data_3HO5
# 
_entry.id   3HO5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HO5         
RCSB  RCSB053374   
WWPDB D_1000053374 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3HO3 . unspecified 
PDB 3HO4 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3HO5 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hymowitz, S.G.' 1 
'Bosanac, I.'    2 
# 
_citation.id                        primary 
_citation.title                     
'The structure of SHH in complex with HHIP reveals a recognition role for the Shh pseudo active site in signaling.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            16 
_citation.page_first                691 
_citation.page_last                 697 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19561609 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1632 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bosanac, I.'      1 
primary 'Maun, H.R.'       2 
primary 'Scales, S.J.'     3 
primary 'Wen, X.'          4 
primary 'Lingel, A.'       5 
primary 'Bazan, J.F.'      6 
primary 'de Sauvage, F.J.' 7 
primary 'Hymowitz, S.G.'   8 
primary 'Lazarus, R.A.'    9 
# 
_cell.entry_id           3HO5 
_cell.length_a           101.618 
_cell.length_b           101.618 
_cell.length_c           302.830 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HO5 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hedgehog-interacting protein' 54087.246 2 ? ? 'UNP residues 193-667' ? 
2 polymer     man 'Sonic hedgehog protein'       19122.484 1 ? ? 'UNP residues 29-197'  ? 
3 non-polymer syn 'ZINC ION'                     65.409    2 ? ? ?                      ? 
4 non-polymer syn 'CALCIUM ION'                  40.078    2 ? ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'HHIP, HIP'                                                                      
2 'SHH, HHG-1, Sonic hedgehog protein N-product, Sonic hedgehog protein C-product' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLV
QSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKH
LGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDP
GRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFG
DRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPE
ECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEHHHHH
H
;
;SNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLV
QSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKH
LGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDP
GRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFG
DRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPE
ECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEHHHHH
H
;
A,B ? 
2 'polypeptide(L)' no no 
;GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNA
LAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE
NSVAAKSGG
;
;GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNA
LAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE
NSVAAKSGG
;
H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   TYR n 
1 4   LEU n 
1 5   ASP n 
1 6   GLN n 
1 7   MET n 
1 8   GLU n 
1 9   GLU n 
1 10  TYR n 
1 11  ASP n 
1 12  LYS n 
1 13  VAL n 
1 14  GLU n 
1 15  GLU n 
1 16  ILE n 
1 17  SER n 
1 18  ARG n 
1 19  LYS n 
1 20  HIS n 
1 21  LYS n 
1 22  HIS n 
1 23  ASN n 
1 24  CYS n 
1 25  PHE n 
1 26  CYS n 
1 27  ILE n 
1 28  GLN n 
1 29  GLU n 
1 30  VAL n 
1 31  VAL n 
1 32  SER n 
1 33  GLY n 
1 34  LEU n 
1 35  ARG n 
1 36  GLN n 
1 37  PRO n 
1 38  VAL n 
1 39  GLY n 
1 40  ALA n 
1 41  LEU n 
1 42  HIS n 
1 43  SER n 
1 44  GLY n 
1 45  ASP n 
1 46  GLY n 
1 47  SER n 
1 48  GLN n 
1 49  ARG n 
1 50  LEU n 
1 51  PHE n 
1 52  ILE n 
1 53  LEU n 
1 54  GLU n 
1 55  LYS n 
1 56  GLU n 
1 57  GLY n 
1 58  TYR n 
1 59  VAL n 
1 60  LYS n 
1 61  ILE n 
1 62  LEU n 
1 63  THR n 
1 64  PRO n 
1 65  GLU n 
1 66  GLY n 
1 67  GLU n 
1 68  ILE n 
1 69  PHE n 
1 70  LYS n 
1 71  GLU n 
1 72  PRO n 
1 73  TYR n 
1 74  LEU n 
1 75  ASP n 
1 76  ILE n 
1 77  HIS n 
1 78  LYS n 
1 79  LEU n 
1 80  VAL n 
1 81  GLN n 
1 82  SER n 
1 83  GLY n 
1 84  ILE n 
1 85  LYS n 
1 86  GLY n 
1 87  GLY n 
1 88  ASP n 
1 89  GLU n 
1 90  ARG n 
1 91  GLY n 
1 92  LEU n 
1 93  LEU n 
1 94  SER n 
1 95  LEU n 
1 96  ALA n 
1 97  PHE n 
1 98  HIS n 
1 99  PRO n 
1 100 ASN n 
1 101 TYR n 
1 102 LYS n 
1 103 LYS n 
1 104 ASN n 
1 105 GLY n 
1 106 LYS n 
1 107 LEU n 
1 108 TYR n 
1 109 VAL n 
1 110 SER n 
1 111 TYR n 
1 112 THR n 
1 113 THR n 
1 114 ASN n 
1 115 GLN n 
1 116 GLU n 
1 117 ARG n 
1 118 TRP n 
1 119 ALA n 
1 120 ILE n 
1 121 GLY n 
1 122 PRO n 
1 123 HIS n 
1 124 ASP n 
1 125 HIS n 
1 126 ILE n 
1 127 LEU n 
1 128 ARG n 
1 129 VAL n 
1 130 VAL n 
1 131 GLU n 
1 132 TYR n 
1 133 THR n 
1 134 VAL n 
1 135 SER n 
1 136 ARG n 
1 137 LYS n 
1 138 ASN n 
1 139 PRO n 
1 140 HIS n 
1 141 GLN n 
1 142 VAL n 
1 143 ASP n 
1 144 LEU n 
1 145 ARG n 
1 146 THR n 
1 147 ALA n 
1 148 ARG n 
1 149 VAL n 
1 150 PHE n 
1 151 LEU n 
1 152 GLU n 
1 153 VAL n 
1 154 ALA n 
1 155 GLU n 
1 156 LEU n 
1 157 HIS n 
1 158 ARG n 
1 159 LYS n 
1 160 HIS n 
1 161 LEU n 
1 162 GLY n 
1 163 GLY n 
1 164 GLN n 
1 165 LEU n 
1 166 LEU n 
1 167 PHE n 
1 168 GLY n 
1 169 PRO n 
1 170 ASP n 
1 171 GLY n 
1 172 PHE n 
1 173 LEU n 
1 174 TYR n 
1 175 ILE n 
1 176 ILE n 
1 177 LEU n 
1 178 GLY n 
1 179 ASP n 
1 180 GLY n 
1 181 MET n 
1 182 ILE n 
1 183 THR n 
1 184 LEU n 
1 185 ASP n 
1 186 ASP n 
1 187 MET n 
1 188 GLU n 
1 189 GLU n 
1 190 MET n 
1 191 ASP n 
1 192 GLY n 
1 193 LEU n 
1 194 SER n 
1 195 ASP n 
1 196 PHE n 
1 197 THR n 
1 198 GLY n 
1 199 SER n 
1 200 VAL n 
1 201 LEU n 
1 202 ARG n 
1 203 LEU n 
1 204 ASP n 
1 205 VAL n 
1 206 ASP n 
1 207 THR n 
1 208 ASP n 
1 209 MET n 
1 210 CYS n 
1 211 ASN n 
1 212 VAL n 
1 213 PRO n 
1 214 TYR n 
1 215 SER n 
1 216 ILE n 
1 217 PRO n 
1 218 ARG n 
1 219 SER n 
1 220 ASN n 
1 221 PRO n 
1 222 HIS n 
1 223 PHE n 
1 224 ASN n 
1 225 SER n 
1 226 THR n 
1 227 ASN n 
1 228 GLN n 
1 229 PRO n 
1 230 PRO n 
1 231 GLU n 
1 232 VAL n 
1 233 PHE n 
1 234 ALA n 
1 235 HIS n 
1 236 GLY n 
1 237 LEU n 
1 238 HIS n 
1 239 ASP n 
1 240 PRO n 
1 241 GLY n 
1 242 ARG n 
1 243 CYS n 
1 244 ALA n 
1 245 VAL n 
1 246 ASP n 
1 247 ARG n 
1 248 HIS n 
1 249 PRO n 
1 250 THR n 
1 251 ASP n 
1 252 ILE n 
1 253 ASN n 
1 254 ILE n 
1 255 ASN n 
1 256 LEU n 
1 257 THR n 
1 258 ILE n 
1 259 LEU n 
1 260 CYS n 
1 261 SER n 
1 262 ASP n 
1 263 SER n 
1 264 ASN n 
1 265 GLY n 
1 266 LYS n 
1 267 ASN n 
1 268 ARG n 
1 269 SER n 
1 270 SER n 
1 271 ALA n 
1 272 ARG n 
1 273 ILE n 
1 274 LEU n 
1 275 GLN n 
1 276 ILE n 
1 277 ILE n 
1 278 LYS n 
1 279 GLY n 
1 280 LYS n 
1 281 ASP n 
1 282 TYR n 
1 283 GLU n 
1 284 SER n 
1 285 GLU n 
1 286 PRO n 
1 287 SER n 
1 288 LEU n 
1 289 LEU n 
1 290 GLU n 
1 291 PHE n 
1 292 LYS n 
1 293 PRO n 
1 294 PHE n 
1 295 SER n 
1 296 ASN n 
1 297 GLY n 
1 298 PRO n 
1 299 LEU n 
1 300 VAL n 
1 301 GLY n 
1 302 GLY n 
1 303 PHE n 
1 304 VAL n 
1 305 TYR n 
1 306 ARG n 
1 307 GLY n 
1 308 CYS n 
1 309 GLN n 
1 310 SER n 
1 311 GLU n 
1 312 ARG n 
1 313 LEU n 
1 314 TYR n 
1 315 GLY n 
1 316 SER n 
1 317 TYR n 
1 318 VAL n 
1 319 PHE n 
1 320 GLY n 
1 321 ASP n 
1 322 ARG n 
1 323 ASN n 
1 324 GLY n 
1 325 ASN n 
1 326 PHE n 
1 327 LEU n 
1 328 THR n 
1 329 LEU n 
1 330 GLN n 
1 331 GLN n 
1 332 SER n 
1 333 PRO n 
1 334 VAL n 
1 335 THR n 
1 336 LYS n 
1 337 GLN n 
1 338 TRP n 
1 339 GLN n 
1 340 GLU n 
1 341 LYS n 
1 342 PRO n 
1 343 LEU n 
1 344 CYS n 
1 345 LEU n 
1 346 GLY n 
1 347 THR n 
1 348 SER n 
1 349 GLY n 
1 350 SER n 
1 351 CYS n 
1 352 ARG n 
1 353 GLY n 
1 354 TYR n 
1 355 PHE n 
1 356 SER n 
1 357 GLY n 
1 358 HIS n 
1 359 ILE n 
1 360 LEU n 
1 361 GLY n 
1 362 PHE n 
1 363 GLY n 
1 364 GLU n 
1 365 ASP n 
1 366 GLU n 
1 367 LEU n 
1 368 GLY n 
1 369 GLU n 
1 370 VAL n 
1 371 TYR n 
1 372 ILE n 
1 373 LEU n 
1 374 SER n 
1 375 SER n 
1 376 SER n 
1 377 LYS n 
1 378 SER n 
1 379 MET n 
1 380 THR n 
1 381 GLN n 
1 382 THR n 
1 383 HIS n 
1 384 ASN n 
1 385 GLY n 
1 386 LYS n 
1 387 LEU n 
1 388 TYR n 
1 389 LYS n 
1 390 ILE n 
1 391 VAL n 
1 392 ASP n 
1 393 PRO n 
1 394 LYS n 
1 395 ARG n 
1 396 PRO n 
1 397 LEU n 
1 398 MET n 
1 399 PRO n 
1 400 GLU n 
1 401 GLU n 
1 402 CYS n 
1 403 ARG n 
1 404 ALA n 
1 405 THR n 
1 406 VAL n 
1 407 GLN n 
1 408 PRO n 
1 409 ALA n 
1 410 GLN n 
1 411 THR n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 GLU n 
1 416 CYS n 
1 417 SER n 
1 418 ARG n 
1 419 LEU n 
1 420 CYS n 
1 421 ARG n 
1 422 ASN n 
1 423 GLY n 
1 424 TYR n 
1 425 CYS n 
1 426 THR n 
1 427 PRO n 
1 428 THR n 
1 429 GLY n 
1 430 LYS n 
1 431 CYS n 
1 432 CYS n 
1 433 CYS n 
1 434 SER n 
1 435 PRO n 
1 436 GLY n 
1 437 TRP n 
1 438 GLU n 
1 439 GLY n 
1 440 ASP n 
1 441 PHE n 
1 442 CYS n 
1 443 ARG n 
1 444 THR n 
1 445 ALA n 
1 446 LYS n 
1 447 CYS n 
1 448 GLU n 
1 449 PRO n 
1 450 ALA n 
1 451 CYS n 
1 452 ARG n 
1 453 HIS n 
1 454 GLY n 
1 455 GLY n 
1 456 VAL n 
1 457 CYS n 
1 458 VAL n 
1 459 ARG n 
1 460 PRO n 
1 461 ASN n 
1 462 LYS n 
1 463 CYS n 
1 464 LEU n 
1 465 CYS n 
1 466 LYS n 
1 467 LYS n 
1 468 GLY n 
1 469 TYR n 
1 470 LEU n 
1 471 GLY n 
1 472 PRO n 
1 473 GLN n 
1 474 CYS n 
1 475 GLU n 
1 476 HIS n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
2 1   GLY n 
2 2   PHE n 
2 3   GLY n 
2 4   LYS n 
2 5   ARG n 
2 6   ARG n 
2 7   HIS n 
2 8   PRO n 
2 9   LYS n 
2 10  LYS n 
2 11  LEU n 
2 12  THR n 
2 13  PRO n 
2 14  LEU n 
2 15  ALA n 
2 16  TYR n 
2 17  LYS n 
2 18  GLN n 
2 19  PHE n 
2 20  ILE n 
2 21  PRO n 
2 22  ASN n 
2 23  VAL n 
2 24  ALA n 
2 25  GLU n 
2 26  LYS n 
2 27  THR n 
2 28  LEU n 
2 29  GLY n 
2 30  ALA n 
2 31  SER n 
2 32  GLY n 
2 33  ARG n 
2 34  TYR n 
2 35  GLU n 
2 36  GLY n 
2 37  LYS n 
2 38  ILE n 
2 39  SER n 
2 40  ARG n 
2 41  ASN n 
2 42  SER n 
2 43  GLU n 
2 44  ARG n 
2 45  PHE n 
2 46  LYS n 
2 47  GLU n 
2 48  LEU n 
2 49  THR n 
2 50  PRO n 
2 51  ASN n 
2 52  TYR n 
2 53  ASN n 
2 54  PRO n 
2 55  ASP n 
2 56  ILE n 
2 57  ILE n 
2 58  PHE n 
2 59  LYS n 
2 60  ASP n 
2 61  GLU n 
2 62  GLU n 
2 63  ASN n 
2 64  THR n 
2 65  GLY n 
2 66  ALA n 
2 67  ASP n 
2 68  ARG n 
2 69  LEU n 
2 70  MET n 
2 71  THR n 
2 72  GLN n 
2 73  ARG n 
2 74  CYS n 
2 75  LYS n 
2 76  ASP n 
2 77  LYS n 
2 78  LEU n 
2 79  ASN n 
2 80  ALA n 
2 81  LEU n 
2 82  ALA n 
2 83  ILE n 
2 84  SER n 
2 85  VAL n 
2 86  MET n 
2 87  ASN n 
2 88  GLN n 
2 89  TRP n 
2 90  PRO n 
2 91  GLY n 
2 92  VAL n 
2 93  LYS n 
2 94  LEU n 
2 95  ARG n 
2 96  VAL n 
2 97  THR n 
2 98  GLU n 
2 99  GLY n 
2 100 TRP n 
2 101 ASP n 
2 102 GLU n 
2 103 ASP n 
2 104 GLY n 
2 105 HIS n 
2 106 HIS n 
2 107 SER n 
2 108 GLU n 
2 109 GLU n 
2 110 SER n 
2 111 LEU n 
2 112 HIS n 
2 113 TYR n 
2 114 GLU n 
2 115 GLY n 
2 116 ARG n 
2 117 ALA n 
2 118 VAL n 
2 119 ASP n 
2 120 ILE n 
2 121 THR n 
2 122 THR n 
2 123 SER n 
2 124 ASP n 
2 125 ARG n 
2 126 ASP n 
2 127 ARG n 
2 128 SER n 
2 129 LYS n 
2 130 TYR n 
2 131 GLY n 
2 132 MET n 
2 133 LEU n 
2 134 ALA n 
2 135 ARG n 
2 136 LEU n 
2 137 ALA n 
2 138 VAL n 
2 139 GLU n 
2 140 ALA n 
2 141 GLY n 
2 142 PHE n 
2 143 ASP n 
2 144 TRP n 
2 145 VAL n 
2 146 TYR n 
2 147 TYR n 
2 148 GLU n 
2 149 SER n 
2 150 LYS n 
2 151 ALA n 
2 152 HIS n 
2 153 ILE n 
2 154 HIS n 
2 155 CYS n 
2 156 SER n 
2 157 VAL n 
2 158 LYS n 
2 159 ALA n 
2 160 GLU n 
2 161 ASN n 
2 162 SER n 
2 163 VAL n 
2 164 ALA n 
2 165 ALA n 
2 166 LYS n 
2 167 SER n 
2 168 GLY n 
2 169 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'HHIP, HIP, UNQ5825/PRO19644' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Trichoplusia ni'  7111 ? ? 
? ? ? ? ? ? 'insect cells'        ? ? ? ? ? 'Gateway vector pENTR/D-TOPO (Invitrogen)'    ? ? ? 
'pENTR/D-TOPO with honeybee melittin secretion signal' ? ? 
2 1 sample ? ? ? human ? SHH                           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562  ? ? 
? ? ? ? ? ? 'Rosetta 2 (Novagen)' ? ? ? ? ? 'pET101/D-TOPO (Invitrogen) with T7 promoter' ? ? ? 'pET101/D-TOPO (Invitrogen)' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HHIP_HUMAN Q96QV1 1 
;SNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLV
QSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKH
LGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDP
GRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFG
DRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPE
ECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCE
;
193 ? 
2 UNP SHH_HUMAN  Q15465 2 
;GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNA
LAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE
NSVAAKSGG
;
29  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HO5 A 1 ? 475 ? Q96QV1 193 ? 667 ? 193 667 
2 1 3HO5 B 1 ? 475 ? Q96QV1 193 ? 667 ? 193 667 
3 2 3HO5 H 1 ? 169 ? Q15465 29  ? 197 ? 29  197 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3HO5 HIS A 476 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 668 1  
1 3HO5 HIS A 477 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 669 2  
1 3HO5 HIS A 478 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 670 3  
1 3HO5 HIS A 479 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 671 4  
1 3HO5 HIS A 480 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 672 5  
1 3HO5 HIS A 481 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 673 6  
2 3HO5 HIS B 476 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 668 7  
2 3HO5 HIS B 477 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 669 8  
2 3HO5 HIS B 478 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 670 9  
2 3HO5 HIS B 479 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 671 10 
2 3HO5 HIS B 480 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 672 11 
2 3HO5 HIS B 481 ? UNP Q96QV1 ? ? 'EXPRESSION TAG' 673 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3HO5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.55 
_exptl_crystal.density_percent_sol   65.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'0.1 M bis-Tris propane pH 7.0 and 2.2-2.5 M sodium formate, VAPOR DIFFUSION, HANGING DROP, temperature 292K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-06-06 
_diffrn_detector.details                
'Flat mirror (vertical focusing); single crystal Si(111) bent monochromator (ho rizontal focusing)' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    
'Side scattering bent cube-root I-beam single crystal; asymmetric cut 4.965 degs' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97839 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97839 
# 
_reflns.entry_id                     3HO5 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   37106 
_reflns.number_all                   37181 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.085 
_reflns.pdbx_netI_over_sigmaI        24.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.589 
_reflns_shell.meanI_over_sigI_obs    4.3 
_reflns_shell.pdbx_redundancy        8.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3HO5 
_refine.ls_number_reflns_obs                     35147 
_refine.ls_number_reflns_all                     35204 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            3.01 
_refine.ls_percent_reflns_obs                    99.84 
_refine.ls_R_factor_obs                          0.23381 
_refine.ls_R_factor_all                          0.23381 
_refine.ls_R_factor_R_work                       0.23097 
_refine.ls_R_factor_R_free                       0.28738 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1874 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.921 
_refine.correlation_coeff_Fo_to_Fc_free          0.885 
_refine.B_iso_mean                               96.674 
_refine.aniso_B[1][1]                            4.78 
_refine.aniso_B[2][2]                            4.78 
_refine.aniso_B[3][3]                            -7.17 
_refine.aniso_B[1][2]                            2.39 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entries 1VHH, 3HO4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       1.342 
_refine.pdbx_overall_ESU_R_Free                  0.425 
_refine.overall_SU_ML                            0.336 
_refine.overall_SU_B                             40.143 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8251 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8255 
_refine_hist.d_res_high                       3.01 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.008  0.021  ? 8444  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.186  1.960  ? 11395 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.529  5.000  ? 1044  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   33.348 23.680 ? 394   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   19.747 15.000 ? 1425  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   15.728 15.000 ? 58    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.080  0.200  ? 1198  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.003  0.020  ? 6462  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.204  0.200  ? 3517  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.306  0.200  ? 5485  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.141  0.200  ? 242   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.200  0.200  ? 61    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.224  0.200  ? 3     'X-RAY DIFFRACTION' ? 
r_mcbond_it              2.161  2.500  ? 5344  'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.635  5.000  ? 8350  'X-RAY DIFFRACTION' ? 
r_scbond_it              1.997  2.500  ? 3463  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.223  5.000  ? 3045  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   25 
_refine_ls_shell.d_res_high                       3.005 
_refine_ls_shell.d_res_low                        3.066 
_refine_ls_shell.number_reflns_R_work             2039 
_refine_ls_shell.R_factor_R_work                  0.293 
_refine_ls_shell.percent_reflns_obs               99.44 
_refine_ls_shell.R_factor_R_free                  0.340 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             103 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2142 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HO5 
_struct.title                     'Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex' 
_struct.pdbx_descriptor           'Hedgehog-interacting protein, Sonic hedgehog protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HO5 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;receptor ectodomain, six-bladed-propeller domain, EGF domain, disulfide bond, calcium cation, zinc cation, Cell membrane, EGF-like domain, Glycoprotein, Membrane, Secreted, Autocatalytic cleavage, Developmental protein, Disease mutation, Holoprosencephaly, Hydrolase, Lipoprotein, Microphthalmia, Palmitate, Protease, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 100 ? GLY A 105 ? ASN A 292 GLY A 297 1 ? 6  
HELX_P HELX_P2  2  PRO A 169 ? GLY A 171 ? PRO A 361 GLY A 363 5 ? 3  
HELX_P HELX_P3  3  THR A 183 ? MET A 190 ? THR A 375 MET A 382 1 ? 8  
HELX_P HELX_P4  4  PRO A 399 ? ARG A 403 ? PRO A 591 ARG A 595 5 ? 5  
HELX_P HELX_P5  5  SER A 414 ? CYS A 420 ? SER A 606 CYS A 612 1 ? 7  
HELX_P HELX_P6  6  ASN B 100 ? GLY B 105 ? ASN B 292 GLY B 297 1 ? 6  
HELX_P HELX_P7  7  THR B 183 ? GLU B 189 ? THR B 375 GLU B 381 1 ? 7  
HELX_P HELX_P8  8  SER B 376 ? HIS B 383 ? SER B 568 HIS B 575 1 ? 8  
HELX_P HELX_P9  9  PRO B 399 ? ARG B 403 ? PRO B 591 ARG B 595 5 ? 5  
HELX_P HELX_P10 10 SER B 414 ? CYS B 420 ? SER B 606 CYS B 612 1 ? 7  
HELX_P HELX_P11 11 GLY C 65  ? ASP C 67  ? GLY H 93  ASP H 95  5 ? 3  
HELX_P HELX_P12 12 THR C 71  ? TRP C 89  ? THR H 99  TRP H 117 1 ? 19 
HELX_P HELX_P13 13 ASP C 126 ? SER C 128 ? ASP H 154 SER H 156 5 ? 3  
HELX_P HELX_P14 14 LYS C 129 ? GLY C 141 ? LYS H 157 GLY H 169 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 24  SG  ? ? ? 1_555 A CYS 344 SG ? ? A CYS 216 A CYS 536 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf2  disulf ? ? A CYS 26  SG  ? ? ? 1_555 A CYS 351 SG ? ? A CYS 218 A CYS 543 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf3  disulf ? ? A CYS 210 SG  ? ? ? 1_555 A CYS 432 SG ? ? A CYS 402 A CYS 624 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf4  disulf ? ? A CYS 243 SG  ? ? ? 1_555 A CYS 260 SG ? ? A CYS 435 A CYS 452 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf5  disulf ? ? A CYS 308 SG  ? ? ? 1_555 A CYS 402 SG ? ? A CYS 500 A CYS 594 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf6  disulf ? ? A CYS 416 SG  ? ? ? 1_555 A CYS 425 SG ? ? A CYS 608 A CYS 617 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf7  disulf ? ? A CYS 420 SG  ? ? ? 1_555 A CYS 431 SG ? ? A CYS 612 A CYS 623 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf8  disulf ? ? A CYS 433 SG  ? ? ? 1_555 A CYS 442 SG ? ? A CYS 625 A CYS 634 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf9  disulf ? ? A CYS 447 SG  ? ? ? 1_555 A CYS 457 SG ? ? A CYS 639 A CYS 649 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf10 disulf ? ? A CYS 451 SG  ? ? ? 1_555 A CYS 463 SG ? ? A CYS 643 A CYS 655 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf11 disulf ? ? A CYS 465 SG  ? ? ? 1_555 A CYS 474 SG ? ? A CYS 657 A CYS 666 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf12 disulf ? ? B CYS 24  SG  ? ? ? 1_555 B CYS 344 SG ? ? B CYS 216 B CYS 536 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf13 disulf ? ? B CYS 26  SG  ? ? ? 1_555 B CYS 351 SG ? ? B CYS 218 B CYS 543 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf14 disulf ? ? B CYS 210 SG  ? ? ? 1_555 B CYS 432 SG ? ? B CYS 402 B CYS 624 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf15 disulf ? ? B CYS 243 SG  ? ? ? 1_555 B CYS 260 SG ? ? B CYS 435 B CYS 452 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf16 disulf ? ? B CYS 308 SG  ? ? ? 1_555 B CYS 402 SG ? ? B CYS 500 B CYS 594 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf17 disulf ? ? B CYS 416 SG  ? ? ? 1_555 B CYS 425 SG ? ? B CYS 608 B CYS 617 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf18 disulf ? ? B CYS 420 SG  ? ? ? 1_555 B CYS 431 SG ? ? B CYS 612 B CYS 623 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf19 disulf ? ? B CYS 433 SG  ? ? ? 1_555 B CYS 442 SG ? ? B CYS 625 B CYS 634 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf20 disulf ? ? B CYS 447 SG  ? ? ? 1_555 B CYS 457 SG ? ? B CYS 639 B CYS 649 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf21 disulf ? ? B CYS 451 SG  ? ? ? 1_555 B CYS 463 SG ? ? B CYS 643 B CYS 655 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf22 disulf ? ? B CYS 465 SG  ? ? ? 1_555 B CYS 474 SG ? ? B CYS 657 B CYS 666 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1  metalc ? ? B ASP 191 OD2 ? ? ? 1_555 E ZN  .   ZN ? ? B ASP 383 H ZN  400 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc2  metalc ? ? C GLU 61  OE1 ? ? ? 1_555 F CA  .   CA ? ? H GLU 89  H CA  401 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc3  metalc ? ? C GLU 61  OE2 ? ? ? 1_555 F CA  .   CA ? ? H GLU 89  H CA  401 1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc4  metalc ? ? C GLU 62  OE1 ? ? ? 1_555 F CA  .   CA ? ? H GLU 90  H CA  401 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc5  metalc ? ? C GLU 62  OE2 ? ? ? 1_555 F CA  .   CA ? ? H GLU 90  H CA  401 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc6  metalc ? ? C GLU 62  OE2 ? ? ? 1_555 G CA  .   CA ? ? H GLU 90  H CA  402 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc7  metalc ? ? C ASP 67  OD1 ? ? ? 1_555 F CA  .   CA ? ? H ASP 95  H CA  401 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc8  metalc ? ? C ASP 67  OD2 ? ? ? 1_555 F CA  .   CA ? ? H ASP 95  H CA  401 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc9  metalc ? ? C THR 97  O   ? ? ? 1_555 F CA  .   CA ? ? H THR 125 H CA  401 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc10 metalc ? ? C GLU 98  OE1 ? ? ? 1_555 G CA  .   CA ? ? H GLU 126 H CA  402 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc11 metalc ? ? C GLU 98  OE2 ? ? ? 1_555 F CA  .   CA ? ? H GLU 126 H CA  401 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc12 metalc ? ? C GLU 98  OE2 ? ? ? 1_555 G CA  .   CA ? ? H GLU 126 H CA  402 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc13 metalc ? ? C ASP 101 OD1 ? ? ? 1_555 G CA  .   CA ? ? H ASP 129 H CA  402 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc14 metalc ? ? C ASP 103 OD2 ? ? ? 1_555 G CA  .   CA ? ? H ASP 131 H CA  402 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc15 metalc ? ? C HIS 112 NE2 ? ? ? 1_555 E ZN  .   ZN ? ? H HIS 140 H ZN  400 1_555 ? ? ? ? ? ? ? 2.069 ? 
metalc16 metalc ? ? C ASP 119 OD1 ? ? ? 1_555 E ZN  .   ZN ? ? H ASP 147 H ZN  400 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc17 metalc ? ? C HIS 154 ND1 ? ? ? 1_555 E ZN  .   ZN ? ? H HIS 182 H ZN  400 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc18 metalc ? ? A ASP 191 OD1 ? ? ? 1_555 D ZN  .   ZN ? ? A ASP 383 A ZN  902 1_555 ? ? ? ? ? ? ? 2.562 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ILE 
_struct_mon_prot_cis.label_seq_id           20 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ILE 
_struct_mon_prot_cis.auth_seq_id            48 
_struct_mon_prot_cis.auth_asym_id           H 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    21 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     49 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    H 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       3.29 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
H ? 2 ? 
I ? 4 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
M ? 4 ? 
N ? 4 ? 
O ? 2 ? 
P ? 2 ? 
Q ? 2 ? 
R ? 6 ? 
S ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
R 5 6 ? parallel      
S 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 26  ? LEU A 34  ? CYS A 218 LEU A 226 
A 2 GLY A 385 ? VAL A 391 ? GLY A 577 VAL A 583 
A 3 VAL A 370 ? SER A 375 ? VAL A 562 SER A 567 
A 4 HIS A 358 ? GLU A 364 ? HIS A 550 GLU A 556 
B 1 PRO A 37  ? LEU A 41  ? PRO A 229 LEU A 233 
B 2 LEU A 50  ? GLU A 54  ? LEU A 242 GLU A 246 
B 3 TYR A 58  ? LEU A 62  ? TYR A 250 LEU A 254 
B 4 LEU A 74  ? ASP A 75  ? LEU A 266 ASP A 267 
C 1 LEU A 92  ? PHE A 97  ? LEU A 284 PHE A 289 
C 2 LYS A 106 ? THR A 113 ? LYS A 298 THR A 305 
C 3 HIS A 125 ? VAL A 134 ? HIS A 317 VAL A 326 
C 4 VAL A 142 ? GLU A 155 ? VAL A 334 GLU A 347 
D 1 GLY A 162 ? PHE A 167 ? GLY A 354 PHE A 359 
D 2 LEU A 173 ? LEU A 177 ? LEU A 365 LEU A 369 
D 3 SER A 199 ? LEU A 203 ? SER A 391 LEU A 395 
D 4 VAL A 232 ? HIS A 235 ? VAL A 424 HIS A 427 
E 1 ALA A 244 ? ASP A 246 ? ALA A 436 ASP A 438 
E 2 THR A 257 ? ASP A 262 ? THR A 449 ASP A 454 
E 3 SER A 270 ? GLN A 275 ? SER A 462 GLN A 467 
E 4 LEU A 289 ? PHE A 291 ? LEU A 481 PHE A 483 
F 1 GLY A 301 ? VAL A 304 ? GLY A 493 VAL A 496 
F 2 TYR A 317 ? GLY A 320 ? TYR A 509 GLY A 512 
F 3 PHE A 326 ? GLN A 331 ? PHE A 518 GLN A 523 
F 4 TRP A 338 ? GLU A 340 ? TRP A 530 GLU A 532 
G 1 TRP A 437 ? GLU A 438 ? TRP A 629 GLU A 630 
G 2 THR A 444 ? ALA A 445 ? THR A 636 ALA A 637 
H 1 VAL A 456 ? ARG A 459 ? VAL A 648 ARG A 651 
H 2 LYS A 462 ? LEU A 464 ? LYS A 654 LEU A 656 
I 1 CYS B 26  ? LEU B 34  ? CYS B 218 LEU B 226 
I 2 GLY B 385 ? VAL B 391 ? GLY B 577 VAL B 583 
I 3 VAL B 370 ? SER B 375 ? VAL B 562 SER B 567 
I 4 HIS B 358 ? GLU B 364 ? HIS B 550 GLU B 556 
J 1 PRO B 37  ? LEU B 41  ? PRO B 229 LEU B 233 
J 2 LEU B 50  ? GLU B 54  ? LEU B 242 GLU B 246 
J 3 TYR B 58  ? LEU B 62  ? TYR B 250 LEU B 254 
J 4 LEU B 74  ? ASP B 75  ? LEU B 266 ASP B 267 
K 1 LEU B 92  ? PHE B 97  ? LEU B 284 PHE B 289 
K 2 LYS B 106 ? THR B 113 ? LYS B 298 THR B 305 
K 3 HIS B 125 ? VAL B 134 ? HIS B 317 VAL B 326 
K 4 VAL B 142 ? GLU B 155 ? VAL B 334 GLU B 347 
L 1 GLY B 162 ? PHE B 167 ? GLY B 354 PHE B 359 
L 2 LEU B 173 ? LEU B 177 ? LEU B 365 LEU B 369 
L 3 SER B 199 ? LEU B 203 ? SER B 391 LEU B 395 
L 4 VAL B 232 ? HIS B 235 ? VAL B 424 HIS B 427 
M 1 ALA B 244 ? ASP B 246 ? ALA B 436 ASP B 438 
M 2 THR B 257 ? ASP B 262 ? THR B 449 ASP B 454 
M 3 SER B 270 ? GLN B 275 ? SER B 462 GLN B 467 
M 4 LEU B 289 ? PHE B 291 ? LEU B 481 PHE B 483 
N 1 GLY B 301 ? VAL B 304 ? GLY B 493 VAL B 496 
N 2 TYR B 317 ? GLY B 320 ? TYR B 509 GLY B 512 
N 3 PHE B 326 ? GLN B 331 ? PHE B 518 GLN B 523 
N 4 TRP B 338 ? LEU B 343 ? TRP B 530 LEU B 535 
O 1 GLY B 423 ? CYS B 425 ? GLY B 615 CYS B 617 
O 2 CYS B 431 ? CYS B 433 ? CYS B 623 CYS B 625 
P 1 TRP B 437 ? GLU B 438 ? TRP B 629 GLU B 630 
P 2 THR B 444 ? ALA B 445 ? THR B 636 ALA B 637 
Q 1 VAL B 456 ? ARG B 459 ? VAL B 648 ARG B 651 
Q 2 LYS B 462 ? LEU B 464 ? LYS B 654 LEU B 656 
R 1 PHE C 19  ? ILE C 20  ? PHE H 47  ILE H 48  
R 2 TRP C 144 ? TYR C 146 ? TRP H 172 TYR H 174 
R 3 ILE C 153 ? SER C 156 ? ILE H 181 SER H 184 
R 4 ALA C 117 ? THR C 122 ? ALA H 145 THR H 150 
R 5 LEU C 94  ? GLU C 98  ? LEU H 122 GLU H 126 
R 6 ILE C 56  ? PHE C 58  ? ILE H 84  PHE H 86  
S 1 THR C 49  ? PRO C 50  ? THR H 77  PRO H 78  
S 2 LEU C 69  ? MET C 70  ? LEU H 97  MET H 98  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 26  ? N CYS A 218 O VAL A 391 ? O VAL A 583 
A 2 3 O TYR A 388 ? O TYR A 580 N ILE A 372 ? N ILE A 564 
A 3 4 O SER A 375 ? O SER A 567 N HIS A 358 ? N HIS A 550 
B 1 2 N LEU A 41  ? N LEU A 233 O PHE A 51  ? O PHE A 243 
B 2 3 N LEU A 50  ? N LEU A 242 O LEU A 62  ? O LEU A 254 
B 3 4 N VAL A 59  ? N VAL A 251 O LEU A 74  ? O LEU A 266 
C 1 2 N SER A 94  ? N SER A 286 O SER A 110 ? O SER A 302 
C 2 3 N TYR A 111 ? N TYR A 303 O ARG A 128 ? O ARG A 320 
C 3 4 N VAL A 129 ? N VAL A 321 O PHE A 150 ? O PHE A 342 
D 1 2 N LEU A 166 ? N LEU A 358 O TYR A 174 ? O TYR A 366 
D 2 3 N LEU A 173 ? N LEU A 365 O LEU A 203 ? O LEU A 395 
D 3 4 N VAL A 200 ? N VAL A 392 O PHE A 233 ? O PHE A 425 
E 1 2 N ASP A 246 ? N ASP A 438 O THR A 257 ? O THR A 449 
E 2 3 N CYS A 260 ? N CYS A 452 O ARG A 272 ? O ARG A 464 
E 3 4 N ALA A 271 ? N ALA A 463 O PHE A 291 ? O PHE A 483 
F 1 2 N PHE A 303 ? N PHE A 495 O VAL A 318 ? O VAL A 510 
F 2 3 N PHE A 319 ? N PHE A 511 O LEU A 327 ? O LEU A 519 
F 3 4 N GLN A 330 ? N GLN A 522 O GLN A 339 ? O GLN A 531 
G 1 2 N GLU A 438 ? N GLU A 630 O THR A 444 ? O THR A 636 
H 1 2 N VAL A 456 ? N VAL A 648 O LEU A 464 ? O LEU A 656 
I 1 2 N LEU B 34  ? N LEU B 226 O GLY B 385 ? O GLY B 577 
I 2 3 O TYR B 388 ? O TYR B 580 N ILE B 372 ? N ILE B 564 
I 3 4 O LEU B 373 ? O LEU B 565 N LEU B 360 ? N LEU B 552 
J 1 2 N LEU B 41  ? N LEU B 233 O PHE B 51  ? O PHE B 243 
J 2 3 N GLU B 54  ? N GLU B 246 O TYR B 58  ? O TYR B 250 
J 3 4 N VAL B 59  ? N VAL B 251 O LEU B 74  ? O LEU B 266 
K 1 2 N LEU B 93  ? N LEU B 285 O SER B 110 ? O SER B 302 
K 2 3 N TYR B 111 ? N TYR B 303 O ARG B 128 ? O ARG B 320 
K 3 4 N GLU B 131 ? N GLU B 323 O ARG B 148 ? O ARG B 340 
L 1 2 N LEU B 166 ? N LEU B 358 O TYR B 174 ? O TYR B 366 
L 2 3 N LEU B 173 ? N LEU B 365 O LEU B 203 ? O LEU B 395 
L 3 4 N VAL B 200 ? N VAL B 392 O PHE B 233 ? O PHE B 425 
M 1 2 N ASP B 246 ? N ASP B 438 O THR B 257 ? O THR B 449 
M 2 3 N ASP B 262 ? N ASP B 454 O SER B 270 ? O SER B 462 
M 3 4 N ALA B 271 ? N ALA B 463 O PHE B 291 ? O PHE B 483 
N 1 2 N PHE B 303 ? N PHE B 495 O VAL B 318 ? O VAL B 510 
N 2 3 N PHE B 319 ? N PHE B 511 O LEU B 327 ? O LEU B 519 
N 3 4 N THR B 328 ? N THR B 520 O LYS B 341 ? O LYS B 533 
O 1 2 N TYR B 424 ? N TYR B 616 O CYS B 432 ? O CYS B 624 
P 1 2 N GLU B 438 ? N GLU B 630 O THR B 444 ? O THR B 636 
Q 1 2 N VAL B 456 ? N VAL B 648 O LEU B 464 ? O LEU B 656 
R 1 2 N ILE C 20  ? N ILE H 48  O VAL C 145 ? O VAL H 173 
R 2 3 N TYR C 146 ? N TYR H 174 O HIS C 154 ? O HIS H 182 
R 3 4 O ILE C 153 ? O ILE H 181 N ILE C 120 ? N ILE H 148 
R 4 5 O THR C 121 ? O THR H 149 N ARG C 95  ? N ARG H 123 
R 5 6 O VAL C 96  ? O VAL H 124 N ILE C 57  ? N ILE H 85  
S 1 2 N THR C 49  ? N THR H 77  O MET C 70  ? O MET H 98  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN H 400' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA H 401' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA H 402' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ZN A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP B 191 ? ASP B 383 . ? 1_555 ? 
