.663 1.00 16.88  ? 182 LYS L N   1 
ATOM   5888  C  CA  . LYS D 3 183 ? 6.108   -37.672  -49.023 1.00 17.45  ? 182 LYS L CA  1 
ATOM   5889  C  C   . LYS D 3 183 ? 5.431   -36.616  -49.901 1.00 17.86  ? 182 LYS L C   1 
ATOM   5890  O  O   . LYS D 3 183 ? 5.805   -36.445  -51.062 1.00 18.58  ? 182 LYS L O   1 
ATOM   5891  C  CB  . LYS D 3 183 ? 5.283   -38.965  -49.046 1.00 17.84  ? 182 LYS L CB  1 
ATOM   5892  C  CG  . LYS D 3 183 ? 4.871   -39.395  -50.465 1.00 18.13  ? 182 LYS L CG  1 
ATOM   5893  C  CD  . LYS D 3 183 ? 4.465   -40.847  -50.534 1.00 18.45  ? 182 LYS L CD  1 
ATOM   5894  C  CE  . LYS D 3 183 ? 3.033   -41.070  -50.082 1.00 17.25  ? 182 LYS L CE  1 
ATOM   5895  N  NZ  . LYS D 3 183 ? 2.766   -42.524  -49.832 1.00 16.86  ? 182 LYS L NZ  1 
ATOM   5896  N  N   . ALA D 3 184 ? 4.435   -35.926  -49.346 1.00 18.04  ? 183 ALA L N   1 
ATOM   5897  C  CA  . ALA D 3 184 ? 3.748   -34.839  -50.051 1.00 18.81  ? 183 ALA L CA  1 
ATOM   5898  C  C   . ALA D 3 184 ? 4.735   -33.779  -50.544 1.00 19.60  ? 183 ALA L C   1 
ATOM   5899  O  O   . ALA D 3 184 ? 4.732   -33.429  -51.724 1.00 19.24  ? 183 ALA L O   1 
ATOM   5900  C  CB  . ALA D 3 184 ? 2.708   -34.202  -49.156 1.00 18.31  ? 183 ALA L CB  1 
ATOM   5901  N  N   . ASP D 3 185 ? 5.580   -33.283  -49.641 1.00 19.42  ? 184 ASP L N   1 
ATOM   5902  C  CA  . ASP D 3 185 ? 6.606   -32.306  -50.003 1.00 20.61  ? 184 ASP L CA  1 
ATOM   5903  C  C   . ASP D 3 185 ? 7.610   -32.884  -51.006 1.00 20.03  ? 184 ASP L C   1 
ATOM   5904  O  O   . ASP D 3 185 ? 7.985   -32.217  -51.972 1.00 19.37  ? 184 ASP L O   1 
ATOM   5905  C  CB  . ASP D 3 185 ? 7.361   -31.812  -48.758 1.00 22.62  ? 184 ASP L CB  1 
ATOM   5906  C  CG  . ASP D 3 185 ? 6.586   -30.766  -47.958 1.00 24.93  ? 184 ASP L CG  1 
ATOM   5907  O  OD1 . ASP D 3 185 ? 5.348   -30.613  -48.118 1.00 26.68  ? 184 ASP L OD1 1 
ATOM   5908  O  OD2 . ASP D 3 185 ? 7.234   -30.080  -47.144 1.00 26.64  ? 184 ASP L OD2 1 
ATOM   5909  N  N   . TYR D 3 186 ? 8.048   -34.121  -50.768 1.00 19.36  ? 185 TYR L N   1 
ATOM   5910  C  CA  . TYR D 3 186 ? 9.018   -34.777  -51.649 1.00 18.08  ? 185 TYR L CA  1 
ATOM   5911  C  C   . TYR D 3 186 ? 8.487   -34.893  -53.080 1.00 17.90  ? 185 TYR L C   1 
ATOM   5912  O  O   . TYR D 3 186 ? 9.208   -34.637  -54.048 1.00 15.36  ? 185 TYR L O   1 
ATOM   5913  C  CB  . TYR D 3 186 ? 9.401   -36.158  -51.107 1.00 17.77  ? 185 TYR L CB  1 
ATOM   5914  C  CG  . TYR D 3 186 ? 10.314  -36.946  -52.026 1.00 17.98  ? 185 TYR L CG  1 
ATOM   5915  C  CD1 . TYR D 3 186 ? 11.658  -36.624  -52.147 1.00 17.49  ? 185 TYR L CD1 1 
ATOM   5916  C  CD2 . TYR D 3 186 ? 9.826   -38.015  -52.782 1.00 18.57  ? 185 TYR L CD2 1 
ATOM   5917  C  CE1 . TYR D 3 186 ? 12.497  -37.342  -52.995 1.00 17.63  ? 185 TYR L CE1 1 
ATOM   5918  C  CE2 . TYR D 3 186 ? 10.660  -38.737  -53.629 1.00 18.24  ? 185 TYR L CE2 1 
ATOM   5919  C  CZ  . TYR D 3 186 ? 11.991  -38.393  -53.732 1.00 17.13  ? 185 TYR L CZ  1 
ATOM   5920  O  OH  . TYR D 3 186 ? 12.810  -39.098  -54.579 1.00 16.43  ? 185 TYR L OH  1 
ATOM   5921  N  N   . GLU D 3 187 ? 7.215   -35.251  -53.206 1.00 18.95  ? 186 GLU L N   1 
ATOM   5922  C  CA  . GLU D 3 187 ? 6.619   -35.451  -54.524 1.00 20.56  ? 186 GLU L CA  1 
ATOM   5923  C  C   . GLU D 3 187 ? 6.254   -34.143  -55.241 1.00 20.46  ? 186 GLU L C   1 
ATOM   5924  O  O   . GLU D 3 187 ? 5.924   -34.167  -56.427 1.00 20.69  ? 186 GLU L O   1 
ATOM   5925  C  CB  . GLU D 3 187 ? 5.432   -36.422  -54.433 1.00 20.75  ? 186 GLU L CB  1 
ATOM   5926  C  CG  . GLU D 3 187 ? 5.908   -37.869  -54.215 1.00 21.65  ? 186 GLU L CG  1 
ATOM   5927  C  CD  . GLU D 3 187 ? 4.777   -38.887  -54.104 1.00 22.83  ? 186 GLU L CD  1 
ATOM   5928  O  OE1 . GLU D 3 187 ? 3.605   -38.469  -53.953 1.00 24.50  ? 186 GLU L OE1 1 
ATOM   5929  O  OE2 . GLU D 3 187 ? 5.063   -40.109  -54.164 1.00 21.37  ? 186 GLU L OE2 1 
ATOM   5930  N  N   . LYS D 3 188 ? 6.343   -33.013  -54.537 1.00 20.41  ? 187 LYS L N   1 
ATOM   5931  C  CA  . LYS D 3 188 ? 6.117   -31.692  -55.143 1.00 21.31  ? 187 LYS L CA  1 
ATOM   5932  C  C   . LYS D 3 188 ? 7.313   -31.181  -55.947 1.00 20.50  ? 187 LYS L C   1 
ATOM   5933  O  O   . LYS D 3 188 ? 7.161   -30.277  -56.767 1.00 21.86  ? 187 LYS L O   1 
ATOM   5934  C  CB  . LYS D 3 188 ? 5.793   -30.643  -54.066 1.00 22.75  ? 187 LYS L CB  1 
ATOM   5935  C  CG  . LYS D 3 188 ? 4.375   -30.666  -53.541 1.00 24.16  ? 187 LYS L CG  1 
ATOM   5936  C  CD  . LYS D 3 188 ? 4.196   -29.663  -52.398 1.00 25.40  ? 187 LYS L CD  1 
ATOM   5937  C  CE  . LYS D 3 188 ? 2.733   -29.583  -51.943 1.00 26.74  ? 187 LYS L CE  1 
ATOM   5938  N  NZ  . LYS D 3 188 ? 2.383   -28.248  -51.347 1.00 27.39  ? 187 LYS L NZ  1 
ATOM   5939  N  N   . HIS D 3 189 ? 8.495   -31.738  -55.703 1.00 19.13  ? 188 HIS L N   1 
ATOM   5940  C  CA  . HIS D 3 189 ? 9.743   -31.163  -56.206 1.00 17.87  ? 188 HIS L CA  1 
ATOM   5941  C  C   . HIS D 3 189 ? 10.559  -32.166  -57.015 1.00 15.80  ? 188 HIS L C   1 
ATOM   5942  O  O   . HIS D 3 189 ? 10.356  -33.367  -56.898 1.00 16.20  ? 188 HIS L O   1 
ATOM   5943  C  CB  . HIS D 3 189 ? 10.552  -30.621  -55.028 1.00 18.73  ? 188 HIS L CB  1 
ATOM   5944  C  CG  . HIS D 3 189 ? 9.831   -29.561  -54.256 1.00 19.65  ? 188 HIS L CG  1 
ATOM   5945  N  ND1 . HIS D 3 189 ? 9.454   -28.359  -54.818 1.00 20.79  ? 188 HIS L ND1 1 
ATOM   5946  C  CD2 . HIS D 3 189 ? 9.391   -29.531  -52.976 1.00 20.24  ? 188 HIS L CD2 1 
ATOM   5947  C  CE1 . HIS D 3 189 ? 8.817   -27.632  -53.917 1.00 20.86  ? 188 HIS L CE1 1 
ATOM   5948  N  NE2 . HIS D 3 189 ? 8.766   -28.320  -52.790 1.00 21.41  ? 188 HIS L NE2 1 
ATOM   5949  N  N   . LYS D 3 190 ? 11.480  -31.656  -57.828 1.00 13.86  ? 189 LYS L N   1 
ATOM   5950  C  CA  . LYS D 3 190 ? 12.224  -32.462  -58.791 1.00 13.28  ? 189 LYS L CA  1 
ATOM   5951  C  C   . LYS D 3 190 ? 13.706  -32.619  -58.430 1.00 12.99  ? 189 LYS L C   1 
ATOM   5952  O  O   . LYS D 3 190 ? 14.174  -33.741  -58.248 1.00 12.80  ? 189 LYS L O   1 
ATOM   5953  C  CB  . LYS D 3 190 ? 12.086  -31.845  -60.184 1.00 14.38  ? 189 LYS L CB  1 
ATOM   5954  C  CG  . LYS D 3 190 ? 12.835  -32.581  -61.291 1.00 15.93  ? 189 LYS L CG  1 
ATOM   5955  C  CD  . LYS D 3 190 ? 12.522  -31.979  -62.658 1.00 17.38  ? 189 LYS L CD  1 
ATOM   5956  C  CE  . LYS D 3 190 ? 13.607  -32.294  -63.685 1.00 18.41  ? 189 LYS L CE  1 
ATOM   5957  N  NZ  . LYS D 3 190 ? 13.205  -31.914  -65.074 1.00 18.99  ? 189 LYS L NZ  1 
ATOM   5958  N  N   . VAL D 3 191 ? 14.440  -31.508  -58.328 1.00 11.71  ? 190 VAL L N   1 
ATOM   5959  C  CA  . VAL D 3 191 ? 15.888  -31.568  -58.077 1.00 11.81  ? 190 VAL L CA  1 
ATOM   5960  C  C   . VAL D 3 191 ? 16.256  -31.584  -56.583 1.00 12.83  ? 190 VAL L C   1 
ATOM   5961  O  O   . VAL D 3 191 ? 15.971  -30.637  -55.852 1.00 11.87  ? 190 VAL L O   1 
ATOM   5962  C  CB  . VAL D 3 191 ? 16.655  -30.395  -58.744 1.00 10.35  ? 190 VAL L CB  1 
ATOM   5963  C  CG1 . VAL D 3 191 ? 18.168  -30.652  -58.655 1.00 7.33   ? 190 VAL L CG1 1 
ATOM   5964  C  CG2 . VAL D 3 191 ? 16.216  -30.219  -60.200 1.00 8.18   ? 190 VAL L CG2 1 
ATOM   5965  N  N   . TYR D 3 192 ? 16.904  -32.664  -56.150 1.00 13.42  ? 191 TYR L N   1 
ATOM   5966  C  CA  . TYR D 3 192 ? 17.394  -32.784  -54.786 1.00 13.82  ? 191 TYR L CA  1 
ATOM   5967  C  C   . TYR D 3 192 ? 18.904  -32.804  -54.858 1.00 14.97  ? 191 TYR L C   1 
ATOM   5968  O  O   . TYR D 3 192 ? 19.473  -33.596  -55.601 1.00 15.40  ? 191 TYR L O   1 
ATOM   5969  C  CB  . TYR D 3 192 ? 16.831  -34.042  -54.119 1.00 13.96  ? 191 TYR L CB  1 
ATOM   5970  C  CG  . TYR D 3 192 ? 15.337  -33.930  -53.935 1.00 14.42  ? 191 TYR L CG  1 
ATOM   5971  C  CD1 . TYR D 3 192 ? 14.798  -33.483  -52.731 1.00 15.12  ? 191 TYR L CD1 1 
ATOM   5972  C  CD2 . TYR D 3 192 ? 14.465  -34.206  -54.986 1.00 14.16  ? 191 TYR L CD2 1 
ATOM   5973  C  CE1 . TYR D 3 192 ? 13.426  -33.335  -52.571 1.00 14.93  ? 191 TYR L CE1 1 
ATOM   5974  C  CE2 . TYR D 3 192 ? 13.095  -34.057  -54.836 1.00 14.30  ? 191 TYR L CE2 1 
ATOM   5975  C  CZ  . TYR D 3 192 ? 12.588  -33.626  -53.625 1.00 14.72  ? 191 TYR L CZ  1 
ATOM   5976  O  OH  . TYR D 3 192 ? 11.245  -33.493  -53.460 1.00 16.01  ? 191 TYR L OH  1 
ATOM   5977  N  N   . ALA D 3 193 ? 19.542  -31.912  -54.102 1.00 16.03  ? 192 ALA L N   1 
ATOM   5978  C  CA  . ALA D 3 193 ? 20.980  -31.680  -54.216 1.00 17.45  ? 192 ALA L CA  1 
ATOM   5979  C  C   . ALA D 3 193 ? 21.659  -31.553  -52.850 1.00 19.71  ? 192 ALA L C   1 
ATOM   5980  O  O   . ALA D 3 193 ? 21.130  -30.960  -51.905 1.00 19.19  ? 192 ALA L O   1 
ATOM   5981  C  CB  . ALA D 3 193 ? 21.258  -30.431  -55.060 1.00 14.68  ? 192 ALA L CB  1 
ATOM   5982  N  N   . CYS D 3 194 ? 22.856  -32.113  -52.783 1.00 22.30  ? 193 CYS L N   1 
ATOM   5983  C  CA  . CYS D 3 194 ? 23.667  -32.101  -51.596 1.00 23.76  ? 193 CYS L CA  1 
ATOM   5984  C  C   . CYS D 3 194 ? 24.954  -31.373  -51.968 1.00 21.78  ? 193 CYS L C   1 
ATOM   5985  O  O   . CYS D 3 194 ? 25.639  -31.810  -52.878 1.00 21.98  ? 193 CYS L O   1 
ATOM   5986  C  CB  . CYS D 3 194 ? 23.967  -33.548  -51.200 1.00 27.13  ? 193 CYS L CB  1 
ATOM   5987  S  SG  . CYS D 3 194 ? 24.831  -33.618  -49.681 1.00 33.24  ? 193 CYS L SG  1 
ATOM   5988  N  N   . GLU D 3 195 ? 25.283  -30.269  -51.301 1.00 20.70  ? 194 GLU L N   1 
ATOM   5989  C  CA  . GLU D 3 195 ? 26.540  -29.558  -51.584 1.00 20.04  ? 194 GLU L CA  1 
ATOM   5990  C  C   . GLU D 3 195 ? 27.515  -29.637  -50.410 1.00 19.52  ? 194 GLU L C   1 
ATOM   5991  O  O   . GLU D 3 195 ? 27.182  -29.230  -49.297 1.00 18.91  ? 194 GLU L O   1 
ATOM   5992  C  CB  . GLU D 3 195 ? 26.283  -28.103  -51.936 1.00 21.03  ? 194 GLU L CB  1 
ATOM   5993  C  CG  . GLU D 3 195 ? 27.553  -27.328  -52.255 1.00 22.43  ? 194 GLU L CG  1 
ATOM   5994  C  CD  . GLU D 3 195 ? 27.297  -25.851  -52.397 1.00 23.62  ? 194 GLU L CD  1 
ATOM   5995  O  OE1 . GLU D 3 195 ? 27.959  -25.052  -51.701 1.00 24.74  ? 194 GLU L OE1 1 
ATOM   5996  O  OE2 . GLU D 3 195 ? 26.415  -25.488  -53.194 1.00 25.23  ? 194 GLU L OE2 1 
ATOM   5997  N  N   . VAL D 3 196 ? 28.720  -30.150  -50.672 1.00 17.92  ? 195 VAL L N   1 
ATOM   5998  C  CA  . VAL D 3 196 ? 29.703  -30.401  -49.618 1.00 16.78  ? 195 VAL L CA  1 
ATOM   5999  C  C   . VAL D 3 196 ? 30.882  -29.423  -49.699 1.00 15.09  ? 195 VAL L C   1 
ATOM   6000  O  O   . VAL D 3 196 ? 31.451  -29.193  -50.766 1.00 13.17  ? 195 VAL L O   1 
ATOM   6001  C  CB  . VAL D 3 196 ? 30.221  -31.861  -49.661 1.00 16.14  ? 195 VAL L CB  1 
ATOM   6002  C  CG1 . VAL D 3 196 ? 31.354  -32.072  -48.649 1.00 14.70  ? 195 VAL L CG1 1 
ATOM   6003  C  CG2 . VAL D 3 196 ? 29.083  -32.836  -49.404 1.00 15.58  ? 195 VAL L CG2 1 
ATOM   6004  N  N   . THR D 3 197 ? 31.225  -28.847  -48.553 1.00 14.60  ? 196 THR L N   1 
ATOM   6005  C  CA  . THR D 3 197 ? 32.361  -27.947  -48.437 1.00 14.03  ? 196 THR L CA  1 
ATOM   6006  C  C   . THR D 3 197 ? 33.365  -28.565  -47.486 1.00 14.68  ? 196 THR L C   1 
ATOM   6007  O  O   . THR D 3 197 ? 33.007  -29.006  -46.388 1.00 14.80  ? 196 THR L O   1 
ATOM   6008  C  CB  . THR D 3 197 ? 31.949  -26.571  -47.900 1.00 13.49  ? 196 THR L CB  1 
ATOM   6009  O  OG1 . THR D 3 197 ? 30.833  -26.096  -48.650 1.00 14.24  ? 196 THR L OG1 1 
ATOM   6010  C  CG2 . THR D 3 197 ? 33.088  -25.573  -48.022 1.00 12.19  ? 196 THR L CG2 1 
ATOM   6011  N  N   . HIS D 3 198 ? 34.620  -28.593  -47.917 1.00 15.54  ? 197 HIS L N   1 
ATOM   6012  C  CA  . HIS D 3 198 ? 35.697  -29.212  -47.149 1.00 16.06  ? 197 HIS L CA  1 
ATOM   6013  C  C   . HIS D 3 198 ? 37.046  -28.749  -47.706 1.00 14.64  ? 197 HIS L C   1 
ATOM   6014  O  O   . HIS D 3 198 ? 37.207  -28.543  -48.909 1.00 12.07  ? 197 HIS L O   1 
ATOM   6015  C  CB  . HIS D 3 198 ? 35.587  -30.743  -47.188 1.00 16.98  ? 197 HIS L CB  1 
ATOM   6016  C  CG  . HIS D 3 198 ? 36.529  -31.435  -46.253 1.00 18.23  ? 197 HIS L CG  1 
ATOM   6017  N  ND1 . HIS D 3 198 ? 37.815  -31.776  -46.611 1.00 17.68  ? 197 HIS L ND1 1 
ATOM   6018  C  CD2 . HIS D 3 198 ? 36.375  -31.832  -44.967 1.00 18.38  ? 197 HIS L CD2 1 
ATOM   6019  C  CE1 . HIS D 3 198 ? 38.410  -32.360  -45.587 1.00 18.93  ? 197 HIS L CE1 1 
ATOM   6020  N  NE2 . HIS D 3 198 ? 37.559  -32.405  -44.576 1.00 18.00  ? 197 HIS L NE2 1 
ATOM   6021  N  N   . GLN D 3 199 ? 38.014  -28.585  -46.818 1.00 15.27  ? 198 GLN L N   1 
ATOM   6022  C  CA  . GLN D 3 199 ? 39.252  -27.916  -47.175 1.00 15.83  ? 198 GLN L CA  1 
ATOM   6023  C  C   . GLN D 3 199 ? 40.145  -28.740  -48.104 1.00 16.23  ? 198 GLN L C   1 
ATOM   6024  O  O   . GLN D 3 199 ? 41.009  -28.187  -48.780 1.00 18.54  ? 198 GLN L O   1 
ATOM   6025  C  CB  . GLN D 3 199 ? 40.009  -27.506  -45.914 1.00 17.00  ? 198 GLN L CB  1 
ATOM   6026  C  CG  . GLN D 3 199 ? 40.605  -28.639  -45.112 1.00 17.68  ? 198 GLN L CG  1 
ATOM   6027  C  CD  . GLN D 3 199 ? 41.480  -28.115  -44.001 1.00 17.97  ? 198 GLN L CD  1 
ATOM   6028  O  OE1 . GLN D 3 199 ? 41.020  -27.949  -42.878 1.00 19.50  ? 198 GLN L OE1 1 
ATOM   6029  N  NE2 . GLN D 3 199 ? 42.736  -27.816  -44.316 1.00 17.31  ? 198 GLN L NE2 1 
ATOM   6030  N  N   . GLY D 3 200 ? 39.947  -30.052  -48.126 1.00 15.98  ? 199 GLY L N   1 
ATOM   6031  C  CA  . GLY D 3 200 ? 40.637  -30.924  -49.067 1.00 16.37  ? 199 GLY L CA  1 
ATOM   6032  C  C   . GLY D 3 200 ? 40.211  -30.695  -50.509 1.00 15.74  ? 199 GLY L C   1 
ATOM   6033  O  O   . GLY D 3 200 ? 40.994  -30.905  -51.443 1.00 14.99  ? 199 GLY L O   1 
ATOM   6034  N  N   . LEU D 3 201 ? 38.972  -30.248  -50.683 1.00 16.60  ? 200 LEU L N   1 
ATOM   6035  C  CA  . LEU D 3 201 ? 38.425  -29.948  -52.000 1.00 17.13  ? 200 LEU L CA  1 
ATOM   6036  C  C   . LEU D 3 201 ? 38.914  -28.582  -52.491 1.00 17.78  ? 200 LEU L C   1 
ATOM   6037  O  O   . LEU D 3 201 ? 39.094  -27.658  -51.694 1.00 18.34  ? 200 LEU L O   1 
ATOM   6038  C  CB  . LEU D 3 201 ? 36.896  -29.964  -51.947 1.00 17.11  ? 200 LEU L CB  1 
ATOM   6039  C  CG  . LEU D 3 201 ? 36.255  -31.295  -51.564 1.00 18.07  ? 200 LEU L CG  1 
ATOM   6040  C  CD1 . LEU D 3 201 ? 34.740  -31.150  -51.373 1.00 17.02  ? 200 LEU L CD1 1 
ATOM   6041  C  CD2 . LEU D 3 201 ? 36.580  -32.354  -52.633 1.00 18.10  ? 200 LEU L CD2 1 
ATOM   6042  N  N   . SER D 3 202 ? 39.131  -28.455  -53.798 1.00 18.35  ? 201 SER L N   1 
ATOM   6043  C  CA  . SER D 3 202 ? 39.493  -27.155  -54.380 1.00 20.56  ? 201 SER L CA  1 
ATOM   6044  C  C   . SER D 3 202 ? 38.273  -26.229  -54.410 1.00 20.34  ? 201 SER L C   1 
ATOM   6045  O  O   . SER D 3 202 ? 38.413  -25.010  -54.431 1.00 18.86  ? 201 SER L O   1 
ATOM   6046  C  CB  . SER D 3 202 ? 40.061  -27.317  -55.793 1.00 20.83  ? 201 SER L CB  1 
ATOM   6047  O  OG  . SER D 3 202 ? 39.077  -27.841  -56.671 1.00 21.88  ? 201 SER L OG  1 
ATOM   6048  N  N   . SER D 3 203 ? 37.077  -26.818  -54.439 1.00 20.83  ? 202 SER L N   1 
ATOM   6049  C  CA  . SER D 3 203 ? 35.840  -26.044  -54.334 1.00 21.31  ? 202 SER L CA  1 
ATOM   6050  C  C   . SER D 3 203 ? 34.694  -26.975  -53.942 1.00 20.31  ? 202 SER L C   1 
ATOM   6051  O  O   . SER D 3 203 ? 34.865  -28.191  -53.968 1.00 20.95  ? 202 SER L O   1 
ATOM   6052  C  CB  . SER D 3 203 ? 35.550  -25.298  -55.648 1.00 20.91  ? 202 SER L CB  1 
ATOM   6053  O  OG  . SER D 3 203 ? 35.255  -26.201  -56.691 1.00 21.93  ? 202 SER L OG  1 
ATOM   6054  N  N   . PRO D 3 204 ? 33.525  -26.411  -53.571 1.00 19.95  ? 203 PRO L N   1 
ATOM   6055  C  CA  . PRO D 3 204 ? 32.433  -27.256  -53.078 1.00 19.84  ? 203 PRO L CA  1 
ATOM   6056  C  C   . PRO D 3 204 ? 31.916  -28.267  -54.107 1.00 19.66  ? 203 PRO L C   1 
ATOM   6057  O  O   . PRO D 3 204 ? 31.825  -27.957  -55.289 1.00 20.63  ? 203 PRO L O   1 
ATOM   6058  C  CB  . PRO D 3 204 ? 31.336  -26.242  -52.718 1.00 19.54  ? 203 PRO L CB  1 
ATOM   6059  C  CG  . PRO D 3 204 ? 32.044  -24.942  -52.573 1.00 19.86  ? 203 PRO L CG  1 
ATOM   6060  C  CD  . PRO D 3 204 ? 33.145  -24.986  -53.563 1.00 19.45  ? 203 PRO L CD  1 
ATOM   6061  N  N   . VAL D 3 205 ? 31.590  -29.468  -53.646 1.00 19.42  ? 204 VAL L N   1 
ATOM   6062  C  CA  . VAL D 3 205 ? 31.110  -30.536  -54.518 1.00 19.34  ? 204 VAL L CA  1 
ATOM   6063  C  C   . VAL D 3 205 ? 29.612  -30.766  -54.297 1.00 18.87  ? 204 VAL L C   1 
ATOM   6064  O  O   . VAL D 3 205 ? 29.148  -30.821  -53.157 1.00 19.05  ? 204 VAL L O   1 
ATOM   6065  C  CB  . VAL D 3 205 ? 31.890  -31.849  -54.273 1.00 19.51  ? 204 VAL L CB  1 
ATOM   6066  C  CG1 . VAL D 3 205 ? 31.190  -33.031  -54.950 1.00 20.59  ? 204 VAL L CG1 1 
ATOM   6067  C  CG2 . VAL D 3 205 ? 33.331  -31.708  -54.780 1.00 18.55  ? 204 VAL L CG2 1 
ATOM   6068  N  N   . THR D 3 206 ? 28.869  -30.888  -55.395 1.00 17.81  ? 205 THR L N   1 
ATOM   6069  C  CA  . THR D 3 206 ? 27.434  -31.091  -55.348 1.00 16.66  ? 205 THR L CA  1 
ATOM   6070  C  C   . THR D 3 206 ? 27.071  -32.406  -56.012 1.00 18.06  ? 205 THR L C   1 
ATOM   6071  O  O   . THR D 3 206 ? 27.532  -32.695  -57.120 1.00 18.10  ? 205 THR L O   1 
ATOM   6072  C  CB  . THR D 3 206 ? 26.681  -29.974  -56.064 1.00 16.19  ? 205 THR L CB  1 
ATOM   6073  O  OG1 . THR D 3 206 ? 27.149  -28.709  -55.583 1.00 17.64  ? 205 THR L OG1 1 
ATOM   6074  C  CG2 . THR D 3 206 ? 25.183  -30.093  -55.810 1.00 15.03  ? 205 THR L CG2 1 
ATOM   6075  N  N   . LYS D 3 207 ? 26.259  -33.198  -55.312 1.00 18.08  ? 206 LYS L N   1 
ATOM   6076  C  CA  . LYS D 3 207 ? 25.668  -34.407  -55.848 1.00 18.56  ? 206 LYS L CA  1 
ATOM   6077  C  C   . LYS D 3 207 ? 24.176  -34.223  -55.777 1.00 18.32  ? 206 LYS L C   1 
ATOM   6078  O  O   . LYS D 3 207 ? 23.662  -33.733  -54.770 1.00 18.83  ? 206 LYS L O   1 
ATOM   6079  C  CB  . LYS D 3 207 ? 26.051  -35.626  -55.017 1.00 19.44  ? 206 LYS L CB  1 
ATOM   6080  C  CG  . LYS D 3 207 ? 27.523  -35.934  -55.007 1.00 20.63  ? 206 LYS L CG  1 
ATOM   6081  C  CD  . LYS D 3 207 ? 28.005  -36.396  -56.369 1.00 20.25  ? 206 LYS L CD  1 
ATOM   6082  C  CE  . LYS D 3 207 ? 29.513  -36.483  -56.389 1.00 20.80  ? 206 LYS L CE  1 
ATOM   6083  N  NZ  . LYS D 3 207 ? 29.984  -37.113  -57.644 1.00 22.62  ? 206 LYS L NZ  1 
ATOM   6084  N  N   . SER D 3 208 ? 23.484  -34.621  -56.839 1.00 17.15  ? 207 SER L N   1 
ATOM   6085  C  CA  . SER D 3 208 ? 22.053  -34.385  -56.945 1.00 17.46  ? 207 SER L CA  1 
ATOM   6086  C  C   . SER D 3 208 ? 21.381  -35.422  -57.821 1.00 16.34  ? 207 SER L C   1 
ATOM   6087  O  O   . SER D 3 208 ? 22.045  -36.137  -58.569 1.00 18.29  ? 207 SER L O   1 
ATOM   6088  C  CB  . SER D 3 208 ? 21.792  -32.982  -57.500 1.00 16.87  ? 207 SER L CB  1 
ATOM   6089  O  OG  . SER D 3 208 ? 22.500  -32.790  -58.696 1.00 16.43  ? 207 SER L OG  1 
ATOM   6090  N  N   . PHE D 3 209 ? 20.062  -35.510  -57.695 1.00 15.14  ? 208 PHE L N   1 
ATOM   6091  C  CA  . PHE D 3 209 ? 19.242  -36.366  -58.550 1.00 14.12  ? 208 PHE L CA  1 
ATOM   6092  C  C   . PHE D 3 209 ? 17.890  -35.710  -58.770 1.00 13.11  ? 208 PHE L C   1 
ATOM   6093  O  O   . PHE D 3 209 ? 17.433  -34.920  -57.943 1.00 11.39  ? 208 PHE L O   1 
ATOM   6094  C  CB  . PHE D 3 209 ? 19.033  -37.741  -57.912 1.00 14.53  ? 208 PHE L CB  1 
ATOM   6095  C  CG  . PHE D 3 209 ? 18.214  -37.698  -56.646 1.00 15.33  ? 208 PHE L CG  1 
ATOM   6096  C  CD1 . PHE D 3 209 ? 16.822  -37.778  -56.696 1.00 14.59  ? 208 PHE L CD1 1 
ATOM   6097  C  CD2 . PHE D 3 209 ? 18.836  -37.567  -55.406 1.00 14.75  ? 208 PHE L CD2 1 
ATOM   6098  C  CE1 . PHE D 3 209 ? 16.061  -37.719  -55.529 1.00 14.57  ? 208 PHE L CE1 1 
ATOM   6099  C  CE2 . PHE D 3 209 ? 18.087  -37.508  -54.236 1.00 14.74  ? 208 PHE L CE2 1 
ATOM   6100  C  CZ  . PHE D 3 209 ? 16.698  -37.580  -54.295 1.00 14.64  ? 208 PHE L CZ  1 
ATOM   6101  N  N   . ASN D 3 210 ? 17.254  -36.064  -59.880 1.00 14.37  ? 209 ASN L N   1 
ATOM   6102  C  CA  . ASN D 3 210 ? 15.881  -35.660  -60.168 1.00 15.24  ? 209 ASN L CA  1 
ATOM   6103  C  C   . ASN D 3 210 ? 14.921  -36.770  -59.758 1.00 15.95  ? 209 ASN L C   1 
ATOM   6104  O  O   . ASN D 3 210 ? 15.132  -37.934  -60.105 1.00 15.33  ? 209 ASN L O   1 
ATOM   6105  C  CB  . ASN D 3 210 ? 15.725  -35.351  -61.656 1.00 14.96  ? 209 ASN L CB  1 
ATOM   6106  C  CG  . ASN D 3 210 ? 16.656  -34.245  -62.115 1.00 14.71  ? 209 ASN L CG  1 
ATOM   6107  O  OD1 . ASN D 3 210 ? 17.139  -33.457  -61.305 1.00 15.10  ? 209 ASN L OD1 1 
ATOM   6108  N  ND2 . ASN D 3 210 ? 16.917  -34.184  -63.410 1.00 14.46  ? 209 ASN L ND2 1 
ATOM   6109  N  N   . ARG D 3 211 ? 13.878  -36.414  -59.013 1.00 16.11  ? 210 ARG L N   1 
ATOM   6110  C  CA  . ARG D 3 211 ? 12.927  -37.402  -58.532 1.00 17.20  ? 210 ARG L CA  1 
ATOM   6111  C  C   . ARG D 3 211 ? 12.329  -38.181  -59.705 1.00 18.76  ? 210 ARG L C   1 
ATOM   6112  O  O   . ARG D 3 211 ? 11.656  -37.598  -60.556 1.00 18.16  ? 210 ARG L O   1 
ATOM   6113  C  CB  . ARG D 3 211 ? 11.811  -36.735  -57.727 1.00 17.07  ? 210 ARG L CB  1 
ATOM   6114  C  CG  . ARG D 3 211 ? 10.740  -37.716  -57.225 1.00 16.47  ? 210 ARG L CG  1 
ATOM   6115  C  CD  . ARG D 3 211 ? 9.672   -37.027  -56.401 1.00 16.14  ? 210 ARG L CD  1 
ATOM   6116  N  NE  . ARG D 3 211 ? 9.190   -35.810  -57.048 1.00 15.77  ? 210 ARG L NE  1 
ATOM   6117  C  CZ  . ARG D 3 211 ? 8.423   -35.776  -58.139 1.00 15.44  ? 210 ARG L CZ  1 
ATOM   6118  N  NH1 . ARG D 3 211 ? 7.997   -36.890  -58.728 1.00 15.01  ? 210 ARG L NH1 1 
ATOM   6119  N  NH2 . ARG D 3 211 ? 8.069   -34.603  -58.646 1.00 15.17  ? 210 ARG L NH2 1 
ATOM   6120  N  N   . GLY D 3 212 ? 12.596  -39.489  -59.742 1.00 19.93  ? 211 GLY L N   1 
ATOM   6121  C  CA  . GLY D 3 212 ? 12.021  -40.389  -60.737 1.00 20.79  ? 211 GLY L CA  1 
ATOM   6122  C  C   . GLY D 3 212 ? 12.926  -40.695  -61.921 1.00 22.35  ? 211 GLY L C   1 
ATOM   6123  O  O   . GLY D 3 212 ? 14.160  -40.680  -61.871 1.00 22.91  ? 211 GLY L O   1 
ATOM   6124  O  OXT . GLY D 3 212 ? 12.415  -40.984  -63.001 1.00 23.05  ? 211 GLY L OXT 1 
ATOM   6125  N  N   . GLU E 2 1   ? 24.257  -60.556  -10.083 1.00 32.92  ? 1   GLU X N   1 
ATOM   6126  C  CA  . GLU E 2 1   ? 24.310  -62.043  -9.973  1.00 33.40  ? 1   GLU X CA  1 
ATOM   6127  C  C   . GLU E 2 1   ? 25.484  -62.519  -9.129  1.00 31.82  ? 1   GLU X C   1 
ATOM   6128  O  O   . GLU E 2 1   ? 26.421  -61.767  -8.861  1.00 32.39  ? 1   GLU X O   1 
ATOM   6129  C  CB  . GLU E 2 1   ? 24.398  -62.688  -11.360 1.00 34.56  ? 1   GLU X CB  1 
ATOM   6130  C  CG  . GLU E 2 1   ? 25.795  -62.703  -11.971 1.00 35.82  ? 1   GLU X CG  1 
ATOM   6131  C  CD  . GLU E 2 1   ? 25.889  -63.631  -13.164 1.00 37.18  ? 1   GLU X CD  1 
ATOM   6132  O  OE1 . GLU E 2 1   ? 25.099  -63.456  -14.122 1.00 36.97  ? 1   GLU X OE1 1 
ATOM   6133  O  OE2 . GLU E 2 1   ? 26.754  -64.538  -13.137 1.00 38.52  ? 1   GLU X OE2 1 
ATOM   6134  N  N   . VAL E 2 2   ? 25.425  -63.786  -8.738  1.00 29.99  ? 2   VAL X N   1 
ATOM   6135  C  CA  . VAL E 2 2   ? 26.499  -64.420  -7.999  1.00 29.82  ? 2   VAL X CA  1 
ATOM   6136  C  C   . VAL E 2 2   ? 27.532  -64.996  -8.965  1.00 29.57  ? 2   VAL X C   1 
ATOM   6137  O  O   . VAL E 2 2   ? 27.188  -65.619  -9.969  1.00 28.63  ? 2   VAL X O   1 
ATOM   6138  C  CB  . VAL E 2 2   ? 25.979  -65.562  -7.094  1.00 30.65  ? 2   VAL X CB  1 
ATOM   6139  C  CG1 . VAL E 2 2   ? 24.826  -65.080  -6.224  1.00 31.45  ? 2   VAL X CG1 1 
ATOM   6140  C  CG2 . VAL E 2 2   ? 25.543  -66.748  -7.928  1.00 31.40  ? 2   VAL X CG2 1 
ATOM   6141  N  N   . GLN E 2 3   ? 28.808  -64.798  -8.670  1.00 29.56  ? 3   GLN X N   1 
ATOM   6142  C  CA  . GLN E 2 3   ? 29.827  -65.473  -9.452  1.00 28.97  ? 3   GLN X CA  1 
ATOM   6143  C  C   . GLN E 2 3   ? 31.127  -65.692  -8.713  1.00 27.93  ? 3   GLN X C   1 
ATOM   6144  O  O   . GLN E 2 3   ? 31.383  -65.113  -7.647  1.00 27.34  ? 3   GLN X O   1 
ATOM   6145  C  CB  . GLN E 2 3   ? 30.076  -64.759  -10.789 1.00 29.96  ? 3   GLN X CB  1 
ATOM   6146  C  CG  . GLN E 2 3   ? 29.980  -63.264  -10.747 1.00 30.60  ? 3   GLN X CG  1 
ATOM   6147  C  CD  . GLN E 2 3   ? 30.221  -62.638  -12.107 1.00 31.66  ? 3   GLN X CD  1 
ATOM   6148  O  OE1 . GLN E 2 3   ? 29.380  -61.894  -12.620 1.00 32.42  ? 3   GLN X OE1 1 
ATOM   6149  N  NE2 . GLN E 2 3   ? 31.377  -62.934  -12.700 1.00 31.03  ? 3   GLN X NE2 1 
ATOM   6150  N  N   . LEU E 2 4   ? 31.923  -66.571  -9.315  1.00 26.01  ? 4   LEU X N   1 
ATOM   6151  C  CA  . LEU E 2 4   ? 33.237  -66.930  -8.856  1.00 24.46  ? 4   LEU X CA  1 
ATOM   6152  C  C   . LEU E 2 4   ? 34.144  -66.836  -10.075 1.00 24.26  ? 4   LEU X C   1 
ATOM   6153  O  O   . LEU E 2 4   ? 33.830  -67.421  -11.100 1.00 23.66  ? 4   LEU X O   1 
ATOM   6154  C  CB  . LEU E 2 4   ? 33.201  -68.371  -8.334  1.00 24.03  ? 4   LEU X CB  1 
ATOM   6155  C  CG  . LEU E 2 4   ? 32.448  -68.593  -7.015  1.00 23.09  ? 4   LEU X CG  1 
ATOM   6156  C  CD1 . LEU E 2 4   ? 32.261  -70.079  -6.746  1.00 20.41  ? 4   LEU X CD1 1 
ATOM   6157  C  CD2 . LEU E 2 4   ? 33.194  -67.880  -5.870  1.00 20.64  ? 4   LEU X CD2 1 
ATOM   6158  N  N   . LEU E 2 5   ? 35.244  -66.092  -9.988  1.00 24.69  ? 5   LEU X N   1 
ATOM   6159  C  CA  . LEU E 2 5   ? 36.162  -65.953  -11.134 1.00 24.76  ? 5   LEU X CA  1 
ATOM   6160  C  C   . LEU E 2 5   ? 37.547  -66.478  -10.766 1.00 23.51  ? 5   LEU X C   1 
ATOM   6161  O  O   . LEU E 2 5   ? 38.209  -65.899  -9.908  1.00 22.43  ? 5   LEU X O   1 
ATOM   6162  C  CB  . LEU E 2 5   ? 36.244  -64.493  -11.602 1.00 24.72  ? 5   LEU X CB  1 
ATOM   6163  C  CG  . LEU E 2 5   ? 37.203  -64.176  -12.775 1.00 26.43  ? 5   LEU X CG  1 
ATOM   6164  C  CD1 . LEU E 2 5   ? 36.848  -64.929  -14.064 1.00 25.35  ? 5   LEU X CD1 1 
ATOM   6165  C  CD2 . LEU E 2 5   ? 37.266  -62.664  -13.055 1.00 25.48  ? 5   LEU X CD2 1 
ATOM   6166  N  N   . GLU E 2 6   ? 37.967  -67.577  -11.404 1.00 23.20  ? 6   GLU X N   1 
ATOM   6167  C  CA  . GLU E 2 6   ? 39.318  -68.122  -11.210 1.00 23.75  ? 6   GLU X CA  1 
ATOM   6168  C  C   . GLU E 2 6   ? 40.346  -67.326  -12.007 1.00 23.18  ? 6   GLU X C   1 
ATOM   6169  O  O   . GLU E 2 6   ? 40.017  -66.679  -12.995 1.00 21.38  ? 6   GLU X O   1 
ATOM   6170  C  CB  . GLU E 2 6   ? 39.445  -69.596  -11.624 1.00 24.62  ? 6   GLU X CB  1 
ATOM   6171  C  CG  . GLU E 2 6   ? 38.578  -70.597  -10.865 1.00 25.45  ? 6   GLU X CG  1 
ATOM   6172  C  CD  . GLU E 2 6   ? 37.232  -70.821  -11.514 1.00 26.78  ? 6   GLU X CD  1 
ATOM   6173  O  OE1 . GLU E 2 6   ? 36.770  -69.949  -12.269 1.00 28.33  ? 6   GLU X OE1 1 
ATOM   6174  O  OE2 . GLU E 2 6   ? 36.611  -71.873  -11.278 1.00 29.29  ? 6   GLU X OE2 1 
ATOM   6175  N  N   . SER E 2 7   ? 41.593  -67.390  -11.547 1.00 24.17  ? 7   SER X N   1 
ATOM   6176  C  CA  . SER E 2 7   ? 42.741  -66.870  -12.282 1.00 24.41  ? 7   SER X CA  1 
ATOM   6177  C  C   . SER E 2 7   ? 43.988  -67.588  -11.801 1.00 24.44  ? 7   SER X C   1 
ATOM   6178  O  O   . SER E 2 7   ? 43.954  -68.271  -10.779 1.00 24.56  ? 7   SER X O   1 
ATOM   6179  C  CB  . SER E 2 7   ? 42.891  -65.376  -12.048 1.00 24.13  ? 7   SER X CB  1 
ATOM   6180  O  OG  . SER E 2 7   ? 42.915  -65.108  -10.661 1.00 25.24  ? 7   SER X OG  1 
ATOM   6181  N  N   . GLY E 2 8   ? 45.077  -67.444  -12.549 1.00 25.91  ? 8   GLY X N   1 
ATOM   6182  C  CA  . GLY E 2 8   ? 46.388  -67.943  -12.130 1.00 26.59  ? 8   GLY X CA  1 
ATOM   6183  C  C   . GLY E 2 8   ? 46.895  -69.162  -12.881 1.00 26.49  ? 8   GLY X C   1 
ATOM   6184  O  O   . GLY E 2 8   ? 48.054  -69.568  -12.696 1.00 27.38  ? 8   GLY X O   1 
ATOM   6185  N  N   . GLY E 2 9   ? 46.046  -69.749  -13.723 1.00 24.84  ? 9   GLY X N   1 
ATOM   6186  C  CA  . GLY E 2 9   ? 46.419  -70.948  -14.466 1.00 24.40  ? 9   GLY X CA  1 
ATOM   6187  C  C   . GLY E 2 9   ? 47.518  -70.693  -15.473 1.00 24.14  ? 9   GLY X C   1 
ATOM   6188  O  O   . GLY E 2 9   ? 47.748  -69.554  -15.881 1.00 24.07  ? 9   GLY X O   1 
ATOM   6189  N  N   . GLY E 2 10  ? 48.206  -71.758  -15.876 1.00 24.69  ? 10  GLY X N   1 
ATOM   6190  C  CA  . GLY E 2 10  ? 49.249  -71.658  -16.901 1.00 23.14  ? 10  GLY X CA  1 
ATOM   6191  C  C   . GLY E 2 10  ? 50.062  -72.929  -17.068 1.00 23.13  ? 10  GLY X C   1 
ATOM   6192  O  O   . GLY E 2 10  ? 49.633  -74.016  -16.672 1.00 21.78  ? 10  GLY X O   1 
ATOM   6193  N  N   . LEU E 2 11  ? 51.247  -72.780  -17.660 1.00 24.67  ? 11  LEU X N   1 
ATOM   6194  C  CA  . LEU E 2 11  ? 52.159  -73.896  -17.883 1.00 24.39  ? 11  LEU X CA  1 
ATOM   6195  C  C   . LEU E 2 11  ? 53.220  -73.910  -16.790 1.00 25.49  ? 11  LEU X C   1 
ATOM   6196  O  O   . LEU E 2 11  ? 53.901  -72.910  -16.567 1.00 27.27  ? 11  LEU X O   1 
ATOM   6197  C  CB  . LEU E 2 11  ? 52.803  -73.774  -19.267 1.00 23.97  ? 11  LEU X CB  1 
ATOM   6198  C  CG  . LEU E 2 11  ? 53.866  -74.807  -19.666 1.00 23.32  ? 11  LEU X CG  1 
ATOM   6199  C  CD1 . LEU E 2 11  ? 53.333  -76.226  -19.546 1.00 23.07  ? 11  LEU X CD1 1 
ATOM   6200  C  CD2 . LEU E 2 11  ? 54.357  -74.534  -21.080 1.00 22.66  ? 11  LEU X CD2 1 
ATOM   6201  N  N   . VAL E 2 12  ? 53.356  -75.044  -16.108 1.00 26.53  ? 12  VAL X N   1 
ATOM   6202  C  CA  . VAL E 2 12  ? 54.367  -75.223  -15.056 1.00 26.03  ? 12  VAL X CA  1 
ATOM   6203  C  C   . VAL E 2 12  ? 55.183  -76.479  -15.347 1.00 25.34  ? 12  VAL X C   1 
ATOM   6204  O  O   . VAL E 2 12  ? 54.623  -77.500  -15.746 1.00 23.72  ? 12  VAL X O   1 
ATOM   6205  C  CB  . VAL E 2 12  ? 53.705  -75.404  -13.654 1.00 27.08  ? 12  VAL X CB  1 
ATOM   6206  C  CG1 . VAL E 2 12  ? 54.765  -75.517  -12.557 1.00 27.21  ? 12  VAL X CG1 1 
ATOM   6207  C  CG2 . VAL E 2 12  ? 52.746  -74.271  -13.353 1.00 27.52  ? 12  VAL X CG2 1 
ATOM   6208  N  N   . GLN E 2 13  ? 56.500  -76.409  -15.141 1.00 26.08  ? 13  GLN X N   1 
ATOM   6209  C  CA  . GLN E 2 13  ? 57.341  -77.602  -15.195 1.00 25.89  ? 13  GLN X CA  1 
ATOM   6210  C  C   . GLN E 2 13  ? 57.057  -78.525  -14.005 1.00 25.10  ? 13  GLN X C   1 
ATOM   6211  O  O   . GLN E 2 13  ? 56.723  -78.051  -12.916 1.00 24.11  ? 13  GLN X O   1 
ATOM   6212  C  CB  . GLN E 2 13  ? 58.822  -77.233  -15.195 1.00 27.52  ? 13  GLN X CB  1 
ATOM   6213  C  CG  . GLN E 2 13  ? 59.325  -76.682  -16.520 1.00 28.53  ? 13  GLN X CG  1 
ATOM   6214  C  CD  . GLN E 2 13  ? 60.772  -77.029  -16.778 1.00 29.41  ? 13  GLN X CD  1 
ATOM   6215  O  OE1 . GLN E 2 13  ? 61.590  -77.069  -15.857 1.00 30.23  ? 13  GLN X OE1 1 
ATOM   6216  N  NE2 . GLN E 2 13  ? 61.098  -77.293  -18.039 1.00 30.21  ? 13  GLN X NE2 1 
ATOM   6217  N  N   . PRO E 2 14  ? 57.201  -79.848  -14.203 1.00 25.30  ? 14  PRO X N   1 
ATOM   6218  C  CA  . PRO E 2 14  ? 56.960  -80.771  -13.090 1.00 24.89  ? 14  PRO X CA  1 
ATOM   6219  C  C   . PRO E 2 14  ? 57.936  -80.524  -11.937 1.00 23.94  ? 14  PRO X C   1 
ATOM   6220  O  O   . PRO E 2 14  ? 59.129  -80.360  -12.169 1.00 22.51  ? 14  PRO X O   1 
ATOM   6221  C  CB  . PRO E 2 14  ? 57.191  -82.158  -13.710 1.00 25.68  ? 14  PRO X CB  1 
ATOM   6222  C  CG  . PRO E 2 14  ? 57.258  -81.944  -15.198 1.00 25.71  ? 14  PRO X CG  1 
ATOM   6223  C  CD  . PRO E 2 14  ? 57.710  -80.542  -15.401 1.00 25.52  ? 14  PRO X CD  1 
ATOM   6224  N  N   . GLY E 2 15  ? 57.425  -80.487  -10.712 1.00 23.68  ? 15  GLY X N   1 
ATOM   6225  C  CA  . GLY E 2 15  ? 58.224  -80.075  -9.556  1.00 23.30  ? 15  GLY X CA  1 
ATOM   6226  C  C   . GLY E 2 15  ? 57.946  -78.632  -9.163  1.00 23.28  ? 15  GLY X C   1 
ATOM   6227  O  O   . GLY E 2 15  ? 58.103  -78.261  -8.001  1.00 23.11  ? 15  GLY X O   1 
ATOM   6228  N  N   . GLY E 2 16  ? 57.517  -77.817  -10.125 1.00 23.21  ? 16  GLY X N   1 
ATOM   6229  C  CA  . GLY E 2 16  ? 57.191  -76.422  -9.864  1.00 23.00  ? 16  GLY X CA  1 
ATOM   6230  C  C   . GLY E 2 16  ? 55.932  -76.235  -9.028  1.00 23.73  ? 16  GLY X C   1 
ATOM   6231  O  O   . GLY E 2 16  ? 55.247  -77.200  -8.652  1.00 21.99  ? 16  GLY X O   1 
ATOM   6232  N  N   . SER E 2 17  ? 55.646  -74.973  -8.728  1.00 24.28  ? 17  SER X N   1 
ATOM   6233  C  CA  . SER E 2 17  ? 54.448  -74.598  -7.996  1.00 25.33  ? 17  SER X CA  1 
ATOM   6234  C  C   . SER E 2 17  ? 53.665  -73.521  -8.751  1.00 25.12  ? 17  SER X C   1 
ATOM   6235  O  O   . SER E 2 17  ? 54.191  -72.851  -9.647  1.00 24.11  ? 17  SER X O   1 
ATOM   6236  C  CB  . SER E 2 17  ? 54.807  -74.110  -6.592  1.00 25.47  ? 17  SER X CB  1 
ATOM   6237  O  OG  . SER E 2 17  ? 55.780  -73.091  -6.651  1.00 26.70  ? 17  SER X OG  1 
ATOM   6238  N  N   . LEU E 2 18  ? 52.400  -73.383  -8.379  1.00 24.98  ? 18  LEU X N   1 
ATOM   6239  C  CA  . LEU E 2 18  ? 51.503  -72.423  -8.999  1.00 26.06  ? 18  LEU X CA  1 
ATOM   6240  C  C   . LEU E 2 18  ? 50.395  -72.063  -8.014  1.00 25.82  ? 18  LEU X C   1 
ATOM   6241  O  O   . LEU E 2 18  ? 49.969  -72.899  -7.213  1.00 25.92  ? 18  LEU X O   1 
ATOM   6242  C  CB  . LEU E 2 18  ? 50.912  -73.016  -10.276 1.00 26.55  ? 18  LEU X CB  1 
ATOM   6243  C  CG  . LEU E 2 18  ? 50.135  -72.086  -11.206 1.00 26.90  ? 18  LEU X CG  1 
ATOM   6244  C  CD1 . LEU E 2 18  ? 51.034  -71.031  -11.799 1.00 26.66  ? 18  LEU X CD1 1 
ATOM   6245  C  CD2 . LEU E 2 18  ? 49.472  -72.911  -12.303 1.00 27.65  ? 18  LEU X CD2 1 
ATOM   6246  N  N   . ARG E 2 19  ? 49.938  -70.817  -8.077  1.00 25.06  ? 19  ARG X N   1 
ATOM   6247  C  CA  . ARG E 2 19  ? 48.914  -70.333  -7.168  1.00 24.72  ? 19  ARG X CA  1 
ATOM   6248  C  C   . ARG E 2 19  ? 47.676  -69.899  -7.931  1.00 22.57  ? 19  ARG X C   1 
ATOM   6249  O  O   . ARG E 2 19  ? 47.743  -69.057  -8.825  1.00 21.58  ? 19  ARG X O   1 
ATOM   6250  C  CB  . ARG E 2 19  ? 49.442  -69.174  -6.335  1.00 25.75  ? 19  ARG X CB  1 
ATOM   6251  C  CG  . ARG E 2 19  ? 48.599  -68.865  -5.120  1.00 27.14  ? 19  ARG X CG  1 
ATOM   6252  C  CD  . ARG E 2 19  ? 48.706  -67.401  -4.743  1.00 28.51  ? 19  ARG X CD  1 
ATOM   6253  N  NE  . ARG E 2 19  ? 48.392  -67.176  -3.332  1.00 29.71  ? 19  ARG X NE  1 
ATOM   6254  C  CZ  . ARG E 2 19  ? 47.958  -66.024  -2.822  1.00 30.60  ? 19  ARG X CZ  1 
ATOM   6255  N  NH1 . ARG E 2 19  ? 47.770  -64.958  -3.602  1.00 30.62  ? 19  ARG X NH1 1 
ATOM   6256  N  NH2 . ARG E 2 19  ? 47.701  -65.938  -1.516  1.00 30.64  ? 19  ARG X NH2 1 
ATOM   6257  N  N   . LEU E 2 20  ? 46.545  -70.496  -7.573  1.00 21.63  ? 20  LEU X N   1 
ATOM   6258  C  CA  . LEU E 2 20  ? 45.254  -70.124  -8.144  1.00 20.90  ? 20  LEU X CA  1 
ATOM   6259  C  C   . LEU E 2 20  ? 44.498  -69.226  -7.181  1.00 20.87  ? 20  LEU X C   1 
ATOM   6260  O  O   . LEU E 2 20  ? 44.607  -69.381  -5.957  1.00 20.60  ? 20  LEU X O   1 
ATOM   6261  C  CB  . LEU E 2 20  ? 44.419  -71.363  -8.445  1.00 19.51  ? 20  LEU X CB  1 
ATOM   6262  C  CG  . LEU E 2 20  ? 45.119  -72.465  -9.228  1.00 19.09  ? 20  LEU X CG  1 
ATOM   6263  C  CD1 . LEU E 2 20  ? 44.123  -73.586  -9.548  1.00 19.40  ? 20  LEU X CD1 1 
ATOM   6264  C  CD2 . LEU E 2 20  ? 45.765  -71.902  -10.497 1.00 19.42  ? 20  LEU X CD2 1 
ATOM   6265  N  N   . SER E 2 21  ? 43.750  -68.279  -7.742  1.00 21.48  ? 21  SER X N   1 
ATOM   6266  C  CA  . SER E 2 21  ? 42.867  -67.425  -6.969  1.00 22.83  ? 21  SER X CA  1 
ATOM   6267  C  C   . SER E 2 21  ? 41.450  -67.511  -7.522  1.00 23.93  ? 21  SER X C   1 
ATOM   6268  O  O   . SER E 2 21  ? 41.248  -67.806  -8.696  1.00 22.96  ? 21  SER X O   1 
ATOM   6269  C  CB  . SER E 2 21  ? 43.347  -65.991  -7.003  1.00 22.68  ? 21  SER X CB  1 
ATOM   6270  O  OG  . SER E 2 21  ? 44.692  -65.915  -6.583  1.00 25.03  ? 21  SER X OG  1 
ATOM   6271  N  N   . CYS E 2 22  ? 40.477  -67.245  -6.658  1.00 25.50  ? 22  CYS X N   1 
ATOM   6272  C  CA  . CYS E 2 22  ? 39.073  -67.293  -7.018  1.00 26.53  ? 22  CYS X CA  1 
ATOM   6273  C  C   . CYS E 2 22  ? 38.346  -66.201  -6.246  1.00 25.86  ? 22  CYS X C   1 
ATOM   6274  O  O   . CYS E 2 22  ? 38.147  -66.313  -5.038  1.00 26.27  ? 22  CYS X O   1 
ATOM   6275  C  CB  . CYS E 2 22  ? 38.498  -68.679  -6.709  1.00 28.53  ? 22  CYS X CB  1 
ATOM   6276  S  SG  . CYS E 2 22  ? 36.676  -68.806  -6.679  1.00 31.41  ? 22  CYS X SG  1 
ATOM   6277  N  N   . ALA E 2 23  ? 37.966  -65.138  -6.949  1.00 24.54  ? 23  ALA X N   1 
ATOM   6278  C  CA  . ALA E 2 23  ? 37.243  -64.021  -6.346  1.00 22.24  ? 23  ALA X CA  1 
ATOM   6279  C  C   . ALA E 2 23  ? 35.742  -64.296  -6.386  1.00 20.77  ? 23  ALA X C   1 
ATOM   6280  O  O   . ALA E 2 23  ? 35.197  -64.560  -7.461  1.00 21.51  ? 23  ALA X O   1 
ATOM   6281  C  CB  . ALA E 2 23  ? 37.562  -62.730  -7.088  1.00 18.97  ? 23  ALA X CB  1 
ATOM   6282  N  N   . ALA E 2 24  ? 35.084  -64.227  -5.222  1.00 19.28  ? 24  ALA X N   1 
ATOM   6283  C  CA  . ALA E 2 24  ? 33.624  -64.329  -5.126  1.00 18.35  ? 24  ALA X CA  1 
ATOM   6284  C  C   . ALA E 2 24  ? 32.966  -62.956  -5.179  1.00 18.69  ? 24  ALA X C   1 
ATOM   6285  O  O   . ALA E 2 24  ? 33.529  -61.972  -4.698  1.00 17.45  ? 24  ALA X O   1 
ATOM   6286  C  CB  . ALA E 2 24  ? 33.222  -65.041  -3.837  1.00 18.50  ? 24  ALA X CB  1 
ATOM   6287  N  N   . SER E 2 25  ? 31.774  -62.893  -5.780  1.00 20.54  ? 25  SER X N   1 
ATOM   6288  C  CA  . SER E 2 25  ? 30.951  -61.686  -5.738  1.00 20.99  ? 25  SER X CA  1 
ATOM   6289  C  C   . SER E 2 25  ? 29.466  -62.016  -5.731  1.00 19.87  ? 25  SER X C   1 
ATOM   6290  O  O   . SER E 2 25  ? 29.056  -63.059  -6.215  1.00 20.03  ? 25  SER X O   1 
ATOM   6291  C  CB  . SER E 2 25  ? 31.271  -60.762  -6.908  1.00 23.20  ? 25  SER X CB  1 
ATOM   6292  O  OG  . SER E 2 25  ? 31.087  -61.427  -8.136  1.00 25.72  ? 25  SER X OG  1 
ATOM   6293  N  N   . GLY E 2 26  ? 28.677  -61.113  -5.155  1.00 20.27  ? 26  GLY X N   1 
ATOM   6294  C  CA  . GLY E 2 26  ? 27.219  -61.235  -5.100  1.00 19.60  ? 26  GLY X CA  1 
ATOM   6295  C  C   . GLY E 2 26  ? 26.620  -62.143  -4.040  1.00 18.93  ? 26  GLY X C   1 
ATOM   6296  O  O   . GLY E 2 26  ? 25.407  -62.297  -3.993  1.00 20.74  ? 26  GLY X O   1 
ATOM   6297  N  N   . PHE E 2 27  ? 27.445  -62.767  -3.203  1.00 19.48  ? 27  PHE X N   1 
ATOM   6298  C  CA  . PHE E 2 27  ? 26.942  -63.640  -2.133  1.00 18.61  ? 27  PHE X CA  1 
ATOM   6299  C  C   . PHE E 2 27  ? 27.844  -63.614  -0.887  1.00 19.02  ? 27  PHE X C   1 
ATOM   6300  O  O   . PHE E 2 27  ? 28.975  -63.153  -0.954  1.00 17.80  ? 27  PHE X O   1 
ATOM   6301  C  CB  . PHE E 2 27  ? 26.722  -65.064  -2.663  1.00 18.04  ? 27  PHE X CB  1 
ATOM   6302  C  CG  . PHE E 2 27  ? 27.979  -65.892  -2.789  1.00 17.85  ? 27  PHE X CG  1 
ATOM   6303  C  CD1 . PHE E 2 27  ? 28.286  -66.850  -1.835  1.00 17.80  ? 27  PHE X CD1 1 
ATOM   6304  C  CD2 . PHE E 2 27  ? 28.829  -65.736  -3.879  1.00 17.18  ? 27  PHE X CD2 1 
ATOM   6305  C  CE1 . PHE E 2 27  ? 29.431  -67.618  -1.947  1.00 17.24  ? 27  PHE X CE1 1 
ATOM   6306  C  CE2 . PHE E 2 27  ? 29.962  -66.489  -4.003  1.00 16.14  ? 27  PHE X CE2 1 
ATOM   6307  C  CZ  . PHE E 2 27  ? 30.279  -67.429  -3.029  1.00 17.90  ? 27  PHE X CZ  1 
ATOM   6308  N  N   . THR E 2 28  ? 27.329  -64.091  0.249   1.00 19.97  ? 28  THR X N   1 
ATOM   6309  C  CA  . THR E 2 28  ? 28.042  -63.989  1.530   1.00 19.06  ? 28  THR X CA  1 
ATOM   6310  C  C   . THR E 2 28  ? 29.062  -65.111  1.666   1.00 20.02  ? 28  THR X C   1 
ATOM   6311  O  O   . THR E 2 28  ? 28.883  -66.079  2.428   1.00 18.92  ? 28  THR X O   1 
ATOM   6312  C  CB  . THR E 2 28  ? 27.082  -63.979  2.737   1.00 19.30  ? 28  THR X CB  1 
ATOM   6313  O  OG1 . THR E 2 28  ? 26.022  -63.046  2.501   1.00 18.48  ? 28  THR X OG1 1 
ATOM   6314  C  CG2 . THR E 2 28  ? 27.835  -63.581  4.004   1.00 18.73  ? 28  THR X CG2 1 
ATOM   6315  N  N   . PHE E 2 29  ? 30.136  -64.936  0.902   1.00 19.64  ? 29  PHE X N   1 
ATOM   6316  C  CA  . PHE E 2 29  ? 31.262  -65.851  0.797   1.00 19.16  ? 29  PHE X CA  1 
ATOM   6317  C  C   . PHE E 2 29  ? 31.708  -66.479  2.125   1.00 19.07  ? 29  PHE X C   1 
ATOM   6318  O  O   . PHE E 2 29  ? 31.963  -67.681  2.210   1.00 19.33  ? 29  PHE X O   1 
ATOM   6319  C  CB  . PHE E 2 29  ? 32.411  -65.061  0.165   1.00 19.35  ? 29  PHE X CB  1 
ATOM   6320  C  CG  . PHE E 2 29  ? 33.674  -65.829  0.015   1.00 18.65  ? 29  PHE X CG  1 
ATOM   6321  C  CD1 . PHE E 2 29  ? 33.812  -66.749  -1.002  1.00 17.96  ? 29  PHE X CD1 1 
ATOM   6322  C  CD2 . PHE E 2 29  ? 34.737  -65.617  0.887   1.00 18.98  ? 29  PHE X CD2 1 
ATOM   6323  C  CE1 . PHE E 2 29  ? 34.987  -67.461  -1.149  1.00 18.41  ? 29  PHE X CE1 1 
ATOM   6324  C  CE2 . PHE E 2 29  ? 35.913  -66.318  0.756   1.00 18.15  ? 29  PHE X CE2 1 
ATOM   6325  C  CZ  . PHE E 2 29  ? 36.042  -67.245  -0.259  1.00 19.28  ? 29  PHE X CZ  1 
ATOM   6326  N  N   . SER E 2 30  ? 31.792  -65.656  3.158   1.00 19.76  ? 30  SER X N   1 
ATOM   6327  C  CA  . SER E 2 30  ? 32.293  -66.089  4.467   1.00 20.43  ? 30  SER X CA  1 
ATOM   6328  C  C   . SER E 2 30  ? 31.417  -67.109  5.192   1.00 18.77  ? 30  SER X C   1 
ATOM   6329  O  O   . SER E 2 30  ? 31.853  -67.664  6.183   1.00 19.24  ? 30  SER X O   1 
ATOM   6330  C  CB  . SER E 2 30  ? 32.477  -64.872  5.384   1.00 20.08  ? 30  SER X CB  1 
ATOM   6331  O  OG  . SER E 2 30  ? 31.225  -64.255  5.643   1.00 21.34  ? 30  SER X OG  1 
ATOM   6332  N  N   . ARG E 2 31  ? 30.190  -67.325  4.727   1.00 19.34  ? 31  ARG X N   1 
ATOM   6333  C  CA  . ARG E 2 31  ? 29.294  -68.354  5.294   1.00 19.71  ? 31  ARG X CA  1 
ATOM   6334  C  C   . ARG E 2 31  ? 29.473  -69.758  4.688   1.00 19.11  ? 31  ARG X C   1 
ATOM   6335  O  O   . ARG E 2 31  ? 28.996  -70.745  5.257   1.00 19.14  ? 31  ARG X O   1 
ATOM   6336  C  CB  . ARG E 2 31  ? 27.837  -67.942  5.109   1.00 20.86  ? 31  ARG X CB  1 
ATOM   6337  C  CG  . ARG E 2 31  ? 27.412  -66.768  5.962   1.00 21.86  ? 31  ARG X CG  1 
ATOM   6338  C  CD  . ARG E 2 31  ? 25.909  -66.575  5.938   1.00 23.13  ? 31  ARG X CD  1 
ATOM   6339  N  NE  . ARG E 2 31  ? 25.444  -65.963  7.182   1.00 25.69  ? 31  ARG X NE  1 
ATOM   6340  C  CZ  . ARG E 2 31  ? 24.164  -65.847  7.546   1.00 27.94  ? 31  ARG X CZ  1 
ATOM   6341  N  NH1 . ARG E 2 31  ? 23.179  -66.292  6.765   1.00 27.91  ? 31  ARG X NH1 1 
ATOM   6342  N  NH2 . ARG E 2 31  ? 23.864  -65.275  8.708   1.00 29.00  ? 31  ARG X NH2 1 
ATOM   6343  N  N   . TYR E 2 32  ? 30.161  -69.840  3.549   1.00 18.53  ? 32  TYR X N   1 
ATOM   6344  C  CA  . TYR E 2 32  ? 30.192  -71.050  2.717   1.00 17.25  ? 32  TYR X CA  1 
ATOM   6345  C  C   . TYR E 2 32  ? 31.479  -71.848  2.823   1.00 17.57  ? 32  TYR X C   1 
ATOM   6346  O  O   . TYR E 2 32  ? 32.564  -71.278  2.830   1.00 17.87  ? 32  TYR X O   1 
ATOM   6347  C  CB  . TYR E 2 32  ? 30.006  -70.661  1.250   1.00 16.58  ? 32  TYR X CB  1 
ATOM   6348  C  CG  . TYR E 2 32  ? 28.598  -70.250  0.939   1.00 15.98  ? 32  TYR X CG  1 
ATOM   6349  C  CD1 . TYR E 2 32  ? 27.684  -71.159  0.420   1.00 16.68  ? 32  TYR X CD1 1 
ATOM   6350  C  CD2 . TYR E 2 32  ? 28.169  -68.962  1.202   1.00 15.82  ? 32  TYR X CD2 1 
ATOM   6351  C  CE1 . TYR E 2 32  ? 26.359  -70.781  0.167   1.00 17.35  ? 32  TYR X CE1 1 
ATOM   6352  C  CE2 . TYR E 2 32  ? 26.876  -68.568  0.941   1.00 16.48  ? 32  TYR X CE2 1 
ATOM   6353  C  CZ  . TYR E 2 32  ? 25.974  -69.473  0.426   1.00 17.34  ? 32  TYR X CZ  1 
ATOM   6354  O  OH  . TYR E 2 32  ? 24.695  -69.047  0.194   1.00 18.48  ? 32  TYR X OH  1 
ATOM   6355  N  N   . VAL E 2 33  ? 31.345  -73.172  2.902   1.00 18.08  ? 33  VAL X N   1 
ATOM   6356  C  CA  . VAL E 2 33  ? 32.435  -74.078  2.577   1.00 18.74  ? 33  VAL X CA  1 
ATOM   6357  C  C   . VAL E 2 33  ? 32.764  -73.840  1.102   1.00 18.53  ? 33  VAL X C   1 
ATOM   6358  O  O   . VAL E 2 33  ? 31.864  -73.707  0.284   1.00 21.85  ? 33  VAL X O   1 
ATOM   6359  C  CB  . VAL E 2 33  ? 32.036  -75.566  2.802   1.00 20.00  ? 33  VAL X CB  1 
ATOM   6360  C  CG1 . VAL E 2 33  ? 33.081  -76.516  2.187   1.00 19.73  ? 33  VAL X CG1 1 
ATOM   6361  C  CG2 . VAL E 2 33  ? 31.839  -75.857  4.301   1.00 19.77  ? 33  VAL X CG2 1 
ATOM   6362  N  N   . MET E 2 34  ? 34.046  -73.753  0.782   1.00 19.97  ? 34  MET X N   1 
ATOM   6363  C  CA  . MET E 2 34  ? 34.520  -73.482  -0.579  1.00 21.90  ? 34  MET X CA  1 
ATOM   6364  C  C   . MET E 2 34  ? 35.414  -74.621  -1.038  1.00 22.33  ? 34  MET X C   1 
ATOM   6365  O  O   . MET E 2 34  ? 36.132  -75.220  -0.228  1.00 22.87  ? 34  MET X O   1 
ATOM   6366  C  CB  . MET E 2 34  ? 35.303  -72.163  -0.639  1.00 22.91  ? 34  MET X CB  1 
ATOM   6367  C  CG  . MET E 2 34  ? 34.438  -70.901  -0.430  1.00 23.23  ? 34  MET X CG  1 
ATOM   6368  S  SD  . MET E 2 34  ? 33.090  -70.707  -1.630  1.00 23.65  ? 34  MET X SD  1 
ATOM   6369  C  CE  . MET E 2 34  ? 34.005  -70.550  -3.180  1.00 21.40  ? 34  MET X CE  1 
ATOM   6370  N  N   . TRP E 2 35  ? 35.350  -74.919  -2.338  1.00 22.48  ? 35  TRP X N   1 
ATOM   6371  C  CA  . TRP E 2 35  ? 36.028  -76.069  -2.907  1.00 22.07  ? 35  TRP X CA  1 
ATOM   6372  C  C   . TRP E 2 35  ? 36.897  -75.701  -4.077  1.00 22.36  ? 35  TRP X C   1 
ATOM   6373  O  O   . TRP E 2 35  ? 36.618  -74.740  -4.793  1.00 22.91  ? 35  TRP X O   1 
ATOM   6374  C  CB  . TRP E 2 35  ? 35.013  -77.070  -3.464  1.00 22.01  ? 35  TRP X CB  1 
ATOM   6375  C  CG  . TRP E 2 35  ? 34.024  -77.578  -2.498  1.00 22.57  ? 35  TRP X CG  1 
ATOM   6376  C  CD1 . TRP E 2 35  ? 32.964  -76.893  -1.980  1.00 22.81  ? 35  TRP X CD1 1 
ATOM   6377  C  CD2 . TRP E 2 35  ? 33.958  -78.899  -1.958  1.00 21.84  ? 35  TRP X CD2 1 
ATOM   6378  N  NE1 . TRP E 2 35  ? 32.253  -77.702  -1.130  1.00 24.25  ? 35  TRP X NE1 1 
ATOM   6379  C  CE2 . TRP E 2 35  ? 32.834  -78.941  -1.098  1.00 22.53  ? 35  TRP X CE2 1 
ATOM   6380  C  CE3 . TRP E 2 35  ? 34.734  -80.056  -2.116  1.00 21.27  ? 35  TRP X CE3 1 
ATOM   6381  C  CZ2 . TRP E 2 35  ? 32.463  -80.100  -0.394  1.00 21.19  ? 35  TRP X CZ2 1 
ATOM   6382  C  CZ3 . TRP E 2 35  ? 34.371  -81.208  -1.409  1.00 21.09  ? 35  TRP X CZ3 1 
ATOM   6383  C  CH2 . TRP E 2 35  ? 33.246  -81.218  -0.560  1.00 20.41  ? 35  TRP X CH2 1 
ATOM   6384  N  N   . TRP E 2 36  ? 37.920  -76.519  -4.295  1.00 22.18  ? 36  TRP X N   1 
ATOM   6385  C  CA  . TRP E 2 36  ? 38.539  -76.643  -5.607  1.00 23.38  ? 36  TRP X CA  1 
ATOM   6386  C  C   . TRP E 2 36  ? 38.170  -78.018  -6.172  1.00 24.25  ? 36  TRP X C   1 
ATOM   6387  O  O   . TRP E 2 36  ? 38.227  -79.024  -5.463  1.00 24.74  ? 36  TRP X O   1 
ATOM   6388  C  CB  . TRP E 2 36  ? 40.057  -76.460  -5.519  1.00 22.05  ? 36  TRP X CB  1 
ATOM   6389  C  CG  . TRP E 2 36  ? 40.442  -75.030  -5.232  1.00 21.67  ? 36  TRP X CG  1 
ATOM   6390  C  CD1 . TRP E 2 36  ? 40.737  -74.492  -4.011  1.00 20.84  ? 36  TRP X CD1 1 
ATOM   6391  C  CD2 . TRP E 2 36  ? 40.555  -73.956  -6.181  1.00 21.42  ? 36  TRP X CD2 1 
ATOM   6392  N  NE1 . TRP E 2 36  ? 41.029  -73.155  -4.141  1.00 20.52  ? 36  TRP X NE1 1 
ATOM   6393  C  CE2 . TRP E 2 36  ? 40.927  -72.800  -5.461  1.00 20.48  ? 36  TRP X CE2 1 
ATOM   6394  C  CE3 . TRP E 2 36  ? 40.373  -73.858  -7.566  1.00 22.28  ? 36  TRP X CE3 1 
ATOM   6395  C  CZ2 . TRP E 2 36  ? 41.123  -71.566  -6.076  1.00 19.81  ? 36  TRP X CZ2 1 
ATOM   6396  C  CZ3 . TRP E 2 36  ? 40.575  -72.621  -8.182  1.00 21.73  ? 36  TRP X CZ3 1 
ATOM   6397  C  CH2 . TRP E 2 36  ? 40.947  -71.497  -7.433  1.00 21.25  ? 36  TRP X CH2 1 
ATOM   6398  N  N   . VAL E 2 37  ? 37.743  -78.036  -7.434  1.00 24.60  ? 37  VAL X N   1 
ATOM   6399  C  CA  . VAL E 2 37  ? 37.382  -79.261  -8.133  1.00 23.51  ? 37  VAL X CA  1 
ATOM   6400  C  C   . VAL E 2 37  ? 38.066  -79.190  -9.488  1.00 25.37  ? 37  VAL X C   1 
ATOM   6401  O  O   . VAL E 2 37  ? 38.041  -78.137  -10.138 1.00 27.64  ? 37  VAL X O   1 
ATOM   6402  C  CB  . VAL E 2 37  ? 35.866  -79.357  -8.337  1.00 23.96  ? 37  VAL X CB  1 
ATOM   6403  C  CG1 . VAL E 2 37  ? 35.467  -80.706  -9.017  1.00 21.10  ? 37  VAL X CG1 1 
ATOM   6404  C  CG2 . VAL E 2 37  ? 35.134  -79.138  -7.006  1.00 22.35  ? 37  VAL X CG2 1 
ATOM   6405  N  N   . ARG E 2 38  ? 38.685  -80.287  -9.915  1.00 22.61  ? 38  ARG X N   1 
ATOM   6406  C  CA  . ARG E 2 38  ? 39.399  -80.278  -11.180 1.00 22.61  ? 38  ARG X CA  1 
ATOM   6407  C  C   . ARG E 2 38  ? 38.886  -81.320  -12.157 1.00 21.50  ? 38  ARG X C   1 
ATOM   6408  O  O   . ARG E 2 38  ? 38.238  -82.286  -11.767 1.00 21.54  ? 38  ARG X O   1 
ATOM   6409  C  CB  . ARG E 2 38  ? 40.912  -80.427  -10.971 1.00 21.56  ? 38  ARG X CB  1 
ATOM   6410  C  CG  . ARG E 2 38  ? 41.356  -81.796  -10.519 1.00 21.14  ? 38  ARG X CG  1 
ATOM   6411  C  CD  . ARG E 2 38  ? 42.833  -81.796  -10.150 1.00 20.79  ? 38  ARG X CD  1 
ATOM   6412  N  NE  . ARG E 2 38  ? 43.258  -83.139  -9.782  1.00 21.12  ? 38  ARG X NE  1 
ATOM   6413  C  CZ  . ARG E 2 38  ? 44.477  -83.462  -9.359  1.00 20.24  ? 38  ARG X CZ  1 
ATOM   6414  N  NH1 . ARG E 2 38  ? 45.433  -82.550  -9.248  1.00 19.58  ? 38  ARG X NH1 1 
ATOM   6415  N  NH2 . ARG E 2 38  ? 44.742  -84.720  -9.051  1.00 20.50  ? 38  ARG X NH2 1 
ATOM   6416  N  N   . GLN E 2 39  ? 39.177  -81.094  -13.434 1.00 21.46  ? 39  GLN X N   1 
ATOM   6417  C  CA  . GLN E 2 39  ? 38.748  -81.989  -14.495 1.00 22.23  ? 39  GLN X CA  1 
ATOM   6418  C  C   . GLN E 2 39  ? 39.860  -82.116  -15.503 1.00 22.82  ? 39  GLN X C   1 
ATOM   6419  O  O   . GLN E 2 39  ? 40.162  -81.165  -16.207 1.00 23.61  ? 39  GLN X O   1 
ATOM   6420  C  CB  . GLN E 2 39  ? 37.502  -81.438  -15.171 1.00 22.69  ? 39  GLN X CB  1 
ATOM   6421  C  CG  . GLN E 2 39  ? 36.863  -82.382  -16.162 1.00 23.34  ? 39  GLN X CG  1 
ATOM   6422  C  CD  . GLN E 2 39  ? 35.458  -81.949  -16.520 1.00 25.09  ? 39  GLN X CD  1 
ATOM   6423  O  OE1 . GLN E 2 39  ? 35.163  -80.746  -16.590 1.00 25.34  ? 39  GLN X OE1 1 
ATOM   6424  N  NE2 . GLN E 2 39  ? 34.570  -82.925  -16.734 1.00 24.45  ? 39  GLN X NE2 1 
ATOM   6425  N  N   . ALA E 2 40  ? 40.485  -83.286  -15.556 1.00 23.51  ? 40  ALA X N   1 
ATOM   6426  C  CA  . ALA E 2 40  ? 41.482  -83.560  -16.575 1.00 25.44  ? 40  ALA X CA  1 
ATOM   6427  C  C   . ALA E 2 40  ? 40.769  -83.699  -17.928 1.00 27.33  ? 40  ALA X C   1 
ATOM   6428  O  O   . ALA E 2 40  ? 39.571  -84.001  -17.975 1.00 26.87  ? 40  ALA X O   1 
ATOM   6429  C  CB  . ALA E 2 40  ? 42.273  -84.822  -16.230 1.00 24.27  ? 40  ALA X CB  1 
ATOM   6430  N  N   . PRO E 2 41  ? 41.499  -83.472  -19.035 1.00 29.12  ? 41  PRO X N   1 
ATOM   6431  C  CA  . PRO E 2 41  ? 40.831  -83.413  -20.342 1.00 29.63  ? 41  PRO X CA  1 
ATOM   6432  C  C   . PRO E 2 41  ? 40.129  -84.728  -20.689 1.00 29.80  ? 41  PRO X C   1 
ATOM   6433  O  O   . PRO E 2 41  ? 40.751  -85.792  -20.643 1.00 29.24  ? 41  PRO X O   1 
ATOM   6434  C  CB  . PRO E 2 41  ? 41.976  -83.120  -21.331 1.00 29.78  ? 41  PRO X CB  1 
ATOM   6435  C  CG  . PRO E 2 41  ? 43.204  -82.888  -20.510 1.00 29.83  ? 41  PRO X CG  1 
ATOM   6436  C  CD  . PRO E 2 41  ? 42.969  -83.473  -19.155 1.00 29.60  ? 41  PRO X CD  1 
ATOM   6437  N  N   . GLY E 2 42  ? 38.839  -84.646  -21.002 1.00 30.56  ? 42  GLY X N   1 
ATOM   6438  C  CA  . GLY E 2 42  ? 38.039  -85.826  -21.343 1.00 31.38  ? 42  GLY X CA  1 
ATOM   6439  C  C   . GLY E 2 42  ? 37.761  -86.760  -20.170 1.00 32.43  ? 42  GLY X C   1 
ATOM   6440  O  O   . GLY E 2 42  ? 37.441  -87.934  -20.375 1.00 33.09  ? 42  GLY X O   1 
ATOM   6441  N  N   . LYS E 2 43  ? 37.874  -86.242  -18.947 1.00 32.44  ? 43  LYS X N   1 
ATOM   6442  C  CA  . LYS E 2 43  ? 37.668  -87.037  -17.734 1.00 31.73  ? 43  LYS X CA  1 
ATOM   6443  C  C   . LYS E 2 43  ? 36.616  -86.393  -16.833 1.00 30.11  ? 43  LYS X C   1 
ATOM   6444  O  O   . LYS E 2 43  ? 36.056  -85.341  -17.171 1.00 28.90  ? 43  LYS X O   1 
ATOM   6445  C  CB  . LYS E 2 43  ? 38.990  -87.208  -16.982 1.00 32.60  ? 43  LYS X CB  1 
ATOM   6446  C  CG  . LYS E 2 43  ? 40.115  -87.798  -17.826 1.00 33.26  ? 43  LYS X CG  1 
ATOM   6447  C  CD  . LYS E 2 43  ? 39.769  -89.199  -18.325 1.00 34.11  ? 43  LYS X CD  1 
ATOM   6448  C  CE  . LYS E 2 43  ? 40.784  -89.729  -19.329 1.00 34.65  ? 43  LYS X CE  1 
ATOM   6449  N  NZ  . LYS E 2 43  ? 40.179  -90.809  -20.177 1.00 34.72  ? 43  LYS X NZ  1 
ATOM   6450  N  N   . GLY E 2 44  ? 36.341  -87.042  -15.700 1.00 28.13  ? 44  GLY X N   1 
ATOM   6451  C  CA  . GLY E 2 44  ? 35.293  -86.599  -14.780 1.00 26.43  ? 44  GLY X CA  1 
ATOM   6452  C  C   . GLY E 2 44  ? 35.741  -85.544  -13.795 1.00 23.85  ? 44  GLY X C   1 
ATOM   6453  O  O   . GLY E 2 44  ? 36.904  -85.154  -13.770 1.00 25.69  ? 44  GLY X O   1 
ATOM   6454  N  N   . LEU E 2 45  ? 34.810  -85.090  -12.968 1.00 22.58  ? 45  LEU X N   1 
ATOM   6455  C  CA  . LEU E 2 45  ? 35.077  -84.030  -11.996 1.00 21.42  ? 45  LEU X CA  1 
ATOM   6456  C  C   . LEU E 2 45  ? 35.644  -84.638  -10.725 1.00 21.60  ? 45  LEU X C   1 
ATOM   6457  O  O   . LEU E 2 45  ? 35.063  -85.558  -10.167 1.00 21.30  ? 45  LEU X O   1 
ATOM   6458  C  CB  . LEU E 2 45  ? 33.789  -83.246  -11.693 1.00 21.68  ? 45  LEU X CB  1 
ATOM   6459  C  CG  . LEU E 2 45  ? 33.227  -82.360  -12.829 1.00 21.04  ? 45  LEU X CG  1 
ATOM   6460  C  CD1 . LEU E 2 45  ? 31.710  -82.159  -12.705 1.00 18.28  ? 45  LEU X CD1 1 
ATOM   6461  C  CD2 . LEU E 2 45  ? 33.951  -81.004  -12.871 1.00 21.02  ? 45  LEU X CD2 1 
ATOM   6462  N  N   . GLU E 2 46  ? 36.784  -84.124  -10.272 1.00 22.72  ? 46  GLU X N   1 
ATOM   6463  C  CA  . GLU E 2 46  ? 37.444  -84.631  -9.070  1.00 23.97  ? 46  GLU X CA  1 
ATOM   6464  C  C   . GLU E 2 46  ? 37.631  -83.500  -8.064  1.00 22.72  ? 46  GLU X C   1 
ATOM   6465  O  O   . GLU E 2 46  ? 38.358  -82.551  -8.342  1.00 23.45  ? 46  GLU X O   1 
ATOM   6466  C  CB  . GLU E 2 46  ? 38.813  -85.221  -9.432  1.00 25.43  ? 46  GLU X CB  1 
ATOM   6467  C  CG  . GLU E 2 46  ? 39.585  -85.806  -8.226  1.00 27.10  ? 46  GLU X CG  1 
ATOM   6468  C  CD  . GLU E 2 46  ? 41.065  -86.087  -8.504  1.00 27.75  ? 46  GLU X CD  1 
ATOM   6469  O  OE1 . GLU E 2 46  ? 41.600  -85.623  -9.535  1.00 26.46  ? 46  GLU X OE1 1 
ATOM   6470  O  OE2 . GLU E 2 46  ? 41.695  -86.783  -7.673  1.00 29.27  ? 46  GLU X OE2 1 
ATOM   6471  N  N   . TRP E 2 47  ? 36.996  -83.589  -6.896  1.00 21.98  ? 47  TRP X N   1 
ATOM   6472  C  CA  . TRP E 2 47  ? 37.257  -82.601  -5.852  1.00 21.82  ? 47  TRP X CA  1 
ATOM   6473  C  C   . TRP E 2 47  ? 38.647  -82.890  -5.285  1.00 21.56  ? 47  TRP X C   1 
ATOM   6474  O  O   . TRP E 2 47  ? 39.024  -84.047  -5.078  1.00 20.18  ? 47  TRP X O   1 
ATOM   6475  C  CB  . TRP E 2 47  ? 36.160  -82.587  -4.768  1.00 23.35  ? 47  TRP X CB  1 
ATOM   6476  C  CG  . TRP E 2 47  ? 36.216  -83.720  -3.793  1.00 23.02  ? 47  TRP X CG  1 
ATOM   6477  C  CD1 . TRP E 2 47  ? 35.555  -84.909  -3.882  1.00 23.05  ? 47  TRP X CD1 1 
ATOM   6478  C  CD2 . TRP E 2 47  ? 36.970  -83.770  -2.576  1.00 22.97  ? 47  TRP X CD2 1 
ATOM   6479  N  NE1 . TRP E 2 47  ? 35.860  -85.702  -2.806  1.00 22.50  ? 47  TRP X NE1 1 
ATOM   6480  C  CE2 . TRP E 2 47  ? 36.727  -85.031  -1.988  1.00 22.71  ? 47  TRP X CE2 1 
ATOM   6481  C  CE3 . TRP E 2 47  ? 37.832  -82.875  -1.927  1.00 21.91  ? 47  TRP X CE3 1 
ATOM   6482  C  CZ2 . TRP E 2 47  ? 37.311  -85.419  -0.779  1.00 23.08  ? 47  TRP X CZ2 1 
ATOM   6483  C  CZ3 . TRP E 2 47  ? 38.412  -83.259  -0.724  1.00 21.94  ? 47  TRP X CZ3 1 
ATOM   6484  C  CH2 . TRP E 2 47  ? 38.156  -84.520  -0.166  1.00 22.63  ? 47  TRP X CH2 1 
ATOM   6485  N  N   . VAL E 2 48  ? 39.438  -81.840  -5.104  1.00 22.88  ? 48  VAL X N   1 
ATOM   6486  C  CA  . VAL E 2 48  ? 40.786  -82.002  -4.571  1.00 23.58  ? 48  VAL X CA  1 
ATOM   6487  C  C   . VAL E 2 48  ? 40.952  -81.377  -3.187  1.00 24.53  ? 48  VAL X C   1 
ATOM   6488  O  O   . VAL E 2 48  ? 41.835  -81.785  -2.420  1.00 24.20  ? 48  VAL X O   1 
ATOM   6489  C  CB  . VAL E 2 48  ? 41.861  -81.462  -5.541  1.00 22.49  ? 48  VAL X CB  1 
ATOM   6490  C  CG1 . VAL E 2 48  ? 41.846  -82.274  -6.836  1.00 23.20  ? 48  VAL X CG1 1 
ATOM   6491  C  CG2 . VAL E 2 48  ? 41.669  -79.980  -5.808  1.00 22.00  ? 48  VAL X CG2 1 
ATOM   6492  N  N   . SER E 2 49  ? 40.119  -80.392  -2.866  1.00 25.24  ? 49  SER X N   1 
