data_3HM5
# 
_entry.id   3HM5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HM5         
RCSB  RCSB053303   
WWPDB D_1000053303 
# 
_pdbx_database_status.entry_id                        3HM5 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-28 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dombrovski, L.'                       1  
'Tempel, W.'                           2  
'Amaya, M.F.'                          3  
'Tong, Y.'                             4  
'Ni, S.'                               5  
'Bountra, C.'                          6  
'Weigelt, J.'                          7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Bochkarev, A.'                        10 
'Min, J.'                              11 
'Park, H.'                             12 
'Wu, H.'                               13 
'Structural Genomics Consortium (SGC)' 14 
# 
_citation.id                        primary 
_citation.title                     'SANT domain of human DNA methyltransferase 1 associated protein 1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dombrovski, L.'   1  
primary 'Tempel, W.'       2  
primary 'Amaya, M.F.'      3  
primary 'Tong, Y.'         4  
primary 'Ni, S.'           5  
primary 'Bountra, C.'      6  
primary 'Weigelt, J.'      7  
primary 'Arrowsmith, C.H.' 8  
primary 'Edwards, A.M.'    9  
primary 'Bochkarev, A.'    10 
primary 'Min, J.'          11 
primary 'Park, H.'         12 
primary 'Wu, H.'           13 
# 
_cell.entry_id           3HM5 
_cell.length_a           36.523 
_cell.length_b           36.523 
_cell.length_c           230.506 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HM5 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.Int_Tables_number                178 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA methyltransferase 1-associated protein 1' 11216.549 1  ? ? 'SANT domain, UNP residues 121-212' ? 
2 non-polymer syn 'CALCIUM ION'                                  40.078    1  ? ? ?                                   ? 
3 non-polymer syn 'UNKNOWN ATOM OR ION'                          ?         5  ? ? ?                                   ? 
4 water       nat water                                          18.015    37 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DNMT1-associated protein 1, DNMAP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHIC
AKLANVRAVPGTD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHIC
AKLANVRAVPGTD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  GLY n 
1 3  LYS n 
1 4  ASP n 
1 5  TYR n 
1 6  PRO n 
1 7  PHE n 
1 8  ALA n 
1 9  ARG n 
1 10 PHE n 
1 11 ASN n 
1 12 LYS n 
1 13 THR n 
1 14 VAL n 
1 15 GLN n 
1 16 VAL n 
1 17 PRO n 
1 18 VAL n 
1 19 TYR n 
1 20 SER n 
1 21 GLU n 
1 22 GLN n 
1 23 GLU n 
1 24 TYR n 
1 25 GLN n 
1 26 LEU n 
1 27 TYR n 
1 28 LEU n 
1 29 HIS n 
1 30 ASP n 
1 31 ASP n 
1 32 ALA n 
1 33 TRP n 
1 34 THR n 
1 35 LYS n 
1 36 ALA n 
1 37 GLU n 
1 38 THR n 
1 39 ASP n 
1 40 HIS n 
1 41 LEU n 
1 42 PHE n 
1 43 ASP n 
1 44 LEU n 
1 45 SER n 
1 46 ARG n 
1 47 ARG n 
1 48 PHE n 
1 49 ASP n 
1 50 LEU n 
1 51 ARG n 
1 52 PHE n 
1 53 VAL n 
1 54 VAL n 
1 55 ILE n 
1 56 HIS n 
1 57 ASP n 
1 58 ARG n 
1 59 TYR n 
1 60 ASP n 
1 61 HIS n 
1 62 GLN n 
1 63 GLN n 
1 64 PHE n 
1 65 LYS n 
1 66 LYS n 
1 67 ARG n 
1 68 SER n 
1 69 VAL n 
1 70 GLU n 
1 71 ASP n 
1 72 LEU n 
1 73 LYS n 
1 74 GLU n 
1 75 ARG n 
1 76 TYR n 
1 77 TYR n 
1 78 HIS n 
1 79 ILE n 
1 80 CYS n 
1 81 ALA n 
1 82 LYS n 
1 83 LEU n 
1 84 ALA n 
1 85 ASN n 
1 86 VAL n 
1 87 ARG n 
1 88 ALA n 
1 89 VAL n 
1 90 PRO n 
1 91 GLY n 
1 92 THR n 
1 93 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DMAP1, KIAA1425' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28-MHL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DMAP1_HUMAN 
_struct_ref.pdbx_db_accession          Q9NPF5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICA
KLANVRAVPGTD
;
_struct_ref.pdbx_align_begin           121 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3HM5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 93 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9NPF5 
_struct_ref_seq.db_align_beg                  121 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  212 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       121 
_struct_ref_seq.pdbx_auth_seq_align_end       212 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3HM5 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9NPF5 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            120 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'         ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION' ? ?                ?       
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3HM5 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   37.83 
_exptl_crystal.density_Matthews      1.98 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'20% PEG3350, 0.2M calcium chloride, 0.1M HEPES, pH 7.0, vapor diffusion, hanging drop, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
3 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' 'MAR scanner 300 mm plate' 2009-04-06 ? 
2 'IMAGE PLATE' 'MAR scanner 300 mm plate' 2009-05-17 ? 
3 'IMAGE PLATE' 'MAR scanner 300 mm plate' 2009-05-16 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 'SINGLE WAVELENGTH' ? 1 M x-ray 
2 'SINGLE WAVELENGTH' ? 1 M x-ray 
3 'SINGLE WAVELENGTH' ? 1 M x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.91987 1.0 
2 1.07221 1.0 
3 1.00645 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength_list 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
1 SYNCHROTRON 'APS BEAMLINE 23-ID-B' 0.91987 ? APS  23-ID-B 
2 SYNCHROTRON 'CLSI BEAMLINE 08ID-1' 1.07221 ? CLSI 08ID-1  
3 SYNCHROTRON 'CLSI BEAMLINE 08ID-1' 1.00645 ? CLSI 08ID-1  
# 
_reflns.entry_id                     3HM5 
_reflns.d_resolution_high            1.800 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   9198 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_netI_over_sigmaI        44.467 
_reflns.pdbx_chi_squared             1.434 
_reflns.pdbx_redundancy              17.000 
_reflns.percent_possible_obs         96.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1,2,3 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
1.80 1.86  ? ? ? 0.470 ? ? 0.772 6.20  ? 693  75.60  ? 1  
1.86 1.94  ? ? ? 0.364 ? ? 0.795 10.60 ? 833  92.80  ? 2  
1.94 2.03  ? ? ? 0.318 ? ? 0.849 15.50 ? 912  99.20  ? 3  
2.03 2.13  ? ? ? 0.233 ? ? 0.969 19.20 ? 897  99.90  ? 4  
2.13 2.27  ? ? ? 0.168 ? ? 1.139 20.00 ? 933  100.00 ? 5  
2.27 2.44  ? ? ? 0.141 ? ? 1.400 20.10 ? 930  100.00 ? 6  
2.44 2.69  ? ? ? 0.115 ? ? 1.387 19.90 ? 932  100.00 ? 7  
2.69 3.08  ? ? ? 0.080 ? ? 1.602 19.60 ? 960  100.00 ? 8  
3.08 3.88  ? ? ? 0.063 ? ? 2.501 18.70 ? 980  99.80  ? 9  
3.88 40.00 ? ? ? 0.042 ? ? 1.884 16.70 ? 1128 99.30  ? 10 
# 
_refine.entry_id                                 3HM5 
_refine.ls_d_res_high                            1.800 
_refine.ls_d_res_low                             19.905 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.040 
_refine.ls_number_reflns_obs                     9080 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 
 U VALUES      : REFINED INDIVIDUALLY. Structure was solved in I4122 spacegroup using SIRAS, using a thimerosal-soaked sample as "native" and a tetrabromoplatinate derivative. DM and RESOLVE were used for NCS averaging after a rough outline of the protein chain was traced in the initial map. Preliminary model was placed into refinement space group using PHASER. The model was automatically updated with ARP/WARP and further refined/validated wit REFMAC/MOLPROBITY.
;
_refine.ls_R_factor_obs                          0.225 
_refine.ls_R_factor_R_work                       0.223 
_refine.ls_wR_factor_R_work                      0.213 
_refine.ls_R_factor_R_free                       0.275 
_refine.ls_wR_factor_R_free                      0.254 
_refine.ls_percent_reflns_R_free                 4.769 
_refine.ls_number_reflns_R_free                  433 
_refine.B_iso_mean                               17.685 
_refine.aniso_B[1][1]                            0.121 
_refine.aniso_B[2][2]                            0.121 
_refine.aniso_B[3][3]                            -0.181 
_refine.aniso_B[1][2]                            0.060 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.937 
_refine.correlation_coeff_Fo_to_Fc_free          0.898 
_refine.pdbx_overall_ESU_R                       0.141 
_refine.pdbx_overall_ESU_R_Free                  0.143 
_refine.overall_SU_ML                            0.090 
_refine.overall_SU_B                             2.851 
_refine.solvent_model_details                    'MASK BULK SOLVENT' 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                53.98 
_refine.B_iso_min                                2.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.01 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        644 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               687 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        19.905 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       665  0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d         441  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    905  1.455  1.905  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg      1050 0.960  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 76   6.521  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 41   29.836 22.195 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 101  11.336 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 7    17.197 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr         93   0.097  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   759  0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other     167  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it            379  1.080  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other         149  0.302  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it           608  1.927  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it            286  2.762  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it           296  4.439  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_low 
_refine_ls_shell.d_res_high 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.pdbx_refine_id 
20 1.846  1.800 661 75.794  470 0.344 31 0.466 . . . . . 'X-RAY DIFFRACTION' 
20 1.897  1.846 636 88.679  537 0.297 27 0.404 . . . . . 'X-RAY DIFFRACTION' 
20 1.951  1.897 617 94.003  551 0.242 29 0.334 . . . . . 'X-RAY DIFFRACTION' 
20 2.010  1.951 622 99.035  581 0.244 35 0.316 . . . . . 'X-RAY DIFFRACTION' 
20 2.076  2.010 584 99.829  553 0.215 30 0.269 . . . . . 'X-RAY DIFFRACTION' 
20 2.148  2.076 597 100.000 573 0.205 24 0.249 . . . . . 'X-RAY DIFFRACTION' 
20 2.228  2.148 529 100.000 506 0.189 23 0.181 . . . . . 'X-RAY DIFFRACTION' 
20 2.317  2.228 553 100.000 527 0.192 26 0.218 . . . . . 'X-RAY DIFFRACTION' 
20 2.419  2.317 531 100.000 512 0.204 19 0.258 . . . . . 'X-RAY DIFFRACTION' 
20 2.535  2.419 490 100.000 463 0.213 27 0.237 . . . . . 'X-RAY DIFFRACTION' 
20 2.670  2.535 479 100.000 459 0.207 20 0.285 . . . . . 'X-RAY DIFFRACTION' 
20 2.829  2.670 458 100.000 438 0.226 20 0.343 . . . . . 'X-RAY DIFFRACTION' 
20 3.020  2.829 446 100.000 416 0.233 30 0.299 . . . . . 'X-RAY DIFFRACTION' 
20 3.255  3.020 397 100.000 372 0.230 25 0.309 . . . . . 'X-RAY DIFFRACTION' 
20 3.557  3.255 392 100.000 378 0.208 14 0.328 . . . . . 'X-RAY DIFFRACTION' 
20 3.961  3.557 355 100.000 341 0.198 14 0.252 . . . . . 'X-RAY DIFFRACTION' 
20 4.543  3.961 328 100.000 317 0.195 11 0.150 . . . . . 'X-RAY DIFFRACTION' 
20 5.494  4.543 269 100.000 256 0.221 13 0.195 . . . . . 'X-RAY DIFFRACTION' 
20 7.489  5.494 240 100.000 232 0.284 8  0.455 . . . . . 'X-RAY DIFFRACTION' 
20 19.905 7.489 173 99.422  165 0.292 7  0.313 . . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HM5 
_struct.title                     'SANT domain of human DNA methyltransferase 1 associated protein 1' 
_struct.pdbx_descriptor           'DNA methyltransferase 1-associated protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HM5 
_struct_keywords.text            
;DNA methylation, chromatin, Structural Genomics Consortium, SGC, Activator, Chromatin regulator, Coiled coil, Growth regulation, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation
;
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 20 ? LEU A 28 ? SER A 139 LEU A 147 1 ? 9  
HELX_P HELX_P2 2 THR A 34 ? PHE A 48 ? THR A 153 PHE A 167 1 ? 15 
HELX_P HELX_P3 3 ARG A 51 ? TYR A 59 ? ARG A 170 TYR A 178 1 ? 9  
HELX_P HELX_P4 4 SER A 68 ? ARG A 87 ? SER A 187 ARG A 206 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A ARG 46 O   ? ? ? 1_555 B CA  . CA ? ? A ARG 165 A CA  1   1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc2 metalc ? ? A ASP 49 OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 168 A CA  1   1_555 ? ? ? ? ? ? ? 2.722 ? 
metalc3 metalc ? ? B CA  .  CA  ? ? ? 1_555 H HOH . O  ? ? A CA  1   A HOH 217 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc4 metalc ? ? B CA  .  CA  ? ? ? 1_555 H HOH . O  ? ? A CA  1   A HOH 214 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc5 metalc ? ? B CA  .  CA  ? ? ? 1_555 H HOH . O  ? ? A CA  1   A HOH 215 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc6 metalc ? ? B CA  .  CA  ? ? ? 1_555 H HOH . O  ? ? A CA  1   A HOH 216 1_555 ? ? ? ? ? ? ? 2.779 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE CA A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 ARG A 46 ? ARG A 165 . ? 1_555 ? 