2  AC1 4 HIS C 112 ? HIS H 140 . ? 1_555 ? 
3  AC1 4 ASP C 119 ? ASP H 147 . ? 1_555 ? 
4  AC1 4 HIS C 154 ? HIS H 182 . ? 1_555 ? 
5  AC2 5 GLU C 61  ? GLU H 89  . ? 1_555 ? 
6  AC2 5 GLU C 62  ? GLU H 90  . ? 1_555 ? 
7  AC2 5 ASP C 67  ? ASP H 95  . ? 1_555 ? 
8  AC2 5 THR C 97  ? THR H 125 . ? 1_555 ? 
9  AC2 5 GLU C 98  ? GLU H 126 . ? 1_555 ? 
10 AC3 4 GLU C 62  ? GLU H 90  . ? 1_555 ? 
11 AC3 4 GLU C 98  ? GLU H 126 . ? 1_555 ? 
12 AC3 4 ASP C 101 ? ASP H 129 . ? 1_555 ? 
13 AC3 4 ASP C 103 ? ASP H 131 . ? 1_555 ? 
14 AC4 1 ASP A 191 ? ASP A 383 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3HO5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3HO5 
_atom_sites.fract_transf_matrix[1][1]   0.009841 
_atom_sites.fract_transf_matrix[1][2]   0.005682 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011363 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003302 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 22  ? -9.620  21.274 70.320  1.00 123.07 ? 214 HIS A N   1 
ATOM   2    C  CA  . HIS A 1 22  ? -9.462  22.268 69.218  1.00 122.43 ? 214 HIS A CA  1 
ATOM   3    C  C   . HIS A 1 22  ? -8.593  21.702 68.094  1.00 115.38 ? 214 HIS A C   1 
ATOM   4    O  O   . HIS A 1 22  ? -7.945  20.667 68.263  1.00 111.14 ? 214 HIS A O   1 
ATOM   5    C  CB  . HIS A 1 22  ? -8.847  23.566 69.756  1.00 130.75 ? 214 HIS A CB  1 
ATOM   6    C  CG  . HIS A 1 22  ? -9.634  24.797 69.419  1.00 137.67 ? 214 HIS A CG  1 
ATOM   7    N  ND1 . HIS A 1 22  ? -10.040 25.098 68.135  1.00 140.80 ? 214 HIS A ND1 1 
ATOM   8    C  CD2 . HIS A 1 22  ? -10.088 25.805 70.203  1.00 138.95 ? 214 HIS A CD2 1 
ATOM   9    C  CE1 . HIS A 1 22  ? -10.712 26.236 68.143  1.00 141.79 ? 214 HIS A CE1 1 
ATOM   10   N  NE2 . HIS A 1 22  ? -10.755 26.686 69.385  1.00 141.60 ? 214 HIS A NE2 1 
ATOM   11   N  N   . ASN A 1 23  ? -8.577  22.383 66.950  1.00 111.60 ? 215 ASN A N   1 
ATOM   12   C  CA  . ASN A 1 23  ? -7.804  21.923 65.797  1.00 108.13 ? 215 ASN A CA  1 
ATOM   13   C  C   . ASN A 1 23  ? -6.713  22.886 65.320  1.00 105.08 ? 215 ASN A C   1 
ATOM   14   O  O   . ASN A 1 23  ? -6.251  22.801 64.176  1.00 105.33 ? 215 ASN A O   1 
ATOM   15   C  CB  . ASN A 1 23  ? -8.743  21.557 64.650  1.00 108.75 ? 215 ASN A CB  1 
ATOM   16   C  CG  . ASN A 1 23  ? -9.508  20.271 64.914  1.00 110.13 ? 215 ASN A CG  1 
ATOM   17   O  OD1 . ASN A 1 23  ? -8.953  19.287 65.411  1.00 109.75 ? 215 ASN A OD1 1 
ATOM   18   N  ND2 . ASN A 1 23  ? -10.790 20.272 64.571  1.00 111.63 ? 215 ASN A ND2 1 
ATOM   19   N  N   . CYS A 1 24  ? -6.295  23.784 66.210  1.00 99.69  ? 216 CYS A N   1 
ATOM   20   C  CA  . CYS A 1 24  ? -5.299  24.791 65.884  1.00 95.99  ? 216 CYS A CA  1 
ATOM   21   C  C   . CYS A 1 24  ? -3.904  24.204 65.890  1.00 94.09  ? 216 CYS A C   1 
ATOM   22   O  O   . CYS A 1 24  ? -3.661  23.165 66.501  1.00 94.24  ? 216 CYS A O   1 
ATOM   23   C  CB  . CYS A 1 24  ? -5.355  25.936 66.895  1.00 99.65  ? 216 CYS A CB  1 
ATOM   24   S  SG  . CYS A 1 24  ? -6.791  27.023 66.776  1.00 104.03 ? 216 CYS A SG  1 
ATOM   25   N  N   . PHE A 1 25  ? -2.981  24.879 65.216  1.00 92.78  ? 217 PHE A N   1 
ATOM   26   C  CA  . PHE A 1 25  ? -1.567  24.555 65.358  1.00 90.92  ? 217 PHE A CA  1 
ATOM   27   C  C   . PHE A 1 25  ? -0.907  25.518 66.338  1.00 92.75  ? 217 PHE A C   1 
ATOM   28   O  O   . PHE A 1 25  ? -1.588  26.312 66.993  1.00 91.45  ? 217 PHE A O   1 
ATOM   29   C  CB  . PHE A 1 25  ? -0.864  24.480 63.999  1.00 87.54  ? 217 PHE A CB  1 
ATOM   30   C  CG  . PHE A 1 25  ? -1.203  23.237 63.227  1.00 85.14  ? 217 PHE A CG  1 
ATOM   31   C  CD1 . PHE A 1 25  ? -2.445  23.091 62.631  1.00 87.23  ? 217 PHE A CD1 1 
ATOM   32   C  CD2 . PHE A 1 25  ? -0.295  22.195 63.130  1.00 83.81  ? 217 PHE A CD2 1 
ATOM   33   C  CE1 . PHE A 1 25  ? -2.772  21.922 61.943  1.00 89.05  ? 217 PHE A CE1 1 
ATOM   34   C  CE2 . PHE A 1 25  ? -0.607  21.031 62.433  1.00 83.00  ? 217 PHE A CE2 1 
ATOM   35   C  CZ  . PHE A 1 25  ? -1.841  20.895 61.844  1.00 86.71  ? 217 PHE A CZ  1 
ATOM   36   N  N   . CYS A 1 26  ? 0.413   25.449 66.426  1.00 96.57  ? 218 CYS A N   1 
ATOM   37   C  CA  . CYS A 1 26  ? 1.126   25.869 67.619  1.00 95.30  ? 218 CYS A CA  1 
ATOM   38   C  C   . CYS A 1 26  ? 2.533   26.342 67.248  1.00 97.81  ? 218 CYS A C   1 
ATOM   39   O  O   . CYS A 1 26  ? 3.274   25.598 66.588  1.00 99.69  ? 218 CYS A O   1 
ATOM   40   C  CB  . CYS A 1 26  ? 1.247   24.626 68.475  1.00 96.84  ? 218 CYS A CB  1 
ATOM   41   S  SG  . CYS A 1 26  ? 1.495   24.882 70.158  1.00 102.74 ? 218 CYS A SG  1 
ATOM   42   N  N   . ILE A 1 27  ? 2.933   27.551 67.639  1.00 95.49  ? 219 ILE A N   1 
ATOM   43   C  CA  . ILE A 1 27  ? 4.323   27.951 67.330  1.00 96.44  ? 219 ILE A CA  1 
ATOM   44   C  C   . ILE A 1 27  ? 5.236   28.058 68.540  1.00 93.09  ? 219 ILE A C   1 
ATOM   45   O  O   . ILE A 1 27  ? 4.798   28.438 69.627  1.00 97.72  ? 219 ILE A O   1 
ATOM   46   C  CB  . ILE A 1 27  ? 4.452   29.186 66.404  1.00 98.44  ? 219 ILE A CB  1 
ATOM   47   C  CG1 . ILE A 1 27  ? 3.836   30.423 67.043  1.00 101.86 ? 219 ILE A CG1 1 
ATOM   48   C  CG2 . ILE A 1 27  ? 3.827   28.882 65.027  1.00 96.92  ? 219 ILE A CG2 1 
ATOM   49   C  CD1 . ILE A 1 27  ? 2.356   30.635 66.662  1.00 106.49 ? 219 ILE A CD1 1 
ATOM   50   N  N   . GLN A 1 28  ? 6.497   27.689 68.327  1.00 88.37  ? 220 GLN A N   1 
ATOM   51   C  CA  . GLN A 1 28  ? 7.499   27.575 69.385  1.00 89.74  ? 220 GLN A CA  1 
ATOM   52   C  C   . GLN A 1 28  ? 8.809   28.278 68.979  1.00 93.56  ? 220 GLN A C   1 
ATOM   53   O  O   . GLN A 1 28  ? 9.345   28.042 67.882  1.00 94.30  ? 220 GLN A O   1 
ATOM   54   C  CB  . GLN A 1 28  ? 7.773   26.097 69.663  1.00 89.33  ? 220 GLN A CB  1 
ATOM   55   C  CG  . GLN A 1 28  ? 8.560   25.840 70.923  1.00 94.27  ? 220 GLN A CG  1 
ATOM   56   C  CD  . GLN A 1 28  ? 7.676   25.706 72.141  1.00 100.74 ? 220 GLN A CD  1 
ATOM   57   O  OE1 . GLN A 1 28  ? 6.818   24.820 72.199  1.00 104.17 ? 220 GLN A OE1 1 
ATOM   58   N  NE2 . GLN A 1 28  ? 7.885   26.575 73.134  1.00 103.01 ? 220 GLN A NE2 1 
ATOM   59   N  N   . GLU A 1 29  ? 9.336   29.127 69.860  1.00 92.34  ? 221 GLU A N   1 
ATOM   60   C  CA  . GLU A 1 29  ? 10.565  29.848 69.544  1.00 90.75  ? 221 GLU A CA  1 
ATOM   61   C  C   . GLU A 1 29  ? 11.755  28.906 69.602  1.00 90.08  ? 221 GLU A C   1 
ATOM   62   O  O   . GLU A 1 29  ? 11.984  28.272 70.629  1.00 91.07  ? 221 GLU A O   1 
ATOM   63   C  CB  . GLU A 1 29  ? 10.764  31.009 70.500  1.00 88.49  ? 221 GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 29  ? 11.779  32.027 70.036  1.00 94.56  ? 221 GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 29  ? 11.927  33.189 71.012  1.00 103.20 ? 221 GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 29  ? 10.900  33.815 71.379  1.00 106.21 ? 221 GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 29  ? 13.077  33.480 71.409  1.00 106.11 ? 221 GLU A OE2 1 
ATOM   68   N  N   . VAL A 1 30  ? 12.493  28.795 68.497  1.00 88.14  ? 222 VAL A N   1 
ATOM   69   C  CA  . VAL A 1 30  ? 13.712  27.980 68.491  1.00 89.84  ? 222 VAL A CA  1 
ATOM   70   C  C   . VAL A 1 30  ? 14.976  28.801 68.747  1.00 91.18  ? 222 VAL A C   1 
ATOM   71   O  O   . VAL A 1 30  ? 15.772  28.438 69.607  1.00 88.27  ? 222 VAL A O   1 
ATOM   72   C  CB  . VAL A 1 30  ? 13.909  27.176 67.194  1.00 88.81  ? 222 VAL A CB  1 
ATOM   73   C  CG1 . VAL A 1 30  ? 15.073  26.224 67.366  1.00 92.23  ? 222 VAL A CG1 1 
ATOM   74   C  CG2 . VAL A 1 30  ? 12.689  26.385 66.866  1.00 93.27  ? 222 VAL A CG2 1 
ATOM   75   N  N   . VAL A 1 31  ? 15.150  29.887 67.984  1.00 94.03  ? 223 VAL A N   1 
ATOM   76   C  CA  . VAL A 1 31  ? 16.352  30.736 68.020  1.00 93.38  ? 223 VAL A CA  1 
ATOM   77   C  C   . VAL A 1 31  ? 15.965  32.207 67.866  1.00 93.74  ? 223 VAL A C   1 
ATOM   78   O  O   . VAL A 1 31  ? 15.008  32.532 67.153  1.00 89.91  ? 223 VAL A O   1 
ATOM   79   C  CB  . VAL A 1 31  ? 17.341  30.360 66.879  1.00 94.48  ? 223 VAL A CB  1 
ATOM   80   C  CG1 . VAL A 1 31  ? 18.403  31.445 66.661  1.00 92.87  ? 223 VAL A CG1 1 
ATOM   81   C  CG2 . VAL A 1 31  ? 18.016  29.037 67.166  1.00 97.56  ? 223 VAL A CG2 1 
ATOM   82   N  N   . SER A 1 32  ? 16.713  33.088 68.532  1.00 94.90  ? 224 SER A N   1 
ATOM   83   C  CA  . SER A 1 32  ? 16.549  34.531 68.352  1.00 95.27  ? 224 SER A CA  1 
ATOM   84   C  C   . SER A 1 32  ? 17.887  35.219 68.084  1.00 94.52  ? 224 SER A C   1 
ATOM   85   O  O   . SER A 1 32  ? 18.900  34.560 67.880  1.00 97.74  ? 224 SER A O   1 
ATOM   86   C  CB  . SER A 1 32  ? 15.880  35.142 69.569  1.00 98.10  ? 224 SER A CB  1 
ATOM   87   O  OG  . SER A 1 32  ? 16.616  34.811 70.727  1.00 106.34 ? 224 SER A OG  1 
ATOM   88   N  N   . GLY A 1 33  ? 17.877  36.548 68.060  1.00 91.53  ? 225 GLY A N   1 
ATOM   89   C  CA  . GLY A 1 33  ? 19.082  37.326 67.825  1.00 88.78  ? 225 GLY A CA  1 
ATOM   90   C  C   . GLY A 1 33  ? 19.699  37.184 66.449  1.00 91.23  ? 225 GLY A C   1 
ATOM   91   O  O   . GLY A 1 33  ? 20.875  37.494 66.263  1.00 97.38  ? 225 GLY A O   1 
ATOM   92   N  N   . LEU A 1 34  ? 18.910  36.717 65.488  1.00 89.18  ? 226 LEU A N   1 
ATOM   93   C  CA  . LEU A 1 34  ? 19.339  36.624 64.101  1.00 88.14  ? 226 LEU A CA  1 
ATOM   94   C  C   . LEU A 1 34  ? 19.252  37.986 63.397  1.00 91.34  ? 226 LEU A C   1 
ATOM   95   O  O   . LEU A 1 34  ? 18.593  38.906 63.884  1.00 90.40  ? 226 LEU A O   1 
ATOM   96   C  CB  . LEU A 1 34  ? 18.464  35.611 63.371  1.00 87.63  ? 226 LEU A CB  1 
ATOM   97   C  CG  . LEU A 1 34  ? 18.514  34.161 63.858  1.00 86.66  ? 226 LEU A CG  1 
ATOM   98   C  CD1 . LEU A 1 34  ? 17.217  33.461 63.498  1.00 83.46  ? 226 LEU A CD1 1 
ATOM   99   C  CD2 . LEU A 1 34  ? 19.740  33.404 63.309  1.00 82.55  ? 226 LEU A CD2 1 
ATOM   100  N  N   . ARG A 1 35  ? 19.920  38.120 62.256  1.00 93.98  ? 227 ARG A N   1 
ATOM   101  C  CA  . ARG A 1 35  ? 19.818  39.347 61.471  1.00 97.91  ? 227 ARG A CA  1 
ATOM   102  C  C   . ARG A 1 35  ? 18.942  39.066 60.257  1.00 98.45  ? 227 ARG A C   1 
ATOM   103  O  O   . ARG A 1 35  ? 19.270  38.189 59.464  1.00 103.46 ? 227 ARG A O   1 
ATOM   104  C  CB  . ARG A 1 35  ? 21.192  39.843 60.995  1.00 99.85  ? 227 ARG A CB  1 
ATOM   105  C  CG  . ARG A 1 35  ? 22.413  39.164 61.603  1.00 103.28 ? 227 ARG A CG  1 
ATOM   106  C  CD  . ARG A 1 35  ? 23.608  39.351 60.670  1.00 106.74 ? 227 ARG A CD  1 
ATOM   107  N  NE  . ARG A 1 35  ? 24.611  38.287 60.757  1.00 106.77 ? 227 ARG A NE  1 
ATOM   108  C  CZ  . ARG A 1 35  ? 25.878  38.476 61.117  1.00 107.22 ? 227 ARG A CZ  1 
ATOM   109  N  NH1 . ARG A 1 35  ? 26.307  39.689 61.437  1.00 106.69 ? 227 ARG A NH1 1 
ATOM   110  N  NH2 . ARG A 1 35  ? 26.722  37.451 61.158  1.00 107.81 ? 227 ARG A NH2 1 
ATOM   111  N  N   . GLN A 1 36  ? 17.843  39.808 60.113  1.00 95.22  ? 228 GLN A N   1 
ATOM   112  C  CA  . GLN A 1 36  ? 16.902  39.650 58.989  1.00 92.82  ? 228 GLN A CA  1 
ATOM   113  C  C   . GLN A 1 36  ? 16.981  38.287 58.313  1.00 89.99  ? 228 GLN A C   1 
ATOM   114  O  O   . GLN A 1 36  ? 17.656  38.136 57.302  1.00 90.18  ? 228 GLN A O   1 
ATOM   115  C  CB  . GLN A 1 36  ? 17.107  40.739 57.942  1.00 95.48  ? 228 GLN A CB  1 
ATOM   116  C  CG  . GLN A 1 36  ? 16.658  42.124 58.363  1.00 103.28 ? 228 GLN A CG  1 
ATOM   117  C  CD  . GLN A 1 36  ? 16.340  43.013 57.165  1.00 107.66 ? 228 GLN A CD  1 
ATOM   118  O  OE1 . GLN A 1 36  ? 16.964  44.069 56.968  1.00 106.71 ? 228 GLN A OE1 1 
ATOM   119  N  NE2 . GLN A 1 36  ? 15.370  42.580 56.347  1.00 106.72 ? 228 GLN A NE2 1 
ATOM   120  N  N   . PRO A 1 37  ? 16.309  37.280 58.880  1.00 91.20  ? 229 PRO A N   1 
ATOM   121  C  CA  . PRO A 1 37  ? 16.324  35.950 58.272  1.00 93.30  ? 229 PRO A CA  1 
ATOM   122  C  C   . PRO A 1 37  ? 15.553  35.882 56.945  1.00 95.68  ? 229 PRO A C   1 
ATOM   123  O  O   . PRO A 1 37  ? 14.596  36.630 56.734  1.00 98.49  ? 229 PRO A O   1 
ATOM   124  C  CB  . PRO A 1 37  ? 15.659  35.082 59.332  1.00 93.12  ? 229 PRO A CB  1 
ATOM   125  C  CG  . PRO A 1 37  ? 14.785  36.011 60.077  1.00 94.74  ? 229 PRO A CG  1 
ATOM   126  C  CD  . PRO A 1 37  ? 15.518  37.311 60.119  1.00 91.92  ? 229 PRO A CD  1 
ATOM   127  N  N   . VAL A 1 38  ? 15.982  34.986 56.065  1.00 93.47  ? 230 VAL A N   1 
ATOM   128  C  CA  . VAL A 1 38  ? 15.429  34.889 54.723  1.00 92.69  ? 230 VAL A CA  1 
ATOM   129  C  C   . VAL A 1 38  ? 14.694  33.566 54.574  1.00 92.67  ? 230 VAL A C   1 
ATOM   130  O  O   . VAL A 1 38  ? 13.677  33.491 53.888  1.00 93.87  ? 230 VAL A O   1 
ATOM   131  C  CB  . VAL A 1 38  ? 16.554  34.962 53.660  1.00 92.62  ? 230 VAL A CB  1 
ATOM   132  C  CG1 . VAL A 1 38  ? 15.991  35.119 52.245  1.00 93.13  ? 230 VAL A CG1 1 
ATOM   133  C  CG2 . VAL A 1 38  ? 17.468  36.102 53.968  1.00 94.76  ? 230 VAL A CG2 1 
ATOM   134  N  N   . GLY A 1 39  ? 15.229  32.534 55.224  1.00 92.98  ? 231 GLY A N   1 
ATOM   135  C  CA  . GLY A 1 39  ? 14.731  31.161 55.127  1.00 93.63  ? 231 GLY A CA  1 
ATOM   136  C  C   . GLY A 1 39  ? 15.683  30.222 55.849  1.00 95.71  ? 231 GLY A C   1 
ATOM   137  O  O   . GLY A 1 39  ? 16.681  30.666 56.413  1.00 101.29 ? 231 GLY A O   1 
ATOM   138  N  N   . ALA A 1 40  ? 15.381  28.927 55.849  1.00 94.68  ? 232 ALA A N   1 
ATOM   139  C  CA  . ALA A 1 40  ? 16.283  27.927 56.431  1.00 95.46  ? 232 ALA A CA  1 
ATOM   140  C  C   . ALA A 1 40  ? 16.054  26.565 55.791  1.00 99.05  ? 232 ALA A C   1 
ATOM   141  O  O   . ALA A 1 40  ? 14.919  26.219 55.443  1.00 102.84 ? 232 ALA A O   1 
ATOM   142  C  CB  . ALA A 1 40  ? 16.102  27.836 57.946  1.00 91.74  ? 232 ALA A CB  1 
ATOM   143  N  N   . LEU A 1 41  ? 17.124  25.793 55.631  1.00 95.89  ? 233 LEU A N   1 
ATOM   144  C  CA  . LEU A 1 41  ? 16.991  24.440 55.096  1.00 96.00  ? 233 LEU A CA  1 
ATOM   145  C  C   . LEU A 1 41  ? 18.046  23.490 55.661  1.00 97.19  ? 233 LEU A C   1 
ATOM   146  O  O   . LEU A 1 41  ? 18.881  23.889 56.483  1.00 96.64  ? 233 LEU A O   1 
ATOM   147  C  CB  . LEU A 1 41  ? 17.010  24.443 53.559  1.00 92.04  ? 233 LEU A CB  1 
ATOM   148  C  CG  . LEU A 1 41  ? 18.332  24.511 52.802  1.00 91.21  ? 233 LEU A CG  1 
ATOM   149  C  CD1 . LEU A 1 41  ? 18.098  24.169 51.349  1.00 93.77  ? 233 LEU A CD1 1 
ATOM   150  C  CD2 . LEU A 1 41  ? 18.978  25.886 52.926  1.00 96.61  ? 233 LEU A CD2 1 
ATOM   151  N  N   . HIS A 1 42  ? 17.989  22.237 55.218  1.00 94.34  ? 234 HIS A N   1 
ATOM   152  C  CA  . HIS A 1 42  ? 18.885  21.214 55.711  1.00 94.62  ? 234 HIS A CA  1 
ATOM   153  C  C   . HIS A 1 42  ? 19.803  20.724 54.607  1.00 96.32  ? 234 HIS A C   1 
ATOM   154  O  O   . HIS A 1 42  ? 19.569  20.971 53.424  1.00 96.29  ? 234 HIS A O   1 
ATOM   155  C  CB  . HIS A 1 42  ? 18.093  20.044 56.285  1.00 94.89  ? 234 HIS A CB  1 
ATOM   156  C  CG  . HIS A 1 42  ? 17.384  19.239 55.248  1.00 97.35  ? 234 HIS A CG  1 
ATOM   157  N  ND1 . HIS A 1 42  ? 16.038  19.377 54.992  1.00 102.33 ? 234 HIS A ND1 1 
ATOM   158  C  CD2 . HIS A 1 42  ? 17.834  18.298 54.388  1.00 97.15  ? 234 HIS A CD2 1 
ATOM   159  C  CE1 . HIS A 1 42  ? 15.686  18.545 54.027  1.00 101.31 ? 234 HIS A CE1 1 
ATOM   160  N  NE2 . HIS A 1 42  ? 16.760  17.883 53.641  1.00 99.84  ? 234 HIS A NE2 1 
ATOM   161  N  N   . SER A 1 43  ? 20.824  19.985 55.023  1.00 97.39  ? 235 SER A N   1 
ATOM   162  C  CA  . SER A 1 43  ? 21.914  19.563 54.166  1.00 95.03  ? 235 SER A CA  1 
ATOM   163  C  C   . SER A 1 43  ? 21.605  18.281 53.403  1.00 95.10  ? 235 SER A C   1 
ATOM   164  O  O   . SER A 1 43  ? 22.233  17.995 52.387  1.00 94.78  ? 235 SER A O   1 
ATOM   165  C  CB  . SER A 1 43  ? 23.148  19.353 55.035  1.00 95.99  ? 235 SER A CB  1 
ATOM   166  O  OG  . SER A 1 43  ? 24.239  18.931 54.256  1.00 100.03 ? 235 SER A OG  1 
ATOM   167  N  N   . GLY A 1 44  ? 20.646  17.508 53.911  1.00 96.79  ? 236 GLY A N   1 
ATOM   168  C  CA  . GLY A 1 44  ? 20.284  16.206 53.344  1.00 92.61  ? 236 GLY A CA  1 
ATOM   169  C  C   . GLY A 1 44  ? 21.352  15.152 53.556  1.00 92.01  ? 236 GLY A C   1 
ATOM   170  O  O   . GLY A 1 44  ? 21.354  14.118 52.888  1.00 94.27  ? 236 GLY A O   1 
ATOM   171  N  N   . ASP A 1 45  ? 22.255  15.404 54.496  1.00 91.41  ? 237 ASP A N   1 
ATOM   172  C  CA  . ASP A 1 45  ? 23.426  14.558 54.671  1.00 92.44  ? 237 ASP A CA  1 
ATOM   173  C  C   . ASP A 1 45  ? 23.380  13.638 55.894  1.00 94.64  ? 237 ASP A C   1 
ATOM   174  O  O   . ASP A 1 45  ? 24.310  12.856 56.114  1.00 96.74  ? 237 ASP A O   1 
ATOM   175  C  CB  . ASP A 1 45  ? 24.697  15.412 54.676  1.00 92.78  ? 237 ASP A CB  1 
ATOM   176  C  CG  . ASP A 1 45  ? 24.804  16.307 55.891  1.00 93.61  ? 237 ASP A CG  1 
ATOM   177  O  OD1 . ASP A 1 45  ? 23.781  16.575 56.557  1.00 94.08  ? 237 ASP A OD1 1 
ATOM   178  O  OD2 . ASP A 1 45  ? 25.933  16.758 56.169  1.00 96.19  ? 237 ASP A OD2 1 
ATOM   179  N  N   . GLY A 1 46  ? 22.310  13.729 56.682  1.00 93.06  ? 238 GLY A N   1 
ATOM   180  C  CA  . GLY A 1 46  ? 22.120  12.824 57.810  1.00 93.77  ? 238 GLY A CA  1 
ATOM   181  C  C   . GLY A 1 46  ? 22.312  13.499 59.145  1.00 97.28  ? 238 GLY A C   1 
ATOM   182  O  O   . GLY A 1 46  ? 21.672  13.128 60.134  1.00 100.06 ? 238 GLY A O   1 
ATOM   183  N  N   . SER A 1 47  ? 23.222  14.469 59.179  1.00 99.12  ? 239 SER A N   1 
ATOM   184  C  CA  . SER A 1 47  ? 23.321  15.396 60.297  1.00 100.60 ? 239 SER A CA  1 
ATOM   185  C  C   . SER A 1 47  ? 22.100  16.284 60.205  1.00 105.13 ? 239 SER A C   1 
ATOM   186  O  O   . SER A 1 47  ? 21.846  16.890 59.162  1.00 113.20 ? 239 SER A O   1 
ATOM   187  C  CB  . SER A 1 47  ? 24.575  16.256 60.174  1.00 98.44  ? 239 SER A CB  1 
ATOM   188  O  OG  . SER A 1 47  ? 24.508  17.112 59.041  1.00 92.90  ? 239 SER A OG  1 
ATOM   189  N  N   . GLN A 1 48  ? 21.329  16.363 61.273  1.00 102.34 ? 240 GLN A N   1 
ATOM   190  C  CA  . GLN A 1 48  ? 20.112  17.145 61.212  1.00 101.05 ? 240 GLN A CA  1 
ATOM   191  C  C   . GLN A 1 48  ? 20.436  18.623 61.439  1.00 101.05 ? 240 GLN A C   1 
ATOM   192  O  O   . GLN A 1 48  ? 19.766  19.320 62.205  1.00 105.12 ? 240 GLN A O   1 
ATOM   193  C  CB  . GLN A 1 48  ? 19.085  16.602 62.202  1.00 102.58 ? 240 GLN A CB  1 
ATOM   194  C  CG  . GLN A 1 48  ? 18.713  15.148 61.944  1.00 103.80 ? 240 GLN A CG  1 
ATOM   195  C  CD  . GLN A 1 48  ? 18.140  14.462 63.168  1.00 105.39 ? 240 GLN A CD  1 
ATOM   196  O  OE1 . GLN A 1 48  ? 17.736  15.121 64.132  1.00 107.62 ? 240 GLN A OE1 1 
ATOM   197  N  NE2 . GLN A 1 48  ? 18.094  13.130 63.135  1.00 103.49 ? 240 GLN A NE2 1 
ATOM   198  N  N   . ARG A 1 49  ? 21.490  19.080 60.768  1.00 97.96  ? 241 ARG A N   1 
ATOM   199  C  CA  . ARG A 1 49  ? 21.867  20.487 60.740  1.00 97.16  ? 241 ARG A CA  1 
ATOM   200  C  C   . ARG A 1 49  ? 20.774  21.308 60.078  1.00 98.82  ? 241 ARG A C   1 
ATOM   201  O  O   . ARG A 1 49  ? 20.061  20.816 59.200  1.00 101.25 ? 241 ARG A O   1 
ATOM   202  C  CB  . ARG A 1 49  ? 23.175  20.664 59.976  1.00 95.33  ? 241 ARG A CB  1 
ATOM   203  C  CG  . ARG A 1 49  ? 24.375  20.943 60.853  1.00 98.59  ? 241 ARG A CG  1 
ATOM   204  C  CD  . ARG A 1 49  ? 25.545  20.016 60.554  1.00 101.99 ? 241 ARG A CD  1 
ATOM   205  N  NE  . ARG A 1 49  ? 25.665  19.670 59.137  1.00 101.95 ? 241 ARG A NE  1 
ATOM   206  C  CZ  . ARG A 1 49  ? 26.592  20.154 58.321  1.00 101.71 ? 241 ARG A CZ  1 
ATOM   207  N  NH1 . ARG A 1 49  ? 27.493  21.013 58.767  1.00 102.35 ? 241 ARG A NH1 1 
ATOM   208  N  NH2 . ARG A 1 49  ? 26.625  19.770 57.054  1.00 103.28 ? 241 ARG A NH2 1 
ATOM   209  N  N   . LEU A 1 50  ? 20.629  22.551 60.520  1.00 96.23  ? 242 LEU A N   1 
ATOM   210  C  CA  . LEU A 1 50  ? 19.704  23.474 59.886  1.00 95.13  ? 242 LEU A CA  1 
ATOM   211  C  C   . LEU A 1 50  ? 20.456  24.747 59.543  1.00 95.56  ? 242 LEU A C   1 
ATOM   212  O  O   . LEU A 1 50  ? 21.030  25.400 60.412  1.00 95.95  ? 242 LEU A O   1 
ATOM   213  C  CB  . LEU A 1 50  ? 18.508  23.767 60.792  1.00 94.28  ? 242 LEU A CB  1 
ATOM   214  C  CG  . LEU A 1 50  ? 17.410  24.710 60.294  1.00 90.99  ? 242 LEU A CG  1 
ATOM   215  C  CD1 . LEU A 1 50  ? 16.648  24.122 59.131  1.00 87.15  ? 242 LEU A CD1 1 
ATOM   216  C  CD2 . LEU A 1 50  ? 16.472  24.996 61.430  1.00 92.85  ? 242 LEU A CD2 1 
ATOM   217  N  N   . PHE A 1 51  ? 20.456  25.076 58.260  1.00 94.74  ? 243 PHE A N   1 
ATOM   218  C  CA  . PHE A 1 51  ? 21.197  26.204 57.753  1.00 94.09  ? 243 PHE A CA  1 
ATOM   219  C  C   . PHE A 1 51  ? 20.242  27.361 57.580  1.00 95.64  ? 243 PHE A C   1 
ATOM   220  O  O   . PHE A 1 51  ? 19.306  27.272 56.779  1.00 102.49 ? 243 PHE A O   1 
ATOM   221  C  CB  . PHE A 1 51  ? 21.839  25.824 56.417  1.00 95.69  ? 243 PHE A CB  1 
ATOM   222  C  CG  . PHE A 1 51  ? 22.896  24.762 56.536  1.00 94.04  ? 243 PHE A CG  1 
ATOM   223  C  CD1 . PHE A 1 51  ? 22.547  23.416 56.587  1.00 94.28  ? 243 PHE A CD1 1 
ATOM   224  C  CD2 . PHE A 1 51  ? 24.236  25.110 56.612  1.00 92.93  ? 243 PHE A CD2 1 
ATOM   225  C  CE1 . PHE A 1 51  ? 23.513  22.436 56.706  1.00 94.83  ? 243 PHE A CE1 1 
ATOM   226  C  CE2 . PHE A 1 51  ? 25.209  24.136 56.727  1.00 95.57  ? 243 PHE A CE2 1 
ATOM   227  C  CZ  . PHE A 1 51  ? 24.846  22.793 56.776  1.00 96.15  ? 243 PHE A CZ  1 
ATOM   228  N  N   . ILE A 1 52  ? 20.455  28.436 58.338  1.00 91.68  ? 244 ILE A N   1 
ATOM   229  C  CA  . ILE A 1 52  ? 19.585  29.616 58.232  1.00 89.94  ? 244 ILE A CA  1 
ATOM   230  C  C   . ILE A 1 52  ? 20.218  30.820 57.515  1.00 92.43  ? 244 ILE A C   1 
ATOM   231  O  O   . ILE A 1 52  ? 21.322  31.255 57.851  1.00 93.74  ? 244 ILE A O   1 
ATOM   232  C  CB  . ILE A 1 52  ? 18.902  30.043 59.573  1.00 85.49  ? 244 ILE A CB  1 
ATOM   233  C  CG1 . ILE A 1 52  ? 18.981  31.549 59.732  1.00 91.39  ? 244 ILE A CG1 1 
ATOM   234  C  CG2 . ILE A 1 52  ? 19.496  29.377 60.810  1.00 77.97  ? 244 ILE A CG2 1 
ATOM   235  C  CD1 . ILE A 1 52  ? 17.953  32.098 60.660  1.00 101.35 ? 244 ILE A CD1 1 
ATOM   236  N  N   . LEU A 1 53  ? 19.485  31.350 56.535  1.00 93.15  ? 245 LEU A N   1 
ATOM   237  C  CA  . LEU A 1 53  ? 19.944  32.450 55.690  1.00 92.77  ? 245 LEU A CA  1 
ATOM   238  C  C   . LEU A 1 53  ? 19.630  33.809 56.299  1.00 93.95  ? 245 LEU A C   1 
ATOM   239  O  O   . LEU A 1 53  ? 18.531  34.034 56.803  1.00 97.71  ? 245 LEU A O   1 
ATOM   240  C  CB  . LEU A 1 53  ? 19.293  32.391 54.301  1.00 92.93  ? 245 LEU A CB  1 
ATOM   241  C  CG  . LEU A 1 53  ? 19.012  31.143 53.450  1.00 92.44  ? 245 LEU A CG  1 
ATOM   242  C  CD1 . LEU A 1 53  ? 19.173  31.520 51.989  1.00 90.39  ? 245 LEU A CD1 1 
ATOM   243  C  CD2 . LEU A 1 53  ? 19.906  29.956 53.767  1.00 95.03  ? 245 LEU A CD2 1 
ATOM   244  N  N   . GLU A 1 54  ? 20.597  34.713 56.227  1.00 92.07  ? 246 GLU A N   1 
ATOM   245  C  CA  . GLU A 1 54  ? 20.415  36.096 56.649  1.00 93.58  ? 246 GLU A CA  1 
ATOM   246  C  C   . GLU A 1 54  ? 20.649  37.037 55.455  1.00 93.94  ? 246 GLU A C   1 
ATOM   247  O  O   . GLU A 1 54  ? 21.554  36.810 54.644  1.00 92.16  ? 246 GLU A O   1 
ATOM   248  C  CB  . GLU A 1 54  ? 21.374  36.428 57.789  1.00 93.97  ? 246 GLU A CB  1 
ATOM   249  C  CG  . GLU A 1 54  ? 21.167  35.598 59.043  1.00 93.60  ? 246 GLU A CG  1 
ATOM   250  C  CD  . GLU A 1 54  ? 22.146  35.959 60.149  1.00 95.84  ? 246 GLU A CD  1 
ATOM   251  O  OE1 . GLU A 1 54  ? 21.692  36.171 61.294  1.00 96.87  ? 246 GLU A OE1 1 
ATOM   252  O  OE2 . GLU A 1 54  ? 23.367  36.040 59.877  1.00 97.31  ? 246 GLU A OE2 1 
ATOM   253  N  N   . LYS A 1 55  ? 19.847  38.099 55.364  1.00 92.67  ? 247 LYS A N   1 
ATOM   254  C  CA  . LYS A 1 55  ? 19.752  38.887 54.134  1.00 93.10  ? 247 LYS A CA  1 
ATOM   255  C  C   . LYS A 1 55  ? 21.020  39.649 53.770  1.00 95.69  ? 247 LYS A C   1 
ATOM   256  O  O   . LYS A 1 55  ? 21.255  39.938 52.596  1.00 96.67  ? 247 LYS A O   1 
ATOM   257  C  CB  . LYS A 1 55  ? 18.561  39.839 54.182  1.00 92.94  ? 247 LYS A CB  1 
ATOM   258  C  CG  . LYS A 1 55  ? 18.024  40.183 52.812  1.00 95.00  ? 247 LYS A CG  1 
ATOM   259  C  CD  . LYS A 1 55  ? 17.018  41.306 52.877  1.00 98.82  ? 247 LYS A CD  1 
ATOM   260  C  CE  . LYS A 1 55  ? 16.733  41.859 51.486  1.00 102.01 ? 247 LYS A CE  1 
ATOM   261  N  NZ  . LYS A 1 55  ? 15.416  42.557 51.439  1.00 104.44 ? 247 LYS A NZ  1 
ATOM   262  N  N   . GLU A 1 56  ? 21.835  39.978 54.766  1.00 94.44  ? 248 GLU A N   1 
ATOM   263  C  CA  . GLU A 1 56  ? 23.066  40.716 54.507  1.00 92.05  ? 248 GLU A CA  1 
ATOM   264  C  C   . GLU A 1 56  ? 24.105  39.838 53.808  1.00 91.77  ? 248 GLU A C   1 
ATOM   265  O  O   . GLU A 1 56  ? 25.038  40.354 53.184  1.00 93.97  ? 248 GLU A O   1 
ATOM   266  C  CB  . GLU A 1 56  ? 23.613  41.351 55.790  1.00 91.38  ? 248 GLU A CB  1 
ATOM   267  C  CG  . GLU A 1 56  ? 22.735  42.478 56.348  1.00 92.65  ? 248 GLU A CG  1 
ATOM   268  C  CD  . GLU A 1 56  ? 23.262  43.062 57.653  1.00 96.05  ? 248 GLU A CD  1 
ATOM   269  O  OE1 . GLU A 1 56  ? 23.365  42.323 58.655  1.00 99.97  ? 248 GLU A OE1 1 
ATOM   270  O  OE2 . GLU A 1 56  ? 23.563  44.273 57.686  1.00 99.35  ? 248 GLU A OE2 1 
ATOM   271  N  N   . GLY A 1 57  ? 23.919  38.518 53.893  1.00 90.51  ? 249 GLY A N   1 
ATOM   272  C  CA  . GLY A 1 57  ? 24.778  37.550 53.201  1.00 90.47  ? 249 GLY A CA  1 
ATOM   273  C  C   . GLY A 1 57  ? 25.512  36.556 54.090  1.00 90.67  ? 249 GLY A C   1 
ATOM   274  O  O   . GLY A 1 57  ? 26.717  36.339 53.928  1.00 85.73  ? 249 GLY A O   1 
ATOM   275  N  N   . TYR A 1 58  ? 24.781  35.948 55.024  1.00 93.67  ? 250 TYR A N   1 
ATOM   276  C  CA  . TYR A 1 58  ? 25.333  34.923 55.909  1.00 94.00  ? 250 TYR A CA  1 
ATOM   277  C  C   . TYR A 1 58  ? 24.469  33.666 55.901  1.00 94.48  ? 250 TYR A C   1 
ATOM   278  O  O   . TYR A 1 58  ? 23.247  33.748 55.820  1.00 95.77  ? 250 TYR A O   1 
ATOM   279  C  CB  . TYR A 1 58  ? 25.425  35.432 57.345  1.00 92.70  ? 250 TYR A CB  1 
ATOM   280  C  CG  . TYR A 1 58  ? 26.119  36.762 57.519  1.00 94.53  ? 250 TYR A CG  1 
ATOM   281  C  CD1 . TYR A 1 58  ? 25.410  37.959 57.408  1.00 95.96  ? 250 TYR A CD1 1 
ATOM   282  C  CD2 . TYR A 1 58  ? 27.479  36.828 57.833  1.00 92.93  ? 250 TYR A CD2 1 
ATOM   283  C  CE1 . TYR A 1 58  ? 26.044  39.189 57.582  1.00 96.02  ? 250 TYR A CE1 1 
ATOM   284  C  CE2 . TYR A 1 58  ? 28.119  38.051 58.013  1.00 91.55  ? 250 TYR A CE2 1 
ATOM   285  C  CZ  . TYR A 1 58  ? 27.399  39.226 57.885  1.00 93.40  ? 250 TYR A CZ  1 
ATOM   286  O  OH  . TYR A 1 58  ? 28.021  40.441 58.059  1.00 92.28  ? 250 TYR A OH  1 
ATOM   287  N  N   . VAL A 1 59  ? 25.110  32.505 55.983  1.00 94.64  ? 251 VAL A N   1 
ATOM   288  C  CA  . VAL A 1 59  ? 24.406  31.269 56.290  1.00 95.07  ? 251 VAL A CA  1 
ATOM   289  C  C   . VAL A 1 59  ? 24.977  30.720 57.594  1.00 95.53  ? 251 VAL A C   1 
ATOM   290  O  O   . VAL A 1 59  ? 26.159  30.387 57.669  1.00 97.13  ? 251 VAL A O   1 
ATOM   291  C  CB  . VAL A 1 59  ? 24.518  30.210 55.163  1.00 97.78  ? 251 VAL A CB  1 
ATOM   292  C  CG1 . VAL A 1 59  ? 23.734  28.961 55.526  1.00 98.41  ? 251 VAL A CG1 1 
ATOM   293  C  CG2 . VAL A 1 59  ? 24.018  30.761 53.833  1.00 98.95  ? 251 VAL A CG2 1 
ATOM   294  N  N   . LYS A 1 60  ? 24.130  30.661 58.619  1.00 94.77  ? 252 LYS A N   1 
ATOM   295  C  CA  . LYS A 1 60  ? 24.496  30.121 59.925  1.00 91.85  ? 252 LYS A CA  1 
ATOM   296  C  C   . LYS A 1 60  ? 23.936  28.705 60.120  1.00 92.39  ? 252 LYS A C   1 
ATOM   297  O  O   . LYS A 1 60  ? 22.894  28.353 59.559  1.00 89.60  ? 252 LYS A O   1 
ATOM   298  C  CB  . LYS A 1 60  ? 23.944  31.014 61.023  1.00 89.69  ? 252 LYS A CB  1 
ATOM   299  C  CG  . LYS A 1 60  ? 24.484  32.420 61.060  1.00 87.01  ? 252 LYS A CG  1 
ATOM   300  C  CD  . LYS A 1 60  ? 23.633  33.235 62.019  1.00 86.23  ? 252 LYS A CD  1 
ATOM   301  C  CE  . LYS A 1 60  ? 24.381  34.400 62.609  1.00 86.60  ? 252 LYS A CE  1 
ATOM   302  N  NZ  . LYS A 1 60  ? 23.466  35.213 63.454  1.00 88.65  ? 252 LYS A NZ  1 
ATOM   303  N  N   . ILE A 1 61  ? 24.627  27.910 60.934  1.00 92.41  ? 253 ILE A N   1 
ATOM   304  C  CA  . ILE A 1 61  ? 24.231  26.533 61.224  1.00 90.99  ? 253 ILE A CA  1 
ATOM   305  C  C   . ILE A 1 61  ? 23.536  26.456 62.572  1.00 93.34  ? 253 ILE A C   1 
ATOM   306  O  O   . ILE A 1 61  ? 24.034  26.980 63.575  1.00 97.95  ? 253 ILE A O   1 
ATOM   307  C  CB  . ILE A 1 61  ? 25.470  25.596 61.241  1.00 91.47  ? 253 ILE A CB  1 
ATOM   308  C  CG1 . ILE A 1 61  ? 25.969  25.333 59.817  1.00 91.09  ? 253 ILE A CG1 1 
ATOM   309  C  CG2 . ILE A 1 61  ? 25.162  24.283 61.945  1.00 90.79  ? 253 ILE A CG2 1 
ATOM   310  C  CD1 . ILE A 1 61  ? 27.377  24.780 59.732  1.00 90.02  ? 253 ILE A CD1 1 
ATOM   311  N  N   . LEU A 1 62  ? 22.379  25.811 62.600  1.00 93.69  ? 254 LEU A N   1 
ATOM   312  C  CA  . LEU A 1 62  ? 21.747  25.462 63.872  1.00 93.23  ? 254 LEU A CA  1 
ATOM   313  C  C   . LEU A 1 62  ? 21.903  23.974 64.079  1.00 95.23  ? 254 LEU A C   1 
ATOM   314  O  O   . LEU A 1 62  ? 21.519  23.165 63.224  1.00 98.64  ? 254 LEU A O   1 
ATOM   315  C  CB  . LEU A 1 62  ? 20.262  25.847 63.921  1.00 92.04  ? 254 LEU A CB  1 
ATOM   316  C  CG  . LEU A 1 62  ? 19.498  25.418 65.180  1.00 89.06  ? 254 LEU A CG  1 
ATOM   317  C  CD1 . LEU A 1 62  ? 20.121  25.987 66.462  1.00 89.17  ? 254 LEU A CD1 1 
ATOM   318  C  CD2 . LEU A 1 62  ? 18.050  25.824 65.084  1.00 88.58  ? 254 LEU A CD2 1 
ATOM   319  N  N   . THR A 1 63  ? 22.473  23.630 65.223  1.00 94.32  ? 255 THR A N   1 
ATOM   320  C  CA  . THR A 1 63  ? 22.758  22.256 65.570  1.00 94.33  ? 255 THR A CA  1 
ATOM   321  C  C   . THR A 1 63  ? 21.453  21.579 66.028  1.00 97.01  ? 255 THR A C   1 
ATOM   322  O  O   . THR A 1 63  ? 20.574  22.240 66.593  0.70 94.89  ? 255 THR A O   1 
ATOM   323  C  CB  . THR A 1 63  ? 23.919  22.234 66.592  1.00 96.60  ? 255 THR A CB  1 
ATOM   324  O  OG1 . THR A 1 63  ? 25.011  21.490 66.053  1.00 104.53 ? 255 THR A OG1 1 
ATOM   325  C  CG2 . THR A 1 63  ? 23.528  21.707 67.960  1.00 94.21  ? 255 THR A CG2 1 
ATOM   326  N  N   . PRO A 1 64  ? 21.296  20.269 65.747  1.00 99.16  ? 256 PRO A N   1 
ATOM   327  C  CA  . PRO A 1 64  ? 20.016  19.598 66.024  1.00 97.00  ? 256 PRO A CA  1 
ATOM   328  C  C   . PRO A 1 64  ? 19.750  19.545 67.518  1.00 96.27  ? 256 PRO A C   1 
ATOM   329  O  O   . PRO A 1 64  ? 18.638  19.263 67.953  1.00 101.92 ? 256 PRO A O   1 
ATOM   330  C  CB  . PRO A 1 64  ? 20.227  18.186 65.476  1.00 94.29  ? 256 PRO A CB  1 
ATOM   331  C  CG  . PRO A 1 64  ? 21.685  17.991 65.489  1.00 98.93  ? 256 PRO A CG  1 
ATOM   332  C  CD  . PRO A 1 64  ? 22.293  19.335 65.201  1.00 99.49  ? 256 PRO A CD  1 
ATOM   333  N  N   . GLU A 1 65  ? 20.794  19.826 68.279  1.00 92.87  ? 257 GLU A N   1 
ATOM   334  C  CA  . GLU A 1 65  ? 20.757  19.891 69.720  1.00 91.56  ? 257 GLU A CA  1 
ATOM   335  C  C   . GLU A 1 65  ? 20.514  21.352 70.160  1.00 92.99  ? 257 GLU A C   1 
ATOM   336  O  O   . GLU A 1 65  ? 20.404  21.648 71.349  1.00 90.35  ? 257 GLU A O   1 
ATOM   337  C  CB  . GLU A 1 65  ? 22.099  19.368 70.236  1.00 90.19  ? 257 GLU A CB  1 
ATOM   338  C  CG  . GLU A 1 65  ? 22.096  18.825 71.633  1.00 91.57  ? 257 GLU A CG  1 
ATOM   339  C  CD  . GLU A 1 65  ? 21.390  17.497 71.753  1.00 93.30  ? 257 GLU A CD  1 
ATOM   340  O  OE1 . GLU A 1 65  ? 21.359  16.714 70.777  1.00 87.19  ? 257 GLU A OE1 1 
ATOM   341  O  OE2 . GLU A 1 65  ? 20.856  17.236 72.853  1.00 99.43  ? 257 GLU A OE2 1 
ATOM   342  N  N   . GLY A 1 66  ? 20.462  22.262 69.189  1.00 95.27  ? 258 GLY A N   1 
ATOM   343  C  CA  . GLY A 1 66  ? 20.055  23.644 69.433  1.00 94.18  ? 258 GLY A CA  1 
ATOM   344  C  C   . GLY A 1 66  ? 21.086  24.750 69.573  1.00 93.59  ? 258 GLY A C   1 
ATOM   345  O  O   . GLY A 1 66  ? 20.750  25.807 70.101  1.00 98.56  ? 258 GLY A O   1 
ATOM   346  N  N   . GLU A 1 67  ? 22.318  24.534 69.104  1.00 91.31  ? 259 GLU A N   1 
ATOM   347  C  CA  . GLU A 1 67  ? 23.385  25.562 69.160  1.00 86.62  ? 259 GLU A CA  1 
ATOM   348  C  C   . GLU A 1 67  ? 23.611  26.276 67.834  1.00 85.74  ? 259 GLU A C   1 
ATOM   349  O  O   . GLU A 1 67  ? 23.656  25.641 66.785  1.00 87.01  ? 259 GLU A O   1 