ATOM   6493  C  CA  . SER E 2 49  ? 40.245  -79.709  -1.584  1.00 25.80  ? 49  SER X CA  1 
ATOM   6494  C  C   . SER E 2 49  ? 39.011  -78.894  -1.228  1.00 23.40  ? 49  SER X C   1 
ATOM   6495  O  O   . SER E 2 49  ? 38.283  -78.433  -2.119  1.00 20.20  ? 49  SER X O   1 
ATOM   6496  C  CB  . SER E 2 49  ? 41.478  -78.789  -1.586  1.00 26.38  ? 49  SER X CB  1 
ATOM   6497  O  OG  . SER E 2 49  ? 41.789  -78.356  -0.272  1.00 27.54  ? 49  SER X OG  1 
ATOM   6498  N  N   . TYR E 2 50  ? 38.784  -78.748  0.080   1.00 21.19  ? 50  TYR X N   1 
ATOM   6499  C  CA  . TYR E 2 50  ? 37.823  -77.783  0.591   1.00 20.04  ? 50  TYR X CA  1 
ATOM   6500  C  C   . TYR E 2 50  ? 38.200  -77.196  1.954   1.00 20.13  ? 50  TYR X C   1 
ATOM   6501  O  O   . TYR E 2 50  ? 39.064  -77.722  2.666   1.00 20.08  ? 50  TYR X O   1 
ATOM   6502  C  CB  . TYR E 2 50  ? 36.403  -78.361  0.606   1.00 20.17  ? 50  TYR X CB  1 
ATOM   6503  C  CG  . TYR E 2 50  ? 36.114  -79.469  1.599   1.00 18.58  ? 50  TYR X CG  1 
ATOM   6504  C  CD1 . TYR E 2 50  ? 35.524  -79.189  2.815   1.00 18.66  ? 50  TYR X CD1 1 
ATOM   6505  C  CD2 . TYR E 2 50  ? 36.384  -80.797  1.293   1.00 18.28  ? 50  TYR X CD2 1 
ATOM   6506  C  CE1 . TYR E 2 50  ? 35.229  -80.204  3.725   1.00 19.09  ? 50  TYR X CE1 1 
ATOM   6507  C  CE2 . TYR E 2 50  ? 36.098  -81.813  2.189   1.00 18.43  ? 50  TYR X CE2 1 
ATOM   6508  C  CZ  . TYR E 2 50  ? 35.516  -81.509  3.400   1.00 19.02  ? 50  TYR X CZ  1 
ATOM   6509  O  OH  . TYR E 2 50  ? 35.230  -82.512  4.295   1.00 20.41  ? 50  TYR X OH  1 
ATOM   6510  N  N   . ILE E 2 51  ? 37.530  -76.091  2.281   1.00 19.89  ? 51  ILE X N   1 
ATOM   6511  C  CA  . ILE E 2 51  ? 37.853  -75.260  3.421   1.00 19.08  ? 51  ILE X CA  1 
ATOM   6512  C  C   . ILE E 2 51  ? 36.564  -74.757  4.064   1.00 19.66  ? 51  ILE X C   1 
ATOM   6513  O  O   . ILE E 2 51  ? 35.659  -74.285  3.380   1.00 19.12  ? 51  ILE X O   1 
ATOM   6514  C  CB  . ILE E 2 51  ? 38.788  -74.074  2.995   1.00 20.14  ? 51  ILE X CB  1 
ATOM   6515  C  CG1 . ILE E 2 51  ? 39.272  -73.288  4.217   1.00 20.76  ? 51  ILE X CG1 1 
ATOM   6516  C  CG2 . ILE E 2 51  ? 38.104  -73.159  1.972   1.00 19.41  ? 51  ILE X CG2 1 
ATOM   6517  C  CD1 . ILE E 2 51  ? 40.482  -72.379  3.958   1.00 17.05  ? 51  ILE X CD1 1 
ATOM   6518  N  N   . TRP E 2 52  ? 36.483  -74.893  5.386   1.00 21.33  ? 52  TRP X N   1 
ATOM   6519  C  CA  . TRP E 2 52  ? 35.359  -74.379  6.175   1.00 21.77  ? 52  TRP X CA  1 
ATOM   6520  C  C   . TRP E 2 52  ? 35.294  -72.851  6.097   1.00 21.79  ? 52  TRP X C   1 
ATOM   6521  O  O   . TRP E 2 52  ? 36.300  -72.215  5.804   1.00 23.30  ? 52  TRP X O   1 
ATOM   6522  C  CB  . TRP E 2 52  ? 35.501  -74.816  7.640   1.00 22.40  ? 52  TRP X CB  1 
ATOM   6523  C  CG  . TRP E 2 52  ? 35.117  -76.252  7.909   1.00 23.82  ? 52  TRP X CG  1 
ATOM   6524  C  CD1 . TRP E 2 52  ? 35.055  -77.279  7.003   1.00 24.37  ? 52  TRP X CD1 1 
ATOM   6525  C  CD2 . TRP E 2 52  ? 34.767  -76.816  9.176   1.00 23.61  ? 52  TRP X CD2 1 
ATOM   6526  N  NE1 . TRP E 2 52  ? 34.673  -78.435  7.631   1.00 26.04  ? 52  TRP X NE1 1 
ATOM   6527  C  CE2 . TRP E 2 52  ? 34.502  -78.179  8.968   1.00 24.96  ? 52  TRP X CE2 1 
ATOM   6528  C  CE3 . TRP E 2 52  ? 34.647  -76.294  10.468  1.00 25.86  ? 52  TRP X CE3 1 
ATOM   6529  C  CZ2 . TRP E 2 52  ? 34.117  -79.029  9.996   1.00 25.31  ? 52  TRP X CZ2 1 
ATOM   6530  C  CZ3 . TRP E 2 52  ? 34.270  -77.148  11.500  1.00 26.42  ? 52  TRP X CZ3 1 
ATOM   6531  C  CH2 . TRP E 2 52  ? 34.013  -78.499  11.253  1.00 26.14  ? 52  TRP X CH2 1 
ATOM   6532  N  N   . PRO E 2 53  ? 34.116  -72.264  6.379   1.00 22.89  ? 53  PRO X N   1 
ATOM   6533  C  CA  . PRO E 2 53  ? 33.878  -70.824  6.294   1.00 24.79  ? 53  PRO X CA  1 
ATOM   6534  C  C   . PRO E 2 53  ? 34.910  -69.955  7.023   1.00 26.62  ? 53  PRO X C   1 
ATOM   6535  O  O   . PRO E 2 53  ? 35.432  -69.007  6.444   1.00 27.78  ? 53  PRO X O   1 
ATOM   6536  C  CB  . PRO E 2 53  ? 32.496  -70.679  6.934   1.00 24.40  ? 53  PRO X CB  1 
ATOM   6537  C  CG  . PRO E 2 53  ? 31.833  -71.947  6.632   1.00 24.07  ? 53  PRO X CG  1 
ATOM   6538  C  CD  . PRO E 2 53  ? 32.900  -72.968  6.824   1.00 23.10  ? 53  PRO X CD  1 
ATOM   6539  N  N   . SER E 2 54  ? 35.201  -70.286  8.276   1.00 29.12  ? 54  SER X N   1 
ATOM   6540  C  CA  . SER E 2 54  ? 36.201  -69.560  9.065   1.00 31.67  ? 54  SER X CA  1 
ATOM   6541  C  C   . SER E 2 54  ? 37.607  -69.742  8.483   1.00 34.19  ? 54  SER X C   1 
ATOM   6542  O  O   . SER E 2 54  ? 38.454  -68.849  8.593   1.00 36.23  ? 54  SER X O   1 
ATOM   6543  C  CB  . SER E 2 54  ? 36.177  -70.036  10.512  1.00 31.96  ? 54  SER X CB  1 
ATOM   6544  O  OG  . SER E 2 54  ? 36.194  -71.459  10.558  1.00 34.44  ? 54  SER X OG  1 
ATOM   6545  N  N   . GLY E 2 55  ? 37.849  -70.889  7.852   1.00 35.31  ? 55  GLY X N   1 
ATOM   6546  C  CA  . GLY E 2 55  ? 39.124  -71.145  7.192   1.00 36.45  ? 55  GLY X CA  1 
ATOM   6547  C  C   . GLY E 2 55  ? 40.106  -71.935  8.038   1.00 36.90  ? 55  GLY X C   1 
ATOM   6548  O  O   . GLY E 2 55  ? 41.253  -72.150  7.631   1.00 38.61  ? 55  GLY X O   1 
ATOM   6549  N  N   . GLY E 2 56  ? 39.666  -72.362  9.219   1.00 35.47  ? 56  GLY X N   1 
ATOM   6550  C  CA  . GLY E 2 56  ? 40.472  -73.222  10.060  1.00 34.39  ? 56  GLY X CA  1 
ATOM   6551  C  C   . GLY E 2 56  ? 40.623  -74.565  9.376   1.00 33.54  ? 56  GLY X C   1 
ATOM   6552  O  O   . GLY E 2 56  ? 41.660  -74.846  8.773   1.00 36.74  ? 56  GLY X O   1 
ATOM   6553  N  N   . ASN E 2 57  ? 39.570  -75.376  9.435   1.00 30.38  ? 57  ASN X N   1 
ATOM   6554  C  CA  . ASN E 2 57  ? 39.619  -76.738  8.929   1.00 27.43  ? 57  ASN X CA  1 
ATOM   6555  C  C   . ASN E 2 57  ? 39.773  -76.789  7.411   1.00 25.04  ? 57  ASN X C   1 
ATOM   6556  O  O   . ASN E 2 57  ? 39.037  -76.126  6.681   1.00 24.12  ? 57  ASN X O   1 
ATOM   6557  C  CB  . ASN E 2 57  ? 38.368  -77.512  9.347   1.00 27.97  ? 57  ASN X CB  1 
ATOM   6558  C  CG  . ASN E 2 57  ? 38.218  -77.625  10.858  1.00 27.91  ? 57  ASN X CG  1 
ATOM   6559  O  OD1 . ASN E 2 57  ? 38.982  -77.038  11.608  1.00 28.39  ? 57  ASN X OD1 1 
ATOM   6560  N  ND2 . ASN E 2 57  ? 37.218  -78.384  11.304  1.00 28.41  ? 57  ASN X ND2 1 
ATOM   6561  N  N   . THR E 2 58  ? 40.743  -77.579  6.956   1.00 24.04  ? 58  THR X N   1 
ATOM   6562  C  CA  . THR E 2 58  ? 40.976  -77.820  5.531   1.00 23.70  ? 58  THR X CA  1 
ATOM   6563  C  C   . THR E 2 58  ? 41.034  -79.323  5.246   1.00 22.39  ? 58  THR X C   1 
ATOM   6564  O  O   . THR E 2 58  ? 41.313  -80.117  6.140   1.00 21.51  ? 58  THR X O   1 
ATOM   6565  C  CB  . THR E 2 58  ? 42.279  -77.171  5.071   1.00 22.52  ? 58  THR X CB  1 
ATOM   6566  O  OG1 . THR E 2 58  ? 43.365  -77.741  5.805   1.00 22.18  ? 58  THR X OG1 1 
ATOM   6567  C  CG2 . THR E 2 58  ? 42.237  -75.660  5.291   1.00 21.00  ? 58  THR X CG2 1 
ATOM   6568  N  N   . TYR E 2 59  ? 40.757  -79.695  3.999   1.00 22.21  ? 59  TYR X N   1 
ATOM   6569  C  CA  . TYR E 2 59  ? 40.639  -81.105  3.596   1.00 22.13  ? 59  TYR X CA  1 
ATOM   6570  C  C   . TYR E 2 59  ? 41.165  -81.302  2.185   1.00 22.63  ? 59  TYR X C   1 
ATOM   6571  O  O   . TYR E 2 59  ? 41.105  -80.386  1.355   1.00 22.41  ? 59  TYR X O   1 
ATOM   6572  C  CB  . TYR E 2 59  ? 39.181  -81.581  3.676   1.00 21.13  ? 59  TYR X CB  1 
ATOM   6573  C  CG  . TYR E 2 59  ? 38.583  -81.371  5.049   1.00 21.00  ? 59  TYR X CG  1 
ATOM   6574  C  CD1 . TYR E 2 59  ? 38.590  -82.384  6.002   1.00 20.16  ? 59  TYR X CD1 1 
ATOM   6575  C  CD2 . TYR E 2 59  ? 38.053  -80.136  5.407   1.00 20.41  ? 59  TYR X CD2 1 
ATOM   6576  C  CE1 . TYR E 2 59  ? 38.065  -82.169  7.275   1.00 20.56  ? 59  TYR X CE1 1 
ATOM   6577  C  CE2 . TYR E 2 59  ? 37.534  -79.913  6.663   1.00 19.77  ? 59  TYR X CE2 1 
ATOM   6578  C  CZ  . TYR E 2 59  ? 37.534  -80.926  7.594   1.00 20.75  ? 59  TYR X CZ  1 
ATOM   6579  O  OH  . TYR E 2 59  ? 37.013  -80.674  8.845   1.00 21.80  ? 59  TYR X OH  1 
ATOM   6580  N  N   . TYR E 2 60  ? 41.680  -82.500  1.920   1.00 22.84  ? 60  TYR X N   1 
ATOM   6581  C  CA  . TYR E 2 60  ? 42.388  -82.771  0.681   1.00 23.16  ? 60  TYR X CA  1 
ATOM   6582  C  C   . TYR E 2 60  ? 42.125  -84.189  0.193   1.00 23.77  ? 60  TYR X C   1 
ATOM   6583  O  O   . TYR E 2 60  ? 42.113  -85.145  0.981   1.00 24.09  ? 60  TYR X O   1 
ATOM   6584  C  CB  . TYR E 2 60  ? 43.903  -82.554  0.873   1.00 23.74  ? 60  TYR X CB  1 
ATOM   6585  C  CG  . TYR E 2 60  ? 44.258  -81.162  1.355   1.00 23.31  ? 60  TYR X CG  1 
ATOM   6586  C  CD1 . TYR E 2 60  ? 44.440  -80.115  0.455   1.00 22.98  ? 60  TYR X CD1 1 
ATOM   6587  C  CD2 . TYR E 2 60  ? 44.384  -80.889  2.715   1.00 22.92  ? 60  TYR X CD2 1 
ATOM   6588  C  CE1 . TYR E 2 60  ? 44.746  -78.828  0.893   1.00 23.09  ? 60  TYR X CE1 1 
ATOM   6589  C  CE2 . TYR E 2 60  ? 44.679  -79.606  3.163   1.00 23.51  ? 60  TYR X CE2 1 
ATOM   6590  C  CZ  . TYR E 2 60  ? 44.862  -78.578  2.247   1.00 24.11  ? 60  TYR X CZ  1 
ATOM   6591  O  OH  . TYR E 2 60  ? 45.170  -77.310  2.695   1.00 25.17  ? 60  TYR X OH  1 
ATOM   6592  N  N   . ALA E 2 61  ? 41.922  -84.317  -1.114  1.00 23.62  ? 61  ALA X N   1 
ATOM   6593  C  CA  . ALA E 2 61  ? 41.950  -85.615  -1.774  1.00 23.79  ? 61  ALA X CA  1 
ATOM   6594  C  C   . ALA E 2 61  ? 43.345  -86.239  -1.625  1.00 23.64  ? 61  ALA X C   1 
ATOM   6595  O  O   . ALA E 2 61  ? 44.353  -85.538  -1.695  1.00 23.28  ? 61  ALA X O   1 
ATOM   6596  C  CB  . ALA E 2 61  ? 41.587  -85.466  -3.247  1.00 22.93  ? 61  ALA X CB  1 
ATOM   6597  N  N   . ASP E 2 62  ? 43.396  -87.552  -1.422  1.00 23.76  ? 62  ASP X N   1 
ATOM   6598  C  CA  . ASP E 2 62  ? 44.664  -88.264  -1.292  1.00 25.18  ? 62  ASP X CA  1 
ATOM   6599  C  C   . ASP E 2 62  ? 45.595  -88.027  -2.484  1.00 25.80  ? 62  ASP X C   1 
ATOM   6600  O  O   . ASP E 2 62  ? 46.810  -88.107  -2.344  1.00 26.33  ? 62  ASP X O   1 
ATOM   6601  C  CB  . ASP E 2 62  ? 44.434  -89.770  -1.116  1.00 26.18  ? 62  ASP X CB  1 
ATOM   6602  C  CG  . ASP E 2 62  ? 43.914  -90.131  0.267   1.00 28.14  ? 62  ASP X CG  1 
ATOM   6603  O  OD1 . ASP E 2 62  ? 43.405  -89.239  0.985   1.00 28.83  ? 62  ASP X OD1 1 
ATOM   6604  O  OD2 . ASP E 2 62  ? 44.018  -91.320  0.642   1.00 29.86  ? 62  ASP X OD2 1 
ATOM   6605  N  N   . SER E 2 63  ? 45.029  -87.736  -3.651  1.00 26.89  ? 63  SER X N   1 
ATOM   6606  C  CA  . SER E 2 63  ? 45.835  -87.435  -4.830  1.00 26.78  ? 63  SER X CA  1 
ATOM   6607  C  C   . SER E 2 63  ? 46.707  -86.185  -4.655  1.00 25.99  ? 63  SER X C   1 
ATOM   6608  O  O   . SER E 2 63  ? 47.723  -86.067  -5.320  1.00 26.48  ? 63  SER X O   1 
ATOM   6609  C  CB  . SER E 2 63  ? 44.940  -87.281  -6.069  1.00 26.92  ? 63  SER X CB  1 
ATOM   6610  O  OG  . SER E 2 63  ? 44.103  -86.137  -5.965  1.00 27.94  ? 63  SER X OG  1 
ATOM   6611  N  N   . VAL E 2 64  ? 46.312  -85.269  -3.767  1.00 25.47  ? 64  VAL X N   1 
ATOM   6612  C  CA  . VAL E 2 64  ? 46.979  -83.968  -3.619  1.00 24.60  ? 64  VAL X CA  1 
ATOM   6613  C  C   . VAL E 2 64  ? 47.489  -83.656  -2.204  1.00 25.15  ? 64  VAL X C   1 
ATOM   6614  O  O   . VAL E 2 64  ? 48.088  -82.597  -1.973  1.00 22.92  ? 64  VAL X O   1 
ATOM   6615  C  CB  . VAL E 2 64  ? 46.030  -82.821  -4.042  1.00 24.52  ? 64  VAL X CB  1 
ATOM   6616  C  CG1 . VAL E 2 64  ? 45.529  -83.043  -5.466  1.00 23.80  ? 64  VAL X CG1 1 
ATOM   6617  C  CG2 . VAL E 2 64  ? 44.862  -82.683  -3.061  1.00 22.24  ? 64  VAL X CG2 1 
ATOM   6618  N  N   . LYS E 2 65  ? 47.268  -84.568  -1.261  1.00 26.91  ? 65  LYS X N   1 
ATOM   6619  C  CA  . LYS E 2 65  ? 47.616  -84.311  0.131   1.00 27.59  ? 65  LYS X CA  1 
ATOM   6620  C  C   . LYS E 2 65  ? 49.129  -84.157  0.295   1.00 27.87  ? 65  LYS X C   1 
ATOM   6621  O  O   . LYS E 2 65  ? 49.908  -84.913  -0.292  1.00 28.24  ? 65  LYS X O   1 
ATOM   6622  C  CB  . LYS E 2 65  ? 47.095  -85.423  1.037   1.00 29.22  ? 65  LYS X CB  1 
ATOM   6623  C  CG  . LYS E 2 65  ? 47.271  -85.104  2.517   1.00 30.76  ? 65  LYS X CG  1 
ATOM   6624  C  CD  . LYS E 2 65  ? 46.599  -86.123  3.427   1.00 31.95  ? 65  LYS X CD  1 
ATOM   6625  C  CE  . LYS E 2 65  ? 46.095  -85.450  4.697   1.00 33.00  ? 65  LYS X CE  1 
ATOM   6626  N  NZ  . LYS E 2 65  ? 45.075  -84.388  4.381   1.00 33.24  ? 65  LYS X NZ  1 
ATOM   6627  N  N   . GLY E 2 66  ? 49.529  -83.159  1.081   1.00 26.77  ? 66  GLY X N   1 
ATOM   6628  C  CA  . GLY E 2 66  ? 50.933  -82.808  1.253   1.00 24.95  ? 66  GLY X CA  1 
ATOM   6629  C  C   . GLY E 2 66  ? 51.492  -81.859  0.205   1.00 24.30  ? 66  GLY X C   1 
ATOM   6630  O  O   . GLY E 2 66  ? 52.550  -81.280  0.411   1.00 24.67  ? 66  GLY X O   1 
ATOM   6631  N  N   . ARG E 2 67  ? 50.809  -81.693  -0.923  1.00 23.89  ? 67  ARG X N   1 
ATOM   6632  C  CA  . ARG E 2 67  ? 51.365  -80.911  -2.038  1.00 24.56  ? 67  ARG X CA  1 
ATOM   6633  C  C   . ARG E 2 67  ? 50.617  -79.608  -2.288  1.00 24.79  ? 67  ARG X C   1 
ATOM   6634  O  O   . ARG E 2 67  ? 51.225  -78.602  -2.653  1.00 24.84  ? 67  ARG X O   1 
ATOM   6635  C  CB  . ARG E 2 67  ? 51.423  -81.763  -3.311  1.00 24.36  ? 67  ARG X CB  1 
ATOM   6636  C  CG  . ARG E 2 67  ? 52.298  -83.006  -3.134  1.00 24.57  ? 67  ARG X CG  1 
ATOM   6637  C  CD  . ARG E 2 67  ? 52.557  -83.743  -4.428  1.00 24.82  ? 67  ARG X CD  1 
ATOM   6638  N  NE  . ARG E 2 67  ? 51.326  -84.184  -5.077  1.00 25.20  ? 67  ARG X NE  1 
ATOM   6639  C  CZ  . ARG E 2 67  ? 50.762  -83.606  -6.140  1.00 25.89  ? 67  ARG X CZ  1 
ATOM   6640  N  NH1 . ARG E 2 67  ? 51.303  -82.533  -6.714  1.00 26.45  ? 67  ARG X NH1 1 
ATOM   6641  N  NH2 . ARG E 2 67  ? 49.640  -84.109  -6.636  1.00 25.04  ? 67  ARG X NH2 1 
ATOM   6642  N  N   . PHE E 2 68  ? 49.303  -79.636  -2.089  1.00 25.61  ? 68  PHE X N   1 
ATOM   6643  C  CA  . PHE E 2 68  ? 48.450  -78.477  -2.322  1.00 26.52  ? 68  PHE X CA  1 
ATOM   6644  C  C   . PHE E 2 68  ? 48.039  -77.889  -0.971  1.00 26.15  ? 68  PHE X C   1 
ATOM   6645  O  O   . PHE E 2 68  ? 47.925  -78.616  0.022   1.00 24.95  ? 68  PHE X O   1 
ATOM   6646  C  CB  . PHE E 2 68  ? 47.192  -78.878  -3.108  1.00 26.68  ? 68  PHE X CB  1 
ATOM   6647  C  CG  . PHE E 2 68  ? 47.439  -79.281  -4.555  1.00 27.96  ? 68  PHE X CG  1 
ATOM   6648  C  CD1 . PHE E 2 68  ? 48.714  -79.554  -5.048  1.00 29.49  ? 68  PHE X CD1 1 
ATOM   6649  C  CD2 . PHE E 2 68  ? 46.366  -79.430  -5.417  1.00 28.78  ? 68  PHE X CD2 1 
ATOM   6650  C  CE1 . PHE E 2 68  ? 48.904  -79.937  -6.373  1.00 29.15  ? 68  PHE X CE1 1 
ATOM   6651  C  CE2 . PHE E 2 68  ? 46.553  -79.816  -6.739  1.00 28.87  ? 68  PHE X CE2 1 
ATOM   6652  C  CZ  . PHE E 2 68  ? 47.821  -80.067  -7.211  1.00 28.82  ? 68  PHE X CZ  1 
ATOM   6653  N  N   . THR E 2 69  ? 47.812  -76.579  -0.937  1.00 25.41  ? 69  THR X N   1 
ATOM   6654  C  CA  . THR E 2 69  ? 47.280  -75.926  0.254   1.00 24.22  ? 69  THR X CA  1 
ATOM   6655  C  C   . THR E 2 69  ? 46.167  -74.942  -0.114  1.00 24.42  ? 69  THR X C   1 
ATOM   6656  O  O   . THR E 2 69  ? 46.389  -73.985  -0.875  1.00 22.59  ? 69  THR X O   1 
ATOM   6657  C  CB  . THR E 2 69  ? 48.382  -75.189  1.024   1.00 23.23  ? 69  THR X CB  1 
ATOM   6658  O  OG1 . THR E 2 69  ? 49.498  -76.065  1.195   1.00 24.41  ? 69  THR X OG1 1 
ATOM   6659  C  CG2 . THR E 2 69  ? 47.881  -74.725  2.394   1.00 20.72  ? 69  THR X CG2 1 
ATOM   6660  N  N   . ILE E 2 70  ? 44.981  -75.188  0.445   1.00 24.06  ? 70  ILE X N   1 
ATOM   6661  C  CA  . ILE E 2 70  ? 43.823  -74.305  0.271   1.00 24.24  ? 70  ILE X CA  1 
ATOM   6662  C  C   . ILE E 2 70  ? 43.818  -73.248  1.382   1.00 24.53  ? 70  ILE X C   1 
ATOM   6663  O  O   . ILE E 2 70  ? 44.223  -73.518  2.521   1.00 22.86  ? 70  ILE X O   1 
ATOM   6664  C  CB  . ILE E 2 70  ? 42.471  -75.100  0.258   1.00 24.40  ? 70  ILE X CB  1 
ATOM   6665  C  CG1 . ILE E 2 70  ? 41.310  -74.201  -0.186  1.00 24.43  ? 70  ILE X CG1 1 
ATOM   6666  C  CG2 . ILE E 2 70  ? 42.175  -75.727  1.625   1.00 23.90  ? 70  ILE X CG2 1 
ATOM   6667  C  CD1 . ILE E 2 70  ? 40.053  -74.971  -0.601  1.00 23.37  ? 70  ILE X CD1 1 
ATOM   6668  N  N   . SER E 2 71  ? 43.399  -72.036  1.029   1.00 23.57  ? 71  SER X N   1 
ATOM   6669  C  CA  . SER E 2 71  ? 43.227  -70.965  2.003   1.00 23.47  ? 71  SER X CA  1 
ATOM   6670  C  C   . SER E 2 71  ? 42.222  -69.949  1.482   1.00 23.16  ? 71  SER X C   1 
ATOM   6671  O  O   . SER E 2 71  ? 41.778  -70.023  0.340   1.00 23.99  ? 71  SER X O   1 
ATOM   6672  C  CB  . SER E 2 71  ? 44.564  -70.297  2.344   1.00 22.68  ? 71  SER X CB  1 
ATOM   6673  O  OG  . SER E 2 71  ? 45.212  -69.812  1.190   1.00 22.74  ? 71  SER X OG  1 
ATOM   6674  N  N   . ARG E 2 72  ? 41.833  -69.021  2.338   1.00 23.51  ? 72  ARG X N   1 
ATOM   6675  C  CA  . ARG E 2 72  ? 40.811  -68.054  1.981   1.00 24.70  ? 72  ARG X CA  1 
ATOM   6676  C  C   . ARG E 2 72  ? 41.047  -66.756  2.735   1.00 24.42  ? 72  ARG X C   1 
ATOM   6677  O  O   . ARG E 2 72  ? 41.640  -66.755  3.800   1.00 22.72  ? 72  ARG X O   1 
ATOM   6678  C  CB  . ARG E 2 72  ? 39.407  -68.610  2.278   1.00 23.77  ? 72  ARG X CB  1 
ATOM   6679  C  CG  . ARG E 2 72  ? 39.134  -68.885  3.767   1.00 24.07  ? 72  ARG X CG  1 
ATOM   6680  C  CD  . ARG E 2 72  ? 37.903  -69.753  3.979   1.00 24.34  ? 72  ARG X CD  1 
ATOM   6681  N  NE  . ARG E 2 72  ? 36.677  -69.087  3.537   1.00 24.01  ? 72  ARG X NE  1 
ATOM   6682  C  CZ  . ARG E 2 72  ? 35.555  -69.703  3.154   1.00 22.52  ? 72  ARG X CZ  1 
ATOM   6683  N  NH1 . ARG E 2 72  ? 35.465  -71.022  3.117   1.00 22.09  ? 72  ARG X NH1 1 
ATOM   6684  N  NH2 . ARG E 2 72  ? 34.509  -68.977  2.786   1.00 23.39  ? 72  ARG X NH2 1 
ATOM   6685  N  N   . ASP E 2 73  ? 40.589  -65.660  2.144   1.00 26.22  ? 73  ASP X N   1 
ATOM   6686  C  CA  . ASP E 2 73  ? 40.634  -64.343  2.751   1.00 26.38  ? 73  ASP X CA  1 
ATOM   6687  C  C   . ASP E 2 73  ? 39.204  -63.819  2.719   1.00 27.07  ? 73  ASP X C   1 
ATOM   6688  O  O   . ASP E 2 73  ? 38.744  -63.274  1.709   1.00 28.37  ? 73  ASP X O   1 
ATOM   6689  C  CB  . ASP E 2 73  ? 41.579  -63.432  1.962   1.00 26.60  ? 73  ASP X CB  1 
ATOM   6690  C  CG  . ASP E 2 73  ? 41.698  -62.046  2.562   1.00 27.06  ? 73  ASP X CG  1 
ATOM   6691  O  OD1 . ASP E 2 73  ? 40.850  -61.678  3.394   1.00 28.90  ? 73  ASP X OD1 1 
ATOM   6692  O  OD2 . ASP E 2 73  ? 42.637  -61.314  2.199   1.00 26.71  ? 73  ASP X OD2 1 
ATOM   6693  N  N   . ASN E 2 74  ? 38.493  -64.009  3.822   1.00 25.97  ? 74  ASN X N   1 
ATOM   6694  C  CA  . ASN E 2 74  ? 37.109  -63.584  3.907   1.00 25.94  ? 74  ASN X CA  1 
ATOM   6695  C  C   . ASN E 2 74  ? 36.957  -62.065  3.831   1.00 26.18  ? 74  ASN X C   1 
ATOM   6696  O  O   . ASN E 2 74  ? 35.890  -61.577  3.461   1.00 28.58  ? 74  ASN X O   1 
ATOM   6697  C  CB  . ASN E 2 74  ? 36.438  -64.147  5.179   1.00 25.48  ? 74  ASN X CB  1 
ATOM   6698  C  CG  . ASN E 2 74  ? 36.101  -65.637  5.065   1.00 24.50  ? 74  ASN X CG  1 
ATOM   6699  O  OD1 . ASN E 2 74  ? 36.055  -66.196  3.971   1.00 24.99  ? 74  ASN X OD1 1 
ATOM   6700  N  ND2 . ASN E 2 74  ? 35.849  -66.276  6.200   1.00 23.33  ? 74  ASN X ND2 1 
ATOM   6701  N  N   . SER E 2 75  ? 38.015  -61.323  4.153   1.00 25.00  ? 75  SER X N   1 
ATOM   6702  C  CA  . SER E 2 75  ? 37.990  -59.859  4.045   1.00 24.83  ? 75  SER X CA  1 
ATOM   6703  C  C   . SER E 2 75  ? 37.950  -59.367  2.587   1.00 23.76  ? 75  SER X C   1 
ATOM   6704  O  O   . SER E 2 75  ? 37.313  -58.358  2.295   1.00 22.36  ? 75  SER X O   1 
ATOM   6705  C  CB  . SER E 2 75  ? 39.188  -59.242  4.770   1.00 25.20  ? 75  SER X CB  1 
ATOM   6706  O  OG  . SER E 2 75  ? 40.370  -59.369  3.993   1.00 26.75  ? 75  SER X OG  1 
ATOM   6707  N  N   . LYS E 2 76  ? 38.633  -60.074  1.685   1.00 23.96  ? 76  LYS X N   1 
ATOM   6708  C  CA  . LYS E 2 76  ? 38.573  -59.780  0.240   1.00 23.90  ? 76  LYS X CA  1 
ATOM   6709  C  C   . LYS E 2 76  ? 37.648  -60.737  -0.523  1.00 23.22  ? 76  LYS X C   1 
ATOM   6710  O  O   . LYS E 2 76  ? 37.531  -60.648  -1.744  1.00 24.16  ? 76  LYS X O   1 
ATOM   6711  C  CB  . LYS E 2 76  ? 39.969  -59.839  -0.381  1.00 23.34  ? 76  LYS X CB  1 
ATOM   6712  C  CG  . LYS E 2 76  ? 40.950  -58.887  0.243   1.00 24.02  ? 76  LYS X CG  1 
ATOM   6713  C  CD  . LYS E 2 76  ? 42.207  -58.747  -0.581  1.00 23.88  ? 76  LYS X CD  1 
ATOM   6714  C  CE  . LYS E 2 76  ? 43.155  -57.747  0.069   1.00 24.55  ? 76  LYS X CE  1 
ATOM   6715  N  NZ  . LYS E 2 76  ? 44.000  -57.037  -0.923  1.00 23.77  ? 76  LYS X NZ  1 
ATOM   6716  N  N   . ASN E 2 77  ? 36.987  -61.633  0.196   1.00 23.52  ? 77  ASN X N   1 
ATOM   6717  C  CA  . ASN E 2 77  ? 36.188  -62.709  -0.412  1.00 24.32  ? 77  ASN X CA  1 
ATOM   6718  C  C   . ASN E 2 77  ? 36.926  -63.499  -1.497  1.00 22.86  ? 77  ASN X C   1 
ATOM   6719  O  O   . ASN E 2 77  ? 36.411  -63.725  -2.595  1.00 21.31  ? 77  ASN X O   1 
ATOM   6720  C  CB  . ASN E 2 77  ? 34.858  -62.155  -0.942  1.00 26.17  ? 77  ASN X CB  1 
ATOM   6721  C  CG  . ASN E 2 77  ? 33.875  -61.846  0.166   1.00 27.31  ? 77  ASN X CG  1 
ATOM   6722  O  OD1 . ASN E 2 77  ? 34.209  -61.925  1.356   1.00 28.29  ? 77  ASN X OD1 1 
ATOM   6723  N  ND2 . ASN E 2 77  ? 32.651  -61.502  -0.215  1.00 26.62  ? 77  ASN X ND2 1 
ATOM   6724  N  N   . THR E 2 78  ? 38.141  -63.919  -1.178  1.00 22.69  ? 78  THR X N   1 
ATOM   6725  C  CA  . THR E 2 78  ? 38.965  -64.641  -2.137  1.00 22.26  ? 78  THR X CA  1 
ATOM   6726  C  C   . THR E 2 78  ? 39.352  -66.018  -1.587  1.00 21.95  ? 78  THR X C   1 
ATOM   6727  O  O   . THR E 2 78  ? 39.534  -66.201  -0.382  1.00 20.56  ? 78  THR X O   1 
ATOM   6728  C  CB  . THR E 2 78  ? 40.211  -63.811  -2.561  1.00 22.59  ? 78  THR X CB  1 
ATOM   6729  O  OG1 . THR E 2 78  ? 39.788  -62.576  -3.162  1.00 21.32  ? 78  THR X OG1 1 
ATOM   6730  C  CG2 . THR E 2 78  ? 41.033  -64.576  -3.582  1.00 23.70  ? 78  THR X CG2 1 
ATOM   6731  N  N   . LEU E 2 79  ? 39.421  -66.984  -2.501  1.00 22.71  ? 79  LEU X N   1 
ATOM   6732  C  CA  . LEU E 2 79  ? 39.820  -68.356  -2.216  1.00 21.79  ? 79  LEU X CA  1 
ATOM   6733  C  C   . LEU E 2 79  ? 41.110  -68.637  -2.980  1.00 21.08  ? 79  LEU X C   1 
ATOM   6734  O  O   . LEU E 2 79  ? 41.269  -68.169  -4.108  1.00 21.40  ? 79  LEU X O   1 
ATOM   6735  C  CB  . LEU E 2 79  ? 38.727  -69.320  -2.674  1.00 20.97  ? 79  LEU X CB  1 
ATOM   6736  C  CG  . LEU E 2 79  ? 38.957  -70.807  -2.399  1.00 21.20  ? 79  LEU X CG  1 
ATOM   6737  C  CD1 . LEU E 2 79  ? 38.823  -71.083  -0.888  1.00 19.06  ? 79  LEU X CD1 1 
ATOM   6738  C  CD2 . LEU E 2 79  ? 38.002  -71.692  -3.230  1.00 19.53  ? 79  LEU X CD2 1 
ATOM   6739  N  N   . TYR E 2 80  ? 42.006  -69.409  -2.377  1.00 19.95  ? 80  TYR X N   1 
ATOM   6740  C  CA  . TYR E 2 80  ? 43.328  -69.685  -2.958  1.00 22.41  ? 80  TYR X CA  1 
ATOM   6741  C  C   . TYR E 2 80  ? 43.690  -71.175  -2.954  1.00 22.15  ? 80  TYR X C   1 
ATOM   6742  O  O   . TYR E 2 80  ? 43.222  -71.946  -2.120  1.00 19.30  ? 80  TYR X O   1 
ATOM   6743  C  CB  . TYR E 2 80  ? 44.421  -68.936  -2.197  1.00 22.23  ? 80  TYR X CB  1 
ATOM   6744  C  CG  . TYR E 2 80  ? 44.203  -67.442  -2.103  1.00 24.39  ? 80  TYR X CG  1 
ATOM   6745  C  CD1 . TYR E 2 80  ? 44.505  -66.602  -3.179  1.00 25.70  ? 80  TYR X CD1 1 
ATOM   6746  C  CD2 . TYR E 2 80  ? 43.699  -66.867  -0.936  1.00 24.25  ? 80  TYR X CD2 1 
ATOM   6747  C  CE1 . TYR E 2 80  ? 44.307  -65.228  -3.090  1.00 25.90  ? 80  TYR X CE1 1 
ATOM   6748  C  CE2 . TYR E 2 80  ? 43.493  -65.510  -0.837  1.00 25.15  ? 80  TYR X CE2 1 
ATOM   6749  C  CZ  . TYR E 2 80  ? 43.801  -64.689  -1.914  1.00 26.54  ? 80  TYR X CZ  1 
ATOM   6750  O  OH  . TYR E 2 80  ? 43.605  -63.333  -1.802  1.00 27.38  ? 80  TYR X OH  1 
ATOM   6751  N  N   . LEU E 2 81  ? 44.522  -71.561  -3.916  1.00 23.55  ? 81  LEU X N   1 
ATOM   6752  C  CA  . LEU E 2 81  ? 45.118  -72.892  -3.934  1.00 23.29  ? 81  LEU X CA  1 
ATOM   6753  C  C   . LEU E 2 81  ? 46.606  -72.794  -4.287  1.00 23.21  ? 81  LEU X C   1 
ATOM   6754  O  O   . LEU E 2 81  ? 46.968  -72.453  -5.413  1.00 21.97  ? 81  LEU X O   1 
ATOM   6755  C  CB  . LEU E 2 81  ? 44.392  -73.796  -4.931  1.00 21.99  ? 81  LEU X CB  1 
ATOM   6756  C  CG  . LEU E 2 81  ? 44.791  -75.280  -4.928  1.00 21.15  ? 81  LEU X CG  1 
ATOM   6757  C  CD1 . LEU E 2 81  ? 44.443  -75.958  -3.617  1.00 18.93  ? 81  LEU X CD1 1 
ATOM   6758  C  CD2 . LEU E 2 81  ? 44.136  -75.999  -6.111  1.00 19.99  ? 81  LEU X CD2 1 
ATOM   6759  N  N   . GLN E 2 82  ? 47.456  -73.083  -3.308  1.00 24.18  ? 82  GLN X N   1 
ATOM   6760  C  CA  . GLN E 2 82  ? 48.886  -73.230  -3.552  1.00 24.77  ? 82  GLN X CA  1 
ATOM   6761  C  C   . GLN E 2 82  ? 49.164  -74.668  -3.966  1.00 25.80  ? 82  GLN X C   1 
ATOM   6762  O  O   . GLN E 2 82  ? 48.947  -75.594  -3.188  1.00 26.73  ? 82  GLN X O   1 
ATOM   6763  C  CB  . GLN E 2 82  ? 49.685  -72.893  -2.297  1.00 24.61  ? 82  GLN X CB  1 
ATOM   6764  C  CG  . GLN E 2 82  ? 51.191  -72.877  -2.513  1.00 25.39  ? 82  GLN X CG  1 
ATOM   6765  C  CD  . GLN E 2 82  ? 51.580  -71.890  -3.580  1.00 25.60  ? 82  GLN X CD  1 
ATOM   6766  O  OE1 . GLN E 2 82  ? 51.224  -70.714  -3.497  1.00 26.17  ? 82  GLN X OE1 1 
ATOM   6767  N  NE2 . GLN E 2 82  ? 52.283  -72.363  -4.607  1.00 25.10  ? 82  GLN X NE2 1 
ATOM   6768  N  N   . MET E 2 83  ? 49.621  -74.855  -5.197  1.00 25.79  ? 83  MET X N   1 
ATOM   6769  C  CA  . MET E 2 83  ? 49.990  -76.173  -5.680  1.00 25.67  ? 83  MET X CA  1 
ATOM   6770  C  C   . MET E 2 83  ? 51.506  -76.243  -5.694  1.00 25.74  ? 83  MET X C   1 
ATOM   6771  O  O   . MET E 2 83  ? 52.146  -75.398  -6.291  1.00 25.38  ? 83  MET X O   1 
ATOM   6772  C  CB  . MET E 2 83  ? 49.408  -76.391  -7.075  1.00 26.64  ? 83  MET X CB  1 
ATOM   6773  C  CG  . MET E 2 83  ? 47.870  -76.315  -7.110  1.00 27.54  ? 83  MET X CG  1 
ATOM   6774  S  SD  . MET E 2 83  ? 47.115  -76.377  -8.758  1.00 28.79  ? 83  MET X SD  1 
ATOM   6775  C  CE  . MET E 2 83  ? 47.569  -74.777  -9.423  1.00 29.26  ? 83  MET X CE  1 
ATOM   6776  N  N   . ASN E 2 84  ? 52.077  -77.219  -4.995  1.00 26.34  ? 84  ASN X N   1 
ATOM   6777  C  CA  . ASN E 2 84  ? 53.523  -77.448  -5.017  1.00 27.35  ? 84  ASN X CA  1 
ATOM   6778  C  C   . ASN E 2 84  ? 53.835  -78.839  -5.555  1.00 27.32  ? 84  ASN X C   1 
ATOM   6779  O  O   . ASN E 2 84  ? 52.938  -79.669  -5.687  1.00 27.19  ? 84  ASN X O   1 
ATOM   6780  C  CB  . ASN E 2 84  ? 54.133  -77.293  -3.615  1.00 28.17  ? 84  ASN X CB  1 
ATOM   6781  C  CG  . ASN E 2 84  ? 53.958  -75.888  -3.034  1.00 29.16  ? 84  ASN X CG  1 
ATOM   6782  O  OD1 . ASN E 2 84  ? 53.747  -74.911  -3.754  1.00 30.36  ? 84  ASN X OD1 1 
ATOM   6783  N  ND2 . ASN E 2 84  ? 54.057  -75.790  -1.717  1.00 29.80  ? 84  ASN X ND2 1 
ATOM   6784  N  N   . SER E 2 85  ? 55.109  -79.085  -5.861  1.00 28.11  ? 85  SER X N   1 
ATOM   6785  C  CA  . SER E 2 85  ? 55.568  -80.392  -6.350  1.00 27.37  ? 85  SER X CA  1 
ATOM   6786  C  C   . SER E 2 85  ? 54.679  -80.926  -7.485  1.00 25.96  ? 85  SER X C   1 
ATOM   6787  O  O   . SER E 2 85  ? 54.271  -82.088  -7.468  1.00 25.62  ? 85  SER X O   1 
ATOM   6788  C  CB  . SER E 2 85  ? 55.588  -81.405  -5.197  1.00 27.18  ? 85  SER X CB  1 
ATOM   6789  O  OG  . SER E 2 85  ? 56.270  -80.893  -4.070  1.00 28.05  ? 85  SER X OG  1 
ATOM   6790  N  N   . LEU E 2 86  ? 54.386  -80.082  -8.469  1.00 24.46  ? 86  LEU X N   1 
ATOM   6791  C  CA  . LEU E 2 86  ? 53.372  -80.424  -9.473  1.00 24.60  ? 86  LEU X CA  1 
ATOM   6792  C  C   . LEU E 2 86  ? 53.783  -81.601  -10.371 1.00 24.78  ? 86  LEU X C   1 
ATOM   6793  O  O   . LEU E 2 86  ? 54.925  -81.690  -10.812 1.00 23.13  ? 86  LEU X O   1 
ATOM   6794  C  CB  . LEU E 2 86  ? 53.003  -79.203  -10.319 1.00 23.99  ? 86  LEU X CB  1 
ATOM   6795  C  CG  . LEU E 2 86  ? 51.938  -78.284  -9.713  1.00 23.37  ? 86  LEU X CG  1 
ATOM   6796  C  CD1 . LEU E 2 86  ? 52.058  -76.882  -10.289 1.00 22.89  ? 86  LEU X CD1 1 
ATOM   6797  C  CD2 . LEU E 2 86  ? 50.533  -78.852  -9.940  1.00 22.90  ? 86  LEU X CD2 1 
ATOM   6798  N  N   . ARG E 2 87  ? 52.829  -82.498  -10.620 1.00 25.68  ? 87  ARG X N   1 
ATOM   6799  C  CA  . ARG E 2 87  ? 53.035  -83.666  -11.471 1.00 25.83  ? 87  ARG X CA  1 
ATOM   6800  C  C   . ARG E 2 87  ? 52.234  -83.523  -12.754 1.00 25.57  ? 87  ARG X C   1 
ATOM   6801  O  O   . ARG E 2 87  ? 51.306  -82.715  -12.836 1.00 24.56  ? 87  ARG X O   1 
ATOM   6802  C  CB  . ARG E 2 87  ? 52.580  -84.934  -10.752 1.00 26.92  ? 87  ARG X CB  1 
ATOM   6803  C  CG  . ARG E 2 87  ? 53.357  -85.252  -9.484  1.00 28.29  ? 87  ARG X CG  1 
ATOM   6804  C  CD  . ARG E 2 87  ? 52.509  -86.053  -8.500  1.00 29.32  ? 87  ARG X CD  1 
ATOM   6805  N  NE  . ARG E 2 87  ? 53.234  -86.371  -7.268  1.00 30.08  ? 87  ARG X NE  1 
ATOM   6806  C  CZ  . ARG E 2 87  ? 52.701  -86.995  -6.218  1.00 30.83  ? 87  ARG X CZ  1 
ATOM   6807  N  NH1 . ARG E 2 87  ? 51.423  -87.374  -6.231  1.00 30.73  ? 87  ARG X NH1 1 
ATOM   6808  N  NH2 . ARG E 2 87  ? 53.448  -87.245  -5.144  1.00 30.72  ? 87  ARG X NH2 1 
ATOM   6809  N  N   . ALA E 2 88  ? 52.593  -84.331  -13.748 1.00 25.83  ? 88  ALA X N   1 
ATOM   6810  C  CA  . ALA E 2 88  ? 51.876  -84.376  -15.020 1.00 26.15  ? 88  ALA X CA  1 
ATOM   6811  C  C   . ALA E 2 88  ? 50.393  -84.667  -14.804 1.00 26.10  ? 88  ALA X C   1 
ATOM   6812  O  O   . ALA E 2 88  ? 49.542  -84.105  -15.487 1.00 27.13  ? 88  ALA X O   1 
ATOM   6813  C  CB  . ALA E 2 88  ? 52.498  -85.429  -15.941 1.00 25.61  ? 88  ALA X CB  1 
ATOM   6814  N  N   . GLU E 2 89  ? 50.089  -85.516  -13.825 1.00 25.61  ? 89  GLU X N   1 
ATOM   6815  C  CA  . GLU E 2 89  ? 48.717  -85.946  -13.567 1.00 25.60  ? 89  GLU X CA  1 
ATOM   6816  C  C   . GLU E 2 89  ? 47.829  -84.830  -13.017 1.00 23.56  ? 89  GLU X C   1 
ATOM   6817  O  O   . GLU E 2 89  ? 46.622  -84.999  -12.943 1.00 22.61  ? 89  GLU X O   1 
ATOM   6818  C  CB  . GLU E 2 89  ? 48.684  -87.123  -12.584 1.00 26.82  ? 89  GLU X CB  1 
ATOM   6819  C  CG  . GLU E 2 89  ? 49.354  -88.389  -13.079 1.00 27.85  ? 89  GLU X CG  1 
ATOM   6820  C  CD  . GLU E 2 89  ? 50.863  -88.403  -12.853 1.00 29.04  ? 89  GLU X CD  1 
ATOM   6821  O  OE1 . GLU E 2 89  ? 51.580  -89.009  -13.687 1.00 29.30  ? 89  GLU X OE1 1 
ATOM   6822  O  OE2 . GLU E 2 89  ? 51.329  -87.809  -11.849 1.00 29.14  ? 89  GLU X OE2 1 
ATOM   6823  N  N   . ASP E 2 90  ? 48.430  -83.712  -12.613 1.00 22.93  ? 90  ASP X N   1 
ATOM   6824  C  CA  . ASP E 2 90  ? 47.685  -82.562  -12.097 1.00 20.95  ? 90  ASP X CA  1 
ATOM   6825  C  C   . ASP E 2 90  ? 47.176  -81.660  -13.210 1.00 19.95  ? 90  ASP X C   1 
ATOM   6826  O  O   . ASP E 2 90  ? 46.442  -80.709  -12.941 1.00 19.09  ? 90  ASP X O   1 
ATOM   6827  C  CB  . ASP E 2 90  ? 48.567  -81.732  -11.163 1.00 21.09  ? 90  ASP X CB  1 
ATOM   6828  C  CG  . ASP E 2 90  ? 49.079  -82.528  -9.987  1.00 20.75  ? 90  ASP X CG  1 
ATOM   6829  O  OD1 . ASP E 2 90  ? 48.283  -83.277  -9.375  1.00 18.37  ? 90  ASP X OD1 1 
ATOM   6830  O  OD2 . ASP E 2 90  ? 50.286  -82.406  -9.688  1.00 22.38  ? 90  ASP X OD2 1 
ATOM   6831  N  N   . THR E 2 91  ? 47.588  -81.933  -14.447 1.00 19.35  ? 91  THR X N   1 
ATOM   6832  C  CA  . THR E 2 91  ? 47.095  -81.195  -15.602 1.00 19.48  ? 91  THR X CA  1 
ATOM   6833  C  C   . THR E 2 91  ? 45.578  -81.369  -15.682 1.00 19.49  ? 91  THR X C   1 
ATOM   6834  O  O   . THR E 2 91  ? 45.081  -82.486  -15.799 1.00 19.62  ? 91  THR X O   1 
ATOM   6835  C  CB  . THR E 2 91  ? 47.771  -81.677  -16.918 1.00 19.91  ? 91  THR X CB  1 
ATOM   6836  O  OG1 . THR E 2 91  ? 49.192  -81.479  -16.831 1.00 19.85  ? 91  THR X OG1 1 
ATOM   6837  C  CG2 . THR E 2 91  ? 47.235  -80.914  -18.133 1.00 19.47  ? 91  THR X CG2 1 
ATOM   6838  N  N   . ALA E 2 92  ? 44.856  -80.255  -15.582 1.00 19.49  ? 92  ALA X N   1 
ATOM   6839  C  CA  . ALA E 2 92  ? 43.394  -80.253  -15.592 1.00 19.62  ? 92  ALA X CA  1 
ATOM   6840  C  C   . ALA E 2 92  ? 42.882  -78.824  -15.646 1.00 19.62  ? 92  ALA X C   1 
ATOM   6841  O  O   . ALA E 2 92  ? 43.649  -77.879  -15.466 1.00 19.45  ? 92  ALA X O   1 
ATOM   6842  C  CB  . ALA E 2 92  ? 42.859  -80.945  -14.328 1.00 18.69  ? 92  ALA X CB  1 
ATOM   6843  N  N   . VAL E 2 93  ? 41.585  -78.672  -15.891 1.00 21.07  ? 93  VAL X N   1 
ATOM   6844  C  CA  . VAL E 2 93  ? 40.890  -77.418  -15.595 1.00 21.20  ? 93  VAL X CA  1 
ATOM   6845  C  C   . VAL E 2 93  ? 40.550  -77.417  -14.103 1.00 22.56  ? 93  VAL X C   1 
ATOM   6846  O  O   . VAL E 2 93  ? 40.032  -78.411  -13.571 1.00 21.22  ? 93  VAL X O   1 
ATOM   6847  C  CB  . VAL E 2 93  ? 39.584  -77.250  -16.404 1.00 20.34  ? 93  VAL X CB  1 
ATOM   6848  C  CG1 . VAL E 2 93  ? 38.762  -76.075  -15.861 1.00 18.77  ? 93  VAL X CG1 1 
ATOM   6849  C  CG2 . VAL E 2 93  ? 39.899  -77.044  -17.891 1.00 19.24  ? 93  VAL X CG2 1 
ATOM   6850  N  N   . TYR E 2 94  ? 40.846  -76.300  -13.441 1.00 22.36  ? 94  TYR X N   1 
ATOM   6851  C  CA  . TYR E 2 94  ? 40.561  -76.140  -12.028 1.00 22.67  ? 94  TYR X CA  1 
ATOM   6852  C  C   . TYR E 2 94  ? 39.415  -75.170  -11.820 1.00 24.57  ? 94  TYR X C   1 
ATOM   6853  O  O   . TYR E 2 94  ? 39.474  -74.019  -12.272 1.00 24.01  ? 94  TYR X O   1 
ATOM   6854  C  CB  . TYR E 2 94  ? 41.806  -75.655  -11.284 1.00 22.20  ? 94  TYR X CB  1 
ATOM   6855  C  CG  . TYR E 2 94  ? 42.820  -76.746  -11.090 1.00 21.49  ? 94  TYR X CG  1 
ATOM   6856  C  CD1 . TYR E 2 94  ? 42.964  -77.370  -9.860  1.00 21.40  ? 94  TYR X CD1 1 
ATOM   6857  C  CD2 . TYR E 2 94  ? 43.622  -77.179  -12.149 1.00 21.30  ? 94  TYR X CD2 1 
ATOM   6858  C  CE1 . TYR E 2 94  ? 43.893  -78.385  -9.683  1.00 21.66  ? 94  TYR X CE1 1 
ATOM   6859  C  CE2 . TYR E 2 94  ? 44.538  -78.188  -11.979 1.00 20.60  ? 94  TYR X CE2 1 
ATOM   6860  C  CZ  . TYR E 2 94  ? 44.671  -78.785  -10.736 1.00 20.31  ? 94  TYR X CZ  1 
ATOM   6861  O  OH  . TYR E 2 94  ? 45.579  -79.786  -10.543 1.00 21.30  ? 94  TYR X OH  1 
ATOM   6862  N  N   . TYR E 2 95  ? 38.380  -75.660  -11.136 1.00 26.02  ? 95  TYR X N   1 
ATOM   6863  C  CA  . TYR E 2 95  ? 37.223  -74.870  -10.749 1.00 27.12  ? 95  TYR X CA  1 
ATOM   6864  C  C   . TYR E 2 95  ? 37.196  -74.629  -9.245  1.00 27.01  ? 95  TYR X C   1 
ATOM   6865  O  O   . TYR E 2 95  ? 37.563  -75.512  -8.474  1.00 25.81  ? 95  TYR X O   1 
ATOM   6866  C  CB  . TYR E 2 95  ? 35.936  -75.612  -11.108 1.00 27.35  ? 95  TYR X CB  1 
ATOM   6867  C  CG  . TYR E 2 95  ? 35.746  -75.902  -12.570 1.00 27.48  ? 95  TYR X CG  1 
ATOM   6868  C  CD1 . TYR E 2 95  ? 35.211  -74.939  -13.416 1.00 28.73  ? 95  TYR X CD1 1 
ATOM   6869  C  CD2 . TYR E 2 95  ? 36.077  -77.140  -13.104 1.00 27.64  ? 95  TYR X CD2 1 
ATOM   6870  C  CE1 . TYR E 2 95  ? 35.021  -75.189  -14.751 1.00 29.16  ? 95  TYR X CE1 1 
ATOM   6871  C  CE2 . TYR E 2 95  ? 35.889  -77.406  -14.450 1.00 29.42  ? 95  TYR X CE2 1 
ATOM   6872  C  CZ  . TYR E 2 95  ? 35.351  -76.424  -15.270 1.00 29.60  ? 95  TYR X CZ  1 
ATOM   6873  O  OH  . TYR E 2 95  ? 35.149  -76.651  -16.615 1.00 31.31  ? 95  TYR X OH  1 
ATOM   6874  N  N   . CYS E 2 96  ? 36.751  -73.440  -8.834  1.00 28.15  ? 96  CYS X N   1 
ATOM   6875  C  CA  . CYS E 2 96  ? 36.269  -73.239  -7.466  1.00 28.44  ? 96  CYS X CA  1 
ATOM   6876  C  C   . CYS E 2 96  ? 34.745  -73.371  -7.463  1.00 26.19  ? 96  CYS X C   1 
ATOM   6877  O  O   . CYS E 2 96  ? 34.074  -73.107  -8.464  1.00 25.71  ? 96  CYS X O   1 
ATOM   6878  C  CB  . CYS E 2 96  ? 36.711  -71.898  -6.865  1.00 30.37  ? 96  CYS X CB  1 
ATOM   6879  S  SG  . CYS E 2 96  ? 36.270  -70.462  -7.822  1.00 34.46  ? 96  CYS X SG  1 
ATOM   6880  N  N   . ALA E 2 97  ? 34.217  -73.829  -6.342  1.00 23.03  ? 97  ALA X N   1 
ATOM   6881  C  CA  . ALA E 2 97  ? 32.795  -73.970  -6.171  1.00 22.54  ? 97  ALA X CA  1 
ATOM   6882  C  C   . ALA E 2 97  ? 32.424  -73.797  -4.702  1.00 21.57  ? 97  ALA X C   1 
ATOM   6883  O  O   . ALA E 2 97  ? 33.230  -74.050  -3.798  1.00 21.50  ? 97  ALA X O   1 
ATOM   6884  C  CB  . ALA E 2 97  ? 32.327  -75.323  -6.696  1.00 21.78  ? 97  ALA X CB  1 
ATOM   6885  N  N   . SER E 2 98  ? 31.197  -73.340  -4.484  1.00 22.55  ? 98  SER X N   1 
ATOM   6886  C  CA  . SER E 2 98  ? 30.634  -73.189  -3.149  1.00 21.73  ? 98  SER X CA  1 
ATOM   6887  C  C   . SER E 2 98  ? 29.742  -74.377  -2.796  1.00 22.47  ? 98  SER X C   1 
ATOM   6888  O  O   . SER E 2 98  ? 29.148  -75.035  -3.682  1.00 21.81  ? 98  SER X O   1 
ATOM   6889  C  CB  . SER E 2 98  ? 29.815  -71.897  -3.060  1.00 20.03  ? 98  SER X CB  1 
ATOM   6890  O  OG  . SER E 2 98  ? 28.835  -71.862  -4.082  1.00 17.94  ? 98  SER X OG  1 
ATOM   6891  N  N   . SER E 2 99  ? 29.638  -74.625  -1.493  1.00 21.68  ? 99  SER X N   1 
ATOM   6892  C  CA  . SER E 2 99  ? 28.691  -75.604  -0.978  1.00 21.08  ? 99  SER X CA  1 
ATOM   6893  C  C   . SER E 2 99  ? 27.267  -75.077  -1.027  1.00 21.45  ? 99  SER X C   1 
ATOM   6894  O  O   . SER E 2 99  ? 26.978  -73.975  -0.559  1.00 20.11  ? 99  SER X O   1 
ATOM   6895  C  CB  . SER E 2 99  ? 29.019  -76.000  0.462   1.00 20.27  ? 99  SER X CB  1 
ATOM   6896  O  OG  . SER E 2 99  ? 29.809  -77.165  0.505   1.00 18.88  ? 99  SER X OG  1 
ATOM   6897  N  N   . TYR E 2 100 ? 26.373  -75.892  -1.580  1.00 20.76  ? 100 TYR X N   1 
ATOM   6898  C  CA  . TYR E 2 100 ? 24.955  -75.634  -1.477  1.00 19.69  ? 100 TYR X CA  1 
ATOM   6899  C  C   . TYR E 2 100 ? 24.571  -75.682  0.004   1.00 20.99  ? 100 TYR X C   1 
ATOM   6900  O  O   . TYR E 2 100 ? 25.092  -76.513  0.758   1.00 21.52  ? 100 TYR X O   1 
ATOM   6901  C  CB  . TYR E 2 100 ? 24.203  -76.665  -2.307  1.00 19.32  ? 100 TYR X CB  1 
ATOM   6902  C  CG  . TYR E 2 100 ? 22.713  -76.592  -2.271  1.00 18.81  ? 100 TYR X CG  1 
ATOM   6903  C  CD1 . TYR E 2 100 ? 22.031  -75.635  -3.007  1.00 20.13  ? 100 TYR X CD1 1 
ATOM   6904  C  CD2 . TYR E 2 100 ? 21.965  -77.530  -1.545  1.00 18.99  ? 100 TYR X CD2 1 
ATOM   6905  C  CE1 . TYR E 2 100 ? 20.624  -75.582  -2.985  1.00 19.71  ? 100 TYR X CE1 1 
ATOM   6906  C  CE2 . TYR E 2 100 ? 20.583  -77.496  -1.533  1.00 17.45  ? 100 TYR X CE2 1 
ATOM   6907  C  CZ  . TYR E 2 100 ? 19.917  -76.515  -2.248  1.00 18.19  ? 100 TYR X CZ  1 
ATOM   6908  O  OH  . TYR E 2 100 ? 18.537  -76.484  -2.252  1.00 17.00  ? 100 TYR X OH  1 
ATOM   6909  N  N   . ASP E 2 101 ? 23.692  -74.762  0.410   1.00 20.83  ? 101 ASP X N   1 
ATOM   6910  C  CA  . ASP E 2 101 ? 23.203  -74.660  1.796   1.00 20.70  ? 101 ASP X CA  1 
ATOM   6911  C  C   . ASP E 2 101 ? 24.323  -74.508  2.825   1.00 20.55  ? 101 ASP X C   1 
ATOM   6912  O  O   . ASP E 2 101 ? 24.250  -75.057  3.930   1.00 18.19  ? 101 ASP X O   1 
ATOM   6913  C  CB  . ASP E 2 101 ? 22.289  -75.848  2.150   1.00 19.59  ? 101 ASP X CB  1 
ATOM   6914  C  CG  . ASP E 2 101 ? 21.339  -75.530  3.308   1.00 18.94  ? 101 ASP X CG  1 
ATOM   6915  O  OD1 . ASP E 2 101 ? 20.759  -74.418  3.341   1.00 18.91  ? 101 ASP X OD1 1 
ATOM   6916  O  OD2 . ASP E 2 101 ? 21.197  -76.381  4.203   1.00 17.95  ? 101 ASP X OD2 1 
ATOM   6917  N  N   . PHE E 2 102 ? 25.344  -73.735  2.434   1.00 21.03  ? 102 PHE X N   1 
ATOM   6918  C  CA  . PHE E 2 102 ? 26.516  -73.383  3.252   1.00 20.27  ? 102 PHE X CA  1 
ATOM   6919  C  C   . PHE E 2 102 ? 27.564  -74.496  3.363   1.00 20.29  ? 102 PHE X C   1 
ATOM   6920  O  O   . PHE E 2 102 ? 28.739  -74.236  3.121   1.00 19.31  ? 102 PHE X O   1 
ATOM   6921  C  CB  . PHE E 2 102 ? 26.148  -72.882  4.658   1.00 21.20  ? 102 PHE X CB  1 
ATOM   6922  C  CG  . PHE E 2 102 ? 25.218  -71.680  4.686   1.00 21.67  ? 102 PHE X CG  1 
ATOM   6923  C  CD1 . PHE E 2 102 ? 25.361  -70.631  3.795   1.00 22.09  ? 102 PHE X CD1 1 
ATOM   6924  C  CD2 . PHE E 2 102 ? 24.236  -71.584  5.668   1.00 21.96  ? 102 PHE X CD2 1 
ATOM   6925  C  CE1 . PHE E 2 102 ? 24.516  -69.536  3.845   1.00 21.60  ? 102 PHE X CE1 1 
ATOM   6926  C  CE2 . PHE E 2 102 ? 23.390  -70.496  5.725   1.00 22.04  ? 102 PHE X CE2 1 
ATOM   6927  C  CZ  . PHE E 2 102 ? 23.531  -69.466  4.810   1.00 21.74  ? 102 PHE X CZ  1 
ATOM   6928  N  N   . TRP E 2 103 ? 27.163  -75.714  3.745   1.00 21.83  ? 103 TRP X N   1 
ATOM   6929  C  CA  . TRP E 2 103 ? 28.130  -76.808  3.938   1.00 22.23  ? 103 TRP X CA  1 
ATOM   6930  C  C   . TRP E 2 103 ? 27.610  -78.206  3.628   1.00 23.21  ? 103 TRP X C   1 
ATOM   6931  O  O   . TRP E 2 103 ? 28.089  -79.195  4.194   1.00 23.43  ? 103 TRP X O   1 
ATOM   6932  C  CB  . TRP E 2 103 ? 28.716  -76.776  5.354   1.00 23.44  ? 103 TRP X CB  1 
ATOM   6933  C  CG  . TRP E 2 103 ? 27.703  -76.811  6.451   1.00 24.58  ? 103 TRP X CG  1 
ATOM   6934  C  CD1 . TRP E 2 103 ? 27.014  -77.910  6.909   1.00 25.36  ? 103 TRP X CD1 1 
ATOM   6935  C  CD2 . TRP E 2 103 ? 27.293  -75.710  7.271   1.00 24.39  ? 103 TRP X CD2 1 
ATOM   6936  N  NE1 . TRP E 2 103 ? 26.189  -77.548  7.955   1.00 25.85  ? 103 TRP X NE1 1 
ATOM   6937  C  CE2 . TRP E 2 103 ? 26.332  -76.204  8.189   1.00 25.10  ? 103 TRP X CE2 1 
ATOM   6938  C  CE3 . TRP E 2 103 ? 27.636  -74.354  7.315   1.00 23.78  ? 103 TRP X CE3 1 
ATOM   6939  C  CZ2 . TRP E 2 103 ? 25.708  -75.385  9.131   1.00 26.05  ? 103 TRP X CZ2 1 
ATOM   6940  C  CZ3 . TRP E 2 103 ? 27.024  -73.543  8.246   1.00 25.02  ? 103 TRP X CZ3 1 
ATOM   6941  C  CH2 . TRP E 2 103 ? 26.066  -74.058  9.149   1.00 26.61  ? 103 TRP X CH2 1 
ATOM   6942  N  N   . SER E 2 104 ? 26.650  -78.299  2.718   1.00 22.56  ? 104 SER X N   1 
ATOM   6943  C  CA  . SER E 2 104 ? 26.291  -79.594  2.157   1.00 22.89  ? 104 SER X CA  1 
ATOM   6944  C  C   . SER E 2 104 ? 27.430  -80.090  1.261   1.00 22.55  ? 104 SER X C   1 
ATOM   6945  O  O   . SER E 2 104 ? 28.402  -79.372  1.012   1.00 18.53  ? 104 SER X O   1 
ATOM   6946  C  CB  . SER E 2 104 ? 25.009  -79.483  1.318   1.00 22.70  ? 104 SER X CB  1 
ATOM   6947  O  OG  . SER E 2 104 ? 25.304  -78.916  0.052   1.00 22.40  ? 104 SER X OG  1 
ATOM   6948  N  N   . ASN E 2 105 ? 27.282  -81.311  0.757   1.00 24.97  ? 105 ASN X N   1 
ATOM   6949  C  CA  . ASN E 2 105 ? 28.245  -81.890  -0.190  1.00 24.79  ? 105 ASN X CA  1 
ATOM   6950  C  C   . ASN E 2 105 ? 27.713  -81.847  -1.628  1.00 24.24  ? 105 ASN X C   1 
ATOM   6951  O  O   . ASN E 2 105 ? 28.167  -82.603  -2.506  1.00 24.60  ? 105 ASN X O   1 
ATOM   6952  C  CB  . ASN E 2 105 ? 28.611  -83.318  0.232   1.00 24.13  ? 105 ASN X CB  1 
ATOM   6953  C  CG  . ASN E 2 105 ? 29.626  -83.351  1.366   1.00 23.18  ? 105 ASN X CG  1 
ATOM   6954  O  OD1 . ASN E 2 105 ? 30.716  -82.813  1.238   1.00 23.53  ? 105 ASN X OD1 1 
ATOM   6955  N  ND2 . ASN E 2 105 ? 29.284  -84.021  2.464   1.00 21.70  ? 105 ASN X ND2 1 
ATOM   6956  N  N   . ALA E 2 106 ? 26.747  -80.955  -1.850  1.00 23.10  ? 106 ALA X N   1 
ATOM   6957  C  CA  . ALA E 2 106 ? 26.312  -80.565  -3.190  1.00 22.66  ? 106 ALA X CA  1 
ATOM   6958  C  C   . ALA E 2 106 ? 26.912  -79.204  -3.528  1.00 22.32  ? 106 ALA X C   1 
ATOM   6959  O  O   . ALA E 2 106 ? 27.187  -78.393  -2.636  1.00 23.63  ? 106 ALA X O   1 
ATOM   6960  C  CB  . ALA E 2 106 ? 24.798  -80.522  -3.291  1.00 20.21  ? 106 ALA X CB  1 
ATOM   6961  N  N   . PHE E 2 107 ? 27.124  -78.967  -4.818  1.00 21.80  ? 107 PHE X N   1 
ATOM   6962  C  CA  . PHE E 2 107 ? 27.760  -77.741  -5.274  1.00 24.24  ? 107 PHE X CA  1 
ATOM   6963  C  C   . PHE E 2 107 ? 26.730  -76.726  -5.739  1.00 23.82  ? 107 PHE X C   1 
ATOM   6964  O  O   . PHE E 2 107 ? 25.781  -77.071  -6.448  1.00 25.53  ? 107 PHE X O   1 
ATOM   6965  C  CB  . PHE E 2 107 ? 28.740  -78.040  -6.408  1.00 25.13  ? 107 PHE X CB  1 
ATOM   6966  C  CG  . PHE E 2 107 ? 29.870  -78.931  -6.005  1.00 24.53  ? 107 PHE X CG  1 
ATOM   6967  C  CD1 . PHE E 2 107 ? 30.914  -78.439  -5.227  1.00 25.87  ? 107 PHE X CD1 1 
ATOM   6968  C  CD2 . PHE E 2 107 ? 29.912  -80.252  -6.412  1.00 25.67  ? 107 PHE X CD2 1 
ATOM   6969  C  CE1 . PHE E 2 107 ? 31.984  -79.253  -4.862  1.00 24.70  ? 107 PHE X CE1 1 
ATOM   6970  C  CE2 . PHE E 2 107 ? 30.983  -81.078  -6.042  1.00 25.77  ? 107 PHE X CE2 1 
ATOM   6971  C  CZ  . PHE E 2 107 ? 32.016  -80.568  -5.266  1.00 24.92  ? 107 PHE X CZ  1 
ATOM   6972  N  N   . ASP E 2 108 ? 26.933  -75.474  -5.353  1.00 23.23  ? 108 ASP X N   1 
ATOM   6973  C  CA  . ASP E 2 108 ? 25.995  -74.400  -5.679  1.00 24.48  ? 108 ASP X CA  1 
ATOM   6974  C  C   . ASP E 2 108 ? 26.468  -73.567  -6.886  1.00 24.79  ? 108 ASP X C   1 
ATOM   6975  O  O   . ASP E 2 108 ? 25.887  -73.656  -7.964  1.00 26.87  ? 108 ASP X O   1 
ATOM   6976  C  CB  . ASP E 2 108 ? 25.793  -73.522  -4.446  1.00 25.84  ? 108 ASP X CB  1 
ATOM   6977  C  CG  . ASP E 2 108 ? 24.733  -72.469  -4.642  1.00 26.94  ? 108 ASP X CG  1 
ATOM   6978  O  OD1 . ASP E 2 108 ? 24.157  -72.387  -5.739  1.00 28.56  ? 108 ASP X OD1 1 
ATOM   6979  O  OD2 . ASP E 2 108 ? 24.471  -71.724  -3.683  1.00 27.48  ? 108 ASP X OD2 1 
ATOM   6980  N  N   . ILE E 2 109 ? 27.522  -72.777  -6.700  1.00 24.29  ? 109 ILE X N   1 
ATOM   6981  C  CA  . ILE E 2 109 ? 28.034  -71.872  -7.723  1.00 25.32  ? 109 ILE X CA  1 
ATOM   6982  C  C   . ILE E 2 109 ? 29.421  -72.352  -8.118  1.00 25.47  ? 109 ILE X C   1 
ATOM   6983  O  O   . ILE E 2 109 ? 30.186  -72.833  -7.270  1.00 22.33  ? 109 ILE X O   1 
ATOM   6984  C  CB  . ILE E 2 109 ? 28.159  -70.414  -7.207  1.00 26.36  ? 109 ILE X CB  1 
ATOM   6985  C  CG1 . ILE E 2 109 ? 26.817  -69.874  -6.727  1.00 28.34  ? 109 ILE X CG1 1 
ATOM   6986  C  CG2 . ILE E 2 109 ? 28.703  -69.479  -8.288  1.00 26.01  ? 109 ILE X CG2 1 
ATOM   6987  C  CD1 . ILE E 2 109 ? 26.958  -68.616  -5.832  1.00 29.67  ? 109 ILE X CD1 1 
ATOM   6988  N  N   . TRP E 2 110 ? 29.723  -72.216  -9.410  1.00 24.90  ? 110 TRP X N   1 
ATOM   6989  C  CA  . TRP E 2 110 ? 30.961  -72.688  -10.002 1.00 24.91  ? 110 TRP X CA  1 
ATOM   6990  C  C   . TRP E 2 110 ? 31.628  -71.513  -10.681 1.00 26.29  ? 110 TRP X C   1 
ATOM   6991  O  O   . TRP E 2 110 ? 30.946  -70.635  -11.222 1.00 26.89  ? 110 TRP X O   1 
ATOM   6992  C  CB  . TRP E 2 110 ? 30.679  -73.747  -11.064 1.00 25.32  ? 110 TRP X CB  1 
ATOM   6993  C  CG  . TRP E 2 110 ? 30.209  -75.076  -10.577 1.00 24.80  ? 110 TRP X CG  1 
ATOM   6994  C  CD1 . TRP E 2 110 ? 28.946  -75.415  -10.241 1.00 25.18  ? 110 TRP X CD1 1 
ATOM   6995  C  CD2 . TRP E 2 110 ? 30.996  -76.267  -10.444 1.00 25.93  ? 110 TRP X CD2 1 
ATOM   6996  N  NE1 . TRP E 2 110 ? 28.886  -76.743  -9.882  1.00 25.79  ? 110 TRP X NE1 1 
ATOM   6997  C  CE2 . TRP E 2 110 ? 30.136  -77.287  -9.991  1.00 25.87  ? 110 TRP X CE2 1 
ATOM   6998  C  CE3 . TRP E 2 110 ? 32.351  -76.565  -10.642 1.00 27.71  ? 110 TRP X CE3 1 
ATOM   6999  C  CZ2 . TRP E 2 110 ? 30.578  -78.591  -9.746  1.00 25.68  ? 110 TRP X CZ2 1 
ATOM   7000  C  CZ3 . TRP E 2 110 ? 32.793  -77.871  -10.396 1.00 28.11  ? 110 TRP X CZ3 1 
ATOM   7001  C  CH2 . TRP E 2 110 ? 31.901  -78.864  -9.952  1.00 25.71  ? 110 TRP X CH2 1 
ATOM   7002  N  N   . GLY E 2 111 ? 32.955  -71.486  -10.651 1.00 27.13  ? 111 GLY X N   1 
ATOM   7003  C  CA  . GLY E 2 111 ? 33.710  -70.502  -11.409 1.00 28.14  ? 111 GLY X CA  1 
ATOM   7004  C  C   . GLY E 2 111 ? 33.763  -70.892  -12.879 1.00 28.62  ? 111 GLY X C   1 
ATOM   7005  O  O   . GLY E 2 111 ? 33.166  -71.898  -13.285 1.00 26.60  ? 111 GLY X O   1 
ATOM   7006  N  N   . GLN E 2 112 ? 34.471  -70.097  -13.681 1.00 29.71  ? 112 GLN X N   1 
ATOM   7007  C  CA  . GLN E 2 112 ? 34.533  -70.340  -15.123 1.00 31.20  ? 112 GLN X CA  1 
ATOM   7008  C  C   . GLN E 2 112 ? 35.590  -71.397  -15.480 1.00 30.28  ? 112 GLN X C   1 
ATOM   7009  O  O   . GLN E 2 112 ? 35.560  -71.978  -16.574 1.00 30.78  ? 112 GLN X O   1 
ATOM   7010  C  CB  . GLN E 2 112 ? 34.719  -69.022  -15.900 1.00 33.80  ? 112 GLN X CB  1 
ATOM   7011  C  CG  . GLN E 2 112 ? 36.158  -68.564  -16.185 1.00 36.81  ? 112 GLN X CG  1 
ATOM   7012  C  CD  . GLN E 2 112 ? 36.924  -68.106  -14.945 1.00 39.09  ? 112 GLN X CD  1 
ATOM   7013  O  OE1 . GLN E 2 112 ? 36.331  -67.832  -13.893 1.00 40.42  ? 112 GLN X OE1 1 
ATOM   7014  N  NE2 . GLN E 2 112 ? 38.250  -68.013  -15.070 1.00 38.95  ? 112 GLN X NE2 1 
ATOM   7015  N  N   . GLY E 2 113 ? 36.505  -71.645  -14.542 1.00 29.53  ? 113 GLY X N   1 
ATOM   7016  C  CA  . GLY E 2 113 ? 37.571  -72.622  -14.702 1.00 27.75  ? 113 GLY X CA  1 
ATOM   7017  C  C   . GLY E 2 113 ? 38.865  -71.970  -15.143 1.00 27.40  ? 113 GLY X C   1 
ATOM   7018  O  O   . GLY E 2 113 ? 38.847  -70.959  -15.841 1.00 26.36  ? 113 GLY X O   1 
ATOM   7019  N  N   . THR E 2 114 ? 39.988  -72.548  -14.721 1.00 27.43  ? 114 THR X N   1 
ATOM   7020  C  CA  . THR E 2 114 ? 41.310  -72.116  -15.169 1.00 28.32  ? 114 THR X CA  1 
ATOM   7021  C  C   . THR E 2 114 ? 42.207  -73.330  -15.478 1.00 29.26  ? 114 THR X C   1 
ATOM   7022  O  O   . THR E 2 114 ? 42.329  -74.259  -14.669 1.00 29.44  ? 114 THR X O   1 
ATOM   7023  C  CB  . THR E 2 114 ? 41.994  -71.160  -14.146 1.00 27.81  ? 114 THR X CB  1 
ATOM   7024  O  OG1 . THR E 2 114 ? 43.131  -70.548  -14.759 1.00 27.05  ? 114 THR X OG1 1 
ATOM   7025  C  CG2 . THR E 2 114 ? 42.435  -71.896  -12.877 1.00 26.50  ? 114 THR X CG2 1 
ATOM   7026  N  N   . MET E 2 115 ? 42.829  -73.308  -16.655 1.00 30.39  ? 115 MET X N   1 
ATOM   7027  C  CA  . MET E 2 115 ? 43.598  -74.444  -17.150 1.00 31.23  ? 115 MET X CA  1 
ATOM   7028  C  C   . MET E 2 115 ? 44.993  -74.433  -16.560 1.00 29.49  ? 115 MET X C   1 
ATOM   7029  O  O   . MET E 2 115 ? 45.656  -73.401  -16.536 1.00 30.55  ? 115 MET X O   1 
ATOM   7030  C  CB  . MET E 2 115 ? 43.672  -74.413  -18.684 1.00 33.87  ? 115 MET X CB  1 
ATOM   7031  C  CG  . MET E 2 115 ? 44.501  -75.542  -19.318 1.00 36.07  ? 115 MET X CG  1 
ATOM   7032  S  SD  . MET E 2 115 ? 43.857  -77.209  -19.014 1.00 38.74  ? 115 MET X SD  1 
ATOM   7033  C  CE  . MET E 2 115 ? 42.473  -77.264  -20.154 1.00 39.53  ? 115 MET X CE  1 
ATOM   7034  N  N   . VAL E 2 116 ? 45.420  -75.596  -16.078 1.00 27.56  ? 116 VAL X N   1 
ATOM   7035  C  CA  . VAL E 2 116 ? 46.770  -75.806  -15.579 1.00 25.18  ? 116 VAL X CA  1 
ATOM   7036  C  C   . VAL E 2 116 ? 47.388  -76.923  -16.411 1.00 24.83  ? 116 VAL X C   1 
ATOM   7037  O  O   . VAL E 2 116 ? 46.781  -77.982  -16.572 1.00 23.67  ? 116 VAL X O   1 
ATOM   7038  C  CB  . VAL E 2 116 ? 46.756  -76.199  -14.082 1.00 24.62  ? 116 VAL X CB  1 
ATOM   7039  C  CG1 . VAL E 2 116 ? 48.134  -76.568  -13.597 1.00 25.54  ? 116 VAL X CG1 1 
ATOM   7040  C  CG2 . VAL E 2 116 ? 46.187  -75.067  -13.231 1.00 23.82  ? 116 VAL X CG2 1 
ATOM   7041  N  N   . THR E 2 117 ? 48.580  -76.671  -16.961 1.00 24.87  ? 117 THR X N   1 
ATOM   7042  C  CA  . THR E 2 117 ? 49.326  -77.671  -17.723 1.00 23.68  ? 117 THR X CA  1 
ATOM   7043  C  C   . THR E 2 117 ? 50.677  -77.906  -17.058 1.00 22.74  ? 117 THR X C   1 
ATOM   7044  O  O   . THR E 2 117 ? 51.466  -76.970  -16.895 1.00 21.73  ? 117 THR X O   1 
ATOM   7045  C  CB  . THR E 2 117 ? 49.543  -77.214  -19.187 1.00 24.95  ? 117 THR X CB  1 
ATOM   7046  O  OG1 . THR E 2 117 ? 48.273  -76.973  -19.801 1.00 24.93  ? 117 THR X OG1 1 
ATOM   7047  C  CG2 . THR E 2 117 ? 50.322  -78.268  -20.003 1.00 23.29  ? 117 THR X CG2 1 
ATOM   7048  N  N   . VAL E 2 118 ? 50.926  -79.154  -16.660 1.00 21.58  ? 118 VAL X N   1 
ATOM   7049  C  CA  . VAL E 2 118 ? 52.217  -79.545  -16.104 1.00 21.41  ? 118 VAL X CA  1 
ATOM   7050  C  C   . VAL E 2 118 ? 52.982  -80.385  -17.135 1.00 20.76  ? 118 VAL X C   1 
ATOM   7051  O  O   . VAL E 2 118 ? 52.614  -81.524  -17.426 1.00 19.35  ? 118 VAL X O   1 
ATOM   7052  C  CB  . VAL E 2 118 ? 52.065  -80.332  -14.778 1.00 22.24  ? 118 VAL X CB  1 
ATOM   7053  C  CG1 . VAL E 2 118 ? 53.431  -80.612  -14.162 1.00 20.67  ? 118 VAL X CG1 1 
ATOM   7054  C  CG2 . VAL E 2 118 ? 51.164  -79.568  -13.787 1.00 21.64  ? 118 VAL X CG2 1 
ATOM   7055  N  N   . SER E 2 119 ? 54.042  -79.804  -17.688 1.00 20.61  ? 119 SER X N   1 
ATOM   7056  C  CA  . SER E 2 119 ? 54.834  -80.460  -18.717 1.00 20.31  ? 119 SER X CA  1 
ATOM   7057  C  C   . SER E 2 119 ? 56.224  -79.840  -18.789 1.00 20.39  ? 119 SER X C   1 
ATOM   7058  O  O   . SER E 2 119 ? 56.371  -78.618  -18.690 1.00 19.56  ? 119 SER X O   1 
ATOM   7059  C  CB  . SER E 2 119 ? 54.131  -80.338  -20.072 1.00 19.97  ? 119 SER X CB  1 
ATOM   7060  O  OG  . SER E 2 119 ? 54.912  -80.898  -21.117 1.00 20.33  ? 119 SER X OG  1 
ATOM   7061  N  N   . SER E 2 120 ? 57.239  -80.686  -18.961 1.00 21.15  ? 120 SER X N   1 
ATOM   7062  C  CA  . SER E 2 120 ? 58.627  -80.227  -19.050 1.00 22.08  ? 120 SER X CA  1 
ATOM   7063  C  C   . SER E 2 120 ? 58.946  -79.617  -20.417 1.00 23.49  ? 120 SER X C   1 
ATOM   7064  O  O   . SER E 2 120 ? 59.971  -78.955  -20.575 1.00 22.98  ? 120 SER X O   1 
ATOM   7065  C  CB  . SER E 2 120 ? 59.595  -81.376  -18.764 1.00 21.57  ? 120 SER X CB  1 
ATOM   7066  O  OG  . SER E 2 120 ? 59.569  -82.335  -19.805 1.00 20.78  ? 120 SER X OG  1 
ATOM   7067  N  N   . ALA E 2 121 ? 58.078  -79.859  -21.400 1.00 25.45  ? 121 ALA X N   1 
ATOM   7068  C  CA  . ALA E 2 121 ? 58.192  -79.228  -22.713 1.00 26.93  ? 121 ALA X CA  1 
ATOM   7069  C  C   . ALA E 2 121 ? 58.007  -77.717  -22.596 1.00 28.97  ? 121 ALA X C   1 
ATOM   7070  O  O   . ALA E 2 121 ? 57.315  -77.233  -21.697 1.00 30.65  ? 121 ALA X O   1 
ATOM   7071  C  CB  . ALA E 2 121 ? 57.168  -79.814  -23.680 1.00 25.99  ? 121 ALA X CB  1 
ATOM   7072  N  N   . SER E 2 122 ? 58.630  -76.979  -23.508 1.00 31.52  ? 122 SER X N   1 
ATOM   7073  C  CA  . SER E 2 122 ? 58.625  -75.521  -23.453 1.00 33.82  ? 122 SER X CA  1 
ATOM   7074  C  C   . SER E 2 122 ? 57.632  -74.944  -24.437 1.00 34.34  ? 122 SER X C   1 
ATOM   7075  O  O   . SER E 2 122 ? 57.321  -75.559  -25.459 1.00 34.62  ? 122 SER X O   1 
ATOM   7076  C  CB  . SER E 2 122 ? 60.013  -74.954  -23.753 1.00 35.06  ? 122 SER X CB  1 
ATOM   7077  O  OG  . SER E 2 122 ? 60.049  -73.564  -23.458 1.00 36.04  ? 122 SER X OG  1 
ATOM   7078  N  N   . THR E 2 123 ? 57.162  -73.741  -24.130 1.00 34.94  ? 123 THR X N   1 
ATOM   7079  C  CA  . THR E 2 123 ? 56.150  -73.094  -24.942 1.00 35.72  ? 123 THR X CA  1 
ATOM   7080  C  C   . THR E 2 123 ? 56.737  -72.771  -26.311 1.00 35.68  ? 123 THR X C   1 
ATOM   7081  O  O   . THR E 2 123 ? 57.935  -72.518  -26.439 1.00 34.60  ? 123 THR X O   1 
ATOM   7082  C  CB  . THR E 2 123 ? 55.598  -71.801  -24.293 1.00 35.82  ? 123 THR X CB  1 
ATOM   7083  O  OG1 . THR E 2 123 ? 56.576  -70.759  -24.390 1.00 37.18  ? 123 THR X OG1 1 
ATOM   7084  C  CG2 . THR E 2 123 ? 55.238  -72.033  -22.826 1.00 35.22  ? 123 THR X CG2 1 
ATOM   7085  N  N   . LYS E 2 124 ? 55.880  -72.797  -27.324 1.00 35.93  ? 124 LYS X N   1 
ATOM   7086  C  CA  . LYS E 2 124 ? 56.288  -72.537  -28.695 1.00 36.99  ? 124 LYS X CA  1 
ATOM   7087  C  C   . LYS E 2 124 ? 55.085  -72.023  -29.473 1.00 37.29  ? 124 LYS X C   1 
ATOM   7088  O  O   . LYS E 2 124 ? 54.010  -72.637  -29.451 1.00 37.03  ? 124 LYS X O   1 
ATOM   7089  C  CB  . LYS E 2 124 ? 56.820  -73.818  -29.333 1.00 37.64  ? 124 LYS X CB  1 
ATOM   7090  C  CG  . LYS E 2 124 ? 57.398  -73.640  -30.729 1.00 38.64  ? 124 LYS X CG  1 
ATOM   7091  C  CD  . LYS E 2 124 ? 57.459  -74.969  -31.464 1.00 39.38  ? 124 LYS X CD  1 
ATOM   7092  C  CE  . LYS E 2 124 ? 58.039  -74.807  -32.857 1.00 40.19  ? 124 LYS X CE  1 
ATOM   7093  N  NZ  . LYS E 2 124 ? 57.806  -76.010  -33.712 1.00 40.64  ? 124 LYS X NZ  1 
ATOM   7094  N  N   . GLY E 2 125 ? 55.268  -70.888  -30.144 1.00 37.10  ? 125 GLY X N   1 
ATOM   7095  C  CA  . GLY E 2 125 ? 54.213  -70.296  -30.955 1.00 37.07  ? 125 GLY X CA  1 
ATOM   7096  C  C   . GLY E 2 125 ? 54.058  -71.066  -32.251 1.00 36.86  ? 125 GLY X C   1 
ATOM   7097  O  O   . GLY E 2 125 ? 55.005  -71.713  -32.704 1.00 36.64  ? 125 GLY X O   1 
ATOM   7098  N  N   . PRO E 2 126 ? 52.868  -70.993  -32.865 1.00 36.67  ? 126 PRO X N   1 