2 AC1 7 ASP A 49 ? ASP A 168 . ? 1_555 ? 
3 AC1 7 ASP A 57 ? ASP A 176 . ? 8_665 ? 
4 AC1 7 HOH H .  ? HOH A 214 . ? 1_555 ? 
5 AC1 7 HOH H .  ? HOH A 215 . ? 1_555 ? 
6 AC1 7 HOH H .  ? HOH A 216 . ? 1_555 ? 
7 AC1 7 HOH H .  ? HOH A 217 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3HM5 
_atom_sites.fract_transf_matrix[1][1]   0.027380 
_atom_sites.fract_transf_matrix[1][2]   0.015808 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.031616 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004338 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . GLN A 1 15 ? 9.267   23.122 -6.076 1.00 29.91 ? 134 GLN A N   1 
ATOM   2   C  CA  . GLN A 1 15 ? 9.834   22.225 -5.039 1.00 28.86 ? 134 GLN A CA  1 
ATOM   3   C  C   . GLN A 1 15 ? 9.683   22.817 -3.616 1.00 27.16 ? 134 GLN A C   1 
ATOM   4   O  O   . GLN A 1 15 ? 9.723   24.018 -3.397 1.00 26.59 ? 134 GLN A O   1 
ATOM   5   C  CB  . GLN A 1 15 ? 11.324  22.009 -5.270 1.00 30.57 ? 134 GLN A CB  1 
ATOM   6   C  CG  . GLN A 1 15 ? 11.720  21.386 -6.595 1.00 33.89 ? 134 GLN A CG  1 
ATOM   7   C  CD  . GLN A 1 15 ? 13.216  21.420 -6.753 1.00 38.73 ? 134 GLN A CD  1 
ATOM   8   O  OE1 . GLN A 1 15 ? 13.881  22.325 -6.238 1.00 40.52 ? 134 GLN A OE1 1 
ATOM   9   N  NE2 . GLN A 1 15 ? 13.760  20.452 -7.476 1.00 42.65 ? 134 GLN A NE2 1 
ATOM   10  N  N   . VAL A 1 16 ? 9.635   21.926 -2.646 1.00 25.30 ? 135 VAL A N   1 
ATOM   11  C  CA  . VAL A 1 16 ? 9.465   22.330 -1.268 1.00 22.73 ? 135 VAL A CA  1 
ATOM   12  C  C   . VAL A 1 16 ? 10.823  22.647 -0.700 1.00 20.78 ? 135 VAL A C   1 
ATOM   13  O  O   . VAL A 1 16 ? 11.729  21.798 -0.734 1.00 20.64 ? 135 VAL A O   1 
ATOM   14  C  CB  . VAL A 1 16 ? 8.745   21.213 -0.509 1.00 22.74 ? 135 VAL A CB  1 
ATOM   15  C  CG1 . VAL A 1 16 ? 8.554   21.552 0.976  1.00 21.57 ? 135 VAL A CG1 1 
ATOM   16  C  CG2 . VAL A 1 16 ? 7.417   20.959 -1.186 1.00 20.58 ? 135 VAL A CG2 1 
ATOM   17  N  N   . PRO A 1 17 ? 10.988  23.852 -0.122 1.00 18.40 ? 136 PRO A N   1 
ATOM   18  C  CA  . PRO A 1 17 ? 12.251  24.148 0.587  1.00 17.57 ? 136 PRO A CA  1 
ATOM   19  C  C   . PRO A 1 17 ? 12.556  23.155 1.707  1.00 17.80 ? 136 PRO A C   1 
ATOM   20  O  O   . PRO A 1 17 ? 11.642  22.552 2.250  1.00 18.16 ? 136 PRO A O   1 
ATOM   21  C  CB  . PRO A 1 17 ? 12.011  25.541 1.176  1.00 17.71 ? 136 PRO A CB  1 
ATOM   22  C  CG  . PRO A 1 17 ? 10.941  26.122 0.288  1.00 17.31 ? 136 PRO A CG  1 
ATOM   23  C  CD  . PRO A 1 17 ? 10.047  24.977 -0.014 1.00 19.74 ? 136 PRO A CD  1 
ATOM   24  N  N   . VAL A 1 18 ? 13.825  23.029 2.069  1.00 17.63 ? 137 VAL A N   1 
ATOM   25  C  CA  . VAL A 1 18 ? 14.254  22.198 3.189  1.00 17.41 ? 137 VAL A CA  1 
ATOM   26  C  C   . VAL A 1 18 ? 15.038  23.101 4.130  1.00 17.93 ? 137 VAL A C   1 
ATOM   27  O  O   . VAL A 1 18 ? 16.102  23.626 3.778  1.00 18.99 ? 137 VAL A O   1 
ATOM   28  C  CB  . VAL A 1 18 ? 15.122  21.012 2.726  1.00 16.29 ? 137 VAL A CB  1 
ATOM   29  C  CG1 . VAL A 1 18 ? 15.436  20.109 3.894  1.00 19.64 ? 137 VAL A CG1 1 
ATOM   30  C  CG2 . VAL A 1 18 ? 14.426  20.255 1.624  1.00 16.92 ? 137 VAL A CG2 1 
ATOM   31  N  N   . TYR A 1 19 ? 14.533  23.274 5.342  1.00 17.31 ? 138 TYR A N   1 
ATOM   32  C  CA  . TYR A 1 19 ? 15.244  24.068 6.332  1.00 16.09 ? 138 TYR A CA  1 
ATOM   33  C  C   . TYR A 1 19 ? 16.123  23.154 7.176  1.00 18.62 ? 138 TYR A C   1 
ATOM   34  O  O   . TYR A 1 19 ? 15.783  21.981 7.455  1.00 19.15 ? 138 TYR A O   1 
ATOM   35  C  CB  . TYR A 1 19 ? 14.293  24.865 7.214  1.00 15.43 ? 138 TYR A CB  1 
ATOM   36  C  CG  . TYR A 1 19 ? 13.118  24.079 7.747  1.00 14.47 ? 138 TYR A CG  1 
ATOM   37  C  CD1 . TYR A 1 19 ? 13.256  23.191 8.825  1.00 16.74 ? 138 TYR A CD1 1 
ATOM   38  C  CD2 . TYR A 1 19 ? 11.843  24.228 7.179  1.00 13.94 ? 138 TYR A CD2 1 
ATOM   39  C  CE1 . TYR A 1 19 ? 12.154  22.458 9.288  1.00 15.00 ? 138 TYR A CE1 1 
ATOM   40  C  CE2 . TYR A 1 19 ? 10.756  23.522 7.647  1.00 10.86 ? 138 TYR A CE2 1 
ATOM   41  C  CZ  . TYR A 1 19 ? 10.902  22.652 8.702  1.00 13.30 ? 138 TYR A CZ  1 
ATOM   42  O  OH  . TYR A 1 19 ? 9.805   21.966 9.179  1.00 14.50 ? 138 TYR A OH  1 
ATOM   43  N  N   . SER A 1 20 ? 17.279  23.681 7.568  1.00 20.21 ? 139 SER A N   1 
ATOM   44  C  CA  . SER A 1 20 ? 18.123  23.011 8.559  1.00 21.06 ? 139 SER A CA  1 
ATOM   45  C  C   . SER A 1 20 ? 17.580  23.176 9.964  1.00 21.51 ? 139 SER A C   1 
ATOM   46  O  O   . SER A 1 20 ? 16.739  24.026 10.226 1.00 19.99 ? 139 SER A O   1 
ATOM   47  C  CB  . SER A 1 20 ? 19.547  23.549 8.488  1.00 21.18 ? 139 SER A CB  1 
ATOM   48  O  OG  . SER A 1 20 ? 19.627  24.883 8.920  1.00 21.89 ? 139 SER A OG  1 
ATOM   49  N  N   . GLU A 1 21 ? 18.090  22.363 10.895 1.00 22.80 ? 140 GLU A N   1 
ATOM   50  C  CA  . GLU A 1 21 ? 17.661  22.476 12.280 1.00 22.89 ? 140 GLU A CA  1 
ATOM   51  C  C   . GLU A 1 21 ? 18.011  23.863 12.823 1.00 23.02 ? 140 GLU A C   1 
ATOM   52  O  O   . GLU A 1 21 ? 17.221  24.483 13.551 1.00 22.29 ? 140 GLU A O   1 
ATOM   53  C  CB  . GLU A 1 21 ? 18.261  21.355 13.162 1.00 23.99 ? 140 GLU A CB  1 
ATOM   54  N  N   . GLN A 1 22 ? 19.204  24.352 12.481 1.00 23.33 ? 141 GLN A N   1 
ATOM   55  C  CA  . GLN A 1 22 ? 19.644  25.661 12.918 1.00 24.03 ? 141 GLN A CA  1 
ATOM   56  C  C   . GLN A 1 22 ? 18.774  26.752 12.322 1.00 21.36 ? 141 GLN A C   1 
ATOM   57  O  O   . GLN A 1 22 ? 18.431  27.709 12.996 1.00 22.00 ? 141 GLN A O   1 
ATOM   58  C  CB  . GLN A 1 22 ? 21.093  25.914 12.532 1.00 24.73 ? 141 GLN A CB  1 
ATOM   59  C  CG  . GLN A 1 22 ? 21.580  27.277 12.965 1.00 30.32 ? 141 GLN A CG  1 
ATOM   60  C  CD  . GLN A 1 22 ? 23.062  27.464 12.721 1.00 36.80 ? 141 GLN A CD  1 
ATOM   61  O  OE1 . GLN A 1 22 ? 23.722  26.593 12.158 1.00 44.37 ? 141 GLN A OE1 1 
ATOM   62  N  NE2 . GLN A 1 22 ? 23.588  28.607 13.129 1.00 40.49 ? 141 GLN A NE2 1 
ATOM   63  N  N   . GLU A 1 23 ? 18.422  26.606 11.045 1.00 20.18 ? 142 GLU A N   1 
ATOM   64  C  CA  . GLU A 1 23 ? 17.525  27.560 10.423 1.00 18.39 ? 142 GLU A CA  1 
ATOM   65  C  C   . GLU A 1 23 ? 16.175  27.639 11.147 1.00 17.37 ? 142 GLU A C   1 
ATOM   66  O  O   . GLU A 1 23 ? 15.665  28.727 11.394 1.00 16.17 ? 142 GLU A O   1 
ATOM   67  C  CB  . GLU A 1 23 ? 17.309  27.247 8.935  1.00 18.19 ? 142 GLU A CB  1 
ATOM   68  C  CG  . GLU A 1 23 ? 18.366  27.830 8.042  1.00 17.69 ? 142 GLU A CG  1 
ATOM   69  C  CD  . GLU A 1 23 ? 18.259  27.389 6.604  1.00 20.68 ? 142 GLU A CD  1 
ATOM   70  O  OE1 . GLU A 1 23 ? 17.742  26.273 6.340  1.00 20.55 ? 142 GLU A OE1 1 
ATOM   71  O  OE2 . GLU A 1 23 ? 18.671  28.176 5.717  1.00 17.91 ? 142 GLU A OE2 1 
ATOM   72  N  N   . TYR A 1 24 ? 15.580  26.491 11.445 1.00 17.77 ? 143 TYR A N   1 
ATOM   73  C  CA  . TYR A 1 24 ? 14.367  26.484 12.215 1.00 17.03 ? 143 TYR A CA  1 
ATOM   74  C  C   . TYR A 1 24 ? 14.521  27.231 13.568 1.00 17.46 ? 143 TYR A C   1 
ATOM   75  O  O   . TYR A 1 24 ? 13.693  28.051 13.950 1.00 17.18 ? 143 TYR A O   1 
ATOM   76  C  CB  . TYR A 1 24 ? 13.848  25.061 12.446 1.00 17.00 ? 143 TYR A CB  1 
ATOM   77  C  CG  . TYR A 1 24 ? 12.417  25.083 12.908 1.00 16.40 ? 143 TYR A CG  1 
ATOM   78  C  CD1 . TYR A 1 24 ? 11.349  24.937 11.992 1.00 18.90 ? 143 TYR A CD1 1 
ATOM   79  C  CD2 . TYR A 1 24 ? 12.099  25.295 14.229 1.00 16.33 ? 143 TYR A CD2 1 
ATOM   80  C  CE1 . TYR A 1 24 ? 10.041  24.980 12.401 1.00 17.29 ? 143 TYR A CE1 1 
ATOM   81  C  CE2 . TYR A 1 24 ? 10.783  25.336 14.665 1.00 16.10 ? 143 TYR A CE2 1 
ATOM   82  C  CZ  . TYR A 1 24 ? 9.740   25.219 13.733 1.00 15.92 ? 143 TYR A CZ  1 
ATOM   83  O  OH  . TYR A 1 24 ? 8.432   25.296 14.151 1.00 14.12 ? 143 TYR A OH  1 
ATOM   84  N  N   . GLN A 1 25 ? 15.592  26.920 14.295 1.00 19.51 ? 144 GLN A N   1 
ATOM   85  C  CA  . GLN A 1 25 ? 15.772  27.448 15.648 1.00 20.10 ? 144 GLN A CA  1 
ATOM   86  C  C   . GLN A 1 25 ? 15.916  28.968 15.629 1.00 20.90 ? 144 GLN A C   1 
ATOM   87  O  O   . GLN A 1 25 ? 15.263  29.697 16.381 1.00 22.84 ? 144 GLN A O   1 
ATOM   88  C  CB  . GLN A 1 25 ? 17.007  26.787 16.284 1.00 20.75 ? 144 GLN A CB  1 
ATOM   89  N  N   . LEU A 1 26 ? 16.719  29.457 14.711 1.00 21.75 ? 145 LEU A N   1 
ATOM   90  C  CA  . LEU A 1 26 ? 16.960  30.904 14.601 1.00 21.95 ? 145 LEU A CA  1 
ATOM   91  C  C   . LEU A 1 26 ? 15.794  31.736 14.048 1.00 21.71 ? 145 LEU A C   1 
ATOM   92  O  O   . LEU A 1 26 ? 15.553  32.873 14.475 1.00 21.41 ? 145 LEU A O   1 
ATOM   93  C  CB  . LEU A 1 26 ? 18.243  31.150 13.801 1.00 22.80 ? 145 LEU A CB  1 
ATOM   94  C  CG  . LEU A 1 26 ? 19.597  30.698 14.390 1.00 24.80 ? 145 LEU A CG  1 
ATOM   95  C  CD1 . LEU A 1 26 ? 20.720  30.765 13.337 1.00 28.52 ? 145 LEU A CD1 1 
ATOM   96  C  CD2 . LEU A 1 26 ? 19.992  31.567 15.598 1.00 27.55 ? 145 LEU A CD2 1 
ATOM   97  N  N   . TYR A 1 27 ? 15.046  31.178 13.101 1.00 20.36 ? 146 TYR A N   1 
ATOM   98  C  CA  . TYR A 1 27 ? 14.230  31.996 12.222 1.00 19.83 ? 146 TYR A CA  1 
ATOM   99  C  C   . TYR A 1 27 ? 12.784  31.582 12.098 1.00 18.73 ? 146 TYR A C   1 
ATOM   100 O  O   . TYR A 1 27 ? 11.949  32.413 11.720 1.00 17.84 ? 146 TYR A O   1 
ATOM   101 C  CB  . TYR A 1 27 ? 14.810  31.994 10.799 1.00 20.08 ? 146 TYR A CB  1 
ATOM   102 C  CG  . TYR A 1 27 ? 16.277  32.390 10.722 1.00 21.45 ? 146 TYR A CG  1 
ATOM   103 C  CD1 . TYR A 1 27 ? 16.698  33.635 11.167 1.00 26.29 ? 146 TYR A CD1 1 
ATOM   104 C  CD2 . TYR A 1 27 ? 17.231  31.525 10.173 1.00 24.29 ? 146 TYR A CD2 1 
ATOM   105 C  CE1 . TYR A 1 27 ? 18.053  34.007 11.096 1.00 27.54 ? 146 TYR A CE1 1 
ATOM   106 C  CE2 . TYR A 1 27 ? 18.570  31.890 10.104 1.00 27.32 ? 146 TYR A CE2 1 
ATOM   107 C  CZ  . TYR A 1 27 ? 18.960  33.130 10.579 1.00 27.09 ? 146 TYR A CZ  1 
ATOM   108 O  OH  . TYR A 1 27 ? 20.266  33.506 10.511 1.00 32.89 ? 146 TYR A OH  1 
ATOM   109 N  N   . LEU A 1 28 ? 12.479  30.316 12.380 1.00 17.10 ? 147 LEU A N   1 
ATOM   110 C  CA  . LEU A 1 28 ? 11.160  29.753 11.940 1.00 16.24 ? 147 LEU A CA  1 
ATOM   111 C  C   . LEU A 1 28 ? 10.186  29.439 13.075 1.00 16.82 ? 147 LEU A C   1 
ATOM   112 O  O   . LEU A 1 28 ? 9.117   28.885 12.864 1.00 16.04 ? 147 LEU A O   1 