ATOM   350  C  CB  . GLU A 1 67  ? 24.702  24.949 69.603  1.00 85.26  ? 259 GLU A CB  1 
ATOM   351  C  CG  . GLU A 1 67  ? 24.732  24.550 71.061  1.00 92.24  ? 259 GLU A CG  1 
ATOM   352  C  CD  . GLU A 1 67  ? 25.111  25.689 71.984  1.00 98.13  ? 259 GLU A CD  1 
ATOM   353  O  OE1 . GLU A 1 67  ? 25.862  26.587 71.543  1.00 102.56 ? 259 GLU A OE1 1 
ATOM   354  O  OE2 . GLU A 1 67  ? 24.674  25.677 73.160  1.00 99.40  ? 259 GLU A OE2 1 
ATOM   355  N  N   . ILE A 1 68  ? 23.741  27.600 67.870  1.00 86.63  ? 260 ILE A N   1 
ATOM   356  C  CA  . ILE A 1 68  ? 24.178  28.325 66.675  1.00 85.88  ? 260 ILE A CA  1 
ATOM   357  C  C   . ILE A 1 68  ? 25.697  28.432 66.733  1.00 87.50  ? 260 ILE A C   1 
ATOM   358  O  O   . ILE A 1 68  ? 26.255  29.006 67.672  1.00 86.78  ? 260 ILE A O   1 
ATOM   359  C  CB  . ILE A 1 68  ? 23.581  29.740 66.558  1.00 84.39  ? 260 ILE A CB  1 
ATOM   360  C  CG1 . ILE A 1 68  ? 22.046  29.711 66.521  1.00 87.88  ? 260 ILE A CG1 1 
ATOM   361  C  CG2 . ILE A 1 68  ? 24.129  30.430 65.327  1.00 82.49  ? 260 ILE A CG2 1 
ATOM   362  C  CD1 . ILE A 1 68  ? 21.434  29.353 65.167  1.00 89.67  ? 260 ILE A CD1 1 
ATOM   363  N  N   . PHE A 1 69  ? 26.364  27.850 65.743  1.00 87.12  ? 261 PHE A N   1 
ATOM   364  C  CA  . PHE A 1 69  ? 27.808  27.909 65.688  1.00 87.90  ? 261 PHE A CA  1 
ATOM   365  C  C   . PHE A 1 69  ? 28.255  29.369 65.549  1.00 90.93  ? 261 PHE A C   1 
ATOM   366  O  O   . PHE A 1 69  ? 27.666  30.131 64.770  1.00 91.63  ? 261 PHE A O   1 
ATOM   367  C  CB  . PHE A 1 69  ? 28.327  27.067 64.524  1.00 87.91  ? 261 PHE A CB  1 
ATOM   368  C  CG  . PHE A 1 69  ? 28.292  25.576 64.768  1.00 86.26  ? 261 PHE A CG  1 
ATOM   369  C  CD1 . PHE A 1 69  ? 28.413  24.689 63.699  1.00 87.51  ? 261 PHE A CD1 1 
ATOM   370  C  CD2 . PHE A 1 69  ? 28.149  25.054 66.050  1.00 85.95  ? 261 PHE A CD2 1 
ATOM   371  C  CE1 . PHE A 1 69  ? 28.392  23.302 63.899  1.00 87.11  ? 261 PHE A CE1 1 
ATOM   372  C  CE2 . PHE A 1 69  ? 28.127  23.668 66.262  1.00 87.96  ? 261 PHE A CE2 1 
ATOM   373  C  CZ  . PHE A 1 69  ? 28.246  22.791 65.181  1.00 87.02  ? 261 PHE A CZ  1 
ATOM   374  N  N   . LYS A 1 70  ? 29.278  29.756 66.312  1.00 92.76  ? 262 LYS A N   1 
ATOM   375  C  CA  . LYS A 1 70  ? 29.764  31.140 66.299  1.00 96.31  ? 262 LYS A CA  1 
ATOM   376  C  C   . LYS A 1 70  ? 30.304  31.524 64.927  1.00 96.26  ? 262 LYS A C   1 
ATOM   377  O  O   . LYS A 1 70  ? 30.009  32.607 64.419  1.00 95.39  ? 262 LYS A O   1 
ATOM   378  C  CB  . LYS A 1 70  ? 30.829  31.372 67.373  1.00 99.21  ? 262 LYS A CB  1 
ATOM   379  C  CG  . LYS A 1 70  ? 31.145  32.843 67.621  1.00 101.53 ? 262 LYS A CG  1 
ATOM   380  C  CD  . LYS A 1 70  ? 32.527  33.008 68.252  1.00 104.26 ? 262 LYS A CD  1 
ATOM   381  C  CE  . LYS A 1 70  ? 32.944  34.474 68.337  1.00 105.49 ? 262 LYS A CE  1 
ATOM   382  N  NZ  . LYS A 1 70  ? 32.104  35.264 69.292  1.00 106.91 ? 262 LYS A NZ  1 
ATOM   383  N  N   . GLU A 1 71  ? 31.086  30.631 64.330  1.00 97.42  ? 263 GLU A N   1 
ATOM   384  C  CA  . GLU A 1 71  ? 31.563  30.843 62.975  1.00 99.29  ? 263 GLU A CA  1 
ATOM   385  C  C   . GLU A 1 71  ? 30.467  30.512 61.968  1.00 96.94  ? 263 GLU A C   1 
ATOM   386  O  O   . GLU A 1 71  ? 29.882  29.423 62.019  1.00 100.90 ? 263 GLU A O   1 
ATOM   387  C  CB  . GLU A 1 71  ? 32.808  30.008 62.705  1.00 104.71 ? 263 GLU A CB  1 
ATOM   388  C  CG  . GLU A 1 71  ? 33.826  30.728 61.840  1.00 113.02 ? 263 GLU A CG  1 
ATOM   389  C  CD  . GLU A 1 71  ? 34.215  32.091 62.406  1.00 117.12 ? 263 GLU A CD  1 
ATOM   390  O  OE1 . GLU A 1 71  ? 34.793  32.146 63.515  1.00 116.93 ? 263 GLU A OE1 1 
ATOM   391  O  OE2 . GLU A 1 71  ? 33.935  33.108 61.736  1.00 120.32 ? 263 GLU A OE2 1 
ATOM   392  N  N   . PRO A 1 72  ? 30.154  31.460 61.069  1.00 91.35  ? 264 PRO A N   1 
ATOM   393  C  CA  . PRO A 1 72  ? 29.176  31.194 60.008  1.00 88.10  ? 264 PRO A CA  1 
ATOM   394  C  C   . PRO A 1 72  ? 29.613  30.074 59.066  1.00 87.11  ? 264 PRO A C   1 
ATOM   395  O  O   . PRO A 1 72  ? 30.811  29.823 58.911  1.00 91.33  ? 264 PRO A O   1 
ATOM   396  C  CB  . PRO A 1 72  ? 29.104  32.524 59.258  1.00 85.83  ? 264 PRO A CB  1 
ATOM   397  C  CG  . PRO A 1 72  ? 29.569  33.535 60.250  1.00 88.42  ? 264 PRO A CG  1 
ATOM   398  C  CD  . PRO A 1 72  ? 30.650  32.843 61.010  1.00 90.04  ? 264 PRO A CD  1 
ATOM   399  N  N   . TYR A 1 73  ? 28.641  29.401 58.463  1.00 83.86  ? 265 TYR A N   1 
ATOM   400  C  CA  . TYR A 1 73  ? 28.901  28.386 57.447  1.00 83.45  ? 265 TYR A CA  1 
ATOM   401  C  C   . TYR A 1 73  ? 29.301  29.065 56.146  1.00 84.56  ? 265 TYR A C   1 
ATOM   402  O  O   . TYR A 1 73  ? 30.193  28.597 55.440  1.00 87.51  ? 265 TYR A O   1 
ATOM   403  C  CB  . TYR A 1 73  ? 27.650  27.529 57.236  1.00 84.71  ? 265 TYR A CB  1 
ATOM   404  C  CG  . TYR A 1 73  ? 27.730  26.506 56.124  1.00 84.29  ? 265 TYR A CG  1 
ATOM   405  C  CD1 . TYR A 1 73  ? 28.492  25.346 56.266  1.00 87.52  ? 265 TYR A CD1 1 
ATOM   406  C  CD2 . TYR A 1 73  ? 27.024  26.683 54.945  1.00 82.38  ? 265 TYR A CD2 1 
ATOM   407  C  CE1 . TYR A 1 73  ? 28.560  24.396 55.253  1.00 86.89  ? 265 TYR A CE1 1 
ATOM   408  C  CE2 . TYR A 1 73  ? 27.080  25.739 53.931  1.00 85.17  ? 265 TYR A CE2 1 
ATOM   409  C  CZ  . TYR A 1 73  ? 27.849  24.599 54.086  1.00 85.72  ? 265 TYR A CZ  1 
ATOM   410  O  OH  . TYR A 1 73  ? 27.915  23.668 53.073  1.00 84.14  ? 265 TYR A OH  1 
ATOM   411  N  N   . LEU A 1 74  ? 28.642  30.180 55.848  1.00 84.64  ? 266 LEU A N   1 
ATOM   412  C  CA  . LEU A 1 74  ? 28.893  30.935 54.630  1.00 87.91  ? 266 LEU A CA  1 
ATOM   413  C  C   . LEU A 1 74  ? 28.886  32.430 54.959  1.00 90.39  ? 266 LEU A C   1 
ATOM   414  O  O   . LEU A 1 74  ? 27.848  32.970 55.357  1.00 92.53  ? 266 LEU A O   1 
ATOM   415  C  CB  . LEU A 1 74  ? 27.807  30.591 53.601  1.00 89.67  ? 266 LEU A CB  1 
ATOM   416  C  CG  . LEU A 1 74  ? 27.984  30.748 52.087  1.00 90.34  ? 266 LEU A CG  1 
ATOM   417  C  CD1 . LEU A 1 74  ? 27.465  32.081 51.588  1.00 91.51  ? 266 LEU A CD1 1 
ATOM   418  C  CD2 . LEU A 1 74  ? 29.427  30.507 51.646  1.00 90.53  ? 266 LEU A CD2 1 
ATOM   419  N  N   . ASP A 1 75  ? 30.041  33.089 54.849  1.00 89.35  ? 267 ASP A N   1 
ATOM   420  C  CA  . ASP A 1 75  ? 30.094  34.540 55.071  1.00 91.08  ? 267 ASP A CA  1 
ATOM   421  C  C   . ASP A 1 75  ? 30.519  35.288 53.811  1.00 93.15  ? 267 ASP A C   1 
ATOM   422  O  O   . ASP A 1 75  ? 31.713  35.465 53.521  1.00 94.47  ? 267 ASP A O   1 
ATOM   423  C  CB  . ASP A 1 75  ? 30.943  34.939 56.288  1.00 91.06  ? 267 ASP A CB  1 
ATOM   424  C  CG  . ASP A 1 75  ? 31.071  36.464 56.442  1.00 93.24  ? 267 ASP A CG  1 
ATOM   425  O  OD1 . ASP A 1 75  ? 30.267  37.196 55.819  1.00 92.25  ? 267 ASP A OD1 1 
ATOM   426  O  OD2 . ASP A 1 75  ? 31.978  36.934 57.175  1.00 93.49  ? 267 ASP A OD2 1 
ATOM   427  N  N   . ILE A 1 76  ? 29.502  35.761 53.102  1.00 91.93  ? 268 ILE A N   1 
ATOM   428  C  CA  . ILE A 1 76  ? 29.642  36.249 51.750  1.00 89.78  ? 268 ILE A CA  1 
ATOM   429  C  C   . ILE A 1 76  ? 29.157  37.700 51.645  1.00 90.36  ? 268 ILE A C   1 
ATOM   430  O  O   . ILE A 1 76  ? 28.963  38.225 50.544  1.00 89.59  ? 268 ILE A O   1 
ATOM   431  C  CB  . ILE A 1 76  ? 28.861  35.302 50.812  1.00 91.21  ? 268 ILE A CB  1 
ATOM   432  C  CG1 . ILE A 1 76  ? 29.557  35.160 49.467  1.00 92.93  ? 268 ILE A CG1 1 
ATOM   433  C  CG2 . ILE A 1 76  ? 27.356  35.675 50.705  1.00 90.08  ? 268 ILE A CG2 1 
ATOM   434  C  CD1 . ILE A 1 76  ? 28.862  34.169 48.564  1.00 98.15  ? 268 ILE A CD1 1 
ATOM   435  N  N   . HIS A 1 77  ? 29.013  38.350 52.803  1.00 91.26  ? 269 HIS A N   1 
ATOM   436  C  CA  . HIS A 1 77  ? 28.330  39.649 52.923  1.00 90.75  ? 269 HIS A CA  1 
ATOM   437  C  C   . HIS A 1 77  ? 28.988  40.791 52.153  1.00 89.13  ? 269 HIS A C   1 
ATOM   438  O  O   . HIS A 1 77  ? 28.339  41.791 51.846  1.00 88.00  ? 269 HIS A O   1 
ATOM   439  C  CB  . HIS A 1 77  ? 28.140  40.032 54.402  1.00 92.27  ? 269 HIS A CB  1 
ATOM   440  C  CG  . HIS A 1 77  ? 29.347  40.654 55.033  1.00 94.42  ? 269 HIS A CG  1 
ATOM   441  N  ND1 . HIS A 1 77  ? 30.518  39.959 55.252  1.00 96.45  ? 269 HIS A ND1 1 
ATOM   442  C  CD2 . HIS A 1 77  ? 29.562  41.906 55.501  1.00 94.26  ? 269 HIS A CD2 1 
ATOM   443  C  CE1 . HIS A 1 77  ? 31.403  40.757 55.822  1.00 94.42  ? 269 HIS A CE1 1 
ATOM   444  N  NE2 . HIS A 1 77  ? 30.848  41.945 55.983  1.00 94.02  ? 269 HIS A NE2 1 
ATOM   445  N  N   . LYS A 1 78  ? 30.272  40.641 51.850  1.00 89.97  ? 270 LYS A N   1 
ATOM   446  C  CA  . LYS A 1 78  ? 30.992  41.659 51.100  1.00 92.54  ? 270 LYS A CA  1 
ATOM   447  C  C   . LYS A 1 78  ? 30.627  41.600 49.620  1.00 92.45  ? 270 LYS A C   1 
ATOM   448  O  O   . LYS A 1 78  ? 30.564  42.630 48.949  1.00 91.21  ? 270 LYS A O   1 
ATOM   449  C  CB  . LYS A 1 78  ? 32.499  41.523 51.311  1.00 93.26  ? 270 LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 78  ? 32.969  41.912 52.717  1.00 94.65  ? 270 LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 78  ? 34.484  41.796 52.843  1.00 95.08  ? 270 LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 78  ? 34.994  42.396 54.144  1.00 96.69  ? 270 LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 78  ? 36.471  42.646 54.093  1.00 96.69  ? 270 LYS A NZ  1 
ATOM   454  N  N   . LEU A 1 79  ? 30.362  40.392 49.128  1.00 93.27  ? 271 LEU A N   1 
ATOM   455  C  CA  . LEU A 1 79  ? 30.002  40.189 47.725  1.00 95.10  ? 271 LEU A CA  1 
ATOM   456  C  C   . LEU A 1 79  ? 28.569  40.618 47.413  1.00 95.47  ? 271 LEU A C   1 
ATOM   457  O  O   . LEU A 1 79  ? 28.271  41.041 46.299  1.00 97.35  ? 271 LEU A O   1 
ATOM   458  C  CB  . LEU A 1 79  ? 30.222  38.727 47.302  1.00 95.88  ? 271 LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 79  ? 31.650  38.165 47.212  1.00 96.96  ? 271 LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 79  ? 31.619  36.669 46.927  1.00 96.02  ? 271 LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 79  ? 32.501  38.891 46.160  1.00 99.27  ? 271 LEU A CD2 1 
ATOM   462  N  N   . VAL A 1 80  ? 27.684  40.508 48.394  1.00 95.94  ? 272 VAL A N   1 
ATOM   463  C  CA  . VAL A 1 80  ? 26.268  40.795 48.176  1.00 96.66  ? 272 VAL A CA  1 
ATOM   464  C  C   . VAL A 1 80  ? 25.905  42.237 48.534  1.00 96.93  ? 272 VAL A C   1 
ATOM   465  O  O   . VAL A 1 80  ? 26.274  42.743 49.597  1.00 96.47  ? 272 VAL A O   1 
ATOM   466  C  CB  . VAL A 1 80  ? 25.331  39.736 48.874  1.00 97.49  ? 272 VAL A CB  1 
ATOM   467  C  CG1 . VAL A 1 80  ? 25.965  39.172 50.125  1.00 97.89  ? 272 VAL A CG1 1 
ATOM   468  C  CG2 . VAL A 1 80  ? 23.949  40.306 49.190  1.00 99.37  ? 272 VAL A CG2 1 
ATOM   469  N  N   . GLN A 1 81  ? 25.203  42.894 47.616  1.00 99.60  ? 273 GLN A N   1 
ATOM   470  C  CA  . GLN A 1 81  ? 24.664  44.222 47.860  1.00 104.73 ? 273 GLN A CA  1 
ATOM   471  C  C   . GLN A 1 81  ? 23.279  44.049 48.468  1.00 108.27 ? 273 GLN A C   1 
ATOM   472  O  O   . GLN A 1 81  ? 22.298  43.859 47.751  1.00 108.10 ? 273 GLN A O   1 
ATOM   473  C  CB  . GLN A 1 81  ? 24.623  45.039 46.554  1.00 105.35 ? 273 GLN A CB  1 
ATOM   474  C  CG  . GLN A 1 81  ? 23.895  46.389 46.631  1.00 105.58 ? 273 GLN A CG  1 
ATOM   475  C  CD  . GLN A 1 81  ? 24.457  47.312 47.692  1.00 106.89 ? 273 GLN A CD  1 
ATOM   476  O  OE1 . GLN A 1 81  ? 25.465  47.984 47.476  1.00 108.74 ? 273 GLN A OE1 1 
ATOM   477  N  NE2 . GLN A 1 81  ? 23.800  47.356 48.847  1.00 107.33 ? 273 GLN A NE2 1 
ATOM   478  N  N   . SER A 1 82  ? 23.215  44.094 49.796  1.00 113.46 ? 274 SER A N   1 
ATOM   479  C  CA  . SER A 1 82  ? 21.967  43.855 50.521  1.00 118.45 ? 274 SER A CA  1 
ATOM   480  C  C   . SER A 1 82  ? 21.309  45.161 50.945  1.00 123.26 ? 274 SER A C   1 
ATOM   481  O  O   . SER A 1 82  ? 21.767  45.839 51.875  1.00 125.76 ? 274 SER A O   1 
ATOM   482  C  CB  . SER A 1 82  ? 22.200  42.948 51.732  1.00 118.15 ? 274 SER A CB  1 
ATOM   483  O  OG  . SER A 1 82  ? 22.968  43.597 52.731  1.00 118.01 ? 274 SER A OG  1 
ATOM   484  N  N   . GLY A 1 83  ? 20.221  45.493 50.256  1.00 126.09 ? 275 GLY A N   1 
ATOM   485  C  CA  . GLY A 1 83  ? 19.541  46.766 50.432  1.00 128.87 ? 275 GLY A CA  1 
ATOM   486  C  C   . GLY A 1 83  ? 18.803  46.974 51.743  1.00 131.10 ? 275 GLY A C   1 
ATOM   487  O  O   . GLY A 1 83  ? 17.840  46.262 52.063  1.00 130.78 ? 275 GLY A O   1 
ATOM   488  N  N   . ILE A 1 84  ? 19.345  47.911 52.525  1.00 132.75 ? 276 ILE A N   1 
ATOM   489  C  CA  . ILE A 1 84  ? 18.600  48.760 53.473  1.00 134.17 ? 276 ILE A CA  1 
ATOM   490  C  C   . ILE A 1 84  ? 17.055  48.775 53.405  1.00 133.46 ? 276 ILE A C   1 
ATOM   491  O  O   . ILE A 1 84  ? 16.391  47.858 53.902  1.00 132.05 ? 276 ILE A O   1 
ATOM   492  C  CB  . ILE A 1 84  ? 19.109  50.231 53.328  1.00 135.48 ? 276 ILE A CB  1 
ATOM   493  C  CG1 . ILE A 1 84  ? 19.362  50.574 51.843  1.00 135.50 ? 276 ILE A CG1 1 
ATOM   494  C  CG2 . ILE A 1 84  ? 20.382  50.440 54.153  1.00 135.84 ? 276 ILE A CG2 1 
ATOM   495  C  CD1 . ILE A 1 84  ? 19.417  52.070 51.532  1.00 134.77 ? 276 ILE A CD1 1 
ATOM   496  N  N   . LYS A 1 85  ? 16.528  49.848 52.802  1.00 132.64 ? 277 LYS A N   1 
ATOM   497  C  CA  . LYS A 1 85  ? 15.095  50.193 52.680  1.00 132.18 ? 277 LYS A CA  1 
ATOM   498  C  C   . LYS A 1 85  ? 14.048  49.372 53.449  1.00 131.40 ? 277 LYS A C   1 
ATOM   499  O  O   . LYS A 1 85  ? 13.497  49.843 54.444  1.00 132.61 ? 277 LYS A O   1 
ATOM   500  C  CB  . LYS A 1 85  ? 14.689  50.299 51.200  1.00 132.45 ? 277 LYS A CB  1 
ATOM   501  C  CG  . LYS A 1 85  ? 15.344  51.438 50.426  1.00 132.37 ? 277 LYS A CG  1 
ATOM   502  C  CD  . LYS A 1 85  ? 14.595  52.751 50.610  1.00 132.08 ? 277 LYS A CD  1 
ATOM   503  C  CE  . LYS A 1 85  ? 15.225  53.863 49.787  1.00 131.49 ? 277 LYS A CE  1 
ATOM   504  N  NZ  . LYS A 1 85  ? 14.499  55.151 49.953  1.00 131.05 ? 277 LYS A NZ  1 
ATOM   505  N  N   . GLY A 1 86  ? 13.781  48.156 52.983  1.00 129.02 ? 278 GLY A N   1 
ATOM   506  C  CA  . GLY A 1 86  ? 12.577  47.434 53.381  1.00 127.19 ? 278 GLY A CA  1 
ATOM   507  C  C   . GLY A 1 86  ? 11.614  47.604 52.225  1.00 126.04 ? 278 GLY A C   1 
ATOM   508  O  O   . GLY A 1 86  ? 11.309  48.732 51.823  1.00 125.16 ? 278 GLY A O   1 
ATOM   509  N  N   . GLY A 1 87  ? 11.146  46.487 51.677  1.00 124.83 ? 279 GLY A N   1 
ATOM   510  C  CA  . GLY A 1 87  ? 10.526  46.494 50.353  1.00 124.14 ? 279 GLY A CA  1 
ATOM   511  C  C   . GLY A 1 87  ? 11.629  46.371 49.314  1.00 122.43 ? 279 GLY A C   1 
ATOM   512  O  O   . GLY A 1 87  ? 11.407  45.868 48.207  1.00 122.58 ? 279 GLY A O   1 
ATOM   513  N  N   . ASP A 1 88  ? 12.817  46.853 49.687  1.00 119.11 ? 280 ASP A N   1 
ATOM   514  C  CA  . ASP A 1 88  ? 14.055  46.599 48.967  1.00 115.27 ? 280 ASP A CA  1 
ATOM   515  C  C   . ASP A 1 88  ? 14.395  45.132 49.144  1.00 113.45 ? 280 ASP A C   1 
ATOM   516  O  O   . ASP A 1 88  ? 14.415  44.626 50.262  1.00 113.43 ? 280 ASP A O   1 
ATOM   517  C  CB  . ASP A 1 88  ? 15.177  47.456 49.541  1.00 114.42 ? 280 ASP A CB  1 
ATOM   518  C  CG  . ASP A 1 88  ? 16.343  47.611 48.590  1.00 114.07 ? 280 ASP A CG  1 
ATOM   519  O  OD1 . ASP A 1 88  ? 16.689  46.635 47.893  1.00 113.49 ? 280 ASP A OD1 1 
ATOM   520  O  OD2 . ASP A 1 88  ? 16.922  48.717 48.547  1.00 114.77 ? 280 ASP A OD2 1 
ATOM   521  N  N   . GLU A 1 89  ? 14.683  44.463 48.037  1.00 113.91 ? 281 GLU A N   1 
ATOM   522  C  CA  . GLU A 1 89  ? 14.694  43.006 47.987  1.00 116.88 ? 281 GLU A CA  1 
ATOM   523  C  C   . GLU A 1 89  ? 16.095  42.444 47.717  1.00 116.60 ? 281 GLU A C   1 
ATOM   524  O  O   . GLU A 1 89  ? 16.239  41.274 47.354  1.00 119.09 ? 281 GLU A O   1 
ATOM   525  C  CB  . GLU A 1 89  ? 13.738  42.576 46.872  1.00 117.50 ? 281 GLU A CB  1 
ATOM   526  C  CG  . GLU A 1 89  ? 12.958  41.300 47.111  1.00 120.08 ? 281 GLU A CG  1 
ATOM   527  C  CD  . GLU A 1 89  ? 11.783  41.160 46.146  1.00 121.22 ? 281 GLU A CD  1 
ATOM   528  O  OE1 . GLU A 1 89  ? 10.910  42.058 46.136  1.00 123.28 ? 281 GLU A OE1 1 
ATOM   529  O  OE2 . GLU A 1 89  ? 11.730  40.155 45.399  1.00 122.12 ? 281 GLU A OE2 1 
ATOM   530  N  N   . ARG A 1 90  ? 17.119  43.264 47.953  1.00 113.17 ? 282 ARG A N   1 
ATOM   531  C  CA  . ARG A 1 90  ? 18.421  43.123 47.285  1.00 108.98 ? 282 ARG A CA  1 
ATOM   532  C  C   . ARG A 1 90  ? 19.489  42.212 47.931  1.00 107.58 ? 282 ARG A C   1 
ATOM   533  O  O   . ARG A 1 90  ? 20.636  42.199 47.487  1.00 108.77 ? 282 ARG A O   1 
ATOM   534  C  CB  . ARG A 1 90  ? 19.005  44.525 47.062  1.00 106.84 ? 282 ARG A CB  1 
ATOM   535  C  CG  . ARG A 1 90  ? 19.422  44.809 45.647  1.00 102.76 ? 282 ARG A CG  1 
ATOM   536  C  CD  . ARG A 1 90  ? 19.086  46.232 45.264  1.00 101.60 ? 282 ARG A CD  1 
ATOM   537  N  NE  . ARG A 1 90  ? 20.209  47.152 45.423  1.00 101.89 ? 282 ARG A NE  1 
ATOM   538  C  CZ  . ARG A 1 90  ? 20.318  48.063 46.387  1.00 100.48 ? 282 ARG A CZ  1 
ATOM   539  N  NH1 . ARG A 1 90  ? 19.367  48.192 47.303  1.00 98.60  ? 282 ARG A NH1 1 
ATOM   540  N  NH2 . ARG A 1 90  ? 21.383  48.852 46.431  1.00 100.43 ? 282 ARG A NH2 1 
ATOM   541  N  N   . GLY A 1 91  ? 19.132  41.442 48.952  1.00 103.68 ? 283 GLY A N   1 
ATOM   542  C  CA  . GLY A 1 91  ? 20.146  40.673 49.682  1.00 100.96 ? 283 GLY A CA  1 
ATOM   543  C  C   . GLY A 1 91  ? 20.530  39.299 49.155  1.00 97.73  ? 283 GLY A C   1 
ATOM   544  O  O   . GLY A 1 91  ? 20.651  39.090 47.952  1.00 96.82  ? 283 GLY A O   1 
ATOM   545  N  N   . LEU A 1 92  ? 20.765  38.376 50.086  1.00 96.35  ? 284 LEU A N   1 
ATOM   546  C  CA  . LEU A 1 92  ? 20.922  36.957 49.791  1.00 93.15  ? 284 LEU A CA  1 
ATOM   547  C  C   . LEU A 1 92  ? 19.523  36.361 49.657  1.00 94.10  ? 284 LEU A C   1 
ATOM   548  O  O   . LEU A 1 92  ? 18.661  36.622 50.493  1.00 97.59  ? 284 LEU A O   1 
ATOM   549  C  CB  . LEU A 1 92  ? 21.692  36.272 50.922  1.00 89.39  ? 284 LEU A CB  1 
ATOM   550  C  CG  . LEU A 1 92  ? 21.663  34.745 51.034  1.00 87.32  ? 284 LEU A CG  1 
ATOM   551  C  CD1 . LEU A 1 92  ? 22.634  34.095 50.050  1.00 85.24  ? 284 LEU A CD1 1 
ATOM   552  C  CD2 . LEU A 1 92  ? 21.969  34.310 52.459  1.00 85.46  ? 284 LEU A CD2 1 
ATOM   553  N  N   . LEU A 1 93  ? 19.302  35.556 48.620  1.00 92.42  ? 285 LEU A N   1 
ATOM   554  C  CA  . LEU A 1 93  ? 17.947  35.158 48.242  1.00 91.58  ? 285 LEU A CA  1 
ATOM   555  C  C   . LEU A 1 93  ? 17.622  33.695 48.531  1.00 93.05  ? 285 LEU A C   1 
ATOM   556  O  O   . LEU A 1 93  ? 16.558  33.387 49.077  1.00 91.37  ? 285 LEU A O   1 
ATOM   557  C  CB  . LEU A 1 93  ? 17.678  35.492 46.768  1.00 92.07  ? 285 LEU A CB  1 
ATOM   558  C  CG  . LEU A 1 93  ? 18.204  36.849 46.269  1.00 93.42  ? 285 LEU A CG  1 
ATOM   559  C  CD1 . LEU A 1 93  ? 18.085  36.963 44.763  1.00 92.04  ? 285 LEU A CD1 1 
ATOM   560  C  CD2 . LEU A 1 93  ? 17.535  38.041 46.961  1.00 92.16  ? 285 LEU A CD2 1 
ATOM   561  N  N   . SER A 1 94  ? 18.530  32.792 48.176  1.00 94.83  ? 286 SER A N   1 
ATOM   562  C  CA  . SER A 1 94  ? 18.249  31.367 48.345  1.00 96.33  ? 286 SER A CA  1 
ATOM   563  C  C   . SER A 1 94  ? 19.505  30.497 48.383  1.00 95.90  ? 286 SER A C   1 
ATOM   564  O  O   . SER A 1 94  ? 20.534  30.838 47.790  1.00 96.11  ? 286 SER A O   1 
ATOM   565  C  CB  . SER A 1 94  ? 17.293  30.880 47.247  1.00 97.09  ? 286 SER A CB  1 
ATOM   566  O  OG  . SER A 1 94  ? 16.867  29.551 47.477  1.00 99.29  ? 286 SER A OG  1 
ATOM   567  N  N   . LEU A 1 95  ? 19.394  29.376 49.093  1.00 94.30  ? 287 LEU A N   1 
ATOM   568  C  CA  . LEU A 1 95  ? 20.434  28.359 49.149  1.00 96.89  ? 287 LEU A CA  1 
ATOM   569  C  C   . LEU A 1 95  ? 19.814  27.010 48.792  1.00 98.11  ? 287 LEU A C   1 
ATOM   570  O  O   . LEU A 1 95  ? 18.661  26.744 49.154  1.00 101.39 ? 287 LEU A O   1 
ATOM   571  C  CB  . LEU A 1 95  ? 21.016  28.286 50.561  1.00 96.98  ? 287 LEU A CB  1 
ATOM   572  C  CG  . LEU A 1 95  ? 22.494  27.979 50.827  1.00 96.55  ? 287 LEU A CG  1 
ATOM   573  C  CD1 . LEU A 1 95  ? 22.666  27.540 52.268  1.00 97.36  ? 287 LEU A CD1 1 
ATOM   574  C  CD2 . LEU A 1 95  ? 23.056  26.920 49.916  1.00 99.40  ? 287 LEU A CD2 1 
ATOM   575  N  N   . ALA A 1 96  ? 20.570  26.168 48.087  1.00 95.07  ? 288 ALA A N   1 
ATOM   576  C  CA  . ALA A 1 96  ? 20.148  24.789 47.810  1.00 95.79  ? 288 ALA A CA  1 
ATOM   577  C  C   . ALA A 1 96  ? 21.323  23.809 47.848  1.00 97.53  ? 288 ALA A C   1 
ATOM   578  O  O   . ALA A 1 96  ? 22.397  24.082 47.299  1.00 97.86  ? 288 ALA A O   1 
ATOM   579  C  CB  . ALA A 1 96  ? 19.418  24.699 46.483  1.00 93.15  ? 288 ALA A CB  1 
ATOM   580  N  N   . PHE A 1 97  ? 21.112  22.669 48.505  1.00 96.61  ? 289 PHE A N   1 
ATOM   581  C  CA  . PHE A 1 97  ? 22.156  21.656 48.652  1.00 93.03  ? 289 PHE A CA  1 
ATOM   582  C  C   . PHE A 1 97  ? 22.015  20.564 47.601  1.00 96.25  ? 289 PHE A C   1 
ATOM   583  O  O   . PHE A 1 97  ? 20.906  20.236 47.175  1.00 99.43  ? 289 PHE A O   1 
ATOM   584  C  CB  . PHE A 1 97  ? 22.115  21.040 50.050  1.00 88.82  ? 289 PHE A CB  1 
ATOM   585  C  CG  . PHE A 1 97  ? 22.616  21.954 51.137  1.00 85.63  ? 289 PHE A CG  1 
ATOM   586  C  CD1 . PHE A 1 97  ? 21.750  22.821 51.787  1.00 84.40  ? 289 PHE A CD1 1 
ATOM   587  C  CD2 . PHE A 1 97  ? 23.953  21.934 51.515  1.00 85.29  ? 289 PHE A CD2 1 
ATOM   588  C  CE1 . PHE A 1 97  ? 22.203  23.659 52.789  1.00 85.83  ? 289 PHE A CE1 1 
ATOM   589  C  CE2 . PHE A 1 97  ? 24.422  22.770 52.512  1.00 86.20  ? 289 PHE A CE2 1 
ATOM   590  C  CZ  . PHE A 1 97  ? 23.544  23.634 53.156  1.00 87.79  ? 289 PHE A CZ  1 
ATOM   591  N  N   . HIS A 1 98  ? 23.142  20.001 47.182  1.00 96.54  ? 290 HIS A N   1 
ATOM   592  C  CA  . HIS A 1 98  ? 23.133  18.941 46.187  1.00 95.07  ? 290 HIS A CA  1 
ATOM   593  C  C   . HIS A 1 98  ? 22.569  17.655 46.783  1.00 95.91  ? 290 HIS A C   1 
ATOM   594  O  O   . HIS A 1 98  ? 22.895  17.303 47.914  1.00 98.04  ? 290 HIS A O   1 
ATOM   595  C  CB  . HIS A 1 98  ? 24.534  18.702 45.644  1.00 93.95  ? 290 HIS A CB  1 
ATOM   596  C  CG  . HIS A 1 98  ? 24.556  17.925 44.367  1.00 94.48  ? 290 HIS A CG  1 
ATOM   597  N  ND1 . HIS A 1 98  ? 24.383  16.559 44.325  1.00 94.75  ? 290 HIS A ND1 1 
ATOM   598  C  CD2 . HIS A 1 98  ? 24.725  18.322 43.084  1.00 94.58  ? 290 HIS A CD2 1 
ATOM   599  C  CE1 . HIS A 1 98  ? 24.448  16.146 43.072  1.00 95.49  ? 290 HIS A CE1 1 
ATOM   600  N  NE2 . HIS A 1 98  ? 24.655  17.196 42.298  1.00 95.12  ? 290 HIS A NE2 1 
ATOM   601  N  N   . PRO A 1 99  ? 21.695  16.962 46.032  1.00 96.45  ? 291 PRO A N   1 
ATOM   602  C  CA  . PRO A 1 99  ? 21.151  15.667 46.442  1.00 98.80  ? 291 PRO A CA  1 
ATOM   603  C  C   . PRO A 1 99  ? 22.227  14.673 46.888  1.00 104.08 ? 291 PRO A C   1 
ATOM   604  O  O   . PRO A 1 99  ? 21.929  13.726 47.621  1.00 105.89 ? 291 PRO A O   1 
ATOM   605  C  CB  . PRO A 1 99  ? 20.469  15.172 45.171  1.00 99.15  ? 291 PRO A CB  1 
ATOM   606  C  CG  . PRO A 1 99  ? 20.053  16.418 44.477  1.00 97.16  ? 291 PRO A CG  1 
ATOM   607  C  CD  . PRO A 1 99  ? 21.141  17.402 44.737  1.00 96.10  ? 291 PRO A CD  1 
ATOM   608  N  N   . ASN A 1 100 ? 23.462  14.895 46.433  1.00 107.55 ? 292 ASN A N   1 
ATOM   609  C  CA  . ASN A 1 100 ? 24.634  14.144 46.894  1.00 106.76 ? 292 ASN A CA  1 
ATOM   610  C  C   . ASN A 1 100 ? 25.722  15.013 47.542  1.00 102.96 ? 292 ASN A C   1 
ATOM   611  O  O   . ASN A 1 100 ? 26.917  14.768 47.368  1.00 104.36 ? 292 ASN A O   1 
ATOM   612  C  CB  . ASN A 1 100 ? 25.212  13.297 45.760  1.00 109.32 ? 292 ASN A CB  1 
ATOM   613  C  CG  . ASN A 1 100 ? 24.739  11.865 45.814  1.00 113.17 ? 292 ASN A CG  1 
ATOM   614  O  OD1 . ASN A 1 100 ? 24.950  11.165 46.807  1.00 113.78 ? 292 ASN A OD1 1 
ATOM   615  N  ND2 . ASN A 1 100 ? 24.100  11.412 44.740  1.00 116.12 ? 292 ASN A ND2 1 
ATOM   616  N  N   . TYR A 1 101 ? 25.293  16.020 48.297  1.00 98.13  ? 293 TYR A N   1 
ATOM   617  C  CA  . TYR A 1 101 ? 26.193  16.855 49.082  1.00 96.28  ? 293 TYR A CA  1 
ATOM   618  C  C   . TYR A 1 101 ? 27.006  16.012 50.078  1.00 98.65  ? 293 TYR A C   1 
ATOM   619  O  O   . TYR A 1 101 ? 28.184  16.290 50.322  1.00 99.08  ? 293 TYR A O   1 
ATOM   620  C  CB  . TYR A 1 101 ? 25.392  17.944 49.796  1.00 92.96  ? 293 TYR A CB  1 
ATOM   621  C  CG  . TYR A 1 101 ? 26.157  18.754 50.817  1.00 94.02  ? 293 TYR A CG  1 
ATOM   622  C  CD1 . TYR A 1 101 ? 26.649  20.018 50.507  1.00 95.04  ? 293 TYR A CD1 1 
ATOM   623  C  CD2 . TYR A 1 101 ? 26.367  18.265 52.109  1.00 93.77  ? 293 TYR A CD2 1 
ATOM   624  C  CE1 . TYR A 1 101 ? 27.351  20.769 51.458  1.00 95.61  ? 293 TYR A CE1 1 
ATOM   625  C  CE2 . TYR A 1 101 ? 27.064  19.004 53.059  1.00 92.83  ? 293 TYR A CE2 1 
ATOM   626  C  CZ  . TYR A 1 101 ? 27.551  20.253 52.732  1.00 93.17  ? 293 TYR A CZ  1 
ATOM   627  O  OH  . TYR A 1 101 ? 28.239  20.977 53.681  1.00 92.68  ? 293 TYR A OH  1 
ATOM   628  N  N   . LYS A 1 102 ? 26.379  14.981 50.641  1.00 99.12  ? 294 LYS A N   1 
ATOM   629  C  CA  . LYS A 1 102 ? 27.067  14.048 51.542  1.00 98.04  ? 294 LYS A CA  1 
ATOM   630  C  C   . LYS A 1 102 ? 28.329  13.454 50.898  1.00 96.80  ? 294 LYS A C   1 
ATOM   631  O  O   . LYS A 1 102 ? 29.294  13.124 51.596  1.00 95.10  ? 294 LYS A O   1 
ATOM   632  C  CB  . LYS A 1 102 ? 26.109  12.941 51.993  1.00 97.86  ? 294 LYS A CB  1 
ATOM   633  C  CG  . LYS A 1 102 ? 26.663  12.010 53.059  1.00 97.56  ? 294 LYS A CG  1 
ATOM   634  C  CD  . LYS A 1 102 ? 25.615  11.016 53.519  1.00 99.16  ? 294 LYS A CD  1 
ATOM   635  C  CE  . LYS A 1 102 ? 26.151  10.142 54.642  1.00 102.52 ? 294 LYS A CE  1 
ATOM   636  N  NZ  . LYS A 1 102 ? 25.075  9.711  55.587  1.00 104.29 ? 294 LYS A NZ  1 
ATOM   637  N  N   . LYS A 1 103 ? 28.308  13.331 49.570  1.00 97.66  ? 295 LYS A N   1 
ATOM   638  C  CA  . LYS A 1 103 ? 29.475  12.882 48.802  1.00 101.45 ? 295 LYS A CA  1 
ATOM   639  C  C   . LYS A 1 103 ? 30.314  14.055 48.283  1.00 98.68  ? 295 LYS A C   1 
ATOM   640  O  O   . LYS A 1 103 ? 31.503  14.161 48.609  1.00 97.65  ? 295 LYS A O   1 
ATOM   641  C  CB  . LYS A 1 103 ? 29.065  11.978 47.629  1.00 102.77 ? 295 LYS A CB  1 
ATOM   642  C  CG  . LYS A 1 103 ? 28.460  10.640 48.028  1.00 106.15 ? 295 LYS A CG  1 
ATOM   643  C  CD  . LYS A 1 103 ? 28.138  9.785  46.801  1.00 106.40 ? 295 LYS A CD  1 
ATOM   644  C  CE  . LYS A 1 103 ? 27.339  8.538  47.181  1.00 108.76 ? 295 LYS A CE  1 
ATOM   645  N  NZ  . LYS A 1 103 ? 27.318  7.515  46.092  1.00 109.27 ? 295 LYS A NZ  1 
ATOM   646  N  N   . ASN A 1 104 ? 29.691  14.931 47.491  1.00 95.40  ? 296 ASN A N   1 
ATOM   647  C  CA  . ASN A 1 104 ? 30.417  15.980 46.771  1.00 93.37  ? 296 ASN A CA  1 
ATOM   648  C  C   . ASN A 1 104 ? 30.511  17.325 47.481  1.00 93.69  ? 296 ASN A C   1 
ATOM   649  O  O   . ASN A 1 104 ? 31.349  18.152 47.133  1.00 96.88  ? 296 ASN A O   1 
ATOM   650  C  CB  . ASN A 1 104 ? 29.872  16.155 45.344  1.00 92.56  ? 296 ASN A CB  1 
ATOM   651  C  CG  . ASN A 1 104 ? 28.453  16.711 45.306  1.00 92.33  ? 296 ASN A CG  1 
ATOM   652  O  OD1 . ASN A 1 104 ? 28.059  17.530 46.144  1.00 91.06  ? 296 ASN A OD1 1 
ATOM   653  N  ND2 . ASN A 1 104 ? 27.682  16.277 44.309  1.00 89.64  ? 296 ASN A ND2 1 
ATOM   654  N  N   . GLY A 1 105 ? 29.644  17.544 48.462  1.00 93.57  ? 297 GLY A N   1 
ATOM   655  C  CA  . GLY A 1 105 ? 29.660  18.776 49.251  1.00 95.02  ? 297 GLY A CA  1 
ATOM   656  C  C   . GLY A 1 105 ? 29.399  20.052 48.469  1.00 95.82  ? 297 GLY A C   1 
ATOM   657  O  O   . GLY A 1 105 ? 30.085  21.059 48.660  1.00 94.78  ? 297 GLY A O   1 
ATOM   658  N  N   . LYS A 1 106 ? 28.394  20.020 47.599  1.00 96.96  ? 298 LYS A N   1 
ATOM   659  C  CA  . LYS A 1 106 ? 28.136  21.155 46.720  1.00 96.40  ? 298 LYS A CA  1 
ATOM   660  C  C   . LYS A 1 106 ? 26.890  21.964 47.070  1.00 96.45  ? 298 LYS A C   1 
ATOM   661  O  O   . LYS A 1 106 ? 25.799  21.420 47.218  1.00 97.29  ? 298 LYS A O   1 
ATOM   662  C  CB  . LYS A 1 106 ? 28.140  20.718 45.260  1.00 94.50  ? 298 LYS A CB  1 
ATOM   663  C  CG  . LYS A 1 106 ? 29.500  20.219 44.833  1.00 94.67  ? 298 LYS A CG  1 
ATOM   664  C  CD  . LYS A 1 106 ? 29.738  20.443 43.367  1.00 95.41  ? 298 LYS A CD  1 
ATOM   665  C  CE  . LYS A 1 106 ? 31.224  20.499 43.061  1.00 93.64  ? 298 LYS A CE  1 
ATOM   666  N  NZ  . LYS A 1 106 ? 31.828  21.816 43.402  1.00 92.36  ? 298 LYS A NZ  1 
ATOM   667  N  N   . LEU A 1 107 ? 27.097  23.270 47.217  1.00 96.46  ? 299 LEU A N   1 
ATOM   668  C  CA  . LEU A 1 107 ? 26.052  24.236 47.510  1.00 94.90  ? 299 LEU A CA  1 
ATOM   669  C  C   . LEU A 1 107 ? 25.679  24.976 46.255  1.00 94.39  ? 299 LEU A C   1 
ATOM   670  O  O   . LEU A 1 107 ? 26.459  25.043 45.303  1.00 93.91  ? 299 LEU A O   1 
ATOM   671  C  CB  . LEU A 1 107 ? 26.571  25.311 48.454  1.00 95.36  ? 299 LEU A CB  1 
ATOM   672  C  CG  . LEU A 1 107 ? 27.094  25.065 49.851  1.00 97.44  ? 299 LEU A CG  1 
ATOM   673  C  CD1 . LEU A 1 107 ? 28.502  24.488 49.825  1.00 96.58  ? 299 LEU A CD1 1 
ATOM   674  C  CD2 . LEU A 1 107 ? 27.076  26.429 50.506  1.00 99.39  ? 299 LEU A CD2 1 
ATOM   675  N  N   . TYR A 1 108 ? 24.496  25.577 46.280  1.00 94.79  ? 300 TYR A N   1 
ATOM   676  C  CA  . TYR A 1 108 ? 24.105  26.543 45.266  1.00 95.34  ? 300 TYR A CA  1 
ATOM   677  C  C   . TYR A 1 108 ? 23.441  27.733 45.937  1.00 97.31  ? 300 TYR A C   1 
ATOM   678  O  O   . TYR A 1 108 ? 22.487  27.581 46.705  1.00 98.70  ? 300 TYR A O   1 
ATOM   679  C  CB  . TYR A 1 108 ? 23.231  25.889 44.190  1.00 92.34  ? 300 TYR A CB  1 
ATOM   680  C  CG  . TYR A 1 108 ? 23.966  24.762 43.504  1.00 90.87  ? 300 TYR A CG  1 
ATOM   681  C  CD1 . TYR A 1 108 ? 23.869  23.454 43.977  1.00 89.57  ? 300 TYR A CD1 1 
ATOM   682  C  CD2 . TYR A 1 108 ? 24.804  25.011 42.419  1.00 90.63  ? 300 TYR A CD2 1 
ATOM   683  C  CE1 . TYR A 1 108 ? 24.562  22.422 43.377  1.00 89.68  ? 300 TYR A CE1 1 
ATOM   684  C  CE2 . TYR A 1 108 ? 25.502  23.982 41.807  1.00 91.26  ? 300 TYR A CE2 1 
ATOM   685  C  CZ  . TYR A 1 108 ? 25.376  22.691 42.295  1.00 91.67  ? 300 TYR A CZ  1 
ATOM   686  O  OH  . TYR A 1 108 ? 26.063  21.662 41.700  1.00 92.91  ? 300 TYR A OH  1 
ATOM   687  N  N   . VAL A 1 109 ? 23.991  28.911 45.666  1.00 97.80  ? 301 VAL A N   1 
ATOM   688  C  CA  . VAL A 1 109 ? 23.527  30.150 46.260  1.00 99.53  ? 301 VAL A CA  1 
ATOM   689  C  C   . VAL A 1 109 ? 23.052  31.102 45.173  1.00 101.48 ? 301 VAL A C   1 
ATOM   690  O  O   . VAL A 1 109 ? 23.706  31.257 44.142  1.00 105.38 ? 301 VAL A O   1 
ATOM   691  C  CB  . VAL A 1 109 ? 24.657  30.838 47.041  1.00 101.30 ? 301 VAL A CB  1 
ATOM   692  C  CG1 . VAL A 1 109 ? 24.154  32.114 47.700  1.00 103.24 ? 301 VAL A CG1 1 
ATOM   693  C  CG2 . VAL A 1 109 ? 25.240  29.893 48.085  1.00 103.98 ? 301 VAL A CG2 1 
ATOM   694  N  N   . SER A 1 110 ? 21.908  31.732 45.400  1.00 100.36 ? 302 SER A N   1 
ATOM   695  C  CA  . SER A 1 110 ? 21.486  32.836 44.559  1.00 100.40 ? 302 SER A CA  1 
ATOM   696  C  C   . SER A 1 110 ? 21.498  34.106 45.393  1.00 100.85 ? 302 SER A C   1 
ATOM   697  O  O   . SER A 1 110 ? 20.890  34.156 46.467  1.00 104.48 ? 302 SER A O   1 
ATOM   698  C  CB  . SER A 1 110 ? 20.098  32.583 43.979  1.00 102.07 ? 302 SER A CB  1 
ATOM   699  O  OG  . SER A 1 110 ? 19.154  32.366 45.009  1.00 104.22 ? 302 SER A OG  1 
ATOM   700  N  N   . TYR A 1 111 ? 22.208  35.119 44.907  1.00 97.91  ? 303 TYR A N   1 
ATOM   701  C  CA  . TYR A 1 111 ? 22.295  36.401 45.594  1.00 94.67  ? 303 TYR A CA  1 
ATOM   702  C  C   . TYR A 1 111 ? 22.418  37.584 44.640  1.00 95.83  ? 303 TYR A C   1 
ATOM   703  O  O   . TYR A 1 111 ? 22.587  37.418 43.426  1.00 95.57  ? 303 TYR A O   1 
ATOM   704  C  CB  . TYR A 1 111 ? 23.450  36.402 46.596  1.00 93.01  ? 303 TYR A CB  1 
ATOM   705  C  CG  . TYR A 1 111 ? 24.841  36.295 45.992  1.00 92.58  ? 303 TYR A CG  1 
ATOM   706  C  CD1 . TYR A 1 111 ? 25.610  37.434 45.740  1.00 90.92  ? 303 TYR A CD1 1 
ATOM   707  C  CD2 . TYR A 1 111 ? 25.402  35.052 45.711  1.00 92.64  ? 303 TYR A CD2 1 
ATOM   708  C  CE1 . TYR A 1 111 ? 26.895  37.332 45.205  1.00 90.74  ? 303 TYR A CE1 1 