ATOM   7099  C  CA  . PRO E 2 126 ? 52.588  -71.748  -34.084 1.00 36.36  ? 126 PRO X CA  1 
ATOM   7100  C  C   . PRO E 2 126 ? 53.131  -71.104  -35.360 1.00 35.49  ? 126 PRO X C   1 
ATOM   7101  O  O   . PRO E 2 126 ? 53.435  -69.912  -35.377 1.00 34.70  ? 126 PRO X O   1 
ATOM   7102  C  CB  . PRO E 2 126 ? 51.061  -71.746  -34.139 1.00 36.83  ? 126 PRO X CB  1 
ATOM   7103  C  CG  . PRO E 2 126 ? 50.680  -70.443  -33.517 1.00 36.94  ? 126 PRO X CG  1 
ATOM   7104  C  CD  . PRO E 2 126 ? 51.725  -70.146  -32.471 1.00 36.80  ? 126 PRO X CD  1 
ATOM   7105  N  N   . SER E 2 127 ? 53.248  -71.914  -36.408 1.00 34.87  ? 127 SER X N   1 
ATOM   7106  C  CA  . SER E 2 127 ? 53.403  -71.424  -37.770 1.00 35.02  ? 127 SER X CA  1 
ATOM   7107  C  C   . SER E 2 127 ? 52.033  -71.503  -38.429 1.00 34.29  ? 127 SER X C   1 
ATOM   7108  O  O   . SER E 2 127 ? 51.284  -72.454  -38.195 1.00 35.00  ? 127 SER X O   1 
ATOM   7109  C  CB  . SER E 2 127 ? 54.407  -72.275  -38.543 1.00 35.98  ? 127 SER X CB  1 
ATOM   7110  O  OG  . SER E 2 127 ? 55.733  -72.041  -38.087 1.00 37.43  ? 127 SER X OG  1 
ATOM   7111  N  N   . VAL E 2 128 ? 51.707  -70.500  -39.242 1.00 33.03  ? 128 VAL X N   1 
ATOM   7112  C  CA  . VAL E 2 128 ? 50.382  -70.384  -39.851 1.00 31.57  ? 128 VAL X CA  1 
ATOM   7113  C  C   . VAL E 2 128 ? 50.460  -70.363  -41.375 1.00 31.43  ? 128 VAL X C   1 
ATOM   7114  O  O   . VAL E 2 128 ? 51.125  -69.510  -41.971 1.00 31.06  ? 128 VAL X O   1 
ATOM   7115  C  CB  . VAL E 2 128 ? 49.650  -69.118  -39.367 1.00 31.30  ? 128 VAL X CB  1 
ATOM   7116  C  CG1 . VAL E 2 128 ? 48.218  -69.086  -39.902 1.00 30.20  ? 128 VAL X CG1 1 
ATOM   7117  C  CG2 . VAL E 2 128 ? 49.661  -69.061  -37.845 1.00 31.58  ? 128 VAL X CG2 1 
ATOM   7118  N  N   . PHE E 2 129 ? 49.754  -71.302  -41.995 1.00 31.39  ? 129 PHE X N   1 
ATOM   7119  C  CA  . PHE E 2 129 ? 49.771  -71.467  -43.436 1.00 30.41  ? 129 PHE X CA  1 
ATOM   7120  C  C   . PHE E 2 129 ? 48.355  -71.346  -43.990 1.00 31.24  ? 129 PHE X C   1 
ATOM   7121  O  O   . PHE E 2 129 ? 47.394  -71.759  -43.337 1.00 30.70  ? 129 PHE X O   1 
ATOM   7122  C  CB  . PHE E 2 129 ? 50.367  -72.828  -43.789 1.00 29.94  ? 129 PHE X CB  1 
ATOM   7123  C  CG  . PHE E 2 129 ? 51.715  -73.080  -43.161 1.00 29.56  ? 129 PHE X CG  1 
ATOM   7124  C  CD1 . PHE E 2 129 ? 52.818  -72.324  -43.532 1.00 29.48  ? 129 PHE X CD1 1 
ATOM   7125  C  CD2 . PHE E 2 129 ? 51.878  -74.066  -42.199 1.00 29.47  ? 129 PHE X CD2 1 
ATOM   7126  C  CE1 . PHE E 2 129 ? 54.057  -72.546  -42.961 1.00 29.65  ? 129 PHE X CE1 1 
ATOM   7127  C  CE2 . PHE E 2 129 ? 53.116  -74.297  -41.619 1.00 29.49  ? 129 PHE X CE2 1 
ATOM   7128  C  CZ  . PHE E 2 129 ? 54.209  -73.536  -41.999 1.00 29.68  ? 129 PHE X CZ  1 
ATOM   7129  N  N   . PRO E 2 130 ? 48.218  -70.766  -45.195 1.00 31.02  ? 130 PRO X N   1 
ATOM   7130  C  CA  . PRO E 2 130 ? 46.896  -70.651  -45.803 1.00 30.82  ? 130 PRO X CA  1 
ATOM   7131  C  C   . PRO E 2 130 ? 46.410  -71.964  -46.400 1.00 29.95  ? 130 PRO X C   1 
ATOM   7132  O  O   . PRO E 2 130 ? 47.199  -72.730  -46.957 1.00 29.49  ? 130 PRO X O   1 
ATOM   7133  C  CB  . PRO E 2 130 ? 47.109  -69.620  -46.923 1.00 30.53  ? 130 PRO X CB  1 
ATOM   7134  C  CG  . PRO E 2 130 ? 48.549  -69.749  -47.288 1.00 30.25  ? 130 PRO X CG  1 
ATOM   7135  C  CD  . PRO E 2 130 ? 49.268  -70.137  -46.023 1.00 30.60  ? 130 PRO X CD  1 
ATOM   7136  N  N   . LEU E 2 131 ? 45.113  -72.206  -46.265 1.00 29.40  ? 131 LEU X N   1 
ATOM   7137  C  CA  . LEU E 2 131 ? 44.423  -73.238  -47.017 1.00 29.11  ? 131 LEU X CA  1 
ATOM   7138  C  C   . LEU E 2 131 ? 43.651  -72.479  -48.082 1.00 28.37  ? 131 LEU X C   1 
ATOM   7139  O  O   . LEU E 2 131 ? 42.539  -72.009  -47.841 1.00 27.20  ? 131 LEU X O   1 
ATOM   7140  C  CB  . LEU E 2 131 ? 43.500  -74.045  -46.107 1.00 29.54  ? 131 LEU X CB  1 
ATOM   7141  C  CG  . LEU E 2 131 ? 44.206  -74.764  -44.955 1.00 29.60  ? 131 LEU X CG  1 
ATOM   7142  C  CD1 . LEU E 2 131 ? 43.212  -75.169  -43.890 1.00 29.82  ? 131 LEU X CD1 1 
ATOM   7143  C  CD2 . LEU E 2 131 ? 44.985  -75.972  -45.473 1.00 30.02  ? 131 LEU X CD2 1 
ATOM   7144  N  N   . ALA E 2 132 ? 44.273  -72.326  -49.250 1.00 29.17  ? 132 ALA X N   1 
ATOM   7145  C  CA  . ALA E 2 132 ? 43.773  -71.411  -50.282 1.00 29.22  ? 132 ALA X CA  1 
ATOM   7146  C  C   . ALA E 2 132 ? 42.510  -71.940  -50.973 1.00 29.70  ? 132 ALA X C   1 
ATOM   7147  O  O   . ALA E 2 132 ? 42.345  -73.144  -51.128 1.00 30.44  ? 132 ALA X O   1 
ATOM   7148  C  CB  . ALA E 2 132 ? 44.857  -71.138  -51.306 1.00 28.31  ? 132 ALA X CB  1 
ATOM   7149  N  N   . PRO E 2 133 ? 41.614  -71.034  -51.396 1.00 30.56  ? 133 PRO X N   1 
ATOM   7150  C  CA  . PRO E 2 133 ? 40.375  -71.460  -52.076 1.00 30.45  ? 133 PRO X CA  1 
ATOM   7151  C  C   . PRO E 2 133 ? 40.572  -72.130  -53.440 1.00 29.87  ? 133 PRO X C   1 
ATOM   7152  O  O   . PRO E 2 133 ? 41.461  -71.750  -54.205 1.00 30.92  ? 133 PRO X O   1 
ATOM   7153  C  CB  . PRO E 2 133 ? 39.573  -70.158  -52.217 1.00 30.57  ? 133 PRO X CB  1 
ATOM   7154  C  CG  . PRO E 2 133 ? 40.541  -69.044  -51.939 1.00 30.86  ? 133 PRO X CG  1 
ATOM   7155  C  CD  . PRO E 2 133 ? 41.625  -69.591  -51.088 1.00 30.50  ? 133 PRO X CD  1 
ATOM   7156  N  N   . SER E 2 137 ? 36.104  -67.202  -58.002 1.00 37.13  ? 137 SER X N   1 
ATOM   7157  C  CA  . SER E 2 137 ? 35.888  -65.758  -58.118 1.00 36.99  ? 137 SER X CA  1 
ATOM   7158  C  C   . SER E 2 137 ? 34.963  -65.435  -59.287 1.00 36.52  ? 137 SER X C   1 
ATOM   7159  O  O   . SER E 2 137 ? 34.002  -64.676  -59.136 1.00 36.58  ? 137 SER X O   1 
ATOM   7160  C  CB  . SER E 2 137 ? 37.220  -65.027  -58.284 1.00 37.46  ? 137 SER X CB  1 
ATOM   7161  O  OG  . SER E 2 137 ? 37.016  -63.631  -58.437 1.00 37.40  ? 137 SER X OG  1 
ATOM   7162  N  N   . THR E 2 138 ? 35.269  -66.005  -60.452 1.00 35.93  ? 138 THR X N   1 
ATOM   7163  C  CA  . THR E 2 138 ? 34.370  -65.958  -61.609 1.00 35.74  ? 138 THR X CA  1 
ATOM   7164  C  C   . THR E 2 138 ? 33.294  -67.057  -61.533 1.00 35.76  ? 138 THR X C   1 
ATOM   7165  O  O   . THR E 2 138 ? 32.421  -67.140  -62.412 1.00 35.65  ? 138 THR X O   1 
ATOM   7166  C  CB  . THR E 2 138 ? 35.144  -66.083  -62.949 1.00 35.06  ? 138 THR X CB  1 
ATOM   7167  O  OG1 . THR E 2 138 ? 36.036  -67.204  -62.891 1.00 33.73  ? 138 THR X OG1 1 
ATOM   7168  C  CG2 . THR E 2 138 ? 35.933  -64.811  -63.236 1.00 34.76  ? 138 THR X CG2 1 
ATOM   7169  N  N   . SER E 2 139 ? 33.383  -67.901  -60.499 1.00 35.01  ? 139 SER X N   1 
ATOM   7170  C  CA  . SER E 2 139 ? 32.352  -68.893  -60.180 1.00 35.48  ? 139 SER X CA  1 
ATOM   7171  C  C   . SER E 2 139 ? 31.325  -68.339  -59.179 1.00 35.33  ? 139 SER X C   1 
ATOM   7172  O  O   . SER E 2 139 ? 31.572  -67.330  -58.508 1.00 35.82  ? 139 SER X O   1 
ATOM   7173  C  CB  . SER E 2 139 ? 32.994  -70.168  -59.629 1.00 34.86  ? 139 SER X CB  1 
ATOM   7174  O  OG  . SER E 2 139 ? 33.783  -70.803  -60.620 1.00 34.30  ? 139 SER X OG  1 
ATOM   7175  N  N   . GLU E 2 140 ? 30.190  -69.031  -59.073 1.00 35.02  ? 140 GLU X N   1 
ATOM   7176  C  CA  . GLU E 2 140 ? 28.994  -68.527  -58.386 1.00 34.20  ? 140 GLU X CA  1 
ATOM   7177  C  C   . GLU E 2 140 ? 28.461  -69.346  -57.214 1.00 34.35  ? 140 GLU X C   1 
ATOM   7178  O  O   . GLU E 2 140 ? 27.414  -69.004  -56.662 1.00 33.93  ? 140 GLU X O   1 
ATOM   7179  N  N   . SER E 2 141 ? 29.173  -70.408  -56.820 1.00 33.59  ? 141 SER X N   1 
ATOM   7180  C  CA  . SER E 2 141 ? 28.761  -71.258  -55.692 1.00 32.95  ? 141 SER X CA  1 
ATOM   7181  C  C   . SER E 2 141 ? 29.499  -70.817  -54.403 1.00 31.05  ? 141 SER X C   1 
ATOM   7182  O  O   . SER E 2 141 ? 29.954  -69.672  -54.299 1.00 29.35  ? 141 SER X O   1 
ATOM   7183  C  CB  . SER E 2 141 ? 29.040  -72.737  -56.008 1.00 33.94  ? 141 SER X CB  1 
ATOM   7184  O  OG  . SER E 2 141 ? 28.664  -73.104  -57.330 1.00 33.68  ? 141 SER X OG  1 
ATOM   7185  N  N   . THR E 2 142 ? 29.622  -71.712  -53.425 1.00 29.11  ? 142 THR X N   1 
ATOM   7186  C  CA  . THR E 2 142 ? 30.408  -71.397  -52.231 1.00 28.78  ? 142 THR X CA  1 
ATOM   7187  C  C   . THR E 2 142 ? 31.802  -72.018  -52.287 1.00 28.05  ? 142 THR X C   1 
ATOM   7188  O  O   . THR E 2 142 ? 31.991  -73.128  -52.791 1.00 27.25  ? 142 THR X O   1 
ATOM   7189  C  CB  . THR E 2 142 ? 29.707  -71.826  -50.928 1.00 28.48  ? 142 THR X CB  1 
ATOM   7190  O  OG1 . THR E 2 142 ? 29.764  -73.250  -50.788 1.00 28.64  ? 142 THR X OG1 1 
ATOM   7191  C  CG2 . THR E 2 142 ? 28.261  -71.355  -50.921 1.00 26.65  ? 142 THR X CG2 1 
ATOM   7192  N  N   . ALA E 2 143 ? 32.767  -71.266  -51.767 1.00 27.90  ? 143 ALA X N   1 
ATOM   7193  C  CA  . ALA E 2 143 ? 34.154  -71.674  -51.706 1.00 27.55  ? 143 ALA X CA  1 
ATOM   7194  C  C   . ALA E 2 143 ? 34.527  -71.887  -50.248 1.00 28.26  ? 143 ALA X C   1 
ATOM   7195  O  O   . ALA E 2 143 ? 33.926  -71.294  -49.363 1.00 25.45  ? 143 ALA X O   1 
ATOM   7196  C  CB  . ALA E 2 143 ? 35.031  -70.604  -52.320 1.00 26.90  ? 143 ALA X CB  1 
ATOM   7197  N  N   . ALA E 2 144 ? 35.518  -72.743  -50.013 1.00 29.91  ? 144 ALA X N   1 
ATOM   7198  C  CA  . ALA E 2 144 ? 36.060  -72.968  -48.678 1.00 32.18  ? 144 ALA X CA  1 
ATOM   7199  C  C   . ALA E 2 144 ? 37.518  -72.527  -48.679 1.00 34.03  ? 144 ALA X C   1 
ATOM   7200  O  O   . ALA E 2 144 ? 38.212  -72.640  -49.687 1.00 34.29  ? 144 ALA X O   1 
ATOM   7201  C  CB  . ALA E 2 144 ? 35.951  -74.441  -48.283 1.00 31.17  ? 144 ALA X CB  1 
ATOM   7202  N  N   . LEU E 2 145 ? 37.964  -72.009  -47.543 1.00 35.85  ? 145 LEU X N   1 
ATOM   7203  C  CA  . LEU E 2 145 ? 39.347  -71.592  -47.367 1.00 36.43  ? 145 LEU X CA  1 
ATOM   7204  C  C   . LEU E 2 145 ? 39.663  -71.669  -45.892 1.00 36.24  ? 145 LEU X C   1 
ATOM   7205  O  O   . LEU E 2 145 ? 38.754  -71.807  -45.080 1.00 35.74  ? 145 LEU X O   1 
ATOM   7206  C  CB  . LEU E 2 145 ? 39.564  -70.168  -47.893 1.00 35.96  ? 145 LEU X CB  1 
ATOM   7207  C  CG  . LEU E 2 145 ? 38.604  -69.093  -47.383 1.00 35.16  ? 145 LEU X CG  1 
ATOM   7208  C  CD1 . LEU E 2 145 ? 38.967  -68.668  -45.976 1.00 35.19  ? 145 LEU X CD1 1 
ATOM   7209  C  CD2 . LEU E 2 145 ? 38.611  -67.897  -48.313 1.00 35.28  ? 145 LEU X CD2 1 
ATOM   7210  N  N   . GLY E 2 146 ? 40.939  -71.571  -45.535 1.00 37.31  ? 146 GLY X N   1 
ATOM   7211  C  CA  . GLY E 2 146 ? 41.288  -71.648  -44.126 1.00 38.52  ? 146 GLY X CA  1 
ATOM   7212  C  C   . GLY E 2 146 ? 42.704  -71.305  -43.751 1.00 39.18  ? 146 GLY X C   1 
ATOM   7213  O  O   . GLY E 2 146 ? 43.479  -70.804  -44.566 1.00 39.01  ? 146 GLY X O   1 
ATOM   7214  N  N   . CYS E 2 147 ? 43.022  -71.582  -42.489 1.00 40.51  ? 147 CYS X N   1 
ATOM   7215  C  CA  . CYS E 2 147 ? 44.382  -71.502  -41.987 1.00 40.81  ? 147 CYS X CA  1 
ATOM   7216  C  C   . CYS E 2 147 ? 44.760  -72.787  -41.272 1.00 39.96  ? 147 CYS X C   1 
ATOM   7217  O  O   . CYS E 2 147 ? 43.993  -73.295  -40.456 1.00 39.53  ? 147 CYS X O   1 
ATOM   7218  C  CB  . CYS E 2 147 ? 44.529  -70.333  -41.025 1.00 42.31  ? 147 CYS X CB  1 
ATOM   7219  S  SG  . CYS E 2 147 ? 44.588  -68.722  -41.845 1.00 44.53  ? 147 CYS X SG  1 
ATOM   7220  N  N   . LEU E 2 148 ? 45.946  -73.298  -41.596 1.00 39.02  ? 148 LEU X N   1 
ATOM   7221  C  CA  . LEU E 2 148 ? 46.571  -74.384  -40.857 1.00 38.22  ? 148 LEU X CA  1 
ATOM   7222  C  C   . LEU E 2 148 ? 47.445  -73.758  -39.772 1.00 37.51  ? 148 LEU X C   1 
ATOM   7223  O  O   . LEU E 2 148 ? 48.389  -73.038  -40.076 1.00 37.46  ? 148 LEU X O   1 
ATOM   7224  C  CB  . LEU E 2 148 ? 47.421  -75.245  -41.798 1.00 38.14  ? 148 LEU X CB  1 
ATOM   7225  C  CG  . LEU E 2 148 ? 48.176  -76.431  -41.201 1.00 37.92  ? 148 LEU X CG  1 
ATOM   7226  C  CD1 . LEU E 2 148 ? 47.194  -77.413  -40.603 1.00 37.33  ? 148 LEU X CD1 1 
ATOM   7227  C  CD2 . LEU E 2 148 ? 49.059  -77.102  -42.255 1.00 37.04  ? 148 LEU X CD2 1 
ATOM   7228  N  N   . VAL E 2 149 ? 47.116  -74.019  -38.511 1.00 37.10  ? 149 VAL X N   1 
ATOM   7229  C  CA  . VAL E 2 149 ? 47.899  -73.512  -37.386 1.00 36.69  ? 149 VAL X CA  1 
ATOM   7230  C  C   . VAL E 2 149 ? 48.746  -74.646  -36.836 1.00 37.01  ? 149 VAL X C   1 
ATOM   7231  O  O   . VAL E 2 149 ? 48.236  -75.534  -36.148 1.00 35.31  ? 149 VAL X O   1 
ATOM   7232  C  CB  . VAL E 2 149 ? 47.003  -72.941  -36.277 1.00 35.65  ? 149 VAL X CB  1 
ATOM   7233  C  CG1 . VAL E 2 149 ? 47.861  -72.309  -35.189 1.00 36.15  ? 149 VAL X CG1 1 
ATOM   7234  C  CG2 . VAL E 2 149 ? 46.036  -71.922  -36.858 1.00 35.71  ? 149 VAL X CG2 1 
ATOM   7235  N  N   . LYS E 2 150 ? 50.046  -74.601  -37.123 1.00 38.35  ? 150 LYS X N   1 
ATOM   7236  C  CA  . LYS E 2 150 ? 50.903  -75.766  -36.915 1.00 39.69  ? 150 LYS X CA  1 
ATOM   7237  C  C   . LYS E 2 150 ? 51.995  -75.608  -35.845 1.00 39.52  ? 150 LYS X C   1 
ATOM   7238  O  O   . LYS E 2 150 ? 52.562  -74.531  -35.657 1.00 39.27  ? 150 LYS X O   1 
ATOM   7239  C  CB  . LYS E 2 150 ? 51.542  -76.194  -38.247 1.00 40.20  ? 150 LYS X CB  1 
ATOM   7240  C  CG  . LYS E 2 150 ? 51.605  -77.707  -38.391 1.00 40.92  ? 150 LYS X CG  1 
ATOM   7241  C  CD  . LYS E 2 150 ? 52.607  -78.163  -39.418 1.00 41.29  ? 150 LYS X CD  1 
ATOM   7242  C  CE  . LYS E 2 150 ? 52.825  -79.673  -39.336 1.00 41.79  ? 150 LYS X CE  1 
ATOM   7243  N  NZ  . LYS E 2 150 ? 54.180  -80.057  -39.826 1.00 43.53  ? 150 LYS X NZ  1 
ATOM   7244  N  N   . ASP E 2 151 ? 52.260  -76.717  -35.153 1.00 39.20  ? 151 ASP X N   1 
ATOM   7245  C  CA  . ASP E 2 151 ? 53.421  -76.883  -34.280 1.00 38.23  ? 151 ASP X CA  1 
ATOM   7246  C  C   . ASP E 2 151 ? 53.529  -75.849  -33.160 1.00 37.97  ? 151 ASP X C   1 
ATOM   7247  O  O   . ASP E 2 151 ? 54.469  -75.050  -33.132 1.00 38.25  ? 151 ASP X O   1 
ATOM   7248  C  CB  . ASP E 2 151 ? 54.706  -76.904  -35.117 1.00 38.63  ? 151 ASP X CB  1 
ATOM   7249  C  CG  . ASP E 2 151 ? 54.708  -78.011  -36.159 1.00 38.53  ? 151 ASP X CG  1 
ATOM   7250  O  OD1 . ASP E 2 151 ? 54.094  -79.073  -35.914 1.00 39.28  ? 151 ASP X OD1 1 
ATOM   7251  O  OD2 . ASP E 2 151 ? 55.329  -77.819  -37.223 1.00 37.56  ? 151 ASP X OD2 1 
ATOM   7252  N  N   . TYR E 2 152 ? 52.576  -75.887  -32.228 1.00 37.02  ? 152 TYR X N   1 
ATOM   7253  C  CA  . TYR E 2 152 ? 52.601  -75.003  -31.063 1.00 36.92  ? 152 TYR X CA  1 
ATOM   7254  C  C   . TYR E 2 152 ? 52.455  -75.778  -29.762 1.00 35.71  ? 152 TYR X C   1 
ATOM   7255  O  O   . TYR E 2 152 ? 51.962  -76.907  -29.747 1.00 34.50  ? 152 TYR X O   1 
ATOM   7256  C  CB  . TYR E 2 152 ? 51.506  -73.931  -31.154 1.00 37.77  ? 152 TYR X CB  1 
ATOM   7257  C  CG  . TYR E 2 152 ? 50.088  -74.463  -31.147 1.00 38.72  ? 152 TYR X CG  1 
ATOM   7258  C  CD1 . TYR E 2 152 ? 49.388  -74.617  -29.952 1.00 39.05  ? 152 TYR X CD1 1 
ATOM   7259  C  CD2 . TYR E 2 152 ? 49.444  -74.809  -32.340 1.00 39.36  ? 152 TYR X CD2 1 
ATOM   7260  C  CE1 . TYR E 2 152 ? 48.087  -75.103  -29.939 1.00 39.62  ? 152 TYR X CE1 1 
ATOM   7261  C  CE2 . TYR E 2 152 ? 48.144  -75.294  -32.341 1.00 39.69  ? 152 TYR X CE2 1 
ATOM   7262  C  CZ  . TYR E 2 152 ? 47.467  -75.440  -31.137 1.00 40.22  ? 152 TYR X CZ  1 
ATOM   7263  O  OH  . TYR E 2 152 ? 46.172  -75.915  -31.125 1.00 39.48  ? 152 TYR X OH  1 
ATOM   7264  N  N   . PHE E 2 153 ? 52.900  -75.156  -28.674 1.00 35.31  ? 153 PHE X N   1 
ATOM   7265  C  CA  . PHE E 2 153 ? 52.738  -75.719  -27.333 1.00 34.35  ? 153 PHE X CA  1 
ATOM   7266  C  C   . PHE E 2 153 ? 52.816  -74.607  -26.283 1.00 34.44  ? 153 PHE X C   1 
ATOM   7267  O  O   . PHE E 2 153 ? 53.595  -73.676  -26.441 1.00 35.49  ? 153 PHE X O   1 
ATOM   7268  C  CB  . PHE E 2 153 ? 53.801  -76.783  -27.046 1.00 32.48  ? 153 PHE X CB  1 
ATOM   7269  C  CG  . PHE E 2 153 ? 53.569  -77.525  -25.767 1.00 31.86  ? 153 PHE X CG  1 
ATOM   7270  C  CD1 . PHE E 2 153 ? 52.825  -78.697  -25.756 1.00 32.67  ? 153 PHE X CD1 1 
ATOM   7271  C  CD2 . PHE E 2 153 ? 54.060  -77.037  -24.565 1.00 31.76  ? 153 PHE X CD2 1 
ATOM   7272  C  CE1 . PHE E 2 153 ? 52.588  -79.382  -24.566 1.00 32.23  ? 153 PHE X CE1 1 
ATOM   7273  C  CE2 . PHE E 2 153 ? 53.831  -77.715  -23.373 1.00 31.81  ? 153 PHE X CE2 1 
ATOM   7274  C  CZ  . PHE E 2 153 ? 53.094  -78.889  -23.373 1.00 31.81  ? 153 PHE X CZ  1 
ATOM   7275  N  N   . PRO E 2 154 ? 51.981  -74.675  -25.230 1.00 34.23  ? 154 PRO X N   1 
ATOM   7276  C  CA  . PRO E 2 154 ? 50.867  -75.598  -25.025 1.00 34.06  ? 154 PRO X CA  1 
ATOM   7277  C  C   . PRO E 2 154 ? 49.596  -75.097  -25.699 1.00 33.57  ? 154 PRO X C   1 
ATOM   7278  O  O   . PRO E 2 154 ? 49.617  -74.103  -26.426 1.00 32.01  ? 154 PRO X O   1 
ATOM   7279  C  CB  . PRO E 2 154 ? 50.695  -75.589  -23.505 1.00 34.11  ? 154 PRO X CB  1 
ATOM   7280  C  CG  . PRO E 2 154 ? 51.070  -74.205  -23.109 1.00 34.40  ? 154 PRO X CG  1 
ATOM   7281  C  CD  . PRO E 2 154 ? 52.133  -73.752  -24.089 1.00 34.45  ? 154 PRO X CD  1 
ATOM   7282  N  N   . GLU E 2 155 ? 48.498  -75.796  -25.450 1.00 35.02  ? 155 GLU X N   1 
ATOM   7283  C  CA  . GLU E 2 155 ? 47.179  -75.279  -25.769 1.00 36.33  ? 155 GLU X CA  1 
ATOM   7284  C  C   . GLU E 2 155 ? 46.873  -74.129  -24.806 1.00 35.61  ? 155 GLU X C   1 
ATOM   7285  O  O   . GLU E 2 155 ? 47.504  -74.020  -23.754 1.00 34.73  ? 155 GLU X O   1 
ATOM   7286  C  CB  . GLU E 2 155 ? 46.125  -76.386  -25.656 1.00 37.89  ? 155 GLU X CB  1 
ATOM   7287  C  CG  . GLU E 2 155 ? 46.242  -77.446  -26.744 1.00 40.28  ? 155 GLU X CG  1 
ATOM   7288  C  CD  . GLU E 2 155 ? 45.134  -78.483  -26.675 1.00 42.86  ? 155 GLU X CD  1 
ATOM   7289  O  OE1 . GLU E 2 155 ? 45.276  -79.451  -25.890 1.00 44.83  ? 155 GLU X OE1 1 
ATOM   7290  O  OE2 . GLU E 2 155 ? 44.121  -78.329  -27.403 1.00 44.02  ? 155 GLU X OE2 1 
ATOM   7291  N  N   . PRO E 2 156 ? 45.925  -73.249  -25.168 1.00 35.44  ? 156 PRO X N   1 
ATOM   7292  C  CA  . PRO E 2 156 ? 45.179  -73.196  -26.420 1.00 35.73  ? 156 PRO X CA  1 
ATOM   7293  C  C   . PRO E 2 156 ? 45.702  -72.145  -27.392 1.00 36.37  ? 156 PRO X C   1 
ATOM   7294  O  O   . PRO E 2 156 ? 46.542  -71.322  -27.039 1.00 36.50  ? 156 PRO X O   1 
ATOM   7295  C  CB  . PRO E 2 156 ? 43.791  -72.785  -25.950 1.00 35.81  ? 156 PRO X CB  1 
ATOM   7296  C  CG  . PRO E 2 156 ? 44.071  -71.873  -24.758 1.00 35.47  ? 156 PRO X CG  1 
ATOM   7297  C  CD  . PRO E 2 156 ? 45.411  -72.262  -24.198 1.00 34.77  ? 156 PRO X CD  1 
ATOM   7298  N  N   . VAL E 2 157 ? 45.192  -72.189  -28.614 1.00 37.19  ? 157 VAL X N   1 
ATOM   7299  C  CA  . VAL E 2 157 ? 45.289  -71.073  -29.536 1.00 37.77  ? 157 VAL X CA  1 
ATOM   7300  C  C   . VAL E 2 157 ? 43.858  -70.673  -29.887 1.00 37.95  ? 157 VAL X C   1 
ATOM   7301  O  O   . VAL E 2 157 ? 42.972  -71.531  -29.947 1.00 38.08  ? 157 VAL X O   1 
ATOM   7302  C  CB  . VAL E 2 157 ? 46.053  -71.471  -30.807 1.00 39.29  ? 157 VAL X CB  1 
ATOM   7303  C  CG1 . VAL E 2 157 ? 45.101  -72.094  -31.840 1.00 39.47  ? 157 VAL X CG1 1 
ATOM   7304  C  CG2 . VAL E 2 157 ? 46.785  -70.267  -31.393 1.00 39.94  ? 157 VAL X CG2 1 
ATOM   7305  N  N   . THR E 2 158 ? 43.621  -69.378  -30.091 1.00 37.47  ? 158 THR X N   1 
ATOM   7306  C  CA  . THR E 2 158 ? 42.318  -68.910  -30.558 1.00 37.76  ? 158 THR X CA  1 
ATOM   7307  C  C   . THR E 2 158 ? 42.447  -68.448  -32.008 1.00 36.62  ? 158 THR X C   1 
ATOM   7308  O  O   . THR E 2 158 ? 43.480  -67.905  -32.405 1.00 35.40  ? 158 THR X O   1 
ATOM   7309  C  CB  . THR E 2 158 ? 41.765  -67.750  -29.709 1.00 39.08  ? 158 THR X CB  1 
ATOM   7310  O  OG1 . THR E 2 158 ? 42.492  -66.552  -29.999 1.00 40.91  ? 158 THR X OG1 1 
ATOM   7311  C  CG2 . THR E 2 158 ? 41.876  -68.058  -28.218 1.00 39.49  ? 158 THR X CG2 1 
ATOM   7312  N  N   . VAL E 2 159 ? 41.397  -68.681  -32.788 1.00 35.59  ? 159 VAL X N   1 
ATOM   7313  C  CA  . VAL E 2 159 ? 41.347  -68.252  -34.175 1.00 35.65  ? 159 VAL X CA  1 
ATOM   7314  C  C   . VAL E 2 159 ? 40.045  -67.512  -34.437 1.00 35.95  ? 159 VAL X C   1 
ATOM   7315  O  O   . VAL E 2 159 ? 38.972  -67.998  -34.076 1.00 35.97  ? 159 VAL X O   1 
ATOM   7316  C  CB  . VAL E 2 159 ? 41.415  -69.450  -35.139 1.00 34.86  ? 159 VAL X CB  1 
ATOM   7317  C  CG1 . VAL E 2 159 ? 41.422  -68.967  -36.588 1.00 34.25  ? 159 VAL X CG1 1 
ATOM   7318  C  CG2 . VAL E 2 159 ? 42.638  -70.308  -34.844 1.00 34.53  ? 159 VAL X CG2 1 
ATOM   7319  N  N   . SER E 2 160 ? 40.149  -66.339  -35.058 1.00 36.57  ? 160 SER X N   1 
ATOM   7320  C  CA  . SER E 2 160 ? 38.978  -65.613  -35.564 1.00 36.83  ? 160 SER X CA  1 
ATOM   7321  C  C   . SER E 2 160 ? 39.207  -65.200  -37.007 1.00 36.76  ? 160 SER X C   1 
ATOM   7322  O  O   . SER E 2 160 ? 40.331  -65.238  -37.501 1.00 36.69  ? 160 SER X O   1 
ATOM   7323  C  CB  . SER E 2 160 ? 38.706  -64.367  -34.721 1.00 37.35  ? 160 SER X CB  1 
ATOM   7324  O  OG  . SER E 2 160 ? 39.743  -63.419  -34.879 1.00 37.91  ? 160 SER X OG  1 
ATOM   7325  N  N   . TRP E 2 161 ? 38.135  -64.801  -37.678 1.00 37.36  ? 161 TRP X N   1 
ATOM   7326  C  CA  . TRP E 2 161 ? 38.210  -64.359  -39.070 1.00 36.34  ? 161 TRP X CA  1 
ATOM   7327  C  C   . TRP E 2 161 ? 37.777  -62.912  -39.218 1.00 35.70  ? 161 TRP X C   1 
ATOM   7328  O  O   . TRP E 2 161 ? 36.773  -62.495  -38.643 1.00 33.62  ? 161 TRP X O   1 
ATOM   7329  C  CB  . TRP E 2 161 ? 37.353  -65.261  -39.957 1.00 36.99  ? 161 TRP X CB  1 
ATOM   7330  C  CG  . TRP E 2 161 ? 37.953  -66.604  -40.127 1.00 37.47  ? 161 TRP X CG  1 
ATOM   7331  C  CD1 . TRP E 2 161 ? 37.780  -67.693  -39.322 1.00 37.57  ? 161 TRP X CD1 1 
ATOM   7332  C  CD2 . TRP E 2 161 ? 38.865  -67.000  -41.150 1.00 37.76  ? 161 TRP X CD2 1 
ATOM   7333  N  NE1 . TRP E 2 161 ? 38.512  -68.750  -39.793 1.00 37.45  ? 161 TRP X NE1 1 
ATOM   7334  C  CE2 . TRP E 2 161 ? 39.190  -68.351  -40.917 1.00 37.84  ? 161 TRP X CE2 1 
ATOM   7335  C  CE3 . TRP E 2 161 ? 39.427  -66.349  -42.250 1.00 37.60  ? 161 TRP X CE3 1 
ATOM   7336  C  CZ2 . TRP E 2 161 ? 40.053  -69.058  -41.741 1.00 37.72  ? 161 TRP X CZ2 1 
ATOM   7337  C  CZ3 . TRP E 2 161 ? 40.277  -67.050  -43.067 1.00 38.14  ? 161 TRP X CZ3 1 
ATOM   7338  C  CH2 . TRP E 2 161 ? 40.586  -68.392  -42.810 1.00 38.12  ? 161 TRP X CH2 1 
ATOM   7339  N  N   . ASN E 2 162 ? 38.545  -62.160  -40.008 1.00 37.08  ? 162 ASN X N   1 
ATOM   7340  C  CA  . ASN E 2 162 ? 38.306  -60.733  -40.226 1.00 37.24  ? 162 ASN X CA  1 
ATOM   7341  C  C   . ASN E 2 162 ? 38.054  -60.016  -38.902 1.00 36.70  ? 162 ASN X C   1 
ATOM   7342  O  O   . ASN E 2 162 ? 37.073  -59.282  -38.751 1.00 36.24  ? 162 ASN X O   1 
ATOM   7343  C  CB  . ASN E 2 162 ? 37.144  -60.512  -41.209 1.00 38.04  ? 162 ASN X CB  1 
ATOM   7344  C  CG  . ASN E 2 162 ? 37.428  -61.070  -42.609 1.00 38.58  ? 162 ASN X CG  1 
ATOM   7345  O  OD1 . ASN E 2 162 ? 38.568  -61.376  -42.958 1.00 37.94  ? 162 ASN X OD1 1 
ATOM   7346  N  ND2 . ASN E 2 162 ? 36.377  -61.195  -43.414 1.00 39.41  ? 162 ASN X ND2 1 
ATOM   7347  N  N   . SER E 2 163 ? 38.950  -60.269  -37.946 1.00 36.58  ? 163 SER X N   1 
ATOM   7348  C  CA  . SER E 2 163 ? 38.907  -59.668  -36.612 1.00 36.45  ? 163 SER X CA  1 
ATOM   7349  C  C   . SER E 2 163 ? 37.605  -59.945  -35.860 1.00 36.30  ? 163 SER X C   1 
ATOM   7350  O  O   . SER E 2 163 ? 37.092  -59.074  -35.152 1.00 35.61  ? 163 SER X O   1 
ATOM   7351  C  CB  . SER E 2 163 ? 39.143  -58.156  -36.702 1.00 36.40  ? 163 SER X CB  1 
ATOM   7352  O  OG  . SER E 2 163 ? 40.246  -57.863  -37.534 1.00 36.57  ? 163 SER X OG  1 
ATOM   7353  N  N   . GLY E 2 164 ? 37.070  -61.153  -36.015 1.00 36.52  ? 164 GLY X N   1 
ATOM   7354  C  CA  . GLY E 2 164 ? 35.828  -61.525  -35.332 1.00 36.53  ? 164 GLY X CA  1 
ATOM   7355  C  C   . GLY E 2 164 ? 34.547  -61.078  -36.021 1.00 36.70  ? 164 GLY X C   1 
ATOM   7356  O  O   . GLY E 2 164 ? 33.455  -61.426  -35.578 1.00 37.45  ? 164 GLY X O   1 
ATOM   7357  N  N   . ALA E 2 165 ? 34.666  -60.306  -37.099 1.00 37.16  ? 165 ALA X N   1 
ATOM   7358  C  CA  . ALA E 2 165 ? 33.500  -59.913  -37.888 1.00 38.65  ? 165 ALA X CA  1 
ATOM   7359  C  C   . ALA E 2 165 ? 32.870  -61.123  -38.595 1.00 39.09  ? 165 ALA X C   1 
ATOM   7360  O  O   . ALA E 2 165 ? 31.652  -61.194  -38.762 1.00 39.93  ? 165 ALA X O   1 
ATOM   7361  C  CB  . ALA E 2 165 ? 33.886  -58.845  -38.913 1.00 38.81  ? 165 ALA X CB  1 
ATOM   7362  N  N   . LEU E 2 166 ? 33.702  -62.073  -39.003 1.00 38.55  ? 166 LEU X N   1 
ATOM   7363  C  CA  . LEU E 2 166 ? 33.228  -63.236  -39.738 1.00 38.55  ? 166 LEU X CA  1 
ATOM   7364  C  C   . LEU E 2 166 ? 33.174  -64.440  -38.804 1.00 39.12  ? 166 LEU X C   1 
ATOM   7365  O  O   . LEU E 2 166 ? 34.206  -65.010  -38.467 1.00 40.12  ? 166 LEU X O   1 
ATOM   7366  C  CB  . LEU E 2 166 ? 34.143  -63.502  -40.939 1.00 37.12  ? 166 LEU X CB  1 
ATOM   7367  C  CG  . LEU E 2 166 ? 33.785  -64.650  -41.887 1.00 36.46  ? 166 LEU X CG  1 
ATOM   7368  C  CD1 . LEU E 2 166 ? 32.303  -64.621  -42.261 1.00 35.31  ? 166 LEU X CD1 1 
ATOM   7369  C  CD2 . LEU E 2 166 ? 34.675  -64.571  -43.132 1.00 34.80  ? 166 LEU X CD2 1 
ATOM   7370  N  N   . THR E 2 167 ? 31.966  -64.796  -38.370 1.00 39.36  ? 167 THR X N   1 
ATOM   7371  C  CA  . THR E 2 167 ? 31.748  -65.923  -37.458 1.00 39.59  ? 167 THR X CA  1 
ATOM   7372  C  C   . THR E 2 167 ? 30.913  -67.038  -38.097 1.00 39.82  ? 167 THR X C   1 
ATOM   7373  O  O   . THR E 2 167 ? 31.143  -68.220  -37.844 1.00 38.90  ? 167 THR X O   1 
ATOM   7374  C  CB  . THR E 2 167 ? 31.041  -65.450  -36.172 1.00 39.78  ? 167 THR X CB  1 
ATOM   7375  O  OG1 . THR E 2 167 ? 29.850  -64.739  -36.523 1.00 39.77  ? 167 THR X OG1 1 
ATOM   7376  C  CG2 . THR E 2 167 ? 31.948  -64.525  -35.363 1.00 38.50  ? 167 THR X CG2 1 
ATOM   7377  N  N   . SER E 2 168 ? 29.943  -66.654  -38.921 1.00 40.65  ? 168 SER X N   1 
ATOM   7378  C  CA  . SER E 2 168 ? 29.060  -67.605  -39.596 1.00 41.01  ? 168 SER X CA  1 
ATOM   7379  C  C   . SER E 2 168 ? 29.827  -68.469  -40.597 1.00 39.77  ? 168 SER X C   1 
ATOM   7380  O  O   . SER E 2 168 ? 30.621  -67.965  -41.388 1.00 39.45  ? 168 SER X O   1 
ATOM   7381  C  CB  . SER E 2 168 ? 27.921  -66.850  -40.293 1.00 42.36  ? 168 SER X CB  1 
ATOM   7382  O  OG  . SER E 2 168 ? 27.182  -67.688  -41.168 1.00 44.57  ? 168 SER X OG  1 
ATOM   7383  N  N   . GLY E 2 169 ? 29.599  -69.780  -40.531 1.00 39.06  ? 169 GLY X N   1 
ATOM   7384  C  CA  . GLY E 2 169 ? 30.258  -70.738  -41.413 1.00 38.63  ? 169 GLY X CA  1 
ATOM   7385  C  C   . GLY E 2 169 ? 31.702  -71.078  -41.055 1.00 38.42  ? 169 GLY X C   1 
ATOM   7386  O  O   . GLY E 2 169 ? 32.370  -71.805  -41.798 1.00 37.70  ? 169 GLY X O   1 
ATOM   7387  N  N   . VAL E 2 170 ? 32.188  -70.553  -39.931 1.00 36.05  ? 170 VAL X N   1 
ATOM   7388  C  CA  . VAL E 2 170 ? 33.530  -70.845  -39.475 1.00 35.27  ? 170 VAL X CA  1 
ATOM   7389  C  C   . VAL E 2 170 ? 33.509  -72.194  -38.761 1.00 35.21  ? 170 VAL X C   1 
ATOM   7390  O  O   . VAL E 2 170 ? 32.550  -72.521  -38.055 1.00 35.97  ? 170 VAL X O   1 
ATOM   7391  C  CB  . VAL E 2 170 ? 34.074  -69.746  -38.515 1.00 34.24  ? 170 VAL X CB  1 
ATOM   7392  C  CG1 . VAL E 2 170 ? 35.379  -70.185  -37.876 1.00 33.30  ? 170 VAL X CG1 1 
ATOM   7393  C  CG2 . VAL E 2 170 ? 34.257  -68.423  -39.252 1.00 33.72  ? 170 VAL X CG2 1 
ATOM   7394  N  N   . HIS E 2 171 ? 34.562  -72.976  -38.962 1.00 33.91  ? 171 HIS X N   1 
ATOM   7395  C  CA  . HIS E 2 171 ? 34.781  -74.195  -38.196 1.00 33.31  ? 171 HIS X CA  1 
ATOM   7396  C  C   . HIS E 2 171 ? 36.235  -74.235  -37.814 1.00 33.24  ? 171 HIS X C   1 
ATOM   7397  O  O   . HIS E 2 171 ? 37.104  -74.266  -38.680 1.00 33.49  ? 171 HIS X O   1 
ATOM   7398  C  CB  . HIS E 2 171 ? 34.437  -75.444  -39.006 1.00 32.70  ? 171 HIS X CB  1 
ATOM   7399  C  CG  . HIS E 2 171 ? 32.994  -75.540  -39.378 1.00 31.83  ? 171 HIS X CG  1 
ATOM   7400  N  ND1 . HIS E 2 171 ? 32.006  -75.824  -38.459 1.00 31.94  ? 171 HIS X ND1 1 
ATOM   7401  C  CD2 . HIS E 2 171 ? 32.370  -75.393  -40.568 1.00 32.13  ? 171 HIS X CD2 1 
ATOM   7402  C  CE1 . HIS E 2 171 ? 30.835  -75.845  -39.070 1.00 32.16  ? 171 HIS X CE1 1 
ATOM   7403  N  NE2 . HIS E 2 171 ? 31.029  -75.592  -40.352 1.00 31.36  ? 171 HIS X NE2 1 
ATOM   7404  N  N   . THR E 2 172 ? 36.496  -74.205  -36.514 1.00 33.62  ? 172 THR X N   1 
ATOM   7405  C  CA  . THR E 2 172 ? 37.839  -74.346  -36.001 1.00 34.46  ? 172 THR X CA  1 
ATOM   7406  C  C   . THR E 2 172 ? 37.870  -75.698  -35.308 1.00 34.88  ? 172 THR X C   1 
ATOM   7407  O  O   . THR E 2 172 ? 37.118  -75.932  -34.363 1.00 35.89  ? 172 THR X O   1 
ATOM   7408  C  CB  . THR E 2 172 ? 38.186  -73.209  -35.040 1.00 34.77  ? 172 THR X CB  1 
ATOM   7409  O  OG1 . THR E 2 172 ? 38.001  -71.959  -35.717 1.00 35.38  ? 172 THR X OG1 1 
ATOM   7410  C  CG2 . THR E 2 172 ? 39.623  -73.322  -34.554 1.00 35.13  ? 172 THR X CG2 1 
ATOM   7411  N  N   . PHE E 2 173 ? 38.727  -76.586  -35.802 1.00 34.03  ? 173 PHE X N   1 
ATOM   7412  C  CA  . PHE E 2 173 ? 38.762  -77.961  -35.338 1.00 34.23  ? 173 PHE X CA  1 
ATOM   7413  C  C   . PHE E 2 173 ? 39.521  -78.061  -34.027 1.00 35.42  ? 173 PHE X C   1 
ATOM   7414  O  O   . PHE E 2 173 ? 40.284  -77.158  -33.685 1.00 35.79  ? 173 PHE X O   1 
ATOM   7415  C  CB  . PHE E 2 173 ? 39.378  -78.865  -36.422 1.00 34.05  ? 173 PHE X CB  1 
ATOM   7416  C  CG  . PHE E 2 173 ? 38.523  -78.969  -37.654 1.00 33.61  ? 173 PHE X CG  1 
ATOM   7417  C  CD1 . PHE E 2 173 ? 37.498  -79.902  -37.720 1.00 33.88  ? 173 PHE X CD1 1 
ATOM   7418  C  CD2 . PHE E 2 173 ? 38.691  -78.094  -38.714 1.00 33.21  ? 173 PHE X CD2 1 
ATOM   7419  C  CE1 . PHE E 2 173 ? 36.680  -79.980  -38.834 1.00 32.98  ? 173 PHE X CE1 1 
ATOM   7420  C  CE2 . PHE E 2 173 ? 37.873  -78.171  -39.841 1.00 33.07  ? 173 PHE X CE2 1 
ATOM   7421  C  CZ  . PHE E 2 173 ? 36.869  -79.117  -39.897 1.00 32.81  ? 173 PHE X CZ  1 
ATOM   7422  N  N   . PRO E 2 174 ? 39.292  -79.148  -33.268 1.00 37.35  ? 174 PRO X N   1 
ATOM   7423  C  CA  . PRO E 2 174 ? 40.104  -79.388  -32.079 1.00 37.60  ? 174 PRO X CA  1 
ATOM   7424  C  C   . PRO E 2 174 ? 41.560  -79.597  -32.456 1.00 38.77  ? 174 PRO X C   1 
ATOM   7425  O  O   . PRO E 2 174 ? 41.847  -80.121  -33.536 1.00 38.39  ? 174 PRO X O   1 
ATOM   7426  C  CB  . PRO E 2 174 ? 39.528  -80.683  -31.500 1.00 37.26  ? 174 PRO X CB  1 
ATOM   7427  C  CG  . PRO E 2 174 ? 38.182  -80.816  -32.066 1.00 37.75  ? 174 PRO X CG  1 
ATOM   7428  C  CD  . PRO E 2 174 ? 38.158  -80.086  -33.369 1.00 37.76  ? 174 PRO X CD  1 
ATOM   7429  N  N   . ALA E 2 175 ? 42.466  -79.192  -31.570 1.00 39.66  ? 175 ALA X N   1 
ATOM   7430  C  CA  . ALA E 2 175 ? 43.894  -79.426  -31.762 1.00 39.56  ? 175 ALA X CA  1 
ATOM   7431  C  C   . ALA E 2 175 ? 44.200  -80.915  -31.649 1.00 40.27  ? 175 ALA X C   1 
ATOM   7432  O  O   . ALA E 2 175 ? 43.685  -81.590  -30.758 1.00 40.86  ? 175 ALA X O   1 
ATOM   7433  C  CB  . ALA E 2 175 ? 44.695  -78.651  -30.733 1.00 38.77  ? 175 ALA X CB  1 
ATOM   7434  N  N   . VAL E 2 176 ? 45.017  -81.426  -32.567 1.00 41.02  ? 176 VAL X N   1 
ATOM   7435  C  CA  . VAL E 2 176 ? 45.566  -82.775  -32.446 1.00 41.95  ? 176 VAL X CA  1 
ATOM   7436  C  C   . VAL E 2 176 ? 47.037  -82.704  -32.022 1.00 41.36  ? 176 VAL X C   1 
ATOM   7437  O  O   . VAL E 2 176 ? 47.788  -81.833  -32.471 1.00 40.53  ? 176 VAL X O   1 
ATOM   7438  C  CB  . VAL E 2 176 ? 45.449  -83.596  -33.762 1.00 43.20  ? 176 VAL X CB  1 
ATOM   7439  C  CG1 . VAL E 2 176 ? 46.066  -82.847  -34.946 1.00 43.95  ? 176 VAL X CG1 1 
ATOM   7440  C  CG2 . VAL E 2 176 ? 46.119  -84.971  -33.590 1.00 42.55  ? 176 VAL X CG2 1 
ATOM   7441  N  N   . LEU E 2 177 ? 47.433  -83.625  -31.149 1.00 40.99  ? 177 LEU X N   1 
ATOM   7442  C  CA  . LEU E 2 177 ? 48.822  -83.741  -30.721 1.00 40.87  ? 177 LEU X CA  1 
ATOM   7443  C  C   . LEU E 2 177 ? 49.579  -84.602  -31.729 1.00 40.79  ? 177 LEU X C   1 
ATOM   7444  O  O   . LEU E 2 177 ? 49.151  -85.703  -32.067 1.00 40.20  ? 177 LEU X O   1 
ATOM   7445  C  CB  . LEU E 2 177 ? 48.892  -84.353  -29.317 1.00 40.19  ? 177 LEU X CB  1 
ATOM   7446  C  CG  . LEU E 2 177 ? 50.260  -84.476  -28.647 1.00 39.71  ? 177 LEU X CG  1 
ATOM   7447  C  CD1 . LEU E 2 177 ? 51.008  -83.155  -28.660 1.00 39.46  ? 177 LEU X CD1 1 
ATOM   7448  C  CD2 . LEU E 2 177 ? 50.087  -84.983  -27.216 1.00 39.58  ? 177 LEU X CD2 1 
ATOM   7449  N  N   . GLN E 2 178 ? 50.697  -84.085  -32.224 1.00 42.08  ? 178 GLN X N   1 
ATOM   7450  C  CA  . GLN E 2 178 ? 51.509  -84.802  -33.209 1.00 42.15  ? 178 GLN X CA  1 
ATOM   7451  C  C   . GLN E 2 178 ? 52.639  -85.560  -32.526 1.00 41.61  ? 178 GLN X C   1 
ATOM   7452  O  O   . GLN E 2 178 ? 52.978  -85.278  -31.369 1.00 41.55  ? 178 GLN X O   1 
ATOM   7453  C  CB  . GLN E 2 178 ? 52.071  -83.817  -34.231 1.00 42.77  ? 178 GLN X CB  1 
ATOM   7454  C  CG  . GLN E 2 178 ? 50.993  -83.018  -34.965 1.00 43.56  ? 178 GLN X CG  1 
ATOM   7455  C  CD  . GLN E 2 178 ? 51.527  -81.736  -35.574 1.00 44.44  ? 178 GLN X CD  1 
ATOM   7456  O  OE1 . GLN E 2 178 ? 51.507  -81.563  -36.794 1.00 45.79  ? 178 GLN X OE1 1 
ATOM   7457  N  NE2 . GLN E 2 178 ? 52.014  -80.829  -34.727 1.00 44.09  ? 178 GLN X NE2 1 
ATOM   7458  N  N   . SER E 2 179 ? 53.222  -86.518  -33.253 1.00 40.86  ? 179 SER X N   1 
ATOM   7459  C  CA  . SER E 2 179 ? 54.362  -87.318  -32.772 1.00 39.30  ? 179 SER X CA  1 
ATOM   7460  C  C   . SER E 2 179 ? 55.447  -86.457  -32.128 1.00 38.30  ? 179 SER X C   1 
ATOM   7461  O  O   . SER E 2 179 ? 56.126  -86.892  -31.202 1.00 37.47  ? 179 SER X O   1 
ATOM   7462  C  CB  . SER E 2 179 ? 54.996  -88.099  -33.931 1.00 39.62  ? 179 SER X CB  1 
ATOM   7463  O  OG  . SER E 2 179 ? 54.028  -88.530  -34.870 1.00 39.47  ? 179 SER X OG  1 
ATOM   7464  N  N   . SER E 2 180 ? 55.607  -85.242  -32.645 1.00 37.91  ? 180 SER X N   1 
ATOM   7465  C  CA  . SER E 2 180 ? 56.600  -84.289  -32.151 1.00 37.29  ? 180 SER X CA  1 
ATOM   7466  C  C   . SER E 2 180 ? 56.294  -83.729  -30.754 1.00 37.26  ? 180 SER X C   1 
ATOM   7467  O  O   . SER E 2 180 ? 57.173  -83.164  -30.107 1.00 35.75  ? 180 SER X O   1 
ATOM   7468  C  CB  . SER E 2 180 ? 56.725  -83.132  -33.150 1.00 36.60  ? 180 SER X CB  1 
ATOM   7469  O  OG  . SER E 2 180 ? 55.450  -82.664  -33.546 1.00 35.57  ? 180 SER X OG  1 
ATOM   7470  N  N   . GLY E 2 181 ? 55.050  -83.878  -30.302 1.00 37.87  ? 181 GLY X N   1 
ATOM   7471  C  CA  . GLY E 2 181 ? 54.616  -83.324  -29.023 1.00 37.58  ? 181 GLY X CA  1 
ATOM   7472  C  C   . GLY E 2 181 ? 54.137  -81.890  -29.163 1.00 37.11  ? 181 GLY X C   1 
ATOM   7473  O  O   . GLY E 2 181 ? 53.942  -81.194  -28.165 1.00 36.82  ? 181 GLY X O   1 
ATOM   7474  N  N   . LEU E 2 182 ? 53.958  -81.446  -30.406 1.00 36.37  ? 182 LEU X N   1 
ATOM   7475  C  CA  . LEU E 2 182 ? 53.406  -80.131  -30.690 1.00 35.74  ? 182 LEU X CA  1 
ATOM   7476  C  C   . LEU E 2 182 ? 51.990  -80.299  -31.235 1.00 35.65  ? 182 LEU X C   1 
ATOM   7477  O  O   . LEU E 2 182 ? 51.684  -81.286  -31.911 1.00 34.98  ? 182 LEU X O   1 
ATOM   7478  C  CB  . LEU E 2 182 ? 54.280  -79.389  -31.700 1.00 35.52  ? 182 LEU X CB  1 
ATOM   7479  C  CG  . LEU E 2 182 ? 55.751  -79.212  -31.309 1.00 35.51  ? 182 LEU X CG  1 
ATOM   7480  C  CD1 . LEU E 2 182 ? 56.571  -78.739  -32.500 1.00 34.25  ? 182 LEU X CD1 1 
ATOM   7481  C  CD2 . LEU E 2 182 ? 55.884  -78.243  -30.133 1.00 34.97  ? 182 LEU X CD2 1 
ATOM   7482  N  N   . TYR E 2 183 ? 51.134  -79.331  -30.926 1.00 35.23  ? 183 TYR X N   1 
ATOM   7483  C  CA  . TYR E 2 183 ? 49.760  -79.336  -31.398 1.00 35.84  ? 183 TYR X CA  1 
ATOM   7484  C  C   . TYR E 2 183 ? 49.647  -78.679  -32.759 1.00 35.45  ? 183 TYR X C   1 
ATOM   7485  O  O   . TYR E 2 183 ? 50.445  -77.811  -33.106 1.00 34.46  ? 183 TYR X O   1 
ATOM   7486  C  CB  . TYR E 2 183 ? 48.849  -78.593  -30.412 1.00 36.27  ? 183 TYR X CB  1 
ATOM   7487  C  CG  . TYR E 2 183 ? 48.670  -79.308  -29.102 1.00 36.93  ? 183 TYR X CG  1 
ATOM   7488  C  CD1 . TYR E 2 183 ? 47.753  -80.343  -28.979 1.00 38.17  ? 183 TYR X CD1 1 
ATOM   7489  C  CD2 . TYR E 2 183 ? 49.418  -78.957  -27.986 1.00 37.88  ? 183 TYR X CD2 1 
ATOM   7490  C  CE1 . TYR E 2 183 ? 47.588  -81.015  -27.781 1.00 39.10  ? 183 TYR X CE1 1 
ATOM   7491  C  CE2 . TYR E 2 183 ? 49.259  -79.620  -26.778 1.00 38.51  ? 183 TYR X CE2 1 
ATOM   7492  C  CZ  . TYR E 2 183 ? 48.343  -80.650  -26.682 1.00 38.89  ? 183 TYR X CZ  1 
ATOM   7493  O  OH  . TYR E 2 183 ? 48.165  -81.309  -25.486 1.00 39.12  ? 183 TYR X OH  1 
ATOM   7494  N  N   . SER E 2 184 ? 48.641  -79.099  -33.519 1.00 36.65  ? 184 SER X N   1 
ATOM   7495  C  CA  . SER E 2 184 ? 48.210  -78.374  -34.714 1.00 37.17  ? 184 SER X CA  1 
ATOM   7496  C  C   . SER E 2 184 ? 46.701  -78.451  -34.886 1.00 36.64  ? 184 SER X C   1 
ATOM   7497  O  O   . SER E 2 184 ? 46.053  -79.382  -34.393 1.00 35.94  ? 184 SER X O   1 
ATOM   7498  C  CB  . SER E 2 184 ? 48.880  -78.939  -35.961 1.00 38.39  ? 184 SER X CB  1 
ATOM   7499  O  OG  . SER E 2 184 ? 48.436  -80.260  -36.200 1.00 39.26  ? 184 SER X OG  1 
ATOM   7500  N  N   . LEU E 2 185 ? 46.154  -77.459  -35.587 1.00 36.58  ? 185 LEU X N   1 
ATOM   7501  C  CA  . LEU E 2 185 ? 44.749  -77.454  -35.970 1.00 35.56  ? 185 LEU X CA  1 
ATOM   7502  C  C   . LEU E 2 185 ? 44.508  -76.615  -37.217 1.00 36.28  ? 185 LEU X C   1 
ATOM   7503  O  O   . LEU E 2 185 ? 45.354  -75.816  -37.626 1.00 33.95  ? 185 LEU X O   1 
ATOM   7504  C  CB  . LEU E 2 185 ? 43.852  -76.968  -34.827 1.00 35.70  ? 185 LEU X CB  1 
ATOM   7505  C  CG  . LEU E 2 185 ? 43.938  -75.550  -34.249 1.00 35.90  ? 185 LEU X CG  1 
ATOM   7506  C  CD1 . LEU E 2 185 ? 43.298  -74.508  -35.154 1.00 36.50  ? 185 LEU X CD1 1 
ATOM   7507  C  CD2 . LEU E 2 185 ? 43.245  -75.528  -32.898 1.00 34.90  ? 185 LEU X CD2 1 
ATOM   7508  N  N   . SER E 2 186 ? 43.345  -76.840  -37.824 1.00 36.57  ? 186 SER X N   1 
ATOM   7509  C  CA  . SER E 2 186 ? 42.878  -76.053  -38.947 1.00 35.94  ? 186 SER X CA  1 
ATOM   7510  C  C   . SER E 2 186 ? 41.583  -75.345  -38.572 1.00 35.37  ? 186 SER X C   1 
ATOM   7511  O  O   . SER E 2 186 ? 40.784  -75.854  -37.782 1.00 35.35  ? 186 SER X O   1 
ATOM   7512  C  CB  . SER E 2 186 ? 42.665  -76.935  -40.177 1.00 36.16  ? 186 SER X CB  1 
ATOM   7513  O  OG  . SER E 2 186 ? 43.899  -77.227  -40.815 1.00 35.90  ? 186 SER X OG  1 
ATOM   7514  N  N   . SER E 2 187 ? 41.421  -74.145  -39.118 1.00 34.89  ? 187 SER X N   1 
ATOM   7515  C  CA  . SER E 2 187 ? 40.182  -73.393  -39.040 1.00 34.39  ? 187 SER X CA  1 
ATOM   7516  C  C   . SER E 2 187 ? 39.757  -73.078  -40.466 1.00 35.09  ? 187 SER X C   1 
ATOM   7517  O  O   . SER E 2 187 ? 40.566  -72.608  -41.274 1.00 35.93  ? 187 SER X O   1 
ATOM   7518  C  CB  . SER E 2 187 ? 40.380  -72.095  -38.259 1.00 34.05  ? 187 SER X CB  1 
ATOM   7519  O  OG  . SER E 2 187 ? 39.178  -71.339  -38.216 1.00 33.13  ? 187 SER X OG  1 
ATOM   7520  N  N   . VAL E 2 188 ? 38.494  -73.333  -40.779 1.00 34.29  ? 188 VAL X N   1 
ATOM   7521  C  CA  . VAL E 2 188 ? 37.999  -73.107  -42.121 1.00 33.48  ? 188 VAL X CA  1 
ATOM   7522  C  C   . VAL E 2 188 ? 36.762  -72.237  -42.091 1.00 33.98  ? 188 VAL X C   1 
ATOM   7523  O  O   . VAL E 2 188 ? 36.077  -72.147  -41.080 1.00 33.56  ? 188 VAL X O   1 
ATOM   7524  C  CB  . VAL E 2 188 ? 37.686  -74.435  -42.842 1.00 32.58  ? 188 VAL X CB  1 
ATOM   7525  C  CG1 . VAL E 2 188 ? 38.986  -75.239  -43.061 1.00 31.36  ? 188 VAL X CG1 1 
ATOM   7526  C  CG2 . VAL E 2 188 ? 36.639  -75.253  -42.064 1.00 30.01  ? 188 VAL X CG2 1 
ATOM   7527  N  N   . VAL E 2 189 ? 36.485  -71.599  -43.219 1.00 35.53  ? 189 VAL X N   1 
ATOM   7528  C  CA  . VAL E 2 189 ? 35.238  -70.869  -43.407 1.00 35.07  ? 189 VAL X CA  1 
ATOM   7529  C  C   . VAL E 2 189 ? 34.800  -71.026  -44.863 1.00 34.89  ? 189 VAL X C   1 
ATOM   7530  O  O   . VAL E 2 189 ? 35.636  -71.083  -45.773 1.00 33.96  ? 189 VAL X O   1 
ATOM   7531  C  CB  . VAL E 2 189 ? 35.410  -69.381  -43.029 1.00 34.64  ? 189 VAL X CB  1 
ATOM   7532  C  CG1 . VAL E 2 189 ? 36.463  -68.725  -43.911 1.00 34.93  ? 189 VAL X CG1 1 
ATOM   7533  C  CG2 . VAL E 2 189 ? 34.081  -68.635  -43.117 1.00 34.19  ? 189 VAL X CG2 1 
ATOM   7534  N  N   . THR E 2 190 ? 33.495  -71.140  -45.077 1.00 35.09  ? 190 THR X N   1 
ATOM   7535  C  CA  . THR E 2 190 ? 32.949  -71.140  -46.434 1.00 35.70  ? 190 THR X CA  1 
ATOM   7536  C  C   . THR E 2 190 ? 32.345  -69.772  -46.737 1.00 34.43  ? 190 THR X C   1 
ATOM   7537  O  O   . THR E 2 190 ? 31.652  -69.200  -45.910 1.00 34.51  ? 190 THR X O   1 
ATOM   7538  C  CB  . THR E 2 190 ? 31.899  -72.232  -46.642 1.00 35.96  ? 190 THR X CB  1 
ATOM   7539  O  OG1 . THR E 2 190 ? 30.866  -72.095  -45.658 1.00 38.49  ? 190 THR X OG1 1 
ATOM   7540  C  CG2 . THR E 2 190 ? 32.531  -73.611  -46.524 1.00 35.53  ? 190 THR X CG2 1 
ATOM   7541  N  N   . VAL E 2 191 ? 32.653  -69.247  -47.914 1.00 34.23  ? 191 VAL X N   1 
ATOM   7542  C  CA  . VAL E 2 191 ? 32.189  -67.936  -48.345 1.00 35.14  ? 191 VAL X CA  1 
ATOM   7543  C  C   . VAL E 2 191 ? 31.711  -68.033  -49.804 1.00 35.03  ? 191 VAL X C   1 
ATOM   7544  O  O   . VAL E 2 191 ? 32.057  -68.991  -50.500 1.00 32.29  ? 191 VAL X O   1 
ATOM   7545  C  CB  . VAL E 2 191 ? 33.331  -66.891  -48.270 1.00 35.58  ? 191 VAL X CB  1 
ATOM   7546  C  CG1 . VAL E 2 191 ? 33.919  -66.832  -46.860 1.00 35.03  ? 191 VAL X CG1 1 
ATOM   7547  C  CG2 . VAL E 2 191 ? 34.416  -67.201  -49.329 1.00 34.76  ? 191 VAL X CG2 1 
ATOM   7548  N  N   . PRO E 2 192 ? 30.931  -67.035  -50.276 1.00 34.11  ? 192 PRO X N   1 
ATOM   7549  C  CA  . PRO E 2 192 ? 30.557  -67.043  -51.695 1.00 35.17  ? 192 PRO X CA  1 
ATOM   7550  C  C   . PRO E 2 192 ? 31.777  -66.959  -52.610 1.00 36.46  ? 192 PRO X C   1 
ATOM   7551  O  O   . PRO E 2 192 ? 32.670  -66.151  -52.368 1.00 37.89  ? 192 PRO X O   1 
ATOM   7552  C  CB  . PRO E 2 192 ? 29.679  -65.793  -51.832 1.00 34.88  ? 192 PRO X CB  1 
ATOM   7553  C  CG  . PRO E 2 192 ? 29.159  -65.543  -50.440 1.00 33.61  ? 192 PRO X CG  1 
ATOM   7554  C  CD  . PRO E 2 192 ? 30.286  -65.933  -49.544 1.00 32.87  ? 192 PRO X CD  1 
ATOM   7555  N  N   . SER E 2 193 ? 31.821  -67.806  -53.635 1.00 38.45  ? 193 SER X N   1 
ATOM   7556  C  CA  . SER E 2 193 ? 32.922  -67.810  -54.619 1.00 38.81  ? 193 SER X CA  1 
ATOM   7557  C  C   . SER E 2 193 ? 33.121  -66.447  -55.285 1.00 37.90  ? 193 SER X C   1 
ATOM   7558  O  O   . SER E 2 193 ? 34.251  -66.001  -55.501 1.00 38.13  ? 193 SER X O   1 
ATOM   7559  C  CB  . SER E 2 193 ? 32.663  -68.869  -55.693 1.00 39.96  ? 193 SER X CB  1 
ATOM   7560  O  OG  . SER E 2 193 ? 32.568  -70.165  -55.119 1.00 40.27  ? 193 SER X OG  1 
ATOM   7561  N  N   . SER E 2 194 ? 32.011  -65.782  -55.583 1.00 37.52  ? 194 SER X N   1 
ATOM   7562  C  CA  . SER E 2 194 ? 32.021  -64.433  -56.152 1.00 35.95  ? 194 SER X CA  1 
ATOM   7563  C  C   . SER E 2 194 ? 32.800  -63.386  -55.317 1.00 36.99  ? 194 SER X C   1 
ATOM   7564  O  O   . SER E 2 194 ? 33.255  -62.377  -55.860 1.00 36.79  ? 194 SER X O   1 
ATOM   7565  C  CB  . SER E 2 194 ? 30.580  -63.961  -56.339 1.00 33.99  ? 194 SER X CB  1 
ATOM   7566  O  OG  . SER E 2 194 ? 29.872  -63.991  -55.106 1.00 30.78  ? 194 SER X OG  1 
ATOM   7567  N  N   . SER E 2 195 ? 32.948  -63.618  -54.013 1.00 36.36  ? 195 SER X N   1 
ATOM   7568  C  CA  . SER E 2 195 ? 33.628  -62.667  -53.139 1.00 36.79  ? 195 SER X CA  1 
ATOM   7569  C  C   . SER E 2 195 ? 35.159  -62.738  -53.172 1.00 37.94  ? 195 SER X C   1 
ATOM   7570  O  O   . SER E 2 195 ? 35.830  -61.792  -52.756 1.00 36.49  ? 195 SER X O   1 
ATOM   7571  C  CB  . SER E 2 195 ? 33.146  -62.853  -51.701 1.00 36.60  ? 195 SER X CB  1 
ATOM   7572  O  OG  . SER E 2 195 ? 33.440  -64.157  -51.252 1.00 36.98  ? 195 SER X OG  1 
ATOM   7573  N  N   . LEU E 2 196 ? 35.710  -63.837  -53.681 1.00 39.56  ? 196 LEU X N   1 
ATOM   7574  C  CA  . LEU E 2 196 ? 37.141  -64.132  -53.500 1.00 40.42  ? 196 LEU X CA  1 
ATOM   7575  C  C   . LEU E 2 196 ? 38.091  -63.057  -54.054 1.00 40.66  ? 196 LEU X C   1 
ATOM   7576  O  O   . LEU E 2 196 ? 39.217  -62.902  -53.572 1.00 39.76  ? 196 LEU X O   1 
ATOM   7577  C  CB  . LEU E 2 196 ? 37.481  -65.506  -54.090 1.00 40.15  ? 196 LEU X CB  1 
ATOM   7578  C  CG  . LEU E 2 196 ? 36.819  -66.694  -53.379 1.00 39.90  ? 196 LEU X CG  1 
ATOM   7579  C  CD1 . LEU E 2 196 ? 37.069  -67.997  -54.139 1.00 39.54  ? 196 LEU X CD1 1 
ATOM   7580  C  CD2 . LEU E 2 196 ? 37.326  -66.791  -51.948 1.00 40.07  ? 196 LEU X CD2 1 
ATOM   7581  N  N   . GLY E 2 197 ? 37.632  -62.307  -55.047 1.00 41.24  ? 197 GLY X N   1 
ATOM   7582  C  CA  . GLY E 2 197 ? 38.444  -61.247  -55.641 1.00 41.10  ? 197 GLY X CA  1 
ATOM   7583  C  C   . GLY E 2 197 ? 38.213  -59.866  -55.051 1.00 40.14  ? 197 GLY X C   1 
ATOM   7584  O  O   . GLY E 2 197 ? 38.999  -58.956  -55.299 1.00 41.90  ? 197 GLY X O   1 
ATOM   7585  N  N   . THR E 2 198 ? 37.148  -59.695  -54.273 1.00 38.49  ? 198 THR X N   1 
ATOM   7586  C  CA  . THR E 2 198 ? 36.763  -58.362  -53.781 1.00 37.45  ? 198 THR X CA  1 
ATOM   7587  C  C   . THR E 2 198 ? 36.826  -58.160  -52.262 1.00 37.72  ? 198 THR X C   1 
ATOM   7588  O  O   . THR E 2 198 ? 36.808  -57.021  -51.806 1.00 38.72  ? 198 THR X O   1 
ATOM   7589  C  CB  . THR E 2 198 ? 35.350  -57.990  -54.267 1.00 36.44  ? 198 THR X CB  1 
ATOM   7590  O  OG1 . THR E 2 198 ? 34.423  -59.011  -53.868 1.00 34.82  ? 198 THR X OG1 1 
ATOM   7591  C  CG2 . THR E 2 198 ? 35.342  -57.837  -55.796 1.00 34.78  ? 198 THR X CG2 1 
ATOM   7592  N  N   . LYS E 2 199 ? 36.867  -59.241  -51.484 1.00 37.71  ? 199 LYS X N   1 
ATOM   7593  C  CA  . LYS E 2 199 ? 37.098  -59.135  -50.043 1.00 38.46  ? 199 LYS X CA  1 
ATOM   7594  C  C   . LYS E 2 199 ? 38.254  -60.030  -49.618 1.00 37.87  ? 199 LYS X C   1 
ATOM   7595  O  O   . LYS E 2 199 ? 38.308  -61.204  -49.980 1.00 36.85  ? 199 LYS X O   1 
ATOM   7596  C  CB  . LYS E 2 199 ? 35.838  -59.497  -49.248 1.00 39.32  ? 199 LYS X CB  1 
ATOM   7597  C  CG  . LYS E 2 199 ? 36.113  -60.079  -47.832 1.00 39.94  ? 199 LYS X CG  1 
ATOM   7598  C  CD  . LYS E 2 199 ? 36.066  -59.084  -46.652 1.00 40.54  ? 199 LYS X CD  1 
ATOM   7599  C  CE  . LYS E 2 199 ? 36.669  -57.731  -46.929 1.00 39.72  ? 199 LYS X CE  1 
ATOM   7600  N  NZ  . LYS E 2 199 ? 35.626  -56.808  -47.431 1.00 38.95  ? 199 LYS X NZ  1 
ATOM   7601  N  N   . THR E 2 200 ? 39.163  -59.468  -48.830 1.00 37.86  ? 200 THR X N   1 
ATOM   7602  C  CA  . THR E 2 200 ? 40.255  -60.234  -48.253 1.00 38.55  ? 200 THR X CA  1 
ATOM   7603  C  C   . THR E 2 200 ? 39.802  -60.937  -46.968 1.00 38.19  ? 200 THR X C   1 
ATOM   7604  O  O   . THR E 2 200 ? 39.104  -60.358  -46.137 1.00 38.23  ? 200 THR X O   1 
ATOM   7605  C  CB  . THR E 2 200 ? 41.480  -59.340  -47.976 1.00 38.69  ? 200 THR X CB  1 
ATOM   7606  O  OG1 . THR E 2 200 ? 41.939  -58.780  -49.213 1.00 38.94  ? 200 THR X OG1 1 
ATOM   7607  C  CG2 . THR E 2 200 ? 42.616  -60.142  -47.342 1.00 38.62  ? 200 THR X CG2 1 
ATOM   7608  N  N   . TYR E 2 201 ? 40.203  -62.196  -46.833 1.00 38.21  ? 201 TYR X N   1 
ATOM   7609  C  CA  . TYR E 2 201 ? 39.910  -62.996  -45.658 1.00 37.08  ? 201 TYR X CA  1 
ATOM   7610  C  C   . TYR E 2 201 ? 41.200  -63.217  -44.872 1.00 37.94  ? 201 TYR X C   1 
ATOM   7611  O  O   . TYR E 2 201 ? 42.197  -63.734  -45.404 1.00 37.51  ? 201 TYR X O   1 
ATOM   7612  C  CB  . TYR E 2 201 ? 39.257  -64.310  -46.068 1.00 36.04  ? 201 TYR X CB  1 
ATOM   7613  C  CG  . TYR E 2 201 ? 37.944  -64.065  -46.753 1.00 36.20  ? 201 TYR X CG  1 
ATOM   7614  C  CD1 . TYR E 2 201 ? 36.811  -63.710  -46.016 1.00 36.07  ? 201 TYR X CD1 1 
ATOM   7615  C  CD2 . TYR E 2 201 ? 37.833  -64.132  -48.138 1.00 36.04  ? 201 TYR X CD2 1 
ATOM   7616  C  CE1 . TYR E 2 201 ? 35.597  -63.454  -46.636 1.00 35.82  ? 201 TYR X CE1 1 
ATOM   7617  C  CE2 . TYR E 2 201 ? 36.612  -63.885  -48.777 1.00 36.42  ? 201 TYR X CE2 1 
ATOM   7618  C  CZ  . TYR E 2 201 ? 35.498  -63.549  -48.016 1.00 36.03  ? 201 TYR X CZ  1 
ATOM   7619  O  OH  . TYR E 2 201 ? 34.297  -63.286  -48.625 1.00 36.22  ? 201 TYR X OH  1 
ATOM   7620  N  N   . THR E 2 202 ? 41.177  -62.777  -43.618 1.00 36.60  ? 202 THR X N   1 
ATOM   7621  C  CA  . THR E 2 202 ? 42.323  -62.861  -42.747 1.00 37.62  ? 202 THR X CA  1 
ATOM   7622  C  C   . THR E 2 202 ? 41.906  -63.668  -41.520 1.00 38.33  ? 202 THR X C   1 
ATOM   7623  O  O   . THR E 2 202 ? 40.905  -63.341  -40.866 1.00 37.31  ? 202 THR X O   1 
ATOM   7624  C  CB  . THR E 2 202 ? 42.813  -61.441  -42.334 1.00 38.19  ? 202 THR X CB  1 
ATOM   7625  O  OG1 . THR E 2 202 ? 43.027  -60.640  -43.509 1.00 38.74  ? 202 THR X OG1 1 
ATOM   7626  C  CG2 . THR E 2 202 ? 44.108  -61.505  -41.509 1.00 36.83  ? 202 THR X CG2 1 
ATOM   7627  N  N   . CYS E 2 203 ? 42.648  -64.739  -41.241 1.00 38.56  ? 203 CYS X N   1 
ATOM   7628  C  CA  . CYS E 2 203 ? 42.503  -65.459  -39.988 1.00 38.93  ? 203 CYS X CA  1 
ATOM   7629  C  C   . CYS E 2 203 ? 43.471  -64.829  -38.985 1.00 38.39  ? 203 CYS X C   1 
ATOM   7630  O  O   . CYS E 2 203 ? 44.638  -64.572  -39.302 1.00 36.72  ? 203 CYS X O   1 
ATOM   7631  C  CB  . CYS E 2 203 ? 42.773  -66.958  -40.159 1.00 40.46  ? 203 CYS X CB  1 
ATOM   7632  S  SG  . CYS E 2 203 ? 44.520  -67.416  -40.283 1.00 42.97  ? 203 CYS X SG  1 
ATOM   7633  N  N   . ASN E 2 204 ? 42.964  -64.574  -37.786 1.00 37.87  ? 204 ASN X N   1 
ATOM   7634  C  CA  . ASN E 2 204 ? 43.721  -63.947  -36.719 1.00 37.50  ? 204 ASN X CA  1 
ATOM   7635  C  C   . ASN E 2 204 ? 44.014  -65.000  -35.661 1.00 38.05  ? 204 ASN X C   1 
ATOM   7636  O  O   . ASN E 2 204 ? 43.140  -65.361  -34.862 1.00 38.64  ? 204 ASN X O   1 
ATOM   7637  C  CB  . ASN E 2 204 ? 42.915  -62.793  -36.126 1.00 37.29  ? 204 ASN X CB  1 
ATOM   7638  C  CG  . ASN E 2 204 ? 42.196  -61.992  -37.187 1.00 37.24  ? 204 ASN X CG  1 
ATOM   7639  O  OD1 . ASN E 2 204 ? 40.967  -62.016  -37.271 1.00 37.32  ? 204 ASN X OD1 1 
ATOM   7640  N  ND2 . ASN E 2 204 ? 42.960  -61.306  -38.029 1.00 36.67  ? 204 ASN X ND2 1 
ATOM   7641  N  N   . VAL E 2 205 ? 45.240  -65.510  -35.684 1.00 37.46  ? 205 VAL X N   1 
ATOM   7642  C  CA  . VAL E 2 205 ? 45.677  -66.522  -34.739 1.00 37.51  ? 205 VAL X CA  1 
ATOM   7643  C  C   . VAL E 2 205 ? 46.341  -65.844  -33.537 1.00 38.16  ? 205 VAL X C   1 
ATOM   7644  O  O   . VAL E 2 205 ? 47.114  -64.891  -33.694 1.00 38.67  ? 205 VAL X O   1 
ATOM   7645  C  CB  . VAL E 2 205 ? 46.650  -67.516  -35.408 1.00 36.81  ? 205 VAL X CB  1 
ATOM   7646  C  CG1 . VAL E 2 205 ? 47.068  -68.583  -34.436 1.00 36.84  ? 205 VAL X CG1 1 
ATOM   7647  C  CG2 . VAL E 2 205 ? 45.999  -68.149  -36.645 1.00 36.98  ? 205 VAL X CG2 1 
ATOM   7648  N  N   . ASP E 2 206 ? 46.020  -66.325  -32.338 1.00 37.59  ? 206 ASP X N   1 
ATOM   7649  C  CA  . ASP E 2 206 ? 46.635  -65.821  -31.117 1.00 37.10  ? 206 ASP X CA  1 
ATOM   7650  C  C   . ASP E 2 206 ? 46.974  -66.983  -30.198 1.00 36.73  ? 206 ASP X C   1 
ATOM   7651  O  O   . ASP E 2 206 ? 46.100  -67.741  -29.796 1.00 35.24  ? 206 ASP X O   1 
ATOM   7652  C  CB  . ASP E 2 206 ? 45.707  -64.839  -30.407 1.00 37.52  ? 206 ASP X CB  1 
ATOM   7653  C  CG  . ASP E 2 206 ? 46.302  -64.290  -29.117 1.00 38.37  ? 206 ASP X CG  1 
ATOM   7654  O  OD1 . ASP E 2 206 ? 47.542  -64.329  -28.935 1.00 38.83  ? 206 ASP X OD1 1 
ATOM   7655  O  OD2 . ASP E 2 206 ? 45.515  -63.806  -28.276 1.00 39.02  ? 206 ASP X OD2 1 
ATOM   7656  N  N   . HIS E 2 207 ? 48.261  -67.113  -29.893 1.00 37.94  ? 207 HIS X N   1 
ATOM   7657  C  CA  . HIS E 2 207 ? 48.760  -68.101  -28.953 1.00 38.14  ? 207 HIS X CA  1 
ATOM   7658  C  C   . HIS E 2 207 ? 49.264  -67.359  -27.722 1.00 38.27  ? 207 HIS X C   1 
ATOM   7659  O  O   . HIS E 2 207 ? 50.464  -67.100  -27.571 1.00 38.40  ? 207 HIS X O   1 
ATOM   7660  C  CB  . HIS E 2 207 ? 49.863  -68.940  -29.593 1.00 37.92  ? 207 HIS X CB  1 
ATOM   7661  C  CG  . HIS E 2 207 ? 50.296  -70.099  -28.752 1.00 38.59  ? 207 HIS X CG  1 
ATOM   7662  N  ND1 . HIS E 2 207 ? 51.613  -70.334  -28.431 1.00 38.83  ? 207 HIS X ND1 1 
ATOM   7663  C  CD2 . HIS E 2 207 ? 49.582  -71.084  -28.157 1.00 38.96  ? 207 HIS X CD2 1 
ATOM   7664  C  CE1 . HIS E 2 207 ? 51.694  -71.418  -27.681 1.00 39.38  ? 207 HIS X CE1 1 
ATOM   7665  N  NE2 . HIS E 2 207 ? 50.475  -71.892  -27.498 1.00 38.83  ? 207 HIS X NE2 1 
ATOM   7666  N  N   . LYS E 2 208 ? 48.328  -67.018  -26.841 1.00 38.34  ? 208 LYS X N   1 
ATOM   7667  C  CA  . LYS E 2 208 ? 48.635  -66.200  -25.670 1.00 39.41  ? 208 LYS X CA  1 
ATOM   7668  C  C   . LYS E 2 208 ? 49.800  -66.747  -24.840 1.00 38.96  ? 208 LYS X C   1 
ATOM   7669  O  O   . LYS E 2 208 ? 50.626  -65.962  -24.364 1.00 38.65  ? 208 LYS X O   1 
ATOM   7670  C  CB  . LYS E 2 208 ? 47.383  -65.985  -24.803 1.00 40.01  ? 208 LYS X CB  1 
ATOM   7671  C  CG  . LYS E 2 208 ? 46.318  -65.151  -25.509 1.00 40.55  ? 208 LYS X CG  1 
ATOM   7672  C  CD  . LYS E 2 208 ? 45.259  -64.608  -24.566 1.00 41.13  ? 208 LYS X CD  1 
ATOM   7673  C  CE  . LYS E 2 208 ? 44.289  -63.702  -25.319 1.00 41.23  ? 208 LYS X CE  1 
ATOM   7674  N  NZ  . LYS E 2 208 ? 43.320  -63.029  -24.414 1.00 42.03  ? 208 LYS X NZ  1 
ATOM   7675  N  N   . PRO E 2 209 ? 49.884  -68.087  -24.680 1.00 38.33  ? 209 PRO X N   1 
ATOM   7676  C  CA  . PRO E 2 209 ? 51.031  -68.677  -23.981 1.00 38.04  ? 209 PRO X CA  1 
ATOM   7677  C  C   . PRO E 2 209 ? 52.408  -68.209  -24.478 1.00 37.97  ? 209 PRO X C   1 
ATOM   7678  O  O   . PRO E 2 209 ? 53.305  -67.995  -23.662 1.00 36.86  ? 209 PRO X O   1 
ATOM   7679  C  CB  . PRO E 2 209 ? 50.849  -70.176  -24.229 1.00 37.91  ? 209 PRO X CB  1 
ATOM   7680  C  CG  . PRO E 2 209 ? 49.381  -70.350  -24.308 1.00 37.96  ? 209 PRO X CG  1 
ATOM   7681  C  CD  . PRO E 2 209 ? 48.851  -69.105  -24.967 1.00 37.74  ? 209 PRO X CD  1 
ATOM   7682  N  N   . SER E 2 210 ? 52.565  -68.047  -25.792 1.00 38.36  ? 210 SER X N   1 
ATOM   7683  C  CA  . SER E 2 210 ? 53.833  -67.586  -26.372 1.00 38.74  ? 210 SER X CA  1 
ATOM   7684  C  C   . SER E 2 210 ? 53.793  -66.111  -26.782 1.00 39.29  ? 210 SER X C   1 
ATOM   7685  O  O   . SER E 2 210 ? 54.642  -65.662  -27.551 1.00 40.01  ? 210 SER X O   1 
ATOM   7686  C  CB  . SER E 2 210 ? 54.204  -68.451  -27.585 1.00 38.73  ? 210 SER X CB  1 
ATOM   7687  O  OG  . SER E 2 210 ? 53.225  -68.351  -28.612 1.00 39.13  ? 210 SER X OG  1 
ATOM   7688  N  N   . ASN E 2 211 ? 52.817  -65.358  -26.269 1.00 39.84  ? 211 ASN X N   1 
ATOM   7689  C  CA  . ASN E 2 211 ? 52.595  -63.966  -26.686 1.00 40.57  ? 211 ASN X CA  1 
ATOM   7690  C  C   . ASN E 2 211 ? 52.624  -63.780  -28.207 1.00 40.71  ? 211 ASN X C   1 
ATOM   7691  O  O   . ASN E 2 211 ? 52.999  -62.719  -28.702 1.00 41.62  ? 211 ASN X O   1 
ATOM   7692  C  CB  . ASN E 2 211 ? 53.627  -63.035  -26.036 1.00 40.78  ? 211 ASN X CB  1 
ATOM   7693  C  CG  . ASN E 2 211 ? 53.589  -63.081  -24.519 1.00 41.23  ? 211 ASN X CG  1 
ATOM   7694  O  OD1 . ASN E 2 211 ? 52.528  -63.252  -23.918 1.00 41.46  ? 211 ASN X OD1 1 
ATOM   7695  N  ND2 . ASN E 2 211 ? 54.751  -62.918  -23.892 1.00 41.12  ? 211 ASN X ND2 1 
ATOM   7696  N  N   . THR E 2 212 ? 52.220  -64.812  -28.941 1.00 41.03  ? 212 THR X N   1 
ATOM   7697  C  CA  . THR E 2 212 ? 52.341  -64.823  -30.395 1.00 41.31  ? 212 THR X CA  1 
ATOM   7698  C  C   . THR E 2 212 ? 50.978  -64.595  -31.026 1.00 41.41  ? 212 THR X C   1 
ATOM   7699  O  O   . THR E 2 212 ? 50.061  -65.389  -30.829 1.00 41.05  ? 212 THR X O   1 
ATOM   7700  C  CB  . THR E 2 212 ? 52.922  -66.164  -30.896 1.00 41.17  ? 212 THR X CB  1 
ATOM   7701  O  OG1 . THR E 2 212 ? 54.222  -66.353  -30.329 1.00 41.30  ? 212 THR X OG1 1 
ATOM   7702  C  CG2 . THR E 2 212 ? 53.030  -66.193  -32.419 1.00 40.79  ? 212 THR X CG2 1 
ATOM   7703  N  N   . LYS E 2 213 ? 50.853  -63.487  -31.754 1.00 41.69  ? 213 LYS X N   1 
ATOM   7704  C  CA  . LYS E 2 213 ? 49.680  -63.205  -32.567 1.00 42.16  ? 213 LYS X CA  1 