ATOM   113 C  CB  . LEU A 1 28 ? 11.344  28.518 11.059 1.00 16.03 ? 147 LEU A CB  1 
ATOM   114 C  CG  . LEU A 1 28 ? 12.307  28.630 9.854  1.00 13.69 ? 147 LEU A CG  1 
ATOM   115 C  CD1 . LEU A 1 28 ? 12.275  27.366 9.033  1.00 14.75 ? 147 LEU A CD1 1 
ATOM   116 C  CD2 . LEU A 1 28 ? 11.981  29.816 8.889  1.00 13.20 ? 147 LEU A CD2 1 
ATOM   117 N  N   . HIS A 1 29 ? 10.569  29.776 14.302 1.00 18.49 ? 148 HIS A N   1 
ATOM   118 C  CA  . HIS A 1 29 ? 9.682   29.552 15.422 1.00 19.35 ? 148 HIS A CA  1 
ATOM   119 C  C   . HIS A 1 29 ? 8.410   30.332 15.323 1.00 18.75 ? 148 HIS A C   1 
ATOM   120 O  O   . HIS A 1 29 ? 8.388   31.442 14.807 1.00 18.43 ? 148 HIS A O   1 
ATOM   121 C  CB  . HIS A 1 29 ? 10.427  29.872 16.725 1.00 21.07 ? 148 HIS A CB  1 
ATOM   122 C  CG  . HIS A 1 29 ? 11.261  28.720 17.171 1.00 27.33 ? 148 HIS A CG  1 
ATOM   123 N  ND1 . HIS A 1 29 ? 10.726  27.481 17.441 1.00 34.26 ? 148 HIS A ND1 1 
ATOM   124 C  CD2 . HIS A 1 29 ? 12.595  28.597 17.344 1.00 34.86 ? 148 HIS A CD2 1 
ATOM   125 C  CE1 . HIS A 1 29 ? 11.692  26.645 17.778 1.00 35.35 ? 148 HIS A CE1 1 
ATOM   126 N  NE2 . HIS A 1 29 ? 12.838  27.299 17.723 1.00 33.18 ? 148 HIS A NE2 1 
ATOM   127 N  N   . ASP A 1 30 ? 7.321   29.737 15.781 1.00 17.70 ? 149 ASP A N   1 
ATOM   128 C  CA  . ASP A 1 30 ? 6.071   30.430 15.877 1.00 17.79 ? 149 ASP A CA  1 
ATOM   129 C  C   . ASP A 1 30 ? 5.461   29.947 17.185 1.00 17.88 ? 149 ASP A C   1 
ATOM   130 O  O   . ASP A 1 30 ? 5.472   28.774 17.451 1.00 17.34 ? 149 ASP A O   1 
ATOM   131 C  CB  . ASP A 1 30 ? 5.184   30.085 14.706 1.00 17.43 ? 149 ASP A CB  1 
ATOM   132 C  CG  . ASP A 1 30 ? 3.888   30.812 14.723 1.00 22.12 ? 149 ASP A CG  1 
ATOM   133 O  OD1 . ASP A 1 30 ? 3.706   31.675 13.832 1.00 27.27 ? 149 ASP A OD1 1 
ATOM   134 O  OD2 . ASP A 1 30 ? 3.008   30.530 15.558 1.00 19.39 ? 149 ASP A OD2 1 
ATOM   135 N  N   . ASP A 1 31 ? 4.925   30.866 17.987 1.00 18.97 ? 150 ASP A N   1 
ATOM   136 C  CA  . ASP A 1 31 ? 4.329   30.485 19.290 1.00 18.92 ? 150 ASP A CA  1 
ATOM   137 C  C   . ASP A 1 31 ? 3.216   29.452 19.192 1.00 18.49 ? 150 ASP A C   1 
ATOM   138 O  O   . ASP A 1 31 ? 2.929   28.767 20.187 1.00 18.78 ? 150 ASP A O   1 
ATOM   139 C  CB  . ASP A 1 31 ? 3.767   31.701 20.038 1.00 20.56 ? 150 ASP A CB  1 
ATOM   140 C  CG  . ASP A 1 31 ? 4.831   32.681 20.476 1.00 24.29 ? 150 ASP A CG  1 
ATOM   141 O  OD1 . ASP A 1 31 ? 6.046   32.390 20.411 1.00 23.43 ? 150 ASP A OD1 1 
ATOM   142 O  OD2 . ASP A 1 31 ? 4.429   33.799 20.870 1.00 30.27 ? 150 ASP A OD2 1 
ATOM   143 N  N   . ALA A 1 32 ? 2.575   29.308 18.020 1.00 17.55 ? 151 ALA A N   1 
ATOM   144 C  CA  . ALA A 1 32 ? 1.449   28.385 17.854 1.00 16.65 ? 151 ALA A CA  1 
ATOM   145 C  C   . ALA A 1 32 ? 1.737   27.086 17.066 1.00 16.54 ? 151 ALA A C   1 
ATOM   146 O  O   . ALA A 1 32 ? 0.807   26.303 16.827 1.00 17.80 ? 151 ALA A O   1 
ATOM   147 C  CB  . ALA A 1 32 ? 0.237   29.149 17.199 1.00 18.94 ? 151 ALA A CB  1 
ATOM   148 N  N   . TRP A 1 33 ? 3.007   26.847 16.711 1.00 15.78 ? 152 TRP A N   1 
ATOM   149 C  CA  . TRP A 1 33 ? 3.442   25.713 15.922 1.00 15.72 ? 152 TRP A CA  1 
ATOM   150 C  C   . TRP A 1 33 ? 4.630   25.057 16.567 1.00 15.34 ? 152 TRP A C   1 
ATOM   151 O  O   . TRP A 1 33 ? 5.553   25.753 16.979 1.00 16.52 ? 152 TRP A O   1 
ATOM   152 C  CB  . TRP A 1 33 ? 3.889   26.171 14.517 1.00 16.73 ? 152 TRP A CB  1 
ATOM   153 C  CG  . TRP A 1 33 ? 2.759   26.497 13.599 1.00 16.18 ? 152 TRP A CG  1 
ATOM   154 C  CD1 . TRP A 1 33 ? 2.010   27.641 13.578 1.00 15.70 ? 152 TRP A CD1 1 
ATOM   155 C  CD2 . TRP A 1 33 ? 2.290   25.675 12.531 1.00 16.15 ? 152 TRP A CD2 1 
ATOM   156 N  NE1 . TRP A 1 33 ? 1.037   27.538 12.594 1.00 20.00 ? 152 TRP A NE1 1 
ATOM   157 C  CE2 . TRP A 1 33 ? 1.207   26.346 11.929 1.00 18.12 ? 152 TRP A CE2 1 
ATOM   158 C  CE3 . TRP A 1 33 ? 2.674   24.406 12.042 1.00 14.99 ? 152 TRP A CE3 1 
ATOM   159 C  CZ2 . TRP A 1 33 ? 0.479   25.788 10.843 1.00 17.22 ? 152 TRP A CZ2 1 
ATOM   160 C  CZ3 . TRP A 1 33 ? 1.964   23.848 10.967 1.00 16.53 ? 152 TRP A CZ3 1 
ATOM   161 C  CH2 . TRP A 1 33 ? 0.883   24.549 10.380 1.00 18.33 ? 152 TRP A CH2 1 
ATOM   162 N  N   . THR A 1 34 ? 4.632   23.730 16.618 1.00 15.72 ? 153 THR A N   1 
ATOM   163 C  CA  . THR A 1 34 ? 5.817   22.964 17.017 1.00 14.99 ? 153 THR A CA  1 
ATOM   164 C  C   . THR A 1 34 ? 6.660   22.725 15.791 1.00 16.19 ? 153 THR A C   1 
ATOM   165 O  O   . THR A 1 34 ? 6.139   22.780 14.658 1.00 16.31 ? 153 THR A O   1 
ATOM   166 C  CB  . THR A 1 34 ? 5.458   21.580 17.589 1.00 15.80 ? 153 THR A CB  1 
ATOM   167 O  OG1 . THR A 1 34 ? 4.756   20.804 16.607 1.00 15.54 ? 153 THR A OG1 1 
ATOM   168 C  CG2 . THR A 1 34 ? 4.608   21.695 18.884 1.00 16.76 ? 153 THR A CG2 1 
ATOM   169 N  N   . LYS A 1 35 ? 7.938   22.414 15.982 1.00 15.19 ? 154 LYS A N   1 
ATOM   170 C  CA  . LYS A 1 35 ? 8.763   21.954 14.891 1.00 15.43 ? 154 LYS A CA  1 
ATOM   171 C  C   . LYS A 1 35 ? 8.236   20.656 14.358 1.00 15.38 ? 154 LYS A C   1 
ATOM   172 O  O   . LYS A 1 35 ? 8.213   20.444 13.153 1.00 13.63 ? 154 LYS A O   1 
ATOM   173 C  CB  . LYS A 1 35 ? 10.224  21.800 15.277 1.00 15.82 ? 154 LYS A CB  1 
ATOM   174 C  CG  . LYS A 1 35 ? 11.132  21.515 14.060 1.00 18.41 ? 154 LYS A CG  1 
ATOM   175 C  CD  . LYS A 1 35 ? 12.576  21.327 14.433 1.00 20.82 ? 154 LYS A CD  1 
ATOM   176 C  CE  . LYS A 1 35 ? 13.458  21.177 13.202 1.00 18.94 ? 154 LYS A CE  1 
ATOM   177 N  NZ  . LYS A 1 35 ? 13.254  19.870 12.512 1.00 15.32 ? 154 LYS A NZ  1 
ATOM   178 N  N   . ALA A 1 36 ? 7.778   19.780 15.238 1.00 14.92 ? 155 ALA A N   1 
ATOM   179 C  CA  . ALA A 1 36 ? 7.198   18.545 14.780 1.00 15.75 ? 155 ALA A CA  1 
ATOM   180 C  C   . ALA A 1 36 ? 6.046   18.759 13.792 1.00 15.06 ? 155 ALA A C   1 
ATOM   181 O  O   . ALA A 1 36 ? 6.008   18.100 12.737 1.00 14.37 ? 155 ALA A O   1 
ATOM   182 C  CB  . ALA A 1 36 ? 6.718   17.696 15.999 1.00 15.20 ? 155 ALA A CB  1 
ATOM   183 N  N   . GLU A 1 37 ? 5.138   19.668 14.090 1.00 15.25 ? 156 GLU A N   1 
ATOM   184 C  CA  . GLU A 1 37 ? 4.007   19.898 13.198 1.00 15.59 ? 156 GLU A CA  1 
ATOM   185 C  C   . GLU A 1 37 ? 4.479   20.531 11.896 1.00 14.81 ? 156 GLU A C   1 
ATOM   186 O  O   . GLU A 1 37 ? 3.984   20.207 10.807 1.00 12.69 ? 156 GLU A O   1 
ATOM   187 C  CB  . GLU A 1 37 ? 2.961   20.834 13.854 1.00 16.75 ? 156 GLU A CB  1 
ATOM   188 C  CG  . GLU A 1 37 ? 1.709   20.860 13.061 1.00 18.96 ? 156 GLU A CG  1 
ATOM   189 C  CD  . GLU A 1 37 ? 0.674   21.846 13.529 1.00 23.66 ? 156 GLU A CD  1 
ATOM   190 O  OE1 . GLU A 1 37 ? 0.815   22.428 14.646 1.00 21.31 ? 156 GLU A OE1 1 
ATOM   191 O  OE2 . GLU A 1 37 ? -0.267  22.047 12.731 1.00 21.76 ? 156 GLU A OE2 1 
ATOM   192 N  N   . THR A 1 38 ? 5.407   21.495 12.008 1.00 13.29 ? 157 THR A N   1 
ATOM   193 C  CA  . THR A 1 38 ? 5.947   22.142 10.813 1.00 12.62 ? 157 THR A CA  1 
ATOM   194 C  C   . THR A 1 38 ? 6.611   21.110 9.883  1.00 12.33 ? 157 THR A C   1 
ATOM   195 O  O   . THR A 1 38 ? 6.409   21.106 8.675  1.00 11.25 ? 157 THR A O   1 
ATOM   196 C  CB  . THR A 1 38 ? 6.921   23.297 11.191 1.00 12.86 ? 157 THR A CB  1 
ATOM   197 O  OG1 . THR A 1 38 ? 6.272   24.211 12.084 1.00 13.46 ? 157 THR A OG1 1 
ATOM   198 C  CG2 . THR A 1 38 ? 7.346   24.045 9.956  1.00 10.33 ? 157 THR A CG2 1 
ATOM   199 N  N   . ASP A 1 39 ? 7.429   20.234 10.462 1.00 11.91 ? 158 ASP A N   1 
ATOM   200 C  CA  . ASP A 1 39 ? 8.070   19.146 9.729  1.00 12.70 ? 158 ASP A CA  1 
ATOM   201 C  C   . ASP A 1 39 ? 7.026   18.265 9.009  1.00 12.92 ? 158 ASP A C   1 
ATOM   202 O  O   . ASP A 1 39 ? 7.216   17.910 7.843  1.00 11.57 ? 158 ASP A O   1 
ATOM   203 C  CB  . ASP A 1 39 ? 8.871   18.241 10.695 1.00 13.37 ? 158 ASP A CB  1 
ATOM   204 C  CG  . ASP A 1 39 ? 10.172  18.878 11.176 1.00 16.54 ? 158 ASP A CG  1 
ATOM   205 O  OD1 . ASP A 1 39 ? 10.547  19.979 10.733 1.00 17.38 ? 158 ASP A OD1 1 
ATOM   206 O  OD2 . ASP A 1 39 ? 10.763  18.279 12.081 1.00 15.88 ? 158 ASP A OD2 1 
ATOM   207 N  N   . HIS A 1 40 ? 5.940   17.963 9.716  1.00 12.34 ? 159 HIS A N   1 
ATOM   208 C  CA  . HIS A 1 40 ? 4.789   17.201 9.168  1.00 13.59 ? 159 HIS A CA  1 
ATOM   209 C  C   . HIS A 1 40 ? 4.177   17.935 7.974  1.00 12.42 ? 159 HIS A C   1 
ATOM   210 O  O   . HIS A 1 40 ? 3.961   17.323 6.910  1.00 13.36 ? 159 HIS A O   1 
ATOM   211 C  CB  . HIS A 1 40 ? 3.749   17.020 10.263 1.00 13.39 ? 159 HIS A CB  1 
ATOM   212 C  CG  . HIS A 1 40 ? 2.516   16.277 9.855  1.00 14.79 ? 159 HIS A CG  1 
ATOM   213 N  ND1 . HIS A 1 40 ? 2.547   15.045 9.239  1.00 15.66 ? 159 HIS A ND1 1 
ATOM   214 C  CD2 . HIS A 1 40 ? 1.210   16.597 10.006 1.00 15.05 ? 159 HIS A CD2 1 
ATOM   215 C  CE1 . HIS A 1 40 ? 1.300   14.634 9.043  1.00 17.36 ? 159 HIS A CE1 1 
ATOM   216 N  NE2 . HIS A 1 40 ? 0.475   15.557 9.503  1.00 16.45 ? 159 HIS A NE2 1 
ATOM   217 N  N   . LEU A 1 41 ? 3.882   19.225 8.125  1.00 12.07 ? 160 LEU A N   1 
ATOM   218 C  CA  . LEU A 1 41 ? 3.381   20.020 7.007  1.00 11.35 ? 160 LEU A CA  1 
ATOM   219 C  C   . LEU A 1 41 ? 4.301   19.949 5.762  1.00 11.19 ? 160 LEU A C   1 
ATOM   220 O  O   . LEU A 1 41 ? 3.835   19.767 4.648  1.00 11.50 ? 160 LEU A O   1 
ATOM   221 C  CB  . LEU A 1 41 ? 3.228   21.471 7.469  1.00 11.42 ? 160 LEU A CB  1 
ATOM   222 C  CG  . LEU A 1 41 ? 2.991   22.540 6.422  1.00 11.35 ? 160 LEU A CG  1 
ATOM   223 C  CD1 . LEU A 1 41 ? 1.641   22.210 5.698  1.00 10.16 ? 160 LEU A CD1 1 
ATOM   224 C  CD2 . LEU A 1 41 ? 3.034   23.929 7.042  1.00 10.20 ? 160 LEU A CD2 1 
ATOM   225 N  N   . PHE A 1 42 ? 5.601   20.109 5.985  1.00 11.22 ? 161 PHE A N   1 
ATOM   226 C  CA  . PHE A 1 42 ? 6.574   20.119 4.900  1.00 12.10 ? 161 PHE A CA  1 
ATOM   227 C  C   . PHE A 1 42 ? 6.710   18.724 4.259  1.00 12.19 ? 161 PHE A C   1 
ATOM   228 O  O   . PHE A 1 42 ? 6.810   18.597 3.028  1.00 12.02 ? 161 PHE A O   1 
ATOM   229 C  CB  . PHE A 1 42 ? 7.895   20.699 5.378  1.00 11.77 ? 161 PHE A CB  1 
ATOM   230 C  CG  . PHE A 1 42 ? 7.959   22.184 5.234  1.00 11.31 ? 161 PHE A CG  1 