ATOM   709  C  CE2 . TYR A 1 111 ? 26.679  34.942 45.180  1.00 92.69  ? 303 TYR A CE2 1 
ATOM   710  C  CZ  . TYR A 1 111 ? 27.424  36.079 44.927  1.00 92.14  ? 303 TYR A CZ  1 
ATOM   711  O  OH  . TYR A 1 111 ? 28.693  35.943 44.395  1.00 91.65  ? 303 TYR A OH  1 
ATOM   712  N  N   . THR A 1 112 ? 22.337  38.779 45.215  1.00 95.62  ? 304 THR A N   1 
ATOM   713  C  CA  . THR A 1 112 ? 22.359  40.022 44.466  1.00 96.94  ? 304 THR A CA  1 
ATOM   714  C  C   . THR A 1 112 ? 23.690  40.723 44.705  1.00 99.11  ? 304 THR A C   1 
ATOM   715  O  O   . THR A 1 112 ? 24.135  40.827 45.849  1.00 100.86 ? 304 THR A O   1 
ATOM   716  C  CB  . THR A 1 112 ? 21.187  40.918 44.902  1.00 97.41  ? 304 THR A CB  1 
ATOM   717  O  OG1 . THR A 1 112 ? 19.976  40.443 44.305  1.00 97.31  ? 304 THR A OG1 1 
ATOM   718  C  CG2 . THR A 1 112 ? 21.403  42.353 44.488  1.00 99.71  ? 304 THR A CG2 1 
ATOM   719  N  N   . THR A 1 113 ? 24.315  41.204 43.628  1.00 98.28  ? 305 THR A N   1 
ATOM   720  C  CA  . THR A 1 113 ? 25.669  41.757 43.697  1.00 97.59  ? 305 THR A CA  1 
ATOM   721  C  C   . THR A 1 113 ? 25.901  42.955 42.780  1.00 100.66 ? 305 THR A C   1 
ATOM   722  O  O   . THR A 1 113 ? 25.114  43.212 41.866  1.00 100.46 ? 305 THR A O   1 
ATOM   723  C  CB  . THR A 1 113 ? 26.739  40.669 43.397  1.00 96.27  ? 305 THR A CB  1 
ATOM   724  O  OG1 . THR A 1 113 ? 28.046  41.253 43.443  1.00 96.86  ? 305 THR A OG1 1 
ATOM   725  C  CG2 . THR A 1 113 ? 26.524  40.035 42.025  1.00 94.98  ? 305 THR A CG2 1 
ATOM   726  N  N   . ASN A 1 114 ? 26.994  43.674 43.046  1.00 104.19 ? 306 ASN A N   1 
ATOM   727  C  CA  . ASN A 1 114 ? 27.478  44.762 42.194  1.00 105.90 ? 306 ASN A CA  1 
ATOM   728  C  C   . ASN A 1 114 ? 28.874  44.467 41.646  1.00 105.40 ? 306 ASN A C   1 
ATOM   729  O  O   . ASN A 1 114 ? 29.036  44.061 40.494  1.00 105.05 ? 306 ASN A O   1 
ATOM   730  C  CB  . ASN A 1 114 ? 27.503  46.087 42.966  1.00 108.67 ? 306 ASN A CB  1 
ATOM   731  C  CG  . ASN A 1 114 ? 26.118  46.700 43.144  1.00 111.18 ? 306 ASN A CG  1 
ATOM   732  O  OD1 . ASN A 1 114 ? 25.093  46.021 43.026  1.00 112.98 ? 306 ASN A OD1 1 
ATOM   733  N  ND2 . ASN A 1 114 ? 26.087  47.995 43.440  1.00 111.23 ? 306 ASN A ND2 1 
ATOM   734  N  N   . ARG A 1 117 ? 31.653  44.118 39.238  1.00 167.98 ? 309 ARG A N   1 
ATOM   735  C  CA  . ARG A 1 117 ? 31.527  45.262 38.342  1.00 167.78 ? 309 ARG A CA  1 
ATOM   736  C  C   . ARG A 1 117 ? 31.077  44.822 36.946  1.00 167.70 ? 309 ARG A C   1 
ATOM   737  O  O   . ARG A 1 117 ? 31.867  44.282 36.164  1.00 167.61 ? 309 ARG A O   1 
ATOM   738  C  CB  . ARG A 1 117 ? 32.847  46.041 38.271  1.00 167.66 ? 309 ARG A CB  1 
ATOM   739  C  CG  . ARG A 1 117 ? 32.727  47.422 37.639  1.00 167.57 ? 309 ARG A CG  1 
ATOM   740  C  CD  . ARG A 1 117 ? 34.093  48.047 37.401  1.00 167.59 ? 309 ARG A CD  1 
ATOM   741  N  NE  . ARG A 1 117 ? 33.993  49.362 36.767  1.00 167.49 ? 309 ARG A NE  1 
ATOM   742  C  CZ  . ARG A 1 117 ? 33.970  49.573 35.453  1.00 167.57 ? 309 ARG A CZ  1 
ATOM   743  N  NH1 . ARG A 1 117 ? 34.038  48.556 34.602  1.00 167.55 ? 309 ARG A NH1 1 
ATOM   744  N  NH2 . ARG A 1 117 ? 33.877  50.810 34.984  1.00 167.61 ? 309 ARG A NH2 1 
ATOM   745  N  N   . TRP A 1 118 ? 29.799  45.053 36.654  1.00 167.19 ? 310 TRP A N   1 
ATOM   746  C  CA  . TRP A 1 118 ? 29.207  44.733 35.355  1.00 166.35 ? 310 TRP A CA  1 
ATOM   747  C  C   . TRP A 1 118 ? 29.323  45.930 34.410  1.00 165.07 ? 310 TRP A C   1 
ATOM   748  O  O   . TRP A 1 118 ? 29.066  47.072 34.803  1.00 164.96 ? 310 TRP A O   1 
ATOM   749  C  CB  . TRP A 1 118 ? 27.741  44.319 35.537  1.00 167.08 ? 310 TRP A CB  1 
ATOM   750  C  CG  . TRP A 1 118 ? 26.989  43.972 34.265  1.00 167.52 ? 310 TRP A CG  1 
ATOM   751  C  CD1 . TRP A 1 118 ? 26.433  44.849 33.374  1.00 167.60 ? 310 TRP A CD1 1 
ATOM   752  C  CD2 . TRP A 1 118 ? 26.682  42.657 33.772  1.00 167.61 ? 310 TRP A CD2 1 
ATOM   753  N  NE1 . TRP A 1 118 ? 25.816  44.165 32.354  1.00 167.60 ? 310 TRP A NE1 1 
ATOM   754  C  CE2 . TRP A 1 118 ? 25.952  42.820 32.572  1.00 167.44 ? 310 TRP A CE2 1 
ATOM   755  C  CE3 . TRP A 1 118 ? 26.959  41.358 34.223  1.00 167.52 ? 310 TRP A CE3 1 
ATOM   756  C  CZ2 . TRP A 1 118 ? 25.496  41.733 31.816  1.00 167.05 ? 310 TRP A CZ2 1 
ATOM   757  C  CZ3 . TRP A 1 118 ? 26.503  40.276 33.470  1.00 167.26 ? 310 TRP A CZ3 1 
ATOM   758  C  CH2 . TRP A 1 118 ? 25.780  40.474 32.280  1.00 167.14 ? 310 TRP A CH2 1 
ATOM   759  N  N   . ALA A 1 119 ? 29.717  45.656 33.168  1.00 163.29 ? 311 ALA A N   1 
ATOM   760  C  CA  . ALA A 1 119 ? 29.868  46.688 32.143  1.00 161.75 ? 311 ALA A CA  1 
ATOM   761  C  C   . ALA A 1 119 ? 29.482  46.166 30.753  1.00 160.11 ? 311 ALA A C   1 
ATOM   762  O  O   . ALA A 1 119 ? 30.050  46.583 29.737  1.00 160.13 ? 311 ALA A O   1 
ATOM   763  C  CB  . ALA A 1 119 ? 31.299  47.238 32.144  1.00 161.94 ? 311 ALA A CB  1 
ATOM   764  N  N   . ILE A 1 120 ? 28.508  45.256 30.721  1.00 157.33 ? 312 ILE A N   1 
ATOM   765  C  CA  . ILE A 1 120 ? 28.049  44.639 29.471  1.00 154.68 ? 312 ILE A CA  1 
ATOM   766  C  C   . ILE A 1 120 ? 26.623  45.093 29.111  1.00 151.04 ? 312 ILE A C   1 
ATOM   767  O  O   . ILE A 1 120 ? 26.024  44.603 28.147  1.00 150.34 ? 312 ILE A O   1 
ATOM   768  C  CB  . ILE A 1 120 ? 28.141  43.080 29.519  1.00 155.25 ? 312 ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 120 ? 29.287  42.618 30.433  1.00 155.44 ? 312 ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 120 ? 28.304  42.504 28.105  1.00 154.85 ? 312 ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 120 ? 29.159  41.185 30.941  1.00 155.19 ? 312 ILE A CD1 1 
ATOM   772  N  N   . GLY A 1 121 ? 26.094  46.039 29.887  1.00 147.20 ? 313 GLY A N   1 
ATOM   773  C  CA  . GLY A 1 121 ? 24.758  46.587 29.650  1.00 142.79 ? 313 GLY A CA  1 
ATOM   774  C  C   . GLY A 1 121 ? 24.206  47.406 30.807  1.00 138.93 ? 313 GLY A C   1 
ATOM   775  O  O   . GLY A 1 121 ? 24.951  47.767 31.723  1.00 139.31 ? 313 GLY A O   1 
ATOM   776  N  N   . PRO A 1 122 ? 22.892  47.713 30.769  1.00 134.94 ? 314 PRO A N   1 
ATOM   777  C  CA  . PRO A 1 122 ? 22.243  48.485 31.829  1.00 131.22 ? 314 PRO A CA  1 
ATOM   778  C  C   . PRO A 1 122 ? 21.922  47.629 33.051  1.00 127.07 ? 314 PRO A C   1 
ATOM   779  O  O   . PRO A 1 122 ? 21.596  46.447 32.908  1.00 126.88 ? 314 PRO A O   1 
ATOM   780  C  CB  . PRO A 1 122 ? 20.948  48.958 31.166  1.00 131.66 ? 314 PRO A CB  1 
ATOM   781  C  CG  . PRO A 1 122 ? 20.623  47.890 30.188  1.00 132.40 ? 314 PRO A CG  1 
ATOM   782  C  CD  . PRO A 1 122 ? 21.942  47.345 29.699  1.00 133.81 ? 314 PRO A CD  1 
ATOM   783  N  N   . HIS A 1 123 ? 22.017  48.228 34.237  1.00 122.71 ? 315 HIS A N   1 
ATOM   784  C  CA  . HIS A 1 123 ? 21.689  47.534 35.486  1.00 118.46 ? 315 HIS A CA  1 
ATOM   785  C  C   . HIS A 1 123 ? 21.632  48.455 36.704  1.00 114.66 ? 315 HIS A C   1 
ATOM   786  O  O   . HIS A 1 123 ? 22.210  49.547 36.709  1.00 112.72 ? 315 HIS A O   1 
ATOM   787  C  CB  . HIS A 1 123 ? 22.676  46.378 35.748  1.00 118.67 ? 315 HIS A CB  1 
ATOM   788  C  CG  . HIS A 1 123 ? 24.051  46.824 36.146  1.00 118.68 ? 315 HIS A CG  1 
ATOM   789  N  ND1 . HIS A 1 123 ? 24.617  46.493 37.358  1.00 118.47 ? 315 HIS A ND1 1 
ATOM   790  C  CD2 . HIS A 1 123 ? 24.972  47.573 35.494  1.00 118.74 ? 315 HIS A CD2 1 
ATOM   791  C  CE1 . HIS A 1 123 ? 25.827  47.018 37.437  1.00 118.16 ? 315 HIS A CE1 1 
ATOM   792  N  NE2 . HIS A 1 123 ? 26.066  47.680 36.319  1.00 118.83 ? 315 HIS A NE2 1 
ATOM   793  N  N   . ASP A 1 124 ? 20.900  48.006 37.721  1.00 111.17 ? 316 ASP A N   1 
ATOM   794  C  CA  . ASP A 1 124 ? 21.066  48.507 39.078  1.00 106.93 ? 316 ASP A CA  1 
ATOM   795  C  C   . ASP A 1 124 ? 22.004  47.530 39.774  1.00 102.28 ? 316 ASP A C   1 
ATOM   796  O  O   . ASP A 1 124 ? 22.896  47.931 40.523  1.00 99.80  ? 316 ASP A O   1 
ATOM   797  C  CB  . ASP A 1 124 ? 19.728  48.568 39.815  1.00 107.42 ? 316 ASP A CB  1 
ATOM   798  C  CG  . ASP A 1 124 ? 19.845  49.225 41.182  1.00 108.47 ? 316 ASP A CG  1 
ATOM   799  O  OD1 . ASP A 1 124 ? 20.062  50.455 41.235  1.00 109.53 ? 316 ASP A OD1 1 
ATOM   800  O  OD2 . ASP A 1 124 ? 19.721  48.516 42.203  1.00 108.13 ? 316 ASP A OD2 1 
ATOM   801  N  N   . HIS A 1 125 ? 21.790  46.245 39.495  1.00 99.92  ? 317 HIS A N   1 
ATOM   802  C  CA  . HIS A 1 125 ? 22.592  45.149 40.028  1.00 99.76  ? 317 HIS A CA  1 
ATOM   803  C  C   . HIS A 1 125 ? 22.411  43.903 39.156  1.00 100.06 ? 317 HIS A C   1 
ATOM   804  O  O   . HIS A 1 125 ? 21.677  43.939 38.166  1.00 101.12 ? 317 HIS A O   1 
ATOM   805  C  CB  . HIS A 1 125 ? 22.203  44.853 41.482  1.00 99.41  ? 317 HIS A CB  1 
ATOM   806  C  CG  . HIS A 1 125 ? 20.752  44.534 41.674  1.00 98.73  ? 317 HIS A CG  1 
ATOM   807  N  ND1 . HIS A 1 125 ? 20.271  43.243 41.712  1.00 97.99  ? 317 HIS A ND1 1 
ATOM   808  C  CD2 . HIS A 1 125 ? 19.677  45.340 41.848  1.00 98.92  ? 317 HIS A CD2 1 
ATOM   809  C  CE1 . HIS A 1 125 ? 18.965  43.266 41.906  1.00 97.84  ? 317 HIS A CE1 1 
ATOM   810  N  NE2 . HIS A 1 125 ? 18.578  44.526 41.987  1.00 98.55  ? 317 HIS A NE2 1 
ATOM   811  N  N   . ILE A 1 126 ? 23.088  42.812 39.512  1.00 99.29  ? 318 ILE A N   1 
ATOM   812  C  CA  . ILE A 1 126 ? 22.904  41.531 38.817  1.00 99.28  ? 318 ILE A CA  1 
ATOM   813  C  C   . ILE A 1 126 ? 22.605  40.391 39.791  1.00 98.94  ? 318 ILE A C   1 
ATOM   814  O  O   . ILE A 1 126 ? 23.342  40.176 40.756  1.00 101.22 ? 318 ILE A O   1 
ATOM   815  C  CB  . ILE A 1 126 ? 24.105  41.160 37.894  1.00 98.92  ? 318 ILE A CB  1 
ATOM   816  C  CG1 . ILE A 1 126 ? 25.435  41.248 38.652  1.00 100.62 ? 318 ILE A CG1 1 
ATOM   817  C  CG2 . ILE A 1 126 ? 24.131  42.054 36.659  1.00 98.02  ? 318 ILE A CG2 1 
ATOM   818  C  CD1 . ILE A 1 126 ? 26.656  40.768 37.858  1.00 101.04 ? 318 ILE A CD1 1 
ATOM   819  N  N   . LEU A 1 127 ? 21.507  39.677 39.543  1.00 96.28  ? 319 LEU A N   1 
ATOM   820  C  CA  . LEU A 1 127 ? 21.164  38.496 40.328  1.00 93.13  ? 319 LEU A CA  1 
ATOM   821  C  C   . LEU A 1 127 ? 22.059  37.353 39.894  1.00 94.20  ? 319 LEU A C   1 
ATOM   822  O  O   . LEU A 1 127 ? 22.046  36.949 38.730  1.00 94.35  ? 319 LEU A O   1 
ATOM   823  C  CB  . LEU A 1 127 ? 19.695  38.107 40.147  1.00 90.58  ? 319 LEU A CB  1 
ATOM   824  C  CG  . LEU A 1 127 ? 19.126  37.052 41.109  1.00 88.59  ? 319 LEU A CG  1 
ATOM   825  C  CD1 . LEU A 1 127 ? 17.613  37.141 41.154  1.00 89.75  ? 319 LEU A CD1 1 
ATOM   826  C  CD2 . LEU A 1 127 ? 19.560  35.632 40.765  1.00 86.65  ? 319 LEU A CD2 1 
ATOM   827  N  N   . ARG A 1 128 ? 22.823  36.830 40.845  1.00 94.47  ? 320 ARG A N   1 
ATOM   828  C  CA  . ARG A 1 128 ? 23.813  35.807 40.562  1.00 94.75  ? 320 ARG A CA  1 
ATOM   829  C  C   . ARG A 1 128 ? 23.351  34.438 41.066  1.00 93.60  ? 320 ARG A C   1 
ATOM   830  O  O   . ARG A 1 128 ? 22.541  34.351 41.988  1.00 94.00  ? 320 ARG A O   1 
ATOM   831  C  CB  . ARG A 1 128 ? 25.136  36.209 41.210  1.00 97.30  ? 320 ARG A CB  1 
ATOM   832  C  CG  . ARG A 1 128 ? 26.376  35.624 40.574  1.00 100.18 ? 320 ARG A CG  1 
ATOM   833  C  CD  . ARG A 1 128 ? 27.624  36.223 41.207  1.00 102.27 ? 320 ARG A CD  1 
ATOM   834  N  NE  . ARG A 1 128 ? 28.361  37.087 40.288  1.00 105.24 ? 320 ARG A NE  1 
ATOM   835  C  CZ  . ARG A 1 128 ? 29.258  37.994 40.666  1.00 106.05 ? 320 ARG A CZ  1 
ATOM   836  N  NH1 . ARG A 1 128 ? 29.521  38.179 41.956  1.00 106.05 ? 320 ARG A NH1 1 
ATOM   837  N  NH2 . ARG A 1 128 ? 29.883  38.730 39.752  1.00 104.56 ? 320 ARG A NH2 1 
ATOM   838  N  N   . VAL A 1 129 ? 23.842  33.380 40.424  1.00 92.30  ? 321 VAL A N   1 
ATOM   839  C  CA  . VAL A 1 129 ? 23.690  32.002 40.910  1.00 89.24  ? 321 VAL A CA  1 
ATOM   840  C  C   . VAL A 1 129 ? 25.072  31.349 40.866  1.00 89.20  ? 321 VAL A C   1 
ATOM   841  O  O   . VAL A 1 129 ? 25.672  31.207 39.792  1.00 87.50  ? 321 VAL A O   1 
ATOM   842  C  CB  . VAL A 1 129 ? 22.674  31.173 40.072  1.00 85.84  ? 321 VAL A CB  1 
ATOM   843  C  CG1 . VAL A 1 129 ? 22.674  29.708 40.506  1.00 81.52  ? 321 VAL A CG1 1 
ATOM   844  C  CG2 . VAL A 1 129 ? 21.279  31.756 40.188  1.00 86.04  ? 321 VAL A CG2 1 
ATOM   845  N  N   . VAL A 1 130 ? 25.572  30.970 42.039  1.00 87.86  ? 322 VAL A N   1 
ATOM   846  C  CA  . VAL A 1 130 ? 26.946  30.496 42.185  1.00 89.17  ? 322 VAL A CA  1 
ATOM   847  C  C   . VAL A 1 130 ? 26.985  29.124 42.847  1.00 91.72  ? 322 VAL A C   1 
ATOM   848  O  O   . VAL A 1 130 ? 26.127  28.803 43.674  1.00 93.81  ? 322 VAL A O   1 
ATOM   849  C  CB  . VAL A 1 130 ? 27.780  31.483 43.039  1.00 87.95  ? 322 VAL A CB  1 
ATOM   850  C  CG1 . VAL A 1 130 ? 29.215  31.015 43.166  1.00 89.54  ? 322 VAL A CG1 1 
ATOM   851  C  CG2 . VAL A 1 130 ? 27.745  32.869 42.445  1.00 86.39  ? 322 VAL A CG2 1 
ATOM   852  N  N   . GLU A 1 131 ? 27.981  28.318 42.484  1.00 91.11  ? 323 GLU A N   1 
ATOM   853  C  CA  . GLU A 1 131 ? 28.221  27.061 43.179  1.00 91.89  ? 323 GLU A CA  1 
ATOM   854  C  C   . GLU A 1 131 ? 29.378  27.177 44.166  1.00 92.44  ? 323 GLU A C   1 
ATOM   855  O  O   . GLU A 1 131 ? 30.476  27.620 43.808  1.00 91.02  ? 323 GLU A O   1 
ATOM   856  C  CB  . GLU A 1 131 ? 28.486  25.926 42.193  1.00 92.74  ? 323 GLU A CB  1 
ATOM   857  C  CG  . GLU A 1 131 ? 28.854  24.610 42.866  1.00 95.22  ? 323 GLU A CG  1 
ATOM   858  C  CD  . GLU A 1 131 ? 29.356  23.573 41.890  1.00 97.57  ? 323 GLU A CD  1 
ATOM   859  O  OE1 . GLU A 1 131 ? 30.591  23.482 41.693  1.00 96.15  ? 323 GLU A OE1 1 
ATOM   860  O  OE2 . GLU A 1 131 ? 28.513  22.851 41.317  1.00 99.26  ? 323 GLU A OE2 1 
ATOM   861  N  N   . TYR A 1 132 ? 29.118  26.776 45.409  1.00 93.13  ? 324 TYR A N   1 
ATOM   862  C  CA  . TYR A 1 132 ? 30.164  26.674 46.427  1.00 95.16  ? 324 TYR A CA  1 
ATOM   863  C  C   . TYR A 1 132 ? 30.429  25.229 46.840  1.00 95.73  ? 324 TYR A C   1 
ATOM   864  O  O   . TYR A 1 132 ? 29.636  24.332 46.557  1.00 97.91  ? 324 TYR A O   1 
ATOM   865  C  CB  . TYR A 1 132 ? 29.823  27.529 47.654  1.00 95.51  ? 324 TYR A CB  1 
ATOM   866  C  CG  . TYR A 1 132 ? 30.177  28.982 47.475  1.00 95.15  ? 324 TYR A CG  1 
ATOM   867  C  CD1 . TYR A 1 132 ? 31.463  29.441 47.743  1.00 94.78  ? 324 TYR A CD1 1 
ATOM   868  C  CD2 . TYR A 1 132 ? 29.232  29.895 47.017  1.00 94.38  ? 324 TYR A CD2 1 
ATOM   869  C  CE1 . TYR A 1 132 ? 31.794  30.770 47.567  1.00 95.13  ? 324 TYR A CE1 1 
ATOM   870  C  CE2 . TYR A 1 132 ? 29.553  31.226 46.838  1.00 93.97  ? 324 TYR A CE2 1 
ATOM   871  C  CZ  . TYR A 1 132 ? 30.834  31.658 47.114  1.00 95.31  ? 324 TYR A CZ  1 
ATOM   872  O  OH  . TYR A 1 132 ? 31.159  32.982 46.934  1.00 96.92  ? 324 TYR A OH  1 
ATOM   873  N  N   . THR A 1 133 ? 31.553  25.013 47.514  1.00 93.94  ? 325 THR A N   1 
ATOM   874  C  CA  . THR A 1 133 ? 31.908  23.690 48.008  1.00 91.29  ? 325 THR A CA  1 
ATOM   875  C  C   . THR A 1 133 ? 32.414  23.821 49.443  1.00 89.81  ? 325 THR A C   1 
ATOM   876  O  O   . THR A 1 133 ? 33.140  24.764 49.752  1.00 91.49  ? 325 THR A O   1 
ATOM   877  C  CB  . THR A 1 133 ? 32.972  23.034 47.098  1.00 89.22  ? 325 THR A CB  1 
ATOM   878  O  OG1 . THR A 1 133 ? 32.584  23.185 45.726  1.00 86.78  ? 325 THR A OG1 1 
ATOM   879  C  CG2 . THR A 1 133 ? 33.123  21.553 47.405  1.00 88.75  ? 325 THR A CG2 1 
ATOM   880  N  N   . VAL A 1 134 ? 32.013  22.894 50.315  1.00 87.75  ? 326 VAL A N   1 
ATOM   881  C  CA  . VAL A 1 134 ? 32.503  22.870 51.699  1.00 88.84  ? 326 VAL A CA  1 
ATOM   882  C  C   . VAL A 1 134 ? 34.011  22.733 51.776  1.00 89.76  ? 326 VAL A C   1 
ATOM   883  O  O   . VAL A 1 134 ? 34.628  22.044 50.955  1.00 90.84  ? 326 VAL A O   1 
ATOM   884  C  CB  . VAL A 1 134 ? 31.924  21.705 52.551  1.00 89.43  ? 326 VAL A CB  1 
ATOM   885  C  CG1 . VAL A 1 134 ? 31.042  22.231 53.669  1.00 90.48  ? 326 VAL A CG1 1 
ATOM   886  C  CG2 . VAL A 1 134 ? 31.216  20.684 51.695  1.00 89.40  ? 326 VAL A CG2 1 
ATOM   887  N  N   . SER A 1 135 ? 34.593  23.385 52.777  1.00 88.03  ? 327 SER A N   1 
ATOM   888  C  CA  . SER A 1 135 ? 35.982  23.165 53.127  1.00 87.19  ? 327 SER A CA  1 
ATOM   889  C  C   . SER A 1 135 ? 36.216  21.669 53.302  1.00 88.55  ? 327 SER A C   1 
ATOM   890  O  O   . SER A 1 135 ? 35.505  21.008 54.059  1.00 85.65  ? 327 SER A O   1 
ATOM   891  C  CB  . SER A 1 135 ? 36.320  23.900 54.421  1.00 85.44  ? 327 SER A CB  1 
ATOM   892  O  OG  . SER A 1 135 ? 37.670  23.704 54.781  1.00 88.35  ? 327 SER A OG  1 
ATOM   893  N  N   . ARG A 1 136 ? 37.198  21.135 52.581  1.00 93.75  ? 328 ARG A N   1 
ATOM   894  C  CA  . ARG A 1 136 ? 37.601  19.742 52.767  1.00 96.51  ? 328 ARG A CA  1 
ATOM   895  C  C   . ARG A 1 136 ? 38.072  19.493 54.197  1.00 93.84  ? 328 ARG A C   1 
ATOM   896  O  O   . ARG A 1 136 ? 38.076  18.357 54.664  1.00 92.58  ? 328 ARG A O   1 
ATOM   897  C  CB  . ARG A 1 136 ? 38.663  19.292 51.745  1.00 97.82  ? 328 ARG A CB  1 
ATOM   898  C  CG  . ARG A 1 136 ? 39.150  20.344 50.743  1.00 100.85 ? 328 ARG A CG  1 
ATOM   899  C  CD  . ARG A 1 136 ? 40.343  19.809 49.931  1.00 102.81 ? 328 ARG A CD  1 
ATOM   900  N  NE  . ARG A 1 136 ? 40.501  20.475 48.633  1.00 108.37 ? 328 ARG A NE  1 
ATOM   901  C  CZ  . ARG A 1 136 ? 41.546  20.322 47.814  1.00 112.13 ? 328 ARG A CZ  1 
ATOM   902  N  NH1 . ARG A 1 136 ? 42.564  19.527 48.139  1.00 113.26 ? 328 ARG A NH1 1 
ATOM   903  N  NH2 . ARG A 1 136 ? 41.579  20.974 46.657  1.00 112.36 ? 328 ARG A NH2 1 
ATOM   904  N  N   . LYS A 1 137 ? 38.426  20.575 54.890  1.00 94.66  ? 329 LYS A N   1 
ATOM   905  C  CA  . LYS A 1 137 ? 39.000  20.508 56.234  1.00 95.70  ? 329 LYS A CA  1 
ATOM   906  C  C   . LYS A 1 137 ? 38.005  20.809 57.350  1.00 96.40  ? 329 LYS A C   1 
ATOM   907  O  O   . LYS A 1 137 ? 38.206  20.387 58.491  1.00 97.56  ? 329 LYS A O   1 
ATOM   908  C  CB  . LYS A 1 137 ? 40.221  21.429 56.334  1.00 96.76  ? 329 LYS A CB  1 
ATOM   909  C  CG  . LYS A 1 137 ? 41.435  20.887 55.586  1.00 99.19  ? 329 LYS A CG  1 
ATOM   910  C  CD  . LYS A 1 137 ? 42.545  21.907 55.469  1.00 101.10 ? 329 LYS A CD  1 
ATOM   911  C  CE  . LYS A 1 137 ? 43.526  21.496 54.387  1.00 102.27 ? 329 LYS A CE  1 
ATOM   912  N  NZ  . LYS A 1 137 ? 44.748  22.339 54.414  1.00 104.44 ? 329 LYS A NZ  1 
ATOM   913  N  N   . ASN A 1 138 ? 36.939  21.536 57.024  1.00 96.51  ? 330 ASN A N   1 
ATOM   914  C  CA  . ASN A 1 138 ? 35.919  21.877 58.010  1.00 98.56  ? 330 ASN A CA  1 
ATOM   915  C  C   . ASN A 1 138 ? 34.493  21.648 57.483  1.00 99.58  ? 330 ASN A C   1 
ATOM   916  O  O   . ASN A 1 138 ? 33.977  22.448 56.700  1.00 101.53 ? 330 ASN A O   1 
ATOM   917  C  CB  . ASN A 1 138 ? 36.117  23.318 58.512  1.00 100.32 ? 330 ASN A CB  1 
ATOM   918  C  CG  . ASN A 1 138 ? 35.231  23.658 59.712  1.00 102.28 ? 330 ASN A CG  1 
ATOM   919  O  OD1 . ASN A 1 138 ? 34.745  22.773 60.419  1.00 103.24 ? 330 ASN A OD1 1 
ATOM   920  N  ND2 . ASN A 1 138 ? 35.028  24.950 59.947  1.00 102.18 ? 330 ASN A ND2 1 
ATOM   921  N  N   . PRO A 1 139 ? 33.843  20.559 57.928  1.00 98.65  ? 331 PRO A N   1 
ATOM   922  C  CA  . PRO A 1 139 ? 32.521  20.205 57.418  1.00 99.28  ? 331 PRO A CA  1 
ATOM   923  C  C   . PRO A 1 139 ? 31.441  21.221 57.802  1.00 101.87 ? 331 PRO A C   1 
ATOM   924  O  O   . PRO A 1 139 ? 30.301  21.120 57.330  1.00 104.21 ? 331 PRO A O   1 
ATOM   925  C  CB  . PRO A 1 139 ? 32.244  18.852 58.080  1.00 98.68  ? 331 PRO A CB  1 
ATOM   926  C  CG  . PRO A 1 139 ? 33.035  18.883 59.322  1.00 100.83 ? 331 PRO A CG  1 
ATOM   927  C  CD  . PRO A 1 139 ? 34.299  19.607 58.955  1.00 99.60  ? 331 PRO A CD  1 
ATOM   928  N  N   . HIS A 1 140 ? 31.801  22.195 58.635  1.00 101.67 ? 332 HIS A N   1 
ATOM   929  C  CA  . HIS A 1 140 ? 30.856  23.231 59.052  1.00 100.41 ? 332 HIS A CA  1 
ATOM   930  C  C   . HIS A 1 140 ? 31.146  24.604 58.452  1.00 100.59 ? 332 HIS A C   1 
ATOM   931  O  O   . HIS A 1 140 ? 30.624  25.622 58.926  1.00 100.68 ? 332 HIS A O   1 
ATOM   932  C  CB  . HIS A 1 140 ? 30.799  23.312 60.570  1.00 97.87  ? 332 HIS A CB  1 
ATOM   933  C  CG  . HIS A 1 140 ? 30.404  22.026 61.212  1.00 98.36  ? 332 HIS A CG  1 
ATOM   934  N  ND1 . HIS A 1 140 ? 31.226  21.345 62.080  1.00 100.39 ? 332 HIS A ND1 1 
ATOM   935  C  CD2 . HIS A 1 140 ? 29.282  21.282 61.091  1.00 100.16 ? 332 HIS A CD2 1 
ATOM   936  C  CE1 . HIS A 1 140 ? 30.620  20.243 62.482  1.00 102.29 ? 332 HIS A CE1 1 
ATOM   937  N  NE2 . HIS A 1 140 ? 29.441  20.179 61.892  1.00 103.07 ? 332 HIS A NE2 1 
ATOM   938  N  N   . GLN A 1 141 ? 31.962  24.624 57.398  1.00 97.87  ? 333 GLN A N   1 
ATOM   939  C  CA  . GLN A 1 141 ? 32.300  25.862 56.716  1.00 95.06  ? 333 GLN A CA  1 
ATOM   940  C  C   . GLN A 1 141 ? 32.681  25.606 55.261  1.00 95.00  ? 333 GLN A C   1 
ATOM   941  O  O   . GLN A 1 141 ? 33.420  24.670 54.965  1.00 95.21  ? 333 GLN A O   1 
ATOM   942  C  CB  . GLN A 1 141 ? 33.449  26.539 57.445  1.00 94.39  ? 333 GLN A CB  1 
ATOM   943  C  CG  . GLN A 1 141 ? 33.423  28.049 57.401  1.00 94.97  ? 333 GLN A CG  1 
ATOM   944  C  CD  . GLN A 1 141 ? 34.519  28.649 58.252  1.00 94.84  ? 333 GLN A CD  1 
ATOM   945  O  OE1 . GLN A 1 141 ? 34.543  28.472 59.474  1.00 92.57  ? 333 GLN A OE1 1 
ATOM   946  N  NE2 . GLN A 1 141 ? 35.444  29.356 57.609  1.00 95.79  ? 333 GLN A NE2 1 
ATOM   947  N  N   . VAL A 1 142 ? 32.165  26.433 54.357  1.00 94.17  ? 334 VAL A N   1 
ATOM   948  C  CA  . VAL A 1 142 ? 32.529  26.351 52.943  1.00 95.13  ? 334 VAL A CA  1 
ATOM   949  C  C   . VAL A 1 142 ? 33.742  27.248 52.701  1.00 95.89  ? 334 VAL A C   1 
ATOM   950  O  O   . VAL A 1 142 ? 33.881  28.281 53.359  1.00 99.51  ? 334 VAL A O   1 
ATOM   951  C  CB  . VAL A 1 142 ? 31.347  26.776 52.012  1.00 96.09  ? 334 VAL A CB  1 
ATOM   952  C  CG1 . VAL A 1 142 ? 30.065  26.958 52.805  1.00 94.21  ? 334 VAL A CG1 1 
ATOM   953  C  CG2 . VAL A 1 142 ? 31.656  28.056 51.237  1.00 96.66  ? 334 VAL A CG2 1 
ATOM   954  N  N   . ASP A 1 143 ? 34.629  26.875 51.783  1.00 93.86  ? 335 ASP A N   1 
ATOM   955  C  CA  . ASP A 1 143 ? 35.679  27.822 51.431  1.00 97.49  ? 335 ASP A CA  1 
ATOM   956  C  C   . ASP A 1 143 ? 35.299  28.663 50.214  1.00 95.58  ? 335 ASP A C   1 
ATOM   957  O  O   . ASP A 1 143 ? 34.936  28.142 49.164  1.00 93.41  ? 335 ASP A O   1 
ATOM   958  C  CB  . ASP A 1 143 ? 37.094  27.195 51.360  1.00 101.59 ? 335 ASP A CB  1 
ATOM   959  C  CG  . ASP A 1 143 ? 37.367  26.463 50.061  1.00 99.98  ? 335 ASP A CG  1 
ATOM   960  O  OD1 . ASP A 1 143 ? 36.480  25.710 49.612  1.00 102.10 ? 335 ASP A OD1 1 
ATOM   961  O  OD2 . ASP A 1 143 ? 38.481  26.629 49.513  1.00 95.39  ? 335 ASP A OD2 1 
ATOM   962  N  N   . LEU A 1 144 ? 35.379  29.977 50.398  1.00 96.45  ? 336 LEU A N   1 
ATOM   963  C  CA  . LEU A 1 144 ? 34.887  30.957 49.435  1.00 95.90  ? 336 LEU A CA  1 
ATOM   964  C  C   . LEU A 1 144 ? 35.630  30.944 48.099  1.00 94.75  ? 336 LEU A C   1 
ATOM   965  O  O   . LEU A 1 144 ? 35.154  31.528 47.127  1.00 97.07  ? 336 LEU A O   1 
ATOM   966  C  CB  . LEU A 1 144 ? 34.913  32.365 50.054  1.00 96.00  ? 336 LEU A CB  1 
ATOM   967  C  CG  . LEU A 1 144 ? 34.384  32.522 51.487  1.00 95.92  ? 336 LEU A CG  1 
ATOM   968  C  CD1 . LEU A 1 144 ? 34.717  33.895 52.041  1.00 96.50  ? 336 LEU A CD1 1 
ATOM   969  C  CD2 . LEU A 1 144 ? 32.882  32.270 51.565  1.00 97.37  ? 336 LEU A CD2 1 
ATOM   970  N  N   . ARG A 1 145 ? 36.779  30.269 48.052  1.00 93.05  ? 337 ARG A N   1 
ATOM   971  C  CA  . ARG A 1 145 ? 37.607  30.204 46.838  1.00 91.98  ? 337 ARG A CA  1 
ATOM   972  C  C   . ARG A 1 145 ? 37.004  29.310 45.755  1.00 89.08  ? 337 ARG A C   1 
ATOM   973  O  O   . ARG A 1 145 ? 37.465  29.325 44.615  1.00 90.58  ? 337 ARG A O   1 
ATOM   974  C  CB  . ARG A 1 145 ? 39.022  29.713 47.163  1.00 92.11  ? 337 ARG A CB  1 
ATOM   975  C  CG  . ARG A 1 145 ? 39.654  30.344 48.403  1.00 94.04  ? 337 ARG A CG  1 
ATOM   976  C  CD  . ARG A 1 145 ? 41.113  29.934 48.562  1.00 95.46  ? 337 ARG A CD  1 
ATOM   977  N  NE  . ARG A 1 145 ? 41.299  28.483 48.635  1.00 99.18  ? 337 ARG A NE  1 
ATOM   978  C  CZ  . ARG A 1 145 ? 41.622  27.807 49.736  1.00 101.03 ? 337 ARG A CZ  1 
ATOM   979  N  NH1 . ARG A 1 145 ? 41.805  28.439 50.889  1.00 104.07 ? 337 ARG A NH1 1 
ATOM   980  N  NH2 . ARG A 1 145 ? 41.768  26.491 49.682  1.00 100.37 ? 337 ARG A NH2 1 
ATOM   981  N  N   . THR A 1 146 ? 35.975  28.543 46.116  1.00 85.43  ? 338 THR A N   1 
ATOM   982  C  CA  . THR A 1 146 ? 35.362  27.557 45.221  1.00 79.82  ? 338 THR A CA  1 
ATOM   983  C  C   . THR A 1 146 ? 34.212  28.118 44.396  1.00 81.42  ? 338 THR A C   1 
ATOM   984  O  O   . THR A 1 146 ? 33.534  27.368 43.681  1.00 82.65  ? 338 THR A O   1 
ATOM   985  C  CB  . THR A 1 146 ? 34.835  26.335 45.998  1.00 76.77  ? 338 THR A CB  1 
ATOM   986  O  OG1 . THR A 1 146 ? 34.125  26.776 47.160  1.00 76.70  ? 338 THR A OG1 1 
ATOM   987  C  CG2 . THR A 1 146 ? 35.972  25.424 46.418  1.00 76.11  ? 338 THR A CG2 1 
ATOM   988  N  N   . ALA A 1 147 ? 33.994  29.428 44.498  1.00 82.11  ? 339 ALA A N   1 
ATOM   989  C  CA  . ALA A 1 147 ? 32.895  30.099 43.797  1.00 82.83  ? 339 ALA A CA  1 
ATOM   990  C  C   . ALA A 1 147 ? 32.932  29.830 42.293  1.00 83.25  ? 339 ALA A C   1 
ATOM   991  O  O   . ALA A 1 147 ? 33.937  30.102 41.633  1.00 88.58  ? 339 ALA A O   1 
ATOM   992  C  CB  . ALA A 1 147 ? 32.930  31.598 44.072  1.00 81.99  ? 339 ALA A CB  1 
ATOM   993  N  N   . ARG A 1 148 ? 31.850  29.263 41.772  1.00 78.73  ? 340 ARG A N   1 
ATOM   994  C  CA  . ARG A 1 148 ? 31.687  29.045 40.344  0.50 79.60  ? 340 ARG A CA  1 
ATOM   995  C  C   . ARG A 1 148 ? 30.414  29.723 39.896  1.00 84.48  ? 340 ARG A C   1 
ATOM   996  O  O   . ARG A 1 148 ? 29.315  29.218 40.141  1.00 89.15  ? 340 ARG A O   1 
ATOM   997  C  CB  . ARG A 1 148 ? 31.569  27.559 40.022  0.50 76.39  ? 340 ARG A CB  1 
ATOM   998  C  CG  . ARG A 1 148 ? 32.864  26.848 39.814  0.50 74.62  ? 340 ARG A CG  1 
ATOM   999  C  CD  . ARG A 1 148 ? 32.823  26.042 38.525  0.50 75.59  ? 340 ARG A CD  1 
ATOM   1000 N  NE  . ARG A 1 148 ? 31.632  25.205 38.384  0.50 77.15  ? 340 ARG A NE  1 
ATOM   1001 C  CZ  . ARG A 1 148 ? 31.460  24.021 38.967  0.50 77.57  ? 340 ARG A CZ  1 
ATOM   1002 N  NH1 . ARG A 1 148 ? 32.398  23.517 39.762  0.50 78.67  ? 340 ARG A NH1 1 
ATOM   1003 N  NH2 . ARG A 1 148 ? 30.338  23.341 38.765  0.50 75.54  ? 340 ARG A NH2 1 
ATOM   1004 N  N   . VAL A 1 149 ? 30.554  30.872 39.250  1.00 86.70  ? 341 VAL A N   1 
ATOM   1005 C  CA  . VAL A 1 149 ? 29.398  31.579 38.718  1.00 88.77  ? 341 VAL A CA  1 
ATOM   1006 C  C   . VAL A 1 149 ? 28.718  30.692 37.676  1.00 89.57  ? 341 VAL A C   1 
ATOM   1007 O  O   . VAL A 1 149 ? 29.365  30.213 36.750  1.00 90.61  ? 341 VAL A O   1 
ATOM   1008 C  CB  . VAL A 1 149 ? 29.791  32.954 38.125  1.00 90.41  ? 341 VAL A CB  1 
ATOM   1009 C  CG1 . VAL A 1 149 ? 28.671  33.525 37.272  1.00 91.71  ? 341 VAL A CG1 1 
ATOM   1010 C  CG2 . VAL A 1 149 ? 30.156  33.931 39.242  1.00 91.74  ? 341 VAL A CG2 1 
ATOM   1011 N  N   . PHE A 1 150 ? 27.422  30.455 37.866  1.00 91.39  ? 342 PHE A N   1 
ATOM   1012 C  CA  . PHE A 1 150 ? 26.612  29.670 36.940  1.00 91.12  ? 342 PHE A CA  1 
ATOM   1013 C  C   . PHE A 1 150 ? 25.827  30.604 36.036  1.00 92.01  ? 342 PHE A C   1 
ATOM   1014 O  O   . PHE A 1 150 ? 25.833  30.458 34.814  1.00 90.19  ? 342 PHE A O   1 
ATOM   1015 C  CB  . PHE A 1 150 ? 25.640  28.778 37.721  1.00 91.52  ? 342 PHE A CB  1 
ATOM   1016 C  CG  . PHE A 1 150 ? 26.160  27.394 38.006  1.00 91.77  ? 342 PHE A CG  1 
ATOM   1017 C  CD1 . PHE A 1 150 ? 25.287  26.314 38.038  1.00 91.85  ? 342 PHE A CD1 1 
ATOM   1018 C  CD2 . PHE A 1 150 ? 27.511  27.162 38.239  1.00 92.29  ? 342 PHE A CD2 1 
ATOM   1019 C  CE1 . PHE A 1 150 ? 25.747  25.028 38.302  1.00 91.67  ? 342 PHE A CE1 1 
ATOM   1020 C  CE2 . PHE A 1 150 ? 27.978  25.877 38.498  1.00 92.65  ? 342 PHE A CE2 1 
ATOM   1021 C  CZ  . PHE A 1 150 ? 27.091  24.809 38.530  1.00 91.89  ? 342 PHE A CZ  1 
ATOM   1022 N  N   . LEU A 1 151 ? 25.150  31.567 36.658  1.00 95.29  ? 343 LEU A N   1 
ATOM   1023 C  CA  . LEU A 1 151 ? 24.255  32.478 35.957  1.00 98.17  ? 343 LEU A CA  1 
ATOM   1024 C  C   . LEU A 1 151 ? 24.371  33.883 36.516  1.00 99.05  ? 343 LEU A C   1 
ATOM   1025 O  O   . LEU A 1 151 ? 24.430  34.075 37.733  1.00 101.91 ? 343 LEU A O   1 
ATOM   1026 C  CB  . LEU A 1 151 ? 22.800  32.007 36.087  1.00 98.77  ? 343 LEU A CB  1 
ATOM   1027 C  CG  . LEU A 1 151 ? 22.314  30.823 35.245  1.00 99.10  ? 343 LEU A CG  1 
ATOM   1028 C  CD1 . LEU A 1 151 ? 21.013  30.259 35.798  1.00 97.63  ? 343 LEU A CD1 1 
ATOM   1029 C  CD2 . LEU A 1 151 ? 22.150  31.225 33.784  1.00 100.83 ? 343 LEU A CD2 1 
ATOM   1030 N  N   . GLU A 1 152 ? 24.404  34.861 35.621  1.00 97.45  ? 344 GLU A N   1 
ATOM   1031 C  CA  . GLU A 1 152 ? 24.344  36.259 36.011  1.00 97.29  ? 344 GLU A CA  1 
ATOM   1032 C  C   . GLU A 1 152 ? 23.162  36.892 35.299  1.00 96.59  ? 344 GLU A C   1 
ATOM   1033 O  O   . GLU A 1 152 ? 23.113  36.938 34.066  1.00 97.55  ? 344 GLU A O   1 
ATOM   1034 C  CB  . GLU A 1 152 ? 25.644  36.980 35.660  1.00 99.32  ? 344 GLU A CB  1 
ATOM   1035 C  CG  . GLU A 1 152 ? 26.837  36.586 36.528  1.00 99.69  ? 344 GLU A CG  1 
ATOM   1036 C  CD  . GLU A 1 152 ? 28.174  37.061 35.962  1.00 98.37  ? 344 GLU A CD  1 
ATOM   1037 O  OE1 . GLU A 1 152 ? 28.917  37.746 36.700  1.00 98.12  ? 344 GLU A OE1 1 
ATOM   1038 O  OE2 . GLU A 1 152 ? 28.479  36.749 34.787  1.00 95.90  ? 344 GLU A OE2 1 
ATOM   1039 N  N   . VAL A 1 153 ? 22.198  37.358 36.085  1.00 94.41  ? 345 VAL A N   1 
ATOM   1040 C  CA  . VAL A 1 153 ? 20.969  37.931 35.552  1.00 90.52  ? 345 VAL A CA  1 
ATOM   1041 C  C   . VAL A 1 153 ? 20.910  39.425 35.866  1.00 90.46  ? 345 VAL A C   1 
ATOM   1042 O  O   . VAL A 1 153 ? 20.646  39.820 37.003  1.00 89.59  ? 345 VAL A O   1 
ATOM   1043 C  CB  . VAL A 1 153 ? 19.720  37.202 36.109  1.00 88.41  ? 345 VAL A CB  1 
ATOM   1044 C  CG1 . VAL A 1 153 ? 18.441  37.816 35.562  1.00 88.59  ? 345 VAL A CG1 1 
ATOM   1045 C  CG2 . VAL A 1 153 ? 19.776  35.714 35.781  1.00 86.69  ? 345 VAL A CG2 1 
ATOM   1046 N  N   . ALA A 1 154 ? 21.173  40.245 34.851  1.00 91.68  ? 346 ALA A N   1 
ATOM   1047 C  CA  . ALA A 1 154 ? 21.095  41.699 34.985  1.00 93.13  ? 346 ALA A CA  1 
ATOM   1048 C  C   . ALA A 1 154 ? 19.717  42.133 35.487  1.00 95.37  ? 346 ALA A C   1 
ATOM   1049 O  O   . ALA A 1 154 ? 18.688  41.700 34.956  1.00 95.61  ? 346 ALA A O   1 
ATOM   1050 C  CB  . ALA A 1 154 ? 21.425  42.374 33.661  1.00 91.04  ? 346 ALA A CB  1 
ATOM   1051 N  N   . GLU A 1 155 ? 19.703  42.970 36.520  1.00 96.68  ? 347 GLU A N   1 
ATOM   1052 C  CA  . GLU A 1 155 ? 18.450  43.477 37.063  1.00 99.36  ? 347 GLU A CA  1 
ATOM   1053 C  C   . GLU A 1 155 ? 18.396  45.000 37.038  1.00 100.42 ? 347 GLU A C   1 
ATOM   1054 O  O   . GLU A 1 155 ? 19.395  45.680 37.290  1.00 100.25 ? 347 GLU A O   1 
ATOM   1055 C  CB  . GLU A 1 155 ? 18.224  42.962 38.483  1.00 101.34 ? 347 GLU A CB  1 
ATOM   1056 C  CG  . GLU A 1 155 ? 16.777  42.566 38.772  1.00 104.20 ? 347 GLU A CG  1 
ATOM   1057 C  CD  . GLU A 1 155 ? 16.461  41.111 38.417  1.00 106.18 ? 347 GLU A CD  1 
ATOM   1058 O  OE1 . GLU A 1 155 ? 17.334  40.409 37.861  1.00 107.25 ? 347 GLU A OE1 1 
ATOM   1059 O  OE2 . GLU A 1 155 ? 15.332  40.660 38.703  1.00 107.57 ? 347 GLU A OE2 1 
ATOM   1060 N  N   . LEU A 1 156 ? 17.215  45.526 36.733  1.00 102.07 ? 348 LEU A N   1 
ATOM   1061 C  CA  . LEU A 1 156 ? 17.019  46.964 36.615  1.00 103.54 ? 348 LEU A CA  1 
ATOM   1062 C  C   . LEU A 1 156 ? 16.369  47.577 37.849  1.00 104.97 ? 348 LEU A C   1 
ATOM   1063 O  O   . LEU A 1 156 ? 16.660  48.722 38.196  1.00 105.85 ? 348 LEU A O   1 
ATOM   1064 C  CB  . LEU A 1 156 ? 16.207  47.293 35.357  1.00 103.89 ? 348 LEU A CB  1 
ATOM   1065 C  CG  . LEU A 1 156 ? 16.986  47.283 34.034  1.00 103.67 ? 348 LEU A CG  1 
ATOM   1066 C  CD1 . LEU A 1 156 ? 16.054  47.123 32.847  1.00 103.82 ? 348 LEU A CD1 1 
ATOM   1067 C  CD2 . LEU A 1 156 ? 17.843  48.535 33.881  1.00 103.06 ? 348 LEU A CD2 1 
ATOM   1068 N  N   . HIS A 1 157 ? 15.501  46.815 38.510  1.00 105.71 ? 349 HIS A N   1 