ATOM   7705  C  C   . LYS E 2 213 ? 50.091  -63.189  -34.029 1.00 43.30  ? 213 LYS X C   1 
ATOM   7706  O  O   . LYS E 2 213 ? 51.166  -62.695  -34.371 1.00 43.24  ? 213 LYS X O   1 
ATOM   7707  C  CB  . LYS E 2 213 ? 49.048  -61.869  -32.175 1.00 41.98  ? 213 LYS X CB  1 
ATOM   7708  C  CG  . LYS E 2 213 ? 48.091  -61.984  -31.008 1.00 42.24  ? 213 LYS X CG  1 
ATOM   7709  C  CD  . LYS E 2 213 ? 47.331  -60.696  -30.744 1.00 42.18  ? 213 LYS X CD  1 
ATOM   7710  C  CE  . LYS E 2 213 ? 48.212  -59.645  -30.107 1.00 42.40  ? 213 LYS X CE  1 
ATOM   7711  N  NZ  . LYS E 2 213 ? 47.398  -58.576  -29.477 1.00 42.72  ? 213 LYS X NZ  1 
ATOM   7712  N  N   . VAL E 2 214 ? 49.238  -63.743  -34.887 1.00 44.77  ? 214 VAL X N   1 
ATOM   7713  C  CA  . VAL E 2 214 ? 49.514  -63.809  -36.322 1.00 45.27  ? 214 VAL X CA  1 
ATOM   7714  C  C   . VAL E 2 214 ? 48.250  -63.505  -37.110 1.00 45.00  ? 214 VAL X C   1 
ATOM   7715  O  O   . VAL E 2 214 ? 47.198  -64.065  -36.826 1.00 46.33  ? 214 VAL X O   1 
ATOM   7716  C  CB  . VAL E 2 214 ? 50.023  -65.213  -36.736 1.00 45.85  ? 214 VAL X CB  1 
ATOM   7717  C  CG1 . VAL E 2 214 ? 50.412  -65.230  -38.209 1.00 45.84  ? 214 VAL X CG1 1 
ATOM   7718  C  CG2 . VAL E 2 214 ? 51.200  -65.646  -35.869 1.00 45.81  ? 214 VAL X CG2 1 
ATOM   7719  N  N   . ASP E 2 215 ? 48.359  -62.611  -38.089 1.00 45.09  ? 215 ASP X N   1 
ATOM   7720  C  CA  . ASP E 2 215 ? 47.285  -62.350  -39.048 1.00 45.21  ? 215 ASP X CA  1 
ATOM   7721  C  C   . ASP E 2 215 ? 47.734  -62.793  -40.431 1.00 45.26  ? 215 ASP X C   1 
ATOM   7722  O  O   . ASP E 2 215 ? 48.722  -62.280  -40.964 1.00 46.47  ? 215 ASP X O   1 
ATOM   7723  C  CB  . ASP E 2 215 ? 46.923  -60.861  -39.077 1.00 45.61  ? 215 ASP X CB  1 
ATOM   7724  C  CG  . ASP E 2 215 ? 46.183  -60.412  -37.834 1.00 45.84  ? 215 ASP X CG  1 
ATOM   7725  O  OD1 . ASP E 2 215 ? 45.552  -61.258  -37.168 1.00 46.20  ? 215 ASP X OD1 1 
ATOM   7726  O  OD2 . ASP E 2 215 ? 46.230  -59.205  -37.524 1.00 46.23  ? 215 ASP X OD2 1 
ATOM   7727  N  N   . LYS E 2 216 ? 47.004  -63.738  -41.013 1.00 45.17  ? 216 LYS X N   1 
ATOM   7728  C  CA  . LYS E 2 216 ? 47.387  -64.341  -42.285 1.00 44.85  ? 216 LYS X CA  1 
ATOM   7729  C  C   . LYS E 2 216 ? 46.282  -64.183  -43.327 1.00 44.21  ? 216 LYS X C   1 
ATOM   7730  O  O   . LYS E 2 216 ? 45.196  -64.755  -43.189 1.00 43.30  ? 216 LYS X O   1 
ATOM   7731  C  CB  . LYS E 2 216 ? 47.712  -65.828  -42.068 1.00 45.46  ? 216 LYS X CB  1 
ATOM   7732  C  CG  . LYS E 2 216 ? 48.292  -66.557  -43.271 1.00 46.86  ? 216 LYS X CG  1 
ATOM   7733  C  CD  . LYS E 2 216 ? 49.589  -65.924  -43.758 1.00 46.97  ? 216 LYS X CD  1 
ATOM   7734  C  CE  . LYS E 2 216 ? 50.121  -66.613  -45.001 1.00 47.80  ? 216 LYS X CE  1 
ATOM   7735  N  NZ  . LYS E 2 216 ? 51.106  -65.762  -45.744 1.00 47.68  ? 216 LYS X NZ  1 
ATOM   7736  N  N   . ARG E 2 217 ? 46.567  -63.397  -44.364 1.00 44.07  ? 217 ARG X N   1 
ATOM   7737  C  CA  . ARG E 2 217 ? 45.665  -63.266  -45.507 1.00 45.16  ? 217 ARG X CA  1 
ATOM   7738  C  C   . ARG E 2 217 ? 45.664  -64.565  -46.302 1.00 45.54  ? 217 ARG X C   1 
ATOM   7739  O  O   . ARG E 2 217 ? 46.726  -65.068  -46.679 1.00 47.20  ? 217 ARG X O   1 
ATOM   7740  C  CB  . ARG E 2 217 ? 46.085  -62.118  -46.427 1.00 45.27  ? 217 ARG X CB  1 
ATOM   7741  C  CG  . ARG E 2 217 ? 46.173  -60.770  -45.745 1.00 46.23  ? 217 ARG X CG  1 
ATOM   7742  C  CD  . ARG E 2 217 ? 46.354  -59.654  -46.755 1.00 46.88  ? 217 ARG X CD  1 
ATOM   7743  N  NE  . ARG E 2 217 ? 46.649  -58.378  -46.107 1.00 47.68  ? 217 ARG X NE  1 
ATOM   7744  C  CZ  . ARG E 2 217 ? 46.672  -57.197  -46.722 1.00 48.69  ? 217 ARG X CZ  1 
ATOM   7745  N  NH1 . ARG E 2 217 ? 46.410  -57.098  -48.026 1.00 49.10  ? 217 ARG X NH1 1 
ATOM   7746  N  NH2 . ARG E 2 217 ? 46.956  -56.100  -46.026 1.00 49.31  ? 217 ARG X NH2 1 
ATOM   7747  N  N   . VAL E 2 218 ? 44.474  -65.107  -46.542 1.00 45.66  ? 218 VAL X N   1 
ATOM   7748  C  CA  . VAL E 2 218 ? 44.319  -66.322  -47.326 1.00 45.40  ? 218 VAL X CA  1 
ATOM   7749  C  C   . VAL E 2 218 ? 43.820  -65.914  -48.702 1.00 45.35  ? 218 VAL X C   1 
ATOM   7750  O  O   . VAL E 2 218 ? 42.620  -65.768  -48.926 1.00 45.37  ? 218 VAL X O   1 
ATOM   7751  C  CB  . VAL E 2 218 ? 43.330  -67.322  -46.666 1.00 44.95  ? 218 VAL X CB  1 
ATOM   7752  C  CG1 . VAL E 2 218 ? 43.322  -68.643  -47.443 1.00 44.46  ? 218 VAL X CG1 1 
ATOM   7753  C  CG2 . VAL E 2 218 ? 43.696  -67.559  -45.193 1.00 43.55  ? 218 VAL X CG2 1 
ATOM   7754  N  N   . GLU E 2 219 ? 44.753  -65.712  -49.617 1.00 45.44  ? 219 GLU X N   1 
ATOM   7755  C  CA  . GLU E 2 219 ? 44.412  -65.274  -50.962 1.00 47.24  ? 219 GLU X CA  1 
ATOM   7756  C  C   . GLU E 2 219 ? 44.354  -66.452  -51.932 1.00 47.47  ? 219 GLU X C   1 
ATOM   7757  O  O   . GLU E 2 219 ? 44.979  -67.493  -51.714 1.00 47.86  ? 219 GLU X O   1 
ATOM   7758  C  CB  . GLU E 2 219 ? 45.378  -64.182  -51.446 1.00 47.97  ? 219 GLU X CB  1 
ATOM   7759  C  CG  . GLU E 2 219 ? 46.856  -64.557  -51.469 1.00 49.23  ? 219 GLU X CG  1 
ATOM   7760  C  CD  . GLU E 2 219 ? 47.763  -63.351  -51.266 1.00 50.41  ? 219 GLU X CD  1 
ATOM   7761  O  OE1 . GLU E 2 219 ? 47.626  -62.679  -50.219 1.00 50.88  ? 219 GLU X OE1 1 
ATOM   7762  O  OE2 . GLU E 2 219 ? 48.613  -63.079  -52.147 1.00 51.08  ? 219 GLU X OE2 1 
ATOM   7763  N  N   . SER E 2 220 ? 43.578  -66.282  -52.996 1.00 47.65  ? 220 SER X N   1 
ATOM   7764  C  CA  . SER E 2 220 ? 43.419  -67.320  -54.005 1.00 48.02  ? 220 SER X CA  1 
ATOM   7765  C  C   . SER E 2 220 ? 44.750  -67.604  -54.695 1.00 47.44  ? 220 SER X C   1 
ATOM   7766  O  O   . SER E 2 220 ? 45.172  -68.752  -54.819 1.00 47.14  ? 220 SER X O   1 
ATOM   7767  C  CB  . SER E 2 220 ? 42.375  -66.889  -55.036 1.00 48.31  ? 220 SER X CB  1 
ATOM   7768  O  OG  . SER E 2 220 ? 41.253  -66.309  -54.395 1.00 48.67  ? 220 SER X OG  1 
ATOM   7769  O  OXT . SER E 2 220 ? 45.435  -66.683  -55.135 1.00 47.46  ? 220 SER X OXT 1 
ATOM   7770  N  N   . ILE F 3 3   ? 31.639  -94.329  -2.049  1.00 17.23  ? 2   ILE Y N   1 
ATOM   7771  C  CA  . ILE F 3 3   ? 30.330  -94.474  -2.779  1.00 16.35  ? 2   ILE Y CA  1 
ATOM   7772  C  C   . ILE F 3 3   ? 30.512  -94.358  -4.291  1.00 16.93  ? 2   ILE Y C   1 
ATOM   7773  O  O   . ILE F 3 3   ? 30.909  -93.307  -4.789  1.00 17.52  ? 2   ILE Y O   1 
ATOM   7774  C  CB  . ILE F 3 3   ? 29.267  -93.434  -2.334  1.00 14.75  ? 2   ILE Y CB  1 
ATOM   7775  C  CG1 . ILE F 3 3   ? 29.112  -93.433  -0.811  1.00 15.26  ? 2   ILE Y CG1 1 
ATOM   7776  C  CG2 . ILE F 3 3   ? 27.921  -93.743  -3.008  1.00 13.12  ? 2   ILE Y CG2 1 
ATOM   7777  C  CD1 . ILE F 3 3   ? 27.951  -92.562  -0.275  1.00 14.01  ? 2   ILE Y CD1 1 
ATOM   7778  N  N   . GLN F 3 4   ? 30.207  -95.437  -5.013  1.00 18.46  ? 3   GLN Y N   1 
ATOM   7779  C  CA  . GLN F 3 4   ? 30.314  -95.464  -6.475  1.00 19.57  ? 3   GLN Y CA  1 
ATOM   7780  C  C   . GLN F 3 4   ? 28.969  -95.175  -7.120  1.00 18.45  ? 3   GLN Y C   1 
ATOM   7781  O  O   . GLN F 3 4   ? 27.948  -95.781  -6.760  1.00 17.91  ? 3   GLN Y O   1 
ATOM   7782  C  CB  . GLN F 3 4   ? 30.855  -96.820  -6.977  1.00 21.96  ? 3   GLN Y CB  1 
ATOM   7783  C  CG  . GLN F 3 4   ? 32.353  -97.034  -6.692  1.00 25.09  ? 3   GLN Y CG  1 
ATOM   7784  C  CD  . GLN F 3 4   ? 33.075  -97.884  -7.758  1.00 27.96  ? 3   GLN Y CD  1 
ATOM   7785  O  OE1 . GLN F 3 4   ? 32.715  -97.868  -8.946  1.00 30.91  ? 3   GLN Y OE1 1 
ATOM   7786  N  NE2 . GLN F 3 4   ? 34.106  -98.615  -7.332  1.00 27.27  ? 3   GLN Y NE2 1 
ATOM   7787  N  N   . MET F 3 5   ? 28.990  -94.244  -8.075  1.00 17.46  ? 4   MET Y N   1 
ATOM   7788  C  CA  . MET F 3 5   ? 27.819  -93.843  -8.838  1.00 17.84  ? 4   MET Y CA  1 
ATOM   7789  C  C   . MET F 3 5   ? 27.970  -94.362  -10.265 1.00 18.88  ? 4   MET Y C   1 
ATOM   7790  O  O   . MET F 3 5   ? 28.922  -94.013  -10.962 1.00 16.80  ? 4   MET Y O   1 
ATOM   7791  C  CB  . MET F 3 5   ? 27.683  -92.308  -8.844  1.00 18.32  ? 4   MET Y CB  1 
ATOM   7792  C  CG  . MET F 3 5   ? 27.533  -91.673  -7.443  1.00 17.66  ? 4   MET Y CG  1 
ATOM   7793  S  SD  . MET F 3 5   ? 26.189  -92.407  -6.457  1.00 19.10  ? 4   MET Y SD  1 
ATOM   7794  C  CE  . MET F 3 5   ? 24.777  -92.177  -7.523  1.00 18.03  ? 4   MET Y CE  1 
ATOM   7795  N  N   . THR F 3 6   ? 27.039  -95.218  -10.686 1.00 20.45  ? 5   THR Y N   1 
ATOM   7796  C  CA  . THR F 3 6   ? 27.074  -95.811  -12.026 1.00 20.94  ? 5   THR Y CA  1 
ATOM   7797  C  C   . THR F 3 6   ? 25.997  -95.155  -12.876 1.00 21.12  ? 5   THR Y C   1 
ATOM   7798  O  O   . THR F 3 6   ? 24.810  -95.346  -12.648 1.00 20.44  ? 5   THR Y O   1 
ATOM   7799  C  CB  . THR F 3 6   ? 26.846  -97.336  -11.989 1.00 20.91  ? 5   THR Y CB  1 
ATOM   7800  O  OG1 . THR F 3 6   ? 27.723  -97.931  -11.025 1.00 22.51  ? 5   THR Y OG1 1 
ATOM   7801  C  CG2 . THR F 3 6   ? 27.112  -97.952  -13.355 1.00 19.94  ? 5   THR Y CG2 1 
ATOM   7802  N  N   . GLN F 3 7   ? 26.428  -94.361  -13.841 1.00 21.60  ? 6   GLN Y N   1 
ATOM   7803  C  CA  . GLN F 3 7   ? 25.519  -93.639  -14.708 1.00 22.61  ? 6   GLN Y CA  1 
ATOM   7804  C  C   . GLN F 3 7   ? 25.298  -94.429  -16.001 1.00 23.31  ? 6   GLN Y C   1 
ATOM   7805  O  O   . GLN F 3 7   ? 26.141  -95.220  -16.410 1.00 23.70  ? 6   GLN Y O   1 
ATOM   7806  C  CB  . GLN F 3 7   ? 26.109  -92.265  -14.987 1.00 22.79  ? 6   GLN Y CB  1 
ATOM   7807  C  CG  . GLN F 3 7   ? 25.146  -91.268  -15.505 1.00 22.37  ? 6   GLN Y CG  1 
ATOM   7808  C  CD  . GLN F 3 7   ? 25.653  -89.852  -15.371 1.00 21.62  ? 6   GLN Y CD  1 
ATOM   7809  O  OE1 . GLN F 3 7   ? 26.536  -89.548  -14.551 1.00 19.78  ? 6   GLN Y OE1 1 
ATOM   7810  N  NE2 . GLN F 3 7   ? 25.086  -88.966  -16.174 1.00 20.58  ? 6   GLN Y NE2 1 
ATOM   7811  N  N   . SER F 3 8   ? 24.153  -94.229  -16.637 1.00 24.20  ? 7   SER Y N   1 
ATOM   7812  C  CA  . SER F 3 8   ? 23.795  -95.026  -17.798 1.00 24.17  ? 7   SER Y CA  1 
ATOM   7813  C  C   . SER F 3 8   ? 22.713  -94.341  -18.651 1.00 24.88  ? 7   SER Y C   1 
ATOM   7814  O  O   . SER F 3 8   ? 21.752  -93.790  -18.105 1.00 25.50  ? 7   SER Y O   1 
ATOM   7815  C  CB  . SER F 3 8   ? 23.324  -96.404  -17.326 1.00 24.28  ? 7   SER Y CB  1 
ATOM   7816  O  OG  . SER F 3 8   ? 22.611  -97.080  -18.336 1.00 24.24  ? 7   SER Y OG  1 
ATOM   7817  N  N   . PRO F 3 9   ? 22.884  -94.333  -19.990 1.00 24.04  ? 8   PRO Y N   1 
ATOM   7818  C  CA  . PRO F 3 9   ? 24.051  -94.798  -20.742 1.00 23.17  ? 8   PRO Y CA  1 
ATOM   7819  C  C   . PRO F 3 9   ? 25.179  -93.761  -20.722 1.00 22.39  ? 8   PRO Y C   1 
ATOM   7820  O  O   . PRO F 3 9   ? 25.014  -92.666  -20.169 1.00 22.44  ? 8   PRO Y O   1 
ATOM   7821  C  CB  . PRO F 3 9   ? 23.501  -94.964  -22.159 1.00 23.59  ? 8   PRO Y CB  1 
ATOM   7822  C  CG  . PRO F 3 9   ? 22.463  -93.892  -22.271 1.00 23.67  ? 8   PRO Y CG  1 
ATOM   7823  C  CD  . PRO F 3 9   ? 21.882  -93.714  -20.880 1.00 23.63  ? 8   PRO Y CD  1 
ATOM   7824  N  N   . SER F 3 10  ? 26.315  -94.130  -21.306 1.00 21.08  ? 9   SER Y N   1 
ATOM   7825  C  CA  . SER F 3 10  ? 27.460  -93.232  -21.491 1.00 20.67  ? 9   SER Y CA  1 
ATOM   7826  C  C   . SER F 3 10  ? 27.195  -92.131  -22.505 1.00 18.40  ? 9   SER Y C   1 
ATOM   7827  O  O   . SER F 3 10  ? 27.671  -91.013  -22.360 1.00 17.01  ? 9   SER Y O   1 
ATOM   7828  C  CB  . SER F 3 10  ? 28.664  -94.035  -21.960 1.00 21.70  ? 9   SER Y CB  1 
ATOM   7829  O  OG  . SER F 3 10  ? 29.187  -94.788  -20.886 1.00 25.03  ? 9   SER Y OG  1 
ATOM   7830  N  N   . SER F 3 11  ? 26.462  -92.473  -23.555 1.00 17.92  ? 10  SER Y N   1 
ATOM   7831  C  CA  . SER F 3 11  ? 26.064  -91.512  -24.558 1.00 18.85  ? 10  SER Y CA  1 
ATOM   7832  C  C   . SER F 3 11  ? 24.750  -91.937  -25.192 1.00 20.06  ? 10  SER Y C   1 
ATOM   7833  O  O   . SER F 3 11  ? 24.390  -93.111  -25.167 1.00 18.28  ? 10  SER Y O   1 
ATOM   7834  C  CB  . SER F 3 11  ? 27.129  -91.387  -25.634 1.00 19.20  ? 10  SER Y CB  1 
ATOM   7835  O  OG  . SER F 3 11  ? 27.319  -92.624  -26.292 1.00 19.79  ? 10  SER Y OG  1 
ATOM   7836  N  N   . LEU F 3 12  ? 24.043  -90.958  -25.746 1.00 21.04  ? 11  LEU Y N   1 
ATOM   7837  C  CA  . LEU F 3 12  ? 22.785  -91.194  -26.412 1.00 21.91  ? 11  LEU Y CA  1 
ATOM   7838  C  C   . LEU F 3 12  ? 22.547  -90.124  -27.459 1.00 22.16  ? 11  LEU Y C   1 
ATOM   7839  O  O   . LEU F 3 12  ? 23.022  -88.990  -27.325 1.00 20.15  ? 11  LEU Y O   1 
ATOM   7840  C  CB  . LEU F 3 12  ? 21.622  -91.209  -25.413 1.00 22.10  ? 11  LEU Y CB  1 
ATOM   7841  C  CG  . LEU F 3 12  ? 21.213  -89.891  -24.743 1.00 22.93  ? 11  LEU Y CG  1 
ATOM   7842  C  CD1 . LEU F 3 12  ? 20.296  -89.024  -25.629 1.00 22.07  ? 11  LEU Y CD1 1 
ATOM   7843  C  CD2 . LEU F 3 12  ? 20.525  -90.209  -23.437 1.00 22.40  ? 11  LEU Y CD2 1 
ATOM   7844  N  N   . SER F 3 13  ? 21.795  -90.516  -28.485 1.00 22.18  ? 12  SER Y N   1 
ATOM   7845  C  CA  . SER F 3 13  ? 21.428  -89.658  -29.602 1.00 23.16  ? 12  SER Y CA  1 
ATOM   7846  C  C   . SER F 3 13  ? 19.906  -89.616  -29.697 1.00 21.86  ? 12  SER Y C   1 
ATOM   7847  O  O   . SER F 3 13  ? 19.257  -90.659  -29.748 1.00 21.93  ? 12  SER Y O   1 
ATOM   7848  C  CB  . SER F 3 13  ? 22.022  -90.239  -30.889 1.00 23.83  ? 12  SER Y CB  1 
ATOM   7849  O  OG  . SER F 3 13  ? 21.850  -89.365  -31.982 1.00 25.53  ? 12  SER Y OG  1 
ATOM   7850  N  N   . ALA F 3 14  ? 19.332  -88.417  -29.703 1.00 21.42  ? 13  ALA Y N   1 
ATOM   7851  C  CA  . ALA F 3 14  ? 17.876  -88.265  -29.788 1.00 20.53  ? 13  ALA Y CA  1 
ATOM   7852  C  C   . ALA F 3 14  ? 17.498  -86.998  -30.537 1.00 20.41  ? 13  ALA Y C   1 
ATOM   7853  O  O   . ALA F 3 14  ? 18.206  -85.988  -30.461 1.00 19.71  ? 13  ALA Y O   1 
ATOM   7854  C  CB  . ALA F 3 14  ? 17.249  -88.256  -28.395 1.00 19.16  ? 13  ALA Y CB  1 
ATOM   7855  N  N   . SER F 3 15  ? 16.379  -87.065  -31.259 1.00 19.50  ? 14  SER Y N   1 
ATOM   7856  C  CA  . SER F 3 15  ? 15.898  -85.945  -32.051 1.00 19.19  ? 14  SER Y CA  1 
ATOM   7857  C  C   . SER F 3 15  ? 15.228  -84.882  -31.188 1.00 19.01  ? 14  SER Y C   1 
ATOM   7858  O  O   . SER F 3 15  ? 14.627  -85.180  -30.156 1.00 17.76  ? 14  SER Y O   1 
ATOM   7859  C  CB  . SER F 3 15  ? 14.903  -86.432  -33.107 1.00 18.75  ? 14  SER Y CB  1 
ATOM   7860  O  OG  . SER F 3 15  ? 15.471  -87.440  -33.920 1.00 18.03  ? 14  SER Y OG  1 
ATOM   7861  N  N   . VAL F 3 16  ? 15.330  -83.634  -31.633 1.00 20.45  ? 15  VAL Y N   1 
ATOM   7862  C  CA  . VAL F 3 16  ? 14.604  -82.532  -31.012 1.00 19.78  ? 15  VAL Y CA  1 
ATOM   7863  C  C   . VAL F 3 16  ? 13.153  -82.948  -30.815 1.00 18.63  ? 15  VAL Y C   1 
ATOM   7864  O  O   . VAL F 3 16  ? 12.551  -83.558  -31.697 1.00 16.16  ? 15  VAL Y O   1 
ATOM   7865  C  CB  . VAL F 3 16  ? 14.654  -81.256  -31.878 1.00 20.25  ? 15  VAL Y CB  1 
ATOM   7866  C  CG1 . VAL F 3 16  ? 13.564  -80.244  -31.427 1.00 20.90  ? 15  VAL Y CG1 1 
ATOM   7867  C  CG2 . VAL F 3 16  ? 16.050  -80.636  -31.828 1.00 19.57  ? 15  VAL Y CG2 1 
ATOM   7868  N  N   . GLY F 3 17  ? 12.610  -82.642  -29.643 1.00 19.35  ? 16  GLY Y N   1 
ATOM   7869  C  CA  . GLY F 3 17  ? 11.259  -83.046  -29.299 1.00 18.96  ? 16  GLY Y CA  1 
ATOM   7870  C  C   . GLY F 3 17  ? 11.120  -84.440  -28.705 1.00 18.91  ? 16  GLY Y C   1 
ATOM   7871  O  O   . GLY F 3 17  ? 10.068  -84.749  -28.183 1.00 19.77  ? 16  GLY Y O   1 
ATOM   7872  N  N   . ASP F 3 18  ? 12.152  -85.282  -28.779 1.00 18.99  ? 17  ASP Y N   1 
ATOM   7873  C  CA  . ASP F 3 18  ? 12.081  -86.633  -28.200 1.00 21.09  ? 17  ASP Y CA  1 
ATOM   7874  C  C   . ASP F 3 18  ? 12.233  -86.569  -26.682 1.00 21.81  ? 17  ASP Y C   1 
ATOM   7875  O  O   . ASP F 3 18  ? 12.895  -85.680  -26.135 1.00 20.95  ? 17  ASP Y O   1 
ATOM   7876  C  CB  . ASP F 3 18  ? 13.190  -87.563  -28.731 1.00 22.20  ? 17  ASP Y CB  1 
ATOM   7877  C  CG  . ASP F 3 18  ? 13.001  -87.976  -30.200 1.00 24.72  ? 17  ASP Y CG  1 
ATOM   7878  O  OD1 . ASP F 3 18  ? 11.957  -87.635  -30.822 1.00 25.38  ? 17  ASP Y OD1 1 
ATOM   7879  O  OD2 . ASP F 3 18  ? 13.921  -88.659  -30.732 1.00 24.41  ? 17  ASP Y OD2 1 
ATOM   7880  N  N   . ARG F 3 19  ? 11.642  -87.555  -26.021 1.00 22.52  ? 18  ARG Y N   1 
ATOM   7881  C  CA  . ARG F 3 19  ? 11.775  -87.747  -24.584 1.00 23.58  ? 18  ARG Y CA  1 
ATOM   7882  C  C   . ARG F 3 19  ? 13.048  -88.532  -24.283 1.00 23.03  ? 18  ARG Y C   1 
ATOM   7883  O  O   . ARG F 3 19  ? 13.291  -89.573  -24.895 1.00 22.36  ? 18  ARG Y O   1 
ATOM   7884  C  CB  . ARG F 3 19  ? 10.570  -88.518  -24.072 1.00 25.11  ? 18  ARG Y CB  1 
ATOM   7885  C  CG  . ARG F 3 19  ? 10.668  -88.918  -22.634 1.00 27.17  ? 18  ARG Y CG  1 
ATOM   7886  C  CD  . ARG F 3 19  ? 9.468   -89.720  -22.222 1.00 27.95  ? 18  ARG Y CD  1 
ATOM   7887  N  NE  . ARG F 3 19  ? 9.120   -89.390  -20.852 1.00 30.39  ? 18  ARG Y NE  1 
ATOM   7888  C  CZ  . ARG F 3 19  ? 8.414   -88.322  -20.491 1.00 31.14  ? 18  ARG Y CZ  1 
ATOM   7889  N  NH1 . ARG F 3 19  ? 7.947   -87.460  -21.401 1.00 31.58  ? 18  ARG Y NH1 1 
ATOM   7890  N  NH2 . ARG F 3 19  ? 8.163   -88.127  -19.207 1.00 31.74  ? 18  ARG Y NH2 1 
ATOM   7891  N  N   . VAL F 3 20  ? 13.843  -88.032  -23.335 1.00 22.39  ? 19  VAL Y N   1 
ATOM   7892  C  CA  . VAL F 3 20  ? 15.164  -88.585  -23.031 1.00 21.80  ? 19  VAL Y CA  1 
ATOM   7893  C  C   . VAL F 3 20  ? 15.244  -88.984  -21.551 1.00 20.79  ? 19  VAL Y C   1 
ATOM   7894  O  O   . VAL F 3 20  ? 14.740  -88.274  -20.676 1.00 18.73  ? 19  VAL Y O   1 
ATOM   7895  C  CB  . VAL F 3 20  ? 16.292  -87.573  -23.397 1.00 23.13  ? 19  VAL Y CB  1 
ATOM   7896  C  CG1 . VAL F 3 20  ? 17.649  -88.025  -22.846 1.00 23.13  ? 19  VAL Y CG1 1 
ATOM   7897  C  CG2 . VAL F 3 20  ? 16.367  -87.374  -24.921 1.00 22.27  ? 19  VAL Y CG2 1 
ATOM   7898  N  N   . THR F 3 21  ? 15.864  -90.135  -21.294 1.00 20.74  ? 20  THR Y N   1 
ATOM   7899  C  CA  . THR F 3 21  ? 15.930  -90.726  -19.962 1.00 21.34  ? 20  THR Y CA  1 
ATOM   7900  C  C   . THR F 3 21  ? 17.334  -91.203  -19.667 1.00 20.31  ? 20  THR Y C   1 
ATOM   7901  O  O   . THR F 3 21  ? 17.878  -91.987  -20.424 1.00 22.27  ? 20  THR Y O   1 
ATOM   7902  C  CB  . THR F 3 21  ? 14.941  -91.900  -19.842 1.00 22.65  ? 20  THR Y CB  1 
ATOM   7903  O  OG1 . THR F 3 21  ? 13.705  -91.429  -19.278 1.00 24.26  ? 20  THR Y OG1 1 
ATOM   7904  C  CG2 . THR F 3 21  ? 15.501  -93.014  -18.973 1.00 23.46  ? 20  THR Y CG2 1 
ATOM   7905  N  N   . ILE F 3 22  ? 17.909  -90.713  -18.567 1.00 19.93  ? 21  ILE Y N   1 
ATOM   7906  C  CA  . ILE F 3 22  ? 19.258  -91.070  -18.116 1.00 19.32  ? 21  ILE Y CA  1 
ATOM   7907  C  C   . ILE F 3 22  ? 19.192  -91.623  -16.701 1.00 18.81  ? 21  ILE Y C   1 
ATOM   7908  O  O   . ILE F 3 22  ? 18.532  -91.042  -15.841 1.00 17.37  ? 21  ILE Y O   1 
ATOM   7909  C  CB  . ILE F 3 22  ? 20.174  -89.842  -18.067 1.00 20.53  ? 21  ILE Y CB  1 
ATOM   7910  C  CG1 . ILE F 3 22  ? 20.291  -89.195  -19.457 1.00 21.13  ? 21  ILE Y CG1 1 
ATOM   7911  C  CG2 . ILE F 3 22  ? 21.553  -90.240  -17.522 1.00 21.58  ? 21  ILE Y CG2 1 
ATOM   7912  C  CD1 . ILE F 3 22  ? 21.109  -87.903  -19.472 1.00 20.60  ? 21  ILE Y CD1 1 
ATOM   7913  N  N   . THR F 3 23  ? 19.872  -92.738  -16.449 1.00 18.71  ? 22  THR Y N   1 
ATOM   7914  C  CA  . THR F 3 23  ? 19.802  -93.359  -15.129 1.00 20.27  ? 22  THR Y CA  1 
ATOM   7915  C  C   . THR F 3 23  ? 21.130  -93.321  -14.391 1.00 20.52  ? 22  THR Y C   1 
ATOM   7916  O  O   . THR F 3 23  ? 22.194  -93.155  -14.983 1.00 20.63  ? 22  THR Y O   1 
ATOM   7917  C  CB  . THR F 3 23  ? 19.279  -94.812  -15.186 1.00 21.50  ? 22  THR Y CB  1 
ATOM   7918  O  OG1 . THR F 3 23  ? 20.249  -95.652  -15.826 1.00 24.06  ? 22  THR Y OG1 1 
ATOM   7919  C  CG2 . THR F 3 23  ? 17.950  -94.886  -15.931 1.00 19.42  ? 22  THR Y CG2 1 
ATOM   7920  N  N   . CYS F 3 24  ? 21.032  -93.464  -13.078 1.00 21.40  ? 23  CYS Y N   1 
ATOM   7921  C  CA  . CYS F 3 24  ? 22.162  -93.345  -12.187 1.00 22.15  ? 23  CYS Y CA  1 
ATOM   7922  C  C   . CYS F 3 24  ? 21.929  -94.284  -10.998 1.00 22.87  ? 23  CYS Y C   1 
ATOM   7923  O  O   . CYS F 3 24  ? 20.891  -94.228  -10.342 1.00 23.70  ? 23  CYS Y O   1 
ATOM   7924  C  CB  . CYS F 3 24  ? 22.305  -91.882  -11.758 1.00 23.68  ? 23  CYS Y CB  1 
ATOM   7925  S  SG  . CYS F 3 24  ? 23.504  -91.534  -10.454 1.00 25.22  ? 23  CYS Y SG  1 
ATOM   7926  N  N   . ARG F 3 25  ? 22.883  -95.172  -10.754 1.00 23.01  ? 24  ARG Y N   1 
ATOM   7927  C  CA  . ARG F 3 25  ? 22.762  -96.158  -9.692  1.00 24.26  ? 24  ARG Y CA  1 
ATOM   7928  C  C   . ARG F 3 25  ? 23.885  -95.945  -8.682  1.00 22.25  ? 24  ARG Y C   1 
ATOM   7929  O  O   . ARG F 3 25  ? 25.034  -95.739  -9.065  1.00 21.15  ? 24  ARG Y O   1 
ATOM   7930  C  CB  . ARG F 3 25  ? 22.824  -97.573  -10.275 1.00 26.45  ? 24  ARG Y CB  1 
ATOM   7931  C  CG  . ARG F 3 25  ? 22.520  -98.672  -9.261  1.00 30.12  ? 24  ARG Y CG  1 
ATOM   7932  C  CD  . ARG F 3 25  ? 22.634  -100.069 -9.874  1.00 32.15  ? 24  ARG Y CD  1 
ATOM   7933  N  NE  . ARG F 3 25  ? 21.800  -100.220 -11.072 1.00 35.01  ? 24  ARG Y NE  1 
ATOM   7934  C  CZ  . ARG F 3 25  ? 20.568  -100.737 -11.104 1.00 37.04  ? 24  ARG Y CZ  1 
ATOM   7935  N  NH1 . ARG F 3 25  ? 19.975  -101.177 -9.993  1.00 38.08  ? 24  ARG Y NH1 1 
ATOM   7936  N  NH2 . ARG F 3 25  ? 19.915  -100.814 -12.263 1.00 37.06  ? 24  ARG Y NH2 1 
ATOM   7937  N  N   . ALA F 3 26  ? 23.534  -95.985  -7.398  1.00 21.07  ? 25  ALA Y N   1 
ATOM   7938  C  CA  . ALA F 3 26  ? 24.492  -95.849  -6.295  1.00 19.11  ? 25  ALA Y CA  1 
ATOM   7939  C  C   . ALA F 3 26  ? 24.769  -97.222  -5.680  1.00 16.88  ? 25  ALA Y C   1 
ATOM   7940  O  O   . ALA F 3 26  ? 23.899  -98.088  -5.646  1.00 16.90  ? 25  ALA Y O   1 
ATOM   7941  C  CB  . ALA F 3 26  ? 23.949  -94.881  -5.236  1.00 18.19  ? 25  ALA Y CB  1 
ATOM   7942  N  N   . SER F 3 27  ? 25.988  -97.400  -5.183  1.00 16.66  ? 26  SER Y N   1 
ATOM   7943  C  CA  . SER F 3 27  ? 26.441  -98.676  -4.611  1.00 14.93  ? 26  SER Y CA  1 
ATOM   7944  C  C   . SER F 3 27  ? 25.840  -98.954  -3.226  1.00 15.29  ? 26  SER Y C   1 
ATOM   7945  O  O   . SER F 3 27  ? 26.009  -100.035 -2.671  1.00 14.04  ? 26  SER Y O   1 
ATOM   7946  C  CB  . SER F 3 27  ? 27.960  -98.656  -4.500  1.00 13.18  ? 26  SER Y CB  1 
ATOM   7947  O  OG  . SER F 3 27  ? 28.367  -97.538  -3.726  1.00 11.84  ? 26  SER Y OG  1 
ATOM   7948  N  N   . GLN F 3 28  ? 25.186  -97.950  -2.655  1.00 15.83  ? 27  GLN Y N   1 
ATOM   7949  C  CA  . GLN F 3 28  ? 24.477  -98.093  -1.399  1.00 16.68  ? 27  GLN Y CA  1 
ATOM   7950  C  C   . GLN F 3 28  ? 23.277  -97.153  -1.433  1.00 16.14  ? 27  GLN Y C   1 
ATOM   7951  O  O   . GLN F 3 28  ? 23.173  -96.306  -2.311  1.00 15.63  ? 27  GLN Y O   1 
ATOM   7952  C  CB  . GLN F 3 28  ? 25.395  -97.735  -0.222  1.00 16.09  ? 27  GLN Y CB  1 
ATOM   7953  C  CG  . GLN F 3 28  ? 25.811  -96.259  -0.217  1.00 16.07  ? 27  GLN Y CG  1 
ATOM   7954  C  CD  . GLN F 3 28  ? 26.624  -95.867  0.996   1.00 14.80  ? 27  GLN Y CD  1 
ATOM   7955  O  OE1 . GLN F 3 28  ? 27.769  -96.289  1.142   1.00 12.79  ? 27  GLN Y OE1 1 
ATOM   7956  N  NE2 . GLN F 3 28  ? 26.038  -95.037  1.869   1.00 14.07  ? 27  GLN Y NE2 1 
ATOM   7957  N  N   . SER F 3 29  ? 22.370  -97.293  -0.477  1.00 17.30  ? 28  SER Y N   1 
ATOM   7958  C  CA  . SER F 3 29  ? 21.288  -96.340  -0.387  1.00 19.19  ? 28  SER Y CA  1 
ATOM   7959  C  C   . SER F 3 29  ? 21.852  -94.981  0.026   1.00 18.28  ? 28  SER Y C   1 
ATOM   7960  O  O   . SER F 3 29  ? 22.670  -94.883  0.949   1.00 18.66  ? 28  SER Y O   1 
ATOM   7961  C  CB  . SER F 3 29  ? 20.208  -96.803  0.582   1.00 20.97  ? 28  SER Y CB  1 
ATOM   7962  O  OG  . SER F 3 29  ? 19.240  -95.772  0.687   1.00 25.36  ? 28  SER Y OG  1 
ATOM   7963  N  N   . ILE F 3 30  ? 21.439  -93.943  -0.692  1.00 18.28  ? 29  ILE Y N   1 
ATOM   7964  C  CA  . ILE F 3 30  ? 21.857  -92.560  -0.400  1.00 17.32  ? 29  ILE Y CA  1 
ATOM   7965  C  C   . ILE F 3 30  ? 20.633  -91.661  -0.192  1.00 17.07  ? 29  ILE Y C   1 
ATOM   7966  O  O   . ILE F 3 30  ? 20.705  -90.443  -0.337  1.00 16.77  ? 29  ILE Y O   1 
ATOM   7967  C  CB  . ILE F 3 30  ? 22.775  -91.983  -1.526  1.00 15.12  ? 29  ILE Y CB  1 
ATOM   7968  C  CG1 . ILE F 3 30  ? 22.088  -92.085  -2.894  1.00 14.41  ? 29  ILE Y CG1 1 
ATOM   7969  C  CG2 . ILE F 3 30  ? 24.135  -92.702  -1.521  1.00 12.41  ? 29  ILE Y CG2 1 
ATOM   7970  C  CD1 . ILE F 3 30  ? 22.761  -91.294  -4.006  1.00 14.59  ? 29  ILE Y CD1 1 
ATOM   7971  N  N   . GLY F 3 31  ? 19.514  -92.278  0.174   1.00 18.26  ? 30  GLY Y N   1 
ATOM   7972  C  CA  . GLY F 3 31  ? 18.240  -91.581  0.286   1.00 18.61  ? 30  GLY Y CA  1 
ATOM   7973  C  C   . GLY F 3 31  ? 17.975  -90.715  -0.936  1.00 18.91  ? 30  GLY Y C   1 
ATOM   7974  O  O   . GLY F 3 31  ? 17.785  -91.222  -2.042  1.00 16.72  ? 30  GLY Y O   1 
ATOM   7975  N  N   . SER F 3 32  ? 17.996  -89.403  -0.719  1.00 18.42  ? 31  SER Y N   1 
ATOM   7976  C  CA  . SER F 3 32  ? 17.685  -88.425  -1.743  1.00 18.35  ? 31  SER Y CA  1 
ATOM   7977  C  C   . SER F 3 32  ? 18.841  -87.458  -1.949  1.00 17.22  ? 31  SER Y C   1 
ATOM   7978  O  O   . SER F 3 32  ? 18.686  -86.455  -2.620  1.00 16.19  ? 31  SER Y O   1 
ATOM   7979  C  CB  . SER F 3 32  ? 16.418  -87.664  -1.348  1.00 19.23  ? 31  SER Y CB  1 
ATOM   7980  O  OG  . SER F 3 32  ? 15.272  -88.417  -1.674  1.00 19.17  ? 31  SER Y OG  1 
ATOM   7981  N  N   . TYR F 3 33  ? 20.010  -87.786  -1.400  1.00 18.16  ? 32  TYR Y N   1 
ATOM   7982  C  CA  . TYR F 3 33  ? 21.189  -86.933  -1.516  1.00 17.63  ? 32  TYR Y CA  1 
ATOM   7983  C  C   . TYR F 3 33  ? 21.802  -87.111  -2.915  1.00 16.81  ? 32  TYR Y C   1 
ATOM   7984  O  O   . TYR F 3 33  ? 22.962  -87.507  -3.054  1.00 13.46  ? 32  TYR Y O   1 
ATOM   7985  C  CB  . TYR F 3 33  ? 22.207  -87.286  -0.418  1.00 17.87  ? 32  TYR Y CB  1 
ATOM   7986  C  CG  . TYR F 3 33  ? 21.862  -86.800  0.985   1.00 16.88  ? 32  TYR Y CG  1 
ATOM   7987  C  CD1 . TYR F 3 33  ? 22.444  -85.645  1.501   1.00 16.37  ? 32  TYR Y CD1 1 
ATOM   7988  C  CD2 . TYR F 3 33  ? 20.983  -87.510  1.801   1.00 16.46  ? 32  TYR Y CD2 1 
ATOM   7989  C  CE1 . TYR F 3 33  ? 22.150  -85.189  2.784   1.00 17.41  ? 32  TYR Y CE1 1 
ATOM   7990  C  CE2 . TYR F 3 33  ? 20.681  -87.070  3.095   1.00 17.44  ? 32  TYR Y CE2 1 
ATOM   7991  C  CZ  . TYR F 3 33  ? 21.270  -85.906  3.585   1.00 20.18  ? 32  TYR Y CZ  1 
ATOM   7992  O  OH  . TYR F 3 33  ? 20.981  -85.453  4.866   1.00 20.02  ? 32  TYR Y OH  1 
ATOM   7993  N  N   . LEU F 3 34  ? 21.012  -86.821  -3.950  1.00 16.02  ? 33  LEU Y N   1 
ATOM   7994  C  CA  . LEU F 3 34  ? 21.426  -87.092  -5.330  1.00 17.34  ? 33  LEU Y CA  1 
ATOM   7995  C  C   . LEU F 3 34  ? 21.095  -85.909  -6.222  1.00 17.61  ? 33  LEU Y C   1 
ATOM   7996  O  O   . LEU F 3 34  ? 19.944  -85.465  -6.278  1.00 16.72  ? 33  LEU Y O   1 
ATOM   7997  C  CB  . LEU F 3 34  ? 20.770  -88.380  -5.868  1.00 16.62  ? 33  LEU Y CB  1 
ATOM   7998  C  CG  . LEU F 3 34  ? 21.289  -88.936  -7.220  1.00 17.87  ? 33  LEU Y CG  1 
ATOM   7999  C  CD1 . LEU F 3 34  ? 20.714  -88.169  -8.434  1.00 16.06  ? 33  LEU Y CD1 1 
ATOM   8000  C  CD2 . LEU F 3 34  ? 22.821  -88.974  -7.279  1.00 14.98  ? 33  LEU Y CD2 1 
ATOM   8001  N  N   . ASN F 3 35  ? 22.117  -85.413  -6.920  1.00 16.92  ? 34  ASN Y N   1 
ATOM   8002  C  CA  . ASN F 3 35  ? 22.016  -84.172  -7.669  1.00 16.54  ? 34  ASN Y CA  1 
ATOM   8003  C  C   . ASN F 3 35  ? 22.450  -84.366  -9.119  1.00 15.89  ? 34  ASN Y C   1 
ATOM   8004  O  O   . ASN F 3 35  ? 23.175  -85.301  -9.422  1.00 17.87  ? 34  ASN Y O   1 
ATOM   8005  C  CB  . ASN F 3 35  ? 22.865  -83.119  -6.954  1.00 17.06  ? 34  ASN Y CB  1 
ATOM   8006  C  CG  . ASN F 3 35  ? 22.629  -83.121  -5.463  1.00 15.22  ? 34  ASN Y CG  1 
ATOM   8007  O  OD1 . ASN F 3 35  ? 21.557  -82.750  -5.008  1.00 16.48  ? 34  ASN Y OD1 1 
ATOM   8008  N  ND2 . ASN F 3 35  ? 23.607  -83.601  -4.697  1.00 13.52  ? 34  ASN Y ND2 1 
ATOM   8009  N  N   . TRP F 3 36  ? 21.968  -83.502  -10.006 1.00 15.72  ? 35  TRP Y N   1 
ATOM   8010  C  CA  . TRP F 3 36  ? 22.261  -83.568  -11.447 1.00 16.43  ? 35  TRP Y CA  1 
ATOM   8011  C  C   . TRP F 3 36  ? 22.815  -82.234  -11.941 1.00 16.81  ? 35  TRP Y C   1 
ATOM   8012  O  O   . TRP F 3 36  ? 22.266  -81.161  -11.622 1.00 15.34  ? 35  TRP Y O   1 
ATOM   8013  C  CB  . TRP F 3 36  ? 20.997  -83.903  -12.264 1.00 16.19  ? 35  TRP Y CB  1 
ATOM   8014  C  CG  . TRP F 3 36  ? 20.457  -85.300  -12.043 1.00 15.34  ? 35  TRP Y CG  1 
ATOM   8015  C  CD1 . TRP F 3 36  ? 19.490  -85.666  -11.161 1.00 16.08  ? 35  TRP Y CD1 1 
ATOM   8016  C  CD2 . TRP F 3 36  ? 20.857  -86.500  -12.719 1.00 15.61  ? 35  TRP Y CD2 1 
ATOM   8017  N  NE1 . TRP F 3 36  ? 19.245  -87.018  -11.246 1.00 16.24  ? 35  TRP Y NE1 1 
ATOM   8018  C  CE2 . TRP F 3 36  ? 20.084  -87.559  -12.185 1.00 16.60  ? 35  TRP Y CE2 1 
ATOM   8019  C  CE3 . TRP F 3 36  ? 21.787  -86.785  -13.730 1.00 16.69  ? 35  TRP Y CE3 1 
ATOM   8020  C  CZ2 . TRP F 3 36  ? 20.206  -88.883  -12.633 1.00 15.31  ? 35  TRP Y CZ2 1 
ATOM   8021  C  CZ3 . TRP F 3 36  ? 21.924  -88.106  -14.160 1.00 16.11  ? 35  TRP Y CZ3 1 
ATOM   8022  C  CH2 . TRP F 3 36  ? 21.131  -89.136  -13.611 1.00 16.28  ? 35  TRP Y CH2 1 
ATOM   8023  N  N   . TYR F 3 37  ? 23.902  -82.313  -12.710 1.00 17.03  ? 36  TYR Y N   1 
ATOM   8024  C  CA  . TYR F 3 37  ? 24.527  -81.139  -13.317 1.00 17.85  ? 36  TYR Y CA  1 
ATOM   8025  C  C   . TYR F 3 37  ? 24.567  -81.318  -14.830 1.00 18.72  ? 36  TYR Y C   1 
ATOM   8026  O  O   . TYR F 3 37  ? 24.608  -82.444  -15.345 1.00 17.06  ? 36  TYR Y O   1 
ATOM   8027  C  CB  . TYR F 3 37  ? 25.956  -80.919  -12.790 1.00 18.22  ? 36  TYR Y CB  1 
ATOM   8028  C  CG  . TYR F 3 37  ? 26.026  -80.759  -11.295 1.00 18.42  ? 36  TYR Y CG  1 
ATOM   8029  C  CD1 . TYR F 3 37  ? 25.991  -79.503  -10.699 1.00 18.72  ? 36  TYR Y CD1 1 
ATOM   8030  C  CD2 . TYR F 3 37  ? 26.095  -81.866  -10.476 1.00 20.02  ? 36  TYR Y CD2 1 
ATOM   8031  C  CE1 . TYR F 3 37  ? 26.027  -79.362  -9.322  1.00 19.61  ? 36  TYR Y CE1 1 
ATOM   8032  C  CE2 . TYR F 3 37  ? 26.137  -81.736  -9.103  1.00 21.09  ? 36  TYR Y CE2 1 
ATOM   8033  C  CZ  . TYR F 3 37  ? 26.103  -80.490  -8.526  1.00 19.90  ? 36  TYR Y CZ  1 
ATOM   8034  O  OH  . TYR F 3 37  ? 26.143  -80.401  -7.151  1.00 19.78  ? 36  TYR Y OH  1 
ATOM   8035  N  N   . GLN F 3 38  ? 24.539  -80.187  -15.524 1.00 18.28  ? 37  GLN Y N   1 
ATOM   8036  C  CA  . GLN F 3 38  ? 24.726  -80.134  -16.960 1.00 18.21  ? 37  GLN Y CA  1 
ATOM   8037  C  C   . GLN F 3 38  ? 26.064  -79.450  -17.212 1.00 15.85  ? 37  GLN Y C   1 
ATOM   8038  O  O   . GLN F 3 38  ? 26.374  -78.456  -16.554 1.00 15.13  ? 37  GLN Y O   1 
ATOM   8039  C  CB  . GLN F 3 38  ? 23.581  -79.329  -17.582 1.00 19.39  ? 37  GLN Y CB  1 
ATOM   8040  C  CG  . GLN F 3 38  ? 23.673  -79.121  -19.086 1.00 20.23  ? 37  GLN Y CG  1 
ATOM   8041  C  CD  . GLN F 3 38  ? 22.628  -78.146  -19.577 1.00 20.41  ? 37  GLN Y CD  1 
ATOM   8042  O  OE1 . GLN F 3 38  ? 22.672  -76.964  -19.233 1.00 20.03  ? 37  GLN Y OE1 1 
ATOM   8043  N  NE2 . GLN F 3 38  ? 21.680  -78.632  -20.386 1.00 19.56  ? 37  GLN Y NE2 1 
ATOM   8044  N  N   . GLN F 3 39  ? 26.869  -80.004  -18.118 1.00 14.34  ? 38  GLN Y N   1 
ATOM   8045  C  CA  . GLN F 3 39  ? 28.112  -79.356  -18.522 1.00 15.91  ? 38  GLN Y CA  1 
ATOM   8046  C  C   . GLN F 3 39  ? 28.250  -79.294  -20.035 1.00 16.09  ? 38  GLN Y C   1 
ATOM   8047  O  O   . GLN F 3 39  ? 28.413  -80.318  -20.694 1.00 16.99  ? 38  GLN Y O   1 
ATOM   8048  C  CB  . GLN F 3 39  ? 29.338  -80.049  -17.912 1.00 16.78  ? 38  GLN Y CB  1 
ATOM   8049  C  CG  . GLN F 3 39  ? 30.663  -79.327  -18.216 1.00 15.71  ? 38  GLN Y CG  1 
ATOM   8050  C  CD  . GLN F 3 39  ? 31.856  -79.928  -17.488 1.00 15.87  ? 38  GLN Y CD  1 
ATOM   8051  O  OE1 . GLN F 3 39  ? 31.942  -81.144  -17.304 1.00 16.78  ? 38  GLN Y OE1 1 
ATOM   8052  N  NE2 . GLN F 3 39  ? 32.788  -79.074  -17.078 1.00 13.33  ? 38  GLN Y NE2 1 
ATOM   8053  N  N   . LYS F 3 40  ? 28.195  -78.082  -20.571 1.00 16.95  ? 39  LYS Y N   1 
ATOM   8054  C  CA  . LYS F 3 40  ? 28.453  -77.846  -21.985 1.00 18.41  ? 39  LYS Y CA  1 
ATOM   8055  C  C   . LYS F 3 40  ? 29.967  -77.686  -22.206 1.00 19.55  ? 39  LYS Y C   1 
ATOM   8056  O  O   . LYS F 3 40  ? 30.710  -77.456  -21.255 1.00 18.38  ? 39  LYS Y O   1 
ATOM   8057  C  CB  . LYS F 3 40  ? 27.662  -76.621  -22.461 1.00 18.86  ? 39  LYS Y CB  1 
ATOM   8058  C  CG  . LYS F 3 40  ? 26.158  -76.769  -22.204 1.00 20.23  ? 39  LYS Y CG  1 
ATOM   8059  C  CD  . LYS F 3 40  ? 25.288  -75.650  -22.768 1.00 21.69  ? 39  LYS Y CD  1 
ATOM   8060  C  CE  . LYS F 3 40  ? 23.855  -75.792  -22.231 1.00 23.45  ? 39  LYS Y CE  1 
ATOM   8061  N  NZ  . LYS F 3 40  ? 22.811  -74.961  -22.936 1.00 24.65  ? 39  LYS Y NZ  1 
ATOM   8062  N  N   . THR F 3 41  ? 30.415  -77.832  -23.455 1.00 20.95  ? 40  THR Y N   1 
ATOM   8063  C  CA  . THR F 3 41  ? 31.845  -77.787  -23.801 1.00 21.14  ? 40  THR Y CA  1 
ATOM   8064  C  C   . THR F 3 41  ? 32.483  -76.465  -23.403 1.00 20.96  ? 40  THR Y C   1 
ATOM   8065  O  O   . THR F 3 41  ? 31.918  -75.408  -23.655 1.00 21.17  ? 40  THR Y O   1 
ATOM   8066  C  CB  . THR F 3 41  ? 32.057  -77.966  -25.319 1.00 22.88  ? 40  THR Y CB  1 
ATOM   8067  O  OG1 . THR F 3 41  ? 31.462  -79.199  -25.741 1.00 24.35  ? 40  THR Y OG1 1 
ATOM   8068  C  CG2 . THR F 3 41  ? 33.554  -77.958  -25.681 1.00 21.61  ? 40  THR Y CG2 1 
ATOM   8069  N  N   . GLY F 3 42  ? 33.663  -76.536  -22.792 1.00 21.47  ? 41  GLY Y N   1 
ATOM   8070  C  CA  . GLY F 3 42  ? 34.395  -75.349  -22.342 1.00 20.88  ? 41  GLY Y CA  1 
ATOM   8071  C  C   . GLY F 3 42  ? 33.641  -74.512  -21.325 1.00 21.64  ? 41  GLY Y C   1 
ATOM   8072  O  O   . GLY F 3 42  ? 33.833  -73.302  -21.251 1.00 21.50  ? 41  GLY Y O   1 
ATOM   8073  N  N   . LYS F 3 43  ? 32.773  -75.151  -20.542 1.00 21.70  ? 42  LYS Y N   1 
ATOM   8074  C  CA  . LYS F 3 43  ? 31.964  -74.445  -19.559 1.00 21.08  ? 42  LYS Y CA  1 
ATOM   8075  C  C   . LYS F 3 43  ? 31.985  -75.189  -18.240 1.00 21.01  ? 42  LYS Y C   1 
ATOM   8076  O  O   . LYS F 3 43  ? 32.293  -76.391  -18.176 1.00 19.85  ? 42  LYS Y O   1 
ATOM   8077  C  CB  . LYS F 3 43  ? 30.517  -74.294  -20.039 1.00 22.00  ? 42  LYS Y CB  1 
ATOM   8078  C  CG  . LYS F 3 43  ? 30.326  -73.441  -21.280 1.00 23.76  ? 42  LYS Y CG  1 
ATOM   8079  C  CD  . LYS F 3 43  ? 30.700  -71.977  -21.037 1.00 25.59  ? 42  LYS Y CD  1 
ATOM   8080  C  CE  . LYS F 3 43  ? 30.486  -71.119  -22.288 1.00 26.93  ? 42  LYS Y CE  1 
ATOM   8081  N  NZ  . LYS F 3 43  ? 31.338  -69.885  -22.276 1.00 27.84  ? 42  LYS Y NZ  1 
ATOM   8082  N  N   . ALA F 3 44  ? 31.640  -74.467  -17.184 1.00 20.49  ? 43  ALA Y N   1 
ATOM   8083  C  CA  . ALA F 3 44  ? 31.524  -75.075  -15.879 1.00 21.21  ? 43  ALA Y CA  1 
ATOM   8084  C  C   . ALA F 3 44  ? 30.237  -75.884  -15.794 1.00 21.19  ? 43  ALA Y C   1 
ATOM   8085  O  O   . ALA F 3 44  ? 29.301  -75.694  -16.586 1.00 20.47  ? 43  ALA Y O   1 
ATOM   8086  C  CB  . ALA F 3 44  ? 31.561  -74.021  -14.788 1.00 22.19  ? 43  ALA Y CB  1 
ATOM   8087  N  N   . PRO F 3 45  ? 30.188  -76.812  -14.837 1.00 20.93  ? 44  PRO Y N   1 
ATOM   8088  C  CA  . PRO F 3 45  ? 28.926  -77.482  -14.568 1.00 20.66  ? 44  PRO Y CA  1 
ATOM   8089  C  C   . PRO F 3 45  ? 27.867  -76.510  -14.049 1.00 21.72  ? 44  PRO Y C   1 
ATOM   8090  O  O   . PRO F 3 45  ? 28.188  -75.450  -13.529 1.00 21.90  ? 44  PRO Y O   1 
ATOM   8091  C  CB  . PRO F 3 45  ? 29.292  -78.502  -13.486 1.00 20.09  ? 44  PRO Y CB  1 
ATOM   8092  C  CG  . PRO F 3 45  ? 30.771  -78.688  -13.614 1.00 20.15  ? 44  PRO Y CG  1 
ATOM   8093  C  CD  . PRO F 3 45  ? 31.304  -77.375  -14.059 1.00 20.12  ? 44  PRO Y CD  1 
ATOM   8094  N  N   . LYS F 3 46  ? 26.607  -76.886  -14.199 1.00 24.10  ? 45  LYS Y N   1 
ATOM   8095  C  CA  . LYS F 3 46  ? 25.489  -76.075  -13.739 1.00 24.45  ? 45  LYS Y CA  1 
ATOM   8096  C  C   . LYS F 3 46  ? 24.466  -77.014  -13.122 1.00 21.51  ? 45  LYS Y C   1 
ATOM   8097  O  O   . LYS F 3 46  ? 24.114  -78.032  -13.728 1.00 19.11  ? 45  LYS Y O   1 
ATOM   8098  C  CB  . LYS F 3 46  ? 24.874  -75.318  -14.919 1.00 26.88  ? 45  LYS Y CB  1 
ATOM   8099  C  CG  . LYS F 3 46  ? 23.896  -74.229  -14.526 1.00 30.08  ? 45  LYS Y CG  1 
ATOM   8100  C  CD  . LYS F 3 46  ? 23.040  -73.780  -15.723 1.00 32.71  ? 45  LYS Y CD  1 
ATOM   8101  C  CE  . LYS F 3 46  ? 21.853  -74.713  -15.946 1.00 34.06  ? 45  LYS Y CE  1 
ATOM   8102  N  NZ  . LYS F 3 46  ? 20.980  -74.207  -17.050 1.00 35.07  ? 45  LYS Y NZ  1 
ATOM   8103  N  N   . ALA F 3 47  ? 23.995  -76.675  -11.925 1.00 20.56  ? 46  ALA Y N   1 
ATOM   8104  C  CA  . ALA F 3 47  ? 23.020  -77.515  -11.215 1.00 19.99  ? 46  ALA Y CA  1 
ATOM   8105  C  C   . ALA F 3 47  ? 21.671  -77.475  -11.933 1.00 18.90  ? 46  ALA Y C   1 
ATOM   8106  O  O   . ALA F 3 47  ? 21.178  -76.405  -12.285 1.00 18.93  ? 46  ALA Y O   1 
ATOM   8107  C  CB  . ALA F 3 47  ? 22.873  -77.063  -9.764  1.00 19.06  ? 46  ALA Y CB  1 
ATOM   8108  N  N   . LEU F 3 48  ? 21.117  -78.650  -12.204 1.00 18.17  ? 47  LEU Y N   1 
ATOM   8109  C  CA  . LEU F 3 48  ? 19.778  -78.771  -12.758 1.00 17.98  ? 47  LEU Y CA  1 
ATOM   8110  C  C   . LEU F 3 48  ? 18.810  -79.149  -11.658 1.00 17.53  ? 47  LEU Y C   1 
ATOM   8111  O  O   . LEU F 3 48  ? 17.748  -78.551  -11.512 1.00 17.22  ? 47  LEU Y O   1 
ATOM   8112  C  CB  . LEU F 3 48  ? 19.733  -79.864  -13.820 1.00 18.47  ? 47  LEU Y CB  1 
ATOM   8113  C  CG  . LEU F 3 48  ? 20.557  -79.684  -15.092 1.00 19.41  ? 47  LEU Y CG  1 
ATOM   8114  C  CD1 . LEU F 3 48  ? 20.543  -80.988  -15.870 1.00 19.04  ? 47  LEU Y CD1 1 
ATOM   8115  C  CD2 . LEU F 3 48  ? 20.027  -78.535  -15.945 1.00 18.22  ? 47  LEU Y CD2 1 
ATOM   8116  N  N   . ILE F 3 49  ? 19.191  -80.170  -10.897 1.00 19.26  ? 48  ILE Y N   1 
ATOM   8117  C  CA  . ILE F 3 49  ? 18.325  -80.775  -9.891  1.00 19.69  ? 48  ILE Y CA  1 
ATOM   8118  C  C   . ILE F 3 49  ? 19.121  -81.011  -8.615  1.00 18.72  ? 48  ILE Y C   1 
ATOM   8119  O  O   . ILE F 3 49  ? 20.255  -81.486  -8.677  1.00 17.78  ? 48  ILE Y O   1 
ATOM   8120  C  CB  . ILE F 3 49  ? 17.724  -82.097  -10.435 1.00 20.57  ? 48  ILE Y CB  1 
ATOM   8121  C  CG1 . ILE F 3 49  ? 16.680  -81.765  -11.515 1.00 22.94  ? 48  ILE Y CG1 1 
ATOM   8122  C  CG2 . ILE F 3 49  ? 17.089  -82.942  -9.316  1.00 18.51  ? 48  ILE Y CG2 1 
ATOM   8123  C  CD1 . ILE F 3 49  ? 16.320  -82.915  -12.382 1.00 24.83  ? 48  ILE Y CD1 1 
ATOM   8124  N  N   . TYR F 3 50  ? 18.546  -80.614  -7.477  1.00 17.17  ? 49  TYR Y N   1 
ATOM   8125  C  CA  . TYR F 3 50  ? 19.055  -81.010  -6.165  1.00 16.86  ? 49  TYR Y CA  1 
ATOM   8126  C  C   . TYR F 3 50  ? 18.066  -81.968  -5.506  1.00 14.85  ? 49  TYR Y C   1 
ATOM   8127  O  O   . TYR F 3 50  ? 16.867  -81.928  -5.785  1.00 16.49  ? 49  TYR Y O   1 
ATOM   8128  C  CB  . TYR F 3 50  ? 19.281  -79.804  -5.229  1.00 17.03  ? 49  TYR Y CB  1 
ATOM   8129  C  CG  . TYR F 3 50  ? 20.387  -78.829  -5.639  1.00 16.95  ? 49  TYR Y CG  1 
ATOM   8130  C  CD1 . TYR F 3 50  ? 21.708  -79.248  -5.799  1.00 16.11  ? 49  TYR Y CD1 1 
ATOM   8131  C  CD2 . TYR F 3 50  ? 20.106  -77.487  -5.842  1.00 16.74  ? 49  TYR Y CD2 1 
ATOM   8132  C  CE1 . TYR F 3 50  ? 22.716  -78.356  -6.162  1.00 14.66  ? 49  TYR Y CE1 1 
ATOM   8133  C  CE2 . TYR F 3 50  ? 21.102  -76.584  -6.214  1.00 17.19  ? 49  TYR Y CE2 1 
ATOM   8134  C  CZ  . TYR F 3 50  ? 22.402  -77.022  -6.374  1.00 17.50  ? 49  TYR Y CZ  1 
ATOM   8135  O  OH  . TYR F 3 50  ? 23.377  -76.109  -6.739  1.00 17.39  ? 49  TYR Y OH  1 
ATOM   8136  N  N   . ALA F 3 51  ? 18.562  -82.820  -4.615  1.00 12.39  ? 50  ALA Y N   1 
ATOM   8137  C  CA  . ALA F 3 51  ? 17.677  -83.593  -3.744  1.00 12.72  ? 50  ALA Y CA  1 
ATOM   8138  C  C   . ALA F 3 51  ? 16.779  -84.550  -4.555  1.00 13.85  ? 50  ALA Y C   1 
ATOM   8139  O  O   . ALA F 3 51  ? 15.613  -84.768  -4.231  1.00 13.01  ? 50  ALA Y O   1 
ATOM   8140  C  CB  . ALA F 3 51  ? 16.834  -82.640  -2.866  1.00 11.59  ? 50  ALA Y CB  1 
ATOM   8141  N  N   . ALA F 3 52  ? 17.336  -85.091  -5.634  1.00 15.94  ? 51  ALA Y N   1 
ATOM   8142  C  CA  . ALA F 3 52  ? 16.676  -86.119  -6.454  1.00 16.49  ? 51  ALA Y CA  1 
ATOM   8143  C  C   . ALA F 3 52  ? 15.622  -85.580  -7.434  1.00 15.55  ? 51  ALA Y C   1 
ATOM   8144  O  O   . ALA F 3 52  ? 15.608  -85.972  -8.602  1.00 14.04  ? 51  ALA Y O   1 
ATOM   8145  C  CB  . ALA F 3 52  ? 16.077  -87.215  -5.570  1.00 14.08  ? 51  ALA Y CB  1 
ATOM   8146  N  N   . SER F 3 53  ? 14.738  -84.709  -6.956  1.00 16.38  ? 52  SER Y N   1 
ATOM   8147  C  CA  . SER F 3 53  ? 13.604  -84.264  -7.745  1.00 19.10  ? 52  SER Y CA  1 
ATOM   8148  C  C   . SER F 3 53  ? 13.374  -82.745  -7.803  1.00 19.57  ? 52  SER Y C   1 
ATOM   8149  O  O   . SER F 3 53  ? 12.450  -82.306  -8.480  1.00 18.30  ? 52  SER Y O   1 
ATOM   8150  C  CB  . SER F 3 53  ? 12.335  -84.932  -7.210  1.00 19.63  ? 52  SER Y CB  1 
ATOM   8151  O  OG  . SER F 3 53  ? 12.046  -84.448  -5.911  1.00 21.34  ? 52  SER Y OG  1 
ATOM   8152  N  N   . SER F 3 54  ? 14.210  -81.953  -7.132  1.00 20.55  ? 53  SER Y N   1 
ATOM   8153  C  CA  . SER F 3 54  ? 13.961  -80.516  -7.002  1.00 20.46  ? 53  SER Y CA  1 
ATOM   8154  C  C   . SER F 3 54  ? 14.660  -79.694  -8.092  1.00 19.97  ? 53  SER Y C   1 
ATOM   8155  O  O   . SER F 3 54  ? 15.868  -79.456  -8.041  1.00 21.08  ? 53  SER Y O   1 
ATOM   8156  C  CB  . SER F 3 54  ? 14.383  -80.042  -5.621  1.00 21.34  ? 53  SER Y CB  1 
ATOM   8157  O  OG  . SER F 3 54  ? 14.151  -78.658  -5.486  1.00 25.26  ? 53  SER Y OG  1 
ATOM   8158  N  N   . LEU F 3 55  ? 13.876  -79.255  -9.069  1.00 18.33  ? 54  LEU Y N   1 
ATOM   8159  C  CA  . LEU F 3 55  ? 14.365  -78.437  -10.168 1.00 19.11  ? 54  LEU Y CA  1 
ATOM   8160  C  C   . LEU F 3 55  ? 14.757  -77.046  -9.673  1.00 19.36  ? 54  LEU Y C   1 
ATOM   8161  O  O   . LEU F 3 55  ? 14.011  -76.414  -8.933  1.00 16.82  ? 54  LEU Y O   1 
ATOM   8162  C  CB  . LEU F 3 55  ? 13.274  -78.322  -11.242 1.00 19.18  ? 54  LEU Y CB  1 
ATOM   8163  C  CG  . LEU F 3 55  ? 13.610  -77.586  -12.543 1.00 18.76  ? 54  LEU Y CG  1 
ATOM   8164  C  CD1 . LEU F 3 55  ? 14.663  -78.339  -13.309 1.00 17.33  ? 54  LEU Y CD1 1 
ATOM   8165  C  CD2 . LEU F 3 55  ? 12.333  -77.383  -13.397 1.00 16.12  ? 54  LEU Y CD2 1 
ATOM   8166  N  N   . GLN F 3 56  ? 15.930  -76.575  -10.078 1.00 20.76  ? 55  GLN Y N   1 
ATOM   8167  C  CA  . GLN F 3 56  ? 16.412  -75.271  -9.634  1.00 21.62  ? 55  GLN Y CA  1 
ATOM   8168  C  C   . GLN F 3 56  ? 15.891  -74.140  -10.494 1.00 20.55  ? 55  GLN Y C   1 
ATOM   8169  O  O   . GLN F 3 56  ? 15.617  -74.324  -11.686 1.00 19.12  ? 55  GLN Y O   1 
ATOM   8170  C  CB  . GLN F 3 56  ? 17.937  -75.262  -9.547  1.00 23.36  ? 55  GLN Y CB  1 
ATOM   8171  C  CG  . GLN F 3 56  ? 18.424  -76.180  -8.409  1.00 25.64  ? 55  GLN Y CG  1 
ATOM   8172  C  CD  . GLN F 3 56  ? 17.655  -75.951  -7.082  1.00 26.67  ? 55  GLN Y CD  1 
ATOM   8173  O  OE1 . GLN F 3 56  ? 17.922  -74.972  -6.375  1.00 29.85  ? 55  GLN Y OE1 1 
ATOM   8174  N  NE2 . GLN F 3 56  ? 16.711  -76.857  -6.744  1.00 22.37  ? 55  GLN Y NE2 1 
ATOM   8175  N  N   . SER F 3 57  ? 15.727  -72.973  -9.871  1.00 20.16  ? 56  SER Y N   1 
ATOM   8176  C  CA  . SER F 3 57  ? 15.159  -71.819  -10.564 1.00 23.01  ? 56  SER Y CA  1 
ATOM   8177  C  C   . SER F 3 57  ? 16.041  -71.476  -11.747 1.00 22.39  ? 56  SER Y C   1 
ATOM   8178  O  O   . SER F 3 57  ? 17.270  -71.655  -11.694 1.00 21.00  ? 56  SER Y O   1 
ATOM   8179  C  CB  . SER F 3 57  ? 14.991  -70.603  -9.638  1.00 24.10  ? 56  SER Y CB  1 
ATOM   8180  O  OG  . SER F 3 57  ? 16.128  -70.419  -8.812  1.00 26.54  ? 56  SER Y OG  1 
ATOM   8181  N  N   . GLY F 3 58  ? 15.394  -71.025  -12.820 1.00 21.84  ? 57  GLY Y N   1 
ATOM   8182  C  CA  . GLY F 3 58  ? 16.064  -70.754  -14.084 1.00 21.72  ? 57  GLY Y CA  1 
ATOM   8183  C  C   . GLY F 3 58  ? 16.108  -71.975  -14.990 1.00 21.00  ? 57  GLY Y C   1 
ATOM   8184  O  O   . GLY F 3 58  ? 16.083  -71.839  -16.203 1.00 24.08  ? 57  GLY Y O   1 
ATOM   8185  N  N   . VAL F 3 59  ? 16.167  -73.173  -14.422 1.00 19.27  ? 58  VAL Y N   1 
ATOM   8186  C  CA  . VAL F 3 59  ? 16.254  -74.379  -15.247 1.00 18.87  ? 58  VAL Y CA  1 
ATOM   8187  C  C   . VAL F 3 59  ? 14.907  -74.689  -15.918 1.00 18.74  ? 58  VAL Y C   1 
ATOM   8188  O  O   . VAL F 3 59  ? 13.870  -74.707  -15.238 1.00 16.93  ? 58  VAL Y O   1 
ATOM   8189  C  CB  . VAL F 3 59  ? 16.719  -75.588  -14.451 1.00 18.87  ? 58  VAL Y CB  1 
ATOM   8190  C  CG1 . VAL F 3 59  ? 16.803  -76.816  -15.375 1.00 18.51  ? 58  VAL Y CG1 1 
ATOM   8191  C  CG2 . VAL F 3 59  ? 18.065  -75.278  -13.783 1.00 15.54  ? 58  VAL Y CG2 1 
ATOM   8192  N  N   . PRO F 3 60  ? 14.921  -74.920  -17.255 1.00 17.27  ? 59  PRO Y N   1 
ATOM   8193  C  CA  . PRO F 3 60  ? 13.678  -75.170  -17.983 1.00 17.37  ? 59  PRO Y CA  1 
ATOM   8194  C  C   . PRO F 3 60  ? 12.904  -76.354  -17.419 1.00 18.07  ? 59  PRO Y C   1 
ATOM   8195  O  O   . PRO F 3 60  ? 13.500  -77.340  -16.981 1.00 19.27  ? 59  PRO Y O   1 
ATOM   8196  C  CB  . PRO F 3 60  ? 14.145  -75.460  -19.419 1.00 16.33  ? 59  PRO Y CB  1 
ATOM   8197  C  CG  . PRO F 3 60  ? 15.471  -74.847  -19.544 1.00 16.02  ? 59  PRO Y CG  1 
ATOM   8198  C  CD  . PRO F 3 60  ? 16.089  -74.925  -18.158 1.00 16.72  ? 59  PRO Y CD  1 
ATOM   8199  N  N   . SER F 3 61  ? 11.579  -76.246  -17.446 1.00 18.86  ? 60  SER Y N   1 
ATOM   8200  C  CA  . SER F 3 61  ? 10.704  -77.211  -16.799 1.00 19.66  ? 60  SER Y CA  1 
ATOM   8201  C  C   . SER F 3 61  ? 10.643  -78.565  -17.497 1.00 18.87  ? 60  SER Y C   1 
ATOM   8202  O  O   . SER F 3 61  ? 10.012  -79.495  -16.972 1.00 16.63  ? 60  SER Y O   1 
ATOM   8203  C  CB  . SER F 3 61  ? 9.297   -76.634  -16.705 1.00 20.53  ? 60  SER Y CB  1 
ATOM   8204  O  OG  . SER F 3 61  ? 8.786   -76.383  -17.998 1.00 22.39  ? 60  SER Y OG  1 
ATOM   8205  N  N   . ARG F 3 62  ? 11.270  -78.681  -18.672 1.00 17.94  ? 61  ARG Y N   1 
ATOM   8206  C  CA  . ARG F 3 62  ? 11.365  -79.977  -19.359 1.00 17.88  ? 61  ARG Y CA  1 
ATOM   8207  C  C   . ARG F 3 62  ? 12.283  -80.961  -18.644 1.00 17.23  ? 61  ARG Y C   1 
ATOM   8208  O  O   . ARG F 3 62  ? 12.223  -82.163  -18.916 1.00 17.83  ? 61  ARG Y O   1 
ATOM   8209  C  CB  . ARG F 3 62  ? 11.811  -79.825  -20.819 1.00 18.04  ? 61  ARG Y CB  1 
ATOM   8210  C  CG  . ARG F 3 62  ? 13.200  -79.242  -21.012 1.00 18.76  ? 61  ARG Y CG  1 
ATOM   8211  C  CD  . ARG F 3 62  ? 13.500  -79.089  -22.483 1.00 18.77  ? 61  ARG Y CD  1 
ATOM   8212  N  NE  . ARG F 3 62  ? 14.757  -78.398  -22.703 1.00 19.41  ? 61  ARG Y NE  1 
ATOM   8213  C  CZ  . ARG F 3 62  ? 14.892  -77.078  -22.799 1.00 19.04  ? 61  ARG Y CZ  1 
ATOM   8214  N  NH1 . ARG F 3 62  ? 13.844  -76.278  -22.672 1.00 20.04  ? 61  ARG Y NH1 1 
ATOM   8215  N  NH2 . ARG F 3 62  ? 16.097  -76.554  -22.998 1.00 19.03  ? 61  ARG Y NH2 1 
ATOM   8216  N  N   . PHE F 3 63  ? 13.135  -80.450  -17.752 1.00 16.66  ? 62  PHE Y N   1 
ATOM   8217  C  CA  . PHE F 3 63  ? 14.029  -81.283  -16.941 1.00 16.13  ? 62  PHE Y CA  1 
ATOM   8218  C  C   . PHE F 3 63  ? 13.322  -81.732  -15.683 1.00 14.85  ? 62  PHE Y C   1 
ATOM   8219  O  O   . PHE F 3 63  ? 12.643  -80.950  -15.044 1.00 11.97  ? 62  PHE Y O   1 
ATOM   8220  C  CB  . PHE F 3 63  ? 15.309  -80.512  -16.558 1.00 17.10  ? 62  PHE Y CB  1 
ATOM   8221  C  CG  . PHE F 3 63  ? 16.239  -80.285  -17.715 1.00 17.58  ? 62  PHE Y CG  1 
ATOM   8222  C  CD1 . PHE F 3 63  ? 17.158  -81.264  -18.088 1.00 16.07  ? 62  PHE Y CD1 1 
ATOM   8223  C  CD2 . PHE F 3 63  ? 16.180  -79.108  -18.452 1.00 17.22  ? 62  PHE Y CD2 1 
ATOM   8224  C  CE1 . PHE F 3 63  ? 18.009  -81.055  -19.176 1.00 16.58  ? 62  PHE Y CE1 1 
ATOM   8225  C  CE2 . PHE F 3 63  ? 17.037  -78.899  -19.535 1.00 16.80  ? 62  PHE Y CE2 1 
ATOM   8226  C  CZ  . PHE F 3 63  ? 17.940  -79.871  -19.899 1.00 15.52  ? 62  PHE Y CZ  1 
ATOM   8227  N  N   . SER F 3 64  ? 13.479  -83.002  -15.336 1.00 16.74  ? 63  SER Y N   1 
ATOM   8228  C  CA  . SER F 3 64  ? 12.918  -83.537  -14.102 1.00 16.59  ? 63  SER Y CA  1 
ATOM   8229  C  C   . SER F 3 64  ? 13.790  -84.677  -13.565 1.00 16.74  ? 63  SER Y C   1 
ATOM   8230  O  O   . SER F 3 64  ? 14.505  -85.346  -14.307 1.00 16.02  ? 63  SER Y O   1 
ATOM   8231  C  CB  . SER F 3 64  ? 11.474  -84.010  -14.321 1.00 16.78  ? 63  SER Y CB  1 
ATOM   8232  O  OG  . SER F 3 64  ? 11.439  -85.304  -14.902 1.00 18.49  ? 63  SER Y OG  1 
ATOM   8233  N  N   . GLY F 3 65  ? 13.731  -84.882  -12.259 1.00 16.63  ? 64  GLY Y N   1 
ATOM   8234  C  CA  . GLY F 3 65  ? 14.512  -85.920  -11.625 1.00 15.97  ? 64  GLY Y CA  1 
ATOM   8235  C  C   . GLY F 3 65  ? 13.601  -86.735  -10.751 1.00 15.65  ? 64  GLY Y C   1 
ATOM   8236  O  O   . GLY F 3 65  ? 12.639  -86.205  -10.186 1.00 16.86  ? 64  GLY Y O   1 
ATOM   8237  N  N   . SER F 3 66  ? 13.891  -88.026  -10.649 1.00 15.96  ? 65  SER Y N   1 
ATOM   8238  C  CA  . SER F 3 66  ? 13.170  -88.902  -9.736  1.00 16.48  ? 65  SER Y CA  1 
ATOM   8239  C  C   . SER F 3 66  ? 14.091  -89.953  -9.116  1.00 15.89  ? 65  SER Y C   1 
ATOM   8240  O  O   . SER F 3 66  ? 15.225  -90.146  -9.547  1.00 14.02  ? 65  SER Y O   1 
ATOM   8241  C  CB  . SER F 3 66  ? 12.009  -89.578  -10.464 1.00 17.73  ? 65  SER Y CB  1 
ATOM   8242  O  OG  . SER F 3 66  ? 12.438  -90.729  -11.168 1.00 20.46  ? 65  SER Y OG  1 
ATOM   8243  N  N   . GLY F 3 67  ? 13.584  -90.625  -8.093  1.00 16.93  ? 66  GLY Y N   1 
ATOM   8244  C  CA  . GLY F 3 67  ? 14.270  -91.750  -7.479  1.00 17.59  ? 66  GLY Y CA  1 
ATOM   8245  C  C   . GLY F 3 67  ? 14.576  -91.507  -6.023  1.00 19.03  ? 66  GLY Y C   1 
ATOM   8246  O  O   . GLY F 3 67  ? 14.569  -90.365  -5.554  1.00 19.95  ? 66  GLY Y O   1 
ATOM   8247  N  N   . SER F 3 68  ? 14.833  -92.592  -5.302  1.00 20.85  ? 67  SER Y N   1 
ATOM   8248  C  CA  . SER F 3 68  ? 15.423  -92.511  -3.966  1.00 22.61  ? 67  SER Y CA  1 
ATOM   8249  C  C   . SER F 3 68  ? 16.054  -93.846  -3.646  1.00 22.14  ? 67  SER Y C   1 
ATOM   8250  O  O   . SER F 3 68  ? 15.707  -94.855  -4.251  1.00 23.63  ? 67  SER Y O   1 
ATOM   8251  C  CB  . SER F 3 68  ? 14.380  -92.172  -2.908  1.00 23.98  ? 67  SER Y CB  1 
ATOM   8252  O  OG  . SER F 3 68  ? 13.462  -93.234  -2.775  1.00 26.75  ? 67  SER Y OG  1 
ATOM   8253  N  N   . GLY F 3 69  ? 16.977  -93.841  -2.695  1.00 20.43  ? 68  GLY Y N   1 
ATOM   8254  C  CA  . GLY F 3 69  ? 17.696  -95.039  -2.301  1.00 19.46  ? 68  GLY Y CA  1 
ATOM   8255  C  C   . GLY F 3 69  ? 18.916  -95.273  -3.174  1.00 19.20  ? 68  GLY Y C   1 
ATOM   8256  O  O   . GLY F 3 69  ? 19.967  -94.642  -2.987  1.00 18.34  ? 68  GLY Y O   1 
ATOM   8257  N  N   . THR F 3 70  ? 18.757  -96.164  -4.145  1.00 18.56  ? 69  THR Y N   1 
ATOM   8258  C  CA  . THR F 3 70  ? 19.852  -96.614  -4.993  1.00 20.22  ? 69  THR Y CA  1 
ATOM   8259  C  C   . THR F 3 70  ? 19.727  -96.172  -6.460  1.00 20.21  ? 69  THR Y C   1 
ATOM   8260  O  O   . THR F 3 70  ? 20.733  -95.956  -7.125  1.00 21.35  ? 69  THR Y O   1 
ATOM   8261  C  CB  . THR F 3 70  ? 19.966  -98.161  -4.908  1.00 21.50  ? 69  THR Y CB  1 
ATOM   8262  O  OG1 . THR F 3 70  ? 20.667  -98.523  -3.700  1.00 22.06  ? 69  THR Y OG1 1 
ATOM   8263  C  CG2 . THR F 3 70  ? 20.695  -98.723  -6.103  1.00 22.63  ? 69  THR Y CG2 1 
ATOM   8264  N  N   . ASP F 3 71  ? 18.501  -96.023  -6.955  1.00 19.66  ? 70  ASP Y N   1 
ATOM   8265  C  CA  . ASP F 3 71  ? 18.255  -95.830  -8.381  1.00 19.10  ? 70  ASP Y CA  1 
ATOM   8266  C  C   . ASP F 3 71  ? 17.562  -94.509  -8.673  1.00 16.36  ? 70  ASP Y C   1 
ATOM   8267  O  O   . ASP F 3 71  ? 16.547  -94.192  -8.062  1.00 15.99  ? 70  ASP Y O   1 
ATOM   8268  C  CB  . ASP F 3 71  ? 17.420  -97.002  -8.912  1.00 20.51  ? 70  ASP Y CB  1 
ATOM   8269  C  CG  . ASP F 3 71  ? 18.192  -98.303  -8.894  1.00 22.65  ? 70  ASP Y CG  1 
ATOM   8270  O  OD1 . ASP F 3 71  ? 19.208  -98.394  -9.616  1.00 24.81  ? 70  ASP Y OD1 1 
ATOM   8271  O  OD2 . ASP F 3 71  ? 17.797  -99.231  -8.157  1.00 24.77  ? 70  ASP Y OD2 1 
ATOM   8272  N  N   . PHE F 3 72  ? 18.123  -93.750  -9.613  1.00 15.17  ? 71  PHE Y N   1 
ATOM   8273  C  CA  . PHE F 3 72  ? 17.654  -92.395  -9.917  1.00 16.07  ? 71  PHE Y CA  1 
ATOM   8274  C  C   . PHE F 3 72  ? 17.575  -92.170  -11.423 1.00 15.12  ? 71  PHE Y C   1 
ATOM   8275  O  O   . PHE F 3 72  ? 18.240  -92.860  -12.194 1.00 17.43  ? 71  PHE Y O   1 
ATOM   8276  C  CB  . PHE F 3 72  ? 18.583  -91.350  -9.291  1.00 16.39  ? 71  PHE Y CB  1 
ATOM   8277  C  CG  . PHE F 3 72  ? 18.792  -91.533  -7.817  1.00 17.04  ? 71  PHE Y CG  1 
ATOM   8278  C  CD1 . PHE F 3 72  ? 18.051  -90.791  -6.903  1.00 17.23  ? 71  PHE Y CD1 1 
ATOM   8279  C  CD2 . PHE F 3 72  ? 19.714  -92.462  -7.341  1.00 16.08  ? 71  PHE Y CD2 1 
ATOM   8280  C  CE1 . PHE F 3 72  ? 18.233  -90.962  -5.550  1.00 17.29  ? 71  PHE Y CE1 1 
ATOM   8281  C  CE2 . PHE F 3 72  ? 19.902  -92.645  -5.986  1.00 16.33  ? 71  PHE Y CE2 1 
ATOM   8282  C  CZ  . PHE F 3 72  ? 19.168  -91.896  -5.083  1.00 17.00  ? 71  PHE Y CZ  1 
ATOM   8283  N  N   . THR F 3 73  ? 16.761  -91.202  -11.827 1.00 13.85  ? 72  THR Y N   1 
ATOM   8284  C  CA  . THR F 3 73  ? 16.510  -90.919  -13.236 1.00 15.13  ? 72  THR Y CA  1 
ATOM   8285  C  C   . THR F 3 73  ? 16.373  -89.417  -13.497 1.00 15.41  ? 72  THR Y C   1 
ATOM   8286  O  O   . THR F 3 73  ? 15.638  -88.724  -12.800 1.00 16.60  ? 72  THR Y O   1 
ATOM   8287  C  CB  . THR F 3 73  ? 15.218  -91.607  -13.733 1.00 14.65  ? 72  THR Y CB  1 
ATOM   8288  O  OG1 . THR F 3 73  ? 15.221  -92.986  -13.352 1.00 15.55  ? 72  THR Y OG1 1 
ATOM   8289  C  CG2 . THR F 3 73  ? 15.126  -91.541  -15.240 1.00 16.03  ? 72  THR Y CG2 1 
ATOM   8290  N  N   . LEU F 3 74  ? 17.086  -88.936  -14.511 1.00 16.88  ? 73  LEU Y N   1 
ATOM   8291  C  CA  . LEU F 3 74  ? 16.925  -87.586  -15.058 1.00 16.79  ? 73  LEU Y CA  1 
ATOM   8292  C  C   . LEU F 3 74  ? 16.118  -87.692  -16.347 1.00 17.25  ? 73  LEU Y C   1 
ATOM   8293  O  O   . LEU F 3 74  ? 16.482  -88.455  -17.237 1.00 16.41  ? 73  LEU Y O   1 
ATOM   8294  C  CB  . LEU F 3 74  ? 18.292  -86.988  -15.386 1.00 17.38  ? 73  LEU Y CB  1 
ATOM   8295  C  CG  . LEU F 3 74  ? 18.323  -85.538  -15.890 1.00 18.12  ? 73  LEU Y CG  1 
ATOM   8296  C  CD1 . LEU F 3 74  ? 17.846  -84.578  -14.804 1.00 16.71  ? 73  LEU Y CD1 1 
ATOM   8297  C  CD2 . LEU F 3 74  ? 19.714  -85.150  -16.368 1.00 17.28  ? 73  LEU Y CD2 1 
ATOM   8298  N  N   . THR F 3 75  ? 15.029  -86.934  -16.459 1.00 17.05  ? 74  THR Y N   1 
ATOM   8299  C  CA  . THR F 3 75  ? 14.253  -86.929  -17.698 1.00 17.46  ? 74  THR Y CA  1 
ATOM   8300  C  C   . THR F 3 75  ? 14.243  -85.554  -18.367 1.00 16.30  ? 74  THR Y C   1 
ATOM   8301  O  O   . THR F 3 75  ? 14.129  -84.524  -17.701 1.00 16.48  ? 74  THR Y O   1 
ATOM   8302  C  CB  . THR F 3 75  ? 12.799  -87.430  -17.475 1.00 17.27  ? 74  THR Y CB  1 
ATOM   8303  O  OG1 . THR F 3 75  ? 12.833  -88.700  -16.825 1.00 17.83  ? 74  THR Y OG1 1 
ATOM   8304  C  CG2 . THR F 3 75  ? 12.063  -87.589  -18.803 1.00 17.67  ? 74  THR Y CG2 1 
ATOM   8305  N  N   . ILE F 3 76  ? 14.390  -85.559  -19.689 1.00 16.00  ? 75  ILE Y N   1 
ATOM   8306  C  CA  . ILE F 3 76  ? 14.155  -84.371  -20.523 1.00 15.30  ? 75  ILE Y CA  1 
ATOM   8307  C  C   . ILE F 3 76  ? 12.902  -84.678  -21.343 1.00 14.41  ? 75  ILE Y C   1 
ATOM   8308  O  O   . ILE F 3 76  ? 12.927  -85.545  -22.202 1.00 15.10  ? 75  ILE Y O   1 
ATOM   8309  C  CB  . ILE F 3 76  ? 15.349  -84.059  -21.454 1.00 14.37  ? 75  ILE Y CB  1 
ATOM   8310  C  CG1 . ILE F 3 76  ? 16.660  -84.093  -20.660 1.00 14.25  ? 75  ILE Y CG1 1 