ATOM   231 C  CD1 . PHE A 1 42 ? 7.100   22.987 5.946  1.00 13.15 ? 161 PHE A CD1 1 
ATOM   232 C  CD2 . PHE A 1 42 ? 8.780   22.763 4.255  1.00 12.98 ? 161 PHE A CD2 1 
ATOM   233 C  CE1 . PHE A 1 42 ? 7.109   24.352 5.755  1.00 14.17 ? 161 PHE A CE1 1 
ATOM   234 C  CE2 . PHE A 1 42 ? 8.813   24.135 4.069  1.00 13.32 ? 161 PHE A CE2 1 
ATOM   235 C  CZ  . PHE A 1 42 ? 7.947   24.921 4.808  1.00 13.97 ? 161 PHE A CZ  1 
ATOM   236 N  N   . ASP A 1 43 ? 6.624   17.689 5.078  1.00 11.87 ? 162 ASP A N   1 
ATOM   237 C  CA  . ASP A 1 43 ? 6.586   16.317 4.563  1.00 13.27 ? 162 ASP A CA  1 
ATOM   238 C  C   . ASP A 1 43 ? 5.370   16.074 3.663  1.00 13.27 ? 162 ASP A C   1 
ATOM   239 O  O   . ASP A 1 43 ? 5.490   15.565 2.535  1.00 12.84 ? 162 ASP A O   1 
ATOM   240 C  CB  . ASP A 1 43 ? 6.592   15.350 5.739  1.00 13.41 ? 162 ASP A CB  1 
ATOM   241 C  CG  . ASP A 1 43 ? 6.615   13.873 5.310  1.00 19.68 ? 162 ASP A CG  1 
ATOM   242 O  OD1 . ASP A 1 43 ? 7.517   13.497 4.508  1.00 22.20 ? 162 ASP A OD1 1 
ATOM   243 O  OD2 . ASP A 1 43 ? 5.762   13.111 5.821  1.00 23.35 ? 162 ASP A OD2 1 
ATOM   244 N  N   . LEU A 1 44 ? 4.198   16.471 4.121  1.00 12.52 ? 163 LEU A N   1 
ATOM   245 C  CA  . LEU A 1 44 ? 3.029   16.300 3.316  1.00 14.31 ? 163 LEU A CA  1 
ATOM   246 C  C   . LEU A 1 44 ? 3.091   17.116 2.040  1.00 14.26 ? 163 LEU A C   1 
ATOM   247 O  O   . LEU A 1 44 ? 2.622   16.666 0.965  1.00 14.98 ? 163 LEU A O   1 
ATOM   248 C  CB  . LEU A 1 44 ? 1.800   16.650 4.121  1.00 13.30 ? 163 LEU A CB  1 
ATOM   249 C  CG  . LEU A 1 44 ? 1.415   15.778 5.312  1.00 15.89 ? 163 LEU A CG  1 
ATOM   250 C  CD1 . LEU A 1 44 ? 0.283   16.478 6.052  1.00 19.43 ? 163 LEU A CD1 1 
ATOM   251 C  CD2 . LEU A 1 44 ? 1.025   14.406 4.924  1.00 21.22 ? 163 LEU A CD2 1 
ATOM   252 N  N   . SER A 1 45 ? 3.623   18.337 2.149  1.00 14.84 ? 164 SER A N   1 
ATOM   253 C  CA  . SER A 1 45 ? 3.869   19.202 1.003  1.00 15.79 ? 164 SER A CA  1 
ATOM   254 C  C   . SER A 1 45 ? 4.736   18.546 -0.087 1.00 15.89 ? 164 SER A C   1 
ATOM   255 O  O   . SER A 1 45 ? 4.446   18.725 -1.296 1.00 15.56 ? 164 SER A O   1 
ATOM   256 C  CB  . SER A 1 45 ? 4.465   20.545 1.462  1.00 15.21 ? 164 SER A CB  1 
ATOM   257 O  OG  . SER A 1 45 ? 3.529   21.228 2.254  1.00 15.20 ? 164 SER A OG  1 
ATOM   258 N  N   . ARG A 1 46 ? 5.775   17.821 0.320  1.00 16.68 ? 165 ARG A N   1 
ATOM   259 C  CA  . ARG A 1 46 ? 6.589   17.029 -0.601 1.00 17.35 ? 165 ARG A CA  1 
ATOM   260 C  C   . ARG A 1 46 ? 5.796   15.883 -1.210 1.00 18.14 ? 165 ARG A C   1 
ATOM   261 O  O   . ARG A 1 46 ? 5.735   15.754 -2.436 1.00 18.47 ? 165 ARG A O   1 
ATOM   262 C  CB  . ARG A 1 46 ? 7.824   16.461 0.081  1.00 17.62 ? 165 ARG A CB  1 
ATOM   263 C  CG  . ARG A 1 46 ? 8.803   17.553 0.462  1.00 17.21 ? 165 ARG A CG  1 
ATOM   264 C  CD  . ARG A 1 46 ? 10.011  17.082 1.219  1.00 16.41 ? 165 ARG A CD  1 
ATOM   265 N  NE  . ARG A 1 46 ? 10.635  18.282 1.802  1.00 15.54 ? 165 ARG A NE  1 
ATOM   266 C  CZ  . ARG A 1 46 ? 10.732  18.563 3.098  1.00 14.06 ? 165 ARG A CZ  1 
ATOM   267 N  NH1 . ARG A 1 46 ? 10.341  17.702 4.049  1.00 14.29 ? 165 ARG A NH1 1 
ATOM   268 N  NH2 . ARG A 1 46 ? 11.234  19.740 3.452  1.00 15.41 ? 165 ARG A NH2 1 
ATOM   269 N  N   . ARG A 1 47 ? 5.213   15.056 -0.366 1.00 18.80 ? 166 ARG A N   1 
ATOM   270 C  CA  . ARG A 1 47 ? 4.554   13.824 -0.805 1.00 20.49 ? 166 ARG A CA  1 
ATOM   271 C  C   . ARG A 1 47 ? 3.320   14.038 -1.704 1.00 20.59 ? 166 ARG A C   1 
ATOM   272 O  O   . ARG A 1 47 ? 3.020   13.206 -2.603 1.00 18.57 ? 166 ARG A O   1 
ATOM   273 C  CB  . ARG A 1 47 ? 4.204   13.006 0.400  1.00 21.96 ? 166 ARG A CB  1 
ATOM   274 C  CG  . ARG A 1 47 ? 5.462   12.471 1.102  1.00 25.58 ? 166 ARG A CG  1 
ATOM   275 C  CD  . ARG A 1 47 ? 5.130   11.993 2.519  1.00 29.95 ? 166 ARG A CD  1 
ATOM   276 N  NE  . ARG A 1 47 ? 3.968   11.106 2.531  1.00 37.66 ? 166 ARG A NE  1 
ATOM   277 C  CZ  . ARG A 1 47 ? 3.177   10.914 3.584  1.00 39.66 ? 166 ARG A CZ  1 
ATOM   278 N  NH1 . ARG A 1 47 ? 3.422   11.534 4.738  1.00 40.40 ? 166 ARG A NH1 1 
ATOM   279 N  NH2 . ARG A 1 47 ? 2.152   10.069 3.492  1.00 41.26 ? 166 ARG A NH2 1 
ATOM   280 N  N   . PHE A 1 48 ? 2.620   15.146 -1.462 1.00 18.45 ? 167 PHE A N   1 
ATOM   281 C  CA  . PHE A 1 48 ? 1.385   15.451 -2.177 1.00 18.50 ? 167 PHE A CA  1 
ATOM   282 C  C   . PHE A 1 48 ? 1.431   16.673 -3.073 1.00 17.52 ? 167 PHE A C   1 
ATOM   283 O  O   . PHE A 1 48 ? 0.392   17.279 -3.397 1.00 16.81 ? 167 PHE A O   1 
ATOM   284 C  CB  . PHE A 1 48 ? 0.219   15.479 -1.179 1.00 18.06 ? 167 PHE A CB  1 
ATOM   285 C  CG  . PHE A 1 48 ? 0.079   14.195 -0.401 1.00 19.30 ? 167 PHE A CG  1 
ATOM   286 C  CD1 . PHE A 1 48 ? -0.199  13.006 -1.054 1.00 20.97 ? 167 PHE A CD1 1 
ATOM   287 C  CD2 . PHE A 1 48 ? 0.237   14.169 0.959  1.00 20.37 ? 167 PHE A CD2 1 
ATOM   288 C  CE1 . PHE A 1 48 ? -0.309  11.824 -0.341 1.00 23.96 ? 167 PHE A CE1 1 
ATOM   289 C  CE2 . PHE A 1 48 ? 0.111   13.006 1.670  1.00 22.92 ? 167 PHE A CE2 1 
ATOM   290 C  CZ  . PHE A 1 48 ? -0.175  11.823 1.002  1.00 23.77 ? 167 PHE A CZ  1 
ATOM   291 N  N   . ASP A 1 49 ? 2.649   17.027 -3.479 1.00 18.93 ? 168 ASP A N   1 
ATOM   292 C  CA  . ASP A 1 49 ? 2.907   17.941 -4.581 1.00 21.31 ? 168 ASP A CA  1 
ATOM   293 C  C   . ASP A 1 49 ? 2.243   19.283 -4.384 1.00 19.46 ? 168 ASP A C   1 
ATOM   294 O  O   . ASP A 1 49 ? 1.745   19.923 -5.306 1.00 19.97 ? 168 ASP A O   1 
ATOM   295 C  CB  . ASP A 1 49 ? 2.534   17.242 -5.898 1.00 22.83 ? 168 ASP A CB  1 
ATOM   296 C  CG  . ASP A 1 49 ? 3.232   15.865 -6.055 1.00 29.34 ? 168 ASP A CG  1 
ATOM   297 O  OD1 . ASP A 1 49 ? 4.439   15.694 -5.660 1.00 33.19 ? 168 ASP A OD1 1 
ATOM   298 O  OD2 . ASP A 1 49 ? 2.549   14.918 -6.536 1.00 35.87 ? 168 ASP A OD2 1 
ATOM   299 N  N   . LEU A 1 50 ? 2.251   19.735 -3.135 1.00 19.37 ? 169 LEU A N   1 
ATOM   300 C  CA  . LEU A 1 50 ? 1.679   21.022 -2.753 1.00 19.02 ? 169 LEU A CA  1 
ATOM   301 C  C   . LEU A 1 50 ? 0.204   21.190 -3.078 1.00 18.82 ? 169 LEU A C   1 
ATOM   302 O  O   . LEU A 1 50 ? -0.261  22.292 -3.331 1.00 18.47 ? 169 LEU A O   1 
ATOM   303 C  CB  . LEU A 1 50 ? 2.512   22.201 -3.328 1.00 20.13 ? 169 LEU A CB  1 
ATOM   304 C  CG  . LEU A 1 50 ? 3.770   22.585 -2.568 1.00 22.17 ? 169 LEU A CG  1 
ATOM   305 C  CD1 . LEU A 1 50 ? 4.419   23.755 -3.303 1.00 26.32 ? 169 LEU A CD1 1 
ATOM   306 C  CD2 . LEU A 1 50 ? 3.423   22.979 -1.145 1.00 20.36 ? 169 LEU A CD2 1 
ATOM   307 N  N   . ARG A 1 51 ? -0.538  20.084 -3.025 1.00 16.92 ? 170 ARG A N   1 
ATOM   308 C  CA  . ARG A 1 51 ? -1.981  20.129 -3.178 1.00 17.21 ? 170 ARG A CA  1 
ATOM   309 C  C   . ARG A 1 51 ? -2.585  20.310 -1.804 1.00 16.62 ? 170 ARG A C   1 
ATOM   310 O  O   . ARG A 1 51 ? -2.717  19.366 -1.033 1.00 15.18 ? 170 ARG A O   1 
ATOM   311 C  CB  . ARG A 1 51 ? -2.437  18.839 -3.845 1.00 16.38 ? 170 ARG A CB  1 
ATOM   312 C  CG  . ARG A 1 51 ? -1.892  18.691 -5.256 1.00 20.07 ? 170 ARG A CG  1 
ATOM   313 C  CD  . ARG A 1 51 ? -1.984  17.218 -5.696 1.00 21.32 ? 170 ARG A CD  1 
ATOM   314 N  NE  . ARG A 1 51 ? -3.375  16.793 -5.854 1.00 22.90 ? 170 ARG A NE  1 
ATOM   315 C  CZ  . ARG A 1 51 ? -3.754  15.529 -6.108 1.00 24.16 ? 170 ARG A CZ  1 
ATOM   316 N  NH1 . ARG A 1 51 ? -2.876  14.571 -6.200 1.00 24.30 ? 170 ARG A NH1 1 
ATOM   317 N  NH2 . ARG A 1 51 ? -5.036  15.228 -6.278 1.00 28.13 ? 170 ARG A NH2 1 
ATOM   318 N  N   . PHE A 1 52 ? -2.907  21.557 -1.465 1.00 17.34 ? 171 PHE A N   1 
ATOM   319 C  CA  . PHE A 1 52 ? -3.293  21.841 -0.102 1.00 18.11 ? 171 PHE A CA  1 
ATOM   320 C  C   . PHE A 1 52 ? -4.595  21.253 0.339  1.00 18.16 ? 171 PHE A C   1 
ATOM   321 O  O   . PHE A 1 52 ? -4.743  20.987 1.506  1.00 18.92 ? 171 PHE A O   1 
ATOM   322 C  CB  . PHE A 1 52 ? -3.252  23.342 0.207  1.00 18.73 ? 171 PHE A CB  1 
ATOM   323 C  CG  . PHE A 1 52 ? -1.895  23.810 0.468  1.00 19.70 ? 171 PHE A CG  1 
ATOM   324 C  CD1 . PHE A 1 52 ? -1.320  23.629 1.708  1.00 21.59 ? 171 PHE A CD1 1 
ATOM   325 C  CD2 . PHE A 1 52 ? -1.140  24.348 -0.555 1.00 21.86 ? 171 PHE A CD2 1 
ATOM   326 C  CE1 . PHE A 1 52 ? -0.002  24.048 1.919  1.00 21.39 ? 171 PHE A CE1 1 
ATOM   327 C  CE2 . PHE A 1 52 ? 0.165   24.750 -0.349 1.00 23.44 ? 171 PHE A CE2 1 
ATOM   328 C  CZ  . PHE A 1 52 ? 0.723   24.602 0.899  1.00 21.66 ? 171 PHE A CZ  1 
ATOM   329 N  N   . VAL A 1 53 ? -5.499  20.945 -0.596 1.00 18.92 ? 172 VAL A N   1 
ATOM   330 C  CA  . VAL A 1 53 ? -6.685  20.154 -0.240 1.00 18.92 ? 172 VAL A CA  1 
ATOM   331 C  C   . VAL A 1 53 ? -6.339  18.729 0.229  1.00 18.29 ? 172 VAL A C   1 
ATOM   332 O  O   . VAL A 1 53 ? -6.959  18.207 1.171  1.00 17.48 ? 172 VAL A O   1 
ATOM   333 C  CB  . VAL A 1 53 ? -7.696  20.057 -1.437 1.00 19.29 ? 172 VAL A CB  1 
ATOM   334 C  CG1 . VAL A 1 53 ? -8.814  19.117 -1.094 1.00 17.69 ? 172 VAL A CG1 1 
ATOM   335 C  CG2 . VAL A 1 53 ? -8.200  21.425 -1.798 1.00 20.61 ? 172 VAL A CG2 1 
ATOM   336 N  N   . VAL A 1 54 ? -5.341  18.106 -0.422 1.00 15.81 ? 173 VAL A N   1 
ATOM   337 C  CA  . VAL A 1 54 ? -4.892  16.813 -0.035 1.00 15.48 ? 173 VAL A CA  1 
ATOM   338 C  C   . VAL A 1 54 ? -4.076  16.905 1.269  1.00 14.78 ? 173 VAL A C   1 
ATOM   339 O  O   . VAL A 1 54 ? -4.249  16.098 2.165  1.00 17.72 ? 173 VAL A O   1 
ATOM   340 C  CB  . VAL A 1 54 ? -4.041  16.160 -1.156 1.00 14.28 ? 173 VAL A CB  1 
ATOM   341 C  CG1 . VAL A 1 54 ? -3.505  14.801 -0.689 1.00 14.54 ? 173 VAL A CG1 1 
ATOM   342 C  CG2 . VAL A 1 54 ? -4.831  16.019 -2.411 1.00 14.96 ? 173 VAL A CG2 1 
ATOM   343 N  N   . ILE A 1 55 ? -3.159  17.856 1.344  1.00 15.40 ? 174 ILE A N   1 
ATOM   344 C  CA  . ILE A 1 55 ? -2.372  18.071 2.554  1.00 14.51 ? 174 ILE A CA  1 
ATOM   345 C  C   . ILE A 1 55 ? -3.319  18.228 3.755  1.00 16.54 ? 174 ILE A C   1 
ATOM   346 O  O   . ILE A 1 55 ? -3.146  17.589 4.787  1.00 17.47 ? 174 ILE A O   1 
ATOM   347 C  CB  . ILE A 1 55 ? -1.440  19.305 2.411  1.00 14.86 ? 174 ILE A CB  1 
ATOM   348 C  CG1 . ILE A 1 55 ? -0.398  19.048 1.316  1.00 14.63 ? 174 ILE A CG1 1 