ATOM   1069 C  CA  . HIS A 1 157 ? 14.773  47.318 39.675  1.00 105.62 ? 349 HIS A CA  1 
ATOM   1070 C  C   . HIS A 1 157 ? 15.097  46.557 40.954  1.00 105.47 ? 349 HIS A C   1 
ATOM   1071 O  O   . HIS A 1 157 ? 15.753  45.515 40.913  1.00 107.43 ? 349 HIS A O   1 
ATOM   1072 C  CB  . HIS A 1 157 ? 13.271  47.322 39.397  1.00 106.06 ? 349 HIS A CB  1 
ATOM   1073 C  CG  . HIS A 1 157 ? 12.865  48.310 38.351  1.00 105.88 ? 349 HIS A CG  1 
ATOM   1074 N  ND1 . HIS A 1 157 ? 12.481  49.599 38.655  1.00 106.04 ? 349 HIS A ND1 1 
ATOM   1075 C  CD2 . HIS A 1 157 ? 12.810  48.208 37.003  1.00 105.56 ? 349 HIS A CD2 1 
ATOM   1076 C  CE1 . HIS A 1 157 ? 12.194  50.244 37.539  1.00 106.59 ? 349 HIS A CE1 1 
ATOM   1077 N  NE2 . HIS A 1 157 ? 12.385  49.422 36.522  1.00 106.90 ? 349 HIS A NE2 1 
ATOM   1078 N  N   . ARG A 1 158 ? 14.641  47.088 42.085  1.00 103.75 ? 350 ARG A N   1 
ATOM   1079 C  CA  . ARG A 1 158 ? 14.929  46.497 43.391  1.00 101.98 ? 350 ARG A CA  1 
ATOM   1080 C  C   . ARG A 1 158 ? 13.699  45.809 43.989  1.00 103.40 ? 350 ARG A C   1 
ATOM   1081 O  O   . ARG A 1 158 ? 13.466  45.874 45.198  1.00 104.00 ? 350 ARG A O   1 
ATOM   1082 C  CB  . ARG A 1 158 ? 15.488  47.562 44.341  1.00 98.92  ? 350 ARG A CB  1 
ATOM   1083 C  CG  . ARG A 1 158 ? 16.687  48.291 43.777  1.00 96.33  ? 350 ARG A CG  1 
ATOM   1084 C  CD  . ARG A 1 158 ? 17.210  49.379 44.693  1.00 94.21  ? 350 ARG A CD  1 
ATOM   1085 N  NE  . ARG A 1 158 ? 18.391  50.016 44.109  1.00 93.26  ? 350 ARG A NE  1 
ATOM   1086 C  CZ  . ARG A 1 158 ? 19.115  50.958 44.702  1.00 92.93  ? 350 ARG A CZ  1 
ATOM   1087 N  NH1 . ARG A 1 158 ? 18.791  51.391 45.914  1.00 93.96  ? 350 ARG A NH1 1 
ATOM   1088 N  NH2 . ARG A 1 158 ? 20.168  51.468 44.082  1.00 92.05  ? 350 ARG A NH2 1 
ATOM   1089 N  N   . LYS A 1 159 ? 12.929  45.149 43.124  1.00 104.81 ? 351 LYS A N   1 
ATOM   1090 C  CA  . LYS A 1 159 ? 11.701  44.435 43.494  1.00 106.84 ? 351 LYS A CA  1 
ATOM   1091 C  C   . LYS A 1 159 ? 11.388  43.355 42.459  1.00 106.47 ? 351 LYS A C   1 
ATOM   1092 O  O   . LYS A 1 159 ? 11.917  43.392 41.344  1.00 106.39 ? 351 LYS A O   1 
ATOM   1093 C  CB  . LYS A 1 159 ? 10.522  45.408 43.592  1.00 109.85 ? 351 LYS A CB  1 
ATOM   1094 C  CG  . LYS A 1 159 ? 10.352  46.062 44.953  1.00 114.14 ? 351 LYS A CG  1 
ATOM   1095 C  CD  . LYS A 1 159 ? 9.622   47.390 44.841  1.00 116.54 ? 351 LYS A CD  1 
ATOM   1096 C  CE  . LYS A 1 159 ? 9.542   48.090 46.189  1.00 118.28 ? 351 LYS A CE  1 
ATOM   1097 N  NZ  . LYS A 1 159 ? 9.020   49.479 46.053  1.00 118.98 ? 351 LYS A NZ  1 
ATOM   1098 N  N   . HIS A 1 160 ? 10.526  42.404 42.828  1.00 105.76 ? 352 HIS A N   1 
ATOM   1099 C  CA  . HIS A 1 160 ? 10.096  41.319 41.930  1.00 106.31 ? 352 HIS A CA  1 
ATOM   1100 C  C   . HIS A 1 160 ? 11.259  40.410 41.526  1.00 104.52 ? 352 HIS A C   1 
ATOM   1101 O  O   . HIS A 1 160 ? 11.266  39.853 40.428  1.00 105.99 ? 352 HIS A O   1 
ATOM   1102 C  CB  . HIS A 1 160 ? 9.428   41.886 40.666  1.00 109.80 ? 352 HIS A CB  1 
ATOM   1103 C  CG  . HIS A 1 160 ? 8.047   42.420 40.884  1.00 114.03 ? 352 HIS A CG  1 
ATOM   1104 N  ND1 . HIS A 1 160 ? 7.751   43.365 41.844  1.00 116.06 ? 352 HIS A ND1 1 
ATOM   1105 C  CD2 . HIS A 1 160 ? 6.884   42.164 40.240  1.00 115.26 ? 352 HIS A CD2 1 
ATOM   1106 C  CE1 . HIS A 1 160 ? 6.462   43.651 41.796  1.00 115.97 ? 352 HIS A CE1 1 
ATOM   1107 N  NE2 . HIS A 1 160 ? 5.913   42.935 40.832  1.00 116.39 ? 352 HIS A NE2 1 
ATOM   1108 N  N   . LEU A 1 161 ? 12.234  40.259 42.417  1.00 100.67 ? 353 LEU A N   1 
ATOM   1109 C  CA  . LEU A 1 161 ? 13.482  39.572 42.091  1.00 98.77  ? 353 LEU A CA  1 
ATOM   1110 C  C   . LEU A 1 161 ? 13.369  38.049 42.045  1.00 99.30  ? 353 LEU A C   1 
ATOM   1111 O  O   . LEU A 1 161 ? 13.787  37.427 41.066  1.00 100.03 ? 353 LEU A O   1 
ATOM   1112 C  CB  . LEU A 1 161 ? 14.586  39.996 43.065  1.00 98.44  ? 353 LEU A CB  1 
ATOM   1113 C  CG  . LEU A 1 161 ? 15.565  41.124 42.702  1.00 98.67  ? 353 LEU A CG  1 
ATOM   1114 C  CD1 . LEU A 1 161 ? 14.921  42.358 42.062  1.00 96.42  ? 353 LEU A CD1 1 
ATOM   1115 C  CD2 . LEU A 1 161 ? 16.310  41.520 43.956  1.00 99.86  ? 353 LEU A CD2 1 
ATOM   1116 N  N   . GLY A 1 162 ? 12.806  37.456 43.098  1.00 99.92  ? 354 GLY A N   1 
ATOM   1117 C  CA  . GLY A 1 162 ? 12.738  35.999 43.228  1.00 98.61  ? 354 GLY A CA  1 
ATOM   1118 C  C   . GLY A 1 162 ? 14.103  35.421 43.557  1.00 99.00  ? 354 GLY A C   1 
ATOM   1119 O  O   . GLY A 1 162 ? 14.852  35.999 44.349  1.00 100.51 ? 354 GLY A O   1 
ATOM   1120 N  N   . GLY A 1 163 ? 14.431  34.283 42.950  1.00 97.53  ? 355 GLY A N   1 
ATOM   1121 C  CA  . GLY A 1 163 ? 15.746  33.666 43.121  1.00 96.13  ? 355 GLY A CA  1 
ATOM   1122 C  C   . GLY A 1 163 ? 15.736  32.338 43.854  1.00 95.93  ? 355 GLY A C   1 
ATOM   1123 O  O   . GLY A 1 163 ? 16.787  31.751 44.100  1.00 96.08  ? 355 GLY A O   1 
ATOM   1124 N  N   . GLN A 1 164 ? 14.545  31.864 44.202  1.00 96.51  ? 356 GLN A N   1 
ATOM   1125 C  CA  . GLN A 1 164 ? 14.380  30.590 44.887  1.00 99.23  ? 356 GLN A CA  1 
ATOM   1126 C  C   . GLN A 1 164 ? 15.072  29.462 44.124  1.00 100.71 ? 356 GLN A C   1 
ATOM   1127 O  O   . GLN A 1 164 ? 14.832  29.277 42.927  1.00 102.89 ? 356 GLN A O   1 
ATOM   1128 C  CB  . GLN A 1 164 ? 12.890  30.286 45.037  1.00 99.91  ? 356 GLN A CB  1 
ATOM   1129 C  CG  . GLN A 1 164 ? 12.551  29.123 45.958  1.00 100.98 ? 356 GLN A CG  1 
ATOM   1130 C  CD  . GLN A 1 164 ? 11.049  28.874 46.043  1.00 101.27 ? 356 GLN A CD  1 
ATOM   1131 O  OE1 . GLN A 1 164 ? 10.240  29.744 45.705  1.00 102.82 ? 356 GLN A OE1 1 
ATOM   1132 N  NE2 . GLN A 1 164 ? 10.671  27.683 46.497  1.00 99.87  ? 356 GLN A NE2 1 
ATOM   1133 N  N   . LEU A 1 165 ? 15.941  28.726 44.816  1.00 99.86  ? 357 LEU A N   1 
ATOM   1134 C  CA  . LEU A 1 165 ? 16.615  27.562 44.230  1.00 98.14  ? 357 LEU A CA  1 
ATOM   1135 C  C   . LEU A 1 165 ? 16.059  26.263 44.809  1.00 98.35  ? 357 LEU A C   1 
ATOM   1136 O  O   . LEU A 1 165 ? 15.700  26.217 45.990  1.00 101.82 ? 357 LEU A O   1 
ATOM   1137 C  CB  . LEU A 1 165 ? 18.127  27.621 44.477  1.00 95.71  ? 357 LEU A CB  1 
ATOM   1138 C  CG  . LEU A 1 165 ? 18.973  28.821 44.040  1.00 95.16  ? 357 LEU A CG  1 
ATOM   1139 C  CD1 . LEU A 1 165 ? 20.433  28.472 44.172  1.00 95.79  ? 357 LEU A CD1 1 
ATOM   1140 C  CD2 . LEU A 1 165 ? 18.688  29.260 42.619  1.00 94.63  ? 357 LEU A CD2 1 
ATOM   1141 N  N   . LEU A 1 166 ? 16.000  25.212 43.991  1.00 94.07  ? 358 LEU A N   1 
ATOM   1142 C  CA  . LEU A 1 166 ? 15.547  23.898 44.464  1.00 93.33  ? 358 LEU A CA  1 
ATOM   1143 C  C   . LEU A 1 166 ? 15.955  22.755 43.535  1.00 96.04  ? 358 LEU A C   1 
ATOM   1144 O  O   . LEU A 1 166 ? 16.086  22.948 42.324  1.00 97.44  ? 358 LEU A O   1 
ATOM   1145 C  CB  . LEU A 1 166 ? 14.025  23.903 44.653  1.00 93.45  ? 358 LEU A CB  1 
ATOM   1146 C  CG  . LEU A 1 166 ? 13.157  23.991 43.390  1.00 93.78  ? 358 LEU A CG  1 
ATOM   1147 C  CD1 . LEU A 1 166 ? 12.690  22.601 42.936  1.00 92.57  ? 358 LEU A CD1 1 
ATOM   1148 C  CD2 . LEU A 1 166 ? 11.975  24.916 43.610  1.00 92.08  ? 358 LEU A CD2 1 
ATOM   1149 N  N   . PHE A 1 167 ? 16.137  21.565 44.105  1.00 98.73  ? 359 PHE A N   1 
ATOM   1150 C  CA  . PHE A 1 167 ? 16.366  20.342 43.315  1.00 100.52 ? 359 PHE A CA  1 
ATOM   1151 C  C   . PHE A 1 167 ? 15.145  19.423 43.319  1.00 98.90  ? 359 PHE A C   1 
ATOM   1152 O  O   . PHE A 1 167 ? 14.753  18.921 44.366  1.00 102.03 ? 359 PHE A O   1 
ATOM   1153 C  CB  . PHE A 1 167 ? 17.548  19.543 43.871  1.00 100.91 ? 359 PHE A CB  1 
ATOM   1154 C  CG  . PHE A 1 167 ? 18.888  20.024 43.414  1.00 100.66 ? 359 PHE A CG  1 
ATOM   1155 C  CD1 . PHE A 1 167 ? 19.717  20.727 44.283  1.00 100.45 ? 359 PHE A CD1 1 
ATOM   1156 C  CD2 . PHE A 1 167 ? 19.337  19.751 42.129  1.00 100.93 ? 359 PHE A CD2 1 
ATOM   1157 C  CE1 . PHE A 1 167 ? 20.967  21.165 43.880  1.00 100.20 ? 359 PHE A CE1 1 
ATOM   1158 C  CE2 . PHE A 1 167 ? 20.587  20.184 41.709  1.00 101.67 ? 359 PHE A CE2 1 
ATOM   1159 C  CZ  . PHE A 1 167 ? 21.403  20.896 42.586  1.00 101.85 ? 359 PHE A CZ  1 
ATOM   1160 N  N   . GLY A 1 168 ? 14.553  19.182 42.157  1.00 96.60  ? 360 GLY A N   1 
ATOM   1161 C  CA  . GLY A 1 168 ? 13.481  18.191 42.062  1.00 97.94  ? 360 GLY A CA  1 
ATOM   1162 C  C   . GLY A 1 168 ? 14.061  16.788 42.084  1.00 98.39  ? 360 GLY A C   1 
ATOM   1163 O  O   . GLY A 1 168 ? 15.279  16.631 42.141  1.00 101.54 ? 360 GLY A O   1 
ATOM   1164 N  N   . PRO A 1 169 ? 13.204  15.751 42.061  1.00 97.67  ? 361 PRO A N   1 
ATOM   1165 C  CA  . PRO A 1 169 ? 13.743  14.409 41.818  1.00 97.24  ? 361 PRO A CA  1 
ATOM   1166 C  C   . PRO A 1 169 ? 14.286  14.283 40.392  1.00 98.60  ? 361 PRO A C   1 
ATOM   1167 O  O   . PRO A 1 169 ? 14.052  15.160 39.550  1.00 97.62  ? 361 PRO A O   1 
ATOM   1168 C  CB  . PRO A 1 169 ? 12.536  13.493 42.041  1.00 96.97  ? 361 PRO A CB  1 
ATOM   1169 C  CG  . PRO A 1 169 ? 11.537  14.337 42.808  1.00 96.76  ? 361 PRO A CG  1 
ATOM   1170 C  CD  . PRO A 1 169 ? 11.750  15.722 42.290  1.00 97.09  ? 361 PRO A CD  1 
ATOM   1171 N  N   . ASP A 1 170 ? 15.018  13.204 40.134  1.00 101.35 ? 362 ASP A N   1 
ATOM   1172 C  CA  . ASP A 1 170 ? 15.838  13.081 38.919  1.00 105.56 ? 362 ASP A CA  1 
ATOM   1173 C  C   . ASP A 1 170 ? 17.051  14.031 38.968  1.00 105.22 ? 362 ASP A C   1 
ATOM   1174 O  O   . ASP A 1 170 ? 17.942  13.959 38.111  1.00 107.55 ? 362 ASP A O   1 
ATOM   1175 C  CB  . ASP A 1 170 ? 15.014  13.273 37.632  1.00 109.37 ? 362 ASP A CB  1 
ATOM   1176 C  CG  . ASP A 1 170 ? 13.921  12.209 37.458  1.00 113.67 ? 362 ASP A CG  1 
ATOM   1177 O  OD1 . ASP A 1 170 ? 13.799  11.650 36.343  1.00 113.67 ? 362 ASP A OD1 1 
ATOM   1178 O  OD2 . ASP A 1 170 ? 13.177  11.934 38.428  1.00 115.60 ? 362 ASP A OD2 1 
ATOM   1179 N  N   . GLY A 1 171 ? 17.065  14.914 39.972  1.00 100.18 ? 363 GLY A N   1 
ATOM   1180 C  CA  . GLY A 1 171 ? 18.252  15.678 40.360  1.00 94.35  ? 363 GLY A CA  1 
ATOM   1181 C  C   . GLY A 1 171 ? 18.573  16.977 39.639  1.00 93.49  ? 363 GLY A C   1 
ATOM   1182 O  O   . GLY A 1 171 ? 19.678  17.505 39.796  1.00 94.42  ? 363 GLY A O   1 
ATOM   1183 N  N   . PHE A 1 172 ? 17.632  17.498 38.852  1.00 92.63  ? 364 PHE A N   1 
ATOM   1184 C  CA  . PHE A 1 172 ? 17.842  18.765 38.143  1.00 92.38  ? 364 PHE A CA  1 
ATOM   1185 C  C   . PHE A 1 172 ? 17.587  19.979 39.042  1.00 93.69  ? 364 PHE A C   1 
ATOM   1186 O  O   . PHE A 1 172 ? 16.692  19.957 39.887  1.00 96.56  ? 364 PHE A O   1 
ATOM   1187 C  CB  . PHE A 1 172 ? 16.964  18.846 36.895  1.00 91.59  ? 364 PHE A CB  1 
ATOM   1188 C  CG  . PHE A 1 172 ? 17.104  17.671 35.966  1.00 92.91  ? 364 PHE A CG  1 
ATOM   1189 C  CD1 . PHE A 1 172 ? 18.357  17.247 35.530  1.00 93.25  ? 364 PHE A CD1 1 
ATOM   1190 C  CD2 . PHE A 1 172 ? 15.974  16.998 35.506  1.00 93.39  ? 364 PHE A CD2 1 
ATOM   1191 C  CE1 . PHE A 1 172 ? 18.482  16.162 34.658  1.00 92.14  ? 364 PHE A CE1 1 
ATOM   1192 C  CE2 . PHE A 1 172 ? 16.090  15.911 34.633  1.00 90.98  ? 364 PHE A CE2 1 
ATOM   1193 C  CZ  . PHE A 1 172 ? 17.344  15.495 34.212  1.00 91.33  ? 364 PHE A CZ  1 
ATOM   1194 N  N   . LEU A 1 173 ? 18.374  21.034 38.855  1.00 93.26  ? 365 LEU A N   1 
ATOM   1195 C  CA  . LEU A 1 173 ? 18.234  22.253 39.651  1.00 92.95  ? 365 LEU A CA  1 
ATOM   1196 C  C   . LEU A 1 173 ? 17.249  23.210 39.004  1.00 95.10  ? 365 LEU A C   1 
ATOM   1197 O  O   . LEU A 1 173 ? 17.333  23.471 37.800  1.00 97.10  ? 365 LEU A O   1 
ATOM   1198 C  CB  . LEU A 1 173 ? 19.588  22.946 39.822  1.00 92.83  ? 365 LEU A CB  1 
ATOM   1199 C  CG  . LEU A 1 173 ? 19.655  24.279 40.573  1.00 92.21  ? 365 LEU A CG  1 
ATOM   1200 C  CD1 . LEU A 1 173 ? 19.470  24.063 42.063  1.00 93.08  ? 365 LEU A CD1 1 
ATOM   1201 C  CD2 . LEU A 1 173 ? 20.980  24.972 40.302  1.00 92.25  ? 365 LEU A CD2 1 
ATOM   1202 N  N   . TYR A 1 174 ? 16.327  23.728 39.814  1.00 94.73  ? 366 TYR A N   1 
ATOM   1203 C  CA  . TYR A 1 174 ? 15.327  24.697 39.366  1.00 92.80  ? 366 TYR A CA  1 
ATOM   1204 C  C   . TYR A 1 174 ? 15.592  26.069 39.972  1.00 92.44  ? 366 TYR A C   1 
ATOM   1205 O  O   . TYR A 1 174 ? 15.880  26.189 41.169  1.00 94.00  ? 366 TYR A O   1 
ATOM   1206 C  CB  . TYR A 1 174 ? 13.922  24.241 39.749  1.00 92.73  ? 366 TYR A CB  1 
ATOM   1207 C  CG  . TYR A 1 174 ? 13.431  23.005 39.025  1.00 93.32  ? 366 TYR A CG  1 
ATOM   1208 C  CD1 . TYR A 1 174 ? 13.830  21.729 39.431  1.00 93.90  ? 366 TYR A CD1 1 
ATOM   1209 C  CD2 . TYR A 1 174 ? 12.546  23.107 37.951  1.00 92.17  ? 366 TYR A CD2 1 
ATOM   1210 C  CE1 . TYR A 1 174 ? 13.377  20.588 38.776  1.00 93.38  ? 366 TYR A CE1 1 
ATOM   1211 C  CE2 . TYR A 1 174 ? 12.082  21.971 37.294  1.00 93.00  ? 366 TYR A CE2 1 
ATOM   1212 C  CZ  . TYR A 1 174 ? 12.504  20.714 37.711  1.00 93.04  ? 366 TYR A CZ  1 
ATOM   1213 O  OH  . TYR A 1 174 ? 12.063  19.581 37.060  1.00 92.26  ? 366 TYR A OH  1 
ATOM   1214 N  N   . ILE A 1 175 ? 15.503  27.097 39.139  1.00 90.48  ? 367 ILE A N   1 
ATOM   1215 C  CA  . ILE A 1 175 ? 15.682  28.470 39.588  1.00 92.18  ? 367 ILE A CA  1 
ATOM   1216 C  C   . ILE A 1 175 ? 14.397  29.218 39.258  1.00 94.63  ? 367 ILE A C   1 
ATOM   1217 O  O   . ILE A 1 175 ? 13.918  29.162 38.123  1.00 96.34  ? 367 ILE A O   1 
ATOM   1218 C  CB  . ILE A 1 175 ? 16.909  29.157 38.906  1.00 93.70  ? 367 ILE A CB  1 
ATOM   1219 C  CG1 . ILE A 1 175 ? 18.234  28.471 39.282  1.00 93.94  ? 367 ILE A CG1 1 
ATOM   1220 C  CG2 . ILE A 1 175 ? 16.990  30.636 39.281  1.00 92.62  ? 367 ILE A CG2 1 
ATOM   1221 C  CD1 . ILE A 1 175 ? 18.701  27.383 38.329  1.00 93.26  ? 367 ILE A CD1 1 
ATOM   1222 N  N   . ILE A 1 176 ? 13.831  29.900 40.251  1.00 96.65  ? 368 ILE A N   1 
ATOM   1223 C  CA  . ILE A 1 176 ? 12.567  30.623 40.066  1.00 97.20  ? 368 ILE A CA  1 
ATOM   1224 C  C   . ILE A 1 176 ? 12.789  32.129 40.106  1.00 96.35  ? 368 ILE A C   1 
ATOM   1225 O  O   . ILE A 1 176 ? 12.835  32.740 41.172  1.00 95.67  ? 368 ILE A O   1 
ATOM   1226 C  CB  . ILE A 1 176 ? 11.484  30.202 41.100  1.00 96.80  ? 368 ILE A CB  1 
ATOM   1227 C  CG1 . ILE A 1 176 ? 11.274  28.682 41.074  1.00 96.54  ? 368 ILE A CG1 1 
ATOM   1228 C  CG2 . ILE A 1 176 ? 10.170  30.932 40.823  1.00 94.50  ? 368 ILE A CG2 1 
ATOM   1229 C  CD1 . ILE A 1 176 ? 10.632  28.118 42.322  1.00 96.01  ? 368 ILE A CD1 1 
ATOM   1230 N  N   . LEU A 1 177 ? 12.926  32.719 38.928  1.00 97.43  ? 369 LEU A N   1 
ATOM   1231 C  CA  . LEU A 1 177 ? 13.215  34.137 38.826  1.00 99.75  ? 369 LEU A CA  1 
ATOM   1232 C  C   . LEU A 1 177 ? 11.941  34.935 38.629  1.00 100.70 ? 369 LEU A C   1 
ATOM   1233 O  O   . LEU A 1 177 ? 11.047  34.511 37.897  1.00 102.22 ? 369 LEU A O   1 
ATOM   1234 C  CB  . LEU A 1 177 ? 14.188  34.394 37.676  1.00 99.99  ? 369 LEU A CB  1 
ATOM   1235 C  CG  . LEU A 1 177 ? 15.574  33.761 37.818  1.00 98.38  ? 369 LEU A CG  1 
ATOM   1236 C  CD1 . LEU A 1 177 ? 16.343  33.863 36.506  1.00 98.49  ? 369 LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A 1 177 ? 16.344  34.408 38.952  1.00 96.47  ? 369 LEU A CD2 1 
ATOM   1238 N  N   . GLY A 1 178 ? 11.865  36.088 39.285  1.00 100.75 ? 370 GLY A N   1 
ATOM   1239 C  CA  . GLY A 1 178 ? 10.703  36.959 39.177  1.00 101.92 ? 370 GLY A CA  1 
ATOM   1240 C  C   . GLY A 1 178 ? 10.747  37.942 38.019  1.00 104.70 ? 370 GLY A C   1 
ATOM   1241 O  O   . GLY A 1 178 ? 11.710  37.985 37.251  1.00 104.81 ? 370 GLY A O   1 
ATOM   1242 N  N   . ASP A 1 179 ? 9.680   38.732 37.919  1.00 106.83 ? 371 ASP A N   1 
ATOM   1243 C  CA  . ASP A 1 179 ? 9.491   39.782 36.921  1.00 105.91 ? 371 ASP A CA  1 
ATOM   1244 C  C   . ASP A 1 179 ? 10.720  40.660 36.795  1.00 103.84 ? 371 ASP A C   1 
ATOM   1245 O  O   . ASP A 1 179 ? 11.147  40.991 35.692  1.00 104.65 ? 371 ASP A O   1 
ATOM   1246 C  CB  . ASP A 1 179 ? 8.338   40.679 37.378  1.00 110.43 ? 371 ASP A CB  1 
ATOM   1247 C  CG  . ASP A 1 179 ? 7.274   40.874 36.322  1.00 114.51 ? 371 ASP A CG  1 
ATOM   1248 O  OD1 . ASP A 1 179 ? 7.074   39.973 35.480  1.00 116.79 ? 371 ASP A OD1 1 
ATOM   1249 O  OD2 . ASP A 1 179 ? 6.607   41.930 36.359  1.00 116.81 ? 371 ASP A OD2 1 
ATOM   1250 N  N   . GLY A 1 180 ? 11.277  41.034 37.945  1.00 101.83 ? 372 GLY A N   1 
ATOM   1251 C  CA  . GLY A 1 180 ? 12.324  42.046 38.026  1.00 101.60 ? 372 GLY A CA  1 
ATOM   1252 C  C   . GLY A 1 180 ? 11.758  43.422 37.740  1.00 100.26 ? 372 GLY A C   1 
ATOM   1253 O  O   . GLY A 1 180 ? 12.493  44.410 37.689  1.00 98.38  ? 372 GLY A O   1 
ATOM   1254 N  N   . MET A 1 181 ? 10.437  43.467 37.575  1.00 102.20 ? 373 MET A N   1 
ATOM   1255 C  CA  . MET A 1 181 ? 9.721   44.630 37.061  1.00 103.84 ? 373 MET A CA  1 
ATOM   1256 C  C   . MET A 1 181 ? 10.253  45.032 35.681  1.00 106.22 ? 373 MET A C   1 
ATOM   1257 O  O   . MET A 1 181 ? 10.243  46.208 35.307  1.00 106.60 ? 373 MET A O   1 
ATOM   1258 C  CB  . MET A 1 181 ? 9.745   45.790 38.066  1.00 103.65 ? 373 MET A CB  1 
ATOM   1259 C  CG  . MET A 1 181 ? 8.715   45.651 39.186  1.00 102.37 ? 373 MET A CG  1 
ATOM   1260 S  SD  . MET A 1 181 ? 8.616   47.104 40.253  1.00 102.57 ? 373 MET A SD  1 
ATOM   1261 C  CE  . MET A 1 181 ? 8.158   48.394 39.088  1.00 102.45 ? 373 MET A CE  1 
ATOM   1262 N  N   . ILE A 1 182 ? 10.706  44.026 34.931  1.00 108.09 ? 374 ILE A N   1 
ATOM   1263 C  CA  . ILE A 1 182 ? 11.244  44.210 33.586  1.00 109.73 ? 374 ILE A CA  1 
ATOM   1264 C  C   . ILE A 1 182 ? 10.109  44.471 32.595  1.00 111.59 ? 374 ILE A C   1 
ATOM   1265 O  O   . ILE A 1 182 ? 9.194   43.653 32.452  1.00 111.67 ? 374 ILE A O   1 
ATOM   1266 C  CB  . ILE A 1 182 ? 12.102  42.984 33.140  1.00 109.24 ? 374 ILE A CB  1 
ATOM   1267 C  CG1 . ILE A 1 182 ? 13.332  42.793 34.053  1.00 107.87 ? 374 ILE A CG1 1 
ATOM   1268 C  CG2 . ILE A 1 182 ? 12.500  43.084 31.659  1.00 108.96 ? 374 ILE A CG2 1 
ATOM   1269 C  CD1 . ILE A 1 182 ? 14.402  43.889 33.976  1.00 105.99 ? 374 ILE A CD1 1 
ATOM   1270 N  N   . THR A 1 183 ? 10.182  45.620 31.923  1.00 113.32 ? 375 THR A N   1 
ATOM   1271 C  CA  . THR A 1 183 ? 9.137   46.064 30.997  1.00 114.71 ? 375 THR A CA  1 
ATOM   1272 C  C   . THR A 1 183 ? 9.618   46.139 29.538  1.00 115.96 ? 375 THR A C   1 
ATOM   1273 O  O   . THR A 1 183 ? 10.819  46.255 29.275  1.00 114.28 ? 375 THR A O   1 
ATOM   1274 C  CB  . THR A 1 183 ? 8.500   47.408 31.461  1.00 114.17 ? 375 THR A CB  1 
ATOM   1275 O  OG1 . THR A 1 183 ? 7.388   47.734 30.619  1.00 114.29 ? 375 THR A OG1 1 
ATOM   1276 C  CG2 . THR A 1 183 ? 9.515   48.552 31.442  1.00 113.92 ? 375 THR A CG2 1 
ATOM   1277 N  N   . LEU A 1 184 ? 8.664   46.081 28.606  1.00 118.99 ? 376 LEU A N   1 
ATOM   1278 C  CA  . LEU A 1 184 ? 8.934   46.048 27.159  1.00 120.76 ? 376 LEU A CA  1 
ATOM   1279 C  C   . LEU A 1 184 ? 9.774   47.215 26.647  1.00 122.99 ? 376 LEU A C   1 
ATOM   1280 O  O   . LEU A 1 184 ? 10.474  47.080 25.641  1.00 123.14 ? 376 LEU A O   1 
ATOM   1281 C  CB  . LEU A 1 184 ? 7.624   45.975 26.365  1.00 119.81 ? 376 LEU A CB  1 
ATOM   1282 C  CG  . LEU A 1 184 ? 6.711   44.760 26.555  1.00 119.71 ? 376 LEU A CG  1 
ATOM   1283 C  CD1 . LEU A 1 184 ? 5.380   44.988 25.852  1.00 120.07 ? 376 LEU A CD1 1 
ATOM   1284 C  CD2 . LEU A 1 184 ? 7.372   43.472 26.066  1.00 118.97 ? 376 LEU A CD2 1 
ATOM   1285 N  N   . ASP A 1 185 ? 9.688   48.354 27.334  1.00 125.90 ? 377 ASP A N   1 
ATOM   1286 C  CA  . ASP A 1 185 ? 10.493  49.536 27.021  1.00 128.50 ? 377 ASP A CA  1 
ATOM   1287 C  C   . ASP A 1 185 ? 11.987  49.241 27.103  1.00 130.17 ? 377 ASP A C   1 
ATOM   1288 O  O   . ASP A 1 185 ? 12.717  49.441 26.131  1.00 130.99 ? 377 ASP A O   1 
ATOM   1289 C  CB  . ASP A 1 185 ? 10.154  50.691 27.971  1.00 128.96 ? 377 ASP A CB  1 
ATOM   1290 C  CG  . ASP A 1 185 ? 8.949   51.493 27.521  1.00 129.32 ? 377 ASP A CG  1 
ATOM   1291 O  OD1 . ASP A 1 185 ? 8.891   51.883 26.334  1.00 129.22 ? 377 ASP A OD1 1 
ATOM   1292 O  OD2 . ASP A 1 185 ? 8.064   51.750 28.365  1.00 129.90 ? 377 ASP A OD2 1 
ATOM   1293 N  N   . ASP A 1 186 ? 12.420  48.752 28.264  1.00 130.95 ? 378 ASP A N   1 
ATOM   1294 C  CA  . ASP A 1 186 ? 13.836  48.551 28.567  1.00 131.47 ? 378 ASP A CA  1 
ATOM   1295 C  C   . ASP A 1 186 ? 14.420  47.300 27.902  1.00 132.32 ? 378 ASP A C   1 
ATOM   1296 O  O   . ASP A 1 186 ? 15.640  47.189 27.743  1.00 131.43 ? 378 ASP A O   1 
ATOM   1297 C  CB  . ASP A 1 186 ? 14.045  48.509 30.086  1.00 131.02 ? 378 ASP A CB  1 
ATOM   1298 C  CG  . ASP A 1 186 ? 13.354  49.662 30.810  1.00 130.63 ? 378 ASP A CG  1 
ATOM   1299 O  OD1 . ASP A 1 186 ? 13.432  50.815 30.332  1.00 131.09 ? 378 ASP A OD1 1 
ATOM   1300 O  OD2 . ASP A 1 186 ? 12.733  49.412 31.864  1.00 129.97 ? 378 ASP A OD2 1 
ATOM   1301 N  N   . MET A 1 187 ? 13.544  46.370 27.517  1.00 133.92 ? 379 MET A N   1 
ATOM   1302 C  CA  . MET A 1 187 ? 13.944  45.154 26.802  1.00 136.08 ? 379 MET A CA  1 
ATOM   1303 C  C   . MET A 1 187 ? 14.425  45.469 25.384  1.00 135.89 ? 379 MET A C   1 
ATOM   1304 O  O   . MET A 1 187 ? 15.479  44.991 24.955  1.00 135.83 ? 379 MET A O   1 
ATOM   1305 C  CB  . MET A 1 187 ? 12.794  44.138 26.751  1.00 136.32 ? 379 MET A CB  1 
ATOM   1306 C  CG  . MET A 1 187 ? 12.447  43.512 28.095  1.00 137.92 ? 379 MET A CG  1 
ATOM   1307 S  SD  . MET A 1 187 ? 11.416  42.026 28.006  1.00 138.85 ? 379 MET A SD  1 
ATOM   1308 C  CE  . MET A 1 187 ? 12.598  40.785 27.476  1.00 138.12 ? 379 MET A CE  1 
ATOM   1309 N  N   . GLU A 1 188 ? 13.646  46.280 24.670  1.00 135.56 ? 380 GLU A N   1 
ATOM   1310 C  CA  . GLU A 1 188 ? 13.951  46.660 23.290  1.00 134.70 ? 380 GLU A CA  1 
ATOM   1311 C  C   . GLU A 1 188 ? 14.748  47.964 23.210  1.00 133.87 ? 380 GLU A C   1 
ATOM   1312 O  O   . GLU A 1 188 ? 15.111  48.413 22.121  1.00 134.21 ? 380 GLU A O   1 
ATOM   1313 C  CB  . GLU A 1 188 ? 12.662  46.761 22.471  1.00 135.20 ? 380 GLU A CB  1 
ATOM   1314 C  CG  . GLU A 1 188 ? 11.939  45.429 22.291  1.00 136.10 ? 380 GLU A CG  1 
ATOM   1315 C  CD  . GLU A 1 188 ? 10.500  45.588 21.833  1.00 136.97 ? 380 GLU A CD  1 
ATOM   1316 O  OE1 . GLU A 1 188 ? 9.851   46.588 22.213  1.00 137.33 ? 380 GLU A OE1 1 
ATOM   1317 O  OE2 . GLU A 1 188 ? 10.012  44.704 21.098  1.00 137.38 ? 380 GLU A OE2 1 
ATOM   1318 N  N   . GLU A 1 189 ? 15.010  48.561 24.371  1.00 133.06 ? 381 GLU A N   1 
ATOM   1319 C  CA  . GLU A 1 189 ? 15.850  49.752 24.485  1.00 132.36 ? 381 GLU A CA  1 
ATOM   1320 C  C   . GLU A 1 189 ? 17.324  49.343 24.454  1.00 131.61 ? 381 GLU A C   1 
ATOM   1321 O  O   . GLU A 1 189 ? 18.078  49.763 23.570  1.00 131.78 ? 381 GLU A O   1 
ATOM   1322 C  CB  . GLU A 1 189 ? 15.528  50.497 25.789  1.00 132.91 ? 381 GLU A CB  1 
ATOM   1323 C  CG  . GLU A 1 189 ? 16.178  51.867 25.959  1.00 132.73 ? 381 GLU A CG  1 
ATOM   1324 C  CD  . GLU A 1 189 ? 16.028  52.415 27.375  1.00 131.77 ? 381 GLU A CD  1 
ATOM   1325 O  OE1 . GLU A 1 189 ? 16.415  51.713 28.335  1.00 129.90 ? 381 GLU A OE1 1 
ATOM   1326 O  OE2 . GLU A 1 189 ? 15.529  53.552 27.530  1.00 132.17 ? 381 GLU A OE2 1 
ATOM   1327 N  N   . MET A 1 190 ? 17.719  48.519 25.425  1.00 130.14 ? 382 MET A N   1 
ATOM   1328 C  CA  . MET A 1 190 ? 19.085  48.013 25.533  1.00 127.93 ? 382 MET A CA  1 
ATOM   1329 C  C   . MET A 1 190 ? 19.128  46.486 25.491  1.00 125.93 ? 382 MET A C   1 
ATOM   1330 O  O   . MET A 1 190 ? 18.144  45.816 25.815  1.00 125.34 ? 382 MET A O   1 
ATOM   1331 C  CB  . MET A 1 190 ? 19.753  48.529 26.811  1.00 127.92 ? 382 MET A CB  1 
ATOM   1332 C  CG  . MET A 1 190 ? 20.434  49.885 26.667  1.00 127.83 ? 382 MET A CG  1 
ATOM   1333 S  SD  . MET A 1 190 ? 21.838  49.865 25.525  1.00 129.03 ? 382 MET A SD  1 
ATOM   1334 C  CE  . MET A 1 190 ? 23.051  48.917 26.442  1.00 128.55 ? 382 MET A CE  1 
ATOM   1335 N  N   . ASP A 1 191 ? 20.278  45.947 25.096  1.00 124.05 ? 383 ASP A N   1 
ATOM   1336 C  CA  . ASP A 1 191 ? 20.446  44.505 24.930  1.00 122.21 ? 383 ASP A CA  1 
ATOM   1337 C  C   . ASP A 1 191 ? 21.204  43.833 26.071  1.00 121.12 ? 383 ASP A C   1 
ATOM   1338 O  O   . ASP A 1 191 ? 21.266  42.604 26.131  1.00 121.30 ? 383 ASP A O   1 
ATOM   1339 C  CB  . ASP A 1 191 ? 21.126  44.198 23.596  1.00 121.93 ? 383 ASP A CB  1 
ATOM   1340 C  CG  . ASP A 1 191 ? 20.227  44.469 22.413  1.00 121.92 ? 383 ASP A CG  1 
ATOM   1341 O  OD1 . ASP A 1 191 ? 19.767  45.621 22.263  1.00 122.51 ? 383 ASP A OD1 1 
ATOM   1342 O  OD2 . ASP A 1 191 ? 19.980  43.530 21.629  1.00 121.68 ? 383 ASP A OD2 1 
ATOM   1343 N  N   . GLY A 1 192 ? 21.773  44.631 26.972  1.00 119.73 ? 384 GLY A N   1 
ATOM   1344 C  CA  . GLY A 1 192 ? 22.463  44.097 28.149  1.00 118.62 ? 384 GLY A CA  1 
ATOM   1345 C  C   . GLY A 1 192 ? 21.496  43.491 29.153  1.00 117.74 ? 384 GLY A C   1 
ATOM   1346 O  O   . GLY A 1 192 ? 21.818  43.339 30.334  1.00 117.71 ? 384 GLY A O   1 
ATOM   1347 N  N   . LEU A 1 193 ? 20.311  43.137 28.661  1.00 116.32 ? 385 LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 193 ? 19.225  42.607 29.470  1.00 114.60 ? 385 LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 193 ? 19.019  41.118 29.190  1.00 113.64 ? 385 LEU A C   1 
ATOM   1350 O  O   . LEU A 1 193 ? 19.263  40.642 28.082  1.00 112.63 ? 385 LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 193 ? 17.953  43.418 29.200  1.00 114.36 ? 385 LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 193 ? 16.597  43.005 29.764  1.00 114.81 ? 385 LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 193 ? 15.829  44.231 30.224  1.00 115.44 ? 385 LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 193 ? 15.815  42.223 28.719  1.00 114.76 ? 385 LEU A CD2 1 
ATOM   1355 N  N   . SER A 1 194 ? 18.558  40.398 30.209  1.00 114.36 ? 386 SER A N   1 
ATOM   1356 C  CA  . SER A 1 194 ? 18.465  38.942 30.179  1.00 114.23 ? 386 SER A CA  1 
ATOM   1357 C  C   . SER A 1 194 ? 17.123  38.421 29.652  1.00 113.40 ? 386 SER A C   1 
ATOM   1358 O  O   . SER A 1 194 ? 16.097  39.094 29.752  1.00 114.37 ? 386 SER A O   1 
ATOM   1359 C  CB  . SER A 1 194 ? 18.723  38.394 31.588  1.00 114.65 ? 386 SER A CB  1 
ATOM   1360 O  OG  . SER A 1 194 ? 18.812  36.981 31.591  1.00 115.25 ? 386 SER A OG  1 
ATOM   1361 N  N   . ASP A 1 195 ? 17.149  37.213 29.093  1.00 111.26 ? 387 ASP A N   1 
ATOM   1362 C  CA  . ASP A 1 195 ? 15.935  36.491 28.713  1.00 109.62 ? 387 ASP A CA  1 
ATOM   1363 C  C   . ASP A 1 195 ? 15.332  35.739 29.895  1.00 110.12 ? 387 ASP A C   1 
ATOM   1364 O  O   . ASP A 1 195 ? 14.203  35.246 29.815  1.00 110.12 ? 387 ASP A O   1 
ATOM   1365 C  CB  . ASP A 1 195 ? 16.242  35.482 27.605  1.00 108.79 ? 387 ASP A CB  1 
ATOM   1366 C  CG  . ASP A 1 195 ? 15.881  35.990 26.227  1.00 107.38 ? 387 ASP A CG  1 
ATOM   1367 O  OD1 . ASP A 1 195 ? 14.811  36.618 26.071  1.00 107.23 ? 387 ASP A OD1 1 
ATOM   1368 O  OD2 . ASP A 1 195 ? 16.663  35.738 25.292  1.00 106.73 ? 387 ASP A OD2 1 
ATOM   1369 N  N   . PHE A 1 196 ? 16.087  35.667 30.990  1.00 109.58 ? 388 PHE A N   1 
ATOM   1370 C  CA  . PHE A 1 196 ? 15.787  34.756 32.094  1.00 108.38 ? 388 PHE A CA  1 
ATOM   1371 C  C   . PHE A 1 196 ? 14.717  35.208 33.102  1.00 108.32 ? 388 PHE A C   1 
ATOM   1372 O  O   . PHE A 1 196 ? 14.102  34.365 33.765  1.00 110.67 ? 388 PHE A O   1 
ATOM   1373 C  CB  . PHE A 1 196 ? 17.076  34.384 32.834  1.00 108.14 ? 388 PHE A CB  1 
ATOM   1374 C  CG  . PHE A 1 196 ? 18.024  33.526 32.032  1.00 108.67 ? 388 PHE A CG  1 
ATOM   1375 C  CD1 . PHE A 1 196 ? 19.355  33.902 31.874  1.00 107.91 ? 388 PHE A CD1 1 
ATOM   1376 C  CD2 . PHE A 1 196 ? 17.593  32.336 31.445  1.00 108.95 ? 388 PHE A CD2 1 
ATOM   1377 C  CE1 . PHE A 1 196 ? 20.239  33.113 31.145  1.00 107.46 ? 388 PHE A CE1 1 
ATOM   1378 C  CE2 . PHE A 1 196 ? 18.473  31.540 30.713  1.00 108.06 ? 388 PHE A CE2 1 
ATOM   1379 C  CZ  . PHE A 1 196 ? 19.796  31.931 30.563  1.00 107.48 ? 388 PHE A CZ  1 
ATOM   1380 N  N   . THR A 1 197 ? 14.502  36.518 33.222  1.00 104.79 ? 389 THR A N   1 
ATOM   1381 C  CA  . THR A 1 197 ? 13.567  37.062 34.219  1.00 100.97 ? 389 THR A CA  1 
ATOM   1382 C  C   . THR A 1 197 ? 12.124  36.622 33.983  1.00 99.07  ? 389 THR A C   1 
ATOM   1383 O  O   . THR A 1 197 ? 11.682  36.507 32.841  1.00 98.08  ? 389 THR A O   1 
ATOM   1384 C  CB  . THR A 1 197 ? 13.607  38.602 34.284  1.00 100.12 ? 389 THR A CB  1 
ATOM   1385 O  OG1 . THR A 1 197 ? 13.330  39.145 32.991  1.00 99.37  ? 389 THR A OG1 1 
ATOM   1386 C  CG2 . THR A 1 197 ? 14.963  39.087 34.756  1.00 100.94 ? 389 THR A CG2 1 
ATOM   1387 N  N   . GLY A 1 198 ? 11.405  36.378 35.077  1.00 97.39  ? 390 GLY A N   1 
ATOM   1388 C  CA  . GLY A 1 198 ? 10.020  35.925 35.026  1.00 95.31  ? 390 GLY A CA  1 
ATOM   1389 C  C   . GLY A 1 198 ? 9.871   34.492 34.547  1.00 95.00  ? 390 GLY A C   1 
ATOM   1390 O  O   . GLY A 1 198 ? 8.854   34.134 33.959  1.00 95.80  ? 390 GLY A O   1 
ATOM   1391 N  N   . SER A 1 199 ? 10.881  33.667 34.809  1.00 95.70  ? 391 SER A N   1 
ATOM   1392 C  CA  . SER A 1 199 ? 10.893  32.293 34.322  1.00 96.21  ? 391 SER A CA  1 
ATOM   1393 C  C   . SER A 1 199 ? 11.369  31.276 35.347  1.00 97.57  ? 391 SER A C   1 
ATOM   1394 O  O   . SER A 1 199 ? 12.135  31.597 36.259  1.00 99.68  ? 391 SER A O   1 
ATOM   1395 C  CB  . SER A 1 199 ? 11.772  32.189 33.081  1.00 97.02  ? 391 SER A CB  1 
ATOM   1396 O  OG  . SER A 1 199 ? 11.244  32.968 32.026  1.00 101.67 ? 391 SER A OG  1 
ATOM   1397 N  N   . VAL A 1 200 ? 10.901  30.044 35.185  1.00 96.68  ? 392 VAL A N   1 
ATOM   1398 C  CA  . VAL A 1 200 ? 11.474  28.904 35.884  1.00 97.13  ? 392 VAL A CA  1 
ATOM   1399 C  C   . VAL A 1 200 ? 12.532  28.291 34.966  1.00 98.30  ? 392 VAL A C   1 
ATOM   1400 O  O   . VAL A 1 200 ? 12.233  27.912 33.829  1.00 100.20 ? 392 VAL A O   1 
ATOM   1401 C  CB  . VAL A 1 200 ? 10.407  27.836 36.242  1.00 96.66  ? 392 VAL A CB  1 
ATOM   1402 C  CG1 . VAL A 1 200 ? 11.038  26.675 37.013  1.00 96.06  ? 392 VAL A CG1 1 
ATOM   1403 C  CG2 . VAL A 1 200 ? 9.270   28.446 37.048  1.00 96.39  ? 392 VAL A CG2 1 
ATOM   1404 N  N   . LEU A 1 201 ? 13.767  28.210 35.450  1.00 95.79  ? 393 LEU A N   1 
ATOM   1405 C  CA  . LEU A 1 201 ? 14.836  27.574 34.686  1.00 95.64  ? 393 LEU A CA  1 
ATOM   1406 C  C   . LEU A 1 201 ? 15.220  26.242 35.319  1.00 95.79  ? 393 LEU A C   1 
ATOM   1407 O  O   . LEU A 1 201 ? 15.319  26.133 36.546  1.00 96.63  ? 393 LEU A O   1 
ATOM   1408 C  CB  . LEU A 1 201 ? 16.062  28.483 34.597  1.00 96.01  ? 393 LEU A CB  1 
ATOM   1409 C  CG  . LEU A 1 201 ? 15.839  29.987 34.435  1.00 95.50  ? 393 LEU A CG  1 
ATOM   1410 C  CD1 . LEU A 1 201 ? 17.156  30.726 34.604  1.00 93.77  ? 393 LEU A CD1 1 
ATOM   1411 C  CD2 . LEU A 1 201 ? 15.194  30.310 33.097  1.00 95.67  ? 393 LEU A CD2 1 
ATOM   1412 N  N   . ARG A 1 202 ? 15.434  25.237 34.473  1.00 93.50  ? 394 ARG A N   1 
ATOM   1413 C  CA  . ARG A 1 202 ? 15.797  23.897 34.927  1.00 91.49  ? 394 ARG A CA  1 
ATOM   1414 C  C   . ARG A 1 202 ? 17.131  23.488 34.311  1.00 89.75  ? 394 ARG A C   1 
ATOM   1415 O  O   . ARG A 1 202 ? 17.268  23.455 33.087  1.00 88.64  ? 394 ARG A O   1 
ATOM   1416 C  CB  . ARG A 1 202 ? 14.695  22.885 34.576  1.00 92.27  ? 394 ARG A CB  1 
ATOM   1417 C  CG  . ARG A 1 202 ? 14.970  21.467 35.064  1.00 92.05  ? 394 ARG A CG  1 
ATOM   1418 C  CD  . ARG A 1 202 ? 13.784  20.538 34.867  1.00 90.78  ? 394 ARG A CD  1 
ATOM   1419 N  NE  . ARG A 1 202 ? 13.666  20.018 33.508  1.00 91.03  ? 394 ARG A NE  1 
ATOM   1420 C  CZ  . ARG A 1 202 ? 13.011  18.906 33.182  1.00 89.69  ? 394 ARG A CZ  1 
ATOM   1421 N  NH1 . ARG A 1 202 ? 12.410  18.176 34.114  1.00 89.68  ? 394 ARG A NH1 1 
ATOM   1422 N  NH2 . ARG A 1 202 ? 12.964  18.516 31.919  1.00 90.16  ? 394 ARG A NH2 1 
ATOM   1423 N  N   . LEU A 1 203 ? 18.104  23.176 35.166  1.00 89.47  ? 395 LEU A N   1 
ATOM   1424 C  CA  . LEU A 1 203 ? 19.478  22.904 34.719  1.00 88.81  ? 395 LEU A CA  1 
ATOM   1425 C  C   . LEU A 1 203 ? 20.008  21.556 35.198  1.00 89.18  ? 395 LEU A C   1 
ATOM   1426 O  O   . LEU A 1 203 ? 19.591  21.053 36.251  1.00 90.32  ? 395 LEU A O   1 
ATOM   1427 C  CB  . LEU A 1 203 ? 20.434  24.011 35.192  1.00 85.75  ? 395 LEU A CB  1 