ATOM   8311  C  CG2 . ILE F 3 76  ? 15.137  -82.712  -22.148 1.00 12.75  ? 75  ILE Y CG2 1 
ATOM   8312  C  CD1 . ILE F 3 76  ? 17.939  -83.827  -21.487 1.00 15.00  ? 75  ILE Y CD1 1 
ATOM   8313  N  N   . SER F 3 77  ? 11.802  -83.991  -21.047 1.00 14.62  ? 76  SER Y N   1 
ATOM   8314  C  CA  . SER F 3 77  ? 10.502  -84.361  -21.598 1.00 16.56  ? 76  SER Y CA  1 
ATOM   8315  C  C   . SER F 3 77  ? 10.438  -84.103  -23.103 1.00 17.07  ? 76  SER Y C   1 
ATOM   8316  O  O   . SER F 3 77  ? 9.761   -84.825  -23.833 1.00 18.86  ? 76  SER Y O   1 
ATOM   8317  C  CB  . SER F 3 77  ? 9.383   -83.597  -20.894 1.00 16.85  ? 76  SER Y CB  1 
ATOM   8318  O  OG  . SER F 3 77  ? 9.435   -82.222  -21.229 1.00 18.51  ? 76  SER Y OG  1 
ATOM   8319  N  N   . SER F 3 78  ? 11.144  -83.071  -23.551 1.00 16.30  ? 77  SER Y N   1 
ATOM   8320  C  CA  . SER F 3 78  ? 11.222  -82.740  -24.965 1.00 16.07  ? 77  SER Y CA  1 
ATOM   8321  C  C   . SER F 3 78  ? 12.593  -82.138  -25.261 1.00 15.00  ? 77  SER Y C   1 
ATOM   8322  O  O   . SER F 3 78  ? 12.843  -80.968  -24.956 1.00 13.80  ? 77  SER Y O   1 
ATOM   8323  C  CB  . SER F 3 78  ? 10.104  -81.761  -25.335 1.00 15.74  ? 77  SER Y CB  1 
ATOM   8324  O  OG  . SER F 3 78  ? 10.133  -81.463  -26.719 1.00 16.16  ? 77  SER Y OG  1 
ATOM   8325  N  N   . LEU F 3 79  ? 13.475  -82.943  -25.850 1.00 14.19  ? 78  LEU Y N   1 
ATOM   8326  C  CA  . LEU F 3 79  ? 14.871  -82.540  -26.053 1.00 13.96  ? 78  LEU Y CA  1 
ATOM   8327  C  C   . LEU F 3 79  ? 14.956  -81.338  -26.990 1.00 13.29  ? 78  LEU Y C   1 
ATOM   8328  O  O   . LEU F 3 79  ? 14.312  -81.329  -28.027 1.00 12.90  ? 78  LEU Y O   1 
ATOM   8329  C  CB  . LEU F 3 79  ? 15.688  -83.705  -26.628 1.00 13.81  ? 78  LEU Y CB  1 
ATOM   8330  C  CG  . LEU F 3 79  ? 17.211  -83.530  -26.655 1.00 14.91  ? 78  LEU Y CG  1 
ATOM   8331  C  CD1 . LEU F 3 79  ? 17.785  -83.455  -25.232 1.00 12.67  ? 78  LEU Y CD1 1 
ATOM   8332  C  CD2 . LEU F 3 79  ? 17.864  -84.656  -27.458 1.00 14.43  ? 78  LEU Y CD2 1 
ATOM   8333  N  N   . GLN F 3 80  ? 15.732  -80.323  -26.608 1.00 13.96  ? 79  GLN Y N   1 
ATOM   8334  C  CA  . GLN F 3 80  ? 15.949  -79.143  -27.455 1.00 15.49  ? 79  GLN Y CA  1 
ATOM   8335  C  C   . GLN F 3 80  ? 17.411  -79.013  -27.855 1.00 16.07  ? 79  GLN Y C   1 
ATOM   8336  O  O   . GLN F 3 80  ? 18.289  -79.590  -27.217 1.00 16.55  ? 79  GLN Y O   1 
ATOM   8337  C  CB  . GLN F 3 80  ? 15.519  -77.870  -26.725 1.00 15.45  ? 79  GLN Y CB  1 
ATOM   8338  C  CG  . GLN F 3 80  ? 14.075  -77.858  -26.292 1.00 16.06  ? 79  GLN Y CG  1 
ATOM   8339  C  CD  . GLN F 3 80  ? 13.127  -77.950  -27.456 1.00 17.25  ? 79  GLN Y CD  1 
ATOM   8340  O  OE1 . GLN F 3 80  ? 13.284  -77.238  -28.458 1.00 16.02  ? 79  GLN Y OE1 1 
ATOM   8341  N  NE2 . GLN F 3 80  ? 12.130  -78.838  -27.345 1.00 18.17  ? 79  GLN Y NE2 1 
ATOM   8342  N  N   . LEU F 3 81  ? 17.669  -78.231  -28.896 1.00 17.00  ? 80  LEU Y N   1 
ATOM   8343  C  CA  . LEU F 3 81  ? 19.044  -77.970  -29.360 1.00 18.28  ? 80  LEU Y CA  1 
ATOM   8344  C  C   . LEU F 3 81  ? 19.985  -77.547  -28.233 1.00 18.03  ? 80  LEU Y C   1 
ATOM   8345  O  O   . LEU F 3 81  ? 21.107  -78.023  -28.161 1.00 19.92  ? 80  LEU Y O   1 
ATOM   8346  C  CB  . LEU F 3 81  ? 19.053  -76.882  -30.442 1.00 18.77  ? 80  LEU Y CB  1 
ATOM   8347  C  CG  . LEU F 3 81  ? 18.616  -77.254  -31.856 1.00 19.65  ? 80  LEU Y CG  1 
ATOM   8348  C  CD1 . LEU F 3 81  ? 18.609  -76.005  -32.722 1.00 18.23  ? 80  LEU Y CD1 1 
ATOM   8349  C  CD2 . LEU F 3 81  ? 19.537  -78.317  -32.462 1.00 21.00  ? 80  LEU Y CD2 1 
ATOM   8350  N  N   . GLU F 3 82  ? 19.523  -76.647  -27.370 1.00 18.79  ? 81  GLU Y N   1 
ATOM   8351  C  CA  . GLU F 3 82  ? 20.258  -76.212  -26.167 1.00 20.51  ? 81  GLU Y CA  1 
ATOM   8352  C  C   . GLU F 3 82  ? 20.744  -77.328  -25.240 1.00 19.62  ? 81  GLU Y C   1 
ATOM   8353  O  O   . GLU F 3 82  ? 21.661  -77.115  -24.445 1.00 18.18  ? 81  GLU Y O   1 
ATOM   8354  C  CB  . GLU F 3 82  ? 19.357  -75.328  -25.299 1.00 23.81  ? 81  GLU Y CB  1 
ATOM   8355  C  CG  . GLU F 3 82  ? 19.448  -73.852  -25.547 1.00 27.06  ? 81  GLU Y CG  1 
ATOM   8356  C  CD  . GLU F 3 82  ? 18.569  -73.064  -24.582 1.00 30.89  ? 81  GLU Y CD  1 
ATOM   8357  O  OE1 . GLU F 3 82  ? 18.033  -73.676  -23.621 1.00 32.60  ? 81  GLU Y OE1 1 
ATOM   8358  O  OE2 . GLU F 3 82  ? 18.401  -71.833  -24.788 1.00 33.08  ? 81  GLU Y OE2 1 
ATOM   8359  N  N   . ASP F 3 83  ? 20.084  -78.484  -25.290 1.00 18.93  ? 82  ASP Y N   1 
ATOM   8360  C  CA  . ASP F 3 83  ? 20.323  -79.552  -24.318 1.00 18.80  ? 82  ASP Y CA  1 
ATOM   8361  C  C   . ASP F 3 83  ? 21.541  -80.436  -24.662 1.00 17.97  ? 82  ASP Y C   1 
ATOM   8362  O  O   . ASP F 3 83  ? 21.883  -81.345  -23.909 1.00 16.75  ? 82  ASP Y O   1 
ATOM   8363  C  CB  . ASP F 3 83  ? 19.061  -80.404  -24.163 1.00 17.34  ? 82  ASP Y CB  1 
ATOM   8364  C  CG  . ASP F 3 83  ? 17.858  -79.596  -23.703 1.00 17.85  ? 82  ASP Y CG  1 
ATOM   8365  O  OD1 . ASP F 3 83  ? 18.054  -78.519  -23.090 1.00 17.49  ? 82  ASP Y OD1 1 
ATOM   8366  O  OD2 . ASP F 3 83  ? 16.706  -80.045  -23.940 1.00 16.59  ? 82  ASP Y OD2 1 
ATOM   8367  N  N   . PHE F 3 84  ? 22.167  -80.162  -25.804 1.00 19.30  ? 83  PHE Y N   1 
ATOM   8368  C  CA  . PHE F 3 84  ? 23.408  -80.815  -26.223 1.00 19.80  ? 83  PHE Y CA  1 
ATOM   8369  C  C   . PHE F 3 84  ? 24.495  -80.551  -25.182 1.00 17.87  ? 83  PHE Y C   1 
ATOM   8370  O  O   . PHE F 3 84  ? 24.926  -79.412  -24.997 1.00 17.59  ? 83  PHE Y O   1 
ATOM   8371  C  CB  . PHE F 3 84  ? 23.806  -80.267  -27.595 1.00 22.06  ? 83  PHE Y CB  1 
ATOM   8372  C  CG  . PHE F 3 84  ? 25.170  -80.678  -28.059 1.00 25.20  ? 83  PHE Y CG  1 
ATOM   8373  C  CD1 . PHE F 3 84  ? 25.378  -81.930  -28.630 1.00 26.90  ? 83  PHE Y CD1 1 
ATOM   8374  C  CD2 . PHE F 3 84  ? 26.241  -79.801  -27.963 1.00 25.50  ? 83  PHE Y CD2 1 
ATOM   8375  C  CE1 . PHE F 3 84  ? 26.636  -82.307  -29.082 1.00 26.95  ? 83  PHE Y CE1 1 
ATOM   8376  C  CE2 . PHE F 3 84  ? 27.492  -80.165  -28.403 1.00 26.04  ? 83  PHE Y CE2 1 
ATOM   8377  C  CZ  . PHE F 3 84  ? 27.695  -81.420  -28.963 1.00 27.42  ? 83  PHE Y CZ  1 
ATOM   8378  N  N   . ALA F 3 85  ? 24.922  -81.605  -24.492 1.00 16.85  ? 84  ALA Y N   1 
ATOM   8379  C  CA  . ALA F 3 85  ? 25.758  -81.445  -23.294 1.00 17.54  ? 84  ALA Y CA  1 
ATOM   8380  C  C   . ALA F 3 85  ? 26.069  -82.781  -22.653 1.00 17.57  ? 84  ALA Y C   1 
ATOM   8381  O  O   . ALA F 3 85  ? 25.516  -83.813  -23.042 1.00 18.39  ? 84  ALA Y O   1 
ATOM   8382  C  CB  . ALA F 3 85  ? 25.054  -80.549  -22.265 1.00 15.67  ? 84  ALA Y CB  1 
ATOM   8383  N  N   . THR F 3 86  ? 26.946  -82.737  -21.655 1.00 17.77  ? 85  THR Y N   1 
ATOM   8384  C  CA  . THR F 3 86  ? 27.207  -83.872  -20.771 1.00 17.26  ? 85  THR Y CA  1 
ATOM   8385  C  C   . THR F 3 86  ? 26.449  -83.671  -19.458 1.00 17.05  ? 85  THR Y C   1 
ATOM   8386  O  O   . THR F 3 86  ? 26.412  -82.572  -18.911 1.00 16.54  ? 85  THR Y O   1 
ATOM   8387  C  CB  . THR F 3 86  ? 28.714  -84.028  -20.523 1.00 18.31  ? 85  THR Y CB  1 
ATOM   8388  O  OG1 . THR F 3 86  ? 29.342  -84.271  -21.780 1.00 19.51  ? 85  THR Y OG1 1 
ATOM   8389  C  CG2 . THR F 3 86  ? 29.036  -85.198  -19.544 1.00 17.87  ? 85  THR Y CG2 1 
ATOM   8390  N  N   . TYR F 3 87  ? 25.823  -84.743  -18.981 1.00 17.80  ? 86  TYR Y N   1 
ATOM   8391  C  CA  . TYR F 3 87  ? 25.025  -84.715  -17.765 1.00 16.66  ? 86  TYR Y CA  1 
ATOM   8392  C  C   . TYR F 3 87  ? 25.660  -85.647  -16.747 1.00 15.84  ? 86  TYR Y C   1 
ATOM   8393  O  O   . TYR F 3 87  ? 26.045  -86.764  -17.077 1.00 15.89  ? 86  TYR Y O   1 
ATOM   8394  C  CB  . TYR F 3 87  ? 23.571  -85.113  -18.067 1.00 17.02  ? 86  TYR Y CB  1 
ATOM   8395  C  CG  . TYR F 3 87  ? 22.885  -84.097  -18.951 1.00 18.14  ? 86  TYR Y CG  1 
ATOM   8396  C  CD1 . TYR F 3 87  ? 22.220  -83.001  -18.402 1.00 18.29  ? 86  TYR Y CD1 1 
ATOM   8397  C  CD2 . TYR F 3 87  ? 22.963  -84.186  -20.345 1.00 17.83  ? 86  TYR Y CD2 1 
ATOM   8398  C  CE1 . TYR F 3 87  ? 21.618  -82.040  -19.215 1.00 18.35  ? 86  TYR Y CE1 1 
ATOM   8399  C  CE2 . TYR F 3 87  ? 22.347  -83.235  -21.161 1.00 18.20  ? 86  TYR Y CE2 1 
ATOM   8400  C  CZ  . TYR F 3 87  ? 21.687  -82.161  -20.589 1.00 16.88  ? 86  TYR Y CZ  1 
ATOM   8401  O  OH  . TYR F 3 87  ? 21.105  -81.210  -21.391 1.00 16.30  ? 86  TYR Y OH  1 
ATOM   8402  N  N   . TYR F 3 88  ? 25.793  -85.161  -15.520 1.00 16.71  ? 87  TYR Y N   1 
ATOM   8403  C  CA  . TYR F 3 88  ? 26.389  -85.920  -14.417 1.00 16.99  ? 87  TYR Y CA  1 
ATOM   8404  C  C   . TYR F 3 88  ? 25.433  -86.024  -13.240 1.00 17.97  ? 87  TYR Y C   1 
ATOM   8405  O  O   . TYR F 3 88  ? 24.862  -85.028  -12.832 1.00 18.37  ? 87  TYR Y O   1 
ATOM   8406  C  CB  . TYR F 3 88  ? 27.618  -85.194  -13.889 1.00 13.77  ? 87  TYR Y CB  1 
ATOM   8407  C  CG  . TYR F 3 88  ? 28.788  -85.164  -14.815 1.00 12.95  ? 87  TYR Y CG  1 
ATOM   8408  C  CD1 . TYR F 3 88  ? 29.589  -86.289  -14.987 1.00 12.31  ? 87  TYR Y CD1 1 
ATOM   8409  C  CD2 . TYR F 3 88  ? 29.130  -84.005  -15.488 1.00 12.65  ? 87  TYR Y CD2 1 
ATOM   8410  C  CE1 . TYR F 3 88  ? 30.674  -86.262  -15.819 1.00 13.76  ? 87  TYR Y CE1 1 
ATOM   8411  C  CE2 . TYR F 3 88  ? 30.231  -83.968  -16.334 1.00 13.11  ? 87  TYR Y CE2 1 
ATOM   8412  C  CZ  . TYR F 3 88  ? 30.995  -85.095  -16.491 1.00 13.51  ? 87  TYR Y CZ  1 
ATOM   8413  O  OH  . TYR F 3 88  ? 32.079  -85.067  -17.317 1.00 14.53  ? 87  TYR Y OH  1 
ATOM   8414  N  N   . CYS F 3 89  ? 25.293  -87.218  -12.672 1.00 19.62  ? 88  CYS Y N   1 
ATOM   8415  C  CA  . CYS F 3 89  ? 24.724  -87.332  -11.344 1.00 19.47  ? 88  CYS Y CA  1 
ATOM   8416  C  C   . CYS F 3 89  ? 25.852  -87.188  -10.317 1.00 18.81  ? 88  CYS Y C   1 
ATOM   8417  O  O   . CYS F 3 89  ? 27.024  -87.372  -10.637 1.00 19.24  ? 88  CYS Y O   1 
ATOM   8418  C  CB  . CYS F 3 89  ? 23.940  -88.628  -11.177 1.00 20.45  ? 88  CYS Y CB  1 
ATOM   8419  S  SG  . CYS F 3 89  ? 24.845  -90.181  -11.284 1.00 21.37  ? 88  CYS Y SG  1 
ATOM   8420  N  N   . GLN F 3 90  ? 25.491  -86.792  -9.104  1.00 18.10  ? 89  GLN Y N   1 
ATOM   8421  C  CA  . GLN F 3 90  ? 26.464  -86.513  -8.044  1.00 17.86  ? 89  GLN Y CA  1 
ATOM   8422  C  C   . GLN F 3 90  ? 25.808  -86.785  -6.708  1.00 16.04  ? 89  GLN Y C   1 
ATOM   8423  O  O   . GLN F 3 90  ? 24.814  -86.147  -6.382  1.00 16.80  ? 89  GLN Y O   1 
ATOM   8424  C  CB  . GLN F 3 90  ? 26.939  -85.060  -8.096  1.00 17.78  ? 89  GLN Y CB  1 
ATOM   8425  C  CG  . GLN F 3 90  ? 28.023  -84.691  -7.046  1.00 19.06  ? 89  GLN Y CG  1 
ATOM   8426  C  CD  . GLN F 3 90  ? 27.510  -83.838  -5.906  1.00 21.39  ? 89  GLN Y CD  1 
ATOM   8427  O  OE1 . GLN F 3 90  ? 26.674  -82.952  -6.095  1.00 21.92  ? 89  GLN Y OE1 1 
ATOM   8428  N  NE2 . GLN F 3 90  ? 28.008  -84.104  -4.703  1.00 23.35  ? 89  GLN Y NE2 1 
ATOM   8429  N  N   . GLN F 3 91  ? 26.345  -87.745  -5.958  1.00 14.70  ? 90  GLN Y N   1 
ATOM   8430  C  CA  . GLN F 3 91  ? 25.836  -88.029  -4.627  1.00 14.78  ? 90  GLN Y CA  1 
ATOM   8431  C  C   . GLN F 3 91  ? 26.443  -87.037  -3.646  1.00 16.05  ? 90  GLN Y C   1 
ATOM   8432  O  O   . GLN F 3 91  ? 27.656  -86.779  -3.689  1.00 17.14  ? 90  GLN Y O   1 
ATOM   8433  C  CB  . GLN F 3 91  ? 26.059  -89.497  -4.205  1.00 13.38  ? 90  GLN Y CB  1 
ATOM   8434  C  CG  . GLN F 3 91  ? 27.512  -89.952  -4.055  1.00 12.43  ? 90  GLN Y CG  1 
ATOM   8435  C  CD  . GLN F 3 91  ? 28.158  -89.561  -2.713  1.00 12.07  ? 90  GLN Y CD  1 
ATOM   8436  O  OE1 . GLN F 3 91  ? 27.467  -89.211  -1.726  1.00 7.98   ? 90  GLN Y OE1 1 
ATOM   8437  N  NE2 . GLN F 3 91  ? 29.502  -89.610  -2.680  1.00 9.45   ? 90  GLN Y NE2 1 
ATOM   8438  N  N   . SER F 3 92  ? 25.575  -86.458  -2.809  1.00 14.74  ? 91  SER Y N   1 
ATOM   8439  C  CA  . SER F 3 92  ? 25.964  -85.560  -1.715  1.00 14.91  ? 91  SER Y CA  1 
ATOM   8440  C  C   . SER F 3 92  ? 25.763  -86.225  -0.336  1.00 15.01  ? 91  SER Y C   1 
ATOM   8441  O  O   . SER F 3 92  ? 25.633  -85.527  0.675   1.00 11.05  ? 91  SER Y O   1 
ATOM   8442  C  CB  . SER F 3 92  ? 25.143  -84.275  -1.776  1.00 13.92  ? 91  SER Y CB  1 
ATOM   8443  O  OG  . SER F 3 92  ? 23.751  -84.546  -1.813  1.00 12.52  ? 91  SER Y OG  1 
ATOM   8444  N  N   . TYR F 3 93  ? 25.729  -87.564  -0.313  1.00 15.70  ? 92  TYR Y N   1 
ATOM   8445  C  CA  . TYR F 3 93  ? 25.478  -88.313  0.918   1.00 15.66  ? 92  TYR Y CA  1 
ATOM   8446  C  C   . TYR F 3 93  ? 26.679  -88.174  1.844   1.00 17.22  ? 92  TYR Y C   1 
ATOM   8447  O  O   . TYR F 3 93  ? 26.520  -87.877  3.021   1.00 16.03  ? 92  TYR Y O   1 
ATOM   8448  C  CB  . TYR F 3 93  ? 25.207  -89.797  0.631   1.00 14.15  ? 92  TYR Y CB  1 
ATOM   8449  C  CG  . TYR F 3 93  ? 24.631  -90.541  1.814   1.00 13.59  ? 92  TYR Y CG  1 
ATOM   8450  C  CD1 . TYR F 3 93  ? 23.254  -90.557  2.051   1.00 12.80  ? 92  TYR Y CD1 1 
ATOM   8451  C  CD2 . TYR F 3 93  ? 25.459  -91.207  2.717   1.00 13.97  ? 92  TYR Y CD2 1 
ATOM   8452  C  CE1 . TYR F 3 93  ? 22.712  -91.241  3.142   1.00 12.48  ? 92  TYR Y CE1 1 
ATOM   8453  C  CE2 . TYR F 3 93  ? 24.927  -91.887  3.816   1.00 14.49  ? 92  TYR Y CE2 1 
ATOM   8454  C  CZ  . TYR F 3 93  ? 23.548  -91.900  4.020   1.00 14.20  ? 92  TYR Y CZ  1 
ATOM   8455  O  OH  . TYR F 3 93  ? 23.024  -92.565  5.108   1.00 14.71  ? 92  TYR Y OH  1 
ATOM   8456  N  N   . SER F 3 94  ? 27.871  -88.426  1.302   1.00 18.15  ? 93  SER Y N   1 
ATOM   8457  C  CA  . SER F 3 94  ? 29.113  -88.078  1.968   1.00 19.46  ? 93  SER Y CA  1 
ATOM   8458  C  C   . SER F 3 94  ? 29.860  -87.117  1.049   1.00 18.35  ? 93  SER Y C   1 
ATOM   8459  O  O   . SER F 3 94  ? 29.236  -86.486  0.190   1.00 19.98  ? 93  SER Y O   1 
ATOM   8460  C  CB  . SER F 3 94  ? 29.934  -89.328  2.295   1.00 20.15  ? 93  SER Y CB  1 
ATOM   8461  O  OG  . SER F 3 94  ? 30.395  -89.935  1.110   1.00 24.35  ? 93  SER Y OG  1 
ATOM   8462  N  N   . THR F 3 95  ? 31.173  -86.987  1.235   1.00 16.73  ? 94  THR Y N   1 
ATOM   8463  C  CA  . THR F 3 95  ? 31.978  -86.128  0.382   1.00 17.04  ? 94  THR Y CA  1 
ATOM   8464  C  C   . THR F 3 95  ? 31.745  -86.529  -1.081  1.00 17.52  ? 94  THR Y C   1 
ATOM   8465  O  O   . THR F 3 95  ? 31.654  -87.722  -1.379  1.00 20.09  ? 94  THR Y O   1 
ATOM   8466  C  CB  . THR F 3 95  ? 33.485  -86.176  0.744   1.00 17.18  ? 94  THR Y CB  1 
ATOM   8467  O  OG1 . THR F 3 95  ? 33.970  -87.517  0.645   1.00 16.56  ? 94  THR Y OG1 1 
ATOM   8468  C  CG2 . THR F 3 95  ? 33.727  -85.651  2.170   1.00 15.72  ? 94  THR Y CG2 1 
ATOM   8469  N  N   . PRO F 3 96  ? 31.624  -85.537  -1.985  1.00 15.57  ? 95  PRO Y N   1 
ATOM   8470  C  CA  . PRO F 3 96  ? 31.059  -85.730  -3.340  1.00 15.85  ? 95  PRO Y CA  1 
ATOM   8471  C  C   . PRO F 3 96  ? 31.683  -86.836  -4.197  1.00 15.99  ? 95  PRO Y C   1 
ATOM   8472  O  O   . PRO F 3 96  ? 32.911  -86.972  -4.244  1.00 17.37  ? 95  PRO Y O   1 
ATOM   8473  C  CB  . PRO F 3 96  ? 31.295  -84.375  -4.030  1.00 15.13  ? 95  PRO Y CB  1 
ATOM   8474  C  CG  . PRO F 3 96  ? 31.568  -83.413  -2.955  1.00 15.81  ? 95  PRO Y CG  1 
ATOM   8475  C  CD  . PRO F 3 96  ? 32.101  -84.159  -1.773  1.00 15.35  ? 95  PRO Y CD  1 
ATOM   8476  N  N   . SER F 3 97  ? 30.839  -87.609  -4.881  1.00 17.09  ? 96  SER Y N   1 
ATOM   8477  C  CA  . SER F 3 97  ? 31.306  -88.470  -5.982  1.00 17.68  ? 96  SER Y CA  1 
ATOM   8478  C  C   . SER F 3 97  ? 30.338  -88.377  -7.141  1.00 18.61  ? 96  SER Y C   1 
ATOM   8479  O  O   . SER F 3 97  ? 29.140  -88.163  -6.961  1.00 20.31  ? 96  SER Y O   1 
ATOM   8480  C  CB  . SER F 3 97  ? 31.531  -89.934  -5.549  1.00 17.81  ? 96  SER Y CB  1 
ATOM   8481  O  OG  . SER F 3 97  ? 30.335  -90.567  -5.126  1.00 18.80  ? 96  SER Y OG  1 
ATOM   8482  N  N   . PHE F 3 98  ? 30.879  -88.511  -8.342  1.00 19.80  ? 97  PHE Y N   1 
ATOM   8483  C  CA  . PHE F 3 98  ? 30.128  -88.294  -9.567  1.00 19.77  ? 97  PHE Y CA  1 
ATOM   8484  C  C   . PHE F 3 98  ? 29.977  -89.593  -10.336 1.00 18.43  ? 97  PHE Y C   1 
ATOM   8485  O  O   . PHE F 3 98  ? 30.835  -90.466  -10.265 1.00 17.06  ? 97  PHE Y O   1 
ATOM   8486  C  CB  . PHE F 3 98  ? 30.865  -87.288  -10.459 1.00 19.76  ? 97  PHE Y CB  1 
ATOM   8487  C  CG  . PHE F 3 98  ? 30.860  -85.894  -9.925  1.00 20.28  ? 97  PHE Y CG  1 
ATOM   8488  C  CD1 . PHE F 3 98  ? 29.895  -84.979  -10.346 1.00 19.69  ? 97  PHE Y CD1 1 
ATOM   8489  C  CD2 . PHE F 3 98  ? 31.816  -85.487  -8.998  1.00 20.20  ? 97  PHE Y CD2 1 
ATOM   8490  C  CE1 . PHE F 3 98  ? 29.886  -83.675  -9.855  1.00 18.90  ? 97  PHE Y CE1 1 
ATOM   8491  C  CE2 . PHE F 3 98  ? 31.806  -84.182  -8.495  1.00 20.67  ? 97  PHE Y CE2 1 
ATOM   8492  C  CZ  . PHE F 3 98  ? 30.834  -83.275  -8.931  1.00 19.54  ? 97  PHE Y CZ  1 
ATOM   8493  N  N   . GLY F 3 99  ? 28.886  -89.700  -11.080 1.00 18.07  ? 98  GLY Y N   1 
ATOM   8494  C  CA  . GLY F 3 99  ? 28.774  -90.705  -12.122 1.00 18.93  ? 98  GLY Y CA  1 
ATOM   8495  C  C   . GLY F 3 99  ? 29.694  -90.341  -13.272 1.00 19.60  ? 98  GLY Y C   1 
ATOM   8496  O  O   . GLY F 3 99  ? 30.178  -89.204  -13.364 1.00 19.01  ? 98  GLY Y O   1 
ATOM   8497  N  N   . GLN F 3 100 ? 29.932  -91.316  -14.141 1.00 20.11  ? 99  GLN Y N   1 
ATOM   8498  C  CA  . GLN F 3 100 ? 30.842  -91.167  -15.285 1.00 21.90  ? 99  GLN Y CA  1 
ATOM   8499  C  C   . GLN F 3 100 ? 30.401  -90.132  -16.336 1.00 20.87  ? 99  GLN Y C   1 
ATOM   8500  O  O   . GLN F 3 100 ? 31.216  -89.683  -17.142 1.00 20.41  ? 99  GLN Y O   1 
ATOM   8501  C  CB  . GLN F 3 100 ? 31.091  -92.528  -15.955 1.00 24.15  ? 99  GLN Y CB  1 
ATOM   8502  C  CG  . GLN F 3 100 ? 29.861  -93.475  -16.051 1.00 26.74  ? 99  GLN Y CG  1 
ATOM   8503  C  CD  . GLN F 3 100 ? 29.262  -93.555  -17.434 1.00 27.95  ? 99  GLN Y CD  1 
ATOM   8504  O  OE1 . GLN F 3 100 ? 28.089  -93.232  -17.632 1.00 29.39  ? 99  GLN Y OE1 1 
ATOM   8505  N  NE2 . GLN F 3 100 ? 30.060  -93.995  -18.405 1.00 29.82  ? 99  GLN Y NE2 1 
ATOM   8506  N  N   . GLY F 3 101 ? 29.121  -89.771  -16.329 1.00 18.87  ? 100 GLY Y N   1 
ATOM   8507  C  CA  . GLY F 3 101 ? 28.581  -88.814  -17.278 1.00 18.97  ? 100 GLY Y CA  1 
ATOM   8508  C  C   . GLY F 3 101 ? 27.854  -89.456  -18.444 1.00 17.64  ? 100 GLY Y C   1 
ATOM   8509  O  O   . GLY F 3 101 ? 28.154  -90.588  -18.840 1.00 16.26  ? 100 GLY Y O   1 
ATOM   8510  N  N   . THR F 3 102 ? 26.879  -88.726  -18.981 1.00 17.81  ? 101 THR Y N   1 
ATOM   8511  C  CA  . THR F 3 102 ? 26.174  -89.122  -20.200 1.00 17.07  ? 101 THR Y CA  1 
ATOM   8512  C  C   . THR F 3 102 ? 26.222  -87.993  -21.221 1.00 17.92  ? 101 THR Y C   1 
ATOM   8513  O  O   . THR F 3 102 ? 25.740  -86.878  -20.955 1.00 16.95  ? 101 THR Y O   1 
ATOM   8514  C  CB  . THR F 3 102 ? 24.689  -89.439  -19.948 1.00 15.65  ? 101 THR Y CB  1 
ATOM   8515  O  OG1 . THR F 3 102 ? 24.574  -90.474  -18.967 1.00 16.48  ? 101 THR Y OG1 1 
ATOM   8516  C  CG2 . THR F 3 102 ? 24.010  -89.901  -21.255 1.00 14.31  ? 101 THR Y CG2 1 
ATOM   8517  N  N   . LYS F 3 103 ? 26.773  -88.299  -22.391 1.00 17.58  ? 102 LYS Y N   1 
ATOM   8518  C  CA  . LYS F 3 103 ? 26.899  -87.322  -23.463 1.00 19.24  ? 102 LYS Y CA  1 
ATOM   8519  C  C   . LYS F 3 103 ? 25.659  -87.396  -24.370 1.00 18.45  ? 102 LYS Y C   1 
ATOM   8520  O  O   . LYS F 3 103 ? 25.414  -88.414  -25.007 1.00 18.50  ? 102 LYS Y O   1 
ATOM   8521  C  CB  . LYS F 3 103 ? 28.186  -87.589  -24.257 1.00 21.00  ? 102 LYS Y CB  1 
ATOM   8522  C  CG  . LYS F 3 103 ? 29.099  -86.375  -24.377 1.00 23.64  ? 102 LYS Y CG  1 
ATOM   8523  C  CD  . LYS F 3 103 ? 30.310  -86.630  -25.291 1.00 25.14  ? 102 LYS Y CD  1 
ATOM   8524  C  CE  . LYS F 3 103 ? 31.395  -87.478  -24.609 1.00 25.83  ? 102 LYS Y CE  1 
ATOM   8525  N  NZ  . LYS F 3 103 ? 32.535  -87.773  -25.550 1.00 27.11  ? 102 LYS Y NZ  1 
ATOM   8526  N  N   . VAL F 3 104 ? 24.869  -86.325  -24.404 1.00 17.71  ? 103 VAL Y N   1 
ATOM   8527  C  CA  . VAL F 3 104 ? 23.687  -86.261  -25.253 1.00 17.19  ? 103 VAL Y CA  1 
ATOM   8528  C  C   . VAL F 3 104 ? 24.016  -85.569  -26.570 1.00 18.41  ? 103 VAL Y C   1 
ATOM   8529  O  O   . VAL F 3 104 ? 24.479  -84.420  -26.583 1.00 16.91  ? 103 VAL Y O   1 
ATOM   8530  C  CB  . VAL F 3 104 ? 22.511  -85.516  -24.566 1.00 17.28  ? 103 VAL Y CB  1 
ATOM   8531  C  CG1 . VAL F 3 104 ? 21.297  -85.419  -25.514 1.00 16.16  ? 103 VAL Y CG1 1 
ATOM   8532  C  CG2 . VAL F 3 104 ? 22.117  -86.209  -23.275 1.00 13.95  ? 103 VAL Y CG2 1 
ATOM   8533  N  N   . GLU F 3 105 ? 23.799  -86.286  -27.674 1.00 20.31  ? 104 GLU Y N   1 
ATOM   8534  C  CA  . GLU F 3 105 ? 23.939  -85.714  -29.006 1.00 21.54  ? 104 GLU Y CA  1 
ATOM   8535  C  C   . GLU F 3 105 ? 22.553  -85.557  -29.626 1.00 20.28  ? 104 GLU Y C   1 
ATOM   8536  O  O   . GLU F 3 105 ? 21.623  -86.296  -29.281 1.00 15.69  ? 104 GLU Y O   1 
ATOM   8537  C  CB  . GLU F 3 105 ? 24.853  -86.571  -29.900 1.00 24.43  ? 104 GLU Y CB  1 
ATOM   8538  C  CG  . GLU F 3 105 ? 24.178  -87.778  -30.555 1.00 27.34  ? 104 GLU Y CG  1 
ATOM   8539  C  CD  . GLU F 3 105 ? 24.848  -88.224  -31.850 1.00 29.38  ? 104 GLU Y CD  1 
ATOM   8540  O  OE1 . GLU F 3 105 ? 25.437  -89.326  -31.855 1.00 31.40  ? 104 GLU Y OE1 1 
ATOM   8541  O  OE2 . GLU F 3 105 ? 24.780  -87.486  -32.861 1.00 29.74  ? 104 GLU Y OE2 1 
ATOM   8542  N  N   . ILE F 3 106 ? 22.432  -84.600  -30.548 1.00 20.10  ? 105 ILE Y N   1 
ATOM   8543  C  CA  . ILE F 3 106 ? 21.174  -84.358  -31.253 1.00 20.94  ? 105 ILE Y CA  1 
ATOM   8544  C  C   . ILE F 3 106 ? 21.102  -85.198  -32.531 1.00 21.21  ? 105 ILE Y C   1 
ATOM   8545  O  O   . ILE F 3 106 ? 21.938  -85.059  -33.413 1.00 22.12  ? 105 ILE Y O   1 
ATOM   8546  C  CB  . ILE F 3 106 ? 21.002  -82.866  -31.618 1.00 20.58  ? 105 ILE Y CB  1 
ATOM   8547  C  CG1 . ILE F 3 106 ? 21.093  -81.979  -30.358 1.00 20.40  ? 105 ILE Y CG1 1 
ATOM   8548  C  CG2 . ILE F 3 106 ? 19.686  -82.640  -32.356 1.00 18.37  ? 105 ILE Y CG2 1 
ATOM   8549  C  CD1 . ILE F 3 106 ? 20.172  -82.360  -29.231 1.00 20.30  ? 105 ILE Y CD1 1 
ATOM   8550  N  N   . LYS F 3 107 ? 20.107  -86.074  -32.612 1.00 21.90  ? 106 LYS Y N   1 
ATOM   8551  C  CA  . LYS F 3 107 ? 19.842  -86.843  -33.830 1.00 23.23  ? 106 LYS Y CA  1 
ATOM   8552  C  C   . LYS F 3 107 ? 19.097  -85.954  -34.821 1.00 22.37  ? 106 LYS Y C   1 
ATOM   8553  O  O   . LYS F 3 107 ? 18.137  -85.298  -34.461 1.00 22.99  ? 106 LYS Y O   1 
ATOM   8554  C  CB  . LYS F 3 107 ? 19.029  -88.105  -33.507 1.00 23.74  ? 106 LYS Y CB  1 
ATOM   8555  C  CG  . LYS F 3 107 ? 18.732  -89.012  -34.695 1.00 25.57  ? 106 LYS Y CG  1 
ATOM   8556  C  CD  . LYS F 3 107 ? 18.308  -90.434  -34.274 1.00 27.37  ? 106 LYS Y CD  1 
ATOM   8557  C  CE  . LYS F 3 107 ? 17.162  -90.439  -33.264 1.00 29.38  ? 106 LYS Y CE  1 
ATOM   8558  N  NZ  . LYS F 3 107 ? 16.686  -91.808  -32.851 1.00 30.74  ? 106 LYS Y NZ  1 
ATOM   8559  N  N   . ARG F 3 108 ? 19.568  -85.914  -36.061 1.00 24.41  ? 107 ARG Y N   1 
ATOM   8560  C  CA  . ARG F 3 108 ? 18.924  -85.139  -37.124 1.00 25.46  ? 107 ARG Y CA  1 
ATOM   8561  C  C   . ARG F 3 108 ? 18.818  -86.003  -38.385 1.00 25.04  ? 107 ARG Y C   1 
ATOM   8562  O  O   . ARG F 3 108 ? 19.271  -87.153  -38.407 1.00 25.07  ? 107 ARG Y O   1 
ATOM   8563  C  CB  . ARG F 3 108 ? 19.706  -83.841  -37.416 1.00 26.36  ? 107 ARG Y CB  1 
ATOM   8564  C  CG  . ARG F 3 108 ? 21.063  -84.059  -38.073 1.00 28.44  ? 107 ARG Y CG  1 
ATOM   8565  C  CD  . ARG F 3 108 ? 21.627  -82.833  -38.834 1.00 30.33  ? 107 ARG Y CD  1 
ATOM   8566  N  NE  . ARG F 3 108 ? 20.679  -82.148  -39.726 1.00 31.74  ? 107 ARG Y NE  1 
ATOM   8567  C  CZ  . ARG F 3 108 ? 20.531  -82.378  -41.027 1.00 34.47  ? 107 ARG Y CZ  1 
ATOM   8568  N  NH1 . ARG F 3 108 ? 21.246  -83.301  -41.644 1.00 38.52  ? 107 ARG Y NH1 1 
ATOM   8569  N  NH2 . ARG F 3 108 ? 19.650  -81.689  -41.734 1.00 34.50  ? 107 ARG Y NH2 1 
ATOM   8570  N  N   . THR F 3 109 ? 18.224  -85.447  -39.432 1.00 24.71  ? 108 THR Y N   1 
ATOM   8571  C  CA  . THR F 3 109 ? 18.160  -86.139  -40.709 1.00 26.65  ? 108 THR Y CA  1 
ATOM   8572  C  C   . THR F 3 109 ? 19.564  -86.248  -41.322 1.00 26.36  ? 108 THR Y C   1 
ATOM   8573  O  O   . THR F 3 109 ? 20.442  -85.457  -41.024 1.00 26.06  ? 108 THR Y O   1 
ATOM   8574  C  CB  . THR F 3 109 ? 17.187  -85.454  -41.702 1.00 27.60  ? 108 THR Y CB  1 
ATOM   8575  O  OG1 . THR F 3 109 ? 17.297  -86.099  -42.977 1.00 30.79  ? 108 THR Y OG1 1 
ATOM   8576  C  CG2 . THR F 3 109 ? 17.500  -83.970  -41.877 1.00 27.02  ? 108 THR Y CG2 1 
ATOM   8577  N  N   . VAL F 3 110 ? 19.772  -87.254  -42.156 1.00 26.13  ? 109 VAL Y N   1 
ATOM   8578  C  CA  . VAL F 3 110 ? 21.076  -87.481  -42.773 1.00 26.36  ? 109 VAL Y CA  1 
ATOM   8579  C  C   . VAL F 3 110 ? 21.460  -86.330  -43.714 1.00 25.07  ? 109 VAL Y C   1 
ATOM   8580  O  O   . VAL F 3 110 ? 20.629  -85.809  -44.451 1.00 24.99  ? 109 VAL Y O   1 
ATOM   8581  C  CB  . VAL F 3 110 ? 21.069  -88.802  -43.557 1.00 26.71  ? 109 VAL Y CB  1 
ATOM   8582  C  CG1 . VAL F 3 110 ? 22.379  -88.992  -44.311 1.00 26.97  ? 109 VAL Y CG1 1 
ATOM   8583  C  CG2 . VAL F 3 110 ? 20.797  -89.957  -42.605 1.00 26.79  ? 109 VAL Y CG2 1 
ATOM   8584  N  N   . ALA F 3 111 ? 22.721  -85.932  -43.672 1.00 24.13  ? 110 ALA Y N   1 
ATOM   8585  C  CA  . ALA F 3 111 ? 23.197  -84.816  -44.479 1.00 23.78  ? 110 ALA Y CA  1 
ATOM   8586  C  C   . ALA F 3 111 ? 24.543  -85.182  -45.067 1.00 23.44  ? 110 ALA Y C   1 
ATOM   8587  O  O   . ALA F 3 111 ? 25.478  -85.491  -44.330 1.00 24.15  ? 110 ALA Y O   1 
ATOM   8588  C  CB  . ALA F 3 111 ? 23.309  -83.540  -43.631 1.00 22.48  ? 110 ALA Y CB  1 
ATOM   8589  N  N   . ALA F 3 112 ? 24.635  -85.162  -46.396 1.00 23.18  ? 111 ALA Y N   1 
ATOM   8590  C  CA  . ALA F 3 112 ? 25.886  -85.457  -47.088 1.00 22.45  ? 111 ALA Y CA  1 
ATOM   8591  C  C   . ALA F 3 112 ? 26.904  -84.343  -46.843 1.00 21.73  ? 111 ALA Y C   1 
ATOM   8592  O  O   . ALA F 3 112 ? 26.532  -83.178  -46.734 1.00 20.50  ? 111 ALA Y O   1 
ATOM   8593  C  CB  . ALA F 3 112 ? 25.634  -85.629  -48.591 1.00 22.19  ? 111 ALA Y CB  1 
ATOM   8594  N  N   . PRO F 3 113 ? 28.196  -84.697  -46.737 1.00 22.65  ? 112 PRO Y N   1 
ATOM   8595  C  CA  . PRO F 3 113 ? 29.206  -83.645  -46.666 1.00 22.63  ? 112 PRO Y CA  1 
ATOM   8596  C  C   . PRO F 3 113 ? 29.462  -83.002  -48.022 1.00 22.32  ? 112 PRO Y C   1 
ATOM   8597  O  O   . PRO F 3 113 ? 29.282  -83.648  -49.055 1.00 20.15  ? 112 PRO Y O   1 
ATOM   8598  C  CB  . PRO F 3 113 ? 30.461  -84.397  -46.220 1.00 21.37  ? 112 PRO Y CB  1 
ATOM   8599  C  CG  . PRO F 3 113 ? 30.267  -85.768  -46.706 1.00 21.36  ? 112 PRO Y CG  1 
ATOM   8600  C  CD  . PRO F 3 113 ? 28.799  -86.037  -46.613 1.00 21.64  ? 112 PRO Y CD  1 
ATOM   8601  N  N   . SER F 3 114 ? 29.873  -81.738  -47.995 1.00 23.32  ? 113 SER Y N   1 
ATOM   8602  C  CA  . SER F 3 114 ? 30.576  -81.119  -49.117 1.00 24.39  ? 113 SER Y CA  1 
ATOM   8603  C  C   . SER F 3 114 ? 32.077  -81.286  -48.879 1.00 23.57  ? 113 SER Y C   1 
ATOM   8604  O  O   . SER F 3 114 ? 32.568  -81.068  -47.767 1.00 23.64  ? 113 SER Y O   1 
ATOM   8605  C  CB  . SER F 3 114 ? 30.241  -79.639  -49.221 1.00 24.74  ? 113 SER Y CB  1 
ATOM   8606  O  OG  . SER F 3 114 ? 28.853  -79.449  -49.120 1.00 26.24  ? 113 SER Y OG  1 
ATOM   8607  N  N   . VAL F 3 115 ? 32.799  -81.673  -49.925 1.00 23.38  ? 114 VAL Y N   1 
ATOM   8608  C  CA  . VAL F 3 115 ? 34.211  -82.010  -49.795 1.00 22.20  ? 114 VAL Y CA  1 
ATOM   8609  C  C   . VAL F 3 115 ? 35.092  -81.008  -50.531 1.00 20.98  ? 114 VAL Y C   1 
ATOM   8610  O  O   . VAL F 3 115 ? 34.741  -80.530  -51.604 1.00 18.49  ? 114 VAL Y O   1 
ATOM   8611  C  CB  . VAL F 3 115 ? 34.484  -83.441  -50.272 1.00 22.40  ? 114 VAL Y CB  1 
ATOM   8612  C  CG1 . VAL F 3 115 ? 35.947  -83.799  -50.100 1.00 22.12  ? 114 VAL Y CG1 1 
ATOM   8613  C  CG2 . VAL F 3 115 ? 33.609  -84.419  -49.489 1.00 23.01  ? 114 VAL Y CG2 1 
ATOM   8614  N  N   . PHE F 3 116 ? 36.224  -80.681  -49.910 1.00 21.48  ? 115 PHE Y N   1 
ATOM   8615  C  CA  . PHE F 3 116 ? 37.199  -79.750  -50.464 1.00 21.98  ? 115 PHE Y CA  1 
ATOM   8616  C  C   . PHE F 3 116 ? 38.583  -80.285  -50.171 1.00 23.27  ? 115 PHE Y C   1 
ATOM   8617  O  O   . PHE F 3 116 ? 38.805  -80.864  -49.102 1.00 25.17  ? 115 PHE Y O   1 
ATOM   8618  C  CB  . PHE F 3 116 ? 37.079  -78.361  -49.822 1.00 21.52  ? 115 PHE Y CB  1 
ATOM   8619  C  CG  . PHE F 3 116 ? 35.695  -77.777  -49.866 1.00 21.12  ? 115 PHE Y CG  1 
ATOM   8620  C  CD1 . PHE F 3 116 ? 35.345  -76.871  -50.840 1.00 21.01  ? 115 PHE Y CD1 1 
ATOM   8621  C  CD2 . PHE F 3 116 ? 34.756  -78.113  -48.906 1.00 21.02  ? 115 PHE Y CD2 1 
ATOM   8622  C  CE1 . PHE F 3 116 ? 34.062  -76.316  -50.873 1.00 21.42  ? 115 PHE Y CE1 1 
ATOM   8623  C  CE2 . PHE F 3 116 ? 33.485  -77.568  -48.930 1.00 21.55  ? 115 PHE Y CE2 1 
ATOM   8624  C  CZ  . PHE F 3 116 ? 33.134  -76.671  -49.919 1.00 21.05  ? 115 PHE Y CZ  1 
ATOM   8625  N  N   . ILE F 3 117 ? 39.505  -80.089  -51.110 1.00 23.10  ? 116 ILE Y N   1 
ATOM   8626  C  CA  . ILE F 3 117 ? 40.905  -80.468  -50.927 1.00 23.89  ? 116 ILE Y CA  1 
ATOM   8627  C  C   . ILE F 3 117 ? 41.780  -79.212  -50.966 1.00 25.40  ? 116 ILE Y C   1 
ATOM   8628  O  O   . ILE F 3 117 ? 41.455  -78.236  -51.651 1.00 26.08  ? 116 ILE Y O   1 
ATOM   8629  C  CB  . ILE F 3 117 ? 41.379  -81.519  -51.986 1.00 23.23  ? 116 ILE Y CB  1 
ATOM   8630  C  CG1 . ILE F 3 117 ? 42.687  -82.179  -51.539 1.00 23.64  ? 116 ILE Y CG1 1 
ATOM   8631  C  CG2 . ILE F 3 117 ? 41.540  -80.893  -53.362 1.00 21.23  ? 116 ILE Y CG2 1 
ATOM   8632  C  CD1 . ILE F 3 117 ? 43.033  -83.450  -52.307 1.00 24.86  ? 116 ILE Y CD1 1 
ATOM   8633  N  N   . PHE F 3 118 ? 42.875  -79.237  -50.211 1.00 26.21  ? 117 PHE Y N   1 
ATOM   8634  C  CA  . PHE F 3 118 ? 43.773  -78.091  -50.101 1.00 26.38  ? 117 PHE Y CA  1 
ATOM   8635  C  C   . PHE F 3 118 ? 45.222  -78.527  -50.265 1.00 26.48  ? 117 PHE Y C   1 
ATOM   8636  O  O   . PHE F 3 118 ? 45.741  -79.287  -49.437 1.00 25.74  ? 117 PHE Y O   1 
ATOM   8637  C  CB  . PHE F 3 118 ? 43.608  -77.413  -48.742 1.00 26.65  ? 117 PHE Y CB  1 
ATOM   8638  C  CG  . PHE F 3 118 ? 42.282  -76.739  -48.557 1.00 26.25  ? 117 PHE Y CG  1 
ATOM   8639  C  CD1 . PHE F 3 118 ? 42.048  -75.485  -49.107 1.00 26.73  ? 117 PHE Y CD1 1 
ATOM   8640  C  CD2 . PHE F 3 118 ? 41.274  -77.347  -47.828 1.00 26.03  ? 117 PHE Y CD2 1 
ATOM   8641  C  CE1 . PHE F 3 118 ? 40.820  -74.846  -48.936 1.00 26.81  ? 117 PHE Y CE1 1 
ATOM   8642  C  CE2 . PHE F 3 118 ? 40.039  -76.712  -47.648 1.00 25.93  ? 117 PHE Y CE2 1 
ATOM   8643  C  CZ  . PHE F 3 118 ? 39.817  -75.463  -48.203 1.00 26.29  ? 117 PHE Y CZ  1 
ATOM   8644  N  N   . PRO F 3 119 ? 45.890  -78.040  -51.325 1.00 27.01  ? 118 PRO Y N   1 
ATOM   8645  C  CA  . PRO F 3 119 ? 47.301  -78.371  -51.459 1.00 27.21  ? 118 PRO Y CA  1 
ATOM   8646  C  C   . PRO F 3 119 ? 48.126  -77.679  -50.372 1.00 27.59  ? 118 PRO Y C   1 
ATOM   8647  O  O   . PRO F 3 119 ? 47.656  -76.701  -49.774 1.00 26.62  ? 118 PRO Y O   1 
ATOM   8648  C  CB  . PRO F 3 119 ? 47.661  -77.825  -52.843 1.00 27.24  ? 118 PRO Y CB  1 
ATOM   8649  C  CG  . PRO F 3 119 ? 46.720  -76.701  -53.058 1.00 27.37  ? 118 PRO Y CG  1 
ATOM   8650  C  CD  . PRO F 3 119 ? 45.451  -77.052  -52.329 1.00 27.04  ? 118 PRO Y CD  1 
ATOM   8651  N  N   . PRO F 3 120 ? 49.340  -78.190  -50.101 1.00 27.44  ? 119 PRO Y N   1 
ATOM   8652  C  CA  . PRO F 3 120 ? 50.241  -77.497  -49.183 1.00 27.22  ? 119 PRO Y CA  1 
ATOM   8653  C  C   . PRO F 3 120 ? 50.660  -76.149  -49.757 1.00 26.25  ? 119 PRO Y C   1 
ATOM   8654  O  O   . PRO F 3 120 ? 50.783  -76.014  -50.973 1.00 25.38  ? 119 PRO Y O   1 
ATOM   8655  C  CB  . PRO F 3 120 ? 51.446  -78.444  -49.072 1.00 27.66  ? 119 PRO Y CB  1 
ATOM   8656  C  CG  . PRO F 3 120 ? 51.379  -79.307  -50.272 1.00 27.50  ? 119 PRO Y CG  1 
ATOM   8657  C  CD  . PRO F 3 120 ? 49.935  -79.426  -50.639 1.00 27.69  ? 119 PRO Y CD  1 
ATOM   8658  N  N   . SER F 3 121 ? 50.858  -75.164  -48.889 1.00 26.70  ? 120 SER Y N   1 
ATOM   8659  C  CA  . SER F 3 121 ? 51.241  -73.826  -49.330 1.00 27.74  ? 120 SER Y CA  1 
ATOM   8660  C  C   . SER F 3 121 ? 52.714  -73.787  -49.721 1.00 28.72  ? 120 SER Y C   1 
ATOM   8661  O  O   . SER F 3 121 ? 53.512  -74.621  -49.282 1.00 28.62  ? 120 SER Y O   1 
ATOM   8662  C  CB  . SER F 3 121 ? 50.942  -72.786  -48.241 1.00 27.41  ? 120 SER Y CB  1 
ATOM   8663  O  OG  . SER F 3 121 ? 51.705  -73.017  -47.070 1.00 26.94  ? 120 SER Y OG  1 
ATOM   8664  N  N   . ASP F 3 122 ? 53.072  -72.824  -50.562 1.00 30.28  ? 121 ASP Y N   1 
ATOM   8665  C  CA  . ASP F 3 122 ? 54.473  -72.620  -50.919 1.00 31.45  ? 121 ASP Y CA  1 
ATOM   8666  C  C   . ASP F 3 122 ? 55.294  -72.257  -49.682 1.00 31.27  ? 121 ASP Y C   1 
ATOM   8667  O  O   . ASP F 3 122 ? 56.457  -72.644  -49.573 1.00 31.36  ? 121 ASP Y O   1 
ATOM   8668  C  CB  . ASP F 3 122 ? 54.621  -71.532  -51.994 1.00 32.75  ? 121 ASP Y CB  1 
ATOM   8669  C  CG  . ASP F 3 122 ? 54.226  -72.019  -53.390 1.00 33.51  ? 121 ASP Y CG  1 
ATOM   8670  O  OD1 . ASP F 3 122 ? 54.487  -73.201  -53.719 1.00 33.54  ? 121 ASP Y OD1 1 
ATOM   8671  O  OD2 . ASP F 3 122 ? 53.664  -71.209  -54.164 1.00 33.90  ? 121 ASP Y OD2 1 
ATOM   8672  N  N   . GLU F 3 123 ? 54.674  -71.539  -48.746 1.00 31.43  ? 122 GLU Y N   1 
ATOM   8673  C  CA  . GLU F 3 123 ? 55.335  -71.137  -47.502 1.00 31.75  ? 122 GLU Y CA  1 
ATOM   8674  C  C   . GLU F 3 123 ? 55.744  -72.344  -46.655 1.00 30.91  ? 122 GLU Y C   1 
ATOM   8675  O  O   . GLU F 3 123 ? 56.877  -72.416  -46.180 1.00 30.82  ? 122 GLU Y O   1 
ATOM   8676  C  CB  . GLU F 3 123 ? 54.433  -70.213  -46.671 1.00 32.75  ? 122 GLU Y CB  1 
ATOM   8677  C  CG  . GLU F 3 123 ? 54.052  -68.894  -47.353 1.00 33.40  ? 122 GLU Y CG  1 
ATOM   8678  C  CD  . GLU F 3 123 ? 52.713  -68.961  -48.085 1.00 33.65  ? 122 GLU Y CD  1 
ATOM   8679  O  OE1 . GLU F 3 123 ? 51.773  -68.246  -47.668 1.00 33.32  ? 122 GLU Y OE1 1 
ATOM   8680  O  OE2 . GLU F 3 123 ? 52.602  -69.729  -49.068 1.00 33.74  ? 122 GLU Y OE2 1 
ATOM   8681  N  N   . GLN F 3 124 ? 54.822  -73.286  -46.467 1.00 30.41  ? 123 GLN Y N   1 
ATOM   8682  C  CA  . GLN F 3 124 ? 55.113  -74.499  -45.698 1.00 30.02  ? 123 GLN Y CA  1 
ATOM   8683  C  C   . GLN F 3 124 ? 56.188  -75.328  -46.402 1.00 30.69  ? 123 GLN Y C   1 
ATOM   8684  O  O   . GLN F 3 124 ? 57.042  -75.939  -45.754 1.00 30.58  ? 123 GLN Y O   1 
ATOM   8685  C  CB  . GLN F 3 124 ? 53.846  -75.340  -45.484 1.00 28.45  ? 123 GLN Y CB  1 
ATOM   8686  C  CG  . GLN F 3 124 ? 54.026  -76.498  -44.494 1.00 27.31  ? 123 GLN Y CG  1 
ATOM   8687  C  CD  . GLN F 3 124 ? 52.833  -77.442  -44.425 1.00 26.39  ? 123 GLN Y CD  1 
ATOM   8688  O  OE1 . GLN F 3 124 ? 52.052  -77.562  -45.368 1.00 26.08  ? 123 GLN Y OE1 1 
ATOM   8689  N  NE2 . GLN F 3 124 ? 52.696  -78.126  -43.298 1.00 25.92  ? 123 GLN Y NE2 1 
ATOM   8690  N  N   . LEU F 3 125 ? 56.141  -75.331  -47.732 1.00 32.04  ? 124 LEU Y N   1 
ATOM   8691  C  CA  . LEU F 3 125 ? 57.134  -76.034  -48.543 1.00 33.36  ? 124 LEU Y CA  1 
ATOM   8692  C  C   . LEU F 3 125 ? 58.550  -75.456  -48.435 1.00 33.85  ? 124 LEU Y C   1 
ATOM   8693  O  O   . LEU F 3 125 ? 59.511  -76.146  -48.781 1.00 34.45  ? 124 LEU Y O   1 
ATOM   8694  C  CB  . LEU F 3 125 ? 56.696  -76.076  -50.014 1.00 33.89  ? 124 LEU Y CB  1 
ATOM   8695  C  CG  . LEU F 3 125 ? 55.586  -77.086  -50.318 1.00 34.35  ? 124 LEU Y CG  1 
ATOM   8696  C  CD1 . LEU F 3 125 ? 54.825  -76.708  -51.585 1.00 34.74  ? 124 LEU Y CD1 1 
ATOM   8697  C  CD2 . LEU F 3 125 ? 56.167  -78.490  -50.426 1.00 34.25  ? 124 LEU Y CD2 1 
ATOM   8698  N  N   . LYS F 3 126 ? 58.692  -74.210  -47.973 1.00 34.43  ? 125 LYS Y N   1 
ATOM   8699  C  CA  . LYS F 3 126 ? 60.033  -73.656  -47.700 1.00 35.43  ? 125 LYS Y CA  1 
ATOM   8700  C  C   . LYS F 3 126 ? 60.777  -74.525  -46.685 1.00 35.28  ? 125 LYS Y C   1 
ATOM   8701  O  O   . LYS F 3 126 ? 61.975  -74.773  -46.841 1.00 35.81  ? 125 LYS Y O   1 
ATOM   8702  C  CB  . LYS F 3 126 ? 59.984  -72.200  -47.206 1.00 35.96  ? 125 LYS Y CB  1 
ATOM   8703  C  CG  . LYS F 3 126 ? 60.221  -71.152  -48.290 1.00 36.46  ? 125 LYS Y CG  1 
ATOM   8704  C  CD  . LYS F 3 126 ? 59.047  -71.059  -49.248 1.00 37.16  ? 125 LYS Y CD  1 
ATOM   8705  C  CE  . LYS F 3 126 ? 59.167  -69.871  -50.196 1.00 37.33  ? 125 LYS Y CE  1 
ATOM   8706  N  NZ  . LYS F 3 126 ? 57.854  -69.549  -50.837 1.00 37.61  ? 125 LYS Y NZ  1 
ATOM   8707  N  N   . SER F 3 127 ? 60.065  -74.972  -45.649 1.00 34.46  ? 126 SER Y N   1 
ATOM   8708  C  CA  . SER F 3 127 ? 60.581  -75.992  -44.736 1.00 33.74  ? 126 SER Y CA  1 
ATOM   8709  C  C   . SER F 3 127 ? 60.324  -77.378  -45.321 1.00 32.72  ? 126 SER Y C   1 
ATOM   8710  O  O   . SER F 3 127 ? 59.607  -77.516  -46.314 1.00 33.29  ? 126 SER Y O   1 
ATOM   8711  C  CB  . SER F 3 127 ? 59.939  -75.866  -43.355 1.00 34.35  ? 126 SER Y CB  1 
ATOM   8712  O  OG  . SER F 3 127 ? 60.499  -74.773  -42.651 1.00 35.00  ? 126 SER Y OG  1 
ATOM   8713  N  N   . GLY F 3 128 ? 60.904  -78.404  -44.705 1.00 31.29  ? 127 GLY Y N   1 
ATOM   8714  C  CA  . GLY F 3 128 ? 60.820  -79.769  -45.227 1.00 30.59  ? 127 GLY Y CA  1 
ATOM   8715  C  C   . GLY F 3 128 ? 59.506  -80.444  -44.887 1.00 29.67  ? 127 GLY Y C   1 
ATOM   8716  O  O   . GLY F 3 128 ? 59.488  -81.569  -44.387 1.00 29.51  ? 127 GLY Y O   1 
ATOM   8717  N  N   . THR F 3 129 ? 58.404  -79.771  -45.198 1.00 28.71  ? 128 THR Y N   1 
ATOM   8718  C  CA  . THR F 3 129 ? 57.121  -80.099  -44.608 1.00 28.62  ? 128 THR Y CA  1 
ATOM   8719  C  C   . THR F 3 129 ? 55.966  -79.861  -45.587 1.00 27.80  ? 128 THR Y C   1 
ATOM   8720  O  O   . THR F 3 129 ? 55.894  -78.820  -46.241 1.00 27.90  ? 128 THR Y O   1 
ATOM   8721  C  CB  . THR F 3 129 ? 56.920  -79.263  -43.325 1.00 29.42  ? 128 THR Y CB  1 
ATOM   8722  O  OG1 . THR F 3 129 ? 57.461  -77.946  -43.523 1.00 29.34  ? 128 THR Y OG1 1 
ATOM   8723  C  CG2 . THR F 3 129 ? 57.636  -79.917  -42.138 1.00 29.23  ? 128 THR Y CG2 1 
ATOM   8724  N  N   . ALA F 3 130 ? 55.074  -80.841  -45.686 1.00 26.66  ? 129 ALA Y N   1 
ATOM   8725  C  CA  . ALA F 3 130 ? 53.921  -80.761  -46.572 1.00 26.35  ? 129 ALA Y CA  1 
ATOM   8726  C  C   . ALA F 3 130 ? 52.682  -81.336  -45.881 1.00 26.49  ? 129 ALA Y C   1 
ATOM   8727  O  O   . ALA F 3 130 ? 52.661  -82.512  -45.509 1.00 27.35  ? 129 ALA Y O   1 
ATOM   8728  C  CB  . ALA F 3 130 ? 54.200  -81.510  -47.867 1.00 25.55  ? 129 ALA Y CB  1 
ATOM   8729  N  N   . SER F 3 131 ? 51.666  -80.497  -45.700 1.00 25.28  ? 130 SER Y N   1 
ATOM   8730  C  CA  . SER F 3 131 ? 50.370  -80.936  -45.205 1.00 25.01  ? 130 SER Y CA  1 
ATOM   8731  C  C   . SER F 3 131 ? 49.325  -80.727  -46.296 1.00 23.91  ? 130 SER Y C   1 
ATOM   8732  O  O   . SER F 3 131 ? 49.261  -79.658  -46.894 1.00 24.75  ? 130 SER Y O   1 
ATOM   8733  C  CB  . SER F 3 131 ? 49.983  -80.160  -43.948 1.00 25.26  ? 130 SER Y CB  1 
ATOM   8734  O  OG  . SER F 3 131 ? 50.819  -80.523  -42.865 1.00 26.19  ? 130 SER Y OG  1 
ATOM   8735  N  N   . VAL F 3 132 ? 48.534  -81.761  -46.567 1.00 22.52  ? 131 VAL Y N   1 
ATOM   8736  C  CA  . VAL F 3 132 ? 47.451  -81.693  -47.543 1.00 22.71  ? 131 VAL Y CA  1 
ATOM   8737  C  C   . VAL F 3 132 ? 46.154  -81.925  -46.776 1.00 23.36  ? 131 VAL Y C   1 
ATOM   8738  O  O   . VAL F 3 132 ? 46.026  -82.936  -46.076 1.00 22.94  ? 131 VAL Y O   1 
ATOM   8739  C  CB  . VAL F 3 132 ? 47.599  -82.774  -48.635 1.00 22.35  ? 131 VAL Y CB  1 
ATOM   8740  C  CG1 . VAL F 3 132 ? 46.670  -82.489  -49.795 1.00 22.18  ? 131 VAL Y CG1 1 
ATOM   8741  C  CG2 . VAL F 3 132 ? 49.035  -82.859  -49.112 1.00 22.40  ? 131 VAL Y CG2 1 
ATOM   8742  N  N   . VAL F 3 133 ? 45.207  -80.992  -46.890 1.00 22.88  ? 132 VAL Y N   1 
ATOM   8743  C  CA  . VAL F 3 133 ? 43.995  -81.034  -46.072 1.00 22.72  ? 132 VAL Y CA  1 
ATOM   8744  C  C   . VAL F 3 133 ? 42.734  -81.348  -46.891 1.00 24.01  ? 132 VAL Y C   1 
ATOM   8745  O  O   . VAL F 3 133 ? 42.454  -80.736  -47.936 1.00 22.96  ? 132 VAL Y O   1 
ATOM   8746  C  CB  . VAL F 3 133 ? 43.803  -79.711  -45.273 1.00 22.69  ? 132 VAL Y CB  1 
ATOM   8747  C  CG1 . VAL F 3 133 ? 42.561  -79.782  -44.376 1.00 21.49  ? 132 VAL Y CG1 1 
ATOM   8748  C  CG2 . VAL F 3 133 ? 45.051  -79.395  -44.443 1.00 20.35  ? 132 VAL Y CG2 1 
ATOM   8749  N  N   . CYS F 3 134 ? 41.988  -82.332  -46.405 1.00 25.29  ? 133 CYS Y N   1 
ATOM   8750  C  CA  . CYS F 3 134 ? 40.690  -82.668  -46.950 1.00 26.61  ? 133 CYS Y CA  1 
ATOM   8751  C  C   . CYS F 3 134 ? 39.662  -82.228  -45.923 1.00 26.20  ? 133 CYS Y C   1 
ATOM   8752  O  O   . CYS F 3 134 ? 39.822  -82.489  -44.730 1.00 25.05  ? 133 CYS Y O   1 
ATOM   8753  C  CB  . CYS F 3 134 ? 40.594  -84.175  -47.217 1.00 28.03  ? 133 CYS Y CB  1 
ATOM   8754  S  SG  . CYS F 3 134 ? 39.209  -84.685  -48.297 1.00 27.69  ? 133 CYS Y SG  1 
ATOM   8755  N  N   . LEU F 3 135 ? 38.627  -81.535  -46.392 1.00 26.54  ? 134 LEU Y N   1 
ATOM   8756  C  CA  . LEU F 3 135 ? 37.577  -80.994  -45.529 1.00 25.07  ? 134 LEU Y CA  1 
ATOM   8757  C  C   . LEU F 3 135 ? 36.255  -81.618  -45.930 1.00 24.71  ? 134 LEU Y C   1 
ATOM   8758  O  O   . LEU F 3 135 ? 35.892  -81.577  -47.096 1.00 24.47  ? 134 LEU Y O   1 
ATOM   8759  C  CB  . LEU F 3 135 ? 37.493  -79.461  -45.665 1.00 23.71  ? 134 LEU Y CB  1 
ATOM   8760  C  CG  . LEU F 3 135 ? 36.188  -78.788  -45.202 1.00 23.39  ? 134 LEU Y CG  1 
ATOM   8761  C  CD1 . LEU F 3 135 ? 35.908  -79.067  -43.717 1.00 23.39  ? 134 LEU Y CD1 1 
ATOM   8762  C  CD2 . LEU F 3 135 ? 36.201  -77.286  -45.483 1.00 22.37  ? 134 LEU Y CD2 1 
ATOM   8763  N  N   . LEU F 3 136 ? 35.549  -82.193  -44.958 1.00 25.43  ? 135 LEU Y N   1 
ATOM   8764  C  CA  . LEU F 3 136 ? 34.152  -82.593  -45.129 1.00 24.83  ? 135 LEU Y CA  1 
ATOM   8765  C  C   . LEU F 3 136 ? 33.323  -81.611  -44.320 1.00 24.62  ? 135 LEU Y C   1 
ATOM   8766  O  O   . LEU F 3 136 ? 33.493  -81.511  -43.097 1.00 24.19  ? 135 LEU Y O   1 
ATOM   8767  C  CB  . LEU F 3 136 ? 33.910  -84.005  -44.602 1.00 24.38  ? 135 LEU Y CB  1 
ATOM   8768  C  CG  . LEU F 3 136 ? 34.495  -85.198  -45.355 1.00 24.97  ? 135 LEU Y CG  1 
ATOM   8769  C  CD1 . LEU F 3 136 ? 35.981  -85.015  -45.670 1.00 24.31  ? 135 LEU Y CD1 1 
ATOM   8770  C  CD2 . LEU F 3 136 ? 34.244  -86.477  -44.539 1.00 25.07  ? 135 LEU Y CD2 1 
ATOM   8771  N  N   . ASN F 3 137 ? 32.422  -80.896  -44.986 1.00 24.14  ? 136 ASN Y N   1 
ATOM   8772  C  CA  . ASN F 3 137 ? 31.680  -79.822  -44.324 1.00 23.39  ? 136 ASN Y CA  1 
ATOM   8773  C  C   . ASN F 3 137 ? 30.210  -80.135  -44.128 1.00 22.31  ? 136 ASN Y C   1 
ATOM   8774  O  O   . ASN F 3 137 ? 29.531  -80.544  -45.070 1.00 18.24  ? 136 ASN Y O   1 
ATOM   8775  C  CB  . ASN F 3 137 ? 31.815  -78.517  -45.115 1.00 23.68  ? 136 ASN Y CB  1 
ATOM   8776  C  CG  . ASN F 3 137 ? 31.802  -77.286  -44.224 1.00 25.56  ? 136 ASN Y CG  1 
ATOM   8777  O  OD1 . ASN F 3 137 ? 32.179  -77.343  -43.051 1.00 27.12  ? 136 ASN Y OD1 1 
ATOM   8778  N  ND2 . ASN F 3 137 ? 31.373  -76.160  -44.781 1.00 27.27  ? 136 ASN Y ND2 1 
ATOM   8779  N  N   . ASN F 3 138 ? 29.745  -79.941  -42.887 1.00 23.13  ? 137 ASN Y N   1 
ATOM   8780  C  CA  . ASN F 3 138 ? 28.325  -79.906  -42.542 1.00 23.98  ? 137 ASN Y CA  1 
ATOM   8781  C  C   . ASN F 3 138 ? 27.560  -81.168  -42.878 1.00 23.70  ? 137 ASN Y C   1 
ATOM   8782  O  O   . ASN F 3 138 ? 26.622  -81.122  -43.659 1.00 23.94  ? 137 ASN Y O   1 
ATOM   8783  C  CB  . ASN F 3 138 ? 27.644  -78.705  -43.223 1.00 24.89  ? 137 ASN Y CB  1 
ATOM   8784  C  CG  . ASN F 3 138 ? 28.175  -77.366  -42.721 1.00 26.26  ? 137 ASN Y CG  1 
ATOM   8785  O  OD1 . ASN F 3 138 ? 28.866  -77.291  -41.696 1.00 26.72  ? 137 ASN Y OD1 1 
ATOM   8786  N  ND2 . ASN F 3 138 ? 27.838  -76.297  -43.439 1.00 25.85  ? 137 ASN Y ND2 1 
ATOM   8787  N  N   . PHE F 3 139 ? 27.938  -82.284  -42.261 1.00 24.73  ? 138 PHE Y N   1 
ATOM   8788  C  CA  . PHE F 3 139 ? 27.321  -83.582  -42.566 1.00 23.69  ? 138 PHE Y CA  1 
ATOM   8789  C  C   . PHE F 3 139 ? 26.710  -84.230  -41.332 1.00 23.67  ? 138 PHE Y C   1 
ATOM   8790  O  O   . PHE F 3 139 ? 26.987  -83.809  -40.221 1.00 24.12  ? 138 PHE Y O   1 
ATOM   8791  C  CB  . PHE F 3 139 ? 28.337  -84.527  -43.216 1.00 22.26  ? 138 PHE Y CB  1 
ATOM   8792  C  CG  . PHE F 3 139 ? 29.547  -84.796  -42.378 1.00 21.82  ? 138 PHE Y CG  1 
ATOM   8793  C  CD1 . PHE F 3 139 ? 29.563  -85.859  -41.481 1.00 23.15  ? 138 PHE Y CD1 1 
ATOM   8794  C  CD2 . PHE F 3 139 ? 30.676  -84.004  -42.486 1.00 21.33  ? 138 PHE Y CD2 1 
ATOM   8795  C  CE1 . PHE F 3 139 ? 30.685  -86.123  -40.694 1.00 21.60  ? 138 PHE Y CE1 1 
ATOM   8796  C  CE2 . PHE F 3 139 ? 31.800  -84.263  -41.708 1.00 20.89  ? 138 PHE Y CE2 1 
ATOM   8797  C  CZ  . PHE F 3 139 ? 31.795  -85.328  -40.806 1.00 21.52  ? 138 PHE Y CZ  1 
ATOM   8798  N  N   . TYR F 3 140 ? 25.855  -85.232  -41.545 1.00 23.05  ? 139 TYR Y N   1 
ATOM   8799  C  CA  . TYR F 3 140 ? 25.322  -86.045  -40.455 1.00 23.51  ? 139 TYR Y CA  1 
ATOM   8800  C  C   . TYR F 3 140 ? 24.963  -87.430  -40.975 1.00 23.02  ? 139 TYR Y C   1 
ATOM   8801  O  O   . TYR F 3 140 ? 24.346  -87.543  -42.017 1.00 23.21  ? 139 TYR Y O   1 
ATOM   8802  C  CB  . TYR F 3 140 ? 24.072  -85.404  -39.809 1.00 24.81  ? 139 TYR Y CB  1 
ATOM   8803  C  CG  . TYR F 3 140 ? 23.646  -86.124  -38.544 1.00 24.21  ? 139 TYR Y CG  1 
ATOM   8804  C  CD1 . TYR F 3 140 ? 24.238  -85.827  -37.325 1.00 24.74  ? 139 TYR Y CD1 1 
ATOM   8805  C  CD2 . TYR F 3 140 ? 22.691  -87.137  -38.576 1.00 24.46  ? 139 TYR Y CD2 1 
ATOM   8806  C  CE1 . TYR F 3 140 ? 23.889  -86.514  -36.167 1.00 24.88  ? 139 TYR Y CE1 1 
ATOM   8807  C  CE2 . TYR F 3 140 ? 22.331  -87.828  -37.418 1.00 24.08  ? 139 TYR Y CE2 1 
ATOM   8808  C  CZ  . TYR F 3 140 ? 22.933  -87.507  -36.222 1.00 24.69  ? 139 TYR Y CZ  1 
ATOM   8809  O  OH  . TYR F 3 140 ? 22.590  -88.174  -35.071 1.00 25.69  ? 139 TYR Y OH  1 
ATOM   8810  N  N   . PRO F 3 141 ? 25.309  -88.493  -40.232 1.00 23.18  ? 140 PRO Y N   1 
ATOM   8811  C  CA  . PRO F 3 141 ? 25.985  -88.524  -38.939 1.00 23.42  ? 140 PRO Y CA  1 
ATOM   8812  C  C   . PRO F 3 141 ? 27.519  -88.377  -38.995 1.00 23.92  ? 140 PRO Y C   1 
ATOM   8813  O  O   . PRO F 3 141 ? 28.112  -88.258  -40.074 1.00 21.00  ? 140 PRO Y O   1 
ATOM   8814  C  CB  . PRO F 3 141 ? 25.575  -89.888  -38.370 1.00 24.08  ? 140 PRO Y CB  1 
ATOM   8815  C  CG  . PRO F 3 141 ? 25.356  -90.739  -39.558 1.00 24.31  ? 140 PRO Y CG  1 
ATOM   8816  C  CD  . PRO F 3 141 ? 24.879  -89.838  -40.659 1.00 23.59  ? 140 PRO Y CD  1 
ATOM   8817  N  N   . ARG F 3 142 ? 28.120  -88.377  -37.805 1.00 25.51  ? 141 ARG Y N   1 
ATOM   8818  C  CA  . ARG F 3 142 ? 29.554  -88.168  -37.593 1.00 26.24  ? 141 ARG Y CA  1 
ATOM   8819  C  C   . ARG F 3 142 ? 30.410  -89.179  -38.354 1.00 26.02  ? 141 ARG Y C   1 
ATOM   8820  O  O   . ARG F 3 142 ? 31.510  -88.867  -38.790 1.00 25.10  ? 141 ARG Y O   1 
ATOM   8821  C  CB  . ARG F 3 142 ? 29.846  -88.268  -36.090 1.00 27.56  ? 141 ARG Y CB  1 
ATOM   8822  C  CG  . ARG F 3 142 ? 31.201  -87.743  -35.638 1.00 29.97  ? 141 ARG Y CG  1 
ATOM   8823  C  CD  . ARG F 3 142 ? 31.276  -87.705  -34.110 1.00 31.51  ? 141 ARG Y CD  1 
ATOM   8824  N  NE  . ARG F 3 142 ? 32.439  -86.967  -33.603 1.00 33.54  ? 141 ARG Y NE  1 
ATOM   8825  C  CZ  . ARG F 3 142 ? 33.638  -87.496  -33.332 1.00 35.22  ? 141 ARG Y CZ  1 
ATOM   8826  N  NH1 . ARG F 3 142 ? 34.610  -86.718  -32.863 1.00 35.19  ? 141 ARG Y NH1 1 
ATOM   8827  N  NH2 . ARG F 3 142 ? 33.893  -88.788  -33.538 1.00 36.10  ? 141 ARG Y NH2 1 
ATOM   8828  N  N   . GLU F 3 143 ? 29.892  -90.391  -38.508 1.00 26.46  ? 142 GLU Y N   1 
ATOM   8829  C  CA  . GLU F 3 143 ? 30.628  -91.478  -39.142 1.00 26.72  ? 142 GLU Y CA  1 
ATOM   8830  C  C   . GLU F 3 143 ? 30.856  -91.193  -40.631 1.00 26.39  ? 142 GLU Y C   1 
ATOM   8831  O  O   . GLU F 3 143 ? 29.909  -91.057  -41.406 1.00 27.08  ? 142 GLU Y O   1 
ATOM   8832  C  CB  . GLU F 3 143 ? 29.888  -92.811  -38.949 1.00 27.00  ? 142 GLU Y CB  1 
ATOM   8833  C  CG  . GLU F 3 143 ? 29.951  -93.368  -37.508 1.00 28.96  ? 142 GLU Y CG  1 
ATOM   8834  C  CD  . GLU F 3 143 ? 29.044  -92.636  -36.497 1.00 29.81  ? 142 GLU Y CD  1 
ATOM   8835  O  OE1 . GLU F 3 143 ? 27.881  -92.306  -36.845 1.00 30.00  ? 142 GLU Y OE1 1 
ATOM   8836  O  OE2 . GLU F 3 143 ? 29.495  -92.411  -35.346 1.00 29.45  ? 142 GLU Y OE2 1 
ATOM   8837  N  N   . ALA F 3 144 ? 32.126  -91.091  -41.004 1.00 26.05  ? 143 ALA Y N   1 
ATOM   8838  C  CA  . ALA F 3 144 ? 32.541  -90.837  -42.376 1.00 25.13  ? 143 ALA Y CA  1 
ATOM   8839  C  C   . ALA F 3 144 ? 33.926  -91.428  -42.580 1.00 26.03  ? 143 ALA Y C   1 
ATOM   8840  O  O   . ALA F 3 144 ? 34.762  -91.399  -41.677 1.00 24.67  ? 143 ALA Y O   1 
ATOM   8841  C  CB  . ALA F 3 144 ? 32.562  -89.355  -42.660 1.00 23.55  ? 143 ALA Y CB  1 
ATOM   8842  N  N   . LYS F 3 145 ? 34.160  -91.960  -43.775 1.00 27.74  ? 144 LYS Y N   1 
ATOM   8843  C  CA  . LYS F 3 145 ? 35.417  -92.619  -44.106 1.00 28.93  ? 144 LYS Y CA  1 
ATOM   8844  C  C   . LYS F 3 145 ? 36.163  -91.788  -45.142 1.00 28.38  ? 144 LYS Y C   1 
ATOM   8845  O  O   . LYS F 3 145 ? 35.596  -91.405  -46.158 1.00 28.39  ? 144 LYS Y O   1 
ATOM   8846  C  CB  . LYS F 3 145 ? 35.122  -94.026  -44.630 1.00 29.93  ? 144 LYS Y CB  1 
ATOM   8847  C  CG  . LYS F 3 145 ? 36.318  -94.770  -45.171 1.00 31.36  ? 144 LYS Y CG  1 
ATOM   8848  C  CD  . LYS F 3 145 ? 35.928  -96.158  -45.656 1.00 32.31  ? 144 LYS Y CD  1 
ATOM   8849  C  CE  . LYS F 3 145 ? 36.974  -96.718  -46.606 1.00 33.03  ? 144 LYS Y CE  1 
ATOM   8850  N  NZ  . LYS F 3 145 ? 38.353  -96.416  -46.136 1.00 33.84  ? 144 LYS Y NZ  1 
ATOM   8851  N  N   . VAL F 3 146 ? 37.432  -91.507  -44.874 1.00 29.21  ? 145 VAL Y N   1 
ATOM   8852  C  CA  . VAL F 3 146 ? 38.249  -90.685  -45.761 1.00 30.19  ? 145 VAL Y CA  1 
ATOM   8853  C  C   . VAL F 3 146 ? 39.533  -91.426  -46.132 1.00 30.56  ? 145 VAL Y C   1 
ATOM   8854  O  O   . VAL F 3 146 ? 40.311  -91.799  -45.257 1.00 31.65  ? 145 VAL Y O   1 
ATOM   8855  C  CB  . VAL F 3 146 ? 38.604  -89.348  -45.098 1.00 30.41  ? 145 VAL Y CB  1 
ATOM   8856  C  CG1 . VAL F 3 146 ? 39.477  -88.508  -46.024 1.00 31.43  ? 145 VAL Y CG1 1 
ATOM   8857  C  CG2 . VAL F 3 146 ? 37.332  -88.596  -44.715 1.00 30.28  ? 145 VAL Y CG2 1 
ATOM   8858  N  N   . GLN F 3 147 ? 39.738  -91.636  -47.430 1.00 30.12  ? 146 GLN Y N   1 
ATOM   8859  C  CA  . GLN F 3 147 ? 40.909  -92.339  -47.949 1.00 30.51  ? 146 GLN Y CA  1 
ATOM   8860  C  C   . GLN F 3 147 ? 41.800  -91.406  -48.760 1.00 29.66  ? 146 GLN Y C   1 
ATOM   8861  O  O   . GLN F 3 147 ? 41.317  -90.694  -49.637 1.00 27.73  ? 146 GLN Y O   1 
ATOM   8862  C  CB  . GLN F 3 147 ? 40.477  -93.501  -48.850 1.00 31.74  ? 146 GLN Y CB  1 
ATOM   8863  C  CG  . GLN F 3 147 ? 39.946  -94.711  -48.107 1.00 32.40  ? 146 GLN Y CG  1 
ATOM   8864  C  CD  . GLN F 3 147 ? 39.758  -95.917  -49.017 1.00 33.34  ? 146 GLN Y CD  1 
ATOM   8865  O  OE1 . GLN F 3 147 ? 38.711  -96.076  -49.653 1.00 33.81  ? 146 GLN Y OE1 1 
ATOM   8866  N  NE2 . GLN F 3 147 ? 40.772  -96.779  -49.076 1.00 32.84  ? 146 GLN Y NE2 1 
ATOM   8867  N  N   . TRP F 3 148 ? 43.102  -91.439  -48.471 1.00 29.86  ? 147 TRP Y N   1 
ATOM   8868  C  CA  . TRP F 3 148 ? 44.103  -90.668  -49.213 1.00 29.71  ? 147 TRP Y CA  1 
ATOM   8869  C  C   . TRP F 3 148 ? 44.797  -91.536  -50.257 1.00 29.98  ? 147 TRP Y C   1 
ATOM   8870  O  O   . TRP F 3 148 ? 45.285  -92.621  -49.948 1.00 28.69  ? 147 TRP Y O   1 
ATOM   8871  C  CB  . TRP F 3 148 ? 45.155  -90.091  -48.268 1.00 29.00  ? 147 TRP Y CB  1 
ATOM   8872  C  CG  . TRP F 3 148 ? 44.697  -88.890  -47.518 1.00 27.91  ? 147 TRP Y CG  1 
ATOM   8873  C  CD1 . TRP F 3 148 ? 44.275  -88.843  -46.223 1.00 26.79  ? 147 TRP Y CD1 1 
ATOM   8874  C  CD2 . TRP F 3 148 ? 44.626  -87.552  -48.014 1.00 27.48  ? 147 TRP Y CD2 1 
ATOM   8875  N  NE1 . TRP F 3 148 ? 43.945  -87.558  -45.884 1.00 26.76  ? 147 TRP Y NE1 1 
ATOM   8876  C  CE2 . TRP F 3 148 ? 44.149  -86.744  -46.964 1.00 26.40  ? 147 TRP Y CE2 1 
ATOM   8877  C  CE3 . TRP F 3 148 ? 44.930  -86.955  -49.244 1.00 27.79  ? 147 TRP Y CE3 1 
ATOM   8878  C  CZ2 . TRP F 3 148 ? 43.962  -85.373  -47.102 1.00 26.58  ? 147 TRP Y CZ2 1 
ATOM   8879  C  CZ3 . TRP F 3 148 ? 44.741  -85.592  -49.383 1.00 27.48  ? 147 TRP Y CZ3 1 
ATOM   8880  C  CH2 . TRP F 3 148 ? 44.262  -84.815  -48.316 1.00 27.14  ? 147 TRP Y CH2 1 
ATOM   8881  N  N   . LYS F 3 149 ? 44.835  -91.042  -51.490 1.00 30.98  ? 148 LYS Y N   1 
ATOM   8882  C  CA  . LYS F 3 149 ? 45.472  -91.742  -52.588 1.00 32.17  ? 148 LYS Y CA  1 
ATOM   8883  C  C   . LYS F 3 149 ? 46.488  -90.828  -53.261 1.00 32.53  ? 148 LYS Y C   1 
ATOM   8884  O  O   . LYS F 3 149 ? 46.174  -89.686  -53.605 1.00 32.42  ? 148 LYS Y O   1 
ATOM   8885  C  CB  . LYS F 3 149 ? 44.425  -92.213  -53.594 1.00 33.34  ? 148 LYS Y CB  1 
ATOM   8886  C  CG  . LYS F 3 149 ? 43.889  -93.606  -53.311 1.00 34.31  ? 148 LYS Y CG  1 
ATOM   8887  C  CD  . LYS F 3 149 ? 42.599  -93.880  -54.081 1.00 34.94  ? 148 LYS Y CD  1 
ATOM   8888  C  CE  . LYS F 3 149 ? 42.408  -95.371  -54.347 1.00 34.89  ? 148 LYS Y CE  1 
ATOM   8889  N  NZ  . LYS F 3 149 ? 43.303  -95.856  -55.424 1.00 34.48  ? 148 LYS Y NZ  1 
ATOM   8890  N  N   . VAL F 3 150 ? 47.706  -91.341  -53.430 1.00 32.21  ? 149 VAL Y N   1 
ATOM   8891  C  CA  . VAL F 3 150 ? 48.793  -90.608  -54.072 1.00 32.03  ? 149 VAL Y CA  1 
ATOM   8892  C  C   . VAL F 3 150 ? 49.225  -91.377  -55.322 1.00 31.18  ? 149 VAL Y C   1 
ATOM   8893  O  O   . VAL F 3 150 ? 49.838  -92.437  -55.219 1.00 30.55  ? 149 VAL Y O   1 
ATOM   8894  C  CB  . VAL F 3 150 ? 49.987  -90.437  -53.113 1.00 32.18  ? 149 VAL Y CB  1 
ATOM   8895  C  CG1 . VAL F 3 150 ? 51.126  -89.696  -53.802 1.00 32.10  ? 149 VAL Y CG1 1 
ATOM   8896  C  CG2 . VAL F 3 150 ? 49.542  -89.707  -51.854 1.00 31.86  ? 149 VAL Y CG2 1 
ATOM   8897  N  N   . ASP F 3 151 ? 48.893  -90.834  -56.493 1.00 30.82  ? 150 ASP Y N   1 
ATOM   8898  C  CA  . ASP F 3 151 ? 48.988  -91.563  -57.762 1.00 30.62  ? 150 ASP Y CA  1 
ATOM   8899  C  C   . ASP F 3 151 ? 48.299  -92.933  -57.655 1.00 30.41  ? 150 ASP Y C   1 
ATOM   8900  O  O   . ASP F 3 151 ? 48.812  -93.942  -58.137 1.00 29.79  ? 150 ASP Y O   1 
ATOM   8901  C  CB  . ASP F 3 151 ? 50.449  -91.699  -58.204 1.00 31.11  ? 150 ASP Y CB  1 
ATOM   8902  C  CG  . ASP F 3 151 ? 51.062  -90.370  -58.637 1.00 31.61  ? 150 ASP Y CG  1 
ATOM   8903  O  OD1 . ASP F 3 151 ? 50.366  -89.579  -59.313 1.00 32.19  ? 150 ASP Y OD1 1 
ATOM   8904  O  OD2 . ASP F 3 151 ? 52.250  -90.127  -58.319 1.00 31.07  ? 150 ASP Y OD2 1 
ATOM   8905  N  N   . ASN F 3 152 ? 47.129  -92.935  -57.011 1.00 30.32  ? 151 ASN Y N   1 
ATOM   8906  C  CA  . ASN F 3 152 ? 46.304  -94.134  -56.759 1.00 30.12  ? 151 ASN Y CA  1 
ATOM   8907  C  C   . ASN F 3 152 ? 46.849  -95.139  -55.724 1.00 29.44  ? 151 ASN Y C   1 
ATOM   8908  O  O   . ASN F 3 152 ? 46.244  -96.191  -55.511 1.00 28.67  ? 151 ASN Y O   1 
ATOM   8909  C  CB  . ASN F 3 152 ? 45.938  -94.839  -58.077 1.00 30.65  ? 151 ASN Y CB  1 
ATOM   8910  C  CG  . ASN F 3 152 ? 44.915  -94.061  -58.882 1.00 30.71  ? 151 ASN Y CG  1 
ATOM   8911  O  OD1 . ASN F 3 152 ? 43.751  -93.971  -58.496 1.00 31.07  ? 151 ASN Y OD1 1 
ATOM   8912  N  ND2 . ASN F 3 152 ? 45.344  -93.496  -60.005 1.00 30.56  ? 151 ASN Y ND2 1 
ATOM   8913  N  N   . ALA F 3 153 ? 47.961  -94.806  -55.068 1.00 28.99  ? 152 ALA Y N   1 
ATOM   8914  C  CA  . ALA F 3 153 ? 48.476  -95.606  -53.953 1.00 28.64  ? 152 ALA Y CA  1 
ATOM   8915  C  C   . ALA F 3 153 ? 47.801  -95.185  -52.638 1.00 28.79  ? 152 ALA Y C   1 
ATOM   8916  O  O   . ALA F 3 153 ? 47.896  -94.029  -52.225 1.00 28.53  ? 152 ALA Y O   1 