ATOM   349 C  CG2 . ILE A 1 55 ? -0.785  19.644 3.773  1.00 12.11 ? 174 ILE A CG2 1 
ATOM   350 C  CD1 . ILE A 1 55 ? 0.345   20.303 0.804  1.00 15.53 ? 174 ILE A CD1 1 
ATOM   351 N  N   . HIS A 1 56 ? -4.327  19.067 3.593  1.00 18.15 ? 175 HIS A N   1 
ATOM   352 C  CA  . HIS A 1 56 ? -5.333  19.254 4.637  1.00 20.40 ? 175 HIS A CA  1 
ATOM   353 C  C   . HIS A 1 56 ? -6.070  17.966 5.010  1.00 20.04 ? 175 HIS A C   1 
ATOM   354 O  O   . HIS A 1 56 ? -6.257  17.682 6.167  1.00 19.92 ? 175 HIS A O   1 
ATOM   355 C  CB  . HIS A 1 56 ? -6.329  20.330 4.240  1.00 21.78 ? 175 HIS A CB  1 
ATOM   356 C  CG  . HIS A 1 56 ? -7.270  20.704 5.351  1.00 26.40 ? 175 HIS A CG  1 
ATOM   357 N  ND1 . HIS A 1 56 ? -8.532  20.162 5.465  1.00 31.28 ? 175 HIS A ND1 1 
ATOM   358 C  CD2 . HIS A 1 56 ? -7.105  21.512 6.433  1.00 30.90 ? 175 HIS A CD2 1 
ATOM   359 C  CE1 . HIS A 1 56 ? -9.115  20.630 6.562  1.00 34.34 ? 175 HIS A CE1 1 
ATOM   360 N  NE2 . HIS A 1 56 ? -8.275  21.461 7.161  1.00 33.71 ? 175 HIS A NE2 1 
ATOM   361 N  N   . ASP A 1 57 ? -6.480  17.187 4.018  1.00 20.61 ? 176 ASP A N   1 
ATOM   362 C  CA  . ASP A 1 57 ? -7.153  15.906 4.241  1.00 20.04 ? 176 ASP A CA  1 
ATOM   363 C  C   . ASP A 1 57 ? -6.292  14.905 5.002  1.00 21.32 ? 176 ASP A C   1 
ATOM   364 O  O   . ASP A 1 57 ? -6.819  14.095 5.822  1.00 21.74 ? 176 ASP A O   1 
ATOM   365 C  CB  . ASP A 1 57 ? -7.571  15.304 2.878  1.00 21.03 ? 176 ASP A CB  1 
ATOM   366 C  CG  . ASP A 1 57 ? -8.337  13.991 3.017  1.00 21.24 ? 176 ASP A CG  1 
ATOM   367 O  OD1 . ASP A 1 57 ? -9.446  14.047 3.559  1.00 22.66 ? 176 ASP A OD1 1 
ATOM   368 O  OD2 . ASP A 1 57 ? -7.855  12.940 2.603  1.00 22.20 ? 176 ASP A OD2 1 
ATOM   369 N  N   . ARG A 1 58 ? -4.983  14.901 4.714  1.00 19.30 ? 177 ARG A N   1 
ATOM   370 C  CA  . ARG A 1 58 ? -4.115  13.858 5.214  1.00 20.48 ? 177 ARG A CA  1 
ATOM   371 C  C   . ARG A 1 58 ? -3.422  14.298 6.512  1.00 21.49 ? 177 ARG A C   1 
ATOM   372 O  O   . ARG A 1 58 ? -2.654  13.546 7.089  1.00 21.63 ? 177 ARG A O   1 
ATOM   373 C  CB  . ARG A 1 58 ? -3.120  13.416 4.137  1.00 19.79 ? 177 ARG A CB  1 
ATOM   374 C  CG  . ARG A 1 58 ? -3.775  12.691 2.922  1.00 22.42 ? 177 ARG A CG  1 
ATOM   375 C  CD  . ARG A 1 58 ? -4.514  11.395 3.371  1.00 26.50 ? 177 ARG A CD  1 
ATOM   376 N  NE  . ARG A 1 58 ? -3.493  10.403 3.669  1.00 29.76 ? 177 ARG A NE  1 
ATOM   377 C  CZ  . ARG A 1 58 ? -3.011  9.541  2.794  1.00 29.76 ? 177 ARG A CZ  1 
ATOM   378 N  NH1 . ARG A 1 58 ? -3.555  9.443  1.590  1.00 28.78 ? 177 ARG A NH1 1 
ATOM   379 N  NH2 . ARG A 1 58 ? -2.028  8.728  3.152  1.00 30.37 ? 177 ARG A NH2 1 
ATOM   380 N  N   . TYR A 1 59 ? -3.763  15.485 6.984  1.00 23.91 ? 178 TYR A N   1 
ATOM   381 C  CA  . TYR A 1 59 ? -3.064  16.099 8.120  1.00 25.98 ? 178 TYR A CA  1 
ATOM   382 C  C   . TYR A 1 59 ? -3.314  15.287 9.380  1.00 28.65 ? 178 TYR A C   1 
ATOM   383 O  O   . TYR A 1 59 ? -4.429  14.816 9.592  1.00 29.08 ? 178 TYR A O   1 
ATOM   384 C  CB  . TYR A 1 59 ? -3.563  17.517 8.329  1.00 26.16 ? 178 TYR A CB  1 
ATOM   385 C  CG  . TYR A 1 59 ? -2.540  18.481 8.893  1.00 24.74 ? 178 TYR A CG  1 
ATOM   386 C  CD1 . TYR A 1 59 ? -1.507  18.943 8.096  1.00 22.97 ? 178 TYR A CD1 1 
ATOM   387 C  CD2 . TYR A 1 59 ? -2.629  18.951 10.212 1.00 23.24 ? 178 TYR A CD2 1 
ATOM   388 C  CE1 . TYR A 1 59 ? -0.587  19.840 8.576  1.00 21.17 ? 178 TYR A CE1 1 
ATOM   389 C  CE2 . TYR A 1 59 ? -1.714  19.873 10.708 1.00 22.60 ? 178 TYR A CE2 1 
ATOM   390 C  CZ  . TYR A 1 59 ? -0.681  20.287 9.896  1.00 22.30 ? 178 TYR A CZ  1 
ATOM   391 O  OH  . TYR A 1 59 ? 0.219   21.206 10.338 1.00 21.36 ? 178 TYR A OH  1 
ATOM   392 N  N   . ASP A 1 60 ? -2.296  15.123 10.221 1.00 30.95 ? 179 ASP A N   1 
ATOM   393 C  CA  . ASP A 1 60 ? -2.452  14.325 11.467 1.00 33.80 ? 179 ASP A CA  1 
ATOM   394 C  C   . ASP A 1 60 ? -3.157  15.222 12.474 1.00 35.68 ? 179 ASP A C   1 
ATOM   395 O  O   . ASP A 1 60 ? -2.531  15.818 13.367 1.00 35.95 ? 179 ASP A O   1 
ATOM   396 C  CB  . ASP A 1 60 ? -1.112  13.796 11.975 1.00 33.89 ? 179 ASP A CB  1 
ATOM   397 C  CG  . ASP A 1 60 ? -1.252  12.701 13.060 1.00 36.72 ? 179 ASP A CG  1 
ATOM   398 O  OD1 . ASP A 1 60 ? -2.393  12.348 13.440 1.00 39.87 ? 179 ASP A OD1 1 
ATOM   399 O  OD2 . ASP A 1 60 ? -0.200  12.186 13.526 1.00 40.61 ? 179 ASP A OD2 1 
ATOM   400 N  N   . HIS A 1 61 ? -4.471  15.352 12.279 1.00 38.10 ? 180 HIS A N   1 
ATOM   401 C  CA  . HIS A 1 61 ? -5.284  16.222 13.107 1.00 40.46 ? 180 HIS A CA  1 
ATOM   402 C  C   . HIS A 1 61 ? -5.412  15.559 14.494 1.00 41.62 ? 180 HIS A C   1 
ATOM   403 O  O   . HIS A 1 61 ? -5.863  16.214 15.434 1.00 43.31 ? 180 HIS A O   1 
ATOM   404 C  CB  . HIS A 1 61 ? -6.670  16.522 12.480 1.00 40.64 ? 180 HIS A CB  1 
ATOM   405 C  CG  . HIS A 1 61 ? -6.630  17.350 11.219 1.00 42.29 ? 180 HIS A CG  1 
ATOM   406 N  ND1 . HIS A 1 61 ? -6.381  18.708 11.219 1.00 43.75 ? 180 HIS A ND1 1 
ATOM   407 C  CD2 . HIS A 1 61 ? -6.847  17.012 9.919  1.00 43.36 ? 180 HIS A CD2 1 
ATOM   408 C  CE1 . HIS A 1 61 ? -6.436  19.169 9.976  1.00 45.64 ? 180 HIS A CE1 1 
ATOM   409 N  NE2 . HIS A 1 61 ? -6.728  18.161 9.168  1.00 45.07 ? 180 HIS A NE2 1 
ATOM   410 N  N   . GLN A 1 62 ? -5.004  14.288 14.636 1.00 43.11 ? 181 GLN A N   1 
ATOM   411 C  CA  . GLN A 1 62 ? -4.837  13.653 15.969 1.00 44.26 ? 181 GLN A CA  1 
ATOM   412 C  C   . GLN A 1 62 ? -3.779  14.359 16.847 1.00 45.20 ? 181 GLN A C   1 
ATOM   413 O  O   . GLN A 1 62 ? -4.133  15.000 17.855 1.00 45.91 ? 181 GLN A O   1 
ATOM   414 C  CB  . GLN A 1 62 ? -4.484  12.158 15.841 1.00 44.45 ? 181 GLN A CB  1 
ATOM   415 N  N   . GLN A 1 63 ? -2.496  14.241 16.475 1.00 45.34 ? 182 GLN A N   1 
ATOM   416 C  CA  . GLN A 1 63 ? -1.407  14.886 17.220 1.00 45.36 ? 182 GLN A CA  1 
ATOM   417 C  C   . GLN A 1 63 ? -1.533  16.395 17.220 1.00 44.81 ? 182 GLN A C   1 
ATOM   418 O  O   . GLN A 1 63 ? -1.221  17.072 18.213 1.00 45.60 ? 182 GLN A O   1 
ATOM   419 C  CB  . GLN A 1 63 ? -0.058  14.542 16.615 1.00 45.89 ? 182 GLN A CB  1 
ATOM   420 C  CG  . GLN A 1 63 ? 0.283   13.073 16.616 1.00 48.32 ? 182 GLN A CG  1 
ATOM   421 C  CD  . GLN A 1 63 ? 1.673   12.786 16.067 1.00 51.36 ? 182 GLN A CD  1 
ATOM   422 O  OE1 . GLN A 1 63 ? 2.631   13.492 16.383 1.00 53.98 ? 182 GLN A OE1 1 
ATOM   423 N  NE2 . GLN A 1 63 ? 1.791   11.735 15.247 1.00 53.90 ? 182 GLN A NE2 1 
ATOM   424 N  N   . PHE A 1 64 ? -1.980  16.942 16.100 1.00 43.75 ? 183 PHE A N   1 
ATOM   425 C  CA  . PHE A 1 64 ? -1.932  18.362 15.905 1.00 42.92 ? 183 PHE A CA  1 
ATOM   426 C  C   . PHE A 1 64 ? -3.324  18.928 15.798 1.00 43.75 ? 183 PHE A C   1 
ATOM   427 O  O   . PHE A 1 64 ? -4.286  18.220 15.444 1.00 44.51 ? 183 PHE A O   1 
ATOM   428 C  CB  . PHE A 1 64 ? -1.082  18.697 14.657 1.00 41.89 ? 183 PHE A CB  1 
ATOM   429 C  CG  . PHE A 1 64 ? 0.249   17.975 14.623 1.00 39.06 ? 183 PHE A CG  1 
ATOM   430 C  CD1 . PHE A 1 64 ? 0.537   17.045 13.622 1.00 35.01 ? 183 PHE A CD1 1 
ATOM   431 C  CD2 . PHE A 1 64 ? 1.204   18.201 15.619 1.00 36.01 ? 183 PHE A CD2 1 
ATOM   432 C  CE1 . PHE A 1 64 ? 1.744   16.374 13.591 1.00 34.72 ? 183 PHE A CE1 1 
ATOM   433 C  CE2 . PHE A 1 64 ? 2.423   17.505 15.609 1.00 35.59 ? 183 PHE A CE2 1 
ATOM   434 C  CZ  . PHE A 1 64 ? 2.697   16.610 14.590 1.00 34.60 ? 183 PHE A CZ  1 
ATOM   435 N  N   . LYS A 1 65 ? -3.400  20.220 16.102 1.00 43.69 ? 184 LYS A N   1 
ATOM   436 C  CA  . LYS A 1 65 ? -4.616  21.013 16.042 1.00 43.48 ? 184 LYS A CA  1 
ATOM   437 C  C   . LYS A 1 65 ? -5.310  20.893 14.682 1.00 43.19 ? 184 LYS A C   1 
ATOM   438 O  O   . LYS A 1 65 ? -4.682  20.554 13.662 1.00 42.96 ? 184 LYS A O   1 
ATOM   439 C  CB  . LYS A 1 65 ? -4.294  22.498 16.319 1.00 43.53 ? 184 LYS A CB  1 
ATOM   440 N  N   . LYS A 1 66 ? -6.610  21.176 14.690 1.00 42.00 ? 185 LYS A N   1 
ATOM   441 C  CA  . LYS A 1 66 ? -7.352  21.360 13.464 1.00 40.88 ? 185 LYS A CA  1 
ATOM   442 C  C   . LYS A 1 66 ? -6.866  22.688 12.884 1.00 39.59 ? 185 LYS A C   1 
ATOM   443 O  O   . LYS A 1 66 ? -6.925  23.755 13.525 1.00 40.39 ? 185 LYS A O   1 
ATOM   444 C  CB  . LYS A 1 66 ? -8.875  21.356 13.707 1.00 40.97 ? 185 LYS A CB  1 
ATOM   445 N  N   . ARG A 1 67 ? -6.341  22.597 11.674 1.00 37.23 ? 186 ARG A N   1 
ATOM   446 C  CA  . ARG A 1 67 ? -5.828  23.738 10.963 1.00 34.82 ? 186 ARG A CA  1 
ATOM   447 C  C   . ARG A 1 67 ? -6.696  23.878 9.743  1.00 33.78 ? 186 ARG A C   1 
ATOM   448 O  O   . ARG A 1 67 ? -7.060  22.868 9.127  1.00 34.16 ? 186 ARG A O   1 
ATOM   449 C  CB  . ARG A 1 67 ? -4.398  23.457 10.537 1.00 34.06 ? 186 ARG A CB  1 
ATOM   450 C  CG  . ARG A 1 67 ? -3.459  23.226 11.715 1.00 31.89 ? 186 ARG A CG  1 
ATOM   451 C  CD  . ARG A 1 67 ? -2.957  24.556 12.274 1.00 27.85 ? 186 ARG A CD  1 
ATOM   452 N  NE  . ARG A 1 67 ? -1.844  24.324 13.190 1.00 25.53 ? 186 ARG A NE  1 
ATOM   453 C  CZ  . ARG A 1 67 ? -1.368  25.237 14.030 1.00 25.39 ? 186 ARG A CZ  1 
ATOM   454 N  NH1 . ARG A 1 67 ? -1.901  26.448 14.072 1.00 25.24 ? 186 ARG A NH1 1 
ATOM   455 N  NH2 . ARG A 1 67 ? -0.365  24.931 14.825 1.00 23.20 ? 186 ARG A NH2 1 
ATOM   456 N  N   . SER A 1 68 ? -7.024  25.113 9.398  1.00 31.71 ? 187 SER A N   1 
ATOM   457 C  CA  . SER A 1 68 ? -7.651  25.393 8.120  1.00 30.43 ? 187 SER A CA  1 
ATOM   458 C  C   . SER A 1 68 ? -6.646  25.224 6.991  1.00 29.86 ? 187 SER A C   1 
ATOM   459 O  O   . SER A 1 68 ? -5.447  25.228 7.221  1.00 28.70 ? 187 SER A O   1 
ATOM   460 C  CB  . SER A 1 68 ? -8.229  26.800 8.089  1.00 30.16 ? 187 SER A CB  1 
ATOM   461 O  OG  . SER A 1 68 ? -7.240  27.823 7.994  1.00 27.89 ? 187 SER A OG  1 
ATOM   462 N  N   . VAL A 1 69 ? -7.144  25.076 5.773  1.00 28.86 ? 188 VAL A N   1 
ATOM   463 C  CA  . VAL A 1 69 ? -6.276  25.057 4.601  1.00 28.24 ? 188 VAL A CA  1 
ATOM   464 C  C   . VAL A 1 69 ? -5.460  26.349 4.578  1.00 28.52 ? 188 VAL A C   1 
ATOM   465 O  O   . VAL A 1 69 ? -4.258  26.367 4.252  1.00 27.41 ? 188 VAL A O   1 
ATOM   466 C  CB  . VAL A 1 69 ? -7.103  24.851 3.313  1.00 28.82 ? 188 VAL A CB  1 