ATOM   1428 C  CG  . LEU A 1 203 ? 20.116  25.483 34.920  1.00 82.48  ? 395 LEU A CG  1 
ATOM   1429 C  CD1 . LEU A 1 203 ? 21.231  26.382 35.430  1.00 82.18  ? 395 LEU A CD1 1 
ATOM   1430 C  CD2 . LEU A 1 203 ? 19.883  25.713 33.450  1.00 80.18  ? 395 LEU A CD2 1 
ATOM   1431 N  N   . ASP A 1 204 ? 20.930  20.984 34.424  1.00 86.77  ? 396 ASP A N   1 
ATOM   1432 C  CA  . ASP A 1 204 ? 21.655  19.788 34.849  1.00 87.45  ? 396 ASP A CA  1 
ATOM   1433 C  C   . ASP A 1 204 ? 23.067  20.151 35.312  1.00 89.28  ? 396 ASP A C   1 
ATOM   1434 O  O   . ASP A 1 204 ? 23.976  20.344 34.493  1.00 88.68  ? 396 ASP A O   1 
ATOM   1435 C  CB  . ASP A 1 204 ? 21.708  18.744 33.731  1.00 86.12  ? 396 ASP A CB  1 
ATOM   1436 C  CG  . ASP A 1 204 ? 22.147  17.372 34.226  1.00 86.52  ? 396 ASP A CG  1 
ATOM   1437 O  OD1 . ASP A 1 204 ? 22.277  17.177 35.456  1.00 87.39  ? 396 ASP A OD1 1 
ATOM   1438 O  OD2 . ASP A 1 204 ? 22.355  16.478 33.378  1.00 87.38  ? 396 ASP A OD2 1 
ATOM   1439 N  N   . VAL A 1 205 ? 23.241  20.243 36.629  1.00 88.33  ? 397 VAL A N   1 
ATOM   1440 C  CA  . VAL A 1 205 ? 24.541  20.573 37.206  1.00 88.69  ? 397 VAL A CA  1 
ATOM   1441 C  C   . VAL A 1 205 ? 25.543  19.433 37.061  1.00 90.30  ? 397 VAL A C   1 
ATOM   1442 O  O   . VAL A 1 205 ? 26.754  19.668 37.069  1.00 90.94  ? 397 VAL A O   1 
ATOM   1443 C  CB  . VAL A 1 205 ? 24.449  21.004 38.700  1.00 87.87  ? 397 VAL A CB  1 
ATOM   1444 C  CG1 . VAL A 1 205 ? 23.591  22.246 38.842  1.00 88.60  ? 397 VAL A CG1 1 
ATOM   1445 C  CG2 . VAL A 1 205 ? 23.934  19.871 39.589  1.00 86.73  ? 397 VAL A CG2 1 
ATOM   1446 N  N   . ASP A 1 206 ? 25.034  18.208 36.923  1.00 91.27  ? 398 ASP A N   1 
ATOM   1447 C  CA  . ASP A 1 206 ? 25.873  17.015 36.848  1.00 94.12  ? 398 ASP A CA  1 
ATOM   1448 C  C   . ASP A 1 206 ? 26.526  16.890 35.464  1.00 96.97  ? 398 ASP A C   1 
ATOM   1449 O  O   . ASP A 1 206 ? 26.219  15.982 34.682  1.00 97.40  ? 398 ASP A O   1 
ATOM   1450 C  CB  . ASP A 1 206 ? 25.075  15.757 37.233  1.00 95.39  ? 398 ASP A CB  1 
ATOM   1451 C  CG  . ASP A 1 206 ? 24.558  15.788 38.689  1.00 98.28  ? 398 ASP A CG  1 
ATOM   1452 O  OD1 . ASP A 1 206 ? 24.939  16.684 39.486  1.00 96.93  ? 398 ASP A OD1 1 
ATOM   1453 O  OD2 . ASP A 1 206 ? 23.757  14.895 39.039  1.00 98.83  ? 398 ASP A OD2 1 
ATOM   1454 N  N   . THR A 1 207 ? 27.433  17.827 35.184  1.00 99.58  ? 399 THR A N   1 
ATOM   1455 C  CA  . THR A 1 207 ? 28.158  17.894 33.921  1.00 100.82 ? 399 THR A CA  1 
ATOM   1456 C  C   . THR A 1 207 ? 29.490  17.194 34.053  1.00 101.61 ? 399 THR A C   1 
ATOM   1457 O  O   . THR A 1 207 ? 30.052  17.113 35.146  1.00 102.23 ? 399 THR A O   1 
ATOM   1458 C  CB  . THR A 1 207 ? 28.493  19.349 33.516  1.00 101.83 ? 399 THR A CB  1 
ATOM   1459 O  OG1 . THR A 1 207 ? 27.741  20.277 34.308  1.00 103.46 ? 399 THR A OG1 1 
ATOM   1460 C  CG2 . THR A 1 207 ? 28.227  19.575 32.025  1.00 101.82 ? 399 THR A CG2 1 
ATOM   1461 N  N   . ASP A 1 208 ? 29.989  16.692 32.930  1.00 103.06 ? 400 ASP A N   1 
ATOM   1462 C  CA  . ASP A 1 208 ? 31.356  16.203 32.834  1.00 104.06 ? 400 ASP A CA  1 
ATOM   1463 C  C   . ASP A 1 208 ? 32.144  17.125 31.907  1.00 104.46 ? 400 ASP A C   1 
ATOM   1464 O  O   . ASP A 1 208 ? 33.355  16.981 31.744  1.00 104.61 ? 400 ASP A O   1 
ATOM   1465 C  CB  . ASP A 1 208 ? 31.373  14.757 32.336  1.00 105.43 ? 400 ASP A CB  1 
ATOM   1466 C  CG  . ASP A 1 208 ? 30.763  13.780 33.339  1.00 107.53 ? 400 ASP A CG  1 
ATOM   1467 O  OD1 . ASP A 1 208 ? 31.044  12.569 33.223  1.00 108.58 ? 400 ASP A OD1 1 
ATOM   1468 O  OD2 . ASP A 1 208 ? 30.007  14.210 34.241  1.00 108.17 ? 400 ASP A OD2 1 
ATOM   1469 N  N   . MET A 1 209 ? 31.433  18.080 31.313  1.00 106.36 ? 401 MET A N   1 
ATOM   1470 C  CA  . MET A 1 209 ? 32.025  19.106 30.459  1.00 107.93 ? 401 MET A CA  1 
ATOM   1471 C  C   . MET A 1 209 ? 32.746  20.141 31.312  1.00 106.47 ? 401 MET A C   1 
ATOM   1472 O  O   . MET A 1 209 ? 32.402  20.344 32.481  1.00 105.84 ? 401 MET A O   1 
ATOM   1473 C  CB  . MET A 1 209 ? 30.937  19.806 29.637  1.00 110.34 ? 401 MET A CB  1 
ATOM   1474 C  CG  . MET A 1 209 ? 30.301  18.959 28.548  1.00 111.29 ? 401 MET A CG  1 
ATOM   1475 S  SD  . MET A 1 209 ? 31.106  19.167 26.952  1.00 113.78 ? 401 MET A SD  1 
ATOM   1476 C  CE  . MET A 1 209 ? 30.509  20.780 26.444  1.00 113.67 ? 401 MET A CE  1 
ATOM   1477 N  N   . CYS A 1 210 ? 33.739  20.798 30.719  1.00 105.25 ? 402 CYS A N   1 
ATOM   1478 C  CA  . CYS A 1 210 ? 34.500  21.834 31.413  1.00 103.97 ? 402 CYS A CA  1 
ATOM   1479 C  C   . CYS A 1 210 ? 34.427  23.186 30.696  1.00 104.26 ? 402 CYS A C   1 
ATOM   1480 O  O   . CYS A 1 210 ? 34.929  24.197 31.199  1.00 103.24 ? 402 CYS A O   1 
ATOM   1481 C  CB  . CYS A 1 210 ? 35.949  21.381 31.611  1.00 101.63 ? 402 CYS A CB  1 
ATOM   1482 S  SG  . CYS A 1 210 ? 36.097  19.824 32.543  1.00 99.15  ? 402 CYS A SG  1 
ATOM   1483 N  N   . ASN A 1 211 ? 33.784  23.189 29.529  1.00 105.44 ? 403 ASN A N   1 
ATOM   1484 C  CA  . ASN A 1 211 ? 33.576  24.402 28.737  1.00 105.90 ? 403 ASN A CA  1 
ATOM   1485 C  C   . ASN A 1 211 ? 32.361  25.179 29.218  1.00 105.74 ? 403 ASN A C   1 
ATOM   1486 O  O   . ASN A 1 211 ? 32.330  26.409 29.144  1.00 106.20 ? 403 ASN A O   1 
ATOM   1487 C  CB  . ASN A 1 211 ? 33.403  24.052 27.257  1.00 106.78 ? 403 ASN A CB  1 
ATOM   1488 C  CG  . ASN A 1 211 ? 34.435  23.054 26.770  1.00 108.59 ? 403 ASN A CG  1 
ATOM   1489 O  OD1 . ASN A 1 211 ? 34.563  21.958 27.321  1.00 109.50 ? 403 ASN A OD1 1 
ATOM   1490 N  ND2 . ASN A 1 211 ? 35.174  23.425 25.728  1.00 108.82 ? 403 ASN A ND2 1 
ATOM   1491 N  N   . VAL A 1 212 ? 31.362  24.440 29.700  1.00 104.75 ? 404 VAL A N   1 
ATOM   1492 C  CA  . VAL A 1 212 ? 30.119  25.004 30.215  1.00 102.70 ? 404 VAL A CA  1 
ATOM   1493 C  C   . VAL A 1 212 ? 30.017  24.646 31.703  1.00 102.26 ? 404 VAL A C   1 
ATOM   1494 O  O   . VAL A 1 212 ? 30.380  23.532 32.090  1.00 103.29 ? 404 VAL A O   1 
ATOM   1495 C  CB  . VAL A 1 212 ? 28.880  24.445 29.463  1.00 101.80 ? 404 VAL A CB  1 
ATOM   1496 C  CG1 . VAL A 1 212 ? 27.778  25.489 29.399  1.00 103.65 ? 404 VAL A CG1 1 
ATOM   1497 C  CG2 . VAL A 1 212 ? 29.238  24.010 28.059  1.00 102.01 ? 404 VAL A CG2 1 
ATOM   1498 N  N   . PRO A 1 213 ? 29.546  25.590 32.548  1.00 100.61 ? 405 PRO A N   1 
ATOM   1499 C  CA  . PRO A 1 213 ? 29.378  25.297 33.977  1.00 99.89  ? 405 PRO A CA  1 
ATOM   1500 C  C   . PRO A 1 213 ? 28.205  24.374 34.305  1.00 99.27  ? 405 PRO A C   1 
ATOM   1501 O  O   . PRO A 1 213 ? 28.182  23.777 35.384  1.00 100.08 ? 405 PRO A O   1 
ATOM   1502 C  CB  . PRO A 1 213 ? 29.145  26.678 34.595  1.00 100.06 ? 405 PRO A CB  1 
ATOM   1503 C  CG  . PRO A 1 213 ? 28.568  27.490 33.498  1.00 100.34 ? 405 PRO A CG  1 
ATOM   1504 C  CD  . PRO A 1 213 ? 29.186  26.986 32.229  1.00 100.52 ? 405 PRO A CD  1 
ATOM   1505 N  N   . TYR A 1 214 ? 27.241  24.276 33.390  1.00 98.49  ? 406 TYR A N   1 
ATOM   1506 C  CA  . TYR A 1 214 ? 26.058  23.425 33.572  1.00 96.87  ? 406 TYR A CA  1 
ATOM   1507 C  C   . TYR A 1 214 ? 25.559  22.862 32.244  1.00 97.32  ? 406 TYR A C   1 
ATOM   1508 O  O   . TYR A 1 214 ? 25.665  23.506 31.195  1.00 96.43  ? 406 TYR A O   1 
ATOM   1509 C  CB  . TYR A 1 214 ? 24.924  24.181 34.284  1.00 94.93  ? 406 TYR A CB  1 
ATOM   1510 C  CG  . TYR A 1 214 ? 24.472  25.433 33.565  1.00 94.24  ? 406 TYR A CG  1 
ATOM   1511 C  CD1 . TYR A 1 214 ? 25.024  26.676 33.878  1.00 94.79  ? 406 TYR A CD1 1 
ATOM   1512 C  CD2 . TYR A 1 214 ? 23.500  25.377 32.572  1.00 93.66  ? 406 TYR A CD2 1 
ATOM   1513 C  CE1 . TYR A 1 214 ? 24.623  27.832 33.212  1.00 95.03  ? 406 TYR A CE1 1 
ATOM   1514 C  CE2 . TYR A 1 214 ? 23.095  26.525 31.898  1.00 95.22  ? 406 TYR A CE2 1 
ATOM   1515 C  CZ  . TYR A 1 214 ? 23.657  27.749 32.225  1.00 95.38  ? 406 TYR A CZ  1 
ATOM   1516 O  OH  . TYR A 1 214 ? 23.251  28.886 31.560  1.00 94.96  ? 406 TYR A OH  1 
ATOM   1517 N  N   . SER A 1 215 ? 25.015  21.653 32.306  1.00 98.40  ? 407 SER A N   1 
ATOM   1518 C  CA  . SER A 1 215 ? 24.421  21.007 31.146  1.00 99.09  ? 407 SER A CA  1 
ATOM   1519 C  C   . SER A 1 215 ? 22.908  21.232 31.144  1.00 100.96 ? 407 SER A C   1 
ATOM   1520 O  O   . SER A 1 215 ? 22.316  21.553 32.181  1.00 102.49 ? 407 SER A O   1 
ATOM   1521 C  CB  . SER A 1 215 ? 24.740  19.511 31.162  1.00 98.13  ? 407 SER A CB  1 
ATOM   1522 O  OG  . SER A 1 215 ? 24.209  18.857 30.028  1.00 98.03  ? 407 SER A OG  1 
ATOM   1523 N  N   . ILE A 1 216 ? 22.297  21.083 29.972  1.00 100.86 ? 408 ILE A N   1 
ATOM   1524 C  CA  . ILE A 1 216 ? 20.847  21.179 29.818  1.00 100.86 ? 408 ILE A CA  1 
ATOM   1525 C  C   . ILE A 1 216 ? 20.293  19.786 29.521  1.00 101.62 ? 408 ILE A C   1 
ATOM   1526 O  O   . ILE A 1 216 ? 20.702  19.156 28.544  1.00 102.13 ? 408 ILE A O   1 
ATOM   1527 C  CB  . ILE A 1 216 ? 20.454  22.173 28.689  1.00 100.65 ? 408 ILE A CB  1 
ATOM   1528 C  CG1 . ILE A 1 216 ? 20.773  23.613 29.109  1.00 100.41 ? 408 ILE A CG1 1 
ATOM   1529 C  CG2 . ILE A 1 216 ? 18.974  22.028 28.308  1.00 100.09 ? 408 ILE A CG2 1 
ATOM   1530 C  CD1 . ILE A 1 216 ? 20.771  24.611 27.959  1.00 101.33 ? 408 ILE A CD1 1 
ATOM   1531 N  N   . PRO A 1 217 ? 19.371  19.295 30.371  1.00 101.94 ? 409 PRO A N   1 
ATOM   1532 C  CA  . PRO A 1 217 ? 18.765  17.977 30.168  1.00 102.41 ? 409 PRO A CA  1 
ATOM   1533 C  C   . PRO A 1 217 ? 18.039  17.889 28.832  1.00 102.99 ? 409 PRO A C   1 
ATOM   1534 O  O   . PRO A 1 217 ? 17.463  18.880 28.380  1.00 103.73 ? 409 PRO A O   1 
ATOM   1535 C  CB  . PRO A 1 217 ? 17.761  17.862 31.321  1.00 103.35 ? 409 PRO A CB  1 
ATOM   1536 C  CG  . PRO A 1 217 ? 17.567  19.251 31.825  1.00 102.97 ? 409 PRO A CG  1 
ATOM   1537 C  CD  . PRO A 1 217 ? 18.850  19.961 31.578  1.00 102.11 ? 409 PRO A CD  1 
ATOM   1538 N  N   . ARG A 1 218 ? 18.080  16.708 28.214  1.00 103.79 ? 410 ARG A N   1 
ATOM   1539 C  CA  . ARG A 1 218 ? 17.438  16.460 26.917  1.00 102.31 ? 410 ARG A CA  1 
ATOM   1540 C  C   . ARG A 1 218 ? 15.922  16.640 26.975  1.00 102.05 ? 410 ARG A C   1 
ATOM   1541 O  O   . ARG A 1 218 ? 15.290  16.957 25.967  1.00 102.12 ? 410 ARG A O   1 
ATOM   1542 C  CB  . ARG A 1 218 ? 17.777  15.114 26.462  0.00 20.00  ? 410 ARG A CB  1 
ATOM   1543 C  CG  . ARG A 1 218 ? 19.249  14.901 26.147  0.00 20.00  ? 410 ARG A CG  1 
ATOM   1544 C  CD  . ARG A 1 218 ? 19.575  13.515 25.613  0.00 20.00  ? 410 ARG A CD  1 
ATOM   1545 N  NE  . ARG A 1 218 ? 21.007  13.336 25.392  0.00 20.00  ? 410 ARG A NE  1 
ATOM   1546 C  CZ  . ARG A 1 218 ? 21.568  12.189 25.041  0.00 20.00  ? 410 ARG A CZ  1 
ATOM   1547 N  NH1 . ARG A 1 218 ? 20.819  11.107 24.864  0.00 20.00  ? 410 ARG A NH1 1 
ATOM   1548 N  NH2 . ARG A 1 218 ? 22.881  12.117 24.861  0.00 20.00  ? 410 ARG A NH2 1 
ATOM   1549 N  N   . SER A 1 219 ? 15.357  16.451 28.168  1.00 102.21 ? 411 SER A N   1 
ATOM   1550 C  CA  . SER A 1 219 ? 13.917  16.567 28.410  1.00 101.07 ? 411 SER A CA  1 
ATOM   1551 C  C   . SER A 1 219 ? 13.436  18.004 28.654  1.00 102.47 ? 411 SER A C   1 
ATOM   1552 O  O   . SER A 1 219 ? 12.315  18.218 29.115  1.00 101.98 ? 411 SER A O   1 
ATOM   1553 C  CB  . SER A 1 219 ? 13.496  15.653 29.572  1.00 98.60  ? 411 SER A CB  1 
ATOM   1554 O  OG  . SER A 1 219 ? 14.431  15.691 30.637  1.00 95.50  ? 411 SER A OG  1 
ATOM   1555 N  N   . ASN A 1 220 ? 14.285  18.981 28.348  1.00 105.72 ? 412 ASN A N   1 
ATOM   1556 C  CA  . ASN A 1 220 ? 13.897  20.386 28.402  1.00 109.60 ? 412 ASN A CA  1 
ATOM   1557 C  C   . ASN A 1 220 ? 13.181  20.821 27.131  1.00 114.50 ? 412 ASN A C   1 
ATOM   1558 O  O   . ASN A 1 220 ? 13.525  20.363 26.035  1.00 114.22 ? 412 ASN A O   1 
ATOM   1559 C  CB  . ASN A 1 220 ? 15.120  21.286 28.607  1.00 109.63 ? 412 ASN A CB  1 
ATOM   1560 C  CG  . ASN A 1 220 ? 15.432  21.542 30.068  1.00 111.07 ? 412 ASN A CG  1 
ATOM   1561 O  OD1 . ASN A 1 220 ? 16.313  22.339 30.391  1.00 111.40 ? 412 ASN A OD1 1 
ATOM   1562 N  ND2 . ASN A 1 220 ? 14.712  20.873 30.960  1.00 111.19 ? 412 ASN A ND2 1 
ATOM   1563 N  N   . PRO A 1 221 ? 12.182  21.712 27.270  1.00 118.07 ? 413 PRO A N   1 
ATOM   1564 C  CA  . PRO A 1 221 ? 11.687  22.412 26.090  1.00 120.17 ? 413 PRO A CA  1 
ATOM   1565 C  C   . PRO A 1 221 ? 12.713  23.473 25.692  1.00 122.06 ? 413 PRO A C   1 
ATOM   1566 O  O   . PRO A 1 221 ? 13.237  24.179 26.560  1.00 125.41 ? 413 PRO A O   1 
ATOM   1567 C  CB  . PRO A 1 221 ? 10.388  23.057 26.579  1.00 119.87 ? 413 PRO A CB  1 
ATOM   1568 C  CG  . PRO A 1 221 ? 10.564  23.215 28.048  1.00 119.00 ? 413 PRO A CG  1 
ATOM   1569 C  CD  . PRO A 1 221 ? 11.476  22.113 28.502  1.00 117.99 ? 413 PRO A CD  1 
ATOM   1570 N  N   . HIS A 1 222 ? 13.000  23.568 24.398  1.00 121.67 ? 414 HIS A N   1 
ATOM   1571 C  CA  . HIS A 1 222 ? 14.073  24.424 23.874  1.00 124.30 ? 414 HIS A CA  1 
ATOM   1572 C  C   . HIS A 1 222 ? 15.464  23.835 24.138  1.00 126.62 ? 414 HIS A C   1 
ATOM   1573 O  O   . HIS A 1 222 ? 16.445  24.575 24.256  1.00 126.92 ? 414 HIS A O   1 
ATOM   1574 C  CB  . HIS A 1 222 ? 13.996  25.858 24.422  1.00 123.38 ? 414 HIS A CB  1 
ATOM   1575 C  CG  . HIS A 1 222 ? 12.631  26.465 24.355  1.00 123.20 ? 414 HIS A CG  1 
ATOM   1576 N  ND1 . HIS A 1 222 ? 11.807  26.558 25.455  1.00 122.03 ? 414 HIS A ND1 1 
ATOM   1577 C  CD2 . HIS A 1 222 ? 11.948  27.016 23.323  1.00 124.13 ? 414 HIS A CD2 1 
ATOM   1578 C  CE1 . HIS A 1 222 ? 10.675  27.139 25.105  1.00 122.72 ? 414 HIS A CE1 1 
ATOM   1579 N  NE2 . HIS A 1 222 ? 10.734  27.426 23.816  1.00 124.61 ? 414 HIS A NE2 1 
ATOM   1580 N  N   . PHE A 1 223 ? 15.545  22.507 24.219  1.00 129.38 ? 415 PHE A N   1 
ATOM   1581 C  CA  . PHE A 1 223 ? 16.826  21.810 24.388  1.00 132.50 ? 415 PHE A CA  1 
ATOM   1582 C  C   . PHE A 1 223 ? 17.780  22.030 23.202  1.00 134.07 ? 415 PHE A C   1 
ATOM   1583 O  O   . PHE A 1 223 ? 19.003  22.008 23.368  1.00 135.11 ? 415 PHE A O   1 
ATOM   1584 C  CB  . PHE A 1 223 ? 16.600  20.309 24.646  1.00 133.65 ? 415 PHE A CB  1 
ATOM   1585 C  CG  . PHE A 1 223 ? 17.854  19.472 24.554  1.00 134.72 ? 415 PHE A CG  1 
ATOM   1586 C  CD1 . PHE A 1 223 ? 18.818  19.518 25.558  1.00 134.74 ? 415 PHE A CD1 1 
ATOM   1587 C  CD2 . PHE A 1 223 ? 18.072  18.642 23.456  1.00 134.96 ? 415 PHE A CD2 1 
ATOM   1588 C  CE1 . PHE A 1 223 ? 19.979  18.749 25.470  1.00 134.68 ? 415 PHE A CE1 1 
ATOM   1589 C  CE2 . PHE A 1 223 ? 19.230  17.870 23.360  1.00 134.82 ? 415 PHE A CE2 1 
ATOM   1590 C  CZ  . PHE A 1 223 ? 20.184  17.923 24.370  1.00 134.34 ? 415 PHE A CZ  1 
ATOM   1591 N  N   . ASN A 1 224 ? 17.222  22.253 22.016  1.00 134.49 ? 416 ASN A N   1 
ATOM   1592 C  CA  . ASN A 1 224 ? 18.031  22.455 20.820  1.00 136.26 ? 416 ASN A CA  1 
ATOM   1593 C  C   . ASN A 1 224 ? 17.814  23.819 20.161  1.00 137.81 ? 416 ASN A C   1 
ATOM   1594 O  O   . ASN A 1 224 ? 18.694  24.310 19.450  1.00 138.41 ? 416 ASN A O   1 
ATOM   1595 C  CB  . ASN A 1 224 ? 17.769  21.327 19.812  1.00 136.50 ? 416 ASN A CB  1 
ATOM   1596 C  CG  . ASN A 1 224 ? 18.924  21.122 18.837  1.00 135.98 ? 416 ASN A CG  1 
ATOM   1597 O  OD1 . ASN A 1 224 ? 18.727  21.104 17.621  1.00 134.99 ? 416 ASN A OD1 1 
ATOM   1598 N  ND2 . ASN A 1 224 ? 20.132  20.956 19.370  1.00 135.99 ? 416 ASN A ND2 1 
ATOM   1599 N  N   . SER A 1 225 ? 16.655  24.427 20.420  1.00 138.87 ? 417 SER A N   1 
ATOM   1600 C  CA  . SER A 1 225 ? 16.193  25.633 19.711  1.00 139.73 ? 417 SER A CA  1 
ATOM   1601 C  C   . SER A 1 225 ? 17.242  26.734 19.539  1.00 139.50 ? 417 SER A C   1 
ATOM   1602 O  O   . SER A 1 225 ? 18.011  27.028 20.459  1.00 139.05 ? 417 SER A O   1 
ATOM   1603 C  CB  . SER A 1 225 ? 14.937  26.203 20.378  1.00 139.92 ? 417 SER A CB  1 
ATOM   1604 O  OG  . SER A 1 225 ? 14.367  27.233 19.588  1.00 140.64 ? 417 SER A OG  1 
ATOM   1605 N  N   . THR A 1 226 ? 17.249  27.337 18.351  1.00 139.17 ? 418 THR A N   1 
ATOM   1606 C  CA  . THR A 1 226 ? 18.202  28.389 17.992  1.00 138.78 ? 418 THR A CA  1 
ATOM   1607 C  C   . THR A 1 226 ? 17.882  29.715 18.684  1.00 137.28 ? 418 THR A C   1 
ATOM   1608 O  O   . THR A 1 226 ? 18.786  30.446 19.090  1.00 135.43 ? 418 THR A O   1 
ATOM   1609 C  CB  . THR A 1 226 ? 18.284  28.586 16.448  1.00 139.69 ? 418 THR A CB  1 
ATOM   1610 O  OG1 . THR A 1 226 ? 19.262  29.586 16.133  1.00 140.31 ? 418 THR A OG1 1 
ATOM   1611 C  CG2 . THR A 1 226 ? 16.929  28.993 15.860  1.00 139.88 ? 418 THR A CG2 1 
ATOM   1612 N  N   . PRO A 1 230 ? 16.889  28.717 26.169  1.00 109.87 ? 422 PRO A N   1 
ATOM   1613 C  CA  . PRO A 1 230 ? 17.002  27.257 26.179  1.00 110.33 ? 422 PRO A CA  1 
ATOM   1614 C  C   . PRO A 1 230 ? 16.858  26.675 27.581  1.00 110.14 ? 422 PRO A C   1 
ATOM   1615 O  O   . PRO A 1 230 ? 16.229  25.629 27.761  1.00 110.09 ? 422 PRO A O   1 
ATOM   1616 C  CB  . PRO A 1 230 ? 18.415  27.000 25.633  1.00 110.16 ? 422 PRO A CB  1 
ATOM   1617 C  CG  . PRO A 1 230 ? 19.160  28.264 25.856  1.00 110.35 ? 422 PRO A CG  1 
ATOM   1618 C  CD  . PRO A 1 230 ? 18.154  29.378 25.806  1.00 110.71 ? 422 PRO A CD  1 
ATOM   1619 N  N   . GLU A 1 231 ? 17.440  27.362 28.561  1.00 110.09 ? 423 GLU A N   1 
ATOM   1620 C  CA  . GLU A 1 231 ? 17.355  26.974 29.965  1.00 108.97 ? 423 GLU A CA  1 
ATOM   1621 C  C   . GLU A 1 231 ? 15.959  27.219 30.535  1.00 107.12 ? 423 GLU A C   1 
ATOM   1622 O  O   . GLU A 1 231 ? 15.614  26.688 31.594  1.00 106.74 ? 423 GLU A O   1 
ATOM   1623 C  CB  . GLU A 1 231 ? 18.393  27.739 30.789  1.00 109.68 ? 423 GLU A CB  1 
ATOM   1624 C  CG  . GLU A 1 231 ? 19.839  27.371 30.480  1.00 110.74 ? 423 GLU A CG  1 
ATOM   1625 C  CD  . GLU A 1 231 ? 20.491  28.265 29.441  1.00 112.48 ? 423 GLU A CD  1 
ATOM   1626 O  OE1 . GLU A 1 231 ? 21.709  28.099 29.215  1.00 112.87 ? 423 GLU A OE1 1 
ATOM   1627 O  OE2 . GLU A 1 231 ? 19.802  29.130 28.855  1.00 112.91 ? 423 GLU A OE2 1 
ATOM   1628 N  N   . VAL A 1 232 ? 15.173  28.030 29.825  1.00 105.30 ? 424 VAL A N   1 
ATOM   1629 C  CA  . VAL A 1 232 ? 13.815  28.384 30.233  1.00 102.70 ? 424 VAL A CA  1 
ATOM   1630 C  C   . VAL A 1 232 ? 12.901  27.166 30.139  1.00 102.27 ? 424 VAL A C   1 
ATOM   1631 O  O   . VAL A 1 232 ? 12.769  26.548 29.078  1.00 101.48 ? 424 VAL A O   1 
ATOM   1632 C  CB  . VAL A 1 232 ? 13.244  29.569 29.404  1.00 100.78 ? 424 VAL A CB  1 
ATOM   1633 C  CG1 . VAL A 1 232 ? 11.822  29.895 29.828  1.00 100.13 ? 424 VAL A CG1 1 
ATOM   1634 C  CG2 . VAL A 1 232 ? 14.117  30.805 29.558  1.00 101.14 ? 424 VAL A CG2 1 
ATOM   1635 N  N   . PHE A 1 233 ? 12.296  26.826 31.274  1.00 101.91 ? 425 PHE A N   1 
ATOM   1636 C  CA  . PHE A 1 233 ? 11.397  25.685 31.384  1.00 101.49 ? 425 PHE A CA  1 
ATOM   1637 C  C   . PHE A 1 233 ? 9.944   26.152 31.328  1.00 100.55 ? 425 PHE A C   1 
ATOM   1638 O  O   . PHE A 1 233 ? 9.078   25.434 30.827  1.00 99.62  ? 425 PHE A O   1 
ATOM   1639 C  CB  . PHE A 1 233 ? 11.686  24.923 32.682  1.00 102.69 ? 425 PHE A CB  1 
ATOM   1640 C  CG  . PHE A 1 233 ? 10.927  23.632 32.822  1.00 103.80 ? 425 PHE A CG  1 
ATOM   1641 C  CD1 . PHE A 1 233 ? 11.270  22.519 32.062  1.00 103.63 ? 425 PHE A CD1 1 
ATOM   1642 C  CD2 . PHE A 1 233 ? 9.885   23.520 33.736  1.00 104.41 ? 425 PHE A CD2 1 
ATOM   1643 C  CE1 . PHE A 1 233 ? 10.573  21.319 32.194  1.00 103.42 ? 425 PHE A CE1 1 
ATOM   1644 C  CE2 . PHE A 1 233 ? 9.184   22.322 33.877  1.00 105.13 ? 425 PHE A CE2 1 
ATOM   1645 C  CZ  . PHE A 1 233 ? 9.530   21.219 33.103  1.00 103.58 ? 425 PHE A CZ  1 
ATOM   1646 N  N   . ALA A 1 234 ? 9.698   27.358 31.847  1.00 99.96  ? 426 ALA A N   1 
ATOM   1647 C  CA  . ALA A 1 234 ? 8.385   28.010 31.817  1.00 99.62  ? 426 ALA A CA  1 
ATOM   1648 C  C   . ALA A 1 234 ? 8.544   29.503 32.090  1.00 101.07 ? 426 ALA A C   1 
ATOM   1649 O  O   . ALA A 1 234 ? 9.437   29.897 32.837  1.00 102.03 ? 426 ALA A O   1 
ATOM   1650 C  CB  . ALA A 1 234 ? 7.453   27.386 32.846  1.00 97.81  ? 426 ALA A CB  1 
ATOM   1651 N  N   . HIS A 1 235 ? 7.690   30.327 31.485  1.00 103.26 ? 427 HIS A N   1 
ATOM   1652 C  CA  . HIS A 1 235 ? 7.681   31.768 31.765  1.00 106.60 ? 427 HIS A CA  1 
ATOM   1653 C  C   . HIS A 1 235 ? 6.293   32.267 32.173  1.00 106.95 ? 427 HIS A C   1 
ATOM   1654 O  O   . HIS A 1 235 ? 5.312   31.522 32.106  1.00 107.57 ? 427 HIS A O   1 
ATOM   1655 C  CB  . HIS A 1 235 ? 8.231   32.576 30.579  1.00 110.09 ? 427 HIS A CB  1 
ATOM   1656 C  CG  . HIS A 1 235 ? 7.308   32.641 29.399  1.00 116.03 ? 427 HIS A CG  1 
ATOM   1657 N  ND1 . HIS A 1 235 ? 6.146   33.384 29.401  1.00 118.68 ? 427 HIS A ND1 1 
ATOM   1658 C  CD2 . HIS A 1 235 ? 7.389   32.076 28.170  1.00 118.16 ? 427 HIS A CD2 1 
ATOM   1659 C  CE1 . HIS A 1 235 ? 5.543   33.261 28.230  1.00 119.80 ? 427 HIS A CE1 1 
ATOM   1660 N  NE2 . HIS A 1 235 ? 6.278   32.474 27.464  1.00 119.50 ? 427 HIS A NE2 1 
ATOM   1661 N  N   . GLY A 1 236 ? 6.223   33.529 32.594  1.00 106.46 ? 428 GLY A N   1 
ATOM   1662 C  CA  . GLY A 1 236 ? 4.957   34.159 32.965  1.00 105.71 ? 428 GLY A CA  1 
ATOM   1663 C  C   . GLY A 1 236 ? 4.918   34.730 34.372  1.00 105.63 ? 428 GLY A C   1 
ATOM   1664 O  O   . GLY A 1 236 ? 4.038   35.534 34.694  1.00 108.12 ? 428 GLY A O   1 
ATOM   1665 N  N   . LEU A 1 237 ? 5.869   34.309 35.206  1.00 102.41 ? 429 LEU A N   1 
ATOM   1666 C  CA  . LEU A 1 237 ? 5.966   34.728 36.606  1.00 98.28  ? 429 LEU A CA  1 
ATOM   1667 C  C   . LEU A 1 237 ? 6.164   36.226 36.781  1.00 97.41  ? 429 LEU A C   1 
ATOM   1668 O  O   . LEU A 1 237 ? 6.933   36.844 36.052  1.00 98.19  ? 429 LEU A O   1 
ATOM   1669 C  CB  . LEU A 1 237 ? 7.129   33.999 37.274  1.00 98.01  ? 429 LEU A CB  1 
ATOM   1670 C  CG  . LEU A 1 237 ? 6.884   32.765 38.142  1.00 98.64  ? 429 LEU A CG  1 
ATOM   1671 C  CD1 . LEU A 1 237 ? 5.531   32.112 37.897  1.00 98.86  ? 429 LEU A CD1 1 
ATOM   1672 C  CD2 . LEU A 1 237 ? 8.011   31.777 37.927  1.00 98.81  ? 429 LEU A CD2 1 
ATOM   1673 N  N   . HIS A 1 238 ? 5.468   36.806 37.752  1.00 97.48  ? 430 HIS A N   1 
ATOM   1674 C  CA  . HIS A 1 238 ? 5.671   38.205 38.096  1.00 98.93  ? 430 HIS A CA  1 
ATOM   1675 C  C   . HIS A 1 238 ? 6.396   38.313 39.435  1.00 99.73  ? 430 HIS A C   1 
ATOM   1676 O  O   . HIS A 1 238 ? 7.624   38.303 39.485  1.00 99.70  ? 430 HIS A O   1 
ATOM   1677 C  CB  . HIS A 1 238 ? 4.344   38.972 38.121  1.00 102.58 ? 430 HIS A CB  1 
ATOM   1678 C  CG  . HIS A 1 238 ? 3.688   39.100 36.780  1.00 106.45 ? 430 HIS A CG  1 
ATOM   1679 N  ND1 . HIS A 1 238 ? 4.029   40.082 35.874  1.00 108.29 ? 430 HIS A ND1 1 
ATOM   1680 C  CD2 . HIS A 1 238 ? 2.706   38.374 36.195  1.00 106.75 ? 430 HIS A CD2 1 
ATOM   1681 C  CE1 . HIS A 1 238 ? 3.289   39.952 34.787  1.00 108.04 ? 430 HIS A CE1 1 
ATOM   1682 N  NE2 . HIS A 1 238 ? 2.478   38.923 34.956  1.00 107.47 ? 430 HIS A NE2 1 
ATOM   1683 N  N   . ASP A 1 239 ? 5.634   38.383 40.521  1.00 99.84  ? 431 ASP A N   1 
ATOM   1684 C  CA  . ASP A 1 239 ? 6.197   38.606 41.843  1.00 100.52 ? 431 ASP A CA  1 
ATOM   1685 C  C   . ASP A 1 239 ? 5.935   37.416 42.772  1.00 102.69 ? 431 ASP A C   1 
ATOM   1686 O  O   . ASP A 1 239 ? 5.057   37.485 43.639  1.00 104.46 ? 431 ASP A O   1 
ATOM   1687 C  CB  . ASP A 1 239 ? 5.615   39.890 42.432  1.00 98.71  ? 431 ASP A CB  1 
ATOM   1688 C  CG  . ASP A 1 239 ? 6.339   40.339 43.676  1.00 98.52  ? 431 ASP A CG  1 
ATOM   1689 O  OD1 . ASP A 1 239 ? 7.517   39.965 43.867  1.00 98.77  ? 431 ASP A OD1 1 
ATOM   1690 O  OD2 . ASP A 1 239 ? 5.721   41.076 44.465  1.00 98.95  ? 431 ASP A OD2 1 
ATOM   1691 N  N   . PRO A 1 240 ? 6.707   36.323 42.609  1.00 102.32 ? 432 PRO A N   1 
ATOM   1692 C  CA  . PRO A 1 240 ? 6.391   35.118 43.367  1.00 101.38 ? 432 PRO A CA  1 
ATOM   1693 C  C   . PRO A 1 240 ? 6.983   35.133 44.761  1.00 101.85 ? 432 PRO A C   1 
ATOM   1694 O  O   . PRO A 1 240 ? 8.098   35.618 44.954  1.00 105.67 ? 432 PRO A O   1 
ATOM   1695 C  CB  . PRO A 1 240 ? 7.033   34.006 42.538  1.00 100.35 ? 432 PRO A CB  1 
ATOM   1696 C  CG  . PRO A 1 240 ? 8.165   34.664 41.826  1.00 100.97 ? 432 PRO A CG  1 
ATOM   1697 C  CD  . PRO A 1 240 ? 7.895   36.141 41.755  1.00 101.46 ? 432 PRO A CD  1 
ATOM   1698 N  N   . GLY A 1 241 ? 6.235   34.609 45.725  1.00 101.32 ? 433 GLY A N   1 
ATOM   1699 C  CA  . GLY A 1 241 ? 6.759   34.403 47.071  1.00 102.33 ? 433 GLY A CA  1 
ATOM   1700 C  C   . GLY A 1 241 ? 7.587   33.134 47.104  1.00 102.67 ? 433 GLY A C   1 
ATOM   1701 O  O   . GLY A 1 241 ? 8.102   32.705 46.071  1.00 104.74 ? 433 GLY A O   1 
ATOM   1702 N  N   . ARG A 1 242 ? 7.731   32.536 48.285  1.00 102.02 ? 434 ARG A N   1 
ATOM   1703 C  CA  . ARG A 1 242 ? 8.315   31.202 48.387  1.00 100.26 ? 434 ARG A CA  1 
ATOM   1704 C  C   . ARG A 1 242 ? 7.298   30.195 47.839  1.00 100.33 ? 434 ARG A C   1 
ATOM   1705 O  O   . ARG A 1 242 ? 6.174   30.107 48.325  1.00 101.97 ? 434 ARG A O   1 
ATOM   1706 C  CB  . ARG A 1 242 ? 8.697   30.886 49.830  1.00 98.91  ? 434 ARG A CB  1 
ATOM   1707 C  CG  . ARG A 1 242 ? 9.679   29.737 49.986  1.00 100.18 ? 434 ARG A CG  1 
ATOM   1708 C  CD  . ARG A 1 242 ? 8.983   28.457 50.398  1.00 102.41 ? 434 ARG A CD  1 
ATOM   1709 N  NE  . ARG A 1 242 ? 9.889   27.310 50.412  1.00 104.46 ? 434 ARG A NE  1 
ATOM   1710 C  CZ  . ARG A 1 242 ? 9.509   26.043 50.264  1.00 106.41 ? 434 ARG A CZ  1 
ATOM   1711 N  NH1 . ARG A 1 242 ? 8.229   25.739 50.078  1.00 111.24 ? 434 ARG A NH1 1 
ATOM   1712 N  NH2 . ARG A 1 242 ? 10.412  25.074 50.283  1.00 106.04 ? 434 ARG A NH2 1 
ATOM   1713 N  N   . CYS A 1 243 ? 7.688   29.467 46.801  1.00 98.32  ? 435 CYS A N   1 
ATOM   1714 C  CA  . CYS A 1 243 ? 6.789   28.536 46.139  1.00 99.20  ? 435 CYS A CA  1 
ATOM   1715 C  C   . CYS A 1 243 ? 6.783   27.192 46.856  1.00 98.80  ? 435 CYS A C   1 
ATOM   1716 O  O   . CYS A 1 243 ? 7.823   26.730 47.326  1.00 99.72  ? 435 CYS A O   1 
ATOM   1717 C  CB  . CYS A 1 243 ? 7.205   28.348 44.680  1.00 102.00 ? 435 CYS A CB  1 
ATOM   1718 S  SG  . CYS A 1 243 ? 7.252   29.872 43.696  1.00 104.38 ? 435 CYS A SG  1 
ATOM   1719 N  N   . ALA A 1 244 ? 5.610   26.570 46.941  1.00 97.12  ? 436 ALA A N   1 
ATOM   1720 C  CA  . ALA A 1 244 ? 5.484   25.253 47.554  1.00 95.15  ? 436 ALA A CA  1 
ATOM   1721 C  C   . ALA A 1 244 ? 5.937   24.189 46.568  1.00 94.35  ? 436 ALA A C   1 
ATOM   1722 O  O   . ALA A 1 244 ? 5.703   24.310 45.370  1.00 91.87  ? 436 ALA A O   1 
ATOM   1723 C  CB  . ALA A 1 244 ? 4.062   25.002 47.999  1.00 95.17  ? 436 ALA A CB  1 
ATOM   1724 N  N   . VAL A 1 245 ? 6.597   23.156 47.086  1.00 98.30  ? 437 VAL A N   1 
ATOM   1725 C  CA  . VAL A 1 245 ? 7.238   22.127 46.262  1.00 98.88  ? 437 VAL A CA  1 
ATOM   1726 C  C   . VAL A 1 245 ? 6.806   20.717 46.693  1.00 100.99 ? 437 VAL A C   1 
ATOM   1727 O  O   . VAL A 1 245 ? 7.091   20.275 47.810  1.00 100.74 ? 437 VAL A O   1 
ATOM   1728 C  CB  . VAL A 1 245 ? 8.790   22.276 46.294  1.00 97.18  ? 437 VAL A CB  1 
ATOM   1729 C  CG1 . VAL A 1 245 ? 9.477   21.087 45.645  1.00 98.15  ? 437 VAL A CG1 1 
ATOM   1730 C  CG2 . VAL A 1 245 ? 9.218   23.567 45.610  1.00 94.36  ? 437 VAL A CG2 1 
ATOM   1731 N  N   . ASP A 1 246 ? 6.110   20.025 45.796  1.00 104.07 ? 438 ASP A N   1 
ATOM   1732 C  CA  . ASP A 1 246 ? 5.611   18.680 46.064  1.00 107.81 ? 438 ASP A CA  1 
ATOM   1733 C  C   . ASP A 1 246 ? 6.454   17.653 45.317  1.00 110.64 ? 438 ASP A C   1 
ATOM   1734 O  O   . ASP A 1 246 ? 6.472   17.628 44.083  1.00 110.70 ? 438 ASP A O   1 
ATOM   1735 C  CB  . ASP A 1 246 ? 4.140   18.569 45.650  1.00 109.53 ? 438 ASP A CB  1 
ATOM   1736 C  CG  . ASP A 1 246 ? 3.458   17.315 46.190  1.00 111.79 ? 438 ASP A CG  1 
ATOM   1737 O  OD1 . ASP A 1 246 ? 4.114   16.258 46.315  1.00 113.57 ? 438 ASP A OD1 1 
ATOM   1738 O  OD2 . ASP A 1 246 ? 2.246   17.384 46.480  1.00 112.05 ? 438 ASP A OD2 1 
ATOM   1739 N  N   . ARG A 1 247 ? 7.144   16.805 46.075  1.00 113.75 ? 439 ARG A N   1 
ATOM   1740 C  CA  . ARG A 1 247 ? 8.018   15.783 45.497  1.00 115.91 ? 439 ARG A CA  1 
ATOM   1741 C  C   . ARG A 1 247 ? 7.313   14.440 45.306  1.00 116.03 ? 439 ARG A C   1 
ATOM   1742 O  O   . ARG A 1 247 ? 7.851   13.546 44.654  1.00 118.05 ? 439 ARG A O   1 
ATOM   1743 C  CB  . ARG A 1 247 ? 9.289   15.622 46.339  1.00 116.85 ? 439 ARG A CB  1 
ATOM   1744 C  CG  . ARG A 1 247 ? 10.244  16.799 46.213  1.00 116.61 ? 439 ARG A CG  1 
ATOM   1745 C  CD  . ARG A 1 247 ? 11.314  16.823 47.304  1.00 116.75 ? 439 ARG A CD  1 
ATOM   1746 N  NE  . ARG A 1 247 ? 11.640  18.204 47.667  1.00 116.96 ? 439 ARG A NE  1 
ATOM   1747 C  CZ  . ARG A 1 247 ? 12.495  18.983 47.008  1.00 114.45 ? 439 ARG A CZ  1 
ATOM   1748 N  NH1 . ARG A 1 247 ? 13.139  18.528 45.948  1.00 113.46 ? 439 ARG A NH1 1 
ATOM   1749 N  NH2 . ARG A 1 247 ? 12.704  20.224 47.413  1.00 115.01 ? 439 ARG A NH2 1 
ATOM   1750 N  N   . HIS A 1 248 ? 6.110   14.319 45.870  1.00 116.03 ? 440 HIS A N   1 
ATOM   1751 C  CA  . HIS A 1 248 ? 5.271   13.116 45.763  1.00 116.47 ? 440 HIS A CA  1 
ATOM   1752 C  C   . HIS A 1 248 ? 5.938   11.858 46.321  1.00 118.25 ? 440 HIS A C   1 
ATOM   1753 O  O   . HIS A 1 248 ? 6.347   11.828 47.488  1.00 118.49 ? 440 HIS A O   1 
ATOM   1754 C  CB  . HIS A 1 248 ? 4.818   12.893 44.320  1.00 114.54 ? 440 HIS A CB  1 
ATOM   1755 C  CG  . HIS A 1 248 ? 3.934   13.979 43.789  1.00 114.28 ? 440 HIS A CG  1 
ATOM   1756 N  ND1 . HIS A 1 248 ? 4.430   15.115 43.187  1.00 113.77 ? 440 HIS A ND1 1 
ATOM   1757 C  CD2 . HIS A 1 248 ? 2.585   14.098 43.759  1.00 113.64 ? 440 HIS A CD2 1 
ATOM   1758 C  CE1 . HIS A 1 248 ? 3.426   15.887 42.812  1.00 112.32 ? 440 HIS A CE1 1 
ATOM   1759 N  NE2 . HIS A 1 248 ? 2.296   15.294 43.147  1.00 112.01 ? 440 HIS A NE2 1 
ATOM   1760 N  N   . ASN A 1 255 ? 7.831   12.642 39.418  1.00 104.45 ? 447 ASN A N   1 
ATOM   1761 C  CA  . ASN A 1 255 ? 7.113   13.868 39.084  1.00 104.93 ? 447 ASN A CA  1 
ATOM   1762 C  C   . ASN A 1 255 ? 7.138   14.908 40.203  1.00 104.97 ? 447 ASN A C   1 
ATOM   1763 O  O   . ASN A 1 255 ? 7.184   14.565 41.388  1.00 107.18 ? 447 ASN A O   1 
ATOM   1764 C  CB  . ASN A 1 255 ? 5.667   13.576 38.641  1.00 105.36 ? 447 ASN A CB  1 
ATOM   1765 C  CG  . ASN A 1 255 ? 4.841   12.865 39.707  1.00 106.26 ? 447 ASN A CG  1 
ATOM   1766 O  OD1 . ASN A 1 255 ? 5.361   12.101 40.522  1.00 106.74 ? 447 ASN A OD1 1 
ATOM   1767 N  ND2 . ASN A 1 255 ? 3.534   13.103 39.685  1.00 106.59 ? 447 ASN A ND2 1 
ATOM   1768 N  N   . LEU A 1 256 ? 7.101   16.178 39.800  1.00 101.62 ? 448 LEU A N   1 
ATOM   1769 C  CA  . LEU A 1 256 ? 7.221   17.317 40.700  1.00 96.55  ? 448 LEU A CA  1 
ATOM   1770 C  C   . LEU A 1 256 ? 6.067   18.290 40.499  1.00 94.10  ? 448 LEU A C   1 
ATOM   1771 O  O   . LEU A 1 256 ? 5.577   18.460 39.383  1.00 92.52  ? 448 LEU A O   1 
ATOM   1772 C  CB  . LEU A 1 256 ? 8.538   18.047 40.423  1.00 96.64  ? 448 LEU A CB  1 
ATOM   1773 C  CG  . LEU A 1 256 ? 8.873   19.282 41.266  1.00 96.86  ? 448 LEU A CG  1 
ATOM   1774 C  CD1 . LEU A 1 256 ? 9.792   18.913 42.419  1.00 97.25  ? 448 LEU A CD1 1 
ATOM   1775 C  CD2 . LEU A 1 256 ? 9.511   20.361 40.412  1.00 97.78  ? 448 LEU A CD2 1 
ATOM   1776 N  N   . THR A 1 257 ? 5.641   18.931 41.582  1.00 92.63  ? 449 THR A N   1 
ATOM   1777 C  CA  . THR A 1 257 ? 4.703   20.040 41.498  1.00 92.62  ? 449 THR A CA  1 
ATOM   1778 C  C   . THR A 1 257 ? 5.284   21.235 42.232  1.00 94.13  ? 449 THR A C   1 
ATOM   1779 O  O   . THR A 1 257 ? 5.641   21.132 43.406  1.00 96.09  ? 449 THR A O   1 
ATOM   1780 C  CB  . THR A 1 257 ? 3.330   19.701 42.119  1.00 93.00  ? 449 THR A CB  1 
ATOM   1781 O  OG1 . THR A 1 257 ? 2.746   18.577 41.446  1.00 93.31  ? 449 THR A OG1 1 
ATOM   1782 C  CG2 . THR A 1 257 ? 2.391   20.894 42.012  1.00 92.66  ? 449 THR A CG2 1 
ATOM   1783 N  N   . ILE A 1 258 ? 5.396   22.362 41.536  1.00 94.76  ? 450 ILE A N   1 
ATOM   1784 C  CA  . ILE A 1 258 ? 5.719   23.630 42.188  1.00 94.30  ? 450 ILE A CA  1 
ATOM   1785 C  C   . ILE A 1 258 ? 4.566   24.612 42.019  1.00 95.33  ? 450 ILE A C   1 
ATOM   1786 O  O   . ILE A 1 258 ? 4.073   24.826 40.913  1.00 95.29  ? 450 ILE A O   1 
ATOM   1787 C  CB  . ILE A 1 258 ? 7.140   24.208 41.806  1.00 96.20  ? 450 ILE A CB  1 