ATOM   8917  C  CB  . ALA F 3 153 ? 49.986  -95.458  -53.846 1.00 28.02  ? 152 ALA Y CB  1 
ATOM   8918  N  N   . LEU F 3 154 ? 47.131  -96.140  -51.992 1.00 28.96  ? 153 LEU Y N   1 
ATOM   8919  C  CA  . LEU F 3 154 ? 46.400  -95.908  -50.738 1.00 29.12  ? 153 LEU Y CA  1 
ATOM   8920  C  C   . LEU F 3 154 ? 47.368  -95.607  -49.594 1.00 28.86  ? 153 LEU Y C   1 
ATOM   8921  O  O   . LEU F 3 154 ? 48.344  -96.327  -49.401 1.00 28.34  ? 153 LEU Y O   1 
ATOM   8922  C  CB  . LEU F 3 154 ? 45.576  -97.154  -50.386 1.00 29.38  ? 153 LEU Y CB  1 
ATOM   8923  C  CG  . LEU F 3 154 ? 44.328  -97.038  -49.501 1.00 29.37  ? 153 LEU Y CG  1 
ATOM   8924  C  CD1 . LEU F 3 154 ? 44.002  -98.422  -48.935 1.00 29.32  ? 153 LEU Y CD1 1 
ATOM   8925  C  CD2 . LEU F 3 154 ? 44.462  -96.027  -48.373 1.00 29.23  ? 153 LEU Y CD2 1 
ATOM   8926  N  N   . GLN F 3 155 ? 47.085  -94.555  -48.830 1.00 29.18  ? 154 GLN Y N   1 
ATOM   8927  C  CA  . GLN F 3 155 ? 47.951  -94.153  -47.714 1.00 29.40  ? 154 GLN Y CA  1 
ATOM   8928  C  C   . GLN F 3 155 ? 47.560  -94.824  -46.397 1.00 28.86  ? 154 GLN Y C   1 
ATOM   8929  O  O   . GLN F 3 155 ? 46.419  -95.251  -46.216 1.00 29.37  ? 154 GLN Y O   1 
ATOM   8930  C  CB  . GLN F 3 155 ? 47.944  -92.630  -47.553 1.00 29.79  ? 154 GLN Y CB  1 
ATOM   8931  C  CG  . GLN F 3 155 ? 48.393  -91.873  -48.799 1.00 30.25  ? 154 GLN Y CG  1 
ATOM   8932  C  CD  . GLN F 3 155 ? 49.776  -92.282  -49.261 1.00 30.75  ? 154 GLN Y CD  1 
ATOM   8933  O  OE1 . GLN F 3 155 ? 50.772  -92.012  -48.589 1.00 31.16  ? 154 GLN Y OE1 1 
ATOM   8934  N  NE2 . GLN F 3 155 ? 49.846  -92.945  -50.412 1.00 31.05  ? 154 GLN Y NE2 1 
ATOM   8935  N  N   . SER F 3 156 ? 48.528  -94.913  -45.488 1.00 28.21  ? 155 SER Y N   1 
ATOM   8936  C  CA  . SER F 3 156 ? 48.347  -95.575  -44.198 1.00 28.23  ? 155 SER Y CA  1 
ATOM   8937  C  C   . SER F 3 156 ? 49.250  -94.950  -43.142 1.00 27.27  ? 155 SER Y C   1 
ATOM   8938  O  O   . SER F 3 156 ? 50.447  -94.782  -43.365 1.00 27.24  ? 155 SER Y O   1 
ATOM   8939  C  CB  . SER F 3 156 ? 48.674  -97.068  -44.311 1.00 29.17  ? 155 SER Y CB  1 
ATOM   8940  O  OG  . SER F 3 156 ? 47.651  -97.773  -44.989 1.00 30.03  ? 155 SER Y OG  1 
ATOM   8941  N  N   . GLY F 3 157 ? 48.672  -94.606  -41.996 1.00 26.41  ? 156 GLY Y N   1 
ATOM   8942  C  CA  . GLY F 3 157 ? 49.444  -94.135  -40.850 1.00 26.11  ? 156 GLY Y CA  1 
ATOM   8943  C  C   . GLY F 3 157 ? 50.143  -92.793  -40.992 1.00 25.81  ? 156 GLY Y C   1 
ATOM   8944  O  O   . GLY F 3 157 ? 51.016  -92.470  -40.181 1.00 26.55  ? 156 GLY Y O   1 
ATOM   8945  N  N   . ASN F 3 158 ? 49.776  -92.017  -42.013 1.00 25.27  ? 157 ASN Y N   1 
ATOM   8946  C  CA  . ASN F 3 158 ? 50.299  -90.658  -42.197 1.00 25.49  ? 157 ASN Y CA  1 
ATOM   8947  C  C   . ASN F 3 158 ? 49.190  -89.619  -42.422 1.00 25.68  ? 157 ASN Y C   1 
ATOM   8948  O  O   . ASN F 3 158 ? 49.444  -88.511  -42.900 1.00 24.53  ? 157 ASN Y O   1 
ATOM   8949  C  CB  . ASN F 3 158 ? 51.329  -90.626  -43.338 1.00 25.73  ? 157 ASN Y CB  1 
ATOM   8950  C  CG  . ASN F 3 158 ? 50.760  -91.103  -44.666 1.00 25.55  ? 157 ASN Y CG  1 
ATOM   8951  O  OD1 . ASN F 3 158 ? 49.622  -91.566  -44.745 1.00 25.23  ? 157 ASN Y OD1 1 
ATOM   8952  N  ND2 . ASN F 3 158 ? 51.560  -90.992  -45.720 1.00 25.29  ? 157 ASN Y ND2 1 
ATOM   8953  N  N   . SER F 3 159 ? 47.960  -89.989  -42.070 1.00 26.68  ? 158 SER Y N   1 
ATOM   8954  C  CA  . SER F 3 159 ? 46.850  -89.055  -42.051 1.00 26.74  ? 158 SER Y CA  1 
ATOM   8955  C  C   . SER F 3 159 ? 46.384  -88.895  -40.608 1.00 26.97  ? 158 SER Y C   1 
ATOM   8956  O  O   . SER F 3 159 ? 46.802  -89.648  -39.731 1.00 27.35  ? 158 SER Y O   1 
ATOM   8957  C  CB  . SER F 3 159 ? 45.715  -89.537  -42.957 1.00 27.15  ? 158 SER Y CB  1 
ATOM   8958  O  OG  . SER F 3 159 ? 45.073  -90.689  -42.444 1.00 27.75  ? 158 SER Y OG  1 
ATOM   8959  N  N   . GLN F 3 160 ? 45.531  -87.905  -40.369 1.00 27.14  ? 159 GLN Y N   1 
ATOM   8960  C  CA  . GLN F 3 160 ? 45.032  -87.606  -39.030 1.00 26.32  ? 159 GLN Y CA  1 
ATOM   8961  C  C   . GLN F 3 160 ? 43.735  -86.821  -39.171 1.00 25.72  ? 159 GLN Y C   1 
ATOM   8962  O  O   . GLN F 3 160 ? 43.679  -85.829  -39.909 1.00 24.36  ? 159 GLN Y O   1 
ATOM   8963  C  CB  . GLN F 3 160 ? 46.069  -86.787  -38.260 1.00 27.63  ? 159 GLN Y CB  1 
ATOM   8964  C  CG  . GLN F 3 160 ? 46.035  -86.953  -36.743 1.00 28.69  ? 159 GLN Y CG  1 
ATOM   8965  C  CD  . GLN F 3 160 ? 47.399  -86.705  -36.090 1.00 29.93  ? 159 GLN Y CD  1 
ATOM   8966  O  OE1 . GLN F 3 160 ? 48.232  -85.951  -36.608 1.00 29.93  ? 159 GLN Y OE1 1 
ATOM   8967  N  NE2 . GLN F 3 160 ? 47.626  -87.340  -34.943 1.00 30.87  ? 159 GLN Y NE2 1 
ATOM   8968  N  N   . GLU F 3 161 ? 42.692  -87.277  -38.480 1.00 25.18  ? 160 GLU Y N   1 
ATOM   8969  C  CA  . GLU F 3 161 ? 41.370  -86.664  -38.571 1.00 23.71  ? 160 GLU Y CA  1 
ATOM   8970  C  C   . GLU F 3 161 ? 41.045  -85.846  -37.336 1.00 22.38  ? 160 GLU Y C   1 
ATOM   8971  O  O   . GLU F 3 161 ? 41.400  -86.224  -36.225 1.00 22.64  ? 160 GLU Y O   1 
ATOM   8972  C  CB  . GLU F 3 161 ? 40.294  -87.731  -38.761 1.00 24.35  ? 160 GLU Y CB  1 
ATOM   8973  C  CG  . GLU F 3 161 ? 40.454  -88.554  -40.031 1.00 25.62  ? 160 GLU Y CG  1 
ATOM   8974  C  CD  . GLU F 3 161 ? 39.240  -89.425  -40.348 1.00 26.74  ? 160 GLU Y CD  1 
ATOM   8975  O  OE1 . GLU F 3 161 ? 38.237  -89.396  -39.595 1.00 27.14  ? 160 GLU Y OE1 1 
ATOM   8976  O  OE2 . GLU F 3 161 ? 39.294  -90.149  -41.366 1.00 28.04  ? 160 GLU Y OE2 1 
ATOM   8977  N  N   . SER F 3 162 ? 40.370  -84.718  -37.535 1.00 20.86  ? 161 SER Y N   1 
ATOM   8978  C  CA  . SER F 3 162 ? 39.778  -83.980  -36.429 1.00 19.31  ? 161 SER Y CA  1 
ATOM   8979  C  C   . SER F 3 162 ? 38.351  -83.605  -36.783 1.00 17.86  ? 161 SER Y C   1 
ATOM   8980  O  O   . SER F 3 162 ? 38.070  -83.241  -37.932 1.00 16.94  ? 161 SER Y O   1 
ATOM   8981  C  CB  . SER F 3 162 ? 40.593  -82.733  -36.117 1.00 20.45  ? 161 SER Y CB  1 
ATOM   8982  O  OG  . SER F 3 162 ? 40.157  -82.152  -34.896 1.00 22.56  ? 161 SER Y OG  1 
ATOM   8983  N  N   . VAL F 3 163 ? 37.456  -83.691  -35.801 1.00 17.07  ? 162 VAL Y N   1 
ATOM   8984  C  CA  . VAL F 3 163 ? 36.022  -83.445  -36.019 1.00 17.38  ? 162 VAL Y CA  1 
ATOM   8985  C  C   . VAL F 3 163 ? 35.509  -82.367  -35.079 1.00 16.15  ? 162 VAL Y C   1 
ATOM   8986  O  O   . VAL F 3 163 ? 35.823  -82.378  -33.903 1.00 14.71  ? 162 VAL Y O   1 
ATOM   8987  C  CB  . VAL F 3 163 ? 35.167  -84.713  -35.777 1.00 18.11  ? 162 VAL Y CB  1 
ATOM   8988  C  CG1 . VAL F 3 163 ? 33.773  -84.529  -36.362 1.00 19.22  ? 162 VAL Y CG1 1 
ATOM   8989  C  CG2 . VAL F 3 163 ? 35.813  -85.929  -36.386 1.00 18.33  ? 162 VAL Y CG2 1 
ATOM   8990  N  N   . THR F 3 164 ? 34.708  -81.445  -35.601 1.00 17.54  ? 163 THR Y N   1 
ATOM   8991  C  CA  . THR F 3 164 ? 34.078  -80.425  -34.770 1.00 19.14  ? 163 THR Y CA  1 
ATOM   8992  C  C   . THR F 3 164 ? 33.016  -81.063  -33.885 1.00 20.70  ? 163 THR Y C   1 
ATOM   8993  O  O   . THR F 3 164 ? 32.530  -82.157  -34.173 1.00 21.19  ? 163 THR Y O   1 
ATOM   8994  C  CB  . THR F 3 164 ? 33.374  -79.364  -35.608 1.00 18.18  ? 163 THR Y CB  1 
ATOM   8995  O  OG1 . THR F 3 164 ? 32.412  -80.002  -36.455 1.00 19.84  ? 163 THR Y OG1 1 
ATOM   8996  C  CG2 . THR F 3 164 ? 34.376  -78.584  -36.450 1.00 17.42  ? 163 THR Y CG2 1 
ATOM   8997  N  N   . GLU F 3 165 ? 32.649  -80.387  -32.805 1.00 21.38  ? 164 GLU Y N   1 
ATOM   8998  C  CA  . GLU F 3 165 ? 31.464  -80.803  -32.091 1.00 22.97  ? 164 GLU Y CA  1 
ATOM   8999  C  C   . GLU F 3 165 ? 30.223  -80.318  -32.838 1.00 22.52  ? 164 GLU Y C   1 
ATOM   9000  O  O   . GLU F 3 165 ? 30.273  -79.406  -33.667 1.00 22.20  ? 164 GLU Y O   1 
ATOM   9001  C  CB  . GLU F 3 165 ? 31.485  -80.360  -30.628 1.00 25.43  ? 164 GLU Y CB  1 
ATOM   9002  C  CG  . GLU F 3 165 ? 31.171  -78.898  -30.352 1.00 26.97  ? 164 GLU Y CG  1 
ATOM   9003  C  CD  . GLU F 3 165 ? 30.915  -78.654  -28.876 1.00 27.67  ? 164 GLU Y CD  1 
ATOM   9004  O  OE1 . GLU F 3 165 ? 31.341  -79.496  -28.055 1.00 28.13  ? 164 GLU Y OE1 1 
ATOM   9005  O  OE2 . GLU F 3 165 ? 30.275  -77.634  -28.541 1.00 28.00  ? 164 GLU Y OE2 1 
ATOM   9006  N  N   . GLN F 3 166 ? 29.109  -80.965  -32.545 1.00 21.71  ? 165 GLN Y N   1 
ATOM   9007  C  CA  . GLN F 3 166 ? 27.860  -80.746  -33.268 1.00 19.31  ? 165 GLN Y CA  1 
ATOM   9008  C  C   . GLN F 3 166 ? 27.508  -79.244  -33.346 1.00 19.02  ? 165 GLN Y C   1 
ATOM   9009  O  O   . GLN F 3 166 ? 27.579  -78.529  -32.356 1.00 19.05  ? 165 GLN Y O   1 
ATOM   9010  C  CB  . GLN F 3 166 ? 26.756  -81.567  -32.581 1.00 18.33  ? 165 GLN Y CB  1 
ATOM   9011  C  CG  . GLN F 3 166 ? 25.696  -82.068  -33.493 1.00 19.21  ? 165 GLN Y CG  1 
ATOM   9012  C  CD  . GLN F 3 166 ? 24.820  -83.151  -32.884 1.00 19.52  ? 165 GLN Y CD  1 
ATOM   9013  O  OE1 . GLN F 3 166 ? 24.925  -83.489  -31.696 1.00 18.83  ? 165 GLN Y OE1 1 
ATOM   9014  N  NE2 . GLN F 3 166 ? 23.929  -83.697  -33.708 1.00 18.75  ? 165 GLN Y NE2 1 
ATOM   9015  N  N   . ASP F 3 167 ? 27.158  -78.766  -34.534 1.00 21.28  ? 166 ASP Y N   1 
ATOM   9016  C  CA  . ASP F 3 167 ? 26.806  -77.356  -34.736 1.00 22.33  ? 166 ASP Y CA  1 
ATOM   9017  C  C   . ASP F 3 167 ? 25.544  -76.995  -33.955 1.00 22.81  ? 166 ASP Y C   1 
ATOM   9018  O  O   . ASP F 3 167 ? 24.550  -77.715  -34.002 1.00 21.82  ? 166 ASP Y O   1 
ATOM   9019  C  CB  . ASP F 3 167 ? 26.575  -77.098  -36.218 1.00 24.12  ? 166 ASP Y CB  1 
ATOM   9020  C  CG  . ASP F 3 167 ? 26.390  -75.627  -36.546 1.00 25.41  ? 166 ASP Y CG  1 
ATOM   9021  O  OD1 . ASP F 3 167 ? 25.425  -74.998  -36.069 1.00 26.35  ? 166 ASP Y OD1 1 
ATOM   9022  O  OD2 . ASP F 3 167 ? 27.209  -75.105  -37.325 1.00 28.09  ? 166 ASP Y OD2 1 
ATOM   9023  N  N   . SER F 3 168 ? 25.573  -75.863  -33.260 1.00 23.43  ? 167 SER Y N   1 
ATOM   9024  C  CA  . SER F 3 168 ? 24.490  -75.518  -32.344 1.00 24.30  ? 167 SER Y CA  1 
ATOM   9025  C  C   . SER F 3 168 ? 23.186  -75.100  -33.041 1.00 24.33  ? 167 SER Y C   1 
ATOM   9026  O  O   . SER F 3 168 ? 22.139  -75.075  -32.397 1.00 24.93  ? 167 SER Y O   1 
ATOM   9027  C  CB  . SER F 3 168 ? 24.937  -74.421  -31.380 1.00 25.15  ? 167 SER Y CB  1 
ATOM   9028  O  OG  . SER F 3 168 ? 24.858  -73.149  -31.993 1.00 26.85  ? 167 SER Y OG  1 
ATOM   9029  N  N   . LYS F 3 169 ? 23.246  -74.774  -34.334 1.00 23.91  ? 168 LYS Y N   1 
ATOM   9030  C  CA  . LYS F 3 169 ? 22.049  -74.402  -35.090 1.00 24.67  ? 168 LYS Y CA  1 
ATOM   9031  C  C   . LYS F 3 169 ? 21.457  -75.567  -35.890 1.00 23.98  ? 168 LYS Y C   1 
ATOM   9032  O  O   . LYS F 3 169 ? 20.244  -75.795  -35.841 1.00 21.67  ? 168 LYS Y O   1 
ATOM   9033  C  CB  . LYS F 3 169 ? 22.329  -73.226  -36.040 1.00 26.33  ? 168 LYS Y CB  1 
ATOM   9034  C  CG  . LYS F 3 169 ? 22.255  -71.826  -35.395 1.00 27.66  ? 168 LYS Y CG  1 
ATOM   9035  C  CD  . LYS F 3 169 ? 23.648  -71.272  -35.059 1.00 28.83  ? 168 LYS Y CD  1 
ATOM   9036  C  CE  . LYS F 3 169 ? 23.621  -69.769  -34.768 1.00 29.16  ? 168 LYS Y CE  1 
ATOM   9037  N  NZ  . LYS F 3 169 ? 24.998  -69.179  -34.814 1.00 28.94  ? 168 LYS Y NZ  1 
ATOM   9038  N  N   . ASP F 3 170 ? 22.301  -76.287  -36.634 1.00 23.46  ? 169 ASP Y N   1 
ATOM   9039  C  CA  . ASP F 3 170 ? 21.812  -77.309  -37.578 1.00 23.26  ? 169 ASP Y CA  1 
ATOM   9040  C  C   . ASP F 3 170 ? 22.242  -78.739  -37.228 1.00 21.67  ? 169 ASP Y C   1 
ATOM   9041  O  O   . ASP F 3 170 ? 21.951  -79.676  -37.975 1.00 20.43  ? 169 ASP Y O   1 
ATOM   9042  C  CB  . ASP F 3 170 ? 22.252  -76.960  -39.010 1.00 24.58  ? 169 ASP Y CB  1 
ATOM   9043  C  CG  . ASP F 3 170 ? 23.747  -77.099  -39.212 1.00 26.06  ? 169 ASP Y CG  1 
ATOM   9044  O  OD1 . ASP F 3 170 ? 24.404  -77.738  -38.370 1.00 27.92  ? 169 ASP Y OD1 1 
ATOM   9045  O  OD2 . ASP F 3 170 ? 24.272  -76.571  -40.210 1.00 28.02  ? 169 ASP Y OD2 1 
ATOM   9046  N  N   . SER F 3 171 ? 22.954  -78.891  -36.112 1.00 20.08  ? 170 SER Y N   1 
ATOM   9047  C  CA  . SER F 3 171 ? 23.350  -80.199  -35.573 1.00 18.76  ? 170 SER Y CA  1 
ATOM   9048  C  C   . SER F 3 171 ? 24.291  -81.025  -36.472 1.00 17.78  ? 170 SER Y C   1 
ATOM   9049  O  O   . SER F 3 171 ? 24.441  -82.230  -36.268 1.00 17.73  ? 170 SER Y O   1 
ATOM   9050  C  CB  . SER F 3 171 ? 22.110  -81.034  -35.210 1.00 17.33  ? 170 SER Y CB  1 
ATOM   9051  O  OG  . SER F 3 171 ? 21.214  -80.296  -34.422 1.00 17.70  ? 170 SER Y OG  1 
ATOM   9052  N  N   . THR F 3 172 ? 24.937  -80.384  -37.442 1.00 16.53  ? 171 THR Y N   1 
ATOM   9053  C  CA  . THR F 3 172 ? 25.860  -81.086  -38.332 1.00 16.85  ? 171 THR Y CA  1 
ATOM   9054  C  C   . THR F 3 172 ? 27.254  -81.149  -37.716 1.00 17.00  ? 171 THR Y C   1 
ATOM   9055  O  O   . THR F 3 172 ? 27.536  -80.469  -36.725 1.00 15.26  ? 171 THR Y O   1 
ATOM   9056  C  CB  . THR F 3 172 ? 25.954  -80.411  -39.720 1.00 17.14  ? 171 THR Y CB  1 
ATOM   9057  O  OG1 . THR F 3 172 ? 26.389  -79.057  -39.569 1.00 19.13  ? 171 THR Y OG1 1 
ATOM   9058  C  CG2 . THR F 3 172 ? 24.606  -80.416  -40.429 1.00 16.02  ? 171 THR Y CG2 1 
ATOM   9059  N  N   . TYR F 3 173 ? 28.105  -81.987  -38.306 1.00 16.91  ? 172 TYR Y N   1 
ATOM   9060  C  CA  . TYR F 3 173 ? 29.521  -82.049  -37.983 1.00 17.80  ? 172 TYR Y CA  1 
ATOM   9061  C  C   . TYR F 3 173 ? 30.349  -81.586  -39.180 1.00 19.22  ? 172 TYR Y C   1 
ATOM   9062  O  O   . TYR F 3 173 ? 29.874  -81.566  -40.327 1.00 18.83  ? 172 TYR Y O   1 
ATOM   9063  C  CB  . TYR F 3 173 ? 29.946  -83.479  -37.634 1.00 18.01  ? 172 TYR Y CB  1 
ATOM   9064  C  CG  . TYR F 3 173 ? 29.200  -84.105  -36.489 1.00 18.33  ? 172 TYR Y CG  1 
ATOM   9065  C  CD1 . TYR F 3 173 ? 29.597  -83.899  -35.178 1.00 18.38  ? 172 TYR Y CD1 1 
ATOM   9066  C  CD2 . TYR F 3 173 ? 28.092  -84.919  -36.724 1.00 20.01  ? 172 TYR Y CD2 1 
ATOM   9067  C  CE1 . TYR F 3 173 ? 28.904  -84.481  -34.115 1.00 18.89  ? 172 TYR Y CE1 1 
ATOM   9068  C  CE2 . TYR F 3 173 ? 27.394  -85.503  -35.676 1.00 19.61  ? 172 TYR Y CE2 1 
ATOM   9069  C  CZ  . TYR F 3 173 ? 27.803  -85.280  -34.373 1.00 19.16  ? 172 TYR Y CZ  1 
ATOM   9070  O  OH  . TYR F 3 173 ? 27.101  -85.867  -33.343 1.00 19.70  ? 172 TYR Y OH  1 
ATOM   9071  N  N   . SER F 3 174 ? 31.598  -81.225  -38.901 1.00 20.26  ? 173 SER Y N   1 
ATOM   9072  C  CA  . SER F 3 174 ? 32.607  -81.053  -39.943 1.00 20.61  ? 173 SER Y CA  1 
ATOM   9073  C  C   . SER F 3 174 ? 33.836  -81.869  -39.567 1.00 20.67  ? 173 SER Y C   1 
ATOM   9074  O  O   . SER F 3 174 ? 34.036  -82.212  -38.411 1.00 21.19  ? 173 SER Y O   1 
ATOM   9075  C  CB  . SER F 3 174 ? 32.961  -79.574  -40.144 1.00 20.66  ? 173 SER Y CB  1 
ATOM   9076  O  OG  . SER F 3 174 ? 31.880  -78.856  -40.738 1.00 19.59  ? 173 SER Y OG  1 
ATOM   9077  N  N   . LEU F 3 175 ? 34.656  -82.181  -40.557 1.00 20.79  ? 174 LEU Y N   1 
ATOM   9078  C  CA  . LEU F 3 175 ? 35.815  -83.036  -40.354 1.00 20.17  ? 174 LEU Y CA  1 
ATOM   9079  C  C   . LEU F 3 175 ? 36.965  -82.594  -41.252 1.00 20.26  ? 174 LEU Y C   1 
ATOM   9080  O  O   . LEU F 3 175 ? 36.756  -82.253  -42.421 1.00 20.51  ? 174 LEU Y O   1 
ATOM   9081  C  CB  . LEU F 3 175 ? 35.433  -84.491  -40.647 1.00 20.09  ? 174 LEU Y CB  1 
ATOM   9082  C  CG  . LEU F 3 175 ? 36.516  -85.579  -40.618 1.00 20.16  ? 174 LEU Y CG  1 
ATOM   9083  C  CD1 . LEU F 3 175 ? 35.855  -86.951  -40.479 1.00 18.82  ? 174 LEU Y CD1 1 
ATOM   9084  C  CD2 . LEU F 3 175 ? 37.409  -85.519  -41.868 1.00 19.44  ? 174 LEU Y CD2 1 
ATOM   9085  N  N   . SER F 3 176 ? 38.170  -82.590  -40.688 1.00 20.30  ? 175 SER Y N   1 
ATOM   9086  C  CA  . SER F 3 176 ? 39.387  -82.376  -41.455 1.00 20.22  ? 175 SER Y CA  1 
ATOM   9087  C  C   . SER F 3 176 ? 40.193  -83.654  -41.424 1.00 20.61  ? 175 SER Y C   1 
ATOM   9088  O  O   . SER F 3 176 ? 40.261  -84.321  -40.393 1.00 20.73  ? 175 SER Y O   1 
ATOM   9089  C  CB  . SER F 3 176 ? 40.215  -81.232  -40.874 1.00 20.25  ? 175 SER Y CB  1 
ATOM   9090  O  OG  . SER F 3 176 ? 40.723  -81.561  -39.589 1.00 20.66  ? 175 SER Y OG  1 
ATOM   9091  N  N   . SER F 3 177 ? 40.770  -84.013  -42.567 1.00 22.09  ? 176 SER Y N   1 
ATOM   9092  C  CA  . SER F 3 177 ? 41.756  -85.083  -42.630 1.00 21.80  ? 176 SER Y CA  1 
ATOM   9093  C  C   . SER F 3 177 ? 43.027  -84.469  -43.180 1.00 21.13  ? 176 SER Y C   1 
ATOM   9094  O  O   . SER F 3 177 ? 43.047  -83.960  -44.295 1.00 21.12  ? 176 SER Y O   1 
ATOM   9095  C  CB  . SER F 3 177 ? 41.284  -86.243  -43.512 1.00 21.72  ? 176 SER Y CB  1 
ATOM   9096  O  OG  . SER F 3 177 ? 42.189  -87.345  -43.427 1.00 20.68  ? 176 SER Y OG  1 
ATOM   9097  N  N   . THR F 3 178 ? 44.083  -84.491  -42.380 1.00 20.76  ? 177 THR Y N   1 
ATOM   9098  C  CA  . THR F 3 178 ? 45.350  -83.908  -42.792 1.00 19.49  ? 177 THR Y CA  1 
ATOM   9099  C  C   . THR F 3 178 ? 46.345  -85.017  -43.116 1.00 18.04  ? 177 THR Y C   1 
ATOM   9100  O  O   . THR F 3 178 ? 46.606  -85.878  -42.283 1.00 16.50  ? 177 THR Y O   1 
ATOM   9101  C  CB  . THR F 3 178 ? 45.903  -82.972  -41.705 1.00 19.90  ? 177 THR Y CB  1 
ATOM   9102  O  OG1 . THR F 3 178 ? 44.880  -82.026  -41.328 1.00 19.38  ? 177 THR Y OG1 1 
ATOM   9103  C  CG2 . THR F 3 178 ? 47.145  -82.240  -42.219 1.00 19.21  ? 177 THR Y CG2 1 
ATOM   9104  N  N   . LEU F 3 179 ? 46.855  -85.006  -44.345 1.00 17.08  ? 178 LEU Y N   1 
ATOM   9105  C  CA  . LEU F 3 179 ? 47.910  -85.919  -44.759 1.00 17.94  ? 178 LEU Y CA  1 
ATOM   9106  C  C   . LEU F 3 179 ? 49.241  -85.191  -44.629 1.00 18.06  ? 178 LEU Y C   1 
ATOM   9107  O  O   . LEU F 3 179 ? 49.431  -84.133  -45.225 1.00 17.34  ? 178 LEU Y O   1 
ATOM   9108  C  CB  . LEU F 3 179 ? 47.685  -86.373  -46.204 1.00 18.07  ? 178 LEU Y CB  1 
ATOM   9109  C  CG  . LEU F 3 179 ? 48.706  -87.306  -46.853 1.00 17.56  ? 178 LEU Y CG  1 
ATOM   9110  C  CD1 . LEU F 3 179 ? 48.833  -88.608  -46.087 1.00 18.00  ? 178 LEU Y CD1 1 
ATOM   9111  C  CD2 . LEU F 3 179 ? 48.296  -87.571  -48.289 1.00 17.32  ? 178 LEU Y CD2 1 
ATOM   9112  N  N   . THR F 3 180 ? 50.153  -85.757  -43.843 1.00 18.43  ? 179 THR Y N   1 
ATOM   9113  C  CA  . THR F 3 180 ? 51.450  -85.142  -43.594 1.00 19.62  ? 179 THR Y CA  1 
ATOM   9114  C  C   . THR F 3 180 ? 52.562  -85.945  -44.280 1.00 19.84  ? 179 THR Y C   1 
ATOM   9115  O  O   . THR F 3 180 ? 52.738  -87.129  -43.998 1.00 19.89  ? 179 THR Y O   1 
ATOM   9116  C  CB  . THR F 3 180 ? 51.716  -85.046  -42.077 1.00 20.05  ? 179 THR Y CB  1 
ATOM   9117  O  OG1 . THR F 3 180 ? 50.581  -84.443  -41.434 1.00 21.12  ? 179 THR Y OG1 1 
ATOM   9118  C  CG2 . THR F 3 180 ? 52.963  -84.219  -41.790 1.00 19.67  ? 179 THR Y CG2 1 
ATOM   9119  N  N   . LEU F 3 181 ? 53.293  -85.296  -45.187 1.00 20.41  ? 180 LEU Y N   1 
ATOM   9120  C  CA  . LEU F 3 181 ? 54.422  -85.919  -45.901 1.00 20.74  ? 180 LEU Y CA  1 
ATOM   9121  C  C   . LEU F 3 181 ? 55.618  -84.980  -45.931 1.00 20.32  ? 180 LEU Y C   1 
ATOM   9122  O  O   . LEU F 3 181 ? 55.461  -83.761  -45.897 1.00 21.17  ? 180 LEU Y O   1 
ATOM   9123  C  CB  . LEU F 3 181 ? 54.044  -86.249  -47.347 1.00 21.43  ? 180 LEU Y CB  1 
ATOM   9124  C  CG  . LEU F 3 181 ? 52.726  -86.990  -47.569 1.00 22.34  ? 180 LEU Y CG  1 
ATOM   9125  C  CD1 . LEU F 3 181 ? 52.363  -86.999  -49.050 1.00 22.21  ? 180 LEU Y CD1 1 
ATOM   9126  C  CD2 . LEU F 3 181 ? 52.815  -88.403  -47.004 1.00 22.47  ? 180 LEU Y CD2 1 
ATOM   9127  N  N   . SER F 3 182 ? 56.814  -85.547  -46.023 1.00 19.96  ? 181 SER Y N   1 
ATOM   9128  C  CA  . SER F 3 182 ? 58.018  -84.738  -46.141 1.00 19.55  ? 181 SER Y CA  1 
ATOM   9129  C  C   . SER F 3 182 ? 58.016  -84.005  -47.484 1.00 20.16  ? 181 SER Y C   1 
ATOM   9130  O  O   . SER F 3 182 ? 57.456  -84.490  -48.473 1.00 19.69  ? 181 SER Y O   1 
ATOM   9131  C  CB  . SER F 3 182 ? 59.281  -85.601  -45.991 1.00 18.76  ? 181 SER Y CB  1 
ATOM   9132  O  OG  . SER F 3 182 ? 59.486  -86.455  -47.106 1.00 17.44  ? 181 SER Y OG  1 
ATOM   9133  N  N   . LYS F 3 183 ? 58.617  -82.819  -47.491 1.00 21.14  ? 182 LYS Y N   1 
ATOM   9134  C  CA  . LYS F 3 183 ? 58.904  -82.064  -48.715 1.00 22.31  ? 182 LYS Y CA  1 
ATOM   9135  C  C   . LYS F 3 183 ? 59.353  -82.975  -49.865 1.00 22.54  ? 182 LYS Y C   1 
ATOM   9136  O  O   . LYS F 3 183 ? 58.853  -82.862  -50.987 1.00 21.85  ? 182 LYS Y O   1 
ATOM   9137  C  CB  . LYS F 3 183 ? 59.990  -81.025  -48.401 1.00 23.22  ? 182 LYS Y CB  1 
ATOM   9138  C  CG  . LYS F 3 183 ? 60.708  -80.379  -49.587 1.00 23.87  ? 182 LYS Y CG  1 
ATOM   9139  C  CD  . LYS F 3 183 ? 60.016  -79.114  -50.074 1.00 24.31  ? 182 LYS Y CD  1 
ATOM   9140  C  CE  . LYS F 3 183 ? 61.036  -78.147  -50.675 1.00 24.28  ? 182 LYS Y CE  1 
ATOM   9141  N  NZ  . LYS F 3 183 ? 61.889  -77.523  -49.622 1.00 23.79  ? 182 LYS Y NZ  1 
ATOM   9142  N  N   . ALA F 3 184 ? 60.299  -83.869  -49.574 1.00 23.16  ? 183 ALA Y N   1 
ATOM   9143  C  CA  . ALA F 3 184 ? 60.825  -84.800  -50.577 1.00 23.75  ? 183 ALA Y CA  1 
ATOM   9144  C  C   . ALA F 3 184 ? 59.726  -85.712  -51.122 1.00 23.96  ? 183 ALA Y C   1 
ATOM   9145  O  O   . ALA F 3 184 ? 59.541  -85.806  -52.336 1.00 24.49  ? 183 ALA Y O   1 
ATOM   9146  C  CB  . ALA F 3 184 ? 61.963  -85.634  -49.993 1.00 23.22  ? 183 ALA Y CB  1 
ATOM   9147  N  N   . ASP F 3 185 ? 58.993  -86.366  -50.223 1.00 23.41  ? 184 ASP Y N   1 
ATOM   9148  C  CA  . ASP F 3 185 ? 57.935  -87.298  -50.622 1.00 22.82  ? 184 ASP Y CA  1 
ATOM   9149  C  C   . ASP F 3 185 ? 56.834  -86.609  -51.412 1.00 22.11  ? 184 ASP Y C   1 
ATOM   9150  O  O   . ASP F 3 185 ? 56.236  -87.219  -52.297 1.00 22.52  ? 184 ASP Y O   1 
ATOM   9151  C  CB  . ASP F 3 185 ? 57.325  -88.004  -49.404 1.00 23.08  ? 184 ASP Y CB  1 
ATOM   9152  C  CG  . ASP F 3 185 ? 58.224  -89.098  -48.837 1.00 23.48  ? 184 ASP Y CG  1 
ATOM   9153  O  OD1 . ASP F 3 185 ? 59.157  -89.561  -49.534 1.00 24.05  ? 184 ASP Y OD1 1 
ATOM   9154  O  OD2 . ASP F 3 185 ? 57.984  -89.505  -47.681 1.00 23.78  ? 184 ASP Y OD2 1 
ATOM   9155  N  N   . TYR F 3 186 ? 56.569  -85.343  -51.094 1.00 21.27  ? 185 TYR Y N   1 
ATOM   9156  C  CA  . TYR F 3 186 ? 55.532  -84.585  -51.789 1.00 20.37  ? 185 TYR Y CA  1 
ATOM   9157  C  C   . TYR F 3 186 ? 55.909  -84.353  -53.262 1.00 20.03  ? 185 TYR Y C   1 
ATOM   9158  O  O   . TYR F 3 186 ? 55.085  -84.553  -54.154 1.00 18.90  ? 185 TYR Y O   1 
ATOM   9159  C  CB  . TYR F 3 186 ? 55.236  -83.260  -51.062 1.00 19.64  ? 185 TYR Y CB  1 
ATOM   9160  C  CG  . TYR F 3 186 ? 54.188  -82.404  -51.755 1.00 18.42  ? 185 TYR Y CG  1 
ATOM   9161  C  CD1 . TYR F 3 186 ? 52.858  -82.820  -51.841 1.00 17.05  ? 185 TYR Y CD1 1 
ATOM   9162  C  CD2 . TYR F 3 186 ? 54.535  -81.185  -52.338 1.00 17.62  ? 185 TYR Y CD2 1 
ATOM   9163  C  CE1 . TYR F 3 186 ? 51.904  -82.041  -52.491 1.00 16.62  ? 185 TYR Y CE1 1 
ATOM   9164  C  CE2 . TYR F 3 186 ? 53.591  -80.400  -52.981 1.00 17.11  ? 185 TYR Y CE2 1 
ATOM   9165  C  CZ  . TYR F 3 186 ? 52.281  -80.831  -53.060 1.00 16.57  ? 185 TYR Y CZ  1 
ATOM   9166  O  OH  . TYR F 3 186 ? 51.364  -80.041  -53.707 1.00 15.76  ? 185 TYR Y OH  1 
ATOM   9167  N  N   . GLU F 3 187 ? 57.161  -83.970  -53.508 1.00 20.69  ? 186 GLU Y N   1 
ATOM   9168  C  CA  . GLU F 3 187 ? 57.648  -83.714  -54.875 1.00 21.15  ? 186 GLU Y CA  1 
ATOM   9169  C  C   . GLU F 3 187 ? 57.831  -84.975  -55.731 1.00 20.35  ? 186 GLU Y C   1 
ATOM   9170  O  O   . GLU F 3 187 ? 57.970  -84.879  -56.950 1.00 19.97  ? 186 GLU Y O   1 
ATOM   9171  C  CB  . GLU F 3 187 ? 58.969  -82.946  -54.835 1.00 22.04  ? 186 GLU Y CB  1 
ATOM   9172  C  CG  . GLU F 3 187 ? 58.844  -81.530  -54.308 1.00 23.25  ? 186 GLU Y CG  1 
ATOM   9173  C  CD  . GLU F 3 187 ? 60.192  -80.891  -54.020 1.00 24.31  ? 186 GLU Y CD  1 
ATOM   9174  O  OE1 . GLU F 3 187 ? 61.207  -81.305  -54.627 1.00 24.99  ? 186 GLU Y OE1 1 
ATOM   9175  O  OE2 . GLU F 3 187 ? 60.234  -79.969  -53.179 1.00 25.50  ? 186 GLU Y OE2 1 
ATOM   9176  N  N   . LYS F 3 188 ? 57.841  -86.147  -55.098 1.00 19.94  ? 187 LYS Y N   1 
ATOM   9177  C  CA  . LYS F 3 188 ? 57.967  -87.414  -55.821 1.00 19.75  ? 187 LYS Y CA  1 
ATOM   9178  C  C   . LYS F 3 188 ? 56.692  -87.825  -56.569 1.00 19.51  ? 187 LYS Y C   1 
ATOM   9179  O  O   . LYS F 3 188 ? 56.747  -88.703  -57.430 1.00 19.96  ? 187 LYS Y O   1 
ATOM   9180  C  CB  . LYS F 3 188 ? 58.367  -88.541  -54.862 1.00 20.10  ? 187 LYS Y CB  1 
ATOM   9181  C  CG  . LYS F 3 188 ? 59.799  -88.452  -54.349 1.00 20.51  ? 187 LYS Y CG  1 
ATOM   9182  C  CD  . LYS F 3 188 ? 60.054  -89.466  -53.235 1.00 20.79  ? 187 LYS Y CD  1 
ATOM   9183  C  CE  . LYS F 3 188 ? 61.229  -89.067  -52.353 1.00 20.91  ? 187 LYS Y CE  1 
ATOM   9184  N  NZ  . LYS F 3 188 ? 62.526  -89.079  -53.085 1.00 20.41  ? 187 LYS Y NZ  1 
ATOM   9185  N  N   . HIS F 3 189 ? 55.554  -87.205  -56.247 1.00 18.46  ? 188 HIS Y N   1 
ATOM   9186  C  CA  . HIS F 3 189 ? 54.267  -87.615  -56.815 1.00 17.80  ? 188 HIS Y CA  1 
ATOM   9187  C  C   . HIS F 3 189 ? 53.431  -86.452  -57.351 1.00 16.39  ? 188 HIS Y C   1 
ATOM   9188  O  O   . HIS F 3 189 ? 53.599  -85.307  -56.931 1.00 15.95  ? 188 HIS Y O   1 
ATOM   9189  C  CB  . HIS F 3 189 ? 53.467  -88.389  -55.768 1.00 18.38  ? 188 HIS Y CB  1 
ATOM   9190  C  CG  . HIS F 3 189 ? 54.100  -89.685  -55.371 1.00 18.76  ? 188 HIS Y CG  1 
ATOM   9191  N  ND1 . HIS F 3 189 ? 54.457  -90.649  -56.290 1.00 18.72  ? 188 HIS Y ND1 1 
ATOM   9192  C  CD2 . HIS F 3 189 ? 54.437  -90.179  -54.157 1.00 18.84  ? 188 HIS Y CD2 1 
ATOM   9193  C  CE1 . HIS F 3 189 ? 54.990  -91.679  -55.659 1.00 18.97  ? 188 HIS Y CE1 1 
ATOM   9194  N  NE2 . HIS F 3 189 ? 54.988  -91.420  -54.363 1.00 19.15  ? 188 HIS Y NE2 1 
ATOM   9195  N  N   . LYS F 3 190 ? 52.522  -86.768  -58.273 1.00 14.66  ? 189 LYS Y N   1 
ATOM   9196  C  CA  . LYS F 3 190 ? 51.714  -85.760  -58.960 1.00 14.03  ? 189 LYS Y CA  1 
ATOM   9197  C  C   . LYS F 3 190 ? 50.299  -85.651  -58.378 1.00 13.44  ? 189 LYS Y C   1 
ATOM   9198  O  O   . LYS F 3 190 ? 49.906  -84.592  -57.894 1.00 13.45  ? 189 LYS Y O   1 
ATOM   9199  C  CB  . LYS F 3 190 ? 51.645  -86.078  -60.461 1.00 13.58  ? 189 LYS Y CB  1 
ATOM   9200  C  CG  . LYS F 3 190 ? 51.089  -84.944  -61.327 1.00 13.53  ? 189 LYS Y CG  1 
ATOM   9201  C  CD  . LYS F 3 190 ? 51.243  -85.225  -62.820 1.00 13.76  ? 189 LYS Y CD  1 
ATOM   9202  C  CE  . LYS F 3 190 ? 52.674  -84.968  -63.320 1.00 13.71  ? 189 LYS Y CE  1 
ATOM   9203  N  NZ  . LYS F 3 190 ? 52.880  -85.399  -64.736 1.00 13.36  ? 189 LYS Y NZ  1 
ATOM   9204  N  N   . VAL F 3 191 ? 49.554  -86.753  -58.421 1.00 12.83  ? 190 VAL Y N   1 
ATOM   9205  C  CA  . VAL F 3 191 ? 48.124  -86.743  -58.134 1.00 13.05  ? 190 VAL Y CA  1 
ATOM   9206  C  C   . VAL F 3 191 ? 47.836  -86.965  -56.653 1.00 13.92  ? 190 VAL Y C   1 
ATOM   9207  O  O   . VAL F 3 191 ? 48.185  -88.005  -56.099 1.00 14.46  ? 190 VAL Y O   1 
ATOM   9208  C  CB  . VAL F 3 191 ? 47.389  -87.831  -58.948 1.00 12.66  ? 190 VAL Y CB  1 
ATOM   9209  C  CG1 . VAL F 3 191 ? 45.908  -87.859  -58.593 1.00 12.61  ? 190 VAL Y CG1 1 
ATOM   9210  C  CG2 . VAL F 3 191 ? 47.575  -87.600  -60.445 1.00 12.54  ? 190 VAL Y CG2 1 
ATOM   9211  N  N   . TYR F 3 192 ? 47.191  -85.985  -56.023 1.00 14.40  ? 191 TYR Y N   1 
ATOM   9212  C  CA  . TYR F 3 192 ? 46.771  -86.102  -54.629 1.00 14.58  ? 191 TYR Y CA  1 
ATOM   9213  C  C   . TYR F 3 192 ? 45.256  -86.048  -54.552 1.00 14.57  ? 191 TYR Y C   1 
ATOM   9214  O  O   . TYR F 3 192 ? 44.638  -85.087  -55.010 1.00 14.46  ? 191 TYR Y O   1 
ATOM   9215  C  CB  . TYR F 3 192 ? 47.408  -85.006  -53.778 1.00 14.41  ? 191 TYR Y CB  1 
ATOM   9216  C  CG  . TYR F 3 192 ? 48.888  -85.218  -53.612 1.00 15.52  ? 191 TYR Y CG  1 
ATOM   9217  C  CD1 . TYR F 3 192 ? 49.399  -85.875  -52.496 1.00 16.12  ? 191 TYR Y CD1 1 
ATOM   9218  C  CD2 . TYR F 3 192 ? 49.781  -84.797  -54.595 1.00 15.49  ? 191 TYR Y CD2 1 
ATOM   9219  C  CE1 . TYR F 3 192 ? 50.771  -86.091  -52.356 1.00 16.17  ? 191 TYR Y CE1 1 
ATOM   9220  C  CE2 . TYR F 3 192 ? 51.141  -85.004  -54.463 1.00 15.74  ? 191 TYR Y CE2 1 
ATOM   9221  C  CZ  . TYR F 3 192 ? 51.632  -85.651  -53.345 1.00 16.10  ? 191 TYR Y CZ  1 
ATOM   9222  O  OH  . TYR F 3 192 ? 52.987  -85.854  -53.226 1.00 16.72  ? 191 TYR Y OH  1 
ATOM   9223  N  N   . ALA F 3 193 ? 44.670  -87.094  -53.975 1.00 15.17  ? 192 ALA Y N   1 
ATOM   9224  C  CA  . ALA F 3 193 ? 43.220  -87.248  -53.922 1.00 15.80  ? 192 ALA Y CA  1 
ATOM   9225  C  C   . ALA F 3 193 ? 42.759  -87.719  -52.543 1.00 15.57  ? 192 ALA Y C   1 
ATOM   9226  O  O   . ALA F 3 193 ? 43.414  -88.544  -51.907 1.00 12.69  ? 192 ALA Y O   1 
ATOM   9227  C  CB  . ALA F 3 193 ? 42.773  -88.244  -54.998 1.00 15.42  ? 192 ALA Y CB  1 
ATOM   9228  N  N   . CYS F 3 194 ? 41.637  -87.180  -52.078 1.00 18.19  ? 193 CYS Y N   1 
ATOM   9229  C  CA  . CYS F 3 194 ? 40.948  -87.750  -50.924 1.00 19.76  ? 193 CYS Y CA  1 
ATOM   9230  C  C   . CYS F 3 194 ? 39.550  -88.203  -51.349 1.00 17.55  ? 193 CYS Y C   1 
ATOM   9231  O  O   . CYS F 3 194 ? 38.833  -87.469  -52.018 1.00 16.02  ? 193 CYS Y O   1 
ATOM   9232  C  CB  . CYS F 3 194 ? 40.901  -86.769  -49.740 1.00 23.14  ? 193 CYS Y CB  1 
ATOM   9233  S  SG  . CYS F 3 194 ? 40.092  -85.197  -50.059 1.00 26.68  ? 193 CYS Y SG  1 
ATOM   9234  N  N   . GLU F 3 195 ? 39.196  -89.431  -50.973 1.00 16.84  ? 194 GLU Y N   1 
ATOM   9235  C  CA  . GLU F 3 195 ? 37.918  -90.039  -51.334 1.00 16.37  ? 194 GLU Y CA  1 
ATOM   9236  C  C   . GLU F 3 195 ? 37.017  -90.209  -50.104 1.00 15.93  ? 194 GLU Y C   1 
ATOM   9237  O  O   . GLU F 3 195 ? 37.363  -90.909  -49.143 1.00 14.64  ? 194 GLU Y O   1 
ATOM   9238  C  CB  . GLU F 3 195 ? 38.146  -91.397  -51.995 1.00 16.71  ? 194 GLU Y CB  1 
ATOM   9239  C  CG  . GLU F 3 195 ? 36.897  -91.966  -52.659 1.00 17.35  ? 194 GLU Y CG  1 
ATOM   9240  C  CD  . GLU F 3 195 ? 36.924  -93.470  -52.773 1.00 18.04  ? 194 GLU Y CD  1 
ATOM   9241  O  OE1 . GLU F 3 195 ? 37.108  -94.136  -51.731 1.00 19.19  ? 194 GLU Y OE1 1 
ATOM   9242  O  OE2 . GLU F 3 195 ? 36.747  -93.989  -53.897 1.00 18.08  ? 194 GLU Y OE2 1 
ATOM   9243  N  N   . VAL F 3 196 ? 35.842  -89.589  -50.162 1.00 15.61  ? 195 VAL Y N   1 
ATOM   9244  C  CA  . VAL F 3 196 ? 34.933  -89.541  -49.028 1.00 15.27  ? 195 VAL Y CA  1 
ATOM   9245  C  C   . VAL F 3 196 ? 33.763  -90.501  -49.213 1.00 14.93  ? 195 VAL Y C   1 
ATOM   9246  O  O   . VAL F 3 196 ? 33.096  -90.478  -50.246 1.00 15.67  ? 195 VAL Y O   1 
ATOM   9247  C  CB  . VAL F 3 196 ? 34.411  -88.116  -48.834 1.00 15.29  ? 195 VAL Y CB  1 
ATOM   9248  C  CG1 . VAL F 3 196 ? 33.324  -88.073  -47.754 1.00 15.44  ? 195 VAL Y CG1 1 
ATOM   9249  C  CG2 . VAL F 3 196 ? 35.581  -87.186  -48.490 1.00 15.46  ? 195 VAL Y CG2 1 
ATOM   9250  N  N   . THR F 3 197 ? 33.554  -91.363  -48.214 1.00 13.76  ? 196 THR Y N   1 
ATOM   9251  C  CA  . THR F 3 197 ? 32.394  -92.246  -48.153 1.00 12.65  ? 196 THR Y CA  1 
ATOM   9252  C  C   . THR F 3 197 ? 31.566  -91.853  -46.934 1.00 12.27  ? 196 THR Y C   1 
ATOM   9253  O  O   . THR F 3 197 ? 32.089  -91.758  -45.820 1.00 11.80  ? 196 THR Y O   1 
ATOM   9254  C  CB  . THR F 3 197 ? 32.788  -93.733  -48.041 1.00 12.70  ? 196 THR Y CB  1 
ATOM   9255  O  OG1 . THR F 3 197 ? 33.730  -94.068  -49.068 1.00 13.36  ? 196 THR Y OG1 1 
ATOM   9256  C  CG2 . THR F 3 197 ? 31.566  -94.624  -48.184 1.00 12.01  ? 196 THR Y CG2 1 
ATOM   9257  N  N   . HIS F 3 198 ? 30.279  -91.608  -47.164 1.00 11.48  ? 197 HIS Y N   1 
ATOM   9258  C  CA  . HIS F 3 198 ? 29.361  -91.200  -46.116 1.00 11.07  ? 197 HIS Y CA  1 
ATOM   9259  C  C   . HIS F 3 198 ? 27.946  -91.661  -46.463 1.00 12.33  ? 197 HIS Y C   1 
ATOM   9260  O  O   . HIS F 3 198 ? 27.543  -91.668  -47.628 1.00 12.44  ? 197 HIS Y O   1 
ATOM   9261  C  CB  . HIS F 3 198 ? 29.402  -89.675  -45.945 1.00 10.31  ? 197 HIS Y CB  1 
ATOM   9262  C  CG  . HIS F 3 198 ? 28.548  -89.167  -44.824 1.00 9.31   ? 197 HIS Y CG  1 
ATOM   9263  N  ND1 . HIS F 3 198 ? 27.242  -88.770  -45.008 1.00 8.53   ? 197 HIS Y ND1 1 
ATOM   9264  C  CD2 . HIS F 3 198 ? 28.814  -88.988  -43.506 1.00 9.32   ? 197 HIS Y CD2 1 
ATOM   9265  C  CE1 . HIS F 3 198 ? 26.739  -88.374  -43.852 1.00 9.08   ? 197 HIS Y CE1 1 
ATOM   9266  N  NE2 . HIS F 3 198 ? 27.671  -88.498  -42.923 1.00 8.16   ? 197 HIS Y NE2 1 
ATOM   9267  N  N   . GLN F 3 199 ? 27.189  -92.008  -45.431 1.00 13.23  ? 198 GLN Y N   1 
ATOM   9268  C  CA  . GLN F 3 199 ? 25.812  -92.470  -45.572 1.00 13.93  ? 198 GLN Y CA  1 
ATOM   9269  C  C   . GLN F 3 199 ? 24.946  -91.619  -46.510 1.00 13.19  ? 198 GLN Y C   1 
ATOM   9270  O  O   . GLN F 3 199 ? 24.101  -92.156  -47.214 1.00 15.05  ? 198 GLN Y O   1 
ATOM   9271  C  CB  . GLN F 3 199 ? 25.166  -92.523  -44.185 1.00 15.13  ? 198 GLN Y CB  1 
ATOM   9272  C  CG  . GLN F 3 199 ? 23.767  -93.085  -44.159 1.00 16.12  ? 198 GLN Y CG  1 
ATOM   9273  C  CD  . GLN F 3 199 ? 23.197  -93.114  -42.768 1.00 17.64  ? 198 GLN Y CD  1 
ATOM   9274  O  OE1 . GLN F 3 199 ? 23.914  -93.340  -41.794 1.00 18.61  ? 198 GLN Y OE1 1 
ATOM   9275  N  NE2 . GLN F 3 199 ? 21.893  -92.888  -42.661 1.00 18.96  ? 198 GLN Y NE2 1 
ATOM   9276  N  N   . GLY F 3 200 ? 25.151  -90.303  -46.507 1.00 11.68  ? 199 GLY Y N   1 
ATOM   9277  C  CA  . GLY F 3 200 ? 24.340  -89.375  -47.296 1.00 10.73  ? 199 GLY Y CA  1 
ATOM   9278  C  C   . GLY F 3 200 ? 24.755  -89.224  -48.751 1.00 10.84  ? 199 GLY Y C   1 
ATOM   9279  O  O   . GLY F 3 200 ? 24.150  -88.456  -49.494 1.00 10.82  ? 199 GLY Y O   1 
ATOM   9280  N  N   . LEU F 3 201 ? 25.790  -89.951  -49.159 1.00 11.21  ? 200 LEU Y N   1 
ATOM   9281  C  CA  . LEU F 3 201 ? 26.277  -89.910  -50.527 1.00 9.92   ? 200 LEU Y CA  1 
ATOM   9282  C  C   . LEU F 3 201 ? 25.991  -91.245  -51.183 1.00 9.98   ? 200 LEU Y C   1 
ATOM   9283  O  O   . LEU F 3 201 ? 26.289  -92.289  -50.606 1.00 10.74  ? 200 LEU Y O   1 
ATOM   9284  C  CB  . LEU F 3 201 ? 27.783  -89.648  -50.541 1.00 9.20   ? 200 LEU Y CB  1 
ATOM   9285  C  CG  . LEU F 3 201 ? 28.257  -88.248  -50.157 1.00 8.09   ? 200 LEU Y CG  1 
ATOM   9286  C  CD1 . LEU F 3 201 ? 29.790  -88.215  -50.074 1.00 6.98   ? 200 LEU Y CD1 1 
ATOM   9287  C  CD2 . LEU F 3 201 ? 27.735  -87.226  -51.153 1.00 6.90   ? 200 LEU Y CD2 1 
ATOM   9288  N  N   . SER F 3 202 ? 25.425  -91.215  -52.387 1.00 9.52   ? 201 SER Y N   1 
ATOM   9289  C  CA  . SER F 3 202 ? 25.064  -92.442  -53.090 1.00 9.74   ? 201 SER Y CA  1 
ATOM   9290  C  C   . SER F 3 202 ? 26.300  -93.132  -53.684 1.00 9.80   ? 201 SER Y C   1 
ATOM   9291  O  O   . SER F 3 202 ? 26.271  -94.325  -53.968 1.00 8.83   ? 201 SER Y O   1 
ATOM   9292  C  CB  . SER F 3 202 ? 24.008  -92.167  -54.171 1.00 10.25  ? 201 SER Y CB  1 
ATOM   9293  O  OG  . SER F 3 202 ? 24.554  -91.468  -55.272 1.00 11.27  ? 201 SER Y OG  1 
ATOM   9294  N  N   . SER F 3 203 ? 27.376  -92.374  -53.875 1.00 11.03  ? 202 SER Y N   1 
ATOM   9295  C  CA  . SER F 3 203 ? 28.685  -92.944  -54.189 1.00 12.38  ? 202 SER Y CA  1 
ATOM   9296  C  C   . SER F 3 203 ? 29.787  -92.027  -53.650 1.00 13.53  ? 202 SER Y C   1 
ATOM   9297  O  O   . SER F 3 203 ? 29.517  -90.868  -53.327 1.00 14.01  ? 202 SER Y O   1 
ATOM   9298  C  CB  . SER F 3 203 ? 28.842  -93.171  -55.698 1.00 12.27  ? 202 SER Y CB  1 
ATOM   9299  O  OG  . SER F 3 203 ? 28.622  -91.981  -56.424 1.00 12.28  ? 202 SER Y OG  1 
ATOM   9300  N  N   . PRO F 3 204 ? 31.029  -92.543  -53.537 1.00 14.94  ? 203 PRO Y N   1 
ATOM   9301  C  CA  . PRO F 3 204 ? 32.095  -91.740  -52.933 1.00 15.21  ? 203 PRO Y CA  1 
ATOM   9302  C  C   . PRO F 3 204 ? 32.489  -90.512  -53.752 1.00 15.01  ? 203 PRO Y C   1 
ATOM   9303  O  O   . PRO F 3 204 ? 32.516  -90.566  -54.975 1.00 15.70  ? 203 PRO Y O   1 
ATOM   9304  C  CB  . PRO F 3 204 ? 33.268  -92.721  -52.839 1.00 15.71  ? 203 PRO Y CB  1 
ATOM   9305  C  CG  . PRO F 3 204 ? 32.655  -94.071  -52.915 1.00 15.47  ? 203 PRO Y CG  1 
ATOM   9306  C  CD  . PRO F 3 204 ? 31.489  -93.912  -53.830 1.00 15.13  ? 203 PRO Y CD  1 
ATOM   9307  N  N   . VAL F 3 205 ? 32.757  -89.410  -53.058 1.00 14.95  ? 204 VAL Y N   1 
ATOM   9308  C  CA  . VAL F 3 205 ? 33.225  -88.180  -53.675 1.00 14.76  ? 204 VAL Y CA  1 
ATOM   9309  C  C   . VAL F 3 205 ? 34.740  -88.155  -53.602 1.00 15.21  ? 204 VAL Y C   1 
ATOM   9310  O  O   . VAL F 3 205 ? 35.318  -88.377  -52.537 1.00 15.05  ? 204 VAL Y O   1 
ATOM   9311  C  CB  . VAL F 3 205 ? 32.684  -86.932  -52.941 1.00 14.46  ? 204 VAL Y CB  1 
ATOM   9312  C  CG1 . VAL F 3 205 ? 33.342  -85.664  -53.476 1.00 13.67  ? 204 VAL Y CG1 1 
ATOM   9313  C  CG2 . VAL F 3 205 ? 31.172  -86.853  -53.074 1.00 13.93  ? 204 VAL Y CG2 1 
ATOM   9314  N  N   . THR F 3 206 ? 35.378  -87.899  -54.740 1.00 15.44  ? 205 THR Y N   1 
ATOM   9315  C  CA  . THR F 3 206 ? 36.815  -87.721  -54.788 1.00 14.98  ? 205 THR Y CA  1 
ATOM   9316  C  C   . THR F 3 206 ? 37.105  -86.283  -55.157 1.00 14.33  ? 205 THR Y C   1 
ATOM   9317  O  O   . THR F 3 206 ? 36.576  -85.775  -56.136 1.00 13.42  ? 205 THR Y O   1 
ATOM   9318  C  CB  . THR F 3 206 ? 37.461  -88.667  -55.797 1.00 15.45  ? 205 THR Y CB  1 
ATOM   9319  O  OG1 . THR F 3 206 ? 37.377  -90.003  -55.294 1.00 16.02  ? 205 THR Y OG1 1 
ATOM   9320  C  CG2 . THR F 3 206 ? 38.935  -88.308  -56.034 1.00 15.16  ? 205 THR Y CG2 1 
ATOM   9321  N  N   . LYS F 3 207 ? 37.909  -85.622  -54.332 1.00 14.15  ? 206 LYS Y N   1 
ATOM   9322  C  CA  . LYS F 3 207 ? 38.439  -84.314  -54.656 1.00 14.38  ? 206 LYS Y CA  1 
ATOM   9323  C  C   . LYS F 3 207 ? 39.939  -84.462  -54.784 1.00 14.13  ? 206 LYS Y C   1 
ATOM   9324  O  O   . LYS F 3 207 ? 40.574  -85.099  -53.946 1.00 14.34  ? 206 LYS Y O   1 
ATOM   9325  C  CB  . LYS F 3 207 ? 38.085  -83.295  -53.580 1.00 15.44  ? 206 LYS Y CB  1 
ATOM   9326  C  CG  . LYS F 3 207 ? 36.596  -82.988  -53.495 1.00 16.22  ? 206 LYS Y CG  1 
ATOM   9327  C  CD  . LYS F 3 207 ? 36.120  -82.153  -54.683 1.00 16.59  ? 206 LYS Y CD  1 
ATOM   9328  C  CE  . LYS F 3 207 ? 34.603  -82.067  -54.702 1.00 17.56  ? 206 LYS Y CE  1 
ATOM   9329  N  NZ  . LYS F 3 207 ? 34.108  -80.938  -55.531 1.00 17.80  ? 206 LYS Y NZ  1 
ATOM   9330  N  N   . SER F 3 208 ? 40.498  -83.883  -55.842 1.00 13.58  ? 207 SER Y N   1 
ATOM   9331  C  CA  . SER F 3 208 ? 41.899  -84.093  -56.174 1.00 13.97  ? 207 SER Y CA  1 
ATOM   9332  C  C   . SER F 3 208 ? 42.543  -82.880  -56.838 1.00 12.80  ? 207 SER Y C   1 
ATOM   9333  O  O   . SER F 3 208 ? 41.860  -82.003  -57.374 1.00 12.70  ? 207 SER Y O   1 
ATOM   9334  C  CB  . SER F 3 208 ? 42.033  -85.313  -57.093 1.00 14.41  ? 207 SER Y CB  1 
ATOM   9335  O  OG  . SER F 3 208 ? 41.105  -85.248  -58.162 1.00 14.52  ? 207 SER Y OG  1 
ATOM   9336  N  N   . PHE F 3 209 ? 43.869  -82.844  -56.776 1.00 11.38  ? 208 PHE Y N   1 
ATOM   9337  C  CA  . PHE F 3 209 ? 44.657  -81.880  -57.527 1.00 10.81  ? 208 PHE Y CA  1 
ATOM   9338  C  C   . PHE F 3 209 ? 45.964  -82.520  -57.993 1.00 11.56  ? 208 PHE Y C   1 
ATOM   9339  O  O   . PHE F 3 209 ? 46.449  -83.486  -57.388 1.00 11.20  ? 208 PHE Y O   1 
ATOM   9340  C  CB  . PHE F 3 209 ? 44.955  -80.649  -56.673 1.00 9.72   ? 208 PHE Y CB  1 
ATOM   9341  C  CG  . PHE F 3 209 ? 45.876  -80.920  -55.516 1.00 9.05   ? 208 PHE Y CG  1 
ATOM   9342  C  CD1 . PHE F 3 209 ? 47.260  -80.882  -55.686 1.00 8.65   ? 208 PHE Y CD1 1 
ATOM   9343  C  CD2 . PHE F 3 209 ? 45.362  -81.206  -54.257 1.00 8.51   ? 208 PHE Y CD2 1 
ATOM   9344  C  CE1 . PHE F 3 209 ? 48.120  -81.133  -54.617 1.00 8.80   ? 208 PHE Y CE1 1 
ATOM   9345  C  CE2 . PHE F 3 209 ? 46.206  -81.458  -53.184 1.00 8.68   ? 208 PHE Y CE2 1 
ATOM   9346  C  CZ  . PHE F 3 209 ? 47.594  -81.420  -53.363 1.00 8.96   ? 208 PHE Y CZ  1 
ATOM   9347  N  N   . ASN F 3 210 ? 46.522  -81.971  -59.070 1.00 12.11  ? 209 ASN Y N   1 
ATOM   9348  C  CA  . ASN F 3 210 ? 47.856  -82.330  -59.534 1.00 12.52  ? 209 ASN Y CA  1 
ATOM   9349  C  C   . ASN F 3 210 ? 48.861  -81.301  -59.022 1.00 12.09  ? 209 ASN Y C   1 
ATOM   9350  O  O   . ASN F 3 210 ? 48.664  -80.102  -59.201 1.00 11.80  ? 209 ASN Y O   1 
ATOM   9351  C  CB  . ASN F 3 210 ? 47.891  -82.365  -61.064 1.00 13.34  ? 209 ASN Y CB  1 
ATOM   9352  C  CG  . ASN F 3 210 ? 46.907  -83.364  -61.655 1.00 13.73  ? 209 ASN Y CG  1 
ATOM   9353  O  OD1 . ASN F 3 210 ? 46.821  -84.510  -61.211 1.00 14.53  ? 209 ASN Y OD1 1 
ATOM   9354  N  ND2 . ASN F 3 210 ? 46.169  -82.936  -62.674 1.00 13.46  ? 209 ASN Y ND2 1 
ATOM   9355  N  N   . ARG F 3 211 ? 49.926  -81.759  -58.374 1.00 12.57  ? 210 ARG Y N   1 
ATOM   9356  C  CA  . ARG F 3 211 ? 50.972  -80.856  -57.888 1.00 13.15  ? 210 ARG Y CA  1 
ATOM   9357  C  C   . ARG F 3 211 ? 51.592  -80.067  -59.047 1.00 13.59  ? 210 ARG Y C   1 
ATOM   9358  O  O   . ARG F 3 211 ? 52.162  -80.644  -59.974 1.00 13.22  ? 210 ARG Y O   1 
ATOM   9359  C  CB  . ARG F 3 211 ? 52.063  -81.644  -57.149 1.00 12.95  ? 210 ARG Y CB  1 
ATOM   9360  C  CG  . ARG F 3 211 ? 53.240  -80.794  -56.673 1.00 12.64  ? 210 ARG Y CG  1 
ATOM   9361  C  CD  . ARG F 3 211 ? 54.334  -81.631  -56.027 1.00 12.56  ? 210 ARG Y CD  1 
ATOM   9362  N  NE  . ARG F 3 211 ? 54.832  -82.683  -56.911 1.00 12.31  ? 210 ARG Y NE  1 
ATOM   9363  C  CZ  . ARG F 3 211 ? 55.625  -82.480  -57.962 1.00 12.67  ? 210 ARG Y CZ  1 
ATOM   9364  N  NH1 . ARG F 3 211 ? 56.046  -81.259  -58.285 1.00 12.76  ? 210 ARG Y NH1 1 
ATOM   9365  N  NH2 . ARG F 3 211 ? 56.008  -83.518  -58.699 1.00 12.50  ? 210 ARG Y NH2 1 
HETATM 9366  MN MN  . MN  G 4 .   ? 43.776  -41.676  5.048   1.00 29.73  ? 1   MN  A MN  1 
HETATM 9367  MN MN  . MN  H 4 .   ? 20.928  -76.072  6.266   1.00 29.33  ? 2   MN  B MN  1 
HETATM 9368  S  S   . SO4 I 5 .   ? 8.192   -99.342  4.517   1.00 95.50  ? 5   SO4 B S   1 
HETATM 9369  O  O1  . SO4 I 5 .   ? 9.205   -100.392 4.500   1.00 95.49  ? 5   SO4 B O1  1 
HETATM 9370  O  O2  . SO4 I 5 .   ? 7.834   -98.989  3.143   1.00 95.49  ? 5   SO4 B O2  1 
HETATM 9371  O  O3  . SO4 I 5 .   ? 7.006   -99.813  5.233   1.00 95.34  ? 5   SO4 B O3  1 
HETATM 9372  O  O4  . SO4 I 5 .   ? 8.734   -98.166  5.196   1.00 96.06  ? 5   SO4 B O4  1 
HETATM 9373  S  S   . SO4 J 5 .   ? 26.303  -64.318  -54.049 1.00 13.83  ? 221 SO4 H S   1 
HETATM 9374  O  O1  . SO4 J 5 .   ? 27.346  -64.976  -54.846 1.00 14.17  ? 221 SO4 H O1  1 
HETATM 9375  O  O2  . SO4 J 5 .   ? 25.206  -63.861  -54.903 1.00 14.05  ? 221 SO4 H O2  1 
HETATM 9376  O  O3  . SO4 J 5 .   ? 25.739  -65.276  -53.093 1.00 13.94  ? 221 SO4 H O3  1 
HETATM 9377  O  O4  . SO4 J 5 .   ? 26.896  -63.140  -53.400 1.00 13.58  ? 221 SO4 H O4  1 
HETATM 9378  S  S   . SO4 K 5 .   ? 41.658  -53.200  0.400   1.00 71.29  ? 222 SO4 H S   1 
HETATM 9379  O  O1  . SO4 K 5 .   ? 42.943  -52.737  0.926   1.00 71.10  ? 222 SO4 H O1  1 
HETATM 9380  O  O2  . SO4 K 5 .   ? 41.431  -52.645  -0.934  1.00 71.71  ? 222 SO4 H O2  1 
HETATM 9381  O  O3  . SO4 K 5 .   ? 41.592  -54.658  0.301   1.00 70.98  ? 222 SO4 H O3  1 
HETATM 9382  O  O4  . SO4 K 5 .   ? 40.633  -52.740  1.326   1.00 72.50  ? 222 SO4 H O4  1 
HETATM 9383  S  S   . SO4 L 5 .   ? 43.297  -49.202  -19.732 1.00 118.00 ? 212 SO4 L S   1 
HETATM 9384  O  O1  . SO4 L 5 .   ? 43.457  -49.873  -21.021 1.00 117.94 ? 212 SO4 L O1  1 
HETATM 9385  O  O2  . SO4 L 5 .   ? 42.012  -48.509  -19.710 1.00 117.76 ? 212 SO4 L O2  1 
HETATM 9386  O  O3  . SO4 L 5 .   ? 43.337  -50.189  -18.653 1.00 117.95 ? 212 SO4 L O3  1 
HETATM 9387  O  O4  . SO4 L 5 .   ? 44.379  -48.236  -19.542 1.00 117.88 ? 212 SO4 L O4  1 
HETATM 9388  S  S   . SO4 M 5 .   ? 23.802  -65.490  0.481   1.00 82.49  ? 221 SO4 X S   1 
HETATM 9389  O  O1  . SO4 M 5 .   ? 25.035  -64.712  0.544   1.00 82.87  ? 221 SO4 X O1  1 
HETATM 9390  O  O2  . SO4 M 5 .   ? 23.546  -65.854  -0.913  1.00 81.88  ? 221 SO4 X O2  1 
HETATM 9391  O  O3  . SO4 M 5 .   ? 23.947  -66.689  1.306   1.00 82.12  ? 221 SO4 X O3  1 
HETATM 9392  O  O4  . SO4 M 5 .   ? 22.706  -64.675  1.004   1.00 82.75  ? 221 SO4 X O4  1 
HETATM 9393  S  S   . SO4 N 5 .   ? 12.066  -72.899  -21.764 1.00 101.16 ? 212 SO4 Y S   1 
HETATM 9394  O  O1  . SO4 N 5 .   ? 13.460  -73.295  -21.954 1.00 100.52 ? 212 SO4 Y O1  1 
HETATM 9395  O  O2  . SO4 N 5 .   ? 11.497  -72.544  -23.062 1.00 100.79 ? 212 SO4 Y O2  1 
HETATM 9396  O  O3  . SO4 N 5 .   ? 11.294  -73.992  -21.167 1.00 100.55 ? 212 SO4 Y O3  1 
HETATM 9397  O  O4  . SO4 N 5 .   ? 12.022  -71.735  -20.877 1.00 100.99 ? 212 SO4 Y O4  1 
HETATM 9398  O  O   . HOH O 6 .   ? 43.770  -41.606  7.051   1.00 24.41  ? 4   HOH A O   1 
HETATM 9399  O  O   . HOH O 6 .   ? 44.276  -27.860  16.356  1.00 35.55  ? 10  HOH A O   1 
HETATM 9400  O  O   . HOH O 6 .   ? 55.360  -52.290  8.522   1.00 37.25  ? 15  HOH A O   1 
HETATM 9401  O  O   . HOH O 6 .   ? 60.294  -30.361  6.587   1.00 29.86  ? 18  HOH A O   1 
HETATM 9402  O  O   . HOH O 6 .   ? 39.190  -34.241  16.929  1.00 27.90  ? 23  HOH A O   1 
HETATM 9403  O  O   . HOH O 6 .   ? 45.627  -44.779  10.628  1.00 21.70  ? 25  HOH A O   1 
HETATM 9404  O  O   . HOH O 6 .   ? 58.684  -49.358  7.891   1.00 32.12  ? 35  HOH A O   1 
HETATM 9405  O  O   . HOH O 6 .   ? 51.109  -53.599  19.446  1.00 48.62  ? 51  HOH A O   1 
HETATM 9406  O  O   . HOH O 6 .   ? 56.280  -34.210  1.544   1.00 40.50  ? 55  HOH A O   1 
HETATM 9407  O  O   . HOH O 6 .   ? 46.008  -35.548  5.684   1.00 26.65  ? 72  HOH A O   1 
HETATM 9408  O  O   . HOH O 6 .   ? 52.778  -55.682  16.875  1.00 55.80  ? 73  HOH A O   1 
HETATM 9409  O  O   . HOH O 6 .   ? 54.952  -23.485  10.040  1.00 31.85  ? 76  HOH A O   1 
HETATM 9410  O  O   . HOH O 6 .   ? 51.252  -51.587  25.934  1.00 33.88  ? 81  HOH A O   1 
HETATM 9411  O  O   . HOH O 6 .   ? 41.649  -43.947  7.612   1.00 28.36  ? 95  HOH A O   1 
HETATM 9412  O  O   . HOH O 6 .   ? 52.363  -36.141  -2.839  1.00 35.71  ? 110 HOH A O   1 
HETATM 9413  O  O   . HOH O 6 .   ? 62.194  -29.601  4.767   1.00 31.28  ? 308 HOH A O   1 
HETATM 9414  O  O   . HOH O 6 .   ? 62.614  -38.285  6.039   1.00 26.77  ? 309 HOH A O   1 
HETATM 9415  O  O   . HOH O 6 .   ? 64.104  -50.493  8.610   1.00 39.21  ? 310 HOH A O   1 
HETATM 9416  O  O   . HOH O 6 .   ? 46.709  -29.190  1.907   1.00 30.49  ? 311 HOH A O   1 
HETATM 9417  O  O   . HOH O 6 .   ? 37.149  -37.592  15.791  1.00 38.93  ? 312 HOH A O   1 
HETATM 9418  O  O   . HOH O 6 .   ? 64.732  -41.682  22.912  1.00 38.87  ? 313 HOH A O   1 
HETATM 9419  O  O   . HOH O 6 .   ? 47.067  -26.962  5.809   1.00 41.02  ? 314 HOH A O   1 
HETATM 9420  O  O   . HOH O 6 .   ? 61.565  -28.206  25.059  1.00 38.09  ? 315 HOH A O   1 
HETATM 9421  O  O   . HOH O 6 .   ? 40.349  -52.068  12.403  1.00 34.60  ? 316 HOH A O   1 
HETATM 9422  O  O   . HOH O 6 .   ? 37.910  -53.334  13.726  1.00 36.37  ? 317 HOH A O   1 
HETATM 9423  O  O   . HOH O 6 .   ? 50.371  -44.338  -3.283  1.00 31.17  ? 318 HOH A O   1 
HETATM 9424  O  O   . HOH O 6 .   ? 64.454  -39.229  10.943  1.00 35.18  ? 319 HOH A O   1 
HETATM 9425  O  O   . HOH O 6 .   ? 39.205  -35.336  1.927   1.00 25.33  ? 320 HOH A O   1 
HETATM 9426  O  O   . HOH O 6 .   ? 69.461  -26.704  24.299  1.00 44.43  ? 321 HOH A O   1 
HETATM 9427  O  O   . HOH O 6 .   ? 53.270  -50.076  4.465   1.00 43.50  ? 322 HOH A O   1 
HETATM 9428  O  O   . HOH O 6 .   ? 59.597  -27.925  7.722   1.00 27.11  ? 323 HOH A O   1 
HETATM 9429  O  O   . HOH O 6 .   ? 43.727  -34.677  3.233   1.00 33.72  ? 324 HOH A O   1 
HETATM 9430  O  O   . HOH O 6 .   ? 43.468  -51.037  9.419   1.00 33.71  ? 325 HOH A O   1 
HETATM 9431  O  O   . HOH O 6 .   ? 58.922  -25.674  22.057  1.00 52.38  ? 326 HOH A O   1 
HETATM 9432  O  O   . HOH O 6 .   ? 53.126  -40.935  28.632  1.00 41.01  ? 327 HOH A O   1 
HETATM 9433  O  O   . HOH O 6 .   ? 64.905  -42.745  25.271  1.00 53.41  ? 328 HOH A O   1 
HETATM 9434  O  O   . HOH O 6 .   ? 56.845  -32.616  3.490   1.00 30.96  ? 329 HOH A O   1 
HETATM 9435  O  O   . HOH O 6 .   ? 41.553  -42.330  26.590  1.00 37.11  ? 330 HOH A O   1 
HETATM 9436  O  O   . HOH O 6 .   ? 59.192  -31.213  3.342   1.00 48.27  ? 331 HOH A O   1 
HETATM 9437  O  O   . HOH O 6 .   ? 67.398  -49.051  9.892   1.00 33.65  ? 332 HOH A O   1 
HETATM 9438  O  O   . HOH O 6 .   ? 51.212  -48.351  -0.597  1.00 45.17  ? 333 HOH A O   1 
HETATM 9439  O  O   . HOH O 6 .   ? 56.435  -26.853  29.506  1.00 46.27  ? 334 HOH A O   1 
HETATM 9440  O  O   . HOH O 6 .   ? 56.899  -48.113  28.819  1.00 44.69  ? 335 HOH A O   1 
HETATM 9441  O  O   . HOH O 6 .   ? 34.262  -53.341  16.006  1.00 52.70  ? 336 HOH A O   1 
HETATM 9442  O  O   . HOH O 6 .   ? 55.366  -47.161  2.941   1.00 48.77  ? 337 HOH A O   1 
HETATM 9443  O  O   . HOH O 6 .   ? 47.536  -55.037  20.544  1.00 49.90  ? 338 HOH A O   1 
HETATM 9444  O  O   . HOH O 6 .   ? 54.075  -52.886  19.898  1.00 42.53  ? 340 HOH A O   1 
HETATM 9445  O  O   . HOH O 6 .   ? 36.595  -47.393  17.057  1.00 49.94  ? 341 HOH A O   1 
HETATM 9446  O  O   . HOH O 6 .   ? 70.125  -34.747  12.587  1.00 44.43  ? 346 HOH A O   1 
HETATM 9447  O  O   . HOH O 6 .   ? 52.909  -49.206  25.912  1.00 52.48  ? 353 HOH A O   1 
HETATM 9448  O  O   . HOH O 6 .   ? 60.771  -54.958  23.398  1.00 46.80  ? 354 HOH A O   1 
HETATM 9449  O  O   . HOH O 6 .   ? 39.703  -49.698  19.704  1.00 42.00  ? 360 HOH A O   1 
HETATM 9450  O  O   . HOH O 6 .   ? 53.196  -52.534  6.976   1.00 36.75  ? 369 HOH A O   1 
HETATM 9451  O  O   . HOH O 6 .   ? 63.122  -48.196  7.719   1.00 49.61  ? 373 HOH A O   1 
HETATM 9452  O  O   . HOH O 6 .   ? 61.511  -25.942  7.531   1.00 48.20  ? 375 HOH A O   1 
HETATM 9453  O  O   . HOH O 6 .   ? 66.096  -37.502  9.631   1.00 44.69  ? 385 HOH A O   1 
HETATM 9454  O  O   . HOH O 6 .   ? 65.030  -37.433  15.325  1.00 30.83  ? 388 HOH A O   1 
HETATM 9455  O  O   . HOH O 6 .   ? 52.030  -37.474  34.511  1.00 55.47  ? 391 HOH A O   1 
HETATM 9456  O  O   . HOH O 6 .   ? 38.046  -28.884  4.860   1.00 34.96  ? 393 HOH A O   1 
HETATM 9457  O  O   . HOH O 6 .   ? 60.722  -44.786  30.391  1.00 41.20  ? 399 HOH A O   1 
HETATM 9458  O  O   . HOH O 6 .   ? 36.226  -36.490  8.833   1.00 41.99  ? 418 HOH A O   1 
HETATM 9459  O  O   . HOH O 6 .   ? 51.468  -52.772  23.854  1.00 37.65  ? 438 HOH A O   1 
HETATM 9460  O  O   . HOH O 6 .   ? 53.331  -40.646  0.935   1.00 21.68  ? 440 HOH A O   1 
HETATM 9461  O  O   . HOH O 6 .   ? 50.060  -54.070  3.865   1.00 46.19  ? 452 HOH A O   1 
HETATM 9462  O  O   . HOH O 6 .   ? 41.571  -26.029  10.341  1.00 37.85  ? 473 HOH A O   1 
HETATM 9463  O  O   . HOH O 6 .   ? 37.733  -39.532  10.036  1.00 36.86  ? 486 HOH A O   1 
HETATM 9464  O  O   . HOH O 6 .   ? 46.039  -21.735  11.546  1.00 49.47  ? 491 HOH A O   1 
HETATM 9465  O  O   . HOH O 6 .   ? 49.686  -50.502  1.620   1.00 39.81  ? 493 HOH A O   1 
HETATM 9466  O  O   . HOH O 6 .   ? 38.759  -37.664  8.016   1.00 35.91  ? 496 HOH A O   1 
HETATM 9467  O  O   . HOH O 6 .   ? 68.759  -47.270  12.139  1.00 56.58  ? 503 HOH A O   1 
HETATM 9468  O  O   . HOH O 6 .   ? 60.304  -49.941  20.973  1.00 42.96  ? 504 HOH A O   1 
HETATM 9469  O  O   . HOH O 6 .   ? 57.131  -17.659  13.979  1.00 58.69  ? 511 HOH A O   1 
HETATM 9470  O  O   . HOH O 6 .   ? 44.544  -52.455  5.427   1.00 53.36  ? 517 HOH A O   1 
HETATM 9471  O  O   . HOH O 6 .   ? 58.559  -45.460  26.334  1.00 35.51  ? 535 HOH A O   1 
HETATM 9472  O  O   . HOH O 6 .   ? 54.601  -22.589  5.693   1.00 48.87  ? 553 HOH A O   1 
HETATM 9473  O  O   . HOH O 6 .   ? 46.767  -59.247  15.432  1.00 57.94  ? 557 HOH A O   1 
HETATM 9474  O  O   . HOH O 6 .   ? 36.277  -47.845  6.769   1.00 45.94  ? 563 HOH A O   1 
HETATM 9475  O  O   . HOH O 6 .   ? 36.851  -45.862  10.259  1.00 44.49  ? 564 HOH A O   1 
HETATM 9476  O  O   . HOH O 6 .   ? 57.931  -53.808  14.094  1.00 38.80  ? 573 HOH A O   1 
HETATM 9477  O  O   . HOH O 6 .   ? 30.603  -47.750  12.838  1.00 42.54  ? 574 HOH A O   1 
HETATM 9478  O  O   . HOH O 6 .   ? 34.701  -40.860  14.791  1.00 50.71  ? 584 HOH A O   1 
HETATM 9479  O  O   . HOH O 6 .   ? 34.159  -37.843  5.016   1.00 43.54  ? 595 HOH A O   1 
HETATM 9480  O  O   . HOH O 6 .   ? 63.715  -34.711  33.069  1.00 52.38  ? 596 HOH A O   1 
HETATM 9481  O  O   . HOH O 6 .   ? 48.088  -53.023  1.895   1.00 45.20  ? 602 HOH A O   1 
HETATM 9482  O  O   . HOH O 6 .   ? 38.280  -47.018  18.692  1.00 59.70  ? 607 HOH A O   1 
HETATM 9483  O  O   . HOH O 6 .   ? 37.210  -37.598  5.848   1.00 44.73  ? 609 HOH A O   1 
HETATM 9484  O  O   . HOH O 6 .   ? 70.947  -29.915  17.306  1.00 45.22  ? 612 HOH A O   1 
HETATM 9485  O  O   . HOH O 6 .   ? 68.469  -28.089  12.297  1.00 44.68  ? 615 HOH A O   1 
HETATM 9486  O  O   . HOH O 6 .   ? 70.994  -32.376  19.306  1.00 46.71  ? 631 HOH A O   1 
HETATM 9487  O  O   . HOH O 6 .   ? 53.745  -55.482  20.001  1.00 59.91  ? 633 HOH A O   1 
HETATM 9488  O  O   . HOH O 6 .   ? 43.617  -46.630  2.625   1.00 43.43  ? 646 HOH A O   1 
HETATM 9489  O  O   . HOH O 6 .   ? 48.707  -23.874  17.795  1.00 49.81  ? 648 HOH A O   1 
HETATM 9490  O  O   . HOH O 6 .   ? 39.874  -29.196  17.068  1.00 49.93  ? 651 HOH A O   1 
HETATM 9491  O  O   . HOH O 6 .   ? 45.228  -52.792  8.476   1.00 40.02  ? 656 HOH A O   1 
HETATM 9492  O  O   . HOH O 6 .   ? 37.764  -29.766  10.137  1.00 54.78  ? 658 HOH A O   1 
HETATM 9493  O  O   . HOH O 6 .   ? 59.428  -19.807  10.101  1.00 44.24  ? 659 HOH A O   1 
HETATM 9494  O  O   . HOH O 6 .   ? 64.745  -38.464  33.313  1.00 58.25  ? 668 HOH A O   1 
HETATM 9495  O  O   . HOH O 6 .   ? 62.115  -20.473  9.384   1.00 46.77  ? 687 HOH A O   1 
HETATM 9496  O  O   . HOH P 6 .   ? 20.652  -75.995  8.363   1.00 26.59  ? 1   HOH B O   1 
HETATM 9497  O  O   . HOH P 6 .   ? 15.212  -74.031  -2.787  1.00 21.68  ? 20  HOH B O   1 
HETATM 9498  O  O   . HOH P 6 .   ? 11.575  -77.386  1.247   1.00 21.35  ? 22  HOH B O   1 
HETATM 9499  O  O   . HOH P 6 .   ? 18.286  -82.330  7.185   1.00 18.45  ? 43  HOH B O   1 
HETATM 9500  O  O   . HOH P 6 .   ? -5.069  -83.479  10.208  1.00 54.21  ? 57  HOH B O   1 
HETATM 9501  O  O   . HOH P 6 .   ? 12.229  -57.431  9.961   1.00 44.26  ? 60  HOH B O   1 
HETATM 9502  O  O   . HOH P 6 .   ? 19.190  -89.420  6.840   1.00 29.61  ? 80  HOH B O   1 
HETATM 9503  O  O   . HOH P 6 .   ? -7.466  -90.482  20.859  1.00 23.80  ? 85  HOH B O   1 
HETATM 9504  O  O   . HOH P 6 .   ? 3.546   -90.297  22.776  1.00 45.62  ? 86  HOH B O   1 
HETATM 9505  O  O   . HOH P 6 .   ? -6.839  -67.164  17.329  1.00 37.98  ? 87  HOH B O   1 
HETATM 9506  O  O   . HOH P 6 .   ? 18.603  -72.605  11.309  1.00 25.65  ? 91  HOH B O   1 
HETATM 9507  O  O   . HOH P 6 .   ? 10.240  -94.375  8.054   1.00 44.37  ? 92  HOH B O   1 
HETATM 9508  O  O   . HOH P 6 .   ? 14.554  -69.896  -0.879  1.00 42.92  ? 94  HOH B O   1 
HETATM 9509  O  O   . HOH P 6 .   ? 12.914  -93.466  18.421  1.00 39.52  ? 99  HOH B O   1 
HETATM 9510  O  O   . HOH P 6 .   ? 26.124  -89.318  7.820   1.00 28.39  ? 101 HOH B O   1 
HETATM 9511  O  O   . HOH P 6 .   ? 24.179  -82.795  19.208  1.00 32.23  ? 103 HOH B O   1 
HETATM 9512  O  O   . HOH P 6 .   ? 29.046  -86.030  5.535   1.00 29.41  ? 111 HOH B O   1 
HETATM 9513  O  O   . HOH P 6 .   ? 29.379  -76.796  16.449  1.00 42.47  ? 112 HOH B O   1 
HETATM 9514  O  O   . HOH P 6 .   ? 25.355  -83.210  4.360   1.00 18.41  ? 115 HOH B O   1 
HETATM 9515  O  O   . HOH P 6 .   ? 22.156  -79.365  26.296  1.00 32.40  ? 122 HOH B O   1 
HETATM 9516  O  O   . HOH P 6 .   ? 18.708  -88.732  18.740  1.00 39.94  ? 125 HOH B O   1 
HETATM 9517  O  O   . HOH P 6 .   ? 7.273   -62.202  12.973  1.00 31.07  ? 127 HOH B O   1 
HETATM 9518  O  O   . HOH P 6 .   ? 25.173  -80.002  9.829   1.00 36.81  ? 308 HOH B O   1 
HETATM 9519  O  O   . HOH P 6 .   ? 12.581  -89.383  6.600   1.00 40.50  ? 309 HOH B O   1 
HETATM 9520  O  O   . HOH P 6 .   ? 7.744   -60.922  10.232  1.00 52.29  ? 310 HOH B O   1 
HETATM 9521  O  O   . HOH P 6 .   ? 26.377  -78.144  12.076  1.00 34.66  ? 311 HOH B O   1 
HETATM 9522  O  O   . HOH P 6 .   ? 2.178   -94.163  9.073   1.00 40.88  ? 312 HOH B O   1 