ATOM   467 C  CG1 . VAL A 1 69 ? -6.277  25.100 2.061  1.00 28.21 ? 188 VAL A CG1 1 
ATOM   468 C  CG2 . VAL A 1 69 ? -7.712  23.443 3.321  1.00 28.96 ? 188 VAL A CG2 1 
ATOM   469 N  N   . GLU A 1 70 ? -6.122  27.442 4.958  1.00 27.55 ? 189 GLU A N   1 
ATOM   470 C  CA  . GLU A 1 70 ? -5.507  28.751 4.948  1.00 27.63 ? 189 GLU A CA  1 
ATOM   471 C  C   . GLU A 1 70 ? -4.383  28.845 5.995  1.00 25.06 ? 189 GLU A C   1 
ATOM   472 O  O   . GLU A 1 70 ? -3.353  29.430 5.696  1.00 25.07 ? 189 GLU A O   1 
ATOM   473 C  CB  . GLU A 1 70 ? -6.606  29.837 5.175  1.00 28.21 ? 189 GLU A CB  1 
ATOM   474 C  CG  . GLU A 1 70 ? -7.551  29.995 3.989  1.00 31.68 ? 189 GLU A CG  1 
ATOM   475 C  CD  . GLU A 1 70 ? -6.789  30.309 2.711  1.00 37.01 ? 189 GLU A CD  1 
ATOM   476 O  OE1 . GLU A 1 70 ? -5.947  31.262 2.739  1.00 41.64 ? 189 GLU A OE1 1 
ATOM   477 O  OE2 . GLU A 1 70 ? -6.988  29.570 1.701  1.00 42.16 ? 189 GLU A OE2 1 
ATOM   478 N  N   . ASP A 1 71 ? -4.581  28.251 7.183  1.00 24.16 ? 190 ASP A N   1 
ATOM   479 C  CA  . ASP A 1 71 ? -3.547  28.158 8.240  1.00 23.58 ? 190 ASP A CA  1 
ATOM   480 C  C   . ASP A 1 71 ? -2.294  27.440 7.711  1.00 22.14 ? 190 ASP A C   1 
ATOM   481 O  O   . ASP A 1 71 ? -1.147  27.888 7.934  1.00 19.81 ? 190 ASP A O   1 
ATOM   482 C  CB  . ASP A 1 71 ? -4.069  27.383 9.469  1.00 24.50 ? 190 ASP A CB  1 
ATOM   483 C  CG  . ASP A 1 71 ? -5.179  28.131 10.230 1.00 28.14 ? 190 ASP A CG  1 
ATOM   484 O  OD1 . ASP A 1 71 ? -5.300  29.362 10.013 1.00 28.23 ? 190 ASP A OD1 1 
ATOM   485 O  OD2 . ASP A 1 71 ? -5.909  27.458 11.018 1.00 29.79 ? 190 ASP A OD2 1 
ATOM   486 N  N   . LEU A 1 72 ? -2.533  26.363 6.969  1.00 19.43 ? 191 LEU A N   1 
ATOM   487 C  CA  . LEU A 1 72 ? -1.426  25.559 6.407  1.00 20.01 ? 191 LEU A CA  1 
ATOM   488 C  C   . LEU A 1 72 ? -0.662  26.316 5.351  1.00 18.36 ? 191 LEU A C   1 
ATOM   489 O  O   . LEU A 1 72 ? 0.558   26.347 5.340  1.00 16.03 ? 191 LEU A O   1 
ATOM   490 C  CB  . LEU A 1 72 ? -1.949  24.244 5.851  1.00 18.99 ? 191 LEU A CB  1 
ATOM   491 C  CG  . LEU A 1 72 ? -2.731  23.361 6.815  1.00 21.41 ? 191 LEU A CG  1 
ATOM   492 C  CD1 . LEU A 1 72 ? -3.076  22.089 6.058  1.00 20.95 ? 191 LEU A CD1 1 
ATOM   493 C  CD2 . LEU A 1 72 ? -2.007  23.022 8.138  1.00 21.03 ? 191 LEU A CD2 1 
ATOM   494 N  N   . LYS A 1 73 ? -1.376  26.986 4.450  1.00 18.32 ? 192 LYS A N   1 
ATOM   495 C  CA  . LYS A 1 73 ? -0.699  27.760 3.427  1.00 19.01 ? 192 LYS A CA  1 
ATOM   496 C  C   . LYS A 1 73 ? 0.079   28.931 3.994  1.00 19.13 ? 192 LYS A C   1 
ATOM   497 O  O   . LYS A 1 73 ? 1.172   29.219 3.528  1.00 18.70 ? 192 LYS A O   1 
ATOM   498 C  CB  . LYS A 1 73 ? -1.690  28.302 2.405  1.00 19.96 ? 192 LYS A CB  1 
ATOM   499 C  CG  . LYS A 1 73 ? -2.315  27.259 1.525  1.00 23.11 ? 192 LYS A CG  1 
ATOM   500 C  CD  . LYS A 1 73 ? -2.831  27.942 0.214  1.00 25.93 ? 192 LYS A CD  1 
ATOM   501 C  CE  . LYS A 1 73 ? -4.014  27.267 -0.371 1.00 30.66 ? 192 LYS A CE  1 
ATOM   502 N  N   . GLU A 1 74 ? -0.475  29.618 4.993  1.00 17.94 ? 193 GLU A N   1 
ATOM   503 C  CA  . GLU A 1 74 ? 0.198   30.789 5.564  1.00 18.54 ? 193 GLU A CA  1 
ATOM   504 C  C   . GLU A 1 74 ? 1.485   30.395 6.277  1.00 16.39 ? 193 GLU A C   1 
ATOM   505 O  O   . GLU A 1 74 ? 2.481   31.077 6.160  1.00 17.34 ? 193 GLU A O   1 
ATOM   506 C  CB  . GLU A 1 74 ? -0.721  31.530 6.539  1.00 19.54 ? 193 GLU A CB  1 
ATOM   507 C  CG  . GLU A 1 74 ? -1.880  32.272 5.793  1.00 27.87 ? 193 GLU A CG  1 
ATOM   508 C  CD  . GLU A 1 74 ? -1.414  33.205 4.650  1.00 33.74 ? 193 GLU A CD  1 
ATOM   509 O  OE1 . GLU A 1 74 ? -0.448  33.989 4.821  1.00 41.47 ? 193 GLU A OE1 1 
ATOM   510 O  OE2 . GLU A 1 74 ? -2.030  33.163 3.550  1.00 42.15 ? 193 GLU A OE2 1 
ATOM   511 N  N   . ARG A 1 75 ? 1.460   29.261 6.946  1.00 14.84 ? 194 ARG A N   1 
ATOM   512 C  CA  . ARG A 1 75 ? 2.633   28.762 7.660  1.00 14.22 ? 194 ARG A CA  1 
ATOM   513 C  C   . ARG A 1 75 ? 3.711   28.411 6.629  1.00 13.73 ? 194 ARG A C   1 
ATOM   514 O  O   . ARG A 1 75 ? 4.846   28.830 6.754  1.00 12.83 ? 194 ARG A O   1 
ATOM   515 C  CB  . ARG A 1 75 ? 2.273   27.531 8.492  1.00 14.49 ? 194 ARG A CB  1 
ATOM   516 C  CG  . ARG A 1 75 ? 3.448   26.933 9.260  1.00 14.85 ? 194 ARG A CG  1 
ATOM   517 C  CD  . ARG A 1 75 ? 4.133   27.921 10.222 1.00 15.93 ? 194 ARG A CD  1 
ATOM   518 N  NE  . ARG A 1 75 ? 5.136   27.245 11.044 1.00 14.46 ? 194 ARG A NE  1 
ATOM   519 C  CZ  . ARG A 1 75 ? 6.199   27.835 11.596 1.00 15.74 ? 194 ARG A CZ  1 
ATOM   520 N  NH1 . ARG A 1 75 ? 6.456   29.124 11.397 1.00 16.15 ? 194 ARG A NH1 1 
ATOM   521 N  NH2 . ARG A 1 75 ? 7.021   27.127 12.334 1.00 16.29 ? 194 ARG A NH2 1 
ATOM   522 N  N   . TYR A 1 76 ? 3.339   27.663 5.601  1.00 13.41 ? 195 TYR A N   1 
ATOM   523 C  CA  . TYR A 1 76 ? 4.270   27.243 4.540  1.00 13.15 ? 195 TYR A CA  1 
ATOM   524 C  C   . TYR A 1 76 ? 4.896   28.433 3.858  1.00 14.47 ? 195 TYR A C   1 
ATOM   525 O  O   . TYR A 1 76 ? 6.107   28.496 3.764  1.00 14.07 ? 195 TYR A O   1 
ATOM   526 C  CB  . TYR A 1 76 ? 3.553   26.393 3.512  1.00 14.09 ? 195 TYR A CB  1 
ATOM   527 C  CG  . TYR A 1 76 ? 4.480   25.840 2.426  1.00 14.36 ? 195 TYR A CG  1 
ATOM   528 C  CD1 . TYR A 1 76 ? 5.155   24.649 2.651  1.00 21.81 ? 195 TYR A CD1 1 
ATOM   529 C  CD2 . TYR A 1 76 ? 4.644   26.464 1.208  1.00 21.48 ? 195 TYR A CD2 1 
ATOM   530 C  CE1 . TYR A 1 76 ? 5.981   24.109 1.708  1.00 22.52 ? 195 TYR A CE1 1 
ATOM   531 C  CE2 . TYR A 1 76 ? 5.538   25.924 0.234  1.00 18.22 ? 195 TYR A CE2 1 
ATOM   532 C  CZ  . TYR A 1 76 ? 6.172   24.748 0.521  1.00 20.85 ? 195 TYR A CZ  1 
ATOM   533 O  OH  . TYR A 1 76 ? 7.009   24.094 -0.372 1.00 22.92 ? 195 TYR A OH  1 
ATOM   534 N  N   A TYR A 1 77 ? 4.123   29.404 3.422  0.50 15.25 ? 196 TYR A N   1 
ATOM   535 N  N   B TYR A 1 77 ? 3.998   29.334 3.415  0.50 15.35 ? 196 TYR A N   1 
ATOM   536 C  CA  A TYR A 1 77 ? 4.750   30.465 2.669  0.50 16.29 ? 196 TYR A CA  1 
ATOM   537 C  CA  B TYR A 1 77 ? 4.280   30.623 2.777  0.50 16.23 ? 196 TYR A CA  1 
ATOM   538 C  C   A TYR A 1 77 ? 5.438   31.562 3.532  0.50 15.71 ? 196 TYR A C   1 
ATOM   539 C  C   B TYR A 1 77 ? 5.325   31.461 3.533  0.50 15.85 ? 196 TYR A C   1 
ATOM   540 O  O   A TYR A 1 77 ? 6.355   32.223 3.056  0.50 15.55 ? 196 TYR A O   1 
ATOM   541 O  O   B TYR A 1 77 ? 6.331   31.883 2.985  0.50 15.39 ? 196 TYR A O   1 
ATOM   542 C  CB  A TYR A 1 77 ? 3.786   30.974 1.625  0.50 16.04 ? 196 TYR A CB  1 
ATOM   543 C  CB  B TYR A 1 77 ? 3.003   31.466 2.665  0.50 16.61 ? 196 TYR A CB  1 
ATOM   544 C  CG  A TYR A 1 77 ? 3.554   29.949 0.508  0.50 14.72 ? 196 TYR A CG  1 
ATOM   545 C  CG  B TYR A 1 77 ? 2.001   31.060 1.585  0.50 18.12 ? 196 TYR A CG  1 
ATOM   546 C  CD1 A TYR A 1 77 ? 4.576   29.601 -0.370 0.50 12.94 ? 196 TYR A CD1 1 
ATOM   547 C  CD1 B TYR A 1 77 ? 2.357   30.206 0.542  0.50 20.27 ? 196 TYR A CD1 1 
ATOM   548 C  CD2 A TYR A 1 77 ? 2.319   29.372 0.314  0.50 14.09 ? 196 TYR A CD2 1 
ATOM   549 C  CD2 B TYR A 1 77 ? 0.694   31.553 1.610  0.50 21.51 ? 196 TYR A CD2 1 
ATOM   550 C  CE1 A TYR A 1 77 ? 4.369   28.686 -1.387 0.50 14.54 ? 196 TYR A CE1 1 
ATOM   551 C  CE1 B TYR A 1 77 ? 1.431   29.861 -0.451 0.50 20.15 ? 196 TYR A CE1 1 
ATOM   552 C  CE2 A TYR A 1 77 ? 2.103   28.471 -0.714 0.50 13.10 ? 196 TYR A CE2 1 
ATOM   553 C  CE2 B TYR A 1 77 ? -0.231  31.206 0.632  0.50 21.37 ? 196 TYR A CE2 1 
ATOM   554 C  CZ  A TYR A 1 77 ? 3.133   28.144 -1.566 0.50 11.98 ? 196 TYR A CZ  1 
ATOM   555 C  CZ  B TYR A 1 77 ? 0.137   30.367 -0.382 0.50 21.84 ? 196 TYR A CZ  1 
ATOM   556 O  OH  A TYR A 1 77 ? 2.941   27.238 -2.589 0.50 14.14 ? 196 TYR A OH  1 
ATOM   557 O  OH  B TYR A 1 77 ? -0.799  30.070 -1.344 0.50 22.08 ? 196 TYR A OH  1 
ATOM   558 N  N   . HIS A 1 78 ? 5.027   31.727 4.785  1.00 16.34 ? 197 HIS A N   1 
ATOM   559 C  CA  A HIS A 1 78 ? 5.839   32.497 5.766  0.50 16.13 ? 197 HIS A CA  1 
ATOM   560 C  CA  B HIS A 1 78 ? 5.864   32.569 5.598  0.50 16.19 ? 197 HIS A CA  1 
ATOM   561 C  C   . HIS A 1 78 ? 7.242   31.950 5.818  1.00 15.88 ? 197 HIS A C   1 
ATOM   562 O  O   . HIS A 1 78 ? 8.246   32.680 5.745  1.00 13.80 ? 197 HIS A O   1 
ATOM   563 C  CB  A HIS A 1 78 ? 5.255   32.423 7.193  0.50 16.96 ? 197 HIS A CB  1 
ATOM   564 C  CB  B HIS A 1 78 ? 5.113   32.979 6.877  0.50 17.10 ? 197 HIS A CB  1 
ATOM   565 C  CG  A HIS A 1 78 ? 6.119   33.078 8.240  0.50 19.08 ? 197 HIS A CG  1 
ATOM   566 C  CG  B HIS A 1 78 ? 4.046   34.009 6.625  0.50 18.68 ? 197 HIS A CG  1 
ATOM   567 N  ND1 A HIS A 1 78 ? 6.929   32.362 9.101  0.50 22.11 ? 197 HIS A ND1 1 
ATOM   568 N  ND1 B HIS A 1 78 ? 2.795   33.692 6.132  0.50 21.03 ? 197 HIS A ND1 1 
ATOM   569 C  CD2 A HIS A 1 78 ? 6.285   34.380 8.572  0.50 20.49 ? 197 HIS A CD2 1 
ATOM   570 C  CD2 B HIS A 1 78 ? 4.066   35.357 6.754  0.50 19.25 ? 197 HIS A CD2 1 
ATOM   571 C  CE1 A HIS A 1 78 ? 7.568   33.193 9.901  0.50 21.08 ? 197 HIS A CE1 1 
ATOM   572 C  CE1 B HIS A 1 78 ? 2.085   34.797 6.000  0.50 21.74 ? 197 HIS A CE1 1 
ATOM   573 N  NE2 A HIS A 1 78 ? 7.198   34.424 9.598  0.50 22.66 ? 197 HIS A NE2 1 
ATOM   574 N  NE2 B HIS A 1 78 ? 2.832   35.820 6.371  0.50 21.02 ? 197 HIS A NE2 1 
ATOM   575 N  N   . ILE A 1 79 ? 7.324   30.621 5.976  1.00 14.55 ? 198 ILE A N   1 
ATOM   576 C  CA  . ILE A 1 79 ? 8.656   29.960 6.024  1.00 13.20 ? 198 ILE A CA  1 
ATOM   577 C  C   . ILE A 1 79 ? 9.441   30.132 4.712  1.00 12.61 ? 198 ILE A C   1 
ATOM   578 O  O   . ILE A 1 79 ? 10.623  30.446 4.733  1.00 12.46 ? 198 ILE A O   1 
ATOM   579 C  CB  . ILE A 1 79 ? 8.509   28.487 6.420  1.00 13.09 ? 198 ILE A CB  1 
ATOM   580 C  CG1 . ILE A 1 79 ? 8.094   28.393 7.896  1.00 13.64 ? 198 ILE A CG1 1 
ATOM   581 C  CG2 . ILE A 1 79 ? 9.762   27.639 6.046  1.00 13.65 ? 198 ILE A CG2 1 
ATOM   582 C  CD1 . ILE A 1 79 ? 7.622   26.940 8.346  1.00 13.93 ? 198 ILE A CD1 1 
ATOM   583 N  N   . CYS A 1 80 ? 8.771   29.987 3.574  1.00 13.05 ? 199 CYS A N   1 
ATOM   584 C  CA  . CYS A 1 80 ? 9.419   30.181 2.278  1.00 13.96 ? 199 CYS A CA  1 