ATOM   1788 C  CG1 . ILE A 1 258 ? 7.159   25.746 41.832  1.00 97.52  ? 450 ILE A CG1 1 
ATOM   1789 C  CG2 . ILE A 1 258 ? 7.683   23.628 40.486  1.00 95.55  ? 450 ILE A CG2 1 
ATOM   1790 C  CD1 . ILE A 1 258 ? 6.928   26.426 40.494  1.00 100.13 ? 450 ILE A CD1 1 
ATOM   1791 N  N   . LEU A 1 259 ? 4.131   25.175 43.142  1.00 98.92  ? 451 LEU A N   1 
ATOM   1792 C  CA  . LEU A 1 259 ? 2.937   26.015 43.213  1.00 98.58  ? 451 LEU A CA  1 
ATOM   1793 C  C   . LEU A 1 259 ? 3.311   27.350 43.842  1.00 97.22  ? 451 LEU A C   1 
ATOM   1794 O  O   . LEU A 1 259 ? 3.773   27.389 44.982  1.00 97.38  ? 451 LEU A O   1 
ATOM   1795 C  CB  . LEU A 1 259 ? 1.865   25.314 44.056  1.00 98.98  ? 451 LEU A CB  1 
ATOM   1796 C  CG  . LEU A 1 259 ? 0.380   25.648 43.874  1.00 101.77 ? 451 LEU A CG  1 
ATOM   1797 C  CD1 . LEU A 1 259 ? -0.482  24.575 44.525  1.00 102.02 ? 451 LEU A CD1 1 
ATOM   1798 C  CD2 . LEU A 1 259 ? 0.011   27.021 44.425  1.00 102.35 ? 451 LEU A CD2 1 
ATOM   1799 N  N   . CYS A 1 260 ? 3.114   28.438 43.102  1.00 96.80  ? 452 CYS A N   1 
ATOM   1800 C  CA  . CYS A 1 260 ? 3.519   29.756 43.579  1.00 98.77  ? 452 CYS A CA  1 
ATOM   1801 C  C   . CYS A 1 260 ? 2.362   30.699 43.845  1.00 97.70  ? 452 CYS A C   1 
ATOM   1802 O  O   . CYS A 1 260 ? 1.383   30.717 43.107  1.00 99.35  ? 452 CYS A O   1 
ATOM   1803 C  CB  . CYS A 1 260 ? 4.463   30.429 42.583  1.00 102.50 ? 452 CYS A CB  1 
ATOM   1804 S  SG  . CYS A 1 260 ? 5.948   29.495 42.176  1.00 109.69 ? 452 CYS A SG  1 
ATOM   1805 N  N   . SER A 1 261 ? 2.495   31.488 44.907  1.00 96.59  ? 453 SER A N   1 
ATOM   1806 C  CA  . SER A 1 261 ? 1.730   32.716 45.048  1.00 95.26  ? 453 SER A CA  1 
ATOM   1807 C  C   . SER A 1 261 ? 2.383   33.759 44.134  1.00 95.77  ? 453 SER A C   1 
ATOM   1808 O  O   . SER A 1 261 ? 3.524   33.580 43.701  1.00 95.93  ? 453 SER A O   1 
ATOM   1809 C  CB  . SER A 1 261 ? 1.736   33.190 46.503  1.00 93.68  ? 453 SER A CB  1 
ATOM   1810 O  OG  . SER A 1 261 ? 2.959   33.820 46.835  1.00 91.31  ? 453 SER A OG  1 
ATOM   1811 N  N   . ASP A 1 262 ? 1.661   34.832 43.827  1.00 95.56  ? 454 ASP A N   1 
ATOM   1812 C  CA  . ASP A 1 262 ? 2.177   35.886 42.963  1.00 95.12  ? 454 ASP A CA  1 
ATOM   1813 C  C   . ASP A 1 262 ? 1.398   37.157 43.228  1.00 96.20  ? 454 ASP A C   1 
ATOM   1814 O  O   . ASP A 1 262 ? 0.174   37.153 43.198  1.00 95.74  ? 454 ASP A O   1 
ATOM   1815 C  CB  . ASP A 1 262 ? 2.056   35.482 41.490  1.00 98.90  ? 454 ASP A CB  1 
ATOM   1816 C  CG  . ASP A 1 262 ? 2.922   36.330 40.573  1.00 102.59 ? 454 ASP A CG  1 
ATOM   1817 O  OD1 . ASP A 1 262 ? 3.247   35.869 39.458  1.00 103.00 ? 454 ASP A OD1 1 
ATOM   1818 O  OD2 . ASP A 1 262 ? 3.275   37.463 40.957  1.00 104.62 ? 454 ASP A OD2 1 
ATOM   1819 N  N   . SER A 1 263 ? 2.110   38.245 43.490  1.00 102.13 ? 455 SER A N   1 
ATOM   1820 C  CA  . SER A 1 263 ? 1.466   39.510 43.844  1.00 110.47 ? 455 SER A CA  1 
ATOM   1821 C  C   . SER A 1 263 ? 0.968   40.295 42.631  1.00 115.52 ? 455 SER A C   1 
ATOM   1822 O  O   . SER A 1 263 ? -0.046  40.999 42.714  1.00 117.30 ? 455 SER A O   1 
ATOM   1823 C  CB  . SER A 1 263 ? 2.407   40.373 44.681  1.00 112.89 ? 455 SER A CB  1 
ATOM   1824 O  OG  . SER A 1 263 ? 2.712   39.732 45.911  1.00 117.72 ? 455 SER A OG  1 
ATOM   1825 N  N   . ASN A 1 264 ? 1.688   40.169 41.514  1.00 118.55 ? 456 ASN A N   1 
ATOM   1826 C  CA  . ASN A 1 264 ? 1.382   40.875 40.262  1.00 121.71 ? 456 ASN A CA  1 
ATOM   1827 C  C   . ASN A 1 264 ? 1.379   42.404 40.405  1.00 124.05 ? 456 ASN A C   1 
ATOM   1828 O  O   . ASN A 1 264 ? 0.670   43.107 39.680  1.00 124.73 ? 456 ASN A O   1 
ATOM   1829 C  CB  . ASN A 1 264 ? 0.057   40.380 39.662  1.00 122.86 ? 456 ASN A CB  1 
ATOM   1830 C  CG  . ASN A 1 264 ? -0.163  38.893 39.874  1.00 123.33 ? 456 ASN A CG  1 
ATOM   1831 O  OD1 . ASN A 1 264 ? 0.693   38.072 39.546  1.00 122.97 ? 456 ASN A OD1 1 
ATOM   1832 N  ND2 . ASN A 1 264 ? -1.320  38.540 40.430  1.00 123.82 ? 456 ASN A ND2 1 
ATOM   1833 N  N   . GLY A 1 265 ? 2.189   42.907 41.336  1.00 126.69 ? 457 GLY A N   1 
ATOM   1834 C  CA  . GLY A 1 265 ? 2.215   44.328 41.667  1.00 129.59 ? 457 GLY A CA  1 
ATOM   1835 C  C   . GLY A 1 265 ? 1.006   44.689 42.505  1.00 132.67 ? 457 GLY A C   1 
ATOM   1836 O  O   . GLY A 1 265 ? 0.829   44.172 43.610  1.00 134.03 ? 457 GLY A O   1 
ATOM   1837 N  N   . LYS A 1 266 ? 0.172   45.577 41.972  1.00 134.84 ? 458 LYS A N   1 
ATOM   1838 C  CA  . LYS A 1 266 ? -1.093  45.931 42.604  1.00 137.21 ? 458 LYS A CA  1 
ATOM   1839 C  C   . LYS A 1 266 ? -2.243  45.428 41.740  1.00 138.69 ? 458 LYS A C   1 
ATOM   1840 O  O   . LYS A 1 266 ? -3.138  46.194 41.378  1.00 138.85 ? 458 LYS A O   1 
ATOM   1841 C  CB  . LYS A 1 266 ? -1.287  47.520 42.239  0.00 20.00  ? 458 LYS A CB  1 
ATOM   1842 C  CG  . LYS A 1 266 ? -0.317  48.242 43.161  0.00 20.00  ? 458 LYS A CG  1 
ATOM   1843 C  CD  . LYS A 1 266 ? -0.457  49.750 43.039  0.00 20.00  ? 458 LYS A CD  1 
ATOM   1844 C  CE  . LYS A 1 266 ? 0.496   50.472 43.977  0.00 20.00  ? 458 LYS A CE  1 
ATOM   1845 N  NZ  . LYS A 1 266 ? 0.386   51.951 43.851  0.00 20.00  ? 458 LYS A NZ  1 
ATOM   1846 N  N   . ASN A 1 267 ? -2.207  44.136 41.417  1.00 139.76 ? 459 ASN A N   1 
ATOM   1847 C  CA  . ASN A 1 267 ? -3.174  43.533 40.503  1.00 140.43 ? 459 ASN A CA  1 
ATOM   1848 C  C   . ASN A 1 267 ? -3.599  42.140 40.978  1.00 140.21 ? 459 ASN A C   1 
ATOM   1849 O  O   . ASN A 1 267 ? -2.993  41.130 40.604  1.00 140.88 ? 459 ASN A O   1 
ATOM   1850 C  CB  . ASN A 1 267 ? -2.589  43.485 39.081  1.00 139.89 ? 459 ASN A CB  1 
ATOM   1851 C  CG  . ASN A 1 267 ? -3.635  43.207 38.012  1.00 139.16 ? 459 ASN A CG  1 
ATOM   1852 O  OD1 . ASN A 1 267 ? -3.298  42.776 36.909  1.00 139.13 ? 459 ASN A OD1 1 
ATOM   1853 N  ND2 . ASN A 1 267 ? -4.903  43.459 38.328  1.00 138.77 ? 459 ASN A ND2 1 
ATOM   1854 N  N   . ARG A 1 268 ? -4.636  42.102 41.815  1.00 138.51 ? 460 ARG A N   1 
ATOM   1855 C  CA  . ARG A 1 268 ? -5.118  40.855 42.412  1.00 135.41 ? 460 ARG A CA  1 
ATOM   1856 C  C   . ARG A 1 268 ? -3.997  40.142 43.167  1.00 132.88 ? 460 ARG A C   1 
ATOM   1857 O  O   . ARG A 1 268 ? -2.972  40.749 43.491  1.00 134.85 ? 460 ARG A O   1 
ATOM   1858 C  CB  . ARG A 1 268 ? -5.863  39.983 41.749  0.00 20.00  ? 460 ARG A CB  1 
ATOM   1859 C  CG  . ARG A 1 268 ? -7.103  40.584 41.108  0.00 20.00  ? 460 ARG A CG  1 
ATOM   1860 C  CD  . ARG A 1 268 ? -7.803  39.660 40.124  0.00 20.00  ? 460 ARG A CD  1 
ATOM   1861 N  NE  . ARG A 1 268 ? -8.946  40.305 39.484  0.00 20.00  ? 460 ARG A NE  1 
ATOM   1862 C  CZ  . ARG A 1 268 ? -9.657  39.763 38.506  0.00 20.00  ? 460 ARG A CZ  1 
ATOM   1863 N  NH1 . ARG A 1 268 ? -9.349  38.555 38.051  0.00 20.00  ? 460 ARG A NH1 1 
ATOM   1864 N  NH2 . ARG A 1 268 ? -10.681 40.423 37.982  0.00 20.00  ? 460 ARG A NH2 1 
ATOM   1865 N  N   . SER A 1 269 ? -4.200  38.856 43.442  1.00 128.43 ? 461 SER A N   1 
ATOM   1866 C  CA  . SER A 1 269 ? -3.197  38.026 44.113  1.00 122.19 ? 461 SER A CA  1 
ATOM   1867 C  C   . SER A 1 269 ? -3.442  36.556 43.786  1.00 117.23 ? 461 SER A C   1 
ATOM   1868 O  O   . SER A 1 269 ? -4.239  35.883 44.442  1.00 119.31 ? 461 SER A O   1 
ATOM   1869 C  CB  . SER A 1 269 ? -3.216  38.258 45.625  1.00 121.39 ? 461 SER A CB  1 
ATOM   1870 O  OG  . SER A 1 269 ? -2.209  37.490 46.253  1.00 121.86 ? 461 SER A OG  1 
ATOM   1871 N  N   . SER A 1 270 ? -2.740  36.067 42.772  1.00 110.10 ? 462 SER A N   1 
ATOM   1872 C  CA  . SER A 1 270 ? -3.055  34.779 42.169  1.00 104.05 ? 462 SER A CA  1 
ATOM   1873 C  C   . SER A 1 270 ? -2.094  33.648 42.521  1.00 100.68 ? 462 SER A C   1 
ATOM   1874 O  O   . SER A 1 270 ? -0.996  33.877 43.029  1.00 99.84  ? 462 SER A O   1 
ATOM   1875 C  CB  . SER A 1 270 ? -3.148  34.933 40.649  1.00 104.14 ? 462 SER A CB  1 
ATOM   1876 O  OG  . SER A 1 270 ? -2.175  35.841 40.166  1.00 102.04 ? 462 SER A OG  1 
ATOM   1877 N  N   . ALA A 1 271 ? -2.534  32.423 42.256  1.00 98.39  ? 463 ALA A N   1 
ATOM   1878 C  CA  . ALA A 1 271 ? -1.680  31.250 42.373  1.00 96.95  ? 463 ALA A CA  1 
ATOM   1879 C  C   . ALA A 1 271 ? -1.354  30.707 40.989  1.00 97.14  ? 463 ALA A C   1 
ATOM   1880 O  O   . ALA A 1 271 ? -2.212  30.676 40.101  1.00 96.99  ? 463 ALA A O   1 
ATOM   1881 C  CB  . ALA A 1 271 ? -2.345  30.186 43.216  1.00 95.68  ? 463 ALA A CB  1 
ATOM   1882 N  N   . ARG A 1 272 ? -0.104  30.296 40.807  1.00 96.31  ? 464 ARG A N   1 
ATOM   1883 C  CA  . ARG A 1 272 ? 0.338   29.695 39.554  1.00 95.07  ? 464 ARG A CA  1 
ATOM   1884 C  C   . ARG A 1 272 ? 0.962   28.336 39.855  1.00 96.89  ? 464 ARG A C   1 
ATOM   1885 O  O   . ARG A 1 272 ? 1.716   28.193 40.822  1.00 96.25  ? 464 ARG A O   1 
ATOM   1886 C  CB  . ARG A 1 272 ? 1.321   30.617 38.827  1.00 93.43  ? 464 ARG A CB  1 
ATOM   1887 C  CG  . ARG A 1 272 ? 0.815   32.046 38.641  1.00 92.44  ? 464 ARG A CG  1 
ATOM   1888 C  CD  . ARG A 1 272 ? 1.816   32.915 37.904  1.00 94.11  ? 464 ARG A CD  1 
ATOM   1889 N  NE  . ARG A 1 272 ? 1.517   34.343 38.031  1.00 95.42  ? 464 ARG A NE  1 
ATOM   1890 C  CZ  . ARG A 1 272 ? 0.750   35.042 37.195  1.00 97.07  ? 464 ARG A CZ  1 
ATOM   1891 N  NH1 . ARG A 1 272 ? 0.178   34.458 36.148  1.00 98.51  ? 464 ARG A NH1 1 
ATOM   1892 N  NH2 . ARG A 1 272 ? 0.548   36.336 37.408  1.00 97.15  ? 464 ARG A NH2 1 
ATOM   1893 N  N   . ILE A 1 273 ? 0.630   27.340 39.036  1.00 99.42  ? 465 ILE A N   1 
ATOM   1894 C  CA  . ILE A 1 273 ? 1.058   25.957 39.278  1.00 102.58 ? 465 ILE A CA  1 
ATOM   1895 C  C   . ILE A 1 273 ? 1.863   25.357 38.115  1.00 105.57 ? 465 ILE A C   1 
ATOM   1896 O  O   . ILE A 1 273 ? 1.511   25.527 36.941  1.00 106.88 ? 465 ILE A O   1 
ATOM   1897 C  CB  . ILE A 1 273 ? -0.151  25.033 39.648  1.00 101.52 ? 465 ILE A CB  1 
ATOM   1898 C  CG1 . ILE A 1 273 ? 0.326   23.624 40.024  1.00 101.79 ? 465 ILE A CG1 1 
ATOM   1899 C  CG2 . ILE A 1 273 ? -1.177  24.979 38.515  1.00 100.34 ? 465 ILE A CG2 1 
ATOM   1900 C  CD1 . ILE A 1 273 ? -0.678  22.814 40.824  1.00 102.05 ? 465 ILE A CD1 1 
ATOM   1901 N  N   . LEU A 1 274 ? 2.945   24.661 38.461  1.00 106.93 ? 466 LEU A N   1 
ATOM   1902 C  CA  . LEU A 1 274 ? 3.732   23.909 37.492  1.00 108.19 ? 466 LEU A CA  1 
ATOM   1903 C  C   . LEU A 1 274 ? 3.851   22.437 37.893  1.00 110.46 ? 466 LEU A C   1 
ATOM   1904 O  O   . LEU A 1 274 ? 4.351   22.117 38.974  1.00 109.46 ? 466 LEU A O   1 
ATOM   1905 C  CB  . LEU A 1 274 ? 5.120   24.533 37.320  1.00 106.95 ? 466 LEU A CB  1 
ATOM   1906 C  CG  . LEU A 1 274 ? 6.000   23.953 36.208  1.00 106.90 ? 466 LEU A CG  1 
ATOM   1907 C  CD1 . LEU A 1 274 ? 5.566   24.460 34.832  1.00 106.22 ? 466 LEU A CD1 1 
ATOM   1908 C  CD2 . LEU A 1 274 ? 7.461   24.280 36.464  1.00 105.73 ? 466 LEU A CD2 1 
ATOM   1909 N  N   . GLN A 1 275 ? 3.372   21.556 37.016  1.00 114.14 ? 467 GLN A N   1 
ATOM   1910 C  CA  . GLN A 1 275 ? 3.518   20.106 37.177  1.00 117.52 ? 467 GLN A CA  1 
ATOM   1911 C  C   . GLN A 1 275 ? 4.289   19.556 35.985  1.00 120.27 ? 467 GLN A C   1 
ATOM   1912 O  O   . GLN A 1 275 ? 4.085   20.012 34.862  1.00 120.96 ? 467 GLN A O   1 
ATOM   1913 C  CB  . GLN A 1 275 ? 2.152   19.422 37.283  1.00 116.70 ? 467 GLN A CB  1 
ATOM   1914 C  CG  . GLN A 1 275 ? 1.352   19.808 38.531  1.00 117.55 ? 467 GLN A CG  1 
ATOM   1915 C  CD  . GLN A 1 275 ? 0.107   18.957 38.746  1.00 117.14 ? 467 GLN A CD  1 
ATOM   1916 O  OE1 . GLN A 1 275 ? -0.207  18.070 37.953  1.00 117.98 ? 467 GLN A OE1 1 
ATOM   1917 N  NE2 . GLN A 1 275 ? -0.606  19.226 39.832  1.00 116.23 ? 467 GLN A NE2 1 
ATOM   1918 N  N   . ILE A 1 276 ? 5.171   18.587 36.221  1.00 123.79 ? 468 ILE A N   1 
ATOM   1919 C  CA  . ILE A 1 276 ? 6.040   18.087 35.148  1.00 129.61 ? 468 ILE A CA  1 
ATOM   1920 C  C   . ILE A 1 276 ? 5.605   16.743 34.546  1.00 135.65 ? 468 ILE A C   1 
ATOM   1921 O  O   . ILE A 1 276 ? 6.158   16.301 33.527  1.00 137.06 ? 468 ILE A O   1 
ATOM   1922 C  CB  . ILE A 1 276 ? 7.541   18.030 35.566  1.00 128.82 ? 468 ILE A CB  1 
ATOM   1923 C  CG1 . ILE A 1 276 ? 7.809   16.850 36.508  1.00 128.85 ? 468 ILE A CG1 1 
ATOM   1924 C  CG2 . ILE A 1 276 ? 7.989   19.367 36.164  1.00 128.94 ? 468 ILE A CG2 1 
ATOM   1925 C  CD1 . ILE A 1 276 ? 9.160   16.182 36.294  1.00 128.08 ? 468 ILE A CD1 1 
ATOM   1926 N  N   . ILE A 1 277 ? 4.606   16.109 35.162  1.00 139.48 ? 469 ILE A N   1 
ATOM   1927 C  CA  . ILE A 1 277 ? 4.156   14.755 34.779  1.00 141.46 ? 469 ILE A CA  1 
ATOM   1928 C  C   . ILE A 1 277 ? 5.290   13.737 35.015  1.00 143.01 ? 469 ILE A C   1 
ATOM   1929 O  O   . ILE A 1 277 ? 6.227   14.022 35.768  1.00 145.59 ? 469 ILE A O   1 
ATOM   1930 C  CB  . ILE A 1 277 ? 3.566   14.685 33.329  1.00 140.56 ? 469 ILE A CB  1 
ATOM   1931 C  CG1 . ILE A 1 277 ? 2.734   15.935 33.013  1.00 140.75 ? 469 ILE A CG1 1 
ATOM   1932 C  CG2 . ILE A 1 277 ? 2.711   13.423 33.153  1.00 141.06 ? 469 ILE A CG2 1 
ATOM   1933 C  CD1 . ILE A 1 277 ? 2.494   16.179 31.529  1.00 141.40 ? 469 ILE A CD1 1 
ATOM   1934 N  N   . LYS A 1 278 ? 5.216   12.566 34.387  1.00 141.64 ? 470 LYS A N   1 
ATOM   1935 C  CA  . LYS A 1 278 ? 6.125   11.468 34.720  1.00 140.96 ? 470 LYS A CA  1 
ATOM   1936 C  C   . LYS A 1 278 ? 6.990   11.009 33.544  1.00 141.10 ? 470 LYS A C   1 
ATOM   1937 O  O   . LYS A 1 278 ? 6.577   10.159 32.751  1.00 140.56 ? 470 LYS A O   1 
ATOM   1938 C  CB  . LYS A 1 278 ? 5.342   10.291 35.325  1.00 141.39 ? 470 LYS A CB  1 
ATOM   1939 C  CG  . LYS A 1 278 ? 4.689   10.602 36.676  1.00 140.65 ? 470 LYS A CG  1 
ATOM   1940 C  CD  . LYS A 1 278 ? 3.780   9.479  37.156  1.00 139.37 ? 470 LYS A CD  1 
ATOM   1941 C  CE  . LYS A 1 278 ? 3.228   9.785  38.539  1.00 136.73 ? 470 LYS A CE  1 
ATOM   1942 N  NZ  . LYS A 1 278 ? 2.446   8.648  39.094  1.00 134.61 ? 470 LYS A NZ  1 
ATOM   1943 N  N   . GLY A 1 279 ? 8.190   11.582 33.447  1.00 141.58 ? 471 GLY A N   1 
ATOM   1944 C  CA  . GLY A 1 279 ? 9.176   11.201 32.430  1.00 141.85 ? 471 GLY A CA  1 
ATOM   1945 C  C   . GLY A 1 279 ? 8.720   11.444 31.004  1.00 141.63 ? 471 GLY A C   1 
ATOM   1946 O  O   . GLY A 1 279 ? 8.411   10.501 30.275  1.00 141.91 ? 471 GLY A O   1 
ATOM   1947 N  N   . LYS A 1 280 ? 8.686   12.714 30.610  1.00 141.82 ? 472 LYS A N   1 
ATOM   1948 C  CA  . LYS A 1 280 ? 8.201   13.117 29.293  1.00 141.86 ? 472 LYS A CA  1 
ATOM   1949 C  C   . LYS A 1 280 ? 9.131   14.161 28.679  1.00 141.52 ? 472 LYS A C   1 
ATOM   1950 O  O   . LYS A 1 280 ? 9.517   15.126 29.343  1.00 142.70 ? 472 LYS A O   1 
ATOM   1951 C  CB  . LYS A 1 280 ? 6.772   13.665 29.408  1.00 141.56 ? 472 LYS A CB  1 
ATOM   1952 C  CG  . LYS A 1 280 ? 6.187   14.239 28.120  1.00 142.36 ? 472 LYS A CG  1 
ATOM   1953 C  CD  . LYS A 1 280 ? 4.838   14.910 28.358  1.00 142.93 ? 472 LYS A CD  1 
ATOM   1954 C  CE  . LYS A 1 280 ? 3.697   13.899 28.351  1.00 144.82 ? 472 LYS A CE  1 
ATOM   1955 N  NZ  . LYS A 1 280 ? 2.361   14.546 28.483  1.00 145.54 ? 472 LYS A NZ  1 
ATOM   1956 N  N   . ASP A 1 281 ? 9.493   13.958 27.415  1.00 140.97 ? 473 ASP A N   1 
ATOM   1957 C  CA  . ASP A 1 281 ? 10.313  14.920 26.684  1.00 140.24 ? 473 ASP A CA  1 
ATOM   1958 C  C   . ASP A 1 281 ? 9.482   16.116 26.233  1.00 139.36 ? 473 ASP A C   1 
ATOM   1959 O  O   . ASP A 1 281 ? 8.419   15.953 25.626  1.00 139.88 ? 473 ASP A O   1 
ATOM   1960 C  CB  . ASP A 1 281 ? 10.989  14.258 25.481  1.00 140.40 ? 473 ASP A CB  1 
ATOM   1961 C  CG  . ASP A 1 281 ? 12.202  13.438 25.871  1.00 140.60 ? 473 ASP A CG  1 
ATOM   1962 O  OD1 . ASP A 1 281 ? 12.099  12.613 26.804  1.00 140.75 ? 473 ASP A OD1 1 
ATOM   1963 O  OD2 . ASP A 1 281 ? 13.263  13.617 25.238  1.00 140.95 ? 473 ASP A OD2 1 
ATOM   1964 N  N   . TYR A 1 282 ? 9.974   17.313 26.540  1.00 137.44 ? 474 TYR A N   1 
ATOM   1965 C  CA  . TYR A 1 282 ? 9.293   18.551 26.174  1.00 135.94 ? 474 TYR A CA  1 
ATOM   1966 C  C   . TYR A 1 282 ? 9.966   19.226 24.984  1.00 136.96 ? 474 TYR A C   1 
ATOM   1967 O  O   . TYR A 1 282 ? 11.196  19.257 24.891  1.00 137.61 ? 474 TYR A O   1 
ATOM   1968 C  CB  . TYR A 1 282 ? 9.247   19.511 27.367  1.00 132.74 ? 474 TYR A CB  1 
ATOM   1969 C  CG  . TYR A 1 282 ? 8.423   19.007 28.531  1.00 131.80 ? 474 TYR A CG  1 
ATOM   1970 C  CD1 . TYR A 1 282 ? 9.030   18.407 29.637  1.00 131.02 ? 474 TYR A CD1 1 
ATOM   1971 C  CD2 . TYR A 1 282 ? 7.035   19.128 28.526  1.00 131.95 ? 474 TYR A CD2 1 
ATOM   1972 C  CE1 . TYR A 1 282 ? 8.271   17.939 30.708  1.00 130.17 ? 474 TYR A CE1 1 
ATOM   1973 C  CE2 . TYR A 1 282 ? 6.270   18.665 29.588  1.00 131.76 ? 474 TYR A CE2 1 
ATOM   1974 C  CZ  . TYR A 1 282 ? 6.893   18.074 30.673  1.00 131.01 ? 474 TYR A CZ  1 
ATOM   1975 O  OH  . TYR A 1 282 ? 6.124   17.621 31.712  1.00 130.31 ? 474 TYR A OH  1 
ATOM   1976 N  N   . GLU A 1 283 ? 9.151   19.755 24.074  1.00 137.07 ? 475 GLU A N   1 
ATOM   1977 C  CA  . GLU A 1 283 ? 9.654   20.493 22.916  1.00 137.22 ? 475 GLU A CA  1 
ATOM   1978 C  C   . GLU A 1 283 ? 9.029   21.888 22.872  1.00 136.53 ? 475 GLU A C   1 
ATOM   1979 O  O   . GLU A 1 283 ? 9.676   22.856 22.461  1.00 135.81 ? 475 GLU A O   1 
ATOM   1980 C  CB  . GLU A 1 283 ? 9.380   19.726 21.619  1.00 138.20 ? 475 GLU A CB  1 
ATOM   1981 C  CG  . GLU A 1 283 ? 10.637  19.390 20.815  1.00 138.85 ? 475 GLU A CG  1 
ATOM   1982 C  CD  . GLU A 1 283 ? 11.401  20.620 20.357  1.00 139.17 ? 475 GLU A CD  1 
ATOM   1983 O  OE1 . GLU A 1 283 ? 12.361  21.017 21.054  1.00 138.50 ? 475 GLU A OE1 1 
ATOM   1984 O  OE2 . GLU A 1 283 ? 11.038  21.189 19.305  1.00 139.58 ? 475 GLU A OE2 1 
ATOM   1985 N  N   . SER A 1 284 ? 7.767   21.970 23.288  1.00 136.28 ? 476 SER A N   1 
ATOM   1986 C  CA  . SER A 1 284 ? 7.097   23.242 23.550  1.00 135.57 ? 476 SER A CA  1 
ATOM   1987 C  C   . SER A 1 284 ? 6.888   23.390 25.059  1.00 134.39 ? 476 SER A C   1 
ATOM   1988 O  O   . SER A 1 284 ? 6.823   22.391 25.782  1.00 134.12 ? 476 SER A O   1 
ATOM   1989 C  CB  . SER A 1 284 ? 5.765   23.331 22.794  1.00 135.77 ? 476 SER A CB  1 
ATOM   1990 O  OG  . SER A 1 284 ? 4.880   22.291 23.171  1.00 136.04 ? 476 SER A OG  1 
ATOM   1991 N  N   . GLU A 1 285 ? 6.791   24.634 25.526  1.00 133.34 ? 477 GLU A N   1 
ATOM   1992 C  CA  . GLU A 1 285 ? 6.721   24.935 26.962  1.00 132.52 ? 477 GLU A CA  1 
ATOM   1993 C  C   . GLU A 1 285 ? 5.460   24.418 27.658  1.00 131.33 ? 477 GLU A C   1 
ATOM   1994 O  O   . GLU A 1 285 ? 4.350   24.587 27.144  1.00 132.42 ? 477 GLU A O   1 
ATOM   1995 C  CB  . GLU A 1 285 ? 6.845   26.443 27.206  1.00 132.56 ? 477 GLU A CB  1 
ATOM   1996 C  CG  . GLU A 1 285 ? 8.270   26.945 27.371  1.00 132.18 ? 477 GLU A CG  1 
ATOM   1997 C  CD  . GLU A 1 285 ? 8.336   28.419 27.741  1.00 132.15 ? 477 GLU A CD  1 
ATOM   1998 O  OE1 . GLU A 1 285 ? 7.520   28.866 28.577  1.00 132.43 ? 477 GLU A OE1 1 
ATOM   1999 O  OE2 . GLU A 1 285 ? 9.209   29.132 27.201  1.00 131.23 ? 477 GLU A OE2 1 
ATOM   2000 N  N   . PRO A 1 286 ? 5.632   23.777 28.831  1.00 128.92 ? 478 PRO A N   1 
ATOM   2001 C  CA  . PRO A 1 286 ? 4.499   23.443 29.691  1.00 127.37 ? 478 PRO A CA  1 
ATOM   2002 C  C   . PRO A 1 286 ? 3.807   24.712 30.173  1.00 125.89 ? 478 PRO A C   1 
ATOM   2003 O  O   . PRO A 1 286 ? 4.467   25.728 30.417  1.00 125.00 ? 478 PRO A O   1 
ATOM   2004 C  CB  . PRO A 1 286 ? 5.149   22.720 30.877  1.00 127.60 ? 478 PRO A CB  1 
ATOM   2005 C  CG  . PRO A 1 286 ? 6.473   22.273 30.382  1.00 128.60 ? 478 PRO A CG  1 
ATOM   2006 C  CD  . PRO A 1 286 ? 6.907   23.311 29.401  1.00 128.70 ? 478 PRO A CD  1 
ATOM   2007 N  N   . SER A 1 287 ? 2.484   24.648 30.294  1.00 124.70 ? 479 SER A N   1 
ATOM   2008 C  CA  . SER A 1 287 ? 1.689   25.790 30.725  1.00 121.80 ? 479 SER A CA  1 
ATOM   2009 C  C   . SER A 1 287 ? 1.869   26.038 32.217  1.00 120.11 ? 479 SER A C   1 
ATOM   2010 O  O   . SER A 1 287 ? 1.859   25.102 33.019  1.00 120.64 ? 479 SER A O   1 
ATOM   2011 C  CB  . SER A 1 287 ? 0.211   25.572 30.388  1.00 120.95 ? 479 SER A CB  1 
ATOM   2012 O  OG  . SER A 1 287 ? 0.030   25.347 28.998  1.00 118.90 ? 479 SER A OG  1 
ATOM   2013 N  N   . LEU A 1 288 ? 2.057   27.304 32.575  1.00 118.14 ? 480 LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 288 ? 2.171   27.713 33.970  1.00 115.46 ? 480 LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 288 ? 0.793   28.169 34.429  1.00 116.68 ? 480 LEU A C   1 
ATOM   2016 O  O   . LEU A 1 288 ? 0.521   29.369 34.539  1.00 117.99 ? 480 LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 288 ? 3.201   28.833 34.099  1.00 113.16 ? 480 LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 288 ? 3.562   29.420 35.459  1.00 110.79 ? 480 LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 288 ? 4.533   28.527 36.229  1.00 108.81 ? 480 LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 288 ? 4.158   30.785 35.206  1.00 110.80 ? 480 LEU A CD2 1 
ATOM   2021 N  N   . LEU A 1 289 ? -0.066  27.186 34.691  1.00 117.19 ? 481 LEU A N   1 
ATOM   2022 C  CA  . LEU A 1 289 ? -1.504  27.387 34.902  1.00 116.00 ? 481 LEU A CA  1 
ATOM   2023 C  C   . LEU A 1 289 ? -1.820  28.329 36.065  1.00 113.63 ? 481 LEU A C   1 
ATOM   2024 O  O   . LEU A 1 289 ? -1.324  28.144 37.177  1.00 113.60 ? 481 LEU A O   1 
ATOM   2025 C  CB  . LEU A 1 289 ? -2.193  26.022 35.080  1.00 117.07 ? 481 LEU A CB  1 
ATOM   2026 C  CG  . LEU A 1 289 ? -3.717  25.803 35.062  1.00 117.68 ? 481 LEU A CG  1 
ATOM   2027 C  CD1 . LEU A 1 289 ? -4.338  25.960 36.456  1.00 117.66 ? 481 LEU A CD1 1 
ATOM   2028 C  CD2 . LEU A 1 289 ? -4.443  26.669 34.018  1.00 118.25 ? 481 LEU A CD2 1 
ATOM   2029 N  N   . GLU A 1 290 ? -2.646  29.337 35.787  1.00 112.47 ? 482 GLU A N   1 
ATOM   2030 C  CA  . GLU A 1 290 ? -3.031  30.340 36.780  1.00 113.30 ? 482 GLU A CA  1 
ATOM   2031 C  C   . GLU A 1 290 ? -4.469  30.160 37.278  1.00 113.78 ? 482 GLU A C   1 
ATOM   2032 O  O   . GLU A 1 290 ? -5.368  29.810 36.511  1.00 114.92 ? 482 GLU A O   1 
ATOM   2033 C  CB  . GLU A 1 290 ? -2.855  31.748 36.208  1.00 113.86 ? 482 GLU A CB  1 
ATOM   2034 C  CG  . GLU A 1 290 ? -2.907  32.857 37.254  1.00 115.81 ? 482 GLU A CG  1 
ATOM   2035 C  CD  . GLU A 1 290 ? -3.421  34.173 36.699  1.00 118.28 ? 482 GLU A CD  1 
ATOM   2036 O  OE1 . GLU A 1 290 ? -3.100  34.512 35.537  1.00 119.48 ? 482 GLU A OE1 1 
ATOM   2037 O  OE2 . GLU A 1 290 ? -4.151  34.873 37.432  1.00 119.19 ? 482 GLU A OE2 1 
ATOM   2038 N  N   . PHE A 1 291 ? -4.667  30.407 38.571  1.00 113.47 ? 483 PHE A N   1 
ATOM   2039 C  CA  . PHE A 1 291 ? -5.986  30.392 39.204  1.00 113.76 ? 483 PHE A CA  1 
ATOM   2040 C  C   . PHE A 1 291 ? -5.975  31.337 40.407  1.00 115.06 ? 483 PHE A C   1 
ATOM   2041 O  O   . PHE A 1 291 ? -4.907  31.639 40.946  1.00 115.78 ? 483 PHE A O   1 
ATOM   2042 C  CB  . PHE A 1 291 ? -6.403  28.966 39.602  1.00 113.45 ? 483 PHE A CB  1 
ATOM   2043 C  CG  . PHE A 1 291 ? -5.410  28.253 40.487  1.00 113.33 ? 483 PHE A CG  1 
ATOM   2044 C  CD1 . PHE A 1 291 ? -4.291  27.625 39.945  1.00 113.87 ? 483 PHE A CD1 1 
ATOM   2045 C  CD2 . PHE A 1 291 ? -5.606  28.189 41.861  1.00 113.14 ? 483 PHE A CD2 1 
ATOM   2046 C  CE1 . PHE A 1 291 ? -3.374  26.962 40.763  1.00 113.69 ? 483 PHE A CE1 1 
ATOM   2047 C  CE2 . PHE A 1 291 ? -4.695  27.525 42.687  1.00 112.83 ? 483 PHE A CE2 1 
ATOM   2048 C  CZ  . PHE A 1 291 ? -3.580  26.911 42.137  1.00 112.90 ? 483 PHE A CZ  1 
ATOM   2049 N  N   . LYS A 1 292 ? -7.152  31.806 40.823  1.00 115.68 ? 484 LYS A N   1 
ATOM   2050 C  CA  . LYS A 1 292 ? -7.239  32.844 41.860  1.00 116.22 ? 484 LYS A CA  1 
ATOM   2051 C  C   . LYS A 1 292 ? -8.023  32.425 43.112  1.00 114.19 ? 484 LYS A C   1 
ATOM   2052 O  O   . LYS A 1 292 ? -9.182  32.808 43.279  1.00 114.95 ? 484 LYS A O   1 
ATOM   2053 C  CB  . LYS A 1 292 ? -7.819  34.139 41.274  1.00 117.27 ? 484 LYS A CB  1 
ATOM   2054 C  CG  . LYS A 1 292 ? -6.934  34.827 40.240  1.00 117.67 ? 484 LYS A CG  1 
ATOM   2055 C  CD  . LYS A 1 292 ? -7.457  36.223 39.922  1.00 118.01 ? 484 LYS A CD  1 
ATOM   2056 C  CE  . LYS A 1 292 ? -6.651  36.896 38.817  1.00 118.36 ? 484 LYS A CE  1 
ATOM   2057 N  NZ  . LYS A 1 292 ? -7.008  36.381 37.465  1.00 118.37 ? 484 LYS A NZ  1 
ATOM   2058 N  N   . PRO A 1 293 ? -7.388  31.645 44.004  1.00 113.47 ? 485 PRO A N   1 
ATOM   2059 C  CA  . PRO A 1 293 ? -8.076  31.156 45.191  1.00 114.78 ? 485 PRO A CA  1 
ATOM   2060 C  C   . PRO A 1 293 ? -7.894  32.015 46.454  1.00 116.80 ? 485 PRO A C   1 
ATOM   2061 O  O   . PRO A 1 293 ? -8.432  31.668 47.509  1.00 117.10 ? 485 PRO A O   1 
ATOM   2062 C  CB  . PRO A 1 293 ? -7.428  29.786 45.400  1.00 114.17 ? 485 PRO A CB  1 
ATOM   2063 C  CG  . PRO A 1 293 ? -6.022  29.956 44.884  1.00 112.66 ? 485 PRO A CG  1 
ATOM   2064 C  CD  . PRO A 1 293 ? -6.002  31.145 43.949  1.00 113.08 ? 485 PRO A CD  1 
ATOM   2065 N  N   . PHE A 1 294 ? -7.162  33.124 46.347  1.00 117.78 ? 486 PHE A N   1 
ATOM   2066 C  CA  . PHE A 1 294 ? -6.809  33.927 47.521  1.00 119.21 ? 486 PHE A CA  1 
ATOM   2067 C  C   . PHE A 1 294 ? -7.736  35.114 47.783  1.00 124.14 ? 486 PHE A C   1 
ATOM   2068 O  O   . PHE A 1 294 ? -8.370  35.635 46.864  1.00 125.26 ? 486 PHE A O   1 
ATOM   2069 C  CB  . PHE A 1 294 ? -5.351  34.382 47.438  1.00 115.77 ? 486 PHE A CB  1 
ATOM   2070 C  CG  . PHE A 1 294 ? -4.374  33.248 47.329  1.00 114.08 ? 486 PHE A CG  1 
ATOM   2071 C  CD1 . PHE A 1 294 ? -4.396  32.204 48.246  1.00 112.52 ? 486 PHE A CD1 1 
ATOM   2072 C  CD2 . PHE A 1 294 ? -3.431  33.221 46.310  1.00 114.47 ? 486 PHE A CD2 1 
ATOM   2073 C  CE1 . PHE A 1 294 ? -3.498  31.152 48.150  1.00 111.99 ? 486 PHE A CE1 1 
ATOM   2074 C  CE2 . PHE A 1 294 ? -2.522  32.169 46.208  1.00 113.89 ? 486 PHE A CE2 1 
ATOM   2075 C  CZ  . PHE A 1 294 ? -2.557  31.133 47.130  1.00 113.22 ? 486 PHE A CZ  1 
ATOM   2076 N  N   . SER A 1 295 ? -7.800  35.536 49.048  1.00 128.85 ? 487 SER A N   1 
ATOM   2077 C  CA  . SER A 1 295 ? -8.712  36.602 49.476  1.00 131.62 ? 487 SER A CA  1 
ATOM   2078 C  C   . SER A 1 295 ? -8.105  37.599 50.473  1.00 134.94 ? 487 SER A C   1 
ATOM   2079 O  O   . SER A 1 295 ? -8.461  38.779 50.460  1.00 134.88 ? 487 SER A O   1 
ATOM   2080 C  CB  . SER A 1 295 ? -9.991  36.002 50.062  1.00 130.17 ? 487 SER A CB  1 
ATOM   2081 O  OG  . SER A 1 295 ? -10.605 35.129 49.133  1.00 129.90 ? 487 SER A OG  1 
ATOM   2082 N  N   . ASN A 1 296 ? -7.198  37.131 51.332  1.00 138.12 ? 488 ASN A N   1 
ATOM   2083 C  CA  . ASN A 1 296 ? -6.618  37.989 52.379  1.00 141.81 ? 488 ASN A CA  1 
ATOM   2084 C  C   . ASN A 1 296 ? -5.399  38.810 51.922  1.00 140.58 ? 488 ASN A C   1 
ATOM   2085 O  O   . ASN A 1 296 ? -4.482  39.091 52.709  1.00 140.98 ? 488 ASN A O   1 
ATOM   2086 C  CB  . ASN A 1 296 ? -6.329  37.189 53.672  1.00 146.11 ? 488 ASN A CB  1 
ATOM   2087 C  CG  . ASN A 1 296 ? -5.000  36.429 53.629  1.00 149.36 ? 488 ASN A CG  1 
ATOM   2088 O  OD1 . ASN A 1 296 ? -4.670  35.769 52.642  1.00 151.44 ? 488 ASN A OD1 1 
ATOM   2089 N  ND2 . ASN A 1 296 ? -4.236  36.519 54.714  1.00 149.58 ? 488 ASN A ND2 1 
ATOM   2090 N  N   . GLY A 1 297 ? -5.410  39.206 50.650  1.00 137.77 ? 489 GLY A N   1 
ATOM   2091 C  CA  . GLY A 1 297 ? -4.354  40.045 50.088  1.00 133.81 ? 489 GLY A CA  1 
ATOM   2092 C  C   . GLY A 1 297 ? -3.035  39.316 49.881  1.00 129.13 ? 489 GLY A C   1 
ATOM   2093 O  O   . GLY A 1 297 ? -3.033  38.116 49.596  1.00 130.27 ? 489 GLY A O   1 
ATOM   2094 N  N   . PRO A 1 298 ? -1.905  40.037 50.033  1.00 123.50 ? 490 PRO A N   1 
ATOM   2095 C  CA  . PRO A 1 298 ? -0.579  39.504 49.698  1.00 119.54 ? 490 PRO A CA  1 
ATOM   2096 C  C   . PRO A 1 298 ? -0.100  38.403 50.645  1.00 114.70 ? 490 PRO A C   1 
ATOM   2097 O  O   . PRO A 1 298 ? -0.416  38.422 51.837  1.00 116.12 ? 490 PRO A O   1 
ATOM   2098 C  CB  . PRO A 1 298 ? 0.329   40.733 49.789  1.00 120.38 ? 490 PRO A CB  1 
ATOM   2099 C  CG  . PRO A 1 298 ? -0.367  41.651 50.731  1.00 121.15 ? 490 PRO A CG  1 
ATOM   2100 C  CD  . PRO A 1 298 ? -1.833  41.418 50.547  1.00 121.75 ? 490 PRO A CD  1 
ATOM   2101 N  N   . LEU A 1 299 ? 0.665   37.463 50.095  1.00 108.04 ? 491 LEU A N   1 
ATOM   2102 C  CA  . LEU A 1 299 ? 1.140   36.281 50.808  1.00 103.00 ? 491 LEU A CA  1 
ATOM   2103 C  C   . LEU A 1 299 ? 2.664   36.184 50.769  1.00 102.96 ? 491 LEU A C   1 
ATOM   2104 O  O   . LEU A 1 299 ? 3.280   36.559 49.775  1.00 107.39 ? 491 LEU A O   1 
ATOM   2105 C  CB  . LEU A 1 299 ? 0.551   35.034 50.149  1.00 101.88 ? 491 LEU A CB  1 
ATOM   2106 C  CG  . LEU A 1 299 ? -0.663  34.308 50.730  1.00 101.28 ? 491 LEU A CG  1 
ATOM   2107 C  CD1 . LEU A 1 299 ? -1.875  35.206 50.861  1.00 103.02 ? 491 LEU A CD1 1 
ATOM   2108 C  CD2 . LEU A 1 299 ? -0.982  33.131 49.846  1.00 101.10 ? 491 LEU A CD2 1 
ATOM   2109 N  N   . VAL A 1 300 ? 3.275   35.664 51.830  1.00 99.84  ? 492 VAL A N   1 
ATOM   2110 C  CA  . VAL A 1 300 ? 4.728   35.471 51.843  1.00 97.16  ? 492 VAL A CA  1 
ATOM   2111 C  C   . VAL A 1 300 ? 5.123   34.305 50.946  1.00 98.94  ? 492 VAL A C   1 
ATOM   2112 O  O   . VAL A 1 300 ? 6.118   34.366 50.226  1.00 101.23 ? 492 VAL A O   1 
ATOM   2113 C  CB  . VAL A 1 300 ? 5.276   35.212 53.256  1.00 96.49  ? 492 VAL A CB  1 
ATOM   2114 C  CG1 . VAL A 1 300 ? 6.778   34.981 53.211  1.00 96.49  ? 492 VAL A CG1 1 
ATOM   2115 C  CG2 . VAL A 1 300 ? 4.966   36.378 54.174  1.00 99.13  ? 492 VAL A CG2 1 
ATOM   2116 N  N   . GLY A 1 301 ? 4.334   33.242 50.993  1.00 99.03  ? 493 GLY A N   1 
ATOM   2117 C  CA  . GLY A 1 301 ? 4.633   32.039 50.236  1.00 98.57  ? 493 GLY A CA  1 
ATOM   2118 C  C   . GLY A 1 301 ? 4.038   30.828 50.919  1.00 99.27  ? 493 GLY A C   1 
ATOM   2119 O  O   . GLY A 1 301 ? 3.177   30.956 51.789  1.00 101.47 ? 493 GLY A O   1 
ATOM   2120 N  N   . GLY A 1 302 ? 4.494   29.647 50.522  1.00 97.41  ? 494 GLY A N   1 
ATOM   2121 C  CA  . GLY A 1 302 ? 3.961   28.414 51.067  1.00 96.52  ? 494 GLY A CA  1 
ATOM   2122 C  C   . GLY A 1 302 ? 4.951   27.274 51.089  1.00 97.59  ? 494 GLY A C   1 
ATOM   2123 O  O   . GLY A 1 302 ? 6.085   27.404 50.630  1.00 96.86  ? 494 GLY A O   1 
ATOM   2124 N  N   . PHE A 1 303 ? 4.512   26.148 51.632  1.00 97.83  ? 495 PHE A N   1 
ATOM   2125 C  CA  . PHE A 1 303 ? 5.318   24.942 51.651  1.00 99.67  ? 495 PHE A CA  1 
ATOM   2126 C  C   . PHE A 1 303 ? 4.423   23.712 51.609  1.00 101.19 ? 495 PHE A C   1 
ATOM   2127 O  O   . PHE A 1 303 ? 3.236   23.784 51.940  1.00 103.39 ? 495 PHE A O   1 
ATOM   2128 C  CB  . PHE A 1 303 ? 6.220   24.920 52.888  1.00 99.81  ? 495 PHE A CB  1 
ATOM   2129 C  CG  . PHE A 1 303 ? 5.491   25.155 54.190  1.00 101.49 ? 495 PHE A CG  1 
ATOM   2130 C  CD1 . PHE A 1 303 ? 5.443   26.427 54.758  1.00 102.89 ? 495 PHE A CD1 1 
ATOM   2131 C  CD2 . PHE A 1 303 ? 4.877   24.101 54.865  1.00 99.25  ? 495 PHE A CD2 1 
ATOM   2132 C  CE1 . PHE A 1 303 ? 4.780   26.646 55.968  1.00 101.54 ? 495 PHE A CE1 1 
ATOM   2133 C  CE2 . PHE A 1 303 ? 4.222   24.310 56.073  1.00 97.63  ? 495 PHE A CE2 1 
ATOM   2134 C  CZ  . PHE A 1 303 ? 4.170   25.580 56.627  1.00 98.80  ? 495 PHE A CZ  1 
ATOM   2135 N  N   . VAL A 1 304 ? 4.982   22.589 51.180  1.00 100.24 ? 496 VAL A N   1 
ATOM   2136 C  CA  . VAL A 1 304 ? 4.265   21.325 51.263  1.00 99.55  ? 496 VAL A CA  1 
ATOM   2137 C  C   . VAL A 1 304 ? 4.803   20.608 52.480  1.00 101.26 ? 496 VAL A C   1 
ATOM   2138 O  O   . VAL A 1 304 ? 5.993   20.296 52.532  1.00 104.21 ? 496 VAL A O   1 
ATOM   2139 C  CB  . VAL A 1 304 ? 4.476   20.446 50.018  1.00 97.31  ? 496 VAL A CB  1 
ATOM   2140 C  CG1 . VAL A 1 304 ? 3.771   19.114 50.196  1.00 99.24  ? 496 VAL A CG1 1 
ATOM   2141 C  CG2 . VAL A 1 304 ? 3.966   21.151 48.776  1.00 97.52  ? 496 VAL A CG2 1 
ATOM   2142 N  N   . TYR A 1 305 ? 3.945   20.364 53.467  1.00 100.01 ? 497 TYR A N   1 
ATOM   2143 C  CA  . TYR A 1 305 ? 4.393   19.684 54.676  1.00 99.15  ? 497 TYR A CA  1 
ATOM   2144 C  C   . TYR A 1 305 ? 4.547   18.194 54.404  1.00 99.23  ? 497 TYR A C   1 
ATOM   2145 O  O   . TYR A 1 305 ? 3.605   17.521 54.000  1.00 98.02  ? 497 TYR A O   1 
ATOM   2146 C  CB  . TYR A 1 305 ? 3.460   19.954 55.860  1.00 98.88  ? 497 TYR A CB  1 
ATOM   2147 C  CG  . TYR A 1 305 ? 3.859   19.254 57.151  1.00 99.80  ? 497 TYR A CG  1 
ATOM   2148 C  CD1 . TYR A 1 305 ? 4.786   19.818 58.017  1.00 99.90  ? 497 TYR A CD1 1 
ATOM   2149 C  CD2 . TYR A 1 305 ? 3.294   18.035 57.511  1.00 100.91 ? 497 TYR A CD2 1 
ATOM   2150 C  CE1 . TYR A 1 305 ? 5.148   19.180 59.208  1.00 100.38 ? 497 TYR A CE1 1 
ATOM   2151 C  CE2 . TYR A 1 305 ? 3.645   17.393 58.695  1.00 100.49 ? 497 TYR A CE2 1 
ATOM   2152 C  CZ  . TYR A 1 305 ? 4.570   17.970 59.538  1.00 100.36 ? 497 TYR A CZ  1 
ATOM   2153 O  OH  . TYR A 1 305 ? 4.918   17.329 60.706  1.00 100.25 ? 497 TYR A OH  1 
ATOM   2154 N  N   . ARG A 1 306 ? 5.761   17.700 54.606  1.00 100.99 ? 498 ARG A N   1 
ATOM   2155 C  CA  . ARG A 1 306 ? 6.065   16.286 54.447  1.00 102.09 ? 498 ARG A CA  1 
ATOM   2156 C  C   . ARG A 1 306 ? 6.799   15.835 55.701  1.00 100.52 ? 498 ARG A C   1 
ATOM   2157 O  O   . ARG A 1 306 ? 7.590   14.894 55.684  1.00 98.13  ? 498 ARG A O   1 
ATOM   2158 C  CB  . ARG A 1 306 ? 6.901   16.058 53.182  1.00 104.91 ? 498 ARG A CB  1 
ATOM   2159 C  CG  . ARG A 1 306 ? 6.092   16.060 51.886  1.00 104.94 ? 498 ARG A CG  1 
ATOM   2160 C  CD  . ARG A 1 306 ? 5.820   14.642 51.409  1.00 108.63 ? 498 ARG A CD  1 
ATOM   2161 N  NE  . ARG A 1 306 ? 4.424   14.431 51.003  1.00 111.26 ? 498 ARG A NE  1 
ATOM   2162 C  CZ  . ARG A 1 306 ? 3.902   14.784 49.828  1.00 110.63 ? 498 ARG A CZ  1 
ATOM   2163 N  NH1 . ARG A 1 306 ? 4.639   15.391 48.903  1.00 111.11 ? 498 ARG A NH1 1 
ATOM   2164 N  NH2 . ARG A 1 306 ? 2.627   14.538 49.583  1.00 110.67 ? 498 ARG A NH2 1 
ATOM   2165 N  N   . GLY A 1 307 ? 6.514   16.528 56.798  1.00 101.54 ? 499 GLY A N   1 
ATOM   2166 C  CA  . GLY A 1 307 ? 7.112   16.219 58.085  1.00 101.92 ? 499 GLY A CA  1 
ATOM   2167 C  C   . GLY A 1 307 ? 6.506   15.002 58.747  1.00 102.17 ? 499 GLY A C   1 
ATOM   2168 O  O   . GLY A 1 307 ? 5.830   14.192 58.107  1.00 102.63 ? 499 GLY A O   1 
ATOM   2169 N  N   . CYS A 1 308 ? 6.743   14.887 60.048  1.00 102.34 ? 500 CYS A N   1 
ATOM   2170 C  CA  . CYS A 1 308 ? 6.430   13.671 60.772  1.00 99.34  ? 500 CYS A CA  1 
ATOM   2171 C  C   . CYS A 1 308 ? 5.658   13.933 62.049  1.00 97.82  ? 500 CYS A C   1 
ATOM   2172 O  O   . CYS A 1 308 ? 4.785   13.145 62.406  1.00 97.95  ? 500 CYS A O   1 
ATOM   2173 C  CB  . CYS A 1 308 ? 7.715   12.918 61.098  1.00 100.65 ? 500 CYS A CB  1 
ATOM   2174 S  SG  . CYS A 1 308 ? 7.439   11.252 61.699  1.00 104.06 ? 500 CYS A SG  1 
ATOM   2175 N  N   . GLN A 1 309 ? 5.984   15.022 62.746  1.00 96.63  ? 501 GLN A N   1 
ATOM   2176 C  CA  . GLN A 1 309 ? 5.327   15.319 64.017  1.00 95.69  ? 501 GLN A CA  1 
ATOM   2177 C  C   . GLN A 1 309 ? 3.813   15.434 63.827  1.00 97.41  ? 501 GLN A C   1 
ATOM   2178 O  O   . GLN A 1 309 ? 3.047   14.862 64.603  1.00 96.72  ? 501 GLN A O   1 
ATOM   2179 C  CB  . GLN A 1 309 ? 5.911   16.563 64.691  1.00 89.86  ? 501 GLN A CB  1 
ATOM   2180 C  CG  . GLN A 1 309 ? 5.623   16.658 66.197  1.00 86.57  ? 501 GLN A CG  1 
ATOM   2181 C  CD  . GLN A 1 309 ? 4.324   17.389 66.523  1.00 86.34  ? 501 GLN A CD  1 
ATOM   2182 O  OE1 . GLN A 1 309 ? 3.960   18.350 65.851  1.00 88.97  ? 501 GLN A OE1 1 
ATOM   2183 N  NE2 . GLN A 1 309 ? 3.635   16.951 67.576  1.00 83.72  ? 501 GLN A NE2 1 
ATOM   2184 N  N   . SER A 1 310 ? 3.389   16.140 62.781  1.00 98.04  ? 502 SER A N   1 
ATOM   2185 C  CA  . SER A 1 310 ? 1.968   16.230 62.460  1.00 98.82  ? 502 SER A CA  1 
ATOM   2186 C  C   . SER A 1 310 ? 1.549   15.181 61.440  1.00 100.09 ? 502 SER A C   1 
ATOM   2187 O  O   . SER A 1 310 ? 2.058   15.151 60.318  1.00 102.10 ? 502 SER A O   1 
ATOM   2188 C  CB  . SER A 1 310 ? 1.603   17.624 61.951  1.00 98.28  ? 502 SER A CB  1 
ATOM   2189 O  OG  . SER A 1 310 ? 0.193   17.755 61.851  1.00 95.35  ? 502 SER A OG  1 
ATOM   2190 N  N   . GLU A 1 311 ? 0.624   14.315 61.841  1.00 100.33 ? 503 GLU A N   1 
ATOM   2191 C  CA  . GLU A 1 311 ? 0.032   13.353 60.925  1.00 99.89  ? 503 GLU A CA  1 
ATOM   2192 C  C   . GLU A 1 311 ? -0.917  14.081 59.992  1.00 96.56  ? 503 GLU A C   1 
ATOM   2193 O  O   . GLU A 1 311 ? -0.768  14.003 58.776  1.00 99.01  ? 503 GLU A O   1 
ATOM   2194 C  CB  . GLU A 1 311 ? -0.734  12.275 61.686  1.00 101.64 ? 503 GLU A CB  1 
ATOM   2195 C  CG  . GLU A 1 311 ? 0.012   10.973 61.892  1.00 103.98 ? 503 GLU A CG  1 
ATOM   2196 C  CD  . GLU A 1 311 ? -0.785  9.982  62.725  1.00 105.82 ? 503 GLU A CD  1 
ATOM   2197 O  OE1 . GLU A 1 311 ? -1.438  10.422 63.699  1.00 107.35 ? 503 GLU A OE1 1 
ATOM   2198 O  OE2 . GLU A 1 311 ? -0.760  8.766  62.413  1.00 109.29 ? 503 GLU A OE2 1 
ATOM   2199 N  N   . ARG A 1 312 ? -1.878  14.800 60.573  1.00 90.96  ? 504 ARG A N   1 
ATOM   2200 C  CA  . ARG A 1 312 ? -2.920  15.487 59.810  1.00 84.06  ? 504 ARG A CA  1 
ATOM   2201 C  C   . ARG A 1 312 ? -2.384  16.443 58.743  1.00 85.64  ? 504 ARG A C   1 
ATOM   2202 O  O   . ARG A 1 312 ? -2.893  16.468 57.617  1.00 87.29  ? 504 ARG A O   1 
ATOM   2203 C  CB  . ARG A 1 312 ? -3.909  16.195 60.740  1.00 81.65  ? 504 ARG A CB  1 
ATOM   2204 C  CG  . ARG A 1 312 ? -3.307  16.843 61.976  1.00 79.31  ? 504 ARG A CG  1 
ATOM   2205 C  CD  . ARG A 1 312 ? -4.349  17.666 62.712  1.00 79.11  ? 504 ARG A CD  1 
ATOM   2206 N  NE  . ARG A 1 312 ? -3.758  18.582 63.685  1.00 80.28  ? 504 ARG A NE  1 
ATOM   2207 C  CZ  . ARG A 1 312 ? -4.337  19.696 64.131  1.00 80.50  ? 504 ARG A CZ  1 
ATOM   2208 N  NH1 . ARG A 1 312 ? -5.541  20.066 63.705  1.00 80.26  ? 504 ARG A NH1 1 
ATOM   2209 N  NH2 . ARG A 1 312 ? -3.705  20.454 65.007  1.00 79.35  ? 504 ARG A NH2 1 
ATOM   2210 N  N   . LEU A 1 313 ? -1.341  17.196 59.077  1.00 85.15  ? 505 LEU A N   1 
ATOM   2211 C  CA  . LEU A 1 313 ? -0.782  18.182 58.147  1.00 88.78  ? 505 LEU A CA  1 
ATOM   2212 C  C   . LEU A 1 313 ? -0.053  17.539 56.973  1.00 91.44  ? 505 LEU A C   1 
ATOM   2213 O  O   . LEU A 1 313 ? 0.305   18.235 56.018  1.00 92.03  ? 505 LEU A O   1 
ATOM   2214 C  CB  . LEU A 1 313 ? 0.190   19.129 58.863  1.00 90.06  ? 505 LEU A CB  1 
ATOM   2215 C  CG  . LEU A 1 313 ? 0.012   20.647 58.751  1.00 87.61  ? 505 LEU A CG  1 
ATOM   2216 C  CD1 . LEU A 1 313 ? 1.378   21.328 58.733  1.00 82.95  ? 505 LEU A CD1 1 
ATOM   2217 C  CD2 . LEU A 1 313 ? -0.830  21.038 57.533  1.00 86.71  ? 505 LEU A CD2 1 
ATOM   2218 N  N   . TYR A 1 314 ? 0.172   16.224 57.048  1.00 91.48  ? 506 TYR A N   1 
ATOM   2219 C  CA  . TYR A 1 314 ? 0.987   15.532 56.048  1.00 89.75  ? 506 TYR A CA  1 
ATOM   2220 C  C   . TYR A 1 314 ? 0.429   15.689 54.635  1.00 90.75  ? 506 TYR A C   1 
ATOM   2221 O  O   . TYR A 1 314 ? -0.745  15.406 54.380  1.00 92.32  ? 506 TYR A O   1 
ATOM   2222 C  CB  . TYR A 1 314 ? 1.192   14.050 56.391  1.00 88.50  ? 506 TYR A CB  1 
ATOM   2223 C  CG  . TYR A 1 314 ? 2.173   13.390 55.457  1.00 88.40  ? 506 TYR A CG  1 
ATOM   2224 C  CD1 . TYR A 1 314 ? 3.541   13.432 55.713  1.00 90.36  ? 506 TYR A CD1 1 
ATOM   2225 C  CD2 . TYR A 1 314 ? 1.741   12.762 54.294  1.00 85.73  ? 506 TYR A CD2 1 
ATOM   2226 C  CE1 . TYR A 1 314 ? 4.451   12.849 54.840  1.00 90.46  ? 506 TYR A CE1 1 
ATOM   2227 C  CE2 . TYR A 1 314 ? 2.639   12.180 53.417  1.00 85.90  ? 506 TYR A CE2 1 
ATOM   2228 C  CZ  . TYR A 1 314 ? 3.987   12.222 53.695  1.00 88.80  ? 506 TYR A CZ  1 
ATOM   2229 O  OH  . TYR A 1 314 ? 4.877   11.645 52.823  1.00 89.88  ? 506 TYR A OH  1 
ATOM   2230 N  N   . GLY A 1 315 ? 1.289   16.152 53.733  1.00 89.47  ? 507 GLY A N   1 
ATOM   2231 C  CA  . GLY A 1 315 ? 0.947   16.343 52.328  1.00 87.69  ? 507 GLY A CA  1 
ATOM   2232 C  C   . GLY A 1 315 ? 0.103   17.573 52.041  1.00 88.07  ? 507 GLY A C   1 
ATOM   2233 O  O   . GLY A 1 315 ? -0.461  17.706 50.954  1.00 90.32  ? 507 GLY A O   1 
ATOM   2234 N  N   . SER A 1 316 ? 0.013   18.478 53.007  1.00 88.78  ? 508 SER A N   1 
ATOM   2235 C  CA  . SER A 1 316 ? -0.787  19.682 52.829  1.00 92.03  ? 508 SER A CA  1 
ATOM   2236 C  C   . SER A 1 316 ? 0.027   20.849 52.261  1.00 94.11  ? 508 SER A C   1 
ATOM   2237 O  O   . SER A 1 316 ? 1.219   21.000 52.551  1.00 94.02  ? 508 SER A O   1 
ATOM   2238 C  CB  . SER A 1 316 ? -1.462  20.071 54.143  1.00 92.22  ? 508 SER A CB  1 
ATOM   2239 O  OG  . SER A 1 316 ? -2.131  18.954 54.705  1.00 93.78  ? 508 SER A OG  1 
ATOM   2240 N  N   . TYR A 1 317 ? -0.627  21.650 51.426  1.00 95.36  ? 509 TYR A N   1 
ATOM   2241 C  CA  . TYR A 1 317 ? -0.047  22.881 50.925  1.00 97.36  ? 509 TYR A CA  1 
ATOM   2242 C  C   . TYR A 1 317 ? -0.419  23.988 51.896  1.00 97.43  ? 509 TYR A C   1 
ATOM   2243 O  O   . TYR A 1 317 ? -1.596  24.277 52.090  1.00 102.93 ? 509 TYR A O   1 
ATOM   2244 C  CB  . TYR A 1 317 ? -0.600  23.202 49.540  1.00 99.87  ? 509 TYR A CB  1 
ATOM   2245 C  CG  . TYR A 1 317 ? -0.113  22.292 48.436  1.00 101.49 ? 509 TYR A CG  1 
ATOM   2246 C  CD1 . TYR A 1 317 ? -0.554  20.973 48.343  1.00 102.90 ? 509 TYR A CD1 1 
ATOM   2247 C  CD2 . TYR A 1 317 ? 0.766   22.758 47.465  1.00 102.02 ? 509 TYR A CD2 1 
ATOM   2248 C  CE1 . TYR A 1 317 ? -0.119  20.139 47.322  1.00 102.28 ? 509 TYR A CE1 1 
ATOM   2249 C  CE2 . TYR A 1 317 ? 1.207   21.933 46.438  1.00 102.88 ? 509 TYR A CE2 1 
ATOM   2250 C  CZ  . TYR A 1 317 ? 0.761   20.625 46.375  1.00 102.47 ? 509 TYR A CZ  1 
ATOM   2251 O  OH  . TYR A 1 317 ? 1.195   19.804 45.358  1.00 103.14 ? 509 TYR A OH  1 
ATOM   2252 N  N   . VAL A 1 318 ? 0.579   24.593 52.519  1.00 92.87  ? 510 VAL A N   1 
ATOM   2253 C  CA  . VAL A 1 318 ? 0.335   25.641 53.503  1.00 92.90  ? 510 VAL A CA  1 
ATOM   2254 C  C   . VAL A 1 318 ? 0.888   26.957 52.976  1.00 93.23  ? 510 VAL A C   1 
ATOM   2255 O  O   . VAL A 1 318 ? 2.018   27.010 52.490  1.00 97.47  ? 510 VAL A O   1 
ATOM   2256 C  CB  . VAL A 1 318 ? 1.023   25.327 54.865  1.00 92.25  ? 510 VAL A CB  1 
ATOM   2257 C  CG1 . VAL A 1 318 ? 0.637   26.357 55.920  1.00 90.67  ? 510 VAL A CG1 1 
ATOM   2258 C  CG2 . VAL A 1 318 ? 0.697   23.907 55.350  1.00 90.90  ? 510 VAL A CG2 1 
ATOM   2259 N  N   . PHE A 1 319 ? 0.098   28.017 53.066  1.00 88.53  ? 511 PHE A N   1 
ATOM   2260 C  CA  . PHE A 1 319 ? 0.597   29.342 52.736  1.00 87.52  ? 511 PHE A CA  1 
ATOM   2261 C  C   . PHE A 1 319 ? 0.290   30.290 53.880  1.00 87.06  ? 511 PHE A C   1 
ATOM   2262 O  O   . PHE A 1 319 ? -0.803  30.255 54.450  1.00 88.11  ? 511 PHE A O   1 
ATOM   2263 C  CB  . PHE A 1 319 ? -0.032  29.869 51.445  1.00 91.04  ? 511 PHE A CB  1 
ATOM   2264 C  CG  . PHE A 1 319 ? 0.460   29.193 50.186  1.00 91.56  ? 511 PHE A CG  1 
ATOM   2265 C  CD1 . PHE A 1 319 ? 0.020   27.911 49.840  1.00 90.09  ? 511 PHE A CD1 1 
ATOM   2266 C  CD2 . PHE A 1 319 ? 1.318   29.861 49.319  1.00 92.09  ? 511 PHE A CD2 1 
ATOM   2267 C  CE1 . PHE A 1 319 ? 0.454   27.291 48.673  1.00 88.67  ? 511 PHE A CE1 1 
ATOM   2268 C  CE2 . PHE A 1 319 ? 1.763   29.249 48.146  1.00 93.25  ? 511 PHE A CE2 1 
ATOM   2269 C  CZ  . PHE A 1 319 ? 1.328   27.958 47.824  1.00 91.54  ? 511 PHE A CZ  1 
ATOM   2270 N  N   . GLY A 1 320 ? 1.264   31.127 54.220  1.00 86.29  ? 512 GLY A N   1 
ATOM   2271 C  CA  . GLY A 1 320 ? 1.096   32.138 55.259  1.00 86.98  ? 512 GLY A CA  1 
ATOM   2272 C  C   . GLY A 1 320 ? 1.327   33.539 54.720  1.00 89.37  ? 512 GLY A C   1 
ATOM   2273 O  O   . GLY A 1 320 ? 2.000   33.715 53.696  1.00 89.76  ? 512 GLY A O   1 
ATOM   2274 N  N   . ASP A 1 321 ? 0.763   34.536 55.402  1.00 89.25  ? 513 ASP A N   1 
ATOM   2275 C  CA  . ASP A 1 321 ? 1.019   35.930 55.061  1.00 91.66  ? 513 ASP A CA  1 
ATOM   2276 C  C   . ASP A 1 321 ? 1.927   36.600 56.094  1.00 95.57  ? 513 ASP A C   1 
ATOM   2277 O  O   . ASP A 1 321 ? 2.297   35.984 57.100  1.00 96.25  ? 513 ASP A O   1 
ATOM   2278 C  CB  . ASP A 1 321 ? -0.290  36.701 54.881  1.00 91.98  ? 513 ASP A CB  1 
ATOM   2279 C  CG  . ASP A 1 321 ? -1.024  36.945 56.185  1.00 93.52  ? 513 ASP A CG  1 
ATOM   2280 O  OD1 . ASP A 1 321 ? -2.085  37.597 56.131  1.00 95.98  ? 513 ASP A OD1 1 
ATOM   2281 O  OD2 . ASP A 1 321 ? -0.565  36.500 57.257  1.00 93.43  ? 513 ASP A OD2 1 
ATOM   2282 N  N   . ARG A 1 322 ? 2.275   37.861 55.836  1.00 98.16  ? 514 ARG A N   1 
ATOM   2283 C  CA  . ARG A 1 322 ? 3.187   38.634 56.681  1.00 99.03  ? 514 ARG A CA  1 
ATOM   2284 C  C   . ARG A 1 322 ? 2.800   38.598 58.159  1.00 97.15  ? 514 ARG A C   1 
ATOM   2285 O  O   . ARG A 1 322 ? 3.664   38.497 59.024  1.00 99.34  ? 514 ARG A O   1 
ATOM   2286 C  CB  . ARG A 1 322 ? 3.258   40.083 56.194  1.00 98.86  ? 514 ARG A CB  1 
ATOM   2287 C  CG  . ARG A 1 322 ? 4.594   40.749 56.439  1.00 104.61 ? 514 ARG A CG  1 
ATOM   2288 C  CD  . ARG A 1 322 ? 4.683   42.134 55.804  1.00 106.78 ? 514 ARG A CD  1 
ATOM   2289 N  NE  . ARG A 1 322 ? 4.610   43.235 56.772  1.00 115.22 ? 514 ARG A NE  1 
ATOM   2290 C  CZ  . ARG A 1 322 ? 3.487   43.709 57.320  1.00 120.00 ? 514 ARG A CZ  1 
ATOM   2291 N  NH1 . ARG A 1 322 ? 2.302   43.174 57.032  1.00 121.90 ? 514 ARG A NH1 1 
ATOM   2292 N  NH2 . ARG A 1 322 ? 3.546   44.725 58.174  1.00 120.78 ? 514 ARG A NH2 1 
ATOM   2293 N  N   . ASN A 1 323 ? 1.502   38.660 58.440  1.00 97.42  ? 515 ASN A N   1 
ATOM   2294 C  CA  . ASN A 1 323 ? 1.012   38.737 59.819  1.00 95.99  ? 515 ASN A CA  1 
ATOM   2295 C  C   . ASN A 1 323 ? 0.675   37.390 60.465  1.00 95.91  ? 515 ASN A C   1 
ATOM   2296 O  O   . ASN A 1 323 ? 0.146   37.343 61.580  1.00 97.96  ? 515 ASN A O   1 
ATOM   2297 C  CB  . ASN A 1 323 ? -0.178  39.697 59.910  1.00 93.21  ? 515 ASN A CB  1 
ATOM   2298 C  CG  . ASN A 1 323 ? -0.376  40.253 61.306  1.00 93.42  ? 515 ASN A CG  1 
ATOM   2299 O  OD1 . ASN A 1 323 ? -1.501  40.342 61.779  1.00 96.71  ? 515 ASN A OD1 1 
ATOM   2300 N  ND2 . ASN A 1 323 ? 0.714   40.629 61.973  1.00 93.15  ? 515 ASN A ND2 1 
ATOM   2301 N  N   . GLY A 1 324 ? 0.987   36.302 59.763  1.00 92.52  ? 516 GLY A N   1 
ATOM   2302 C  CA  . GLY A 1 324 ? 0.884   34.961 60.325  1.00 91.49  ? 516 GLY A CA  1 
ATOM   2303 C  C   . GLY A 1 324 ? -0.469  34.269 60.251  1.00 93.61  ? 516 GLY A C   1 
ATOM   2304 O  O   . GLY A 1 324 ? -0.756  33.392 61.073  1.00 95.39  ? 516 GLY A O   1 
ATOM   2305 N  N   . ASN A 1 325 ? -1.299  34.666 59.284  1.00 90.79  ? 517 ASN A N   1 
ATOM   2306 C  CA  . ASN A 1 325 ? -2.519  33.940 58.940  1.00 86.84  ? 517 ASN A CA  1 
ATOM   2307 C  C   . ASN A 1 325 ? -2.156  32.812 57.993  1.00 89.46  ? 517 ASN A C   1 
ATOM   2308 O  O   . ASN A 1 325 ? -1.563  33.059 56.944  1.00 89.82  ? 517 ASN A O   1 
ATOM   2309 C  CB  . ASN A 1 325 ? -3.504  34.856 58.220  1.00 85.47  ? 517 ASN A CB  1 
ATOM   2310 C  CG  . ASN A 1 325 ? -3.746  36.151 58.950  1.00 88.77  ? 517 ASN A CG  1 
ATOM   2311 O  OD1 . ASN A 1 325 ? -4.243  36.165 60.073  1.00 92.43  ? 517 ASN A OD1 1 
ATOM   2312 N  ND2 . ASN A 1 325 ? -3.418  37.258 58.304  1.00 90.81  ? 517 ASN A ND2 1 
ATOM   2313 N  N   . PHE A 1 326 ? -2.515  31.578 58.334  1.00 92.45  ? 518 PHE A N   1 
ATOM   2314 C  CA  . PHE A 1 326 ? -2.199  30.454 57.446  1.00 94.76  ? 518 PHE A CA  1 
ATOM   2315 C  C   . PHE A 1 326 ? -3.412  29.877 56.712  1.00 98.92  ? 518 PHE A C   1 
ATOM   2316 O  O   . PHE A 1 326 ? -4.536  29.888 57.229  1.00 101.95 ? 518 PHE A O   1 
ATOM   2317 C  CB  . PHE A 1 326 ? -1.428  29.370 58.195  1.00 93.01  ? 518 PHE A CB  1 
ATOM   2318 C  CG  . PHE A 1 326 ? -0.058  29.809 58.655  1.00 93.12  ? 518 PHE A CG  1 
ATOM   2319 C  CD1 . PHE A 1 326 ? 0.098   30.540 59.834  1.00 92.05  ? 518 PHE A CD1 1 
ATOM   2320 C  CD2 . PHE A 1 326 ? 1.076   29.488 57.913  1.00 91.87  ? 518 PHE A CD2 1 
ATOM   2321 C  CE1 . PHE A 1 326 ? 1.348   30.943 60.256  1.00 90.67  ? 518 PHE A CE1 1 
ATOM   2322 C  CE2 . PHE A 1 326 ? 2.344   29.883 58.331  1.00 88.78  ? 518 PHE A CE2 1 
ATOM   2323 C  CZ  . PHE A 1 326 ? 2.479   30.615 59.497  1.00 91.22  ? 518 PHE A CZ  1 
ATOM   2324 N  N   . LEU A 1 327 ? -3.167  29.390 55.496  1.00 98.70  ? 519 LEU A N   1 
ATOM   2325 C  CA  . LEU A 1 327 ? -4.188  28.749 54.670  1.00 96.91  ? 519 LEU A CA  1 
ATOM   2326 C  C   . LEU A 1 327 ? -3.774  27.336 54.326  1.00 98.00  ? 519 LEU A C   1 
ATOM   2327 O  O   . LEU A 1 327 ? -2.663  26.903 54.635  1.00 100.52 ? 519 LEU A O   1 
ATOM   2328 C  CB  . LEU A 1 327 ? -4.347  29.478 53.335  1.00 97.79  ? 519 LEU A CB  1 
ATOM   2329 C  CG  . LEU A 1 327 ? -4.357  30.992 53.179  1.00 100.88 ? 519 LEU A CG  1 
ATOM   2330 C  CD1 . LEU A 1 327 ? -4.474  31.290 51.708  1.00 99.90  ? 519 LEU A CD1 1 
ATOM   2331 C  CD2 . LEU A 1 327 ? -5.500  31.644 53.958  1.00 105.73 ? 519 LEU A CD2 1 
ATOM   2332 N  N   . THR A 1 328 ? -4.668  26.631 53.647  1.00 96.31  ? 520 THR A N   1 
ATOM   2333 C  CA  . THR A 1 328 ? -4.319  25.390 52.990  1.00 94.86  ? 520 THR A CA  1 
ATOM   2334 C  C   . THR A 1 328 ? -4.916  25.434 51.600  1.00 97.21  ? 520 THR A C   1 
ATOM   2335 O  O   . THR A 1 328 ? -6.109  25.690 51.456  1.00 102.85 ? 520 THR A O   1 
ATOM   2336 C  CB  . THR A 1 328 ? -4.866  24.168 53.756  1.00 93.77  ? 520 THR A CB  1 
ATOM   2337 O  OG1 . THR A 1 328 ? -4.371  24.185 55.097  1.00 94.15  ? 520 THR A OG1 1 
ATOM   2338 C  CG2 . THR A 1 328 ? -4.430  22.867 53.097  1.00 95.34  ? 520 THR A CG2 1 
ATOM   2339 N  N   . LEU A 1 329 ? -4.095  25.220 50.575  1.00 96.06  ? 521 LEU A N   1 
ATOM   2340 C  CA  . LEU A 1 329 ? -4.634  24.907 49.254  1.00 95.61  ? 521 LEU A CA  1 
ATOM   2341 C  C   . LEU A 1 329 ? -4.829  23.404 49.182  1.00 96.56  ? 521 LEU A C   1 
ATOM   2342 O  O   . LEU A 1 329 ? -3.882  22.632 49.356  1.00 98.33  ? 521 LEU A O   1 
ATOM   2343 C  CB  . LEU A 1 329 ? -3.726  25.388 48.114  1.00 93.99  ? 521 LEU A CB  1 
ATOM   2344 C  CG  . LEU A 1 329 ? -3.882  26.796 47.524  1.00 92.72  ? 521 LEU A CG  1 
ATOM   2345 C  CD1 . LEU A 1 329 ? -5.337  27.211 47.387  1.00 94.23  ? 521 LEU A CD1 1 
ATOM   2346 C  CD2 . LEU A 1 329 ? -3.153  27.796 48.369  1.00 94.58  ? 521 LEU A CD2 1 
ATOM   2347 N  N   . GLN A 1 330 ? -6.068  22.993 48.956  1.00 96.87  ? 522 GLN A N   1 
ATOM   2348 C  CA  . GLN A 1 330 ? -6.388  21.577 48.845  1.00 99.49  ? 522 GLN A CA  1 
ATOM   2349 C  C   . GLN A 1 330 ? -7.074  21.330 47.507  1.00 93.83  ? 522 GLN A C   1 
ATOM   2350 O  O   . GLN A 1 330 ? -7.880  22.146 47.061  1.00 91.62  ? 522 GLN A O   1 
ATOM   2351 C  CB  . GLN A 1 330 ? -7.274  21.151 50.017  1.00 100.57 ? 522 GLN A CB  1 
ATOM   2352 C  CG  . GLN A 1 330 ? -7.389  19.647 50.232  1.00 103.83 ? 522 GLN A CG  1 
ATOM   2353 C  CD  . GLN A 1 330 ? -8.336  19.297 51.383  1.00 106.43 ? 522 GLN A CD  1 
ATOM   2354 O  OE1 . GLN A 1 330 ? -8.406  20.009 52.392  1.00 110.72 ? 522 GLN A OE1 1 
ATOM   2355 N  NE2 . GLN A 1 330 ? -9.063  18.194 51.236  1.00 107.03 ? 522 GLN A NE2 1 
ATOM   2356 N  N   . GLN A 1 331 ? -6.734  20.221 46.857  1.00 91.77  ? 523 GLN A N   1 
ATOM   2357 C  CA  . GLN A 1 331 ? -7.301  19.908 45.537  1.00 89.79  ? 523 GLN A CA  1 
ATOM   2358 C  C   . GLN A 1 331 ? -8.344  18.804 45.589  1.00 84.98  ? 523 GLN A C   1 
ATOM   2359 O  O   . GLN A 1 331 ? -8.082  17.711 46.096  1.00 83.03  ? 523 GLN A O   1 
ATOM   2360 C  CB  . GLN A 1 331 ? -6.202  19.530 44.543  1.00 90.58  ? 523 GLN A CB  1 
ATOM   2361 C  CG  . GLN A 1 331 ? -6.670  19.426 43.103  1.00 87.72  ? 523 GLN A CG  1 
ATOM   2362 C  CD  . GLN A 1 331 ? -5.525  19.322 42.111  1.00 89.55  ? 523 GLN A CD  1 
ATOM   2363 O  OE1 . GLN A 1 331 ? -4.455  18.710 42.435  1.00 92.95  ? 523 GLN A OE1 1 
ATOM   2364 N  NE2 . GLN A 1 331 ? -5.750  19.930 40.888  1.00 90.18  ? 523 GLN A NE2 1 
ATOM   2365 N  N   . SER A 1 332 ? -9.523  19.104 45.055  1.00 82.40  ? 524 SER A N   1 
ATOM   2366 C  CA  . SER A 1 332 ? -10.593 18.119 44.911  1.00 81.18  ? 524 SER A CA  1 
ATOM   2367 C  C   . SER A 1 332 ? -10.179 16.994 43.958  1.00 77.08  ? 524 SER A C   1 
ATOM   2368 O  O   . SER A 1 332 ? -9.880  17.246 42.778  1.00 78.73  ? 524 SER A O   1 
ATOM   2369 C  CB  . SER A 1 332 ? -11.865 18.794 44.389  1.00 82.35  ? 524 SER A CB  1 
ATOM   2370 O  OG  . SER A 1 332 ? -12.918 17.844 44.179  1.00 84.01  ? 524 SER A OG  1 
ATOM   2371 N  N   . PRO A 1 333 ? -10.184 15.740 44.443  1.00 75.56  ? 525 PRO A N   1 
ATOM   2372 C  CA  . PRO A 1 333 ? -9.787  14.652 43.538  1.00 78.20  ? 525 PRO A CA  1 
ATOM   2373 C  C   . PRO A 1 333 ? -10.841 14.472 42.416  1.00 84.93  ? 525 PRO A C   1 
ATOM   2374 O  O   . PRO A 1 333 ? -10.538 13.939 41.319  1.00 87.55  ? 525 PRO A O   1 
ATOM   2375 C  CB  . PRO A 1 333 ? -9.767  13.395 44.445  1.00 77.16  ? 525 PRO A CB  1 
ATOM   2376 C  CG  . PRO A 1 333 ? -9.804  13.953 45.848  1.00 76.22  ? 525 PRO A CG  1 
ATOM   2377 C  CD  . PRO A 1 333 ? -10.554 15.245 45.787  1.00 76.52  ? 525 PRO A CD  1 
ATOM   2378 N  N   . VAL A 1 334 ? -12.070 14.909 42.693  1.00 85.49  ? 526 VAL A N   1 
ATOM   2379 C  CA  . VAL A 1 334 ? -13.154 14.835 41.731  1.00 85.09  ? 526 VAL A CA  1 
ATOM   2380 C  C   . VAL A 1 334 ? -13.142 15.989 40.718  1.00 85.53  ? 526 VAL A C   1 
ATOM   2381 O  O   . VAL A 1 334 ? -13.021 15.755 39.468  1.00 91.13  ? 526 VAL A O   1 
ATOM   2382 C  CB  . VAL A 1 334 ? -14.549 14.727 42.415  1.00 87.73  ? 526 VAL A CB  1 
ATOM   2383 C  CG1 . VAL A 1 334 ? -15.197 13.365 42.115  1.00 88.77  ? 526 VAL A CG1 1 
ATOM   2384 C  CG2 . VAL A 1 334 ? -14.450 14.994 43.919  1.00 86.89  ? 526 VAL A CG2 1 
ATOM   2385 N  N   . THR A 1 335 ? -13.314 17.224 41.240  1.00 84.38  ? 527 THR A N   1 
ATOM   2386 C  CA  . THR A 1 335 ? -13.501 18.380 40.364  1.00 86.37  ? 527 THR A CA  1 
ATOM   2387 C  C   . THR A 1 335 ? -12.266 19.271 40.318  1.00 90.08  ? 527 THR A C   1 
ATOM   2388 O  O   . THR A 1 335 ? -12.378 20.493 40.459  1.00 93.13  ? 527 THR A O   1 
ATOM   2389 C  CB  . THR A 1 335 ? -14.705 19.230 40.826  1.00 86.98  ? 527 THR A CB  1 
ATOM   2390 O  OG1 . THR A 1 335 ? -14.457 19.747 42.142  1.00 87.03  ? 527 THR A OG1 1 
ATOM   2391 C  CG2 . THR A 1 335 ? -15.979 18.397 40.845  1.00 89.16  ? 527 THR A CG2 1 
ATOM   2392 N  N   . LYS A 1 336 ? -11.108 18.646 40.074  1.00 91.62  ? 528 LYS A N   1 
ATOM   2393 C  CA  . LYS A 1 336 ? -9.756  19.208 40.330  1.00 91.71  ? 528 LYS A CA  1 
ATOM   2394 C  C   . LYS A 1 336 ? -9.521  20.705 40.659  1.00 91.82  ? 528 LYS A C   1 
ATOM   2395 O  O   . LYS A 1 336 ? -8.398  21.212 40.489  1.00 91.17  ? 528 LYS A O   1 
ATOM   2396 C  CB  . LYS A 1 336 ? -8.792  18.745 39.232  1.00 92.75  ? 528 LYS A CB  1 
ATOM   2397 C  CG  . LYS A 1 336 ? -8.039  17.471 39.581  1.00 92.71  ? 528 LYS A CG  1 
ATOM   2398 C  CD  . LYS A 1 336 ? -7.700  16.666 38.285  1.00 95.18  ? 528 LYS A CD  1 
ATOM   2399 C  CE  . LYS A 1 336 ? -6.392  15.830 38.581  1.00 94.15  ? 528 LYS A CE  1 
ATOM   2400 N  NZ  . LYS A 1 336 ? -6.419  15.220 40.098  1.00 93.71  ? 528 LYS A NZ  1 
ATOM   2401 N  N   . GLN A 1 337 ? -10.552 21.388 41.161  1.00 92.33  ? 529 GLN A N   1 
ATOM   2402 C  CA  . GLN A 1 337 ? -10.463 22.800 41.548  1.00 95.43  ? 529 GLN A CA  1 
ATOM   2403 C  C   . GLN A 1 337 ? -9.787  22.952 42.913  1.00 97.71  ? 529 GLN A C   1 
ATOM   2404 O  O   . GLN A 1 337 ? -9.886  22.063 43.765  1.00 98.71  ? 529 GLN A O   1 
ATOM   2405 C  CB  . GLN A 1 337 ? -11.862 23.420 41.605  1.00 96.80  ? 529 GLN A CB  1 
ATOM   2406 C  CG  . GLN A 1 337 ? -11.977 24.798 40.971  1.00 98.59  ? 529 GLN A CG  1 
ATOM   2407 C  CD  . GLN A 1 337 ? -12.283 24.732 39.484  1.00 100.06 ? 529 GLN A CD  1 
ATOM   2408 O  OE1 . GLN A 1 337 ? -13.173 23.996 39.051  1.00 99.69  ? 529 GLN A OE1 1 
ATOM   2409 N  NE2 . GLN A 1 337 ? -11.549 25.508 38.694  1.00 100.86 ? 529 GLN A NE2 1 
ATOM   2410 N  N   . TRP A 1 338 ? -9.117  24.087 43.119  1.00 97.49  ? 530 TRP A N   1 
ATOM   2411 C  CA  . TRP A 1 338 ? -8.421  24.369 44.373  1.00 96.61  ? 530 TRP A CA  1 
ATOM   2412 C  C   . TRP A 1 338 ? -9.267  25.176 45.359  1.00 95.95  ? 530 TRP A C   1 
ATOM   2413 O  O   . TRP A 1 338 ? -10.059 26.037 44.964  1.00 94.45  ? 530 TRP A O   1 
ATOM   2414 C  CB  . TRP A 1 338 ? -7.106  25.095 44.105  1.00 98.75  ? 530 TRP A CB  1 
ATOM   2415 C  CG  . TRP A 1 338 ? -6.090  24.269 43.379  1.00 99.40  ? 530 TRP A CG  1 
ATOM   2416 C  CD1 . TRP A 1 338 ? -5.883  24.229 42.031  1.00 99.92  ? 530 TRP A CD1 1 
ATOM   2417 C  CD2 . TRP A 1 338 ? -5.132  23.372 43.961  1.00 98.87  ? 530 TRP A CD2 1 
ATOM   2418 N  NE1 . TRP A 1 338 ? -4.857  23.362 41.737  1.00 100.57 ? 530 TRP A NE1 1 
ATOM   2419 C  CE2 . TRP A 1 338 ? -4.379  22.822 42.902  1.00 99.01  ? 530 TRP A CE2 1 
ATOM   2420 C  CE3 . TRP A 1 338 ? -4.844  22.973 45.273  1.00 99.87  ? 530 TRP A CE3 1 
ATOM   2421 C  CZ2 . TRP A 1 338 ? -3.355  21.891 43.112  1.00 98.21  ? 530 TRP A CZ2 1 
ATOM   2422 C  CZ3 . TRP A 1 338 ? -3.823  22.049 45.481  1.00 100.19 ? 530 TRP A CZ3 1 
ATOM   2423 C  CH2 . TRP A 1 338 ? -3.094  21.518 44.403  1.00 99.16  ? 530 TRP A CH2 1 
ATOM   2424 N  N   . GLN A 1 339 ? -9.073  24.885 46.644  1.00 95.97  ? 531 GLN A N   1 
ATOM   2425 C  CA  . GLN A 1 339 ? -9.824  25.504 47.730  1.00 99.07  ? 531 GLN A CA  1 
ATOM   2426 C  C   . GLN A 1 339 ? -8.909  25.915 48.880  1.00 101.08 ? 531 GLN A C   1 
ATOM   2427 O  O   . GLN A 1 339 ? -8.013  25.162 49.287  1.00 100.67 ? 531 GLN A O   1 
ATOM   2428 C  CB  . GLN A 1 339 ? -10.881 24.534 48.253  1.00 102.92 ? 531 GLN A CB  1 
ATOM   2429 C  CG  . GLN A 1 339 ? -12.307 24.855 47.826  1.00 109.95 ? 531 GLN A CG  1 
ATOM   2430 C  CD  . GLN A 1 339 ? -13.066 25.688 48.856  1.00 112.63 ? 531 GLN A CD  1 
ATOM   2431 O  OE1 . GLN A 1 339 ? -12.482 26.203 49.818  1.00 113.86 ? 531 GLN A OE1 1 
ATOM   2432 N  NE2 . GLN A 1 339 ? -14.378 25.821 48.657  1.00 111.60 ? 531 GLN A NE2 1 
ATOM   2433 N  N   . GLU A 1 340 ? -9.140  27.116 49.400  1.00 101.20 ? 532 GLU A N   1 
ATOM   2434 C  CA  . GLU A 1 340 ? -8.407  27.589 50.565  1.00 99.58  ? 532 GLU A CA  1 
ATOM   2435 C  C   . GLU A 1 340 ? -9.225  27.352 51.821  1.00 99.48  ? 532 GLU A C   1 
ATOM   2436 O  O   . GLU A 1 340 ? -10.441 27.562 51.832  1.00 101.30 ? 532 GLU A O   1 
ATOM   2437 C  CB  . GLU A 1 340 ? -8.002  29.064 50.433  1.00 100.17 ? 532 GLU A CB  1 
ATOM   2438 C  CG  . GLU A 1 340 ? -9.151  30.055 50.314  1.00 103.85 ? 532 GLU A CG  1 
ATOM   2439 C  CD  . GLU A 1 340 ? -8.827  31.418 50.907  1.00 106.09 ? 532 GLU A CD  1 
ATOM   2440 O  OE1 . GLU A 1 340 ? -9.549  32.391 50.591  1.00 107.99 ? 532 GLU A OE1 1 
ATOM   2441 O  OE2 . GLU A 1 340 ? -7.866  31.521 51.698  1.00 106.43 ? 532 GLU A OE2 1 
ATOM   2442 N  N   . LYS A 1 341 ? -8.553  26.882 52.866  1.00 98.74  ? 533 LYS A N   1 
ATOM   2443 C  CA  . LYS A 1 341 ? -9.190  26.615 54.149  1.00 99.69  ? 533 LYS A CA  1 
ATOM   2444 C  C   . LYS A 1 341 ? -8.286  27.152 55.248  1.00 98.26  ? 533 LYS A C   1 
ATOM   2445 O  O   . LYS A 1 341 ? -7.129  26.729 55.365  1.00 101.37 ? 533 LYS A O   1 
ATOM   2446 C  CB  . LYS A 1 341 ? -9.449  25.113 54.332  1.00 101.16 ? 533 LYS A CB  1 
ATOM   2447 C  CG  . LYS A 1 341 ? -10.311 24.491 53.233  1.00 103.21 ? 533 LYS A CG  1 
ATOM   2448 C  CD  . LYS A 1 341 ? -10.627 23.028 53.487  1.00 103.73 ? 533 LYS A CD  1 
ATOM   2449 C  CE  . LYS A 1 341 ? -11.634 22.517 52.459  1.00 107.90 ? 533 LYS A CE  1 
ATOM   2450 N  NZ  . LYS A 1 341 ? -12.389 21.316 52.927  1.00 110.19 ? 533 LYS A NZ  1 
ATOM   2451 N  N   . PRO A 1 342 ? -8.795  28.104 56.050  1.00 94.44  ? 534 PRO A N   1 
ATOM   2452 C  CA  . PRO A 1 342 ? -7.952  28.727 57.061  1.00 93.70  ? 534 PRO A CA  1 
ATOM   2453 C  C   . PRO A 1 342 ? -7.421  27.722 58.081  1.00 92.93  ? 534 PRO A C   1 
ATOM   2454 O  O   . PRO A 1 342 ? -8.084  26.728 58.367  1.00 91.88  ? 534 PRO A O   1 
ATOM   2455 C  CB  . PRO A 1 342 ? -8.891  29.744 57.729  1.00 91.64  ? 534 PRO A CB  1 
ATOM   2456 C  CG  . PRO A 1 342 ? -10.241 29.316 57.391  1.00 90.58  ? 534 PRO A CG  1 
ATOM   2457 C  CD  . PRO A 1 342 ? -10.160 28.652 56.064  1.00 92.58  ? 534 PRO A CD  1 
ATOM   2458 N  N   . LEU A 1 343 ? -6.213  27.969 58.580  1.00 93.82  ? 535 LEU A N   1 
ATOM   2459 C  CA  . LEU A 1 343 ? -5.672  27.233 59.719  1.00 96.14  ? 535 LEU A CA  1 
ATOM   2460 C  C   . LEU A 1 343 ? -5.595  28.201 60.876  1.00 98.30  ? 535 LEU A C   1 
ATOM   2461 O  O   . LEU A 1 343 ? -5.117  29.322 60.711  1.00 105.08 ? 535 LEU A O   1 
ATOM   2462 C  CB  . LEU A 1 343 ? -4.256  26.723 59.447  1.00 95.03  ? 535 LEU A CB  1 
ATOM   2463 C  CG  . LEU A 1 343 ? -3.919  25.733 58.341  1.00 96.31  ? 535 LEU A CG  1 
ATOM   2464 C  CD1 . LEU A 1 343 ? -2.441  25.376 58.463  1.00 97.72  ? 535 LEU A CD1 1 
ATOM   2465 C  CD2 . LEU A 1 343 ? -4.788  24.479 58.404  1.00 96.94  ? 535 LEU A CD2 1 
ATOM   2466 N  N   . CYS A 1 344 ? -6.041  27.772 62.049  1.00 96.53  ? 536 CYS A N   1 
ATOM   2467 C  CA  . CYS A 1 344 ? -5.903  28.608 63.227  1.00 96.01  ? 536 CYS A CA  1 
ATOM   2468 C  C   . CYS A 1 344 ? -4.638  28.267 64.004  1.00 93.46  ? 536 CYS A C   1 
ATOM   2469 O  O   . CYS A 1 344 ? -4.081  27.173 63.874  1.00 90.65  ? 536 CYS A O   1 
ATOM   2470 C  CB  . CYS A 1 344 ? -7.131  28.517 64.131  1.00 97.97  ? 536 CYS A CB  1 
ATOM   2471 S  SG  . CYS A 1 344 ? -7.382  26.891 64.828  1.00 102.26 ? 536 CYS A SG  1 
ATOM   2472 N  N   . LEU A 1 345 ? -4.189  29.240 64.787  1.00 90.51  ? 537 LEU A N   1 
ATOM   2473 C  CA  . LEU A 1 345 ? -3.136  29.055 65.758  1.00 86.62  ? 537 LEU A CA  1 
ATOM   2474 C  C   . LEU A 1 345 ? -3.795  29.247 67.111  1.00 87.67  ? 537 LEU A C   1 
ATOM   2475 O  O   . LEU A 1 345 ? -4.809  29.951 67.219  1.00 88.24  ? 537 LEU A O   1 
ATOM   2476 C  CB  . LEU A 1 345 ? -2.052  30.106 65.554  1.00 85.07  ? 537 LEU A CB  1 
ATOM   2477 C  CG  . LEU A 1 345 ? -0.813  29.848 64.698  1.00 87.60  ? 537 LEU A CG  1 
ATOM   2478 C  CD1 . LEU A 1 345 ? -0.943  28.643 63.767  1.00 87.81  ? 537 LEU A CD1 1 
ATOM   2479 C  CD2 . LEU A 1 345 ? -0.425  31.119 63.931  1.00 86.84  ? 537 LEU A CD2 1 
ATOM   2480 N  N   . GLY A 1 346 ? -3.229  28.623 68.137  1.00 84.29  ? 538 GLY A N   1 
ATOM   2481 C  CA  . GLY A 1 346 ? -3.778  28.712 69.477  1.00 83.63  ? 538 GLY A CA  1 
ATOM   2482 C  C   . GLY A 1 346 ? -2.795  28.189 70.495  1.00 87.10  ? 538 GLY A C   1 
ATOM   2483 O  O   . GLY A 1 346 ? -1.997  27.292 70.207  1.00 89.08  ? 538 GLY A O   1 
ATOM   2484 N  N   . THR A 1 347 ? -2.849  28.747 71.697  1.00 90.60  ? 539 THR A N   1 
ATOM   2485 C  CA  . THR A 1 347 ? -1.861  28.411 72.703  1.00 95.88  ? 539 THR A CA  1 
ATOM   2486 C  C   . THR A 1 347 ? -2.188  27.082 73.389  1.00 93.68  ? 539 THR A C   1 
ATOM   2487 O  O   . THR A 1 347 ? -3.349  26.804 73.697  1.00 97.87  ? 539 THR A O   1 
ATOM   2488 C  CB  . THR A 1 347 ? -1.691  29.554 73.733  1.00 98.30  ? 539 THR A CB  1 
ATOM   2489 O  OG1 . THR A 1 347 ? -0.406  29.458 74.344  1.00 99.47  ? 539 THR A OG1 1 
ATOM   2490 C  CG2 . THR A 1 347 ? -2.757  29.487 74.825  1.00 103.33 ? 539 THR A CG2 1 
ATOM   2491 N  N   . SER A 1 348 ? -1.163  26.259 73.587  1.00 89.55  ? 540 SER A N   1 
ATOM   2492 C  CA  . SER A 1 348 ? -1.248  25.093 74.458  1.00 91.13  ? 540 SER A CA  1 
ATOM   2493 C  C   . SER A 1 348 ? 0.099   24.882 75.119  1.00 94.42  ? 540 SER A C   1 
ATOM   2494 O  O   . SER A 1 348 ? 1.046   24.408 74.482  1.00 97.74  ? 540 SER A O   1 
ATOM   2495 C  CB  . SER A 1 348 ? -1.703  23.842 73.701  1.00 93.00  ? 540 SER A CB  1 
ATOM   2496 O  OG  . SER A 1 348 ? -1.551  23.991 72.303  1.00 98.75  ? 540 SER A OG  1 
ATOM   2497 N  N   . GLY A 1 349 ? 0.184   25.266 76.394  1.00 93.13  ? 541 GLY A N   1 
ATOM   2498 C  CA  . GLY A 1 349 ? 1.452   25.308 77.107  1.00 92.84  ? 541 GLY A CA  1 
ATOM   2499 C  C   . GLY A 1 349 ? 2.337   26.393 76.531  1.00 98.30  ? 541 GLY A C   1 
ATOM   2500 O  O   . GLY A 1 349 ? 1.869   27.268 75.817  1.00 103.79 ? 541 GLY A O   1 
ATOM   2501 N  N   . SER A 1 350 ? 3.629   26.334 76.820  1.00 100.99 ? 542 SER A N   1 
ATOM   2502 C  CA  . SER A 1 350 ? 4.554   27.358 76.355  1.00 100.33 ? 542 SER A CA  1 
ATOM   2503 C  C   . SER A 1 350 ? 4.646   27.416 74.826  1.00 101.43 ? 542 SER A C   1 
ATOM   2504 O  O   . SER A 1 350 ? 5.442   28.189 74.271  1.00 107.92 ? 542 SER A O   1 
ATOM   2505 C  CB  . SER A 1 350 ? 5.942   27.146 76.974  1.00 102.39 ? 542 SER A CB  1 
ATOM   2506 O  OG  . SER A 1 350 ? 6.747   26.295 76.175  1.00 104.27 ? 542 SER A OG  1 
ATOM   2507 N  N   . CYS A