HETATM 9523  O  O   . HOH P 6 .   ? -5.823  -66.982  12.824  1.00 35.42  ? 313 HOH B O   1 
HETATM 9524  O  O   . HOH P 6 .   ? 6.679   -67.557  7.013   1.00 41.96  ? 314 HOH B O   1 
HETATM 9525  O  O   . HOH P 6 .   ? 7.387   -85.072  4.198   1.00 40.91  ? 315 HOH B O   1 
HETATM 9526  O  O   . HOH P 6 .   ? 1.903   -78.356  5.703   1.00 35.49  ? 316 HOH B O   1 
HETATM 9527  O  O   . HOH P 6 .   ? 15.928  -88.183  28.407  1.00 43.41  ? 317 HOH B O   1 
HETATM 9528  O  O   . HOH P 6 .   ? 22.799  -73.698  8.812   1.00 31.60  ? 318 HOH B O   1 
HETATM 9529  O  O   . HOH P 6 .   ? 20.919  -80.076  28.673  1.00 32.92  ? 319 HOH B O   1 
HETATM 9530  O  O   . HOH P 6 .   ? 23.004  -81.746  30.504  1.00 32.18  ? 320 HOH B O   1 
HETATM 9531  O  O   . HOH P 6 .   ? 21.632  -71.582  3.295   1.00 36.42  ? 321 HOH B O   1 
HETATM 9532  O  O   . HOH P 6 .   ? 24.899  -93.072  7.186   1.00 35.99  ? 322 HOH B O   1 
HETATM 9533  O  O   . HOH P 6 .   ? 9.900   -66.798  25.923  1.00 48.26  ? 323 HOH B O   1 
HETATM 9534  O  O   . HOH P 6 .   ? 4.161   -75.805  32.020  1.00 56.98  ? 324 HOH B O   1 
HETATM 9535  O  O   . HOH P 6 .   ? 21.229  -66.707  10.074  1.00 35.43  ? 325 HOH B O   1 
HETATM 9536  O  O   . HOH P 6 .   ? 13.504  -64.731  31.183  1.00 39.98  ? 326 HOH B O   1 
HETATM 9537  O  O   . HOH P 6 .   ? 25.964  -79.870  26.915  1.00 57.80  ? 327 HOH B O   1 
HETATM 9538  O  O   . HOH P 6 .   ? 5.626   -95.565  18.297  1.00 42.11  ? 328 HOH B O   1 
HETATM 9539  O  O   . HOH P 6 .   ? 8.484   -73.580  35.777  1.00 34.81  ? 329 HOH B O   1 
HETATM 9540  O  O   . HOH P 6 .   ? 9.473   -74.571  28.896  1.00 31.67  ? 330 HOH B O   1 
HETATM 9541  O  O   . HOH P 6 .   ? 9.539   -70.614  1.196   1.00 47.49  ? 331 HOH B O   1 
HETATM 9542  O  O   . HOH P 6 .   ? 27.493  -84.970  13.491  1.00 44.34  ? 332 HOH B O   1 
HETATM 9543  O  O   . HOH P 6 .   ? 11.994  -64.729  25.491  1.00 29.00  ? 333 HOH B O   1 
HETATM 9544  O  O   . HOH P 6 .   ? 0.353   -87.317  25.316  1.00 44.76  ? 334 HOH B O   1 
HETATM 9545  O  O   . HOH P 6 .   ? 13.830  -60.336  5.407   1.00 61.07  ? 335 HOH B O   1 
HETATM 9546  O  O   . HOH P 6 .   ? 4.899   -96.088  20.872  1.00 42.72  ? 336 HOH B O   1 
HETATM 9547  O  O   . HOH P 6 .   ? 26.057  -79.366  17.574  1.00 35.16  ? 337 HOH B O   1 
HETATM 9548  O  O   . HOH P 6 .   ? 19.912  -64.944  8.805   1.00 39.97  ? 338 HOH B O   1 
HETATM 9549  O  O   . HOH P 6 .   ? 15.147  -63.179  4.087   1.00 46.94  ? 339 HOH B O   1 
HETATM 9550  O  O   . HOH P 6 .   ? 21.966  -91.385  13.216  1.00 34.76  ? 340 HOH B O   1 
HETATM 9551  O  O   . HOH P 6 .   ? 10.109  -64.391  7.891   1.00 38.09  ? 341 HOH B O   1 
HETATM 9552  O  O   . HOH P 6 .   ? 7.819   -65.114  6.869   1.00 44.19  ? 342 HOH B O   1 
HETATM 9553  O  O   . HOH P 6 .   ? 26.565  -81.963  19.092  1.00 42.80  ? 344 HOH B O   1 
HETATM 9554  O  O   . HOH P 6 .   ? -3.259  -67.321  13.172  1.00 51.12  ? 368 HOH B O   1 
HETATM 9555  O  O   . HOH P 6 .   ? 15.943  -67.659  1.261   1.00 50.59  ? 381 HOH B O   1 
HETATM 9556  O  O   . HOH P 6 .   ? 4.960   -89.132  8.336   1.00 49.28  ? 383 HOH B O   1 
HETATM 9557  O  O   . HOH P 6 .   ? 5.475   -86.697  3.745   1.00 43.00  ? 387 HOH B O   1 
HETATM 9558  O  O   . HOH P 6 .   ? -6.329  -68.551  14.861  1.00 44.88  ? 392 HOH B O   1 
HETATM 9559  O  O   . HOH P 6 .   ? -2.981  -73.586  9.762   1.00 46.60  ? 396 HOH B O   1 
HETATM 9560  O  O   . HOH P 6 .   ? 25.605  -88.001  13.555  1.00 50.02  ? 426 HOH B O   1 
HETATM 9561  O  O   . HOH P 6 .   ? 12.983  -81.452  -1.840  1.00 37.68  ? 430 HOH B O   1 
HETATM 9562  O  O   . HOH P 6 .   ? 17.511  -61.525  20.167  1.00 46.53  ? 450 HOH B O   1 
HETATM 9563  O  O   . HOH P 6 .   ? 14.334  -90.881  32.749  1.00 58.90  ? 453 HOH B O   1 
HETATM 9564  O  O   . HOH P 6 .   ? 5.802   -73.924  2.772   1.00 44.15  ? 460 HOH B O   1 
HETATM 9565  O  O   . HOH P 6 .   ? -4.745  -88.812  11.569  1.00 54.54  ? 463 HOH B O   1 
HETATM 9566  O  O   . HOH P 6 .   ? 21.858  -93.335  11.416  1.00 43.50  ? 470 HOH B O   1 
HETATM 9567  O  O   . HOH P 6 .   ? 24.150  -65.842  13.133  1.00 36.86  ? 477 HOH B O   1 
HETATM 9568  O  O   . HOH P 6 .   ? 20.051  -92.109  15.032  1.00 35.05  ? 481 HOH B O   1 
HETATM 9569  O  O   . HOH P 6 .   ? 12.036  -67.245  4.302   1.00 41.44  ? 482 HOH B O   1 
HETATM 9570  O  O   . HOH P 6 .   ? -1.619  -85.606  32.622  1.00 55.93  ? 483 HOH B O   1 
HETATM 9571  O  O   . HOH P 6 .   ? 12.448  -61.205  16.054  1.00 39.65  ? 487 HOH B O   1 
HETATM 9572  O  O   . HOH P 6 .   ? 13.444  -84.613  -1.898  1.00 41.61  ? 499 HOH B O   1 
HETATM 9573  O  O   . HOH P 6 .   ? 20.826  -74.281  28.121  1.00 44.72  ? 502 HOH B O   1 
HETATM 9574  O  O   . HOH P 6 .   ? 10.046  -61.953  9.297   1.00 37.87  ? 508 HOH B O   1 
HETATM 9575  O  O   . HOH P 6 .   ? 4.290   -86.785  7.040   1.00 52.57  ? 524 HOH B O   1 
HETATM 9576  O  O   . HOH P 6 .   ? 28.550  -70.589  7.840   1.00 31.70  ? 530 HOH B O   1 
HETATM 9577  O  O   . HOH P 6 .   ? 11.494  -72.845  36.694  1.00 49.29  ? 533 HOH B O   1 
HETATM 9578  O  O   . HOH P 6 .   ? 22.094  -62.364  18.494  1.00 56.72  ? 538 HOH B O   1 
HETATM 9579  O  O   . HOH P 6 .   ? -7.818  -86.358  16.976  1.00 47.51  ? 549 HOH B O   1 
HETATM 9580  O  O   . HOH P 6 .   ? 22.776  -88.190  19.706  1.00 55.76  ? 552 HOH B O   1 
HETATM 9581  O  O   . HOH P 6 .   ? 28.586  -82.114  11.268  1.00 49.45  ? 554 HOH B O   1 
HETATM 9582  O  O   . HOH P 6 .   ? 30.785  -79.845  6.997   1.00 37.78  ? 560 HOH B O   1 
HETATM 9583  O  O   . HOH P 6 .   ? 12.211  -63.300  23.180  1.00 43.95  ? 561 HOH B O   1 
HETATM 9584  O  O   . HOH P 6 .   ? 27.682  -71.863  11.390  1.00 47.35  ? 562 HOH B O   1 
HETATM 9585  O  O   . HOH P 6 .   ? -2.892  -84.837  25.165  1.00 53.18  ? 575 HOH B O   1 
HETATM 9586  O  O   . HOH P 6 .   ? -8.089  -92.755  17.200  1.00 36.05  ? 583 HOH B O   1 
HETATM 9587  O  O   . HOH P 6 .   ? 3.507   -65.581  19.904  1.00 48.78  ? 587 HOH B O   1 
HETATM 9588  O  O   . HOH P 6 .   ? 1.566   -92.076  29.075  1.00 56.63  ? 591 HOH B O   1 
HETATM 9589  O  O   . HOH P 6 .   ? 1.438   -81.419  4.954   1.00 49.96  ? 592 HOH B O   1 
HETATM 9590  O  O   . HOH P 6 .   ? 16.782  -90.350  7.678   1.00 37.88  ? 593 HOH B O   1 
HETATM 9591  O  O   . HOH P 6 .   ? 8.740   -93.391  12.052  1.00 44.64  ? 605 HOH B O   1 
HETATM 9592  O  O   . HOH P 6 .   ? 24.054  -72.699  29.743  1.00 58.82  ? 614 HOH B O   1 
HETATM 9593  O  O   . HOH P 6 .   ? 19.684  -63.861  4.067   1.00 46.57  ? 616 HOH B O   1 
HETATM 9594  O  O   . HOH P 6 .   ? -9.215  -90.794  18.796  1.00 36.33  ? 619 HOH B O   1 
HETATM 9595  O  O   . HOH P 6 .   ? 6.631   -67.459  28.658  1.00 47.10  ? 621 HOH B O   1 
HETATM 9596  O  O   . HOH P 6 .   ? -5.976  -73.607  21.393  1.00 54.08  ? 627 HOH B O   1 
HETATM 9597  O  O   . HOH P 6 .   ? 12.394  -64.830  6.239   1.00 42.35  ? 628 HOH B O   1 
HETATM 9598  O  O   . HOH P 6 .   ? 24.990  -79.887  29.507  1.00 31.67  ? 636 HOH B O   1 
HETATM 9599  O  O   . HOH P 6 .   ? 19.234  -83.920  35.281  1.00 37.24  ? 643 HOH B O   1 
HETATM 9600  O  O   . HOH P 6 .   ? 4.002   -73.518  4.392   1.00 62.77  ? 645 HOH B O   1 
HETATM 9601  O  O   . HOH P 6 .   ? -9.490  -92.871  14.886  1.00 49.87  ? 655 HOH B O   1 
HETATM 9602  O  O   . HOH P 6 .   ? 30.059  -71.390  9.866   1.00 46.54  ? 679 HOH B O   1 
HETATM 9603  O  O   . HOH P 6 .   ? -9.326  -88.489  17.377  1.00 43.02  ? 681 HOH B O   1 
HETATM 9604  O  O   . HOH P 6 .   ? -2.479  -79.255  9.333   1.00 48.12  ? 686 HOH B O   1 
HETATM 9605  O  O   . HOH P 6 .   ? -1.932  -72.317  24.417  1.00 46.49  ? 691 HOH B O   1 
HETATM 9606  O  O   . HOH P 6 .   ? 8.772   -98.624  7.797   1.00 59.80  ? 695 HOH B O   1 
HETATM 9607  O  O   . HOH Q 6 .   ? 42.407  -43.297  5.105   1.00 13.29  ? 223 HOH H O   1 
HETATM 9608  O  O   . HOH Q 6 .   ? 12.555  -30.785  -9.183  1.00 60.59  ? 224 HOH H O   1 
HETATM 9609  O  O   . HOH Q 6 .   ? 37.298  -36.897  2.896   1.00 27.92  ? 225 HOH H O   1 
HETATM 9610  O  O   . HOH Q 6 .   ? 32.608  -60.525  -49.192 1.00 40.54  ? 226 HOH H O   1 
HETATM 9611  O  O   . HOH Q 6 .   ? 18.470  -43.978  3.289   1.00 30.92  ? 227 HOH H O   1 
HETATM 9612  O  O   . HOH Q 6 .   ? 12.069  -32.430  -7.243  1.00 67.73  ? 228 HOH H O   1 
HETATM 9613  O  O   . HOH Q 6 .   ? 22.604  -49.529  3.400   1.00 33.87  ? 229 HOH H O   1 
HETATM 9614  O  O   . HOH Q 6 .   ? 48.247  -43.786  -4.814  1.00 23.03  ? 230 HOH H O   1 
HETATM 9615  O  O   . HOH Q 6 .   ? 7.474   -42.604  -7.419  1.00 63.52  ? 231 HOH H O   1 
HETATM 9616  O  O   . HOH Q 6 .   ? 15.046  -52.735  -20.221 1.00 37.19  ? 232 HOH H O   1 
HETATM 9617  O  O   . HOH Q 6 .   ? 31.442  -49.072  -38.826 1.00 41.20  ? 233 HOH H O   1 
HETATM 9618  O  O   . HOH Q 6 .   ? 26.275  -36.369  -17.215 1.00 48.93  ? 234 HOH H O   1 
HETATM 9619  O  O   . HOH Q 6 .   ? 28.690  -32.465  -18.618 1.00 58.35  ? 235 HOH H O   1 
HETATM 9620  O  O   . HOH Q 6 .   ? 6.328   -41.302  -9.783  1.00 43.69  ? 236 HOH H O   1 
HETATM 9621  O  O   . HOH Q 6 .   ? 18.164  -35.753  -13.287 1.00 45.23  ? 237 HOH H O   1 
HETATM 9622  O  O   . HOH Q 6 .   ? 20.765  -38.256  -30.919 1.00 49.19  ? 238 HOH H O   1 
HETATM 9623  O  O   . HOH Q 6 .   ? 34.402  -53.354  -49.619 1.00 47.52  ? 239 HOH H O   1 
HETATM 9624  O  O   . HOH Q 6 .   ? 26.600  -33.669  -8.710  1.00 32.62  ? 240 HOH H O   1 
HETATM 9625  O  O   . HOH Q 6 .   ? 20.886  -55.183  -30.771 1.00 40.91  ? 241 HOH H O   1 
HETATM 9626  O  O   . HOH Q 6 .   ? 26.130  -47.374  -34.879 1.00 37.02  ? 242 HOH H O   1 
HETATM 9627  O  O   . HOH Q 6 .   ? 5.861   -44.663  -15.364 1.00 44.30  ? 243 HOH H O   1 
HETATM 9628  O  O   . HOH Q 6 .   ? 23.554  -60.373  -62.708 1.00 38.19  ? 244 HOH H O   1 
HETATM 9629  O  O   . HOH Q 6 .   ? 28.167  -55.918  -36.752 1.00 40.85  ? 245 HOH H O   1 
HETATM 9630  O  O   . HOH Q 6 .   ? 28.480  -63.776  -47.540 1.00 37.57  ? 246 HOH H O   1 
HETATM 9631  O  O   . HOH Q 6 .   ? 31.401  -47.363  -19.973 1.00 42.36  ? 247 HOH H O   1 
HETATM 9632  O  O   . HOH Q 6 .   ? 19.656  -54.381  -9.406  1.00 43.94  ? 248 HOH H O   1 
HETATM 9633  O  O   . HOH Q 6 .   ? 15.962  -40.025  -40.065 1.00 41.07  ? 249 HOH H O   1 
HETATM 9634  O  O   . HOH Q 6 .   ? 40.820  -46.332  -11.623 1.00 25.45  ? 250 HOH H O   1 
HETATM 9635  O  O   . HOH Q 6 .   ? 33.520  -46.918  -47.592 1.00 39.36  ? 251 HOH H O   1 
HETATM 9636  O  O   . HOH Q 6 .   ? 14.253  -36.039  -36.323 1.00 45.83  ? 252 HOH H O   1 
HETATM 9637  O  O   . HOH Q 6 .   ? 10.215  -41.295  -36.468 1.00 40.77  ? 253 HOH H O   1 
HETATM 9638  O  O   . HOH Q 6 .   ? 24.117  -62.578  -45.719 1.00 33.97  ? 254 HOH H O   1 
HETATM 9639  O  O   . HOH Q 6 .   ? 22.533  -56.959  -54.337 1.00 28.20  ? 255 HOH H O   1 
HETATM 9640  O  O   . HOH Q 6 .   ? 31.288  -45.441  9.043   1.00 30.94  ? 256 HOH H O   1 
HETATM 9641  O  O   . HOH Q 6 .   ? 42.449  -46.144  -2.250  1.00 25.13  ? 257 HOH H O   1 
HETATM 9642  O  O   . HOH Q 6 .   ? 43.107  -48.151  -0.101  1.00 36.08  ? 258 HOH H O   1 
HETATM 9643  O  O   . HOH Q 6 .   ? 42.287  -59.165  -5.112  1.00 38.88  ? 259 HOH H O   1 
HETATM 9644  O  O   . HOH Q 6 .   ? 34.023  -56.337  2.329   1.00 35.08  ? 260 HOH H O   1 
HETATM 9645  O  O   . HOH Q 6 .   ? 26.076  -62.496  -50.908 1.00 29.54  ? 261 HOH H O   1 
HETATM 9646  O  O   . HOH Q 6 .   ? 39.016  -48.168  -12.220 1.00 30.09  ? 262 HOH H O   1 
HETATM 9647  O  O   . HOH Q 6 .   ? 14.975  -35.150  -6.988  1.00 46.63  ? 263 HOH H O   1 
HETATM 9648  O  O   . HOH Q 6 .   ? 34.366  -56.819  -59.642 1.00 52.46  ? 264 HOH H O   1 
HETATM 9649  O  O   . HOH Q 6 .   ? 18.842  -48.625  -2.378  1.00 40.18  ? 265 HOH H O   1 
HETATM 9650  O  O   . HOH Q 6 .   ? 39.361  -56.325  -48.492 1.00 39.52  ? 266 HOH H O   1 
HETATM 9651  O  O   . HOH Q 6 .   ? 17.689  -59.951  -31.956 1.00 33.20  ? 267 HOH H O   1 
HETATM 9652  O  O   . HOH Q 6 .   ? 30.607  -34.753  -10.136 1.00 50.98  ? 268 HOH H O   1 
HETATM 9653  O  O   . HOH Q 6 .   ? 22.496  -41.947  -37.535 1.00 33.78  ? 269 HOH H O   1 
HETATM 9654  O  O   . HOH Q 6 .   ? 16.067  -63.329  -39.241 1.00 35.02  ? 270 HOH H O   1 
HETATM 9655  O  O   . HOH Q 6 .   ? 29.210  -62.201  -52.306 1.00 40.10  ? 271 HOH H O   1 
HETATM 9656  O  O   . HOH Q 6 .   ? 38.803  -49.432  -3.866  1.00 34.91  ? 272 HOH H O   1 
HETATM 9657  O  O   . HOH Q 6 .   ? 29.591  -63.972  -39.628 1.00 44.51  ? 273 HOH H O   1 
HETATM 9658  O  O   . HOH Q 6 .   ? 22.592  -35.271  0.718   1.00 33.88  ? 274 HOH H O   1 
HETATM 9659  O  O   . HOH Q 6 .   ? 10.829  -37.329  -18.000 1.00 43.88  ? 275 HOH H O   1 
HETATM 9660  O  O   . HOH Q 6 .   ? 14.590  -60.744  -43.005 1.00 39.21  ? 276 HOH H O   1 
HETATM 9661  O  O   . HOH Q 6 .   ? 27.383  -43.854  8.482   1.00 33.15  ? 277 HOH H O   1 
HETATM 9662  O  O   . HOH Q 6 .   ? 27.474  -42.039  -21.189 1.00 40.46  ? 278 HOH H O   1 
HETATM 9663  O  O   . HOH Q 6 .   ? 9.032   -50.644  -24.005 1.00 39.77  ? 279 HOH H O   1 
HETATM 9664  O  O   . HOH Q 6 .   ? 26.566  -47.316  5.949   1.00 37.00  ? 280 HOH H O   1 
HETATM 9665  O  O   . HOH Q 6 .   ? 29.944  -57.039  -42.227 1.00 36.07  ? 281 HOH H O   1 
HETATM 9666  O  O   . HOH Q 6 .   ? 21.283  -57.820  -0.500  1.00 39.88  ? 282 HOH H O   1 
HETATM 9667  O  O   . HOH Q 6 .   ? 13.080  -41.686  -26.730 1.00 34.57  ? 283 HOH H O   1 
HETATM 9668  O  O   . HOH Q 6 .   ? 33.264  -38.133  0.396   1.00 41.81  ? 284 HOH H O   1 
HETATM 9669  O  O   . HOH Q 6 .   ? 32.301  -60.918  -58.215 1.00 54.79  ? 285 HOH H O   1 
HETATM 9670  O  O   . HOH Q 6 .   ? 28.546  -57.044  -62.602 1.00 46.81  ? 286 HOH H O   1 
HETATM 9671  O  O   . HOH Q 6 .   ? 35.401  -51.393  -53.658 1.00 37.35  ? 287 HOH H O   1 
HETATM 9672  O  O   . HOH Q 6 .   ? 16.760  -53.344  -12.684 1.00 45.64  ? 288 HOH H O   1 
HETATM 9673  O  O   . HOH Q 6 .   ? 24.953  -53.759  -17.514 1.00 45.63  ? 289 HOH H O   1 
HETATM 9674  O  O   . HOH Q 6 .   ? 41.909  -52.533  4.031   1.00 41.38  ? 297 HOH H O   1 
HETATM 9675  O  O   . HOH Q 6 .   ? 36.168  -52.399  -11.998 1.00 28.51  ? 309 HOH H O   1 
HETATM 9676  O  O   . HOH Q 6 .   ? 10.490  -56.782  -26.458 1.00 46.30  ? 314 HOH H O   1 
HETATM 9677  O  O   . HOH Q 6 .   ? 14.439  -44.158  -4.035  1.00 39.65  ? 315 HOH H O   1 
HETATM 9678  O  O   . HOH Q 6 .   ? 8.532   -44.529  -9.006  1.00 36.37  ? 318 HOH H O   1 
HETATM 9679  O  O   . HOH Q 6 .   ? 15.575  -59.315  -25.923 1.00 42.77  ? 319 HOH H O   1 
HETATM 9680  O  O   . HOH Q 6 .   ? 19.749  -37.600  -19.915 1.00 44.98  ? 321 HOH H O   1 
HETATM 9681  O  O   . HOH Q 6 .   ? 26.786  -52.186  -36.091 1.00 43.35  ? 323 HOH H O   1 
HETATM 9682  O  O   . HOH Q 6 .   ? 32.608  -56.990  -52.521 1.00 37.39  ? 327 HOH H O   1 
HETATM 9683  O  O   . HOH Q 6 .   ? 16.892  -54.373  -19.211 1.00 53.87  ? 330 HOH H O   1 
HETATM 9684  O  O   . HOH Q 6 .   ? 20.127  -60.300  -39.357 1.00 40.86  ? 332 HOH H O   1 
HETATM 9685  O  O   . HOH Q 6 .   ? 29.815  -62.141  -49.637 1.00 40.01  ? 334 HOH H O   1 
HETATM 9686  O  O   . HOH Q 6 .   ? 17.387  -38.962  -1.772  1.00 37.79  ? 342 HOH H O   1 
HETATM 9687  O  O   . HOH Q 6 .   ? 36.074  -50.009  -15.290 1.00 43.40  ? 349 HOH H O   1 
HETATM 9688  O  O   . HOH Q 6 .   ? 17.927  -37.356  0.667   1.00 53.41  ? 352 HOH H O   1 
HETATM 9689  O  O   . HOH Q 6 .   ? 29.743  -43.347  -20.170 1.00 43.83  ? 362 HOH H O   1 
HETATM 9690  O  O   . HOH Q 6 .   ? 16.944  -47.271  -52.508 1.00 41.77  ? 366 HOH H O   1 
HETATM 9691  O  O   . HOH Q 6 .   ? 24.463  -32.634  -9.791  1.00 43.29  ? 367 HOH H O   1 
HETATM 9692  O  O   . HOH Q 6 .   ? 13.751  -37.883  -38.951 1.00 47.20  ? 376 HOH H O   1 
HETATM 9693  O  O   . HOH Q 6 .   ? 24.930  -45.734  -32.388 1.00 43.53  ? 389 HOH H O   1 
HETATM 9694  O  O   . HOH Q 6 .   ? 20.234  -38.478  3.609   1.00 41.44  ? 397 HOH H O   1 
HETATM 9695  O  O   . HOH Q 6 .   ? 8.991   -57.669  -30.576 1.00 42.74  ? 402 HOH H O   1 
HETATM 9696  O  O   . HOH Q 6 .   ? 10.417  -46.335  -40.831 1.00 50.44  ? 408 HOH H O   1 
HETATM 9697  O  O   . HOH Q 6 .   ? 24.234  -31.822  -2.625  1.00 51.14  ? 409 HOH H O   1 
HETATM 9698  O  O   . HOH Q 6 .   ? 26.523  -31.884  -6.305  1.00 40.32  ? 412 HOH H O   1 
HETATM 9699  O  O   . HOH Q 6 .   ? 44.482  -46.775  -4.281  1.00 36.17  ? 414 HOH H O   1 
HETATM 9700  O  O   . HOH Q 6 .   ? 21.635  -38.035  -16.683 1.00 40.79  ? 417 HOH H O   1 
HETATM 9701  O  O   . HOH Q 6 .   ? 9.460   -42.274  -40.421 1.00 51.35  ? 435 HOH H O   1 
HETATM 9702  O  O   . HOH Q 6 .   ? 18.025  -39.968  2.999   1.00 44.47  ? 437 HOH H O   1 
HETATM 9703  O  O   . HOH Q 6 .   ? 14.308  -53.104  -10.556 1.00 41.42  ? 441 HOH H O   1 
HETATM 9704  O  O   . HOH Q 6 .   ? 24.178  -51.546  -20.193 1.00 47.24  ? 442 HOH H O   1 
HETATM 9705  O  O   . HOH Q 6 .   ? 25.305  -45.237  -55.412 1.00 44.55  ? 446 HOH H O   1 
HETATM 9706  O  O   . HOH Q 6 .   ? 18.820  -42.291  1.994   1.00 35.03  ? 448 HOH H O   1 
HETATM 9707  O  O   . HOH Q 6 .   ? 22.072  -44.441  -29.838 1.00 64.56  ? 455 HOH H O   1 
HETATM 9708  O  O   . HOH Q 6 .   ? 18.550  -55.564  -59.857 1.00 50.31  ? 467 HOH H O   1 
HETATM 9709  O  O   . HOH Q 6 .   ? 14.786  -39.829  -22.783 1.00 40.50  ? 474 HOH H O   1 
HETATM 9710  O  O   . HOH Q 6 .   ? 25.118  -49.661  9.532   1.00 58.90  ? 475 HOH H O   1 
HETATM 9711  O  O   . HOH Q 6 .   ? 19.226  -58.583  -3.669  1.00 56.72  ? 476 HOH H O   1 
HETATM 9712  O  O   . HOH Q 6 .   ? 18.380  -46.241  -26.186 1.00 38.18  ? 480 HOH H O   1 
HETATM 9713  O  O   . HOH Q 6 .   ? 23.806  -46.277  -59.855 1.00 50.50  ? 484 HOH H O   1 
HETATM 9714  O  O   . HOH Q 6 .   ? 23.435  -44.288  -58.115 1.00 64.08  ? 485 HOH H O   1 
HETATM 9715  O  O   . HOH Q 6 .   ? 23.459  -49.352  -60.027 1.00 49.90  ? 490 HOH H O   1 
HETATM 9716  O  O   . HOH Q 6 .   ? 19.383  -48.995  -60.781 1.00 68.05  ? 507 HOH H O   1 
HETATM 9717  O  O   . HOH Q 6 .   ? 20.749  -56.328  -11.066 1.00 61.76  ? 509 HOH H O   1 
HETATM 9718  O  O   . HOH Q 6 .   ? 13.566  -52.766  -24.309 1.00 44.82  ? 513 HOH H O   1 
HETATM 9719  O  O   . HOH Q 6 .   ? 10.422  -51.188  -20.385 1.00 46.85  ? 514 HOH H O   1 
HETATM 9720  O  O   . HOH Q 6 .   ? 6.346   -50.392  -30.541 1.00 47.14  ? 518 HOH H O   1 
HETATM 9721  O  O   . HOH Q 6 .   ? 19.575  -41.986  -40.221 1.00 44.51  ? 520 HOH H O   1 
HETATM 9722  O  O   . HOH Q 6 .   ? 25.283  -56.505  -9.403  1.00 40.76  ? 522 HOH H O   1 
HETATM 9723  O  O   . HOH Q 6 .   ? 32.647  -57.933  -8.910  1.00 46.98  ? 526 HOH H O   1 
HETATM 9724  O  O   . HOH Q 6 .   ? 9.872   -48.909  -37.281 1.00 52.56  ? 529 HOH H O   1 
HETATM 9725  O  O   . HOH Q 6 .   ? 8.402   -48.152  -16.817 1.00 42.34  ? 531 HOH H O   1 
HETATM 9726  O  O   . HOH Q 6 .   ? 10.209  -39.473  -22.974 1.00 47.88  ? 532 HOH H O   1 
HETATM 9727  O  O   . HOH Q 6 .   ? 9.271   -49.060  -21.702 1.00 46.21  ? 544 HOH H O   1 
HETATM 9728  O  O   . HOH Q 6 .   ? 21.980  -31.671  -25.559 1.00 57.44  ? 546 HOH H O   1 
HETATM 9729  O  O   . HOH Q 6 .   ? 24.164  -31.132  -5.574  1.00 38.77  ? 550 HOH H O   1 
HETATM 9730  O  O   . HOH Q 6 .   ? 29.945  -53.906  7.512   1.00 44.11  ? 551 HOH H O   1 
HETATM 9731  O  O   . HOH Q 6 .   ? 28.250  -44.863  -56.098 1.00 57.23  ? 555 HOH H O   1 
HETATM 9732  O  O   . HOH Q 6 .   ? 30.882  -32.902  -14.563 1.00 50.08  ? 556 HOH H O   1 
HETATM 9733  O  O   . HOH Q 6 .   ? 26.535  -46.870  -59.071 1.00 55.31  ? 559 HOH H O   1 
HETATM 9734  O  O   . HOH Q 6 .   ? 16.875  -49.159  -59.036 1.00 51.53  ? 566 HOH H O   1 
HETATM 9735  O  O   . HOH Q 6 .   ? 38.535  -50.906  -44.623 1.00 50.70  ? 577 HOH H O   1 
HETATM 9736  O  O   . HOH Q 6 .   ? 24.437  -56.779  -56.274 1.00 35.84  ? 578 HOH H O   1 
HETATM 9737  O  O   . HOH Q 6 .   ? 30.897  -59.912  1.884   1.00 59.61  ? 579 HOH H O   1 
HETATM 9738  O  O   . HOH Q 6 .   ? 17.023  -50.406  -61.204 1.00 67.05  ? 586 HOH H O   1 
HETATM 9739  O  O   . HOH Q 6 .   ? 43.402  -46.120  -8.201  1.00 41.04  ? 589 HOH H O   1 
HETATM 9740  O  O   . HOH Q 6 .   ? 17.178  -31.420  -4.241  1.00 51.44  ? 594 HOH H O   1 
HETATM 9741  O  O   . HOH Q 6 .   ? 11.288  -54.711  -36.917 1.00 53.75  ? 597 HOH H O   1 
HETATM 9742  O  O   . HOH Q 6 .   ? 30.203  -58.883  -4.382  1.00 45.18  ? 604 HOH H O   1 
HETATM 9743  O  O   . HOH Q 6 .   ? 30.833  -38.165  -22.737 1.00 42.53  ? 606 HOH H O   1 
HETATM 9744  O  O   . HOH Q 6 .   ? 14.219  -46.741  -1.784  1.00 52.67  ? 622 HOH H O   1 
HETATM 9745  O  O   . HOH Q 6 .   ? 12.760  -39.281  -26.744 1.00 39.83  ? 637 HOH H O   1 
HETATM 9746  O  O   . HOH Q 6 .   ? 14.969  -63.088  -41.738 1.00 45.25  ? 640 HOH H O   1 
HETATM 9747  O  O   . HOH Q 6 .   ? 22.101  -56.808  -15.950 1.00 52.44  ? 641 HOH H O   1 
HETATM 9748  O  O   . HOH Q 6 .   ? 30.901  -37.177  4.187   1.00 54.05  ? 650 HOH H O   1 
HETATM 9749  O  O   . HOH Q 6 .   ? 13.016  -37.320  -28.901 1.00 48.00  ? 664 HOH H O   1 
HETATM 9750  O  O   . HOH Q 6 .   ? 9.628   -46.688  -22.587 1.00 48.99  ? 670 HOH H O   1 
HETATM 9751  O  O   . HOH Q 6 .   ? 16.631  -61.945  -57.432 1.00 48.26  ? 675 HOH H O   1 
HETATM 9752  O  O   . HOH Q 6 .   ? 13.308  -52.841  -6.082  1.00 47.86  ? 682 HOH H O   1 
HETATM 9753  O  O   . HOH Q 6 .   ? 13.352  -59.668  -52.759 1.00 58.35  ? 683 HOH H O   1 
HETATM 9754  O  O   . HOH Q 6 .   ? 19.859  -52.464  0.230   1.00 54.42  ? 693 HOH H O   1 
HETATM 9755  O  O   . HOH Q 6 .   ? 33.197  -50.329  -19.545 1.00 44.67  ? 694 HOH H O   1 
HETATM 9756  O  O   . HOH Q 6 .   ? 14.542  -54.901  -7.767  1.00 49.29  ? 696 HOH H O   1 
HETATM 9757  O  O   . HOH Q 6 .   ? 24.334  -55.314  -29.745 1.00 46.72  ? 697 HOH H O   1 
HETATM 9758  O  O   . HOH Q 6 .   ? 7.244   -59.132  -29.070 1.00 39.39  ? 700 HOH H O   1 
HETATM 9759  O  O   . HOH R 6 .   ? 37.630  -30.114  -37.645 1.00 46.82  ? 213 HOH L O   1 
HETATM 9760  O  O   . HOH R 6 .   ? 13.512  -48.533  -53.935 1.00 41.92  ? 214 HOH L O   1 
HETATM 9761  O  O   . HOH R 6 .   ? 48.545  -39.118  -43.109 1.00 37.82  ? 215 HOH L O   1 
HETATM 9762  O  O   . HOH R 6 .   ? 49.127  -42.625  -7.204  1.00 36.84  ? 216 HOH L O   1 
HETATM 9763  O  O   . HOH R 6 .   ? 48.042  -31.768  -12.106 1.00 26.59  ? 217 HOH L O   1 
HETATM 9764  O  O   . HOH R 6 .   ? 22.961  -32.540  -37.100 1.00 30.89  ? 218 HOH L O   1 
HETATM 9765  O  O   . HOH R 6 .   ? 50.190  -39.742  -36.112 1.00 38.63  ? 219 HOH L O   1 
HETATM 9766  O  O   . HOH R 6 .   ? 44.452  -29.031  -32.271 1.00 40.20  ? 220 HOH L O   1 
HETATM 9767  O  O   . HOH R 6 .   ? 23.182  -42.115  -40.416 1.00 27.01  ? 221 HOH L O   1 
HETATM 9768  O  O   . HOH R 6 .   ? 33.529  -28.290  -12.633 1.00 33.68  ? 222 HOH L O   1 
HETATM 9769  O  O   . HOH R 6 .   ? 49.725  -27.416  -2.890  1.00 30.48  ? 223 HOH L O   1 
HETATM 9770  O  O   . HOH R 6 .   ? 37.753  -33.172  1.144   1.00 27.59  ? 224 HOH L O   1 
HETATM 9771  O  O   . HOH R 6 .   ? 14.428  -44.839  -47.958 1.00 38.91  ? 225 HOH L O   1 
HETATM 9772  O  O   . HOH R 6 .   ? 40.448  -19.175  -3.138  1.00 47.42  ? 226 HOH L O   1 
HETATM 9773  O  O   . HOH R 6 .   ? 52.258  -48.359  -22.254 1.00 51.27  ? 227 HOH L O   1 
HETATM 9774  O  O   . HOH R 6 .   ? 31.536  -32.040  -11.932 1.00 37.18  ? 228 HOH L O   1 
HETATM 9775  O  O   . HOH R 6 .   ? 51.256  -30.009  -5.985  1.00 40.39  ? 229 HOH L O   1 
HETATM 9776  O  O   . HOH R 6 .   ? 39.699  -35.802  -0.837  1.00 18.47  ? 230 HOH L O   1 
HETATM 9777  O  O   . HOH R 6 .   ? 36.886  -23.039  -13.206 1.00 43.02  ? 231 HOH L O   1 
HETATM 9778  O  O   . HOH R 6 .   ? 47.273  -29.455  -0.727  1.00 27.13  ? 232 HOH L O   1 
HETATM 9779  O  O   . HOH R 6 .   ? 55.661  -44.068  -21.345 1.00 44.74  ? 233 HOH L O   1 
HETATM 9780  O  O   . HOH R 6 .   ? 16.709  -35.598  -41.020 1.00 27.63  ? 234 HOH L O   1 
HETATM 9781  O  O   . HOH R 6 .   ? 17.288  -37.632  -39.309 1.00 38.94  ? 235 HOH L O   1 
HETATM 9782  O  O   . HOH R 6 .   ? 25.578  -40.444  -55.746 1.00 42.54  ? 236 HOH L O   1 
HETATM 9783  O  O   . HOH R 6 .   ? 41.461  -35.181  -35.343 1.00 49.84  ? 237 HOH L O   1 
HETATM 9784  O  O   . HOH R 6 .   ? 7.405   -40.728  -55.369 1.00 39.21  ? 238 HOH L O   1 
HETATM 9785  O  O   . HOH R 6 .   ? 18.007  -44.915  -52.581 1.00 38.40  ? 239 HOH L O   1 
HETATM 9786  O  O   . HOH R 6 .   ? 56.645  -37.608  -18.771 1.00 40.78  ? 240 HOH L O   1 
HETATM 9787  O  O   . HOH R 6 .   ? 39.773  -33.369  -37.167 1.00 36.15  ? 241 HOH L O   1 
HETATM 9788  O  O   . HOH R 6 .   ? 35.416  -43.426  -39.693 1.00 28.74  ? 242 HOH L O   1 
HETATM 9789  O  O   . HOH R 6 .   ? 9.924   -28.904  -59.691 1.00 41.84  ? 243 HOH L O   1 
HETATM 9790  O  O   . HOH R 6 .   ? 52.107  -31.305  -16.550 1.00 32.01  ? 244 HOH L O   1 
HETATM 9791  O  O   . HOH R 6 .   ? 18.504  -28.992  -43.803 1.00 37.57  ? 245 HOH L O   1 
HETATM 9792  O  O   . HOH R 6 .   ? 22.429  -39.014  -58.813 1.00 47.51  ? 246 HOH L O   1 
HETATM 9793  O  O   . HOH R 6 .   ? 37.251  -28.807  -43.729 1.00 27.27  ? 247 HOH L O   1 
HETATM 9794  O  O   . HOH R 6 .   ? 36.321  -43.186  -42.225 1.00 26.51  ? 248 HOH L O   1 
HETATM 9795  O  O   . HOH R 6 .   ? 18.102  -28.337  -55.872 1.00 44.77  ? 249 HOH L O   1 
HETATM 9796  O  O   . HOH R 6 .   ? 29.481  -33.534  -58.590 1.00 49.18  ? 250 HOH L O   1 
HETATM 9797  O  O   . HOH R 6 .   ? 33.892  -39.187  -22.413 1.00 38.11  ? 251 HOH L O   1 
HETATM 9798  O  O   . HOH R 6 .   ? 22.580  -38.657  -40.948 1.00 33.09  ? 252 HOH L O   1 
HETATM 9799  O  O   . HOH R 6 .   ? 23.772  -31.346  -42.854 1.00 41.29  ? 253 HOH L O   1 
HETATM 9800  O  O   . HOH R 6 .   ? 53.446  -36.473  -12.442 1.00 28.20  ? 254 HOH L O   1 
HETATM 9801  O  O   . HOH R 6 .   ? 12.275  -41.229  -55.646 1.00 48.78  ? 255 HOH L O   1 
HETATM 9802  O  O   . HOH R 6 .   ? 0.783   -42.081  -47.907 1.00 44.55  ? 256 HOH L O   1 
HETATM 9803  O  O   . HOH R 6 .   ? 34.275  -43.603  -50.892 1.00 34.97  ? 257 HOH L O   1 
HETATM 9804  O  O   . HOH R 6 .   ? 47.065  -44.548  -22.585 1.00 37.30  ? 258 HOH L O   1 
HETATM 9805  O  O   . HOH R 6 .   ? 41.736  -45.880  -19.473 1.00 30.03  ? 259 HOH L O   1 
HETATM 9806  O  O   . HOH R 6 .   ? 12.525  -49.939  -52.114 1.00 44.83  ? 260 HOH L O   1 
HETATM 9807  O  O   . HOH R 6 .   ? 9.778   -43.589  -43.084 1.00 38.68  ? 261 HOH L O   1 
HETATM 9808  O  O   . HOH R 6 .   ? 41.849  -24.386  -18.318 1.00 43.12  ? 266 HOH L O   1 
HETATM 9809  O  O   . HOH R 6 .   ? 28.164  -26.713  -48.537 1.00 44.00  ? 268 HOH L O   1 
HETATM 9810  O  O   . HOH R 6 .   ? 31.813  -40.193  -55.388 1.00 46.87  ? 279 HOH L O   1 
HETATM 9811  O  O   . HOH R 6 .   ? 34.663  -37.130  -24.722 1.00 37.75  ? 296 HOH L O   1 
HETATM 9812  O  O   . HOH R 6 .   ? 37.379  -40.323  -26.507 1.00 54.17  ? 298 HOH L O   1 
HETATM 9813  O  O   . HOH R 6 .   ? 35.608  -49.996  -18.040 1.00 48.23  ? 299 HOH L O   1 
HETATM 9814  O  O   . HOH R 6 .   ? 36.839  -28.882  1.929   1.00 40.24  ? 307 HOH L O   1 
HETATM 9815  O  O   . HOH R 6 .   ? 35.663  -29.662  -56.101 1.00 47.89  ? 316 HOH L O   1 
HETATM 9816  O  O   . HOH R 6 .   ? 17.336  -42.598  -48.602 1.00 35.40  ? 320 HOH L O   1 
HETATM 9817  O  O   . HOH R 6 .   ? 8.462   -31.943  -45.644 1.00 49.58  ? 324 HOH L O   1 
HETATM 9818  O  O   . HOH R 6 .   ? 39.230  -50.105  -40.000 1.00 50.00  ? 343 HOH L O   1 
HETATM 9819  O  O   . HOH R 6 .   ? 33.914  -42.005  -55.429 1.00 49.52  ? 348 HOH L O   1 
HETATM 9820  O  O   . HOH R 6 .   ? 35.428  -26.197  1.065   1.00 54.64  ? 351 HOH L O   1 
HETATM 9821  O  O   . HOH R 6 .   ? 55.028  -35.920  -19.153 1.00 32.46  ? 355 HOH L O   1 
HETATM 9822  O  O   . HOH R 6 .   ? 43.722  -31.613  -50.842 1.00 36.33  ? 356 HOH L O   1 
HETATM 9823  O  O   . HOH R 6 .   ? 52.087  -45.613  -30.666 1.00 39.25  ? 358 HOH L O   1 
HETATM 9824  O  O   . HOH R 6 .   ? 14.665  -39.566  -41.926 1.00 51.13  ? 361 HOH L O   1 
HETATM 9825  O  O   . HOH R 6 .   ? 47.007  -46.040  -5.424  1.00 30.24  ? 364 HOH L O   1 
HETATM 9826  O  O   . HOH R 6 .   ? 54.426  -32.211  -15.997 1.00 45.51  ? 365 HOH L O   1 
HETATM 9827  O  O   . HOH R 6 .   ? 38.276  -48.065  -14.747 1.00 41.88  ? 371 HOH L O   1 
HETATM 9828  O  O   . HOH R 6 .   ? 36.961  -40.576  -32.903 1.00 44.62  ? 378 HOH L O   1 
HETATM 9829  O  O   . HOH R 6 .   ? 31.239  -28.625  -11.568 1.00 59.63  ? 390 HOH L O   1 
HETATM 9830  O  O   . HOH R 6 .   ? 35.998  -46.828  -46.684 1.00 56.26  ? 395 HOH L O   1 
HETATM 9831  O  O   . HOH R 6 .   ? 21.101  -41.768  -42.111 1.00 33.02  ? 400 HOH L O   1 
HETATM 9832  O  O   . HOH R 6 .   ? 52.503  -32.171  -6.275  1.00 38.50  ? 401 HOH L O   1 
HETATM 9833  O  O   . HOH R 6 .   ? 21.988  -30.735  -38.470 1.00 54.17  ? 404 HOH L O   1 
HETATM 9834  O  O   . HOH R 6 .   ? 21.966  -33.949  -35.707 1.00 47.10  ? 415 HOH L O   1 
HETATM 9835  O  O   . HOH R 6 .   ? 29.202  -27.235  -55.830 1.00 49.30  ? 420 HOH L O   1 
HETATM 9836  O  O   . HOH R 6 .   ? 54.252  -49.000  -13.012 1.00 72.83  ? 422 HOH L O   1 
HETATM 9837  O  O   . HOH R 6 .   ? 53.377  -45.593  -13.017 1.00 41.73  ? 423 HOH L O   1 
HETATM 9838  O  O   . HOH R 6 .   ? 41.956  -52.099  -36.846 1.00 60.01  ? 427 HOH L O   1 
HETATM 9839  O  O   . HOH R 6 .   ? 34.439  -21.967  -5.756  1.00 51.40  ? 428 HOH L O   1 
HETATM 9840  O  O   . HOH R 6 .   ? 43.147  -43.816  -36.364 1.00 36.65  ? 432 HOH L O   1 
HETATM 9841  O  O   . HOH R 6 .   ? 54.361  -39.436  -35.997 1.00 37.03  ? 433 HOH L O   1 
HETATM 9842  O  O   . HOH R 6 .   ? 39.289  -45.601  -19.952 1.00 29.02  ? 444 HOH L O   1 
HETATM 9843  O  O   . HOH R 6 .   ? 56.056  -32.352  -29.760 1.00 41.12  ? 445 HOH L O   1 
HETATM 9844  O  O   . HOH R 6 .   ? 48.775  -24.418  -3.175  1.00 39.98  ? 449 HOH L O   1 
HETATM 9845  O  O   . HOH R 6 .   ? 33.492  -27.662  -16.955 1.00 52.70  ? 456 HOH L O   1 
HETATM 9846  O  O   . HOH R 6 .   ? 7.356   -48.008  -45.764 1.00 44.50  ? 462 HOH L O   1 
HETATM 9847  O  O   . HOH R 6 .   ? 29.926  -39.787  -33.232 1.00 49.18  ? 464 HOH L O   1 
HETATM 9848  O  O   . HOH R 6 .   ? 27.672  -38.140  -34.746 1.00 36.27  ? 465 HOH L O   1 
HETATM 9849  O  O   . HOH R 6 .   ? 3.563   -31.768  -45.393 1.00 47.88  ? 466 HOH L O   1 
HETATM 9850  O  O   . HOH R 6 .   ? 20.090  -34.261  -60.884 1.00 48.23  ? 469 HOH L O   1 
HETATM 9851  O  O   . HOH R 6 .   ? 43.502  -48.072  -26.292 1.00 38.14  ? 472 HOH L O   1 
HETATM 9852  O  O   . HOH R 6 .   ? 49.486  -29.406  -26.316 1.00 42.99  ? 478 HOH L O   1 
HETATM 9853  O  O   . HOH R 6 .   ? 3.081   -36.774  -47.031 1.00 45.21  ? 479 HOH L O   1 
HETATM 9854  O  O   . HOH R 6 .   ? 34.959  -27.361  -50.606 1.00 36.38  ? 489 HOH L O   1 
HETATM 9855  O  O   . HOH R 6 .   ? 37.864  -48.230  -26.287 1.00 45.42  ? 492 HOH L O   1 
HETATM 9856  O  O   . HOH R 6 .   ? 38.244  -30.996  -55.387 1.00 45.56  ? 494 HOH L O   1 
HETATM 9857  O  O   . HOH R 6 .   ? 55.783  -36.528  -33.494 1.00 44.55  ? 497 HOH L O   1 
HETATM 9858  O  O   . HOH R 6 .   ? 33.141  -36.792  -54.621 1.00 33.22  ? 500 HOH L O   1 
HETATM 9859  O  O   . HOH R 6 .   ? 31.687  -32.735  -38.884 1.00 50.41  ? 501 HOH L O   1 
HETATM 9860  O  O   . HOH R 6 .   ? 29.986  -30.452  -57.893 1.00 55.08  ? 528 HOH L O   1 
HETATM 9861  O  O   . HOH R 6 .   ? 57.696  -36.075  -28.146 1.00 43.54  ? 540 HOH L O   1 
HETATM 9862  O  O   . HOH R 6 .   ? 49.867  -22.045  -6.459  1.00 52.90  ? 568 HOH L O   1 
HETATM 9863  O  O   . HOH R 6 .   ? 50.735  -26.376  -13.995 1.00 41.94  ? 570 HOH L O   1 
HETATM 9864  O  O   . HOH R 6 .   ? 20.212  -44.756  -54.699 1.00 46.82  ? 582 HOH L O   1 
HETATM 9865  O  O   . HOH R 6 .   ? 2.529   -39.147  -56.987 1.00 50.36  ? 583 HOH L O   1 
HETATM 9866  O  O   . HOH R 6 .   ? 53.928  -39.523  -5.737  1.00 51.95  ? 600 HOH L O   1 
HETATM 9867  O  O   . HOH R 6 .   ? 43.953  -26.886  -28.835 1.00 52.41  ? 610 HOH L O   1 
HETATM 9868  O  O   . HOH R 6 .   ? 51.040  -33.391  -4.448  1.00 45.47  ? 611 HOH L O   1 
HETATM 9869  O  O   . HOH R 6 .   ? 52.966  -25.228  -8.543  1.00 51.80  ? 617 HOH L O   1 
HETATM 9870  O  O   . HOH R 6 .   ? 32.610  -29.117  -4.358  1.00 44.93  ? 618 HOH L O   1 
HETATM 9871  O  O   . HOH R 6 .   ? 53.451  -45.309  -10.388 1.00 50.97  ? 626 HOH L O   1 
HETATM 9872  O  O   . HOH R 6 .   ? 38.070  -45.286  -43.473 1.00 55.77  ? 630 HOH L O   1 
HETATM 9873  O  O   . HOH R 6 .   ? 37.818  -48.468  -37.357 1.00 57.51  ? 634 HOH L O   1 
HETATM 9874  O  O   . HOH R 6 .   ? 56.130  -46.754  -20.210 1.00 47.64  ? 638 HOH L O   1 
HETATM 9875  O  O   . HOH R 6 .   ? 37.841  -18.890  -12.364 1.00 47.74  ? 647 HOH L O   1 
HETATM 9876  O  O   . HOH R 6 .   ? 29.205  -32.804  -9.374  1.00 57.53  ? 653 HOH L O   1 
HETATM 9877  O  O   . HOH R 6 .   ? 31.860  -28.821  -39.278 1.00 48.96  ? 654 HOH L O   1 
HETATM 9878  O  O   . HOH R 6 .   ? 39.410  -43.607  -26.740 1.00 39.38  ? 662 HOH L O   1 
HETATM 9879  O  O   . HOH R 6 .   ? 47.301  -48.235  -13.853 1.00 53.96  ? 665 HOH L O   1 
HETATM 9880  O  O   . HOH R 6 .   ? 32.044  -44.719  -35.520 1.00 47.79  ? 673 HOH L O   1 
HETATM 9881  O  O   . HOH R 6 .   ? 38.771  -28.303  -39.045 1.00 51.33  ? 676 HOH L O   1 
HETATM 9882  O  O   . HOH R 6 .   ? 4.690   -55.608  -49.699 1.00 48.12  ? 684 HOH L O   1 
HETATM 9883  O  O   . HOH R 6 .   ? 37.454  -40.119  -49.668 1.00 49.98  ? 688 HOH L O   1 
HETATM 9884  O  O   . HOH R 6 .   ? 24.942  -42.673  -54.708 1.00 52.72  ? 689 HOH L O   1 
HETATM 9885  O  O   . HOH R 6 .   ? 46.746  -29.616  -46.702 1.00 44.77  ? 698 HOH L O   1 
HETATM 9886  O  O   . HOH R 6 .   ? 44.675  -29.729  -48.676 1.00 35.44  ? 699 HOH L O   1 
HETATM 9887  O  O   . HOH S 6 .   ? 22.457  -74.475  6.361   1.00 23.43  ? 222 HOH X O   1 
HETATM 9888  O  O   . HOH S 6 .   ? 36.045  -61.162  -4.260  1.00 38.17  ? 223 HOH X O   1 
HETATM 9889  O  O   . HOH S 6 .   ? 23.081  -72.430  -1.266  1.00 22.86  ? 224 HOH X O   1 
HETATM 9890  O  O   . HOH S 6 .   ? 37.424  -73.905  10.474  1.00 37.97  ? 225 HOH X O   1 
HETATM 9891  O  O   . HOH S 6 .   ? 41.511  -78.299  -29.048 1.00 46.15  ? 226 HOH X O   1 
HETATM 9892  O  O   . HOH S 6 .   ? 35.592  -61.286  -56.112 1.00 48.32  ? 227 HOH X O   1 
HETATM 9893  O  O   . HOH S 6 .   ? 32.036  -81.262  2.809   1.00 37.51  ? 228 HOH X O   1 
HETATM 9894  O  O   . HOH S 6 .   ? 35.365  -74.695  -18.495 1.00 40.07  ? 229 HOH X O   1 
HETATM 9895  O  O   . HOH S 6 .   ? 41.612  -59.160  -39.790 1.00 43.26  ? 230 HOH X O   1 
HETATM 9896  O  O   . HOH S 6 .   ? 39.632  -85.493  -14.114 1.00 45.03  ? 231 HOH X O   1 
HETATM 9897  O  O   . HOH S 6 .   ? 31.268  -73.464  -43.232 1.00 46.87  ? 232 HOH X O   1 
HETATM 9898  O  O   . HOH S 6 .   ? 27.165  -81.400  5.355   1.00 23.17  ? 233 HOH X O   1 
HETATM 9899  O  O   . HOH S 6 .   ? 38.370  -86.657  -4.907  1.00 34.43  ? 234 HOH X O   1 
HETATM 9900  O  O   . HOH S 6 .   ? 37.174  -69.867  -34.459 1.00 42.94  ? 235 HOH X O   1 
HETATM 9901  O  O   . HOH S 6 .   ? 30.307  -68.036  -11.486 1.00 32.91  ? 236 HOH X O   1 
HETATM 9902  O  O   . HOH S 6 .   ? 40.604  -64.735  -9.532  1.00 43.79  ? 237 HOH X O   1 
HETATM 9903  O  O   . HOH S 6 .   ? 36.723  -79.158  -17.800 1.00 40.70  ? 238 HOH X O   1 
HETATM 9904  O  O   . HOH S 6 .   ? 27.740  -67.572  -11.601 1.00 39.02  ? 239 HOH X O   1 
HETATM 9905  O  O   . HOH S 6 .   ? 34.831  -85.646  -7.131  1.00 32.24  ? 240 HOH X O   1 
HETATM 9906  O  O   . HOH S 6 .   ? 35.527  -64.681  -36.353 1.00 40.45  ? 241 HOH X O   1 
HETATM 9907  O  O   . HOH S 6 .   ? 39.561  -63.327  -50.836 1.00 52.87  ? 242 HOH X O   1 
HETATM 9908  O  O   . HOH S 6 .   ? 27.062  -69.962  -3.408  1.00 47.61  ? 243 HOH X O   1 
HETATM 9909  O  O   . HOH S 6 .   ? 51.374  -75.952  -0.731  1.00 51.33  ? 247 HOH X O   1 
HETATM 9910  O  O   . HOH S 6 .   ? 40.456  -88.080  -5.892  1.00 38.75  ? 250 HOH X O   1 
HETATM 9911  O  O   . HOH S 6 .   ? 44.887  -72.577  4.956   1.00 37.34  ? 260 HOH X O   1 
HETATM 9912  O  O   . HOH S 6 .   ? 41.615  -63.271  -49.154 1.00 50.84  ? 262 HOH X O   1 
HETATM 9913  O  O   . HOH S 6 .   ? 36.985  -89.639  -14.931 1.00 64.66  ? 267 HOH X O   1 
HETATM 9914  O  O   . HOH S 6 .   ? 58.599  -73.185  -8.216  1.00 72.57  ? 269 HOH X O   1 
HETATM 9915  O  O   . HOH S 6 .   ? 40.904  -89.157  -1.130  1.00 47.70  ? 271 HOH X O   1 
HETATM 9916  O  O   . HOH S 6 .   ? 51.766  -68.822  -8.781  1.00 50.15  ? 280 HOH X O   1 
HETATM 9917  O  O   . HOH S 6 .   ? 27.285  -72.550  -11.296 1.00 39.57  ? 281 HOH X O   1 
HETATM 9918  O  O   . HOH S 6 .   ? 46.533  -66.725  -8.383  1.00 36.74  ? 283 HOH X O   1 
HETATM 9919  O  O   . HOH S 6 .   ? 42.638  -69.785  5.162   1.00 35.45  ? 284 HOH X O   1 
HETATM 9920  O  O   . HOH S 6 .   ? 46.721  -71.340  -0.428  1.00 36.74  ? 288 HOH X O   1 
HETATM 9921  O  O   . HOH S 6 .   ? 29.716  -67.103  -55.466 1.00 37.17  ? 291 HOH X O   1 
HETATM 9922  O  O   . HOH S 6 .   ? 53.138  -86.642  -1.972  1.00 49.71  ? 295 HOH X O   1 
HETATM 9923  O  O   . HOH S 6 .   ? 33.689  -71.536  -18.770 1.00 56.00  ? 300 HOH X O   1 
HETATM 9924  O  O   . HOH S 6 .   ? 46.134  -85.014  -16.051 1.00 38.35  ? 303 HOH X O   1 
HETATM 9925  O  O   . HOH S 6 .   ? 34.360  -59.451  2.390   1.00 47.70  ? 310 HOH X O   1 
HETATM 9926  O  O   . HOH S 6 .   ? 33.950  -81.427  6.594   1.00 43.37  ? 312 HOH X O   1 
HETATM 9927  O  O   . HOH S 6 .   ? 23.186  -63.918  -2.932  1.00 47.17  ? 325 HOH X O   1 
HETATM 9928  O  O   . HOH S 6 .   ? 25.294  -74.189  -10.520 1.00 35.49  ? 328 HOH X O   1 
HETATM 9929  O  O   . HOH S 6 .   ? 22.619  -70.809  0.697   1.00 35.72  ? 336 HOH X O   1 
HETATM 9930  O  O   . HOH S 6 .   ? 22.219  -60.038  -12.146 1.00 54.37  ? 339 HOH X O   1 
HETATM 9931  O  O   . HOH S 6 .   ? 28.317  -64.926  8.784   1.00 53.58  ? 345 HOH X O   1 
HETATM 9932  O  O   . HOH S 6 .   ? 30.862  -83.939  5.149   1.00 54.68  ? 357 HOH X O   1 
HETATM 9933  O  O   . HOH S 6 .   ? 33.080  -59.246  -51.165 1.00 42.68  ? 363 HOH X O   1 
HETATM 9934  O  O   . HOH S 6 .   ? 44.480  -75.791  -29.026 1.00 56.20  ? 370 HOH X O   1 
HETATM 9935  O  O   . HOH S 6 .   ? 44.395  -66.383  -15.486 1.00 52.52  ? 372 HOH X O   1 
HETATM 9936  O  O   . HOH S 6 .   ? 42.392  -89.087  -3.874  1.00 53.49  ? 374 HOH X O   1 
HETATM 9937  O  O   . HOH S 6 .   ? 34.452  -88.149  -11.125 1.00 42.45  ? 377 HOH X O   1 
HETATM 9938  O  O   . HOH S 6 .   ? 44.406  -62.033  0.804   1.00 45.57  ? 386 HOH X O   1 
HETATM 9939  O  O   . HOH S 6 .   ? 39.092  -80.479  -18.446 1.00 39.68  ? 405 HOH X O   1 
HETATM 9940  O  O   . HOH S 6 .   ? 42.607  -61.538  -50.753 1.00 61.76  ? 406 HOH X O   1 
HETATM 9941  O  O   . HOH S 6 .   ? 22.915  -65.484  -9.810  1.00 62.56  ? 407 HOH X O   1 
HETATM 9942  O  O   . HOH S 6 .   ? 49.717  -67.840  -10.349 1.00 56.64  ? 416 HOH X O   1 
HETATM 9943  O  O   . HOH S 6 .   ? 48.463  -78.110  -23.779 1.00 48.46  ? 424 HOH X O   1 
HETATM 9944  O  O   . HOH S 6 .   ? 47.551  -85.805  -9.033  1.00 54.40  ? 429 HOH X O   1 
HETATM 9945  O  O   . HOH S 6 .   ? 57.299  -75.689  -18.992 1.00 52.13  ? 431 HOH X O   1 
HETATM 9946  O  O   . HOH S 6 .   ? 42.421  -83.828  4.478   1.00 47.08  ? 436 HOH X O   1 
HETATM 9947  O  O   . HOH S 6 .   ? 33.683  -72.574  10.587  1.00 39.11  ? 439 HOH X O   1 
HETATM 9948  O  O   . HOH S 6 .   ? 46.127  -76.952  5.056   1.00 46.87  ? 457 HOH X O   1 
HETATM 9949  O  O   . HOH S 6 .   ? 45.724  -69.194  -57.403 1.00 69.17  ? 458 HOH X O   1 
HETATM 9950  O  O   . HOH S 6 .   ? 42.226  -65.132  -32.283 1.00 46.33  ? 459 HOH X O   1 
HETATM 9951  O  O   . HOH S 6 .   ? 35.450  -83.805  -19.647 1.00 41.97  ? 461 HOH X O   1 
HETATM 9952  O  O   . HOH S 6 .   ? 42.510  -78.385  9.433   1.00 42.70  ? 471 HOH X O   1 
HETATM 9953  O  O   . HOH S 6 .   ? 44.752  -63.236  -6.200  1.00 42.06  ? 505 HOH X O   1 
HETATM 9954  O  O   . HOH S 6 .   ? 49.078  -63.025  -22.991 1.00 64.75  ? 512 HOH X O   1 
HETATM 9955  O  O   . HOH S 6 .   ? 48.014  -67.174  -57.507 1.00 60.02  ? 515 HOH X O   1 
HETATM 9956  O  O   . HOH S 6 .   ? 33.689  -62.882  -8.944  1.00 48.28  ? 516 HOH X O   1 
HETATM 9957  O  O   . HOH S 6 .   ? 28.052  -66.595  -35.964 1.00 45.17  ? 519 HOH X O   1 
HETATM 9958  O  O   . HOH S 6 .   ? 30.084  -61.173  -15.387 1.00 51.01  ? 521 HOH X O   1 
HETATM 9959  O  O   . HOH S 6 .   ? 58.074  -72.261  -21.493 1.00 50.70  ? 525 HOH X O   1 
HETATM 9960  O  O   . HOH S 6 .   ? 43.210  -80.497  -35.656 1.00 41.08  ? 527 HOH X O   1 
HETATM 9961  O  O   . HOH S 6 .   ? 30.945  -79.562  4.268   1.00 32.43  ? 534 HOH X O   1 
HETATM 9962  O  O   . HOH S 6 .   ? 47.762  -72.744  -21.213 1.00 55.38  ? 536 HOH X O   1 
HETATM 9963  O  O   . HOH S 6 .   ? 47.280  -61.675  -3.759  1.00 61.31  ? 537 HOH X O   1 
HETATM 9964  O  O   . HOH S 6 .   ? 47.744  -74.436  -19.153 1.00 54.05  ? 539 HOH X O   1 
HETATM 9965  O  O   . HOH S 6 .   ? 28.405  -60.408  -10.203 1.00 43.56  ? 541 HOH X O   1 
HETATM 9966  O  O   . HOH S 6 .   ? 53.862  -87.530  -12.970 1.00 48.83  ? 542 HOH X O   1 
HETATM 9967  O  O   . HOH S 6 .   ? 30.532  -71.149  -14.365 1.00 44.65  ? 545 HOH X O   1 
HETATM 9968  O  O   . HOH S 6 .   ? 40.165  -75.647  -31.589 1.00 47.16  ? 547 HOH X O   1 
HETATM 9969  O  O   . HOH S 6 .   ? 32.222  -85.992  -13.139 1.00 51.92  ? 565 HOH X O   1 
HETATM 9970  O  O   . HOH S 6 .   ? 36.404  -74.405  -52.691 1.00 44.52  ? 572 HOH X O   1 
HETATM 9971  O  O   . HOH S 6 .   ? 21.268  -72.249  -3.687  1.00 35.19  ? 581 HOH X O   1 
HETATM 9972  O  O   . HOH S 6 .   ? 39.355  -70.132  -31.629 1.00 42.24  ? 588 HOH X O   1 
HETATM 9973  O  O   . HOH S 6 .   ? 34.281  -55.314  -51.817 1.00 47.78  ? 590 HOH X O   1 
HETATM 9974  O  O   . HOH S 6 .   ? 44.245  -80.238  6.925   1.00 51.53  ? 625 HOH X O   1 
HETATM 9975  O  O   . HOH S 6 .   ? 60.428  -78.506  -24.884 1.00 50.44  ? 629 HOH X O   1 
HETATM 9976  O  O   . HOH S 6 .   ? 45.669  -65.128  -10.103 1.00 48.54  ? 632 HOH X O   1 
HETATM 9977  O  O   . HOH S 6 .   ? 52.144  -90.166  -3.480  1.00 56.35  ? 642 HOH X O   1 
HETATM 9978  O  O   . HOH S 6 .   ? 49.531  -65.262  -7.270  1.00 51.56  ? 644 HOH X O   1 
HETATM 9979  O  O   . HOH S 6 .   ? 42.454  -55.727  -2.712  1.00 46.75  ? 652 HOH X O   1 
HETATM 9980  O  O   . HOH S 6 .   ? 42.748  -68.259  -16.376 1.00 58.13  ? 661 HOH X O   1 
HETATM 9981  O  O   . HOH S 6 .   ? 48.051  -75.224  -45.730 1.00 41.10  ? 666 HOH X O   1 
HETATM 9982  O  O   . HOH S 6 .   ? 41.628  -82.933  6.929   1.00 56.82  ? 671 HOH X O   1 
HETATM 9983  O  O   . HOH S 6 .   ? 33.980  -73.668  -34.926 1.00 49.42  ? 672 HOH X O   1 
HETATM 9984  O  O   . HOH S 6 .   ? 22.987  -66.242  3.940   1.00 59.98  ? 674 HOH X O   1 
HETATM 9985  O  O   . HOH S 6 .   ? 49.412  -81.372  -38.578 1.00 47.58  ? 677 HOH X O   1 
HETATM 9986  O  O   . HOH S 6 .   ? 37.836  -89.687  -22.504 1.00 51.09  ? 685 HOH X O   1 
HETATM 9987  O  O   . HOH S 6 .   ? 32.022  -62.701  3.094   1.00 44.75  ? 692 HOH X O   1 
HETATM 9988  O  O   . HOH T 6 .   ? 17.056  -87.964  -9.608  1.00 22.14  ? 213 HOH Y O   1 
HETATM 9989  O  O   . HOH T 6 .   ? 10.870  -84.071  -17.516 1.00 26.98  ? 214 HOH Y O   1 
HETATM 9990  O  O   . HOH T 6 .   ? 25.174  -83.035  1.449   1.00 20.05  ? 215 HOH Y O   1 
HETATM 9991  O  O   . HOH T 6 .   ? 12.005  -82.867  -10.853 1.00 18.58  ? 216 HOH Y O   1 
HETATM 9992  O  O   . HOH T 6 .   ? 21.576  -93.619  -28.566 1.00 45.33  ? 217 HOH Y O   1 
HETATM 9993  O  O   . HOH T 6 .   ? 20.695  -92.129  6.356   1.00 45.82  ? 218 HOH Y O   1 
HETATM 9994  O  O   . HOH T 6 .   ? 33.819  -77.947  -32.276 1.00 41.52  ? 219 HOH Y O   1 
HETATM 9995  O  O   . HOH T 6 .   ? 38.357  -82.575  -57.566 1.00 44.52  ? 220 HOH Y O   1 
HETATM 9996  O  O   . HOH T 6 .   ? 16.738  -82.959  -34.282 1.00 33.95  ? 221 HOH Y O   1 
HETATM 9997  O  O   . HOH T 6 .   ? 13.619  -88.729  -3.814  1.00 37.07  ? 222 HOH Y O   1 
HETATM 9998  O  O   . HOH T 6 .   ? 31.272  -92.504  -8.574  1.00 25.01  ? 223 HOH Y O   1 
HETATM 9999  O  O   . HOH T 6 .   ? 33.565  -87.475  -57.275 1.00 34.95  ? 224 HOH Y O   1 
HETATM 10000 O  O   . HOH T 6 .   ? 27.002  -85.333  3.857   1.00 19.83  ? 225 HOH Y O   1 
HETATM 10001 O  O   . HOH T 6 .   ? 32.710  -88.368  -13.326 1.00 40.52  ? 226 HOH Y O   1 
HETATM 10002 O  O   . HOH T 6 .   ? 22.742  -73.722  -7.655  1.00 37.34  ? 227 HOH Y O   1 
HETATM 10003 O  O   . HOH T 6 .   ? 10.862  -87.585  -13.339 1.00 26.99  ? 228 HOH Y O   1 
HETATM 10004 O  O   . HOH T 6 .   ? 27.664  -75.828  -18.770 1.00 34.24  ? 229 HOH Y O   1 
HETATM 10005 O  O   . HOH T 6 .   ? 28.909  -83.416  -51.709 1.00 38.42  ? 230 HOH Y O   1 
HETATM 10006 O  O   . HOH T 6 .   ? 26.518  -88.779  -35.285 1.00 40.27  ? 231 HOH Y O   1 
HETATM 10007 O  O   . HOH T 6 .   ? 11.027  -78.873  -8.556  1.00 27.48  ? 232 HOH Y O   1 
HETATM 10008 O  O   . HOH T 6 .   ? 17.400  -74.605  -3.955  1.00 27.85  ? 233 HOH Y O   1 
HETATM 10009 O  O   . HOH T 6 .   ? 13.955  -93.212  -10.715 1.00 37.98  ? 234 HOH Y O   1 
HETATM 10010 O  O   . HOH T 6 .   ? 12.845  -73.967  -12.917 1.00 33.36  ? 235 HOH Y O   1 
HETATM 10011 O  O   . HOH T 6 .   ? 19.937  -76.849  -21.613 1.00 41.66  ? 236 HOH Y O   1 
HETATM 10012 O  O   . HOH T 6 .   ? 33.596  -89.062  -8.629  1.00 32.03  ? 237 HOH Y O   1 
HETATM 10013 O  O   . HOH T 6 .   ? 15.356  -76.837  -30.134 1.00 27.53  ? 238 HOH Y O   1 
HETATM 10014 O  O   . HOH T 6 .   ? 27.939  -79.005  -24.919 1.00 43.13  ? 239 HOH Y O   1 
HETATM 10015 O  O   . HOH T 6 .   ? 30.438  -81.364  -22.075 1.00 39.82  ? 240 HOH Y O   1 
HETATM 10016 O  O   . HOH T 6 .   ? 28.895  -78.340  -38.866 1.00 31.43  ? 241 HOH Y O   1 
HETATM 10017 O  O   . HOH T 6 .   ? 51.297  -70.339  -51.326 1.00 54.26  ? 242 HOH Y O   1 
HETATM 10018 O  O   . HOH T 6 .   ? 30.967  -76.989  -33.721 1.00 51.14  ? 243 HOH Y O   1 
HETATM 10019 O  O   . HOH T 6 .   ? 33.825  -89.033  -37.553 1.00 46.67  ? 244 HOH Y O   1 
HETATM 10020 O  O   . HOH T 6 .   ? 31.175  -82.222  -52.312 1.00 37.50  ? 245 HOH Y O   1 
HETATM 10021 O  O   . HOH T 6 .   ? 24.418  -77.046  -25.943 1.00 34.84  ? 246 HOH Y O   1 
HETATM 10022 O  O   . HOH T 6 .   ? 28.739  -97.723  -0.855  1.00 33.44  ? 247 HOH Y O   1 
HETATM 10023 O  O   . HOH T 6 .   ? 35.853  -87.664  -5.730  1.00 43.78  ? 248 HOH Y O   1 
HETATM 10024 O  O   . HOH T 6 .   ? 19.105  -78.888  -42.810 1.00 38.64  ? 255 HOH Y O   1 
HETATM 10025 O  O   . HOH T 6 .   ? 25.739  -90.472  -29.228 1.00 46.24  ? 264 HOH Y O   1 
HETATM 10026 O  O   . HOH T 6 .   ? 29.533  -76.762  -46.942 1.00 49.83  ? 265 HOH Y O   1 
HETATM 10027 O  O   . HOH T 6 .   ? 31.480  -88.114  -20.090 1.00 46.54  ? 272 HOH Y O   1 
HETATM 10028 O  O   . HOH T 6 .   ? 11.401  -76.588  -21.037 1.00 33.14  ? 273 HOH Y O   1 
HETATM 10029 O  O   . HOH T 6 .   ? 12.421  -69.657  -13.694 1.00 60.63  ? 278 HOH Y O   1 
HETATM 10030 O  O   . HOH T 6 .   ? 16.070  -87.153  -36.750 1.00 40.52  ? 285 HOH Y O   1 
HETATM 10031 O  O   . HOH T 6 .   ? 30.967  -92.948  2.597   1.00 43.82  ? 286 HOH Y O   1 
HETATM 10032 O  O   . HOH T 6 .   ? 45.351  -79.452  -60.013 1.00 59.61  ? 292 HOH Y O   1 
HETATM 10033 O  O   . HOH T 6 .   ? 27.149  -79.774  -46.851 1.00 31.39  ? 301 HOH Y O   1 
HETATM 10034 O  O   . HOH T 6 .   ? 22.580  -96.790  -14.080 1.00 51.37  ? 302 HOH Y O   1 
HETATM 10035 O  O   . HOH T 6 .   ? 10.542  -79.315  -29.783 1.00 47.88  ? 304 HOH Y O   1 
HETATM 10036 O  O   . HOH T 6 .   ? 22.562  -94.992  -25.856 1.00 39.91  ? 306 HOH Y O   1 
HETATM 10037 O  O   . HOH T 6 .   ? 19.644  -102.821 -14.685 1.00 62.30  ? 308 HOH Y O   1 
HETATM 10038 O  O   . HOH T 6 .   ? 38.481  -78.924  -53.339 1.00 40.74  ? 311 HOH Y O   1 
HETATM 10039 O  O   . HOH T 6 .   ? 26.442  -72.633  -34.793 1.00 55.26  ? 313 HOH Y O   1 
HETATM 10040 O  O   . HOH T 6 .   ? 9.846   -86.326  -11.106 1.00 33.49  ? 326 HOH Y O   1 
HETATM 10041 O  O   . HOH T 6 .   ? 27.130  -75.762  -39.930 1.00 47.87  ? 347 HOH Y O   1 
HETATM 10042 O  O   . HOH T 6 .   ? 28.932  -92.025  4.751   1.00 40.38  ? 350 HOH Y O   1 
HETATM 10043 O  O   . HOH T 6 .   ? 12.563  -74.518  -10.375 1.00 44.86  ? 359 HOH Y O   1 
HETATM 10044 O  O   . HOH T 6 .   ? 42.911  -83.426  -39.707 1.00 55.35  ? 379 HOH Y O   1 
HETATM 10045 O  O   . HOH T 6 .   ? 50.801  -75.152  -45.976 1.00 40.92  ? 380 HOH Y O   1 
HETATM 10046 O  O   . HOH T 6 .   ? 11.516  -78.363  -4.999  1.00 49.01  ? 382 HOH Y O   1 
HETATM 10047 O  O   . HOH T 6 .   ? 13.206  -88.724  -14.162 1.00 38.22  ? 384 HOH Y O   1 
HETATM 10048 O  O   . HOH T 6 .   ? 11.011  -80.848  -12.691 1.00 38.04  ? 394 HOH Y O   1 
HETATM 10049 O  O   . HOH T 6 .   ? 24.894  -75.694  -18.649 1.00 36.97  ? 398 HOH Y O   1 
HETATM 10050 O  O   . HOH T 6 .   ? 27.411  -89.773  5.098   1.00 40.46  ? 403 HOH Y O   1 
HETATM 10051 O  O   . HOH T 6 .   ? 17.964  -80.829  -35.042 1.00 40.82  ? 410 HOH Y O   1 
HETATM 10052 O  O   . HOH T 6 .   ? 29.357  -75.189  -35.894 1.00 50.31  ? 411 HOH Y O   1 
HETATM 10053 O  O   . HOH T 6 .   ? 22.837  -79.442  -32.385 1.00 38.61  ? 413 HOH Y O   1 
HETATM 10054 O  O   . HOH T 6 .   ? 30.188  -78.511  -36.374 1.00 48.31  ? 419 HOH Y O   1 
HETATM 10055 O  O   . HOH T 6 .   ? 18.256  -80.551  -38.024 1.00 35.24  ? 421 HOH Y O   1 
HETATM 10056 O  O   . HOH T 6 .   ? 33.674  -89.147  -16.247 1.00 50.23  ? 425 HOH Y O   1 
HETATM 10057 O  O   . HOH T 6 .   ? 29.181  -94.438  -25.072 1.00 53.00  ? 434 HOH Y O   1 
HETATM 10058 O  O   . HOH T 6 .   ? 46.727  -74.193  -49.846 1.00 45.34  ? 443 HOH Y O   1 
HETATM 10059 O  O   . HOH T 6 .   ? 30.332  -90.434  -20.949 1.00 44.02  ? 447 HOH Y O   1 
HETATM 10060 O  O   . HOH T 6 .   ? 34.044  -93.899  -1.594  1.00 40.68  ? 451 HOH Y O   1 
HETATM 10061 O  O   . HOH T 6 .   ? 49.456  -77.435  -60.939 1.00 59.80  ? 454 HOH Y O   1 
HETATM 10062 O  O   . HOH T 6 .   ? 27.203  -84.092  -26.356 1.00 44.26  ? 468 HOH Y O   1 
HETATM 10063 O  O   . HOH T 6 .   ? 31.092  -71.579  -17.088 1.00 43.05  ? 488 HOH Y O   1 
HETATM 10064 O  O   . HOH T 6 .   ? 34.488  -88.293  -1.877  1.00 46.32  ? 495 HOH Y O   1 
HETATM 10065 O  O   . HOH T 6 .   ? 33.957  -77.774  -19.668 1.00 53.09  ? 498 HOH Y O   1 
HETATM 10066 O  O   . HOH T 6 .   ? 16.884  -70.003  -5.994  1.00 46.52  ? 506 HOH Y O   1 
HETATM 10067 O  O   . HOH T 6 .   ? 19.503  -71.545  -13.451 1.00 43.52  ? 510 HOH Y O   1 
HETATM 10068 O  O   . HOH T 6 .   ? 17.318  -75.009  -27.612 1.00 44.83  ? 523 HOH Y O   1 
HETATM 10069 O  O   . HOH T 6 .   ? 18.918  -72.823  -29.214 1.00 54.89  ? 543 HOH Y O   1 
HETATM 10070 O  O   . HOH T 6 .   ? 16.892  -95.535  -12.406 1.00 52.78  ? 548 HOH Y O   1 
HETATM 10071 O  O   . HOH T 6 .   ? 47.609  -77.784  -46.804 1.00 38.63  ? 558 HOH Y O   1 
HETATM 10072 O  O   . HOH T 6 .   ? 45.611  -94.746  -41.940 1.00 57.20  ? 567 HOH Y O   1 
HETATM 10073 O  O   . HOH T 6 .   ? 7.733   -82.330  -28.039 1.00 50.12  ? 569 HOH Y O   1 
HETATM 10074 O  O   . HOH T 6 .   ? 19.589  -73.506  -7.479  1.00 45.69  ? 571 HOH Y O   1 
HETATM 10075 O  O   . HOH T 6 .   ? 18.969  -72.880  -4.886  1.00 35.95  ? 576 HOH Y O   1 
HETATM 10076 O  O   . HOH T 6 .   ? 26.583  -88.798  -27.633 1.00 49.11  ? 580 HOH Y O   1 
HETATM 10077 O  O   . HOH T 6 .   ? 27.406  -94.270  4.230   1.00 32.46  ? 585 HOH Y O   1 
HETATM 10078 O  O   . HOH T 6 .   ? 29.320  -74.603  -24.988 1.00 42.55  ? 598 HOH Y O   1 
HETATM 10079 O  O   . HOH T 6 .   ? 17.221  -82.504  -39.320 1.00 49.40  ? 599 HOH Y O   1 
HETATM 10080 O  O   . HOH T 6 .   ? 14.195  -94.992  -6.950  1.00 49.60  ? 601 HOH Y O   1 
HETATM 10081 O  O   . HOH T 6 .   ? 11.359  -76.888  -7.284  1.00 43.95  ? 603 HOH Y O   1 
HETATM 10082 O  O   . HOH T 6 .   ? 19.372  -96.505  -11.626 1.00 52.98  ? 608 HOH Y O   1 
HETATM 10083 O  O   . HOH T 6 .   ? 16.629  -91.758  -23.276 1.00 46.82  ? 613 HOH Y O   1 
HETATM 10084 O  O   . HOH T 6 .   ? 48.420  -85.835  -40.476 1.00 47.93  ? 620 HOH Y O   1 
HETATM 10085 O  O   . HOH T 6 .   ? 14.742  -71.750  -18.503 1.00 49.61  ? 623 HOH Y O   1 
HETATM 10086 O  O   . HOH T 6 .   ? 31.804  -85.501  -21.728 1.00 50.31  ? 624 HOH Y O   1 
HETATM 10087 O  O   . HOH T 6 .   ? 27.462  -81.154  -51.977 1.00 40.56  ? 635 HOH Y O   1 
HETATM 10088 O  O   . HOH T 6 .   ? 26.904  -76.794  -46.589 1.00 58.92  ? 639 HOH Y O   1 
HETATM 10089 O  O   . HOH T 6 .   ? 32.182  -84.210  -32.277 1.00 42.71  ? 649 HOH Y O   1 
HETATM 10090 O  O   . HOH T 6 .   ? 33.572  -87.145  -18.155 1.00 53.11  ? 657 HOH Y O   1 
HETATM 10091 O  O   . HOH T 6 .   ? 27.897  -72.967  -13.715 1.00 48.72  ? 660 HOH Y O   1 
HETATM 10092 O  O   . HOH T 6 .   ? 29.453  -83.661  -30.785 1.00 46.88  ? 663 HOH Y O   1 
HETATM 10093 O  O   . HOH T 6 .   ? 19.206  -71.742  -9.307  1.00 47.21  ? 667 HOH Y O   1 
HETATM 10094 O  O   . HOH T 6 .   ? 23.579  -73.969  -25.204 1.00 53.56  ? 669 HOH Y O   1 
HETATM 10095 O  O   . HOH T 6 .   ? 27.254  -97.919  -8.609  1.00 46.43  ? 678 HOH Y O   1 
HETATM 10096 O  O   . HOH T 6 .   ? 44.603  -79.697  -40.021 1.00 45.22  ? 680 HOH Y O   1 
HETATM 10097 O  O   . HOH T 6 .   ? 10.491  -85.640  -31.733 1.00 42.46  ? 690 HOH Y O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
9373 S S  . SO4 J . ? 0.5256 0.0000 0.0000 0.0000 0.0000 0.0000 221 SO4 H S  
9374 O O1 . SO4 J . ? 0.5385 0.0000 0.0000 0.0000 0.0000 0.0000 221 SO4 H O1 
9375 O O2 . SO4 J . ? 0.5338 0.0000 0.0000 0.0000 0.0000 0.0000 221 SO4 H O2 
9376 O O3 . SO4 J . ? 0.5296 0.0000 0.0000 0.0000 0.0000 0.0000 221 SO4 H O3 
9377 O O4 . SO4 J . ? 0.5160 0.0000 0.0000 0.0000 0.0000 0.0000 221 SO4 H O4 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   128 128 GLY GLY A . n 
A 1 2   ASN 2   129 129 ASN ASN A . n 
A 1 3   VAL 3   130 130 VAL VAL A . n 
A 1 4   ASP 4   131 131 ASP ASP A . n 
A 1 5   LEU 5   132 132 LEU LEU A . n 
A 1 6   VAL 6   133 133 VAL VAL A . n 
A 1 7   PHE 7   134 134 PHE PHE A . n 
A 1 8   LEU 8   135 135 LEU LEU A . n 
A 1 9   PHE 9   136 136 PHE PHE A . n 
A 1 10  ASP 10  137 137 ASP ASP A . n 
A 1 11  GLY 11  138 138 GLY GLY A . n 
A 1 12  SER 12  139 139 SER SER A . n 
A 1 13  MET 13  140 140 MET MET A . n 
A 1 14  SER 14  141 141 SER SER A . n 
A 1 15  LEU 15  142 142 LEU LEU A . n 
A 1 16  GLN 16  143 143 GLN GLN A . n 
A 1 17  PRO 17  144 144 PRO PRO A . n 
A 1 18  ASP 18  145 145 ASP ASP A . n 
A 1 19  GLU 19  146 146 GLU GLU A . n 
A 1 20  PHE 20  147 147 PHE PHE A . n 
A 1 21  GLN 21  148 148 GLN GLN A . n 
A 1 22  LYS 22  149 149 LYS LYS A . n 
A 1 23  ILE 23  150 150 ILE ILE A . n 
A 1 24  LEU 24  151 151 LEU LEU A . n 
A 1 25  ASP 25  152 152 ASP ASP A . n 
A 1 26  PHE 26  153 153 PHE PHE A . n 
A 1 27  MET 27  154 154 MET MET A . n 
A 1 28  LYS 28  155 155 LYS LYS A . n 
A 1 29  ASP 29  156 156 ASP ASP A . n 
A 1 30  VAL 30  157 157 VAL VAL A . n 
A 1 31  MET 31  158 158 MET MET A . n 
A 1 32  LYS 32  159 159 LYS LYS A . n 
A 1 33  LYS 33  160 160 LYS LYS A . n 
A 1 34  CYS 34  161 161 CYS CYS A . n 
A 1 35  SER 35  162 162 SER SER A . n 
A 1 36  ASN 36  163 163 ASN ASN A . n 
A 1 37  THR 37  164 164 THR THR A . n 
A 1 38  SER 38  165 165 SER SER A . n 
A 1 39  TYR 39  166 166 TYR TYR A . n 
A 1 40  GLN 40  167 167 GLN GLN A . n 
A 1 41  PHE 41  168 168 PHE PHE A . n 
A 1 42  ALA 42  169 169 ALA ALA A . n 
A 1 43  ALA 43  170 170 ALA ALA A . n 
A 1 44  VAL 44  171 171 VAL VAL A . n 
A 1 45  GLN 45  172 172 GLN GLN A . n 
A 1 46  PHE 46  173 173 PHE PHE A . n 
A 1 47  SER 47  174 174 SER SER A . n 
A 1 48  THR 48  175 175 THR THR A . n 
A 1 49  SER 49  176 176 SER SER A . n 
A 1 50  TYR 50  177 177 TYR TYR A . n 
A 1 51  LYS 51  178 178 LYS LYS A . n 
A 1 52  THR 52  179 179 THR THR A . n 
A 1 53  GLU 53  180 180 GLU GLU A . n 
A 1 54  PHE 54  181 181 PHE PHE A . n 
A 1 55  ASP 55  182 182 ASP ASP A . n 
A 1 56  PHE 56  183 183 PHE PHE A . n 
A 1 57  SER 57  184 184 SER SER A . n 
A 1 58  ASP 58  185 185 ASP ASP A . n 
A 1 59  TYR 59  186 186 TYR TYR A . n 
A 1 60  VAL 60  187 187 VAL VAL A . n 