ATOM   585 C  C   . CYS A 1 80 ? 10.061  31.574 2.158  1.00 13.85 ? 199 CYS A C   1 
ATOM   586 O  O   . CYS A 1 80 ? 11.233  31.691 1.756  1.00 15.18 ? 199 CYS A O   1 
ATOM   587 C  CB  . CYS A 1 80 ? 8.395   29.943 1.167  1.00 13.81 ? 199 CYS A CB  1 
ATOM   588 S  SG  . CYS A 1 80 ? 8.025   28.242 0.863  1.00 13.76 ? 199 CYS A SG  1 
ATOM   589 N  N   . ALA A 1 81 ? 9.297   32.593 2.564  1.00 14.14 ? 200 ALA A N   1 
ATOM   590 C  CA  . ALA A 1 81 ? 9.708   34.003 2.535  1.00 14.93 ? 200 ALA A CA  1 
ATOM   591 C  C   . ALA A 1 81 ? 10.865  34.230 3.501  1.00 14.30 ? 200 ALA A C   1 
ATOM   592 O  O   . ALA A 1 81 ? 11.908  34.782 3.131  1.00 15.39 ? 200 ALA A O   1 
ATOM   593 C  CB  . ALA A 1 81 ? 8.523   34.939 2.826  1.00 14.91 ? 200 ALA A CB  1 
ATOM   594 N  N   . LYS A 1 82 ? 10.745  33.715 4.718  1.00 15.45 ? 201 LYS A N   1 
ATOM   595 C  CA  . LYS A 1 82 ? 11.835  33.838 5.692  1.00 15.05 ? 201 LYS A CA  1 
ATOM   596 C  C   . LYS A 1 82 ? 13.123  33.195 5.219  1.00 14.60 ? 201 LYS A C   1 
ATOM   597 O  O   . LYS A 1 82 ? 14.185  33.827 5.313  1.00 14.96 ? 201 LYS A O   1 
ATOM   598 C  CB  . LYS A 1 82 ? 11.418  33.268 7.046  1.00 15.53 ? 201 LYS A CB  1 
ATOM   599 C  CG  . LYS A 1 82 ? 12.432  33.553 8.138  1.00 16.88 ? 201 LYS A CG  1 
ATOM   600 C  CD  . LYS A 1 82 ? 12.598  35.064 8.335  1.00 20.28 ? 201 LYS A CD  1 
ATOM   601 N  N   . LEU A 1 83 ? 13.061  31.980 4.657  1.00 13.45 ? 202 LEU A N   1 
ATOM   602 C  CA  . LEU A 1 83 ? 14.224  31.296 4.135  1.00 14.36 ? 202 LEU A CA  1 
ATOM   603 C  C   . LEU A 1 83 ? 14.857  32.053 2.955  1.00 15.14 ? 202 LEU A C   1 
ATOM   604 O  O   . LEU A 1 83 ? 16.081  32.169 2.887  1.00 17.01 ? 202 LEU A O   1 
ATOM   605 C  CB  . LEU A 1 83 ? 13.938  29.845 3.719  1.00 14.66 ? 202 LEU A CB  1 
ATOM   606 C  CG  . LEU A 1 83 ? 13.572  28.900 4.884  1.00 13.67 ? 202 LEU A CG  1 
ATOM   607 C  CD1 . LEU A 1 83 ? 13.106  27.556 4.327  1.00 12.09 ? 202 LEU A CD1 1 
ATOM   608 C  CD2 . LEU A 1 83 ? 14.753  28.737 5.890  1.00 13.97 ? 202 LEU A CD2 1 
ATOM   609 N  N   . ALA A 1 84 ? 14.030  32.529 2.028  1.00 15.77 ? 203 ALA A N   1 
ATOM   610 C  CA  . ALA A 1 84 ? 14.524  33.354 0.920  1.00 16.89 ? 203 ALA A CA  1 
ATOM   611 C  C   . ALA A 1 84 ? 15.363  34.515 1.437  1.00 16.79 ? 203 ALA A C   1 
ATOM   612 O  O   . ALA A 1 84 ? 16.438  34.814 0.905  1.00 17.83 ? 203 ALA A O   1 
ATOM   613 C  CB  . ALA A 1 84 ? 13.361  33.861 0.064  1.00 15.09 ? 203 ALA A CB  1 
ATOM   614 N  N   . ASN A 1 85 ? 14.839  35.195 2.443  1.00 17.46 ? 204 ASN A N   1 
ATOM   615 C  CA  . ASN A 1 85 ? 15.534  36.331 3.057  1.00 19.26 ? 204 ASN A CA  1 
ATOM   616 C  C   . ASN A 1 85 ? 16.852  35.972 3.757  1.00 20.19 ? 204 ASN A C   1 
ATOM   617 O  O   . ASN A 1 85 ? 17.903  36.572 3.480  1.00 20.88 ? 204 ASN A O   1 
ATOM   618 C  CB  . ASN A 1 85 ? 14.585  37.043 4.013  1.00 18.57 ? 204 ASN A CB  1 
ATOM   619 C  CG  . ASN A 1 85 ? 13.486  37.807 3.304  1.00 21.00 ? 204 ASN A CG  1 
ATOM   620 O  OD1 . ASN A 1 85 ? 13.668  38.323 2.203  1.00 27.31 ? 204 ASN A OD1 1 
ATOM   621 N  ND2 . ASN A 1 85 ? 12.358  37.881 3.925  1.00 23.97 ? 204 ASN A ND2 1 
ATOM   622 N  N   . VAL A 1 86 ? 16.821  34.981 4.640  1.00 21.72 ? 205 VAL A N   1 
ATOM   623 C  CA  . VAL A 1 86 ? 18.016  34.665 5.403  1.00 22.32 ? 205 VAL A CA  1 
ATOM   624 C  C   . VAL A 1 86 ? 19.077  34.032 4.518  1.00 23.18 ? 205 VAL A C   1 
ATOM   625 O  O   . VAL A 1 86 ? 20.261  34.102 4.811  1.00 23.45 ? 205 VAL A O   1 
ATOM   626 C  CB  . VAL A 1 86 ? 17.697  33.795 6.647  1.00 22.60 ? 205 VAL A CB  1 
ATOM   627 C  CG1 . VAL A 1 86 ? 16.602  34.476 7.488  1.00 21.91 ? 205 VAL A CG1 1 
ATOM   628 C  CG2 . VAL A 1 86 ? 17.372  32.391 6.263  1.00 21.02 ? 205 VAL A CG2 1 
ATOM   629 N  N   . ARG A 1 87 ? 18.692  33.415 3.414  1.00 23.04 ? 206 ARG A N   1 
ATOM   630 C  CA  . ARG A 1 87 ? 19.684  32.762 2.597  1.00 23.65 ? 206 ARG A CA  1 
ATOM   631 C  C   . ARG A 1 87 ? 20.304  33.722 1.581  1.00 25.25 ? 206 ARG A C   1 
ATOM   632 O  O   . ARG A 1 87 ? 21.176  33.306 0.808  1.00 26.57 ? 206 ARG A O   1 
ATOM   633 C  CB  . ARG A 1 87 ? 19.092  31.586 1.879  1.00 22.72 ? 206 ARG A CB  1 
ATOM   634 C  CG  . ARG A 1 87 ? 18.713  30.492 2.829  1.00 20.58 ? 206 ARG A CG  1 
ATOM   635 C  CD  . ARG A 1 87 ? 17.953  29.408 2.126  1.00 19.90 ? 206 ARG A CD  1 
ATOM   636 N  NE  . ARG A 1 87 ? 17.678  28.292 3.038  1.00 18.61 ? 206 ARG A NE  1 
ATOM   637 C  CZ  . ARG A 1 87 ? 17.026  27.190 2.712  1.00 18.73 ? 206 ARG A CZ  1 
ATOM   638 N  NH1 . ARG A 1 87 ? 16.519  27.009 1.482  1.00 17.13 ? 206 ARG A NH1 1 
ATOM   639 N  NH2 . ARG A 1 87 ? 16.874  26.240 3.624  1.00 20.85 ? 206 ARG A NH2 1 
ATOM   640 N  N   . ALA A 1 88 ? 19.833  34.961 1.572  1.00 25.77 ? 207 ALA A N   1 
ATOM   641 C  CA  . ALA A 1 88 ? 20.391  35.997 0.711  1.00 27.47 ? 207 ALA A CA  1 
ATOM   642 C  C   . ALA A 1 88 ? 21.708  36.469 1.305  1.00 29.25 ? 207 ALA A C   1 
ATOM   643 O  O   . ALA A 1 88 ? 22.662  36.576 0.545  1.00 32.45 ? 207 ALA A O   1 
ATOM   644 C  CB  . ALA A 1 88 ? 19.464  37.152 0.597  1.00 27.13 ? 207 ALA A CB  1 
HETATM 645 CA CA  . CA  B 2 .  ? 6.807   16.466 -4.561 1.00 30.42 ? 1   CA  A CA  1 
HETATM 646 X  UNK . UNX C 3 .  ? -5.660  20.693 -3.610 0.01 2.00  ? 213 UNX A UNK 1 
HETATM 647 X  UNK . UNX D 3 .  ? -6.437  18.197 -5.420 0.01 2.00  ? 2   UNX A UNK 1 
HETATM 648 X  UNK . UNX E 3 .  ? 18.045  23.160 0.218  0.01 2.00  ? 3   UNX A UNK 1 
HETATM 649 X  UNK . UNX F 3 .  ? 8.814   26.174 19.212 0.01 2.00  ? 4   UNX A UNK 1 
HETATM 650 X  UNK . UNX G 3 .  ? 13.063  31.696 15.530 0.01 2.00  ? 5   UNX A UNK 1 
HETATM 651 O  O   . HOH H 4 .  ? 9.830   17.817 6.890  1.00 19.56 ? 6   HOH A O   1 
HETATM 652 O  O   . HOH H 4 .  ? 12.156  21.178 5.828  1.00 17.64 ? 7   HOH A O   1 
HETATM 653 O  O   . HOH H 4 .  ? 14.462  24.565 17.377 1.00 30.06 ? 8   HOH A O   1 
HETATM 654 O  O   . HOH H 4 .  ? 6.426   27.677 19.839 1.00 16.82 ? 9   HOH A O   1 
HETATM 655 O  O   . HOH H 4 .  ? 2.119   22.217 16.774 1.00 23.69 ? 10  HOH A O   1 
HETATM 656 O  O   . HOH H 4 .  ? 11.788  19.328 -0.554 1.00 19.39 ? 11  HOH A O   1 
HETATM 657 O  O   . HOH H 4 .  ? 12.163  23.250 18.695 1.00 29.22 ? 12  HOH A O   1 
HETATM 658 O  O   . HOH H 4 .  ? 6.697   15.551 12.484 1.00 23.69 ? 13  HOH A O   1 
HETATM 659 O  O   . HOH H 4 .  ? 8.008   26.738 16.421 1.00 19.02 ? 14  HOH A O   1 
HETATM 660 O  O   . HOH H 4 .  ? 21.498  22.773 11.306 1.00 25.85 ? 15  HOH A O   1 
HETATM 661 O  O   . HOH H 4 .  ? 20.683  29.858 6.246  1.00 24.08 ? 16  HOH A O   1 
HETATM 662 O  O   . HOH H 4 .  ? 4.912   33.587 16.991 1.00 22.50 ? 17  HOH A O   1 
HETATM 663 O  O   . HOH H 4 .  ? -10.152 24.631 5.426  1.00 33.78 ? 18  HOH A O   1 
HETATM 664 O  O   . HOH H 4 .  ? 4.855   13.595 8.521  1.00 28.04 ? 19  HOH A O   1 
HETATM 665 O  O   . HOH H 4 .  ? 21.931  26.017 8.272  1.00 34.15 ? 20  HOH A O   1 
HETATM 666 O  O   . HOH H 4 .  ? 4.665   31.001 10.923 1.00 29.55 ? 21  HOH A O   1 
HETATM 667 O  O   . HOH H 4 .  ? 0.114   13.874 -5.703 1.00 31.93 ? 22  HOH A O   1 
HETATM 668 O  O   . HOH H 4 .  ? -9.503  18.636 2.418  1.00 35.39 ? 23  HOH A O   1 
HETATM 669 O  O   . HOH H 4 .  ? -0.701  29.700 9.816  1.00 30.41 ? 24  HOH A O   1 
HETATM 670 O  O   . HOH H 4 .  ? 7.496   25.085 -2.770 1.00 24.65 ? 25  HOH A O   1 
HETATM 671 O  O   . HOH H 4 .  ? 21.140  26.421 4.205  1.00 40.33 ? 26  HOH A O   1 
HETATM 672 O  O   . HOH H 4 .  ? 2.094   31.362 9.982  1.00 40.70 ? 27  HOH A O   1 
HETATM 673 O  O   . HOH H 4 .  ? 0.405   27.259 -3.377 1.00 35.21 ? 28  HOH A O   1 
HETATM 674 O  O   . HOH H 4 .  ? -3.345  23.749 -3.554 1.00 34.37 ? 29  HOH A O   1 
HETATM 675 O  O   . HOH H 4 .  ? 14.160  19.805 7.267  1.00 28.50 ? 30  HOH A O   1 
HETATM 676 O  O   . HOH H 4 .  ? -0.349  24.727 -4.251 1.00 38.13 ? 31  HOH A O   1 
HETATM 677 O  O   . HOH H 4 .  ? 7.158   14.509 9.693  1.00 33.60 ? 32  HOH A O   1 
HETATM 678 O  O   . HOH H 4 .  ? 12.496  37.928 7.046  1.00 35.28 ? 33  HOH A O   1 
HETATM 679 O  O   . HOH H 4 .  ? 5.391   26.623 -4.193 1.00 39.66 ? 34  HOH A O   1 
HETATM 680 O  O   . HOH H 4 .  ? -10.321 22.503 9.198  1.00 41.88 ? 35  HOH A O   1 
HETATM 681 O  O   . HOH H 4 .  ? 13.703  18.054 14.685 1.00 39.92 ? 36  HOH A O   1 
HETATM 682 O  O   . HOH H 4 .  ? 0.012   10.624 4.536  1.00 32.25 ? 37  HOH A O   1 
HETATM 683 O  O   . HOH H 4 .  ? 8.193   16.147 -6.598 1.00 28.57 ? 214 HOH A O   1 
HETATM 684 O  O   . HOH H 4 .  ? 5.945   17.388 -6.777 1.00 47.03 ? 215 HOH A O   1 
HETATM 685 O  O   . HOH H 4 .  ? 5.804   18.875 -3.605 1.00 28.87 ? 216 HOH A O   1 
HETATM 686 O  O   . HOH H 4 .  ? 7.714   14.093 -4.356 1.00 34.05 ? 217 HOH A O   1 
HETATM 687 O  O   . HOH H 4 .  ? 9.891   14.872 3.986  1.00 20.78 ? 218 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  120 ?   ?   ?   A . n 
A 1 2  GLY 2  121 ?   ?   ?   A . n 
A 1 3  LYS 3  122 ?   ?   ?   A . n 
A 1 4  ASP 4  123 ?   ?   ?   A . n 
A 1 5  TYR 5  124 ?   ?   ?   A . n 
A 1 6  PRO 6  125 ?   ?   ?   A . n 
A 1 7  PHE 7  126 ?   ?   ?   A . n 
A 1 8  ALA 8  127 ?   ?   ?   A . n 
A 1 9  ARG 9  128 ?   ?   ?   A . n 
A 1 10 PHE 10 129 ?   ?   ?   A . n 
A 1 11 ASN 11 130 ?   ?   ?   A . n 
A 1 12 LYS 12 131 ?   ?   ?   A . n 
A 1 13 THR 13 132 ?   ?   ?   A . n 
A 1 14 VAL 14 133 ?   ?   ?   A . n 
A 1 15 GLN 15 134 134 GLN GLN A . n 
A 1 16 VAL 16 135 135 VAL VAL A . n 
A 1 17 PRO 17 136 136 PRO PRO A . n 
A 1 18 VAL 18 137 137 VAL VAL A . n 
A 1 19 TYR 19 138 138 TYR TYR A . n 
A 1 20 SER 20 139 139 SER SER A . n 
A 1 21 GLU 21 140 140 GLU GLU A . n 
A 1 22 GLN 22 141 141 GLN GLN A . n 
A 1 23 GLU 23 142 142 GLU GLU A . n 
A 1 24 TYR 24 143 143 TYR TYR A . n 
A 1 25 GLN 25 144 144 GLN GLN A . n 
A 1 26 LEU 26 145 145 LEU LEU A . n 
A 1 27 TYR 27 146 146 TYR TYR A . n 
A 1 28 LEU 28 147 147 LEU LEU A . n 
A 1 29 HIS 29 148 148 HIS HIS A . n 
A 1 30 ASP 30 149 149 ASP ASP A . n 
A 1 31 ASP 31 150 150 ASP ASP A . n 
A 1 32 ALA 32 151 151 ALA ALA A . n 
A 1 33 TRP 33 152 152 TRP TRP A . n 
A 1 34 THR 34 153 153 THR THR A . n 