A 1 61  LYS 61  188 188 LYS LYS A . n 
A 1 62  TRP 62  189 189 TRP TRP A . n 
A 1 63  LYS 63  190 190 LYS LYS A . n 
A 1 64  ASP 64  191 191 ASP ASP A . n 
A 1 65  PRO 65  192 192 PRO PRO A . n 
A 1 66  ASP 66  193 193 ASP ASP A . n 
A 1 67  ALA 67  194 194 ALA ALA A . n 
A 1 68  LEU 68  195 195 LEU LEU A . n 
A 1 69  LEU 69  196 196 LEU LEU A . n 
A 1 70  LYS 70  197 197 LYS LYS A . n 
A 1 71  HIS 71  198 198 HIS HIS A . n 
A 1 72  VAL 72  199 199 VAL VAL A . n 
A 1 73  LYS 73  200 200 LYS LYS A . n 
A 1 74  HIS 74  201 201 HIS HIS A . n 
A 1 75  MET 75  202 202 MET MET A . n 
A 1 76  LEU 76  203 203 LEU LEU A . n 
A 1 77  LEU 77  204 204 LEU LEU A . n 
A 1 78  LEU 78  205 205 LEU LEU A . n 
A 1 79  THR 79  206 206 THR THR A . n 
A 1 80  ASN 80  207 207 ASN ASN A . n 
A 1 81  THR 81  208 208 THR THR A . n 
A 1 82  PHE 82  209 209 PHE PHE A . n 
A 1 83  GLY 83  210 210 GLY GLY A . n 
A 1 84  ALA 84  211 211 ALA ALA A . n 
A 1 85  ILE 85  212 212 ILE ILE A . n 
A 1 86  ASN 86  213 213 ASN ASN A . n 
A 1 87  TYR 87  214 214 TYR TYR A . n 
A 1 88  VAL 88  215 215 VAL VAL A . n 
A 1 89  ALA 89  216 216 ALA ALA A . n 
A 1 90  THR 90  217 217 THR THR A . n 
A 1 91  GLU 91  218 218 GLU GLU A . n 
A 1 92  VAL 92  219 219 VAL VAL A . n 
A 1 93  PHE 93  220 220 PHE PHE A . n 
A 1 94  ARG 94  221 221 ARG ARG A . n 
A 1 95  GLU 95  222 222 GLU GLU A . n 
A 1 96  GLU 96  223 223 GLU GLU A . n 
A 1 97  LEU 97  224 224 LEU LEU A . n 
A 1 98  GLY 98  225 225 GLY GLY A . n 
A 1 99  ALA 99  226 226 ALA ALA A . n 
A 1 100 ARG 100 227 227 ARG ARG A . n 
A 1 101 PRO 101 228 228 PRO PRO A . n 
A 1 102 ASP 102 229 229 ASP ASP A . n 
A 1 103 ALA 103 230 230 ALA ALA A . n 
A 1 104 THR 104 231 231 THR THR A . n 
A 1 105 LYS 105 232 232 LYS LYS A . n 
A 1 106 VAL 106 233 233 VAL VAL A . n 
A 1 107 LEU 107 234 234 LEU LEU A . n 
A 1 108 ILE 108 235 235 ILE ILE A . n 
A 1 109 ILE 109 236 236 ILE ILE A . n 
A 1 110 ILE 110 237 237 ILE ILE A . n 
A 1 111 THR 111 238 238 THR THR A . n 
A 1 112 ASP 112 239 239 ASP ASP A . n 
A 1 113 GLY 113 240 240 GLY GLY A . n 
A 1 114 GLU 114 241 241 GLU GLU A . n 
A 1 115 ALA 115 242 242 ALA ALA A . n 
A 1 116 THR 116 243 243 THR THR A . n 
A 1 117 ASP 117 244 244 ASP ASP A . n 
A 1 118 SER 118 245 245 SER SER A . n 
A 1 119 GLY 119 246 246 GLY GLY A . n 
A 1 120 ASN 120 247 247 ASN ASN A . n 
A 1 121 ILE 121 248 248 ILE ILE A . n 
A 1 122 ASP 122 249 249 ASP ASP A . n 
A 1 123 ALA 123 250 250 ALA ALA A . n 
A 1 124 ALA 124 251 251 ALA ALA A . n 
A 1 125 LYS 125 252 252 LYS LYS A . n 
A 1 126 ASP 126 253 253 ASP ASP A . n 
A 1 127 ILE 127 254 254 ILE ILE A . n 
A 1 128 ILE 128 255 255 ILE ILE A . n 
A 1 129 ARG 129 256 256 ARG ARG A . n 
A 1 130 TYR 130 257 257 TYR TYR A . n 
A 1 131 ILE 131 258 258 ILE ILE A . n 
A 1 132 ILE 132 259 259 ILE ILE A . n 
A 1 133 GLY 133 260 260 GLY GLY A . n 
A 1 134 ILE 134 261 261 ILE ILE A . n 
A 1 135 GLY 135 262 262 GLY GLY A . n 
A 1 136 LYS 136 263 263 LYS LYS A . n 
A 1 137 HIS 137 264 264 HIS HIS A . n 
A 1 138 PHE 138 265 265 PHE PHE A . n 
A 1 139 GLN 139 266 266 GLN GLN A . n 
A 1 140 THR 140 267 267 THR THR A . n 
A 1 141 LYS 141 268 268 LYS LYS A . n 
A 1 142 GLU 142 269 269 GLU GLU A . n 
A 1 143 SER 143 270 270 SER SER A . n 
A 1 144 GLN 144 271 271 GLN GLN A . n 
A 1 145 GLU 145 272 272 GLU GLU A . n 
A 1 146 THR 146 273 273 THR THR A . n 
A 1 147 LEU 147 274 274 LEU LEU A . n 
A 1 148 HIS 148 275 275 HIS HIS A . n 
A 1 149 LYS 149 276 276 LYS LYS A . n 
A 1 150 PHE 150 277 277 PHE PHE A . n 
A 1 151 ALA 151 278 278 ALA ALA A . n 
A 1 152 SER 152 279 279 SER SER A . n 
A 1 153 LYS 153 280 280 LYS LYS A . n 
A 1 154 PRO 154 281 281 PRO PRO A . n 
A 1 155 ALA 155 282 282 ALA ALA A . n 
A 1 156 SER 156 283 283 SER SER A . n 
A 1 157 GLU 157 284 284 GLU GLU A . n 
A 1 158 PHE 158 285 285 PHE PHE A . n 
A 1 159 VAL 159 286 286 VAL VAL A . n 
A 1 160 LYS 160 287 287 LYS LYS A . n 
A 1 161 ILE 161 288 288 ILE ILE A . n 
A 1 162 LEU 162 289 289 LEU LEU A . n 
A 1 163 ASP 163 290 290 ASP ASP A . n 
A 1 164 THR 164 291 291 THR THR A . n 
A 1 165 PHE 165 292 292 PHE PHE A . n 
A 1 166 GLU 166 293 293 GLU GLU A . n 
A 1 167 LYS 167 294 294 LYS LYS A . n 
A 1 168 LEU 168 295 295 LEU LEU A . n 
A 1 169 LYS 169 296 296 LYS LYS A . n 
A 1 170 ASP 170 297 297 ASP ASP A . n 
A 1 171 LEU 171 298 298 LEU LEU A . n 
A 1 172 CYS 172 299 299 CYS CYS A . n 
A 1 173 THR 173 300 300 THR THR A . n 
A 1 174 GLU 174 301 301 GLU GLU A . n 
A 1 175 LEU 175 302 302 LEU LEU A . n 
A 1 176 GLN 176 303 303 GLN GLN A . n 
A 1 177 LYS 177 304 304 LYS LYS A . n 
A 1 178 LYS 178 305 305 LYS LYS A . n 
A 1 179 ILE 179 306 306 ILE ILE A . n 
A 1 180 TYR 180 307 307 TYR TYR A . n 
B 1 1   GLY 1   128 128 GLY GLY B . n 
B 1 2   ASN 2   129 129 ASN ASN B . n 
B 1 3   VAL 3   130 130 VAL VAL B . n 
B 1 4   ASP 4   131 131 ASP ASP B . n 
B 1 5   LEU 5   132 132 LEU LEU B . n 
B 1 6   VAL 6   133 133 VAL VAL B . n 
B 1 7   PHE 7   134 134 PHE PHE B . n 
B 1 8   LEU 8   135 135 LEU LEU B . n 
B 1 9   PHE 9   136 136 PHE PHE B . n 
B 1 10  ASP 10  137 137 ASP ASP B . n 
B 1 11  GLY 11  138 138 GLY GLY B . n 
B 1 12  SER 12  139 139 SER SER B . n 
B 1 13  MET 13  140 140 MET MET B . n 
B 1 14  SER 14  141 141 SER SER B . n 
B 1 15  LEU 15  142 142 LEU LEU B . n 
B 1 16  GLN 16  143 143 GLN GLN B . n 
B 1 17  PRO 17  144 144 PRO PRO B . n 
B 1 18  ASP 18  145 145 ASP ASP B . n 
B 1 19  GLU 19  146 146 GLU GLU B . n 
B 1 20  PHE 20  147 147 PHE PHE B . n 
B 1 21  GLN 21  148 148 GLN GLN B . n 
B 1 22  LYS 22  149 149 LYS LYS B . n 
B 1 23  ILE 23  150 150 ILE ILE B . n 
B 1 24  LEU 24  151 151 LEU LEU B . n 
B 1 25  ASP 25  152 152 ASP ASP B . n 
B 1 26  PHE 26  153 153 PHE PHE B . n 
B 1 27  MET 27  154 154 MET MET B . n 
B 1 28  LYS 28  155 155 LYS LYS B . n 
B 1 29  ASP 29  156 156 ASP ASP B . n 
B 1 30  VAL 30  157 157 VAL VAL B . n 
B 1 31  MET 31  158 158 MET MET B . n 
B 1 32  LYS 32  159 159 LYS LYS B . n 
B 1 33  LYS 33  160 160 LYS LYS B . n 
B 1 34  CYS 34  161 161 CYS CYS B . n 
B 1 35  SER 35  162 162 SER SER B . n 
B 1 36  ASN 36  163 163 ASN ASN B . n 
B 1 37  THR 37  164 164 THR THR B . n 
B 1 38  SER 38  165 165 SER SER B . n 
B 1 39  TYR 39  166 166 TYR TYR B . n 
B 1 40  GLN 40  167 167 GLN GLN B . n 
B 1 41  PHE 41  168 168 PHE PHE B . n 
B 1 42  ALA 42  169 169 ALA ALA B . n 
B 1 43  ALA 43  170 170 ALA ALA B . n 
B 1 44  VAL 44  171 171 VAL VAL B . n 
B 1 45  GLN 45  172 172 GLN GLN B . n 
B 1 46  PHE 46  173 173 PHE PHE B . n 
B 1 47  SER 47  174 174 SER SER B . n 
B 1 48  THR 48  175 175 THR THR B . n 
B 1 49  SER 49  176 176 SER SER B . n 
B 1 50  TYR 50  177 177 TYR TYR B . n 
B 1 51  LYS 51  178 178 LYS LYS B . n 
B 1 52  THR 52  179 179 THR THR B . n 
B 1 53  GLU 53  180 180 GLU GLU B . n 
B 1 54  PHE 54  181 181 PHE PHE B . n 
B 1 55  ASP 55  182 182 ASP ASP B . n 
B 1 56  PHE 56  183 183 PHE PHE B . n 
B 1 57  SER 57  184 184 SER SER B . n 
B 1 58  ASP 58  185 185 ASP ASP B . n 
B 1 59  TYR 59  186 186 TYR TYR B . n 
B 1 60  VAL 60  187 187 VAL VAL B . n 
B 1 61  LYS 61  188 188 LYS LYS B . n 
B 1 62  TRP 62  189 189 TRP TRP B . n 
B 1 63  LYS 63  190 190 LYS LYS B . n 
B 1 64  ASP 64  191 191 ASP ASP B . n 
B 1 65  PRO 65  192 192 PRO PRO B . n 
B 1 66  ASP 66  193 193 ASP ASP B . n 
B 1 67  ALA 67  194 194 ALA ALA B . n 
B 1 68  LEU 68  195 195 LEU LEU B . n 
B 1 69  LEU 69  196 196 LEU LEU B . n 
B 1 70  LYS 70  197 197 LYS LYS B . n 
B 1 71  HIS 71  198 198 HIS HIS B . n 
B 1 72  VAL 72  199 199 VAL VAL B . n 
B 1 73  LYS 73  200 200 LYS LYS B . n 
B 1 74  HIS 74  201 201 HIS HIS B . n 
B 1 75  MET 75  202 202 MET MET B . n 
B 1 76  LEU 76  203 203 LEU LEU B . n 
B 1 77  LEU 77  204 204 LEU LEU B . n 
B 1 78  LEU 78  205 205 LEU LEU B . n 
B 1 79  THR 79  206 206 THR THR B . n 
B 1 80  ASN 80  207 207 ASN ASN B . n 
B 1 81  THR 81  208 208 THR THR B . n 
B 1 82  PHE 82  209 209 PHE PHE B . n 
B 1 83  GLY 83  210 210 GLY GLY B . n 
B 1 84  ALA 84  211 211 ALA ALA B . n 
B 1 85  ILE 85  212 212 ILE ILE B . n 
B 1 86  ASN 86  213 213 ASN ASN B . n 
B 1 87  TYR 87  214 214 TYR TYR B . n 
B 1 88  VAL 88  215 215 VAL VAL B . n 
B 1 89  ALA 89  216 216 ALA ALA B . n 
B 1 90  THR 90  217 217 THR THR B . n 
B 1 91  GLU 91  218 218 GLU GLU B . n 
B 1 92  VAL 92  219 219 VAL VAL B . n 
B 1 93  PHE 93  220 220 PHE PHE B . n 
B 1 94  ARG 94  221 221 ARG ARG B . n 
B 1 95  GLU 95  222 222 GLU GLU B . n 
B 1 96  GLU 96  223 223 GLU GLU B . n 
B 1 97  LEU 97  224 224 LEU LEU B . n 
B 1 98  GLY 98  225 225 GLY GLY B . n 
B 1 99  ALA 99  226 226 ALA ALA B . n 
B 1 100 ARG 100 227 227 ARG ARG B . n 
B 1 101 PRO 101 228 228 PRO PRO B . n 
B 1 102 ASP 102 229 229 ASP ASP B . n 
B 1 103 ALA 103 230 230 ALA ALA B . n 
B 1 104 THR 104 231 231 THR THR B . n 
B 1 105 LYS 105 232 232 LYS LYS B . n 
B 1 106 VAL 106 233 233 VAL VAL B . n 
B 1 107 LEU 107 234 234 LEU LEU B . n 
B 1 108 ILE 108 235 235 ILE ILE B . n 
B 1 109 ILE 109 236 236 ILE ILE B . n 
B 1 110 ILE 110 237 237 ILE ILE B . n 
B 1 111 THR 111 238 238 THR THR B . n 
B 1 112 ASP 112 239 239 ASP ASP B . n 
B 1 113 GLY 113 240 240 GLY GLY B . n 
B 1 114 GLU 114 241 241 GLU GLU B . n 
B 1 115 ALA 115 242 242 ALA ALA B . n 
B 1 116 THR 116 243 243 THR THR B . n 
B 1 117 ASP 117 244 244 ASP ASP B . n 
B 1 118 SER 118 245 245 SER SER B . n 
B 1 119 GLY 119 246 246 GLY GLY B . n 
B 1 120 ASN 120 247 247 ASN ASN B . n 
B 1 121 ILE 121 248 248 ILE ILE B . n 
B 1 122 ASP 122 249 249 ASP ASP B . n 
B 1 123 ALA 123 250 250 ALA ALA B . n 
B 1 124 ALA 124 251 251 ALA ALA B . n 
B 1 125 LYS 125 252 252 LYS LYS B . n 
B 1 126 ASP 126 253 253 ASP ASP B . n 
B 1 127 ILE 127 254 254 ILE ILE B . n 
B 1 128 ILE 128 255 255 ILE ILE B . n 
B 1 129 ARG 129 256 256 ARG ARG B . n 
B 1 130 TYR 130 257 257 TYR TYR B . n 
B 1 131 ILE 131 258 258 ILE ILE B . n 
B 1 132 ILE 132 259 259 ILE ILE B . n 
B 1 133 GLY 133 260 260 GLY GLY B . n 
B 1 134 ILE 134 261 261 ILE ILE B . n 
B 1 135 GLY 135 262 262 GLY GLY B . n 
B 1 136 LYS 136 263 263 LYS LYS B . n 
B 1 137 HIS 137 264 264 HIS HIS B . n 
B 1 138 PHE 138 265 265 PHE PHE B . n 
B 1 139 GLN 139 266 266 GLN GLN B . n 
B 1 140 THR 140 267 267 THR THR B . n 
B 1 141 LYS 141 268 268 LYS LYS B . n 
B 1 142 GLU 142 269 269 GLU GLU B . n 
B 1 143 SER 143 270 270 SER SER B . n 
B 1 144 GLN 144 271 271 GLN GLN B . n 
B 1 145 GLU 145 272 272 GLU GLU B . n 
B 1 146 THR 146 273 273 THR THR B . n 
B 1 147 LEU 147 274 274 LEU LEU B . n 
B 1 148 HIS 148 275 275 HIS HIS B . n 
B 1 149 LYS 149 276 276 LYS LYS B . n 
B 1 150 PHE 150 277 277 PHE PHE B . n 
B 1 151 ALA 151 278 278 ALA ALA B . n 
B 1 152 SER 152 279 279 SER SER B . n 
B 1 153 LYS 153 280 280 LYS LYS B . n 
B 1 154 PRO 154 281 281 PRO PRO B . n 
B 1 155 ALA 155 282 282 ALA ALA B . n 
B 1 156 SER 156 283 283 SER SER B . n 
B 1 157 GLU 157 284 284 GLU GLU B . n 
B 1 158 PHE 158 285 285 PHE PHE B . n 
B 1 159 VAL 159 286 286 VAL VAL B . n 
B 1 160 LYS 160 287 287 LYS LYS B . n 
B 1 161 ILE 161 288 288 ILE ILE B . n 
B 1 162 LEU 162 289 289 LEU LEU B . n 
B 1 163 ASP 163 290 290 ASP ASP B . n 
B 1 164 THR 164 291 291 THR THR B . n 
B 1 165 PHE 165 292 292 PHE PHE B . n 
B 1 166 GLU 166 293 293 GLU GLU B . n 
B 1 167 LYS 167 294 294 LYS LYS B . n 
B 1 168 LEU 168 295 295 LEU LEU B . n 
B 1 169 LYS 169 296 296 LYS LYS B . n 
B 1 170 ASP 170 297 297 ASP ASP B . n 
B 1 171 LEU 171 298 298 LEU LEU B . n 
B 1 172 CYS 172 299 299 CYS CYS B . n 
B 1 173 THR 173 300 300 THR THR B . n 
B 1 174 GLU 174 301 301 GLU GLU B . n 
B 1 175 LEU 175 302 302 LEU LEU B . n 
B 1 176 GLN 176 303 303 GLN GLN B . n 
B 1 177 LYS 177 304 304 LYS LYS B . n 
B 1 178 LYS 178 305 305 LYS LYS B . n 
B 1 179 ILE 179 306 306 ILE ILE B . n 
B 1 180 TYR 180 307 307 TYR TYR B . n 
C 2 1   GLU 1   1   1   GLU GLU H . n 
C 2 2   VAL 2   2   2   VAL VAL H . n 
C 2 3   GLN 3   3   3   GLN GLN H . n 
C 2 4   LEU 4   4   4   LEU LEU H . n 
C 2 5   LEU 5   5   5   LEU LEU H . n 
C 2 6   GLU 6   6   6   GLU GLU H . n 
C 2 7   SER 7   7   7   SER SER H . n 
C 2 8   GLY 8   8   8   GLY GLY H . n 
C 2 9   GLY 9   9   9   GLY GLY H . n 
C 2 10  GLY 10  10  10  GLY GLY H . n 
C 2 11  LEU 11  11  11  LEU LEU H . n 
C 2 12  VAL 12  12  12  VAL VAL H . n 
C 2 13  GLN 13  13  13  GLN GLN H . n 
C 2 14  PRO 14  14  14  PRO PRO H . n 
C 2 15  GLY 15  15  15  GLY GLY H . n 
C 2 16  GLY 16  16  16  GLY GLY H . n 
C 2 17  SER 17  17  17  SER SER H . n 
C 2 18  LEU 18  18  18  LEU LEU H . n 
C 2 19  ARG 19  19  19  ARG ARG H . n 
C 2 20  LEU 20  20  20  LEU LEU H . n 
C 2 21  SER 21  21  21  SER SER H . n 
C 2 22  CYS 22  22  22  CYS CYS H . n 
C 2 23  ALA 23  23  23  ALA ALA H . n 
C 2 24  ALA 24  24  24  ALA ALA H . n 
C 2 25  SER 25  25  25  SER SER H . n 
C 2 26  GLY 26  26  26  GLY GLY H . n 
C 2 27  PHE 27  27  27  PHE PHE H . n 
C 2 28  THR 28  28  28  THR THR H . n 
C 2 29  PHE 29  29  29  PHE PHE H . n 
C 2 30  SER 30  30  30  SER SER H . n 
C 2 31  ARG 31  31  31  ARG ARG H . n 
C 2 32  TYR 32  32  32  TYR TYR H . n 
C 2 33  VAL 33  33  33  VAL VAL H . n 
C 2 34  MET 34  34  34  MET MET H . n 
C 2 35  TRP 35  35  35  TRP TRP H . n 
C 2 36  TRP 36  36  36  TRP TRP H . n 
C 2 37  VAL 37  37  37  VAL VAL H . n 
C 2 38  ARG 38  38  38  ARG ARG H . n 
C 2 39  GLN 39  39  39  GLN GLN H . n 
C 2 40  ALA 40  40  40  ALA ALA H . n 
C 2 41  PRO 41  41  41  PRO PRO H . n 
C 2 42  GLY 42  42  42  GLY GLY H . n 
C 2 43  LYS 43  43  43  LYS LYS H . n 
C 2 44  GLY 44  44  44  GLY GLY H . n 
C 2 45  LEU 45  45  45  LEU LEU H . n 
C 2 46  GLU 46  46  46  GLU GLU H . n 
C 2 47  TRP 47  47  47  TRP TRP H . n 
C 2 48  VAL 48  48  48  VAL VAL H . n 
C 2 49  SER 49  49  49  SER SER H . n 
C 2 50  TYR 50  50  50  TYR TYR H . n 
C 2 51  ILE 51  51  51  ILE ILE H . n 
C 2 52  TRP 52  52  52  TRP TRP H . n 
C 2 53  PRO 53  53  53  PRO PRO H . n 
C 2 54  SER 54  54  54  SER SER H . n 
C 2 55  GLY 55  55  55  GLY GLY H . n 
C 2 56  GLY 56  56  56  GLY GLY H . n 
C 2 57  ASN 57  57  57  ASN ASN H . n 
C 2 58  THR 58  58  58  THR THR H . n 
C 2 59  TYR 59  59  59  TYR TYR H . n 
C 2 60  TYR 60  60  60  TYR TYR H . n 
C 2 61  ALA 61  61  61  ALA ALA H . n 
C 2 62  ASP 62  62  62  ASP ASP H . n 
C 2 63  SER 63  63  63  SER SER H . n 
C 2 64  VAL 64  64  64  VAL VAL H . n 
C 2 65  LYS 65  65  65  LYS LYS H . n 
C 2 66  GLY 66  66  66  GLY GLY H . n 
C 2 67  ARG 67  67  67  ARG ARG H . n 
C 2 68  PHE 68  68  68  PHE PHE H . n 
C 2 69  THR 69  69  69  THR THR H . n 
C 2 70  ILE 70  70  70  ILE ILE H . n 
C 2 71  SER 71  71  71  SER SER H . n 
C 2 72  ARG 72  72  72  ARG ARG H . n 
C 2 73  ASP 73  73  73  ASP ASP H . n 
C 2 74  ASN 74  74  74  ASN ASN H . n 
C 2 75  SER 75  75  75  SER SER H . n 
C 2 76  LYS 76  76  76  LYS LYS H . n 
C 2 77  ASN 77  77  77  ASN ASN H . n 
C 2 78  THR 78  78  78  THR THR H . n 
C 2 79  LEU 79  79  79  LEU LEU H . n 
C 2 80  TYR 80  80  80  TYR TYR H . n 
C 2 81  LEU 81  81  81  LEU LEU H . n 
C 2 82  GLN 82  82  82  GLN GLN H . n 
C 2 83  MET 83  83  83  MET MET H . n 
C 2 84  ASN 84  84  84  ASN ASN H . n 
C 2 85  SER 85  85  85  SER SER H . n 
C 2 86  LEU 86  86  86  LEU LEU H . n 
C 2 87  ARG 87  87  87  ARG ARG H . n 
C 2 88  ALA 88  88  88  ALA ALA H . n 
C 2 89  GLU 89  89  89  GLU GLU H . n 
C 2 90  ASP 90  90  90  ASP ASP H . n 
C 2 91  THR 91  91  91  THR THR H . n 
C 2 92  ALA 92  92  92  ALA ALA H . n 
C 2 93  VAL 93  93  93  VAL VAL H . n 
C 2 94  TYR 94  94  94  TYR TYR H . n 
C 2 95  TYR 95  95  95  TYR TYR H . n 
C 2 96  CYS 96  96  96  CYS CYS H . n 
C 2 97  ALA 97  97  97  ALA ALA H . n 
C 2 98  SER 98  98  98  SER SER H . n 
C 2 99  SER 99  99  99  SER SER H . n 
C 2 100 TYR 100 100 100 TYR TYR H . n 
C 2 101 ASP 101 101 101 ASP ASP H . n 
C 2 102 PHE 102 102 102 PHE PHE H . n 
C 2 103 TRP 103 103 103 TRP TRP H . n 
C 2 104 SER 104 104 104 SER SER H . n 
C 2 105 ASN 105 105 105 ASN ASN H . n 
C 2 106 ALA 106 106 106 ALA ALA H . n 
C 2 107 PHE 107 107 107 PHE PHE H . n 
C 2 108 ASP 108 108 108 ASP ASP H . n 
C 2 109 ILE 109 109 109 ILE ILE H . n 
C 2 110 TRP 110 110 110 TRP TRP H . n 
C 2 111 GLY 111 111 111 GLY GLY H . n 
C 2 112 GLN 112 112 112 GLN GLN H . n 
C 2 113 GLY 113 113 113 GLY GLY H . n 
C 2 114 THR 114 114 114 THR THR H . n 
C 2 115 MET 115 115 115 MET MET H . n 
C 2 116 VAL 116 116 116 VAL VAL H . n 
C 2 117 THR 117 117 117 THR THR H . n 
C 2 118 VAL 118 118 118 VAL VAL H . n 
C 2 119 SER 119 119 119 SER SER H . n 
C 2 120 SER 120 120 120 SER SER H . n 
C 2 121 ALA 121 121 121 ALA ALA H . n 
C 2 122 SER 122 122 122 SER SER H . n 
C 2 123 THR 123 123 123 THR THR H . n 
C 2 124 LYS 124 124 124 LYS LYS H . n 
C 2 125 GLY 125 125 125 GLY GLY H . n 
C 2 126 PRO 126 126 126 PRO PRO H . n 
C 2 127 SER 127 127 127 SER SER H . n 
C 2 128 VAL 128 128 128 VAL VAL H . n 
C 2 129 PHE 129 129 129 PHE PHE H . n 
C 2 130 PRO 130 130 130 PRO PRO H . n 
C 2 131 LEU 131 131 131 LEU LEU H . n 
C 2 132 ALA 132 132 132 ALA ALA H . n 
C 2 133 PRO 133 133 133 PRO PRO H . n 
C 2 134 CYS 134 134 ?   ?   ?   H . n 
C 2 135 SER 135 135 ?   ?   ?   H . n 
C 2 136 ARG 136 136 ?   ?   ?   H . n 
C 2 137 SER 137 137 ?   ?   ?   H . n 
C 2 138 THR 138 138 ?   ?   ?   H . n 
C 2 139 SER 139 139 ?   ?   ?   H . n 
C 2 140 GLU 140 140 ?   ?   ?   H . n 
C 2 141 SER 141 141 141 SER SER H . n 
C 2 142 THR 142 142 142 THR THR H . n 
C 2 143 ALA 143 143 143 ALA ALA H . n 
C 2 144 ALA 144 144 144 ALA ALA H . n 
C 2 145 LEU 145 145 145 LEU LEU H . n 
C 2 146 GLY 146 146 146 GLY GLY H . n 
C 2 147 CYS 147 147 147 CYS CYS H . n 
C 2 148 LEU 148 148 148 LEU LEU H . n 
C 2 149 VAL 149 149 149 VAL VAL H . n 
C 2 150 LYS 150 150 150 LYS LYS H . n 
C 2 151 ASP 151 151 151 ASP ASP H . n 
C 2 152 TYR 152 152 152 TYR TYR H . n 
C 2 153 PHE 153 153 153 PHE PHE H . n 
C 2 154 PRO 154 154 154 PRO PRO H . n 
C 2 155 GLU 155 155 155 GLU GLU H . n 
C 2 156 PRO 156 156 156 PRO PRO H . n 
C 2 157 VAL 157 157 157 VAL VAL H . n 
C 2 158 THR 158 158 158 THR THR H . n 
C 2 159 VAL 159 159 159 VAL VAL H . n 
C 2 160 SER 160 160 160 SER SER H . n 
C 2 161 TRP 161 161 161 TRP TRP H . n 
C 2 162 ASN 162 162 162 ASN ASN H . n 
C 2 163 SER 163 163 163 SER SER H . n 
C 2 164 GLY 164 164 164 GLY GLY H . n 
C 2 165 ALA 165 165 165 ALA ALA H . n 
C 2 166 LEU 166 166 166 LEU LEU H . n 
C 2 167 THR 167 167 167 THR THR H . n 
C 2 168 SER 168 168 168 SER SER H . n 
C 2 169 GLY 169 169 169 GLY GLY H . n 
C 2 170 VAL 170 170 170 VAL VAL H . n 
C 2 171 HIS 171 171 171 HIS HIS H . n 
C 2 172 THR 172 172 172 THR THR H . n 
C 2 173 PHE 173 173 173 PHE PHE H . n 
C 2 174 PRO 174 174 174 PRO PRO H . n 
C 2 175 ALA 175 175 175 ALA ALA H . n 
C 2 176 VAL 176 176 176 VAL VAL H . n 
C 2 177 LEU 177 177 177 LEU LEU H . n 
C 2 178 GLN 178 178 178 GLN GLN H . n 
C 2 179 SER 179 179 179 SER SER H . n 
C 2 180 SER 180 180 180 SER SER H . n 
C 2 181 GLY 181 181 181 GLY GLY H . n 
C 2 182 LEU 182 182 182 LEU LEU H . n 
C 2 183 TYR 183 183 183 TYR TYR H . n 
C 2 184 SER 184 184 184 SER SER H . n 
C 2 185 LEU 185 185 185 LEU LEU H . n 
C 2 186 SER 186 186 186 SER SER H . n 
C 2 187 SER 187 187 187 SER SER H . n 
C 2 188 VAL 188 188 188 VAL VAL H . n 
C 2 189 VAL 189 189 189 VAL VAL H . n 
C 2 190 THR 190 190 190 THR THR H . n 
C 2 191 VAL 191 191 191 VAL VAL H . n 
C 2 192 PRO 192 192 192 PRO PRO H . n 
C 2 193 SER 193 193 193 SER SER H . n 
C 2 194 SER 194 194 194 SER SER H . n 
C 2 195 SER 195 195 195 SER SER H . n 
C 2 196 LEU 196 196 196 LEU LEU H . n 
C 2 197 GLY 197 197 197 GLY GLY H . n 
C 2 198 THR 198 198 198 THR THR H . n 
C 2 199 LYS 199 199 199 LYS LYS H . n 
C 2 200 THR 200 200 200 THR THR H . n 
C 2 201 TYR 201 201 201 TYR TYR H . n 
C 2 202 THR 202 202 202 THR THR H . n 
C 2 203 CYS 203 203 203 CYS CYS H . n 
C 2 204 ASN 204 204 204 ASN ASN H . n 
C 2 205 VAL 205 205 205 VAL VAL H . n 
C 2 206 ASP 206 206 206 ASP ASP H . n 
C 2 207 HIS 207 207 207 HIS HIS H . n 
C 2 208 LYS 208 208 208 LYS LYS H . n 
C 2 209 PRO 209 209 209 PRO PRO H . n 
C 2 210 SER 210 210 210 SER SER H . n 
C 2 211 ASN 211 211 211 ASN ASN H . n 
C 2 212 THR 212 212 212 THR THR H . n 
C 2 213 LYS 213 213 213 LYS LYS H . n 
C 2 214 VAL 214 214 214 VAL VAL H . n 
C 2 215 ASP 215 215 215 ASP ASP H . n 
C 2 216 LYS 216 216 216 LYS LYS H . n 
C 2 217 ARG 217 217 217 ARG ARG H . n 
C 2 218 VAL 218 218 218 VAL VAL H . n 
C 2 219 GLU 219 219 219 GLU GLU H . n 
C 2 220 SER 220 220 220 SER SER H . n 
D 3 1   GLN 1   0   ?   ?   ?   L . n 
D 3 2   ASP 2   1   ?   ?   ?   L . n 
D 3 3   ILE 3   2   2   ILE ILE L . n 
D 3 4   GLN 4   3   3   GLN GLN L . n 
D 3 5   MET 5   4   4   MET MET L . n 
D 3 6   THR 6   5   5   THR THR L . n 
D 3 7   GLN 7   6   6   GLN GLN L . n 
D 3 8   SER 8   7   7   SER SER L . n 
D 3 9   PRO 9   8   8   PRO PRO L . n 
D 3 10  SER 10  9   9   SER SER L . n 
D 3 11  SER 11  10  10  SER SER L . n 
D 3 12  LEU 12  11  11  LEU LEU L . n 
D 3 13  SER 13  12  12  SER SER L . n 
D 3 14  ALA 14  13  13  ALA ALA L . n 
D 3 15  SER 15  14  14  SER SER L . n 
D 3 16  VAL 16  15  15  VAL VAL L . n 
D 3 17  GLY 17  16  16  GLY GLY L . n 
D 3 18  ASP 18  17  17  ASP ASP L . n 
D 3 19  ARG 19  18  18  ARG ARG L . n 
D 3 20  VAL 20  19  19  VAL VAL L . n 
D 3 21  THR 21  20  20  THR THR L . n 
D 3 22  ILE 22  21  21  ILE ILE L . n 
D 3 23  THR 23  22  22  THR THR L . n 
D 3 24  CYS 24  23  23  CYS CYS L . n 
D 3 25  ARG 25  24  24  ARG ARG L . n 
D 3 26  ALA 26  25  25  ALA ALA L . n 
D 3 27  SER 27  26  26  SER SER L . n 
D 3 28  GLN 28  27  27  GLN GLN L . n 
D 3 29  SER 29  28  28  SER SER L . n 
D 3 30  ILE 30  29  29  ILE ILE L . n 
D 3 31  GLY 31  30  30  GLY GLY L . n 
D 3 32  SER 32  31  31  SER SER L . n 
D 3 33  TYR 33  32  32  TYR TYR L . n 
D 3 34  LEU 34  33  33  LEU LEU L . n 
D 3 35  ASN 35  34  34  ASN ASN L . n 
D 3 36  TRP 36  35  35  TRP TRP L . n 
D 3 37  TYR 37  36  36  TYR TYR L . n 
D 3 38  GLN 38  37  37  GLN GLN L . n 
D 3 39  GLN 39  38  38  GLN GLN L . n 
D 3 40  LYS 40  39  39  LYS LYS L . n 
D 3 41  THR 41  40  40  THR THR L . n 
D 3 42  GLY 42  41  41  GLY GLY L . n 
D 3 43  LYS 43  42  42  LYS LYS L . n 
D 3 44  ALA 44  43  43  ALA ALA L . n 
D 3 45  PRO 45  44  44  PRO PRO L . n 
D 3 46  LYS 46  45  45  LYS LYS L . n 
D 3 47  ALA 47  46  46  ALA ALA L . n 
D 3 48  LEU 48  47  47  LEU LEU L . n 
D 3 49  ILE 49  48  48  ILE ILE L . n 
D 3 50  TYR 50  49  49  TYR TYR L . n 
D 3 51  ALA 51  50  50  ALA ALA L . n 
D 3 52  ALA 52  51  51  ALA ALA L . n 
D 3 53  SER 53  52  52  SER SER L . n 
D 3 54  SER 54  53  53  SER SER L . n 
D 3 55  LEU 55  54  54  LEU LEU L . n 
D 3 56  GLN 56  55  55  GLN GLN L . n 
D 3 57  SER 57  56  56  SER SER L . n 
D 3 58  GLY 58  57  57  GLY GLY L . n 
D 3 59  VAL 59  58  58  VAL VAL L . n 
D 3 60  PRO 60  59  59  PRO PRO L . n 
D 3 61  SER 61  60  60  SER SER L . n 
D 3 62  ARG 62  61  61  ARG ARG L . n 
D 3 63  PHE 63  62  62  PHE PHE L . n 
D 3 64  SER 64  63  63  SER SER L . n 
D 3 65  GLY 65  64  64  GLY GLY L . n 
D 3 66  SER 66  65  65  SER SER L . n 
D 3 67  GLY 67  66  66  GLY GLY L . n 
D 3 68  SER 68  67  67  SER SER L . n 
D 3 69  GLY 69  68  68  GLY GLY L . n 
D 3 70  THR 70  69  69  THR THR L . n 
D 3 71  ASP 71  70  70  ASP ASP L . n 
D 3 72  PHE 72  71  71  PHE PHE L . n 
D 3 73  THR 73  72  72  THR THR L . n 
D 3 74  LEU 74  73  73  LEU LEU L . n 
D 3 75  THR 75  74  74  THR THR L . n 
D 3 76  ILE 76  75  75  ILE ILE L . n 
D 3 77  SER 77  76  76  SER SER L . n 
D 3 78  SER 78  77  77  SER SER L . n 
D 3 79  LEU 79  78  78  LEU LEU L . n 
D 3 80  GLN 80  79  79  GLN GLN L . n 
D 3 81  LEU 81  80  80  LEU LEU L . n 
D 3 82  GLU 82  81  81  GLU GLU L . n 
D 3 83  ASP 83  82  82  ASP ASP L . n 
D 3 84  PHE 84  83  83  PHE PHE L . n 
D 3 85  ALA 85  84  84  ALA ALA L . n 
D 3 86  THR 86  85  85  THR THR L . n 
D 3 87  TYR 87  86  86  TYR TYR L . n 
D 3 88  TYR 88  87  87  TYR TYR L . n 
D 3 89  CYS 89  88  88  CYS CYS L . n 
D 3 90  GLN 90  89  89  GLN GLN L . n 
D 3 91  GLN 91  90  90  GLN GLN L . n 
D 3 92  SER 92  91  91  SER SER L . n 
D 3 93  TYR 93  92  92  TYR TYR L . n 
D 3 94  SER 94  93  93  SER SER L . n 
D 3 95  THR 95  94  94  THR THR L . n 
D 3 96  PRO 96  95  95  PRO PRO L . n 
D 3 97  SER 97  96  96  SER SER L . n 
D 3 98  PHE 98  97  97  PHE PHE L . n 
D 3 99  GLY 99  98  98  GLY GLY L . n 
D 3 100 GLN 100 99  99  GLN GLN L . n 
D 3 101 GLY 101 100 100 GLY GLY L . n 
D 3 102 THR 102 101 101 THR THR L . n 
D 3 103 LYS 103 102 102 LYS LYS L . n 
D 3 104 VAL 104 103 103 VAL VAL L . n 
D 3 105 GLU 105 104 104 GLU GLU L . n 
D 3 106 ILE 106 105 105 ILE ILE L . n 
D 3 107 LYS 107 106 106 LYS LYS L . n 
D 3 108 ARG 108 107 107 ARG ARG L . n 
D 3 109 THR 109 108 108 THR THR L . n 
D 3 110 VAL 110 109 109 VAL VAL L . n 
D 3 111 ALA 111 110 110 ALA ALA L . n 
D 3 112 ALA 112 111 111 ALA ALA L . n 
D 3 113 PRO 113 112 112 PRO PRO L . n 
D 3 114 SER 114 113 113 SER SER L . n 
D 3 115 VAL 115 114 114 VAL VAL L . n 
D 3 116 PHE 116 115 115 PHE PHE L . n 
D 3 117 ILE 117 116 116 ILE ILE L . n 
D 3 118 PHE 118 117 117 PHE PHE L . n 
D 3 119 PRO 119 118 118 PRO PRO L . n 
D 3 120 PRO 120 119 119 PRO PRO L . n 
D 3 121 SER 121 120 120 SER SER L . n 
D 3 122 ASP 122 121 121 ASP ASP L . n 
D 3 123 GLU 123 122 122 GLU GLU L . n 
D 3 124 GLN 124 123 123 GLN GLN L . n 
D 3 125 LEU 125 124 124 LEU LEU L . n 
D 3 126 LYS 126 125 125 LYS LYS L . n 
D 3 127 SER 127 126 126 SER SER L . n 
D 3 128 GLY 128 127 127 GLY GLY L . n 
D 3 129 THR 129 128 128 THR THR L . n 
D 3 130 ALA 130 129 129 ALA ALA L . n 
D 3 131 SER 131 130 130 SER SER L . n 
D 3 132 VAL 132 131 131 VAL VAL L . n 
D 3 133 VAL 133 132 132 VAL VAL L . n 
D 3 134 CYS 134 133 133 CYS CYS L . n 
D 3 135 LEU 135 134 134 LEU LEU L . n 
D 3 136 LEU 136 135 135 LEU LEU L . n 
D 3 137 ASN 137 136 136 ASN ASN L . n 
D 3 138 ASN 138 137 137 ASN ASN L . n 
D 3 139 PHE 139 138 138 PHE PHE L . n 
D 3 140 TYR 140 139 139 TYR TYR L . n 
D 3 141 PRO 141 140 140 PRO PRO L . n 
D 3 142 ARG 142 141 141 ARG ARG L . n 
D 3 143 GLU 143 142 142 GLU GLU L . n 
D 3 144 ALA 144 143 143 ALA ALA L . n 
D 3 145 LYS 145 144 144 LYS LYS L . n 
D 3 146 VAL 146 145 145 VAL VAL L . n 
D 3 147 GLN 147 146 146 GLN GLN L . n 
D 3 148 TRP 148 147 147 TRP TRP L . n 
D 3 149 LYS 149 148 148 LYS LYS L . n 
D 3 150 VAL 150 149 149 VAL VAL L . n 
D 3 151 ASP 151 150 150 ASP ASP L . n 
D 3 152 ASN 152 151 151 ASN ASN L . n 
D 3 153 ALA 153 152 152 ALA ALA L . n 
D 3 154 LEU 154 153 153 LEU LEU L . n 
D 3 155 GLN 155 154 154 GLN GLN L . n 
D 3 156 SER 156 155 155 SER SER L . n 
D 3 157 GLY 157 156 156 GLY GLY L . n 
D 3 158 ASN 158 157 157 ASN ASN L . n 
D 3 159 SER 159 158 158 SER SER L . n 
D 3 160 GLN 160 159 159 GLN GLN L . n 
D 3 161 GLU 161 160 160 GLU GLU L . n 
D 3 162 SER 162 161 161 SER SER L . n 
D 3 163 VAL 163 162 162 VAL VAL L . n 
D 3 164 THR 164 163 163 THR THR L . n 
D 3 165 GLU 165 164 164 GLU GLU L . n 
D 3 166 GLN 166 165 165 GLN GLN L . n 
D 3 167 ASP 167 166 166 ASP ASP L . n 
D 3 168 SER 168 167 167 SER SER L . n 
D 3 169 LYS 169 168 168 LYS LYS L . n 
D 3 170 ASP 170 169 169 ASP ASP L . n 
D 3 171 SER 171 170 170 SER SER L . n 
D 3 172 THR 172 171 171 THR THR L . n 
D 3 173 TYR 173 172 172 TYR TYR L . n 
D 3 174 SER 174 173 173 SER SER L . n 
D 3 175 LEU 175 174 174 LEU LEU L . n 
D 3 176 SER 176 175 175 SER SER L . n 
D 3 177 SER 177 176 176 SER SER L . n 
D 3 178 THR 178 177 177 THR THR L . n 
D 3 179 LEU 179 178 178 LEU LEU L . n 
D 3 180 THR 180 179 179 THR THR L . n 
D 3 181 LEU 181 180 180 LEU LEU L . n 
D 3 182 SER 182 181 181 SER SER L . n 
D 3 183 LYS 183 182 182 LYS LYS L . n 
D 3 184 ALA 184 183 183 ALA ALA L . n 
D 3 185 ASP 185 184 184 ASP ASP L . n 
D 3 186 TYR 186 185 185 TYR TYR L . n 
D 3 187 GLU 187 186 186 GLU GLU L . n 
D 3 188 LYS 188 187 187 LYS LYS L . n 
D 3 189 HIS 189 188 188 HIS HIS L . n 
D 3 190 LYS 190 189 189 LYS LYS L . n 
D 3 191 VAL 191 190 190 VAL VAL L . n 
D 3 192 TYR 192 191 191 TYR TYR L . n 
D 3 193 ALA 193 192 192 ALA ALA L . n 
D 3 194 CYS 194 193 193 CYS CYS L . n 
D 3 195 GLU 195 194 194 GLU GLU L . n 
D 3 196 VAL 196 195 195 VAL VAL L . n 
D 3 197 THR 197 196 196 THR THR L . n 
D 3 198 HIS 198 197 197 HIS HIS L . n 
D 3 199 GLN 199 198 198 GLN GLN L . n 
D 3 200 GLY 200 199 199 GLY GLY L . n 
D 3 201 LEU 201 200 200 LEU LEU L . n 
D 3 202 SER 202 201 201 SER SER L . n 
D 3 203 SER 203 202 202 SER SER L . n 
D 3 204 PRO 204 203 203 PRO PRO L . n 
D 3 205 VAL 205 204 204 VAL VAL L . n 
D 3 206 THR 206 205 205 THR THR L . n 
D 3 207 LYS 207 206 206 LYS LYS L . n 
D 3 208 SER 208 207 207 SER SER L . n 
D 3 209 PHE 209 208 208 PHE PHE L . n 
D 3 210 ASN 210 209 209 ASN ASN L . n 
D 3 211 ARG 211 210 210 ARG ARG L . n 
D 3 212 GLY 212 211 211 GLY GLY L . n 
E 2 1   GLU 1   1   1   GLU GLU X . n 
E 2 2   VAL 2   2   2   VAL VAL X . n 
E 2 3   GLN 3   3   3   GLN GLN X . n 
E 2 4   LEU 4   4   4   LEU LEU X . n 
E 2 5   LEU 5   5   5   LEU LEU X . n 
E 2 6   GLU 6   6   6   GLU GLU X . n 
E 2 7   SER 7   7   7   SER SER X . n 
E 2 8   GLY 8   8   8   GLY GLY X . n 
E 2 9   GLY 9   9   9   GLY GLY X . n 
E 2 10  GLY 10  10  10  GLY GLY X . n 
E 2 11  LEU 11  11  11  LEU LEU X . n 
E 2 12  VAL 12  12  12  VAL VAL X . n 
E 2 13  GLN 13  13  13  GLN GLN X . n 
E 2 14  PRO 14  14  14  PRO PRO X . n 
E 2 15  GLY 15  15  15  GLY GLY X . n 
E 2 16  GLY 16  16  16  GLY GLY X . n 
E 2 17  SER 17  17  17  SER SER X . n 
E 2 18  LEU 18  18  18  LEU LEU X . n 
E 2 19  ARG 19  19  19  ARG ARG X . n 
E 2 20  LEU 20  20  20  LEU LEU X . n 
E 2 21  SER 21  21  21  SER SER X . n 
E 2 22  CYS 22  22  22  CYS CYS X . n 
E 2 23  ALA 23  23  23  ALA ALA X . n 
E 2 24  ALA 24  24  24  ALA ALA X . n 
E 2 25  SER 25  25  25  SER SER X . n 
E 2 26  GLY 26  26  26  GLY GLY X . n 
E 2 27  PHE 27  27  27  PHE PHE X . n 
E 2 28  THR 28  28  28  THR THR X . n 
E 2 29  PHE 29  29  29  PHE PHE X . n 
E 2 30  SER 30  30  30  SER SER X . n 
E 2 31  ARG 31  31  31  ARG ARG X . n 
E 2 32  TYR 32  32  32  TYR TYR X . n 
E 2 33  VAL 33  33  33  VAL VAL X . n 
E 2 34  MET 34  34  34  MET MET X . n 
E 2 35  TRP 35  35  35  TRP TRP X . n 
E 2 36  TRP 36  36  36  TRP TRP X . n 
E 2 37  VAL 37  37  37  VAL VAL X . n 
E 2 38  ARG 38  38  38  ARG ARG X . n 
E 2 39  GLN 39  39  39  GLN GLN X . n 
E 2 40  ALA 40  40  40  ALA ALA X . n 
E 2 41  PRO 41  41  41  PRO PRO X . n 
E 2 42  GLY 42  42  42  GLY GLY X . n 
E 2 43  LYS 43  43  43  LYS LYS X . n 
E 2 44  GLY 44  44  44  GLY GLY X . n 
E 2 45  LEU 45  45  45  LEU LEU X . n 
E 2 46  GLU 46  46  46  GLU GLU X . n 
E 2 47  TRP 47  47  47  TRP TRP X . n 
E 2 48  VAL 48  48  48  VAL VAL X . n 
E 2 49  SER 49  49  49  SER SER X . n 
E 2 50  TYR 50  50  50  TYR TYR X . n 
E 2 51  ILE 51  51  51  ILE ILE X . n 
E 2 52  TRP 52  52  52  TRP TRP X . n 
E 2 53  PRO 53  53  53  PRO PRO X . n 
E 2 54  SER 54  54  54  SER SER X . n 
E 2 55  GLY 55  55  55  GLY GLY X . n 
E 2 56  GLY 56  56  56  GLY GLY X . n 
E 2 57  ASN 57  57  57  ASN ASN X . n 
E 2 58  THR 58  58  58  THR THR X . n 
E 2 59  TYR 59  59  59  TYR TYR X . n 
E 2 60  TYR 60  60  60  TYR TYR X . n 
E 2 61  ALA 61  61  61  ALA ALA X . n 
E 2 62  ASP 62  62  62  ASP ASP X . n 
E 2 63  SER 63  63  63  SER SER X . n 
E 2 64  VAL 64  64  64  VAL VAL X . n 
E 2 65  LYS 65  65  65  LYS LYS X . n 
E 2 66  GLY 66  66  66  GLY GLY X . n 
E 2 67  ARG 67  67  67  ARG ARG X . n 
E 2 68  PHE 68  68  68  PHE PHE X . n 
E 2 69  THR 69  69  69  THR THR X . n 
E 2 70  ILE 70  70  70  ILE ILE X . n 
E 2 71  SER 71  71  71  SER SER X . n 
E 2 72  ARG 72  72  72  ARG ARG X . n 
E 2 73  ASP 73  73  73  ASP ASP X . n 
E 2 74  ASN 74  74  74  ASN ASN X . n 
E 2 75  SER 75  75  75  SER SER X . n 
E 2 76  LYS 76  76  76  LYS LYS X . n 
E 2 77  ASN 77  77  77  ASN ASN X . n 
E 2 78  THR 78  78  78  THR THR X . n 
E 2 79  LEU 79  79  79  LEU LEU X . n 
E 2 80  TYR 80  80  80  TYR TYR X . n 
E 2 81  LEU 81  81  81  LEU LEU X . n 
E 2 82  GLN 82  82  82  GLN GLN X . n 
E 2 83  MET 83  83  83  MET MET X . n 
E 2 84  ASN 84  84  84  ASN ASN X . n 
E 2 85  SER 85  85  85  SER SER X . n 
E 2 86  LEU 86  86  86  LEU LEU X . n 
E 2 87  ARG 87  87  87  ARG ARG X . n 
E 2 88  ALA 88  88  88  ALA ALA X . n 
E 2 89  GLU 89  89  89  GLU GLU X . n 
E 2 90  ASP 90  90  90  ASP ASP X . n 
E 2 91  THR 91  91  91  THR THR X . n 
E 2 92  ALA 92  92  92  ALA ALA X . n 
E 2 93  VAL 93  93  93  VAL VAL X . n 
E 2 94  TYR 94  94  94  TYR TYR X . n 
E 2 95  TYR 95  95  95  TYR TYR X . n 
E 2 96  CYS 96  96  96  CYS CYS X . n 
E 2 97  ALA 97  97  97  ALA ALA X . n 
E 2 98  SER 98  98  98  SER SER X . n 
E 2 99  SER 99  99  99  SER SER X . n 
E 2 100 TYR 100 100 100 TYR TYR X . n 
E 2 101 ASP 101 101 101 ASP ASP X . n 
E 2 102 PHE 102 102 102 PHE PHE X . n 
E 2 103 TRP 103 103 103 TRP TRP X . n 
E 2 104 SER 104 104 104 SER SER X . n 
E 2 105 ASN 105 105 105 ASN ASN X . n 
E 2 106 ALA 106 106 106 ALA ALA X . n 
E 2 107 PHE 107 107 107 PHE PHE X . n 
E 2 108 ASP 108 108 108 ASP ASP X . n 
E 2 109 ILE 109 109 109 ILE ILE X . n 
E 2 110 TRP 110 110 110 TRP TRP X . n 
E 2 111 GLY 111 111 111 GLY GLY X . n 
E 2 112 GLN 112 112 112 GLN GLN X . n 
E 2 113 GLY 113 113 113 GLY GLY X . n 
E 2 114 THR 114 114 114 THR THR X . n 
E 2 115 MET 115 115 115 MET MET X . n 
E 2 116 VAL 116 116 116 VAL VAL X . n 
E 2 117 THR 117 117 117 THR THR X . n 
E 2 118 VAL 118 118 118 VAL VAL X . n 
E 2 119 SER 119 119 119 SER SER X . n 
E 2 120 SER 120 120 120 SER SER X . n 
E 2 121 ALA 121 121 121 ALA ALA X . n 
E 2 122 SER 122 122 122 SER SER X . n 
E 2 123 THR 123 123 123 THR THR X . n 
E 2 124 LYS 124 124 124 LYS LYS X . n 
E 2 125 GLY 125 125 125 GLY GLY X . n 
E 2 126 PRO 126 126 126 PRO PRO X . n 
E 2 127 SER 127 127 127 SER SER X . n 
E 2 128 VAL 128 128 128 VAL VAL X . n 
E 2 129 PHE 129 129 129 PHE PHE X . n 
E 2 130 PRO 130 130 130 PRO PRO X . n 
E 2 131 LEU 131 131 131 LEU LEU X . n 
E 2 132 ALA 132 132 132 ALA ALA X . n 
E 2 133 PRO 133 133 133 PRO PRO X . n 
E 2 134 CYS 134 134 ?   ?   ?   X . n 
E 2 135 SER 135 135 ?   ?   ?   X . n 
E 2 136 ARG 136 136 ?   ?   ?   X . n 
E 2 137 SER 137 137 137 SER SER X . n 
E 2 138 THR 138 138 138 THR THR X . n 
E 2 139 SER 139 139 139 SER SER X . n 
E 2 140 GLU 140 140 140 GLU GLY X . n 
E 2 141 SER 141 141 141 SER SER X . n 
E 2 142 THR 142 142 142 THR THR X . n 
E 2 143 ALA 143 143 143 ALA ALA X . n 
E 2 144 ALA 144 144 144 ALA ALA X . n 
E 2 145 LEU 145 145 145 LEU LEU X . n 
E 2 146 GLY 146 146 146 GLY GLY X . n 
E 2 147 CYS 147 147 147 CYS CYS X . n 
E 2 148 LEU 148 148 148 LEU LEU X . n 
E 2 149 VAL 149 149 149 VAL VAL X . n 
E 2 150 LYS 150 150 150 LYS LYS X . n 
E 2 151 ASP 151 151 151 ASP ASP X . n 
E 2 152 TYR 152 152 152 TYR TYR X . n 
E 2 153 PHE 153 153 153 PHE PHE X . n 
E 2 154 PRO 154 154 154 PRO PRO X . n 
E 2 155 GLU 155 155 155 GLU GLU X . n 
E 2 156 PRO 156 156 156 PRO PRO X . n 
E 2 157 VAL 157 157 157 VAL VAL X . n 
E 2 158 THR 158 158 158 THR THR X . n 
E 2 159 VAL 159 159 159 VAL VAL X . n 
E 2 160 SER 160 160 160 SER SER X . n 
E 2 161 TRP 161 161 161 TRP TRP X . n 
E 2 162 ASN 162 162 162 ASN ASN X . n 
E 2 163 SER 163 163 163 SER SER X . n 
E 2 164 GLY 164 164 164 GLY GLY X . n 
E 2 165 ALA 165 165 165 ALA ALA X . n 
E 2 166 LEU 166 166 166 LEU LEU X . n 
E 2 167 THR 167 167 167 THR THR X . n 
E 2 168 SER 168 168 168 SER SER X . n 
E 2 169 GLY 169 169 169 GLY GLY X . n 
E 2 170 VAL 170 170 170 VAL VAL X . n 
E 2 171 HIS 171 171 171 HIS HIS X . n 
E 2 172 THR 172 172 172 THR THR X . n 
E 2 173 PHE 173 173 173 PHE PHE X . n 
E 2 174 PRO 174 174 174 PRO PRO X . n 
E 2 175 ALA 175 175 175 ALA ALA X . n 
E 2 176 VAL 176 176 176 VAL VAL X . n 
E 2 177 LEU 177 177 177 LEU LEU X . n 
E 2 178 GLN 178 178 178 GLN GLN X . n 
E 2 179 SER 179 179 179 SER SER X . n 
E 2 180 SER 180 180 180 SER SER X . n 
E 2 181 GLY 181 181 181 GLY GLY X . n 
E 2 182 LEU 182 182 182 LEU LEU X . n 
E 2 183 TYR 183 183 183 TYR TYR X . n 
E 2 184 SER 184 184 184 SER SER X . n 
E 2 185 LEU 185 185 185 LEU LEU X . n 
E 2 186 SER 186 186 186 SER SER X . n 
E 2 187 SER 187 187 187 SER SER X . n 
E 2 188 VAL 188 188 188 VAL VAL X . n 
E 2 189 VAL 189 189 189 VAL VAL X . n 
E 2 190 THR 190 190 190 THR THR X . n 
E 2 191 VAL 191 191 191 VAL VAL X . n 
E 2 192 PRO 192 192 192 PRO PRO X . n 
E 2 193 SER 193 193 193 SER SER X . n 
E 2 194 SER 194 194 194 SER SER X . n 
E 2 195 SER 195 195 195 SER SER X . n 
E 2 196 LEU 196 196 196 LEU LEU X . n 
E 2 197 GLY 197 197 197 GLY GLY X . n 
E 2 198 THR 198 198 198 THR THR X . n 
E 2 199 LYS 199 199 199 LYS LYS X . n 
E 2 200 THR 200 200 200 THR THR X . n 
E 2 201 TYR 201 201 201 TYR TYR X . n 
E 2 202 THR 202 202 202 THR THR X . n 
E 2 203 CYS 203 203 203 CYS CYS X . n 
E 2 204 ASN 204 204 204 ASN ASN X . n 
E 2 205 VAL 205 205 205 VAL VAL X . n 
E 2 206 ASP 206 206 206 ASP ASP X . n 
E 2 207 HIS 207 207 207 HIS HIS X . n 
E 2 208 LYS 208 208 208 LYS LYS X . n 
E 2 209 PRO 209 209 209 PRO PRO X . n 
E 2 210 SER 210 210 210 SER SER X . n 
E 2 211 ASN 211 211 211 ASN ASN X . n 
E 2 212 THR 212 212 212 THR THR X . n 
E 2 213 LYS 213 213 213 LYS LYS X . n 
E 2 214 VAL 214 214 214 VAL VAL X . n 
E 2 215 ASP 215 215 215 ASP ASP X . n 
E 2 216 LYS 216 216 216 LYS LYS X . n 
E 2 217 ARG 217 217 217 ARG ARG X . n 
E 2 218 VAL 218 218 218 VAL VAL X . n 
E 2 219 GLU 219 219 219 GLU GLU X . n 
E 2 220 SER 220 220 220 SER SER X . n 
F 3 1   GLN 1   0   ?   ?   ?   Y . n 
F 3 2   ASP 2   1   ?   ?   ?   Y . n 
F 3 3   ILE 3   2   2   ILE ILE Y . n 
F 3 4   GLN 4   3   3   GLN GLN Y . n 
F 3 5   MET 5   4   4   MET MET Y . n 
F 3 6   THR 6   5   5   THR THR Y . n 
F 3 7   GLN 7   6   6   GLN GLN Y . n 
F 3 8   SER 8   7   7   SER SER Y . n 
F 3 9   PRO 9   8   8   PRO PRO Y . n 
F 3 10  SER 10  9   9   SER SER Y . n 
F 3 11  SER 11  10  10  SER SER Y . n 
F 3 12  LEU 12  11  11  LEU LEU Y . n 
F 3 13  SER 13  12  12  SER SER Y . n 
F 3 14  ALA 14  13  13  ALA ALA Y . n 
F 3 15  SER 15  14  14  SER SER Y . n 
F 3 16  VAL 16  15  15  VAL VAL Y . n 
F 3 17  GLY 17  16  16  GLY GLY Y . n 
F 3 18  ASP 18  17  17  ASP ASP Y . n 
F 3 19  ARG 19  18  18  ARG ARG Y . n 
F 3 20  VAL 20  19  19  VAL VAL Y . n 
F 3 21  THR 21  20  20  THR THR Y . n 
F 3 22  ILE 22  21  21  ILE ILE Y . n 
F 3 23  THR 23  22  22  THR THR Y . n 
F 3 24  CYS 24  23  23  CYS CYS Y . n 
F 3 25  ARG 25  24  24  ARG ARG Y . n 
F 3 26  ALA 26  25  25  ALA ALA Y . n 
F 3 27  SER 27  26  26  SER SER Y . n 
F 3 28  GLN 28  27  27  GLN GLN Y . n 
F 3 29  SER 29  28  28  SER SER Y . n 
F 3 30  ILE 30  29  29  ILE ILE Y . n 
F 3 31  GLY 31  30  30  GLY GLY Y . n 
F 3 32  SER 32  31  31  SER SER Y . n 
F 3 33  TYR 33  32  32  TYR TYR Y . n 
F 3 34  LEU 34  33  33  LEU LEU Y . n 
F 3 35  ASN 35  34  34  ASN ASN Y . n 
F 3 36  TRP 36  35  35  TRP TRP Y . n 
F 3 37  TYR 37  36  36  TYR TYR Y . n 
F 3 38  GLN 38  37  37  GLN GLN Y . n 
F 3 39  GLN 39  38  38  GLN GLN Y . n 
F 3 40  LYS 40  39  39  LYS LYS Y . n 
F 3 41  THR 41  40  40  THR THR Y . n 
F 3 42  GLY 42  41  41  GLY GLY Y . n 
F 3 43  LYS 43  42  42  LYS LYS Y . n 
F 3 44  ALA 44  43  43  ALA ALA Y . n 
F 3 45  PRO 45  44  44  PRO PRO Y . n 
F 3 46  LYS 46  45  45  LYS LYS Y . n 
F 3 47  ALA 47  46  46  ALA ALA Y . n 
F 3 48  LEU 48  47  47  LEU LEU Y . n 
F 3 49  ILE 49  48  48  ILE ILE Y . n 
F 3 50  TYR 50  49  49  TYR TYR Y . n 
F 3 51  ALA 51  50  50  ALA ALA Y . n 
F 3 52  ALA 52  51  51  ALA ALA Y . n 
F 3 53  SER 53  52  52  SER SER Y . n 
F 3 54  SER 54  53  53  SER SER Y . n 
F 3 55  LEU 55  54  54  LEU LEU Y . n 
F 3 56  GLN 56  55  55  GLN GLN Y . n 
F 3 57  SER 57  56  56  SER SER Y . n 
F 3 58  GLY 58  57  57  GLY GLY Y . n 
F 3 59  VAL 59  58  58  VAL VAL Y . n 
F 3 60  PRO 60  59  59  PRO PRO Y . n 
F 3 61  SER 61  60  60  SER SER Y . n 
F 3 62  ARG 62  61  61  ARG ARG Y . n 
F 3 63  PHE 63  62  62  PHE PHE Y . n 
F 3 64  SER 64  63  63  SER SER Y . n 
F 3 65  GLY 65  64  64  GLY GLY Y . n 
F 3 66  SER 66  65  65  SER SER Y . n 
F 3 67  GLY 67  66  66  GLY GLY Y . n 
F 3 68  SER 68  67  67  SER SER Y . n 
F 3 69  GLY 69  68  68  GLY GLY Y . n 
F 3 70  THR 70  69  69  THR THR Y . n 
F 3 71  ASP 71  70  70  ASP ASP Y . n 
F 3 72  PHE 72  71  71  PHE PHE Y . n 
F 3 73  THR 73  72  72  THR THR Y . n 
F 3 74  LEU 74  73  73  LEU LEU Y . n 
F 3 75  THR 75  74  74  THR THR Y . n 
F 3 76  ILE 76  75  75  ILE ILE Y . n 
F 3 77  SER 77  76  76  SER SER Y . n 
F 3 78  SER 78  77  77  SER SER Y . n 
F 3 79  LEU 79  78  78  LEU LEU Y . n 
F 3 80  GLN 80  79  79  GLN GLN Y . n 
F 3 81  LEU 81  80  80  LEU LEU Y . n 
F 3 82  GLU 82  81  81  GLU GLU Y . n 
F 3 83  ASP 83  82  82  ASP ASP Y . n 
F 3 84  PHE 84  83  83  PHE PHE Y . n 
F 3 85  ALA 85  84  84  ALA ALA Y . n 
F 3 86  THR 86  85  85  THR THR Y . n 
F 3 87  TYR 87  86  86  TYR TYR Y . n 
F 3 88  TYR 88  87  87  TYR TYR Y . n 
F 3 89  CYS 89  88  88  CYS CYS Y . n 
F 3 90  GLN 90  89  89  GLN GLN Y . n 
F 3 91  GLN 91  90  90  GLN GLN Y . n 
F 3 92  SER 92  91  91  SER SER Y . n 
F 3 93  TYR 93  92  92  TYR TYR Y . n 
F 3 94  SER 94  93  93  SER SER Y . n 
F 3 95  THR 95  94  94  THR THR Y . n 
F 3 96  PRO 96  95  95  PRO PRO Y . n 
F 3 97  SER 97  96  96  SER SER Y . n 
F 3 98  PHE 98  97  97  PHE PHE Y . n 
F 3 99  GLY 99  98  98  GLY GLY Y . n 
F 3 100 GLN 100 99  99  GLN GLN Y . n 
F 3 101 GLY 101 100 100 GLY GLY Y . n 
F 3 102 THR 102 101 101 THR THR Y . n 
F 3 103 LYS 103 102 102 LYS LYS Y . n 
F 3 104 VAL 104 103 103 VAL VAL Y . n 
F 3 105 GLU 105 104 104 GLU GLU Y . n 
F 3 106 ILE 106 105 105 ILE ILE Y . n 
F 3 107 LYS 107 106 106 LYS LYS Y . n 
F 3 108 ARG 108 107 107 ARG ARG Y . n 
F 3 109 THR 109 108 108 THR THR Y . n 
F 3 110 VAL 110 109 109 VAL VAL Y . n 
F 3 111 ALA 111 110 110 ALA ALA Y . n 
F 3 112 ALA 112 111 111 ALA ALA Y . n 
F 3 113 PRO 113 112 112 PRO PRO Y . n 
F 3 114 SER 114 113 113 SER SER Y . n 
F 3 115 VAL 115 114 114 VAL VAL Y . n 
F 3 116 PHE 116 115 115 PHE PHE Y . n 
F 3 117 ILE 117 116 116 ILE ILE Y . n 
F 3 118 PHE 118 117 117 PHE PHE Y . n 
F 3 119 PRO 119 118 118 PRO PRO Y . n 
F 3 120 PRO 120 119 119 PRO PRO Y . n 
F 3 121 SER 121 120 120 SER SER Y . n 
F 3 122 ASP 122 121 121 ASP ASP Y . n 
F 3 123 GLU 123 122 122 GLU GLU Y . n 
F 3 124 GLN 124 123 123 GLN GLN Y . n 
F 3 125 LEU 125 124 124 LEU LEU Y . n 
F 3 126 LYS 126 125 125 LYS LYS Y . n 
F 3 127 SER 127 126 126 SER SER Y . n 
F 3 128 GLY 128 127 127 GLY GLY Y . n 
F 3 129 THR 129 128 128 THR THR Y . n 
F 3 130 ALA 130 129 129 ALA ALA Y . n 
F 3 131 SER 131 130 130 SER SER Y . n 
F 3 132 VAL 132 131 131 VAL VAL Y . n 
F 3 133 VAL 133 132 132 VAL VAL Y . n 
F 3 134 CYS 134 133 133 CYS CYS Y . n 
F 3 135 LEU 135 134 134 LEU LEU Y . n 
F 3 136 LEU 136 135 135 LEU LEU Y . n 
F 3 137 ASN 137 136 136 ASN ASN Y . n 
F 3 138 ASN 138 137 137 ASN ASN Y . n 
F 3 139 PHE 139 138 138 PHE PHE Y . n 
F 3 140 TYR 140 139 139 TYR TYR Y . n 
F 3 141 PRO 141 140 140 PRO PRO Y . n 
F 3 142 ARG 142 141 141 ARG ARG Y . n 
F 3 143 GLU 143 142 142 GLU GLU Y . n 
F 3 144 ALA 144 143 143 ALA ALA Y . n 
F 3 145 LYS 145 144 144 LYS LYS Y . n 
F 3 146 VAL 146 145 145 VAL VAL Y . n 
F 3 147 GLN 147 146 146 GLN GLN Y . n 
F 3 148 TRP 148 147 147 TRP TRP Y . n 
F 3 149 LYS 149 148 148 LYS LYS Y . n 
F 3 150 VAL 150 149 149 VAL VAL Y . n 
F 3 151 ASP 151 150 150 ASP ASP Y . n 
F 3 152 ASN 152 151 151 ASN ASN Y . n 
F 3 153 ALA 153 152 152 ALA ALA Y . n 
F 3 154 LEU 154 153 153 LEU LEU Y . n 
F 3 155 GLN 155 154 154 GLN GLN Y . n 
F 3 156 SER 156 155 155 SER SER Y . n 
F 3 157 GLY 157 156 156 GLY GLY Y . n 
F 3 158 ASN 158 157 157 ASN ASN Y . n 
F 3 159 SER 159 158 158 SER SER Y . n 
F 3 160 GLN 160 159 159 GLN GLN Y . n 
F 3 161 GLU 161 160 160 GLU GLU Y . n 
F 3 162 SER 162 161 161 SER SER Y . n 
F 3 163 VAL 163 162 162 VAL VAL Y . n 
F 3 164 THR 164 163 163 THR THR Y . n 
F 3 165 GLU 165 164 164 GLU GLU Y . n 
F 3 166 GLN 166 165 165 GLN GLN Y . n 
F 3 167 ASP 167 166 166 ASP ASP Y . n 
F 3 168 SER 168 167 167 SER SER Y . n 
F 3 169 LYS 169 168 168 LYS LYS Y . n 
F 3 170 ASP 170 169 169 ASP ASP Y . n 
F 3 171 SER 171 170 170 SER SER Y . n 
F 3 172 THR 172 171 171 THR THR Y . n 
F 3 173 TYR 173 172 172 TYR TYR Y . n 
F 3 174 SER 174 173 173 SER SER Y . n 
F 3 175 LEU 175 174 174 LEU LEU Y . n 
F 3 176 SER 176 175 175 SER SER Y . n 
F 3 177 SER 177 176 176 SER SER Y . n 
F 3 178 THR 178 177 177 THR THR Y . n 
F 3 179 LEU 179 178 178 LEU LEU Y . n 
F 3 180 THR 180 179 179 THR THR Y . n 
F 3 181 LEU 181 180 180 LEU LEU Y . n 
F 3 182 SER 182 181 181 SER SER Y . n 
F 3 183 LYS 183 182 182 LYS LYS Y . n 
F 3 184 ALA 184 183 183 ALA ALA Y . n 
F 3 185 ASP 185 184 184 ASP ASP Y . n 
F 3 186 TYR 186 185 185 TYR TYR Y . n 
F 3 187 GLU 187 186 186 GLU GLU Y . n 
F 3 188 LYS 188 187 187 LYS LYS Y . n 
F 3 189 HIS 189 188 188 HIS HIS Y . n 
F 3 190 LYS 190 189 189 LYS LYS Y . n 
F 3 191 VAL 191 190 190 VAL VAL Y . n 
F 3 192 TYR 192 191 191 TYR TYR Y . n 
F 3 193 ALA 193 192 192 ALA ALA Y . n 
F 3 194 CYS 194 193 193 CYS CYS Y . n 
F 3 195 GLU 195 194 194 GLU GLU Y . n 
F 3 196 VAL 196 195 195 VAL VAL Y . n 
F 3 197 THR 197 196 196 THR THR Y . n 
F 3 198 HIS 198 197 197 HIS HIS Y . n 
F 3 199 GLN 199 198 198 GLN GLN Y . n 
F 3 200 GLY 200 199 199 GLY GLY Y . n 
F 3 201 LEU 201 200 200 LEU LEU Y . n 
F 3 202 SER 202 201 201 SER SER Y . n 
F 3 203 SER 203 202 202 SER SER Y . n 
F 3 204 PRO 204 203 203 PRO PRO Y . n 
F 3 205 VAL 205 204 204 VAL VAL Y . n 
F 3 206 THR 206 205 205 THR THR Y . n 
F 3 207 LYS 207 206 206 LYS LYS Y . n 
F 3 208 SER 208 207 207 SER SER Y . n 
F 3 209 PHE 209 208 208 PHE PHE Y . n 
F 3 210 ASN 210 209 209 ASN ASN Y . n 
F 3 211 ARG 211 210 210 ARG ARG Y . n 
F 3 212 GLY 212 211 ?   ?   ?   Y . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 MN  1   1   1   MN  MN  A . 
H 4 MN  1   2   2   MN  MN  B . 
I 5 SO4 1   5   5   SO4 SO4 B . 
J 5 SO4 1   221 1   SO4 SO4 H . 
K 5 SO4 1   222 2   SO4 SO4 H . 
L 5 SO4 1   212 4   SO4 SO4 L . 
M 5 SO4 1   221 3   SO4 SO4 X . 
N 5 SO4 1   212 6   SO4 SO4 Y . 
O 6 HOH 1   4   4   HOH HOH A . 
O 6 HOH 2   10  10  HOH HOH A . 
O 6 HOH 3   15  15  HOH HOH A . 
O 6 HOH 4   18  18  HOH HOH A . 
O 6 HOH 5   23  23  HOH HOH A . 
O 6 HOH 6   25  25  HOH HOH A . 
O 6 HOH 7   35  35  HOH HOH A . 
O 6 HOH 8   51  51  HOH HOH A . 
O 6 HOH 9   55  55  HOH HOH A . 
O 6 HOH 10  72  72  HOH HOH A . 
O 6 HOH 11  73  73  HOH HOH A . 
O 6 HOH 12  76  76  HOH HOH A . 
O 6 HOH 13  81  81  HOH HOH A . 
O 6 HOH 14  95  95  HOH HOH A . 
O 6 HOH 15  110 110 HOH HOH A . 
O 6 HOH 16  308 135 HOH HOH A . 
O 6 HOH 17  309 147 HOH HOH A . 
O 6 HOH 18  310 149 HOH HOH A . 
O 6 HOH 19  311 152 HOH HOH A . 
O 6 HOH 20  312 155 HOH HOH A . 
O 6 HOH 21  313 161 HOH HOH A . 
O 6 HOH 22  314 170 HOH HOH A . 
O 6 HOH 23  315 173 HOH HOH A . 
O 6 HOH 24  316 183 HOH HOH A . 
O 6 HOH 25  317 317 HOH HOH A . 
O 6 HOH 26  318 185 HOH HOH A . 
O 6 HOH 27  319 188 HOH HOH A . 
O 6 HOH 28  320 199 HOH HOH A . 
O 6 HOH 29  321 201 HOH HOH A . 
O 6 HOH 30  322 322 HOH HOH A . 
O 6 HOH 31  323 211 HOH HOH A . 
O 6 HOH 32  324 214 HOH HOH A . 
O 6 HOH 33  325 217 HOH HOH A . 
O 6 HOH 34  326 222 HOH HOH A . 
O 6 HOH 35  327 230 HOH HOH A . 
O 6 HOH 36  328 234 HOH HOH A . 
O 6 HOH 37  329 236 HOH HOH A . 
O 6 HOH 38  330 243 HOH HOH A . 
O 6 HOH 39  331 248 HOH HOH A . 
O 6 HOH 40  332 258 HOH HOH A . 
O 6 HOH 41  333 333 HOH HOH A . 
O 6 HOH 42  334 270 HOH HOH A . 
O 6 HOH 43  335 282 HOH HOH A . 
O 6 HOH 44  336 294 HOH HOH A . 
O 6 HOH 45  337 337 HOH HOH A . 
O 6 HOH 46  338 305 HOH HOH A . 
O 6 HOH 47  340 340 HOH HOH A . 
O 6 HOH 48  341 341 HOH HOH A . 
O 6 HOH 49  346 346 HOH HOH A . 
O 6 HOH 50  353 353 HOH HOH A . 
O 6 HOH 51  354 354 HOH HOH A . 
O 6 HOH 52  360 360 HOH HOH A . 
O 6 HOH 53  369 369 HOH HOH A . 
O 6 HOH 54  373 373 HOH HOH A . 
O 6 HOH 55  375 375 HOH HOH A . 
O 6 HOH 56  385 385 HOH HOH A . 
O 6 HOH 57  388 388 HOH HOH A . 
O 6 HOH 58  391 391 HOH HOH A . 
O 6 HOH 59  393 393 HOH HOH A . 
O 6 HOH 60  399 399 HOH HOH A . 
O 6 HOH 61  418 418 HOH HOH A . 
O 6 HOH 62  438 438 HOH HOH A . 
O 6 HOH 63  440 440 HOH HOH A . 
O 6 HOH 64  452 452 HOH HOH A . 
O 6 HOH 65  473 473 HOH HOH A . 
O 6 HOH 66  486 486 HOH HOH A . 
O 6 HOH 67  491 491 HOH HOH A . 
O 6 HOH 68  493 493 HOH HOH A . 
O 6 HOH 69  496 496 HOH HOH A . 
O 6 HOH 70  503 503 HOH HOH A . 
O 6 HOH 71  504 504 HOH HOH A . 
O 6 HOH 72  511 511 HOH HOH A . 
O 6 HOH 73  517 517 HOH HOH A . 
O 6 HOH 74  535 535 HOH HOH A . 
O 6 HOH 75  553 553 HOH HOH A . 
O 6 HOH 76  557 557 HOH HOH A . 
O 6 HOH 77  563 563 HOH HOH A . 
O 6 HOH 78  564 564 HOH HOH A . 
O 6 HOH 79  573 573 HOH HOH A . 
O 6 HOH 80  574 574 HOH HOH A . 
O 6 HOH 81  584 584 HOH HOH A . 
O 6 HOH 82  595 595 HOH HOH A . 
O 6 HOH 83  596 596 HOH HOH A . 
O 6 HOH 84  602 602 HOH HOH A . 
O 6 HOH 85  607 607 HOH HOH A . 
O 6 HOH 86  609 609 HOH HOH A . 
O 6 HOH 87  612 612 HOH HOH A . 
O 6 HOH 88  615 615 HOH HOH A . 
O 6 HOH 89  631 631 HOH HOH A . 
O 6 HOH 90  633 633 HOH HOH A . 
O 6 HOH 91  646 646 HOH HOH A . 
O 6 HOH 92  648 648 HOH HOH A . 
O 6 HOH 93  651 651 HOH HOH A . 
O 6 HOH 94  656 656 HOH HOH A . 
O 6 HOH 95  658 658 HOH HOH A . 
O 6 HOH 96  659 659 HOH HOH A . 
O 6 HOH 97  668 668 HOH HOH A . 
O 6 HOH 98  687 687 HOH HOH A . 
P 6 HOH 1   1   1   HOH HOH B . 
P 6 HOH 2   20  20  HOH HOH B . 
P 6 HOH 3   22  22  HOH HOH B . 
P 6 HOH 4   43  43  HOH HOH B . 
P 6 HOH 5   57  57  HOH HOH B . 
P 6 HOH 6   60  60  HOH HOH B . 
P 6 HOH 7   80  80  HOH HOH B . 
P 6 HOH 8   85  85  HOH HOH B . 
P 6 HOH 9   86  86  HOH HOH B . 
P 6 HOH 10  87  87  HOH HOH B . 
P 6 HOH 11  91  91  HOH HOH B . 
P 6 HOH 12  92  92  HOH HOH B . 
P 6 HOH 13  94  94  HOH HOH B . 
P 6 HOH 14  99  99  HOH HOH B . 
P 6 HOH 15  101 101 HOH HOH B . 
P 6 HOH 16  103 103 HOH HOH B . 
P 6 HOH 17  111 111 HOH HOH B . 
P 6 HOH 18  112 112 HOH HOH B . 
P 6 HOH 19  115 115 HOH HOH B . 
P 6 HOH 20  122 122 HOH HOH B . 
P 6 HOH 21  125 125 HOH HOH B . 
P 6 HOH 22  127 127 HOH HOH B . 
P 6 HOH 23  308 128 HOH HOH B . 
P 6 HOH 24  309 140 HOH HOH B . 
P 6 HOH 25  310 151 HOH HOH B . 
P 6 HOH 26  311 154 HOH HOH B . 
P 6 HOH 27  312 156 HOH HOH B . 
P 6 HOH 28  313 160 HOH HOH B . 
P 6 HOH 29  314 162 HOH HOH B . 
P 6 HOH 30  315 166 HOH HOH B . 
P 6 HOH 31  316 167 HOH HOH B . 
P 6 HOH 32  317 181 HOH HOH B . 
P 6 HOH 33  318 187 HOH HOH B . 
P 6 HOH 34  319 190 HOH HOH B . 
P 6 HOH 35  320 191 HOH HOH B . 
P 6 HOH 36  321 195 HOH HOH B . 
P 6 HOH 37  322 203 HOH HOH B . 
P 6 HOH 38  323 205 HOH HOH B . 
P 6 HOH 39  324 210 HOH HOH B . 
P 6 HOH 40  325 215 HOH HOH B . 
P 6 HOH 41  326 219 HOH HOH B . 
P 6 HOH 42  327 226 HOH HOH B . 
P 6 HOH 43  328 229 HOH HOH B . 
P 6 HOH 44  329 329 HOH HOH B . 
P 6 HOH 45  330 242 HOH HOH B . 
P 6 HOH 46  331 331 HOH HOH B . 
P 6 HOH 47  332 245 HOH HOH B . 
P 6 HOH 48  333 251 HOH HOH B . 
P 6 HOH 49  334 252 HOH HOH B . 
P 6 HOH 50  335 335 HOH HOH B . 
P 6 HOH 51  336 253 HOH HOH B . 
P 6 HOH 52  337 257 HOH HOH B . 
P 6 HOH 53  338 338 HOH HOH B . 
P 6 HOH 54  339 263 HOH HOH B . 
P 6 HOH 55  340 277 HOH HOH B . 
P 6 HOH 56  341 290 HOH HOH B . 
P 6 HOH 57  342 293 HOH HOH B . 
P 6 HOH 58  344 344 HOH HOH B . 
P 6 HOH 59  368 368 HOH HOH B . 
P 6 HOH 60  381 381 HOH HOH B . 
P 6 HOH 61  383 383 HOH HOH B . 
P 6 HOH 62  387 387 HOH HOH B . 
P 6 HOH 63  392 392 HOH HOH B . 
P 6 HOH 64  396 396 HOH HOH B . 
P 6 HOH 65  426 426 HOH HOH B . 
P 6 HOH 66  430 430 HOH HOH B . 
P 6 HOH 67  450 450 HOH HOH B . 
P 6 HOH 68  453 453 HOH HOH B . 
P 6 HOH 69  460 460 HOH HOH B . 
P 6 HOH 70  463 463 HOH HOH B . 
P 6 HOH 71  470 470 HOH HOH B . 
P 6 HOH 72  477 477 HOH HOH B . 
P 6 HOH 73  481 481 HOH HOH B . 
P 6 HOH 74  482 482 HOH HOH B . 
P 6 HOH 75  483 483 HOH HOH B . 
P 6 HOH 76  487 487 HOH HOH B . 
P 6 HOH 77  499 499 HOH HOH B . 
P 6 HOH 78  502 502 HOH HOH B . 
P 6 HOH 79  508 508 HOH HOH B . 
P 6 HOH 80  524 524 HOH HOH B . 
P 6 HOH 81  530 530 HOH HOH B . 
P 6 HOH 82  533 533 HOH HOH B . 
P 6 HOH 83  538 538 HOH HOH B . 
P 6 HOH 84  549 549 HOH HOH B . 
P 6 HOH 85  552 552 HOH HOH B . 
P 6 HOH 86  554 554 HOH HOH B . 
P 6 HOH 87  560 560 HOH HOH B . 
P 6 HOH 88  561 561 HOH HOH B . 
P 6 HOH 89  562 562 HOH HOH B . 
P 6 HOH 90  575 575 HOH HOH B . 
P 6 HOH 91  583 583 HOH HOH B . 
P 6 HOH 92  587 587 HOH HOH B . 
P 6 HOH 93  591 591 HOH HOH B . 
P 6 HOH 94  592 592 HOH HOH B . 
P 6 HOH 95  593 593 HOH HOH B . 
P 6 HOH 96  605 605 HOH HOH B . 
P 6 HOH 97  614 614 HOH HOH B . 
P 6 HOH 98  616 616 HOH HOH B . 
P 6 HOH 99  619 619 HOH HOH B . 
P 6 HOH 100 621 621 HOH HOH B . 
P 6 HOH 101 627 627 HOH HOH B . 
P 6 HOH 102 628 628 HOH HOH B . 
P 6 HOH 103 636 636 HOH HOH B . 
P 6 HOH 104 643 643 HOH HOH B . 
P 6 HOH 105 645 645 HOH HOH B . 
P 6 HOH 106 655 655 HOH HOH B . 
P 6 HOH 107 679 679 HOH HOH B . 
P 6 HOH 108 681 681 HOH HOH B . 
P 6 HOH 109 686 686 HOH HOH B . 
P 6 HOH 110 691 691 HOH HOH B . 
P 6 HOH 111 695 695 HOH HOH B . 
Q 6 HOH 1   223 3   HOH HOH H . 
Q 6 HOH 2   224 6   HOH HOH H . 
Q 6 HOH 3   225 13  HOH HOH H . 
Q 6 HOH 4   226 14  HOH HOH H . 
Q 6 HOH 5   227 17  HOH HOH H . 
Q 6 HOH 6   228 228 HOH HOH H . 
Q 6 HOH 7   229 27  HOH HOH H . 
Q 6 HOH 8   230 30  HOH HOH H . 
Q 6 HOH 9   231 34  HOH HOH H . 
Q 6 HOH 10  232 40  HOH HOH H . 
Q 6 HOH 11  233 45  HOH HOH H . 
Q 6 HOH 12  234 46  HOH HOH H . 
Q 6 HOH 13  235 50  HOH HOH H . 
Q 6 HOH 14  236 52  HOH HOH H . 
Q 6 HOH 15  237 237 HOH HOH H . 
Q 6 HOH 16  238 56  HOH HOH H . 
Q 6 HOH 17  239 239 HOH HOH H . 
Q 6 HOH 18  240 58  HOH HOH H . 
Q 6 HOH 19  241 62  HOH HOH H . 
Q 6 HOH 20  242 63  HOH HOH H . 
Q 6 HOH 21  243 67  HOH HOH H . 
Q 6 HOH 22  244 75  HOH HOH H . 
Q 6 HOH 23  245 79  HOH HOH H . 
Q 6 HOH 24  246 246 HOH HOH H . 
Q 6 HOH 25  247 88  HOH HOH H . 
Q 6 HOH 26  248 93  HOH HOH H . 
Q 6 HOH 27  249 249 HOH HOH H . 
Q 6 HOH 28  250 96  HOH HOH H . 
Q 6 HOH 29  251 100 HOH HOH H . 
Q 6 HOH 30  252 109 HOH HOH H . 
Q 6 HOH 31  253 114 HOH HOH H . 
Q 6 HOH 32  254 116 HOH HOH H . 
Q 6 HOH 33  255 124 HOH HOH H . 
Q 6 HOH 34  256 256 HOH HOH H . 
Q 6 HOH 35  257 129 HOH HOH H . 
Q 6 HOH 36  258 138 HOH HOH H . 
Q 6 HOH 37  259 259 HOH HOH H . 
Q 6 HOH 38  260 141 HOH HOH H . 
Q 6 HOH 39  261 144 HOH HOH H . 
Q 6 HOH 40  262 145 HOH HOH H . 
Q 6 HOH 41  263 148 HOH HOH H . 
Q 6 HOH 42  264 150 HOH HOH H . 
Q 6 HOH 43  265 158 HOH HOH H . 
Q 6 HOH 44  266 159 HOH HOH H . 
Q 6 HOH 45  267 163 HOH HOH H . 
Q 6 HOH 46  268 165 HOH HOH H . 
Q 6 HOH 47  269 178 HOH HOH H . 
Q 6 HOH 48  270 180 HOH HOH H . 
Q 6 HOH 49  271 192 HOH HOH H . 
Q 6 HOH 50  272 193 HOH HOH H . 
Q 6 HOH 51  273 194 HOH HOH H . 
Q 6 HOH 52  274 274 HOH HOH H . 
Q 6 HOH 53  275 275 HOH HOH H . 
Q 6 HOH 54  276 276 HOH HOH H . 
Q 6 HOH 55  277 196 HOH HOH H . 
Q 6 HOH 56  278 197 HOH HOH H . 
Q 6 HOH 57  279 202 HOH HOH H . 
Q 6 HOH 58  280 204 HOH HOH H . 
Q 6 HOH 59  281 206 HOH HOH H . 
Q 6 HOH 60  282 207 HOH HOH H . 
Q 6 HOH 61  283 209 HOH HOH H . 
Q 6 HOH 62  284 212 HOH HOH H . 
Q 6 HOH 63  285 213 HOH HOH H . 
Q 6 HOH 64  286 216 HOH HOH H . 
Q 6 HOH 65  287 287 HOH HOH H . 
Q 6 HOH 66  288 221 HOH HOH H . 
Q 6 HOH 67  289 289 HOH HOH H . 
Q 6 HOH 68  297 297 HOH HOH H . 
Q 6 HOH 69  309 309 HOH HOH H . 
Q 6 HOH 70  314 314 HOH HOH H . 
Q 6 HOH 71  315 315 HOH HOH H . 
Q 6 HOH 72  318 318 HOH HOH H . 
Q 6 HOH 73  319 319 HOH HOH H . 
Q 6 HOH 74  321 321 HOH HOH H . 
Q 6 HOH 75  323 323 HOH HOH H . 
Q 6 HOH 76  327 327 HOH HOH H . 
Q 6 HOH 77  330 330 HOH HOH H . 
Q 6 HOH 78  332 332 HOH HOH H . 
Q 6 HOH 79  334 334 HOH HOH H . 
Q 6 HOH 80  342 342 HOH HOH H . 
Q 6 HOH 81  349 349 HOH HOH H . 
Q 6 HOH 82  352 352 HOH HOH H . 
Q 6 HOH 83  362 362 HOH HOH H . 
Q 6 HOH 84  366 366 HOH HOH H . 
Q 6 HOH 85  367 367 HOH HOH H . 
Q 6 HOH 86  376 376 HOH HOH H . 
Q 6 HOH 87  389 389 HOH HOH H . 
Q 6 HOH 88  397 397 HOH HOH H . 
Q 6 HOH 89  402 402 HOH HOH H . 
Q 6 HOH 90  408 408 HOH HOH H . 
Q 6 HOH 91  409 409 HOH HOH H . 
Q 6 HOH 92  412 412 HOH HOH H . 
Q 6 HOH 93  414 414 HOH HOH H . 
Q 6 HOH 94  417 417 HOH HOH H . 
Q 6 HOH 95  435 435 HOH HO