A 1 35 LYS 35 154 154 LYS LYS A . n 
A 1 36 ALA 36 155 155 ALA ALA A . n 
A 1 37 GLU 37 156 156 GLU GLU A . n 
A 1 38 THR 38 157 157 THR THR A . n 
A 1 39 ASP 39 158 158 ASP ASP A . n 
A 1 40 HIS 40 159 159 HIS HIS A . n 
A 1 41 LEU 41 160 160 LEU LEU A . n 
A 1 42 PHE 42 161 161 PHE PHE A . n 
A 1 43 ASP 43 162 162 ASP ASP A . n 
A 1 44 LEU 44 163 163 LEU LEU A . n 
A 1 45 SER 45 164 164 SER SER A . n 
A 1 46 ARG 46 165 165 ARG ARG A . n 
A 1 47 ARG 47 166 166 ARG ARG A . n 
A 1 48 PHE 48 167 167 PHE PHE A . n 
A 1 49 ASP 49 168 168 ASP ASP A . n 
A 1 50 LEU 50 169 169 LEU LEU A . n 
A 1 51 ARG 51 170 170 ARG ARG A . n 
A 1 52 PHE 52 171 171 PHE PHE A . n 
A 1 53 VAL 53 172 172 VAL VAL A . n 
A 1 54 VAL 54 173 173 VAL VAL A . n 
A 1 55 ILE 55 174 174 ILE ILE A . n 
A 1 56 HIS 56 175 175 HIS HIS A . n 
A 1 57 ASP 57 176 176 ASP ASP A . n 
A 1 58 ARG 58 177 177 ARG ARG A . n 
A 1 59 TYR 59 178 178 TYR TYR A . n 
A 1 60 ASP 60 179 179 ASP ASP A . n 
A 1 61 HIS 61 180 180 HIS HIS A . n 
A 1 62 GLN 62 181 181 GLN GLN A . n 
A 1 63 GLN 63 182 182 GLN GLN A . n 
A 1 64 PHE 64 183 183 PHE PHE A . n 
A 1 65 LYS 65 184 184 LYS LYS A . n 
A 1 66 LYS 66 185 185 LYS LYS A . n 
A 1 67 ARG 67 186 186 ARG ARG A . n 
A 1 68 SER 68 187 187 SER SER A . n 
A 1 69 VAL 69 188 188 VAL VAL A . n 
A 1 70 GLU 70 189 189 GLU GLU A . n 
A 1 71 ASP 71 190 190 ASP ASP A . n 
A 1 72 LEU 72 191 191 LEU LEU A . n 
A 1 73 LYS 73 192 192 LYS LYS A . n 
A 1 74 GLU 74 193 193 GLU GLU A . n 
A 1 75 ARG 75 194 194 ARG ARG A . n 
A 1 76 TYR 76 195 195 TYR TYR A . n 
A 1 77 TYR 77 196 196 TYR TYR A . n 
A 1 78 HIS 78 197 197 HIS HIS A . n 
A 1 79 ILE 79 198 198 ILE ILE A . n 
A 1 80 CYS 80 199 199 CYS CYS A . n 
A 1 81 ALA 81 200 200 ALA ALA A . n 
A 1 82 LYS 82 201 201 LYS LYS A . n 
A 1 83 LEU 83 202 202 LEU LEU A . n 
A 1 84 ALA 84 203 203 ALA ALA A . n 
A 1 85 ASN 85 204 204 ASN ASN A . n 
A 1 86 VAL 86 205 205 VAL VAL A . n 
A 1 87 ARG 87 206 206 ARG ARG A . n 
A 1 88 ALA 88 207 207 ALA ALA A . n 
A 1 89 VAL 89 208 ?   ?   ?   A . n 
A 1 90 PRO 90 209 ?   ?   ?   A . n 
A 1 91 GLY 91 210 ?   ?   ?   A . n 
A 1 92 THR 92 211 ?   ?   ?   A . n 
A 1 93 ASP 93 212 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  1   1  CA  CA  A . 
C 3 UNX 1  213 1  UNX UNX A . 
D 3 UNX 1  2   2  UNX UNX A . 
E 3 UNX 1  3   3  UNX UNX A . 
F 3 UNX 1  4   4  UNX UNX A . 
G 3 UNX 1  5   5  UNX UNX A . 
H 4 HOH 1  6   6  HOH HOH A . 
H 4 HOH 2  7   7  HOH HOH A . 
H 4 HOH 3  8   8  HOH HOH A . 
H 4 HOH 4  9   9  HOH HOH A . 
H 4 HOH 5  10  10 HOH HOH A . 
H 4 HOH 6  11  11 HOH HOH A . 
H 4 HOH 7  12  12 HOH HOH A . 
H 4 HOH 8  13  13 HOH HOH A . 
H 4 HOH 9  14  14 HOH HOH A . 
H 4 HOH 10 15  15 HOH HOH A . 
H 4 HOH 11 16  16 HOH HOH A . 
H 4 HOH 12 17  17 HOH HOH A . 
H 4 HOH 13 18  18 HOH HOH A . 
H 4 HOH 14 19  19 HOH HOH A . 
H 4 HOH 15 20  20 HOH HOH A . 
H 4 HOH 16 21  21 HOH HOH A . 
H 4 HOH 17 22  22 HOH HOH A . 
H 4 HOH 18 23  23 HOH HOH A . 
H 4 HOH 19 24  24 HOH HOH A . 
H 4 HOH 20 25  25 HOH HOH A . 
H 4 HOH 21 26  26 HOH HOH A . 
H 4 HOH 22 27  27 HOH HOH A . 
H 4 HOH 23 28  28 HOH HOH A . 
H 4 HOH 24 29  29 HOH HOH A . 
H 4 HOH 25 30  30 HOH HOH A . 
H 4 HOH 26 31  31 HOH HOH A . 
H 4 HOH 27 32  32 HOH HOH A . 
H 4 HOH 28 33  33 HOH HOH A . 
H 4 HOH 29 34  34 HOH HOH A . 
H 4 HOH 30 35  35 HOH HOH A . 
H 4 HOH 31 36  36 HOH HOH A . 
H 4 HOH 32 37  37 HOH HOH A . 
H 4 HOH 33 214 1  HOH HOH A . 
H 4 HOH 34 215 2  HOH HOH A . 
H 4 HOH 35 216 3  HOH HOH A . 
H 4 HOH 36 217 4  HOH HOH A . 
H 4 HOH 37 218 5  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    UNX 
_pdbx_struct_special_symmetry.auth_seq_id     4 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   UNX 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A ARG 46 ? A ARG 165 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 OD1 ? A ASP 49 ? A ASP 168 ? 1_555 83.6  ? 
2  O   ? A ARG 46 ? A ARG 165 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 217 ? 1_555 79.5  ? 
3  OD1 ? A ASP 49 ? A ASP 168 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 217 ? 1_555 94.5  ? 
4  O   ? A ARG 46 ? A ARG 165 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 214 ? 1_555 154.9 ? 
5  OD1 ? A ASP 49 ? A ASP 168 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 214 ? 1_555 96.8  ? 
6  O   ? H HOH .  ? A HOH 217 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 214 ? 1_555 75.4  ? 
7  O   ? A ARG 46 ? A ARG 165 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 215 ? 1_555 134.5 ? 
8  OD1 ? A ASP 49 ? A ASP 168 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 215 ? 1_555 57.2  ? 
9  O   ? H HOH .  ? A HOH 217 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 215 ? 1_555 121.8 ? 
10 O   ? H HOH .  ? A HOH 214 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 215 ? 1_555 61.5  ? 
11 O   ? A ARG 46 ? A ARG 165 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 78.4  ? 
12 OD1 ? A ASP 49 ? A ASP 168 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 94.1  ? 
13 O   ? H HOH .  ? A HOH 217 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 155.2 ? 
14 O   ? H HOH .  ? A HOH 214 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 126.5 ? 
15 O   ? H HOH .  ? A HOH 215 ? 1_555 CA ? B CA . ? A CA 1 ? 1_555 O   ? H HOH .  ? A HOH 216 ? 1_555 82.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_diffrn_reflns.diffrn_id 
_diffrn_reflns.pdbx_d_res_high 
_diffrn_reflns.pdbx_d_res_low 
_diffrn_reflns.pdbx_number_obs 
_diffrn_reflns.pdbx_Rmerge_I_obs 
_diffrn_reflns.pdbx_Rsym_value 
_diffrn_reflns.pdbx_chi_squared 
_diffrn_reflns.av_sigmaI_over_netI 
_diffrn_reflns.pdbx_redundancy 
_diffrn_reflns.pdbx_percent_possible_obs 
_diffrn_reflns.number 
_diffrn_reflns.pdbx_observed_criterion 
_diffrn_reflns.limit_h_max 
_diffrn_reflns.limit_h_min 
_diffrn_reflns.limit_k_max 
_diffrn_reflns.limit_k_min 
_diffrn_reflns.limit_l_max 
_diffrn_reflns.limit_l_min 
1 2.800 30.000 39689 0.058 ? 1.66 44.47 7.60  100.00 300995 ? ? ? ? ? ? ? 
2 2.800 30.000 21389 0.061 ? 1.76 44.47 12.10 98.80  259196 ? ? ? ? ? ? ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 6.02 30.00 ? ? 0.039 ? 2.188 7.80  99.90  
1 4.78 6.02  ? ? 0.051 ? 2.515 7.70  100.00 
1 4.18 4.78  ? ? 0.050 ? 2.115 7.80  100.00 
1 3.80 4.18  ? ? 0.055 ? 1.787 7.80  100.00 
1 3.53 3.80  ? ? 0.067 ? 1.812 7.80  100.00 
1 3.32 3.53  ? ? 0.084 ? 1.406 7.80  100.00 
1 3.15 3.32  ? ? 0.112 ? 1.251 7.80  100.00 
1 3.02 3.15  ? ? 0.186 ? 1.132 7.70  100.00 
1 2.90 3.02  ? ? 0.282 ? 1.149 7.30  100.00 
1 2.80 2.90  ? ? 0.365 ? 1.086 6.20  99.60  
2 6.02 30.00 ? ? 0.035 ? 2.025 13.20 99.90  
2 4.78 6.02  ? ? 0.046 ? 2.044 13.90 100.00 
2 4.18 4.78  ? ? 0.052 ? 2.032 14.10 100.00 
2 3.80 4.18  ? ? 0.071 ? 1.829 14.00 100.00 
2 3.53 3.80  ? ? 0.104 ? 2.058 13.70 100.00 
2 3.32 3.53  ? ? 0.150 ? 1.686 13.50 100.00 
2 3.15 3.32  ? ? 0.210 ? 1.461 13.30 100.00 
2 3.02 3.15  ? ? 0.364 ? 1.249 12.40 100.00 
2 2.90 3.02  ? ? 0.499 ? 1.210 8.00  99.50  
2 2.80 2.90  ? ? 0.516 ? 1.064 3.60  88.30  
# 
_phasing.method   SIRAS 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .        ?               package 'Zbyszek Otwinowski'    hkl@hkl-xray.com             'data reduction'  
http://www.hkl-xray.com/                     ?          ? 1 
SCALEPACK   .        ?               package 'Zbyszek Otwinowski'    hkl@hkl-xray.com             'data scaling'    
http://www.hkl-xray.com/                     ?          ? 2 
SHELX       .        ?               package 'George M. Sheldrick'   gsheldr@shelx.uni-ac.gwdg.de phasing           
http://shelx.uni-ac.gwdg.de/SHELX/           Fortran_77 ? 3 
RESOLVE     .        ?               program 'Thomas C. Terwilliger' terwilliger@lanl.gov         phasing           
http://www.solve.lanl.gov/                   ?          ? 4 
REFMAC      5.5.0072 ?               program 'Garib N. Murshudov'    garib@ysbl.york.ac.uk        refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                     help@deposit.rcsb.org        'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 6 
HKL-2000    .        ?               ?       ?                       ?                            'data reduction'  ? ?          ? 
7 
HKL-2000    .        ?               ?       ?                       ?                            'data scaling'    ? ?          ? 
8 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 140 ? CG  ? A GLU 21 CG  
2  1 Y 1 A GLU 140 ? CD  ? A GLU 21 CD  
3  1 Y 1 A GLU 140 ? OE1 ? A GLU 21 OE1 
4  1 Y 1 A GLU 140 ? OE2 ? A GLU 21 OE2 
5  1 Y 1 A GLN 144 ? CG  ? A GLN 25 CG  
6  1 Y 1 A GLN 144 ? CD  ? A GLN 25 CD  
7  1 Y 1 A GLN 144 ? OE1 ? A GLN 25 OE1 
8  1 Y 1 A GLN 144 ? NE2 ? A GLN 25 NE2 
9  1 Y 1 A GLN 181 ? CG  ? A GLN 62 CG  
10 1 Y 1 A GLN 181 ? CD  ? A GLN 62 CD  
11 1 Y 1 A GLN 181 ? OE1 ? A GLN 62 OE1 
12 1 Y 1 A GLN 181 ? NE2 ? A GLN 62 NE2 
13 1 Y 1 A LYS 184 ? CG  ? A LYS 65 CG  
14 1 Y 1 A LYS 184 ? CD  ? A LYS 65 CD  
15 1 Y 1 A LYS 184 ? CE  ? A LYS 65 CE  
16 1 Y 1 A LYS 184 ? NZ  ? A LYS 65 NZ  
17 1 Y 1 A LYS 185 ? CG  ? A LYS 66 CG  
18 1 Y 1 A LYS 185 ? CD  ? A LYS 66 CD  
19 1 Y 1 A LYS 185 ? CE  ? A LYS 66 CE  
20 1 Y 1 A LYS 185 ? NZ  ? A LYS 66 NZ  
21 1 Y 1 A LYS 192 ? NZ  ? A LYS 73 NZ  
22 1 Y 1 A LYS 201 ? CE  ? A LYS 82 CE  
23 1 Y 1 A LYS 201 ? NZ  ? A LYS 82 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 120 ? A GLY 1  
2  1 Y 1 A GLY 121 ? A GLY 2  
3  1 Y 1 A LYS 122 ? A LYS 3  
4  1 Y 1 A ASP 123 ? A ASP 4  
5  1 Y 1 A TYR 124 ? A TYR 5  
6  1 Y 1 A PRO 125 ? A PRO 6  
7  1 Y 1 A PHE 126 ? A PHE 7  
8  1 Y 1 A ALA 127 ? A ALA 8  
9  1 Y 1 A ARG 128 ? A ARG 9  
10 1 Y 1 A PHE 129 ? A PHE 10 
11 1 Y 1 A ASN 130 ? A ASN 11 
12 1 Y 1 A LYS 131 ? A LYS 12 
13 1 Y 1 A THR 132 ? A THR 13 
14 1 Y 1 A VAL 133 ? A VAL 14 
15 1 Y 1 A VAL 208 ? A VAL 89 
16 1 Y 1 A PRO 209 ? A PRO 90 
17 1 Y 1 A GLY 210 ? A GLY 91 
18 1 Y 1 A THR 211 ? A THR 92 
19 1 Y 1 A ASP 212 ? A ASP 93 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'         CA  
3 'UNKNOWN ATOM OR ION' UNX 
4 water                 HOH 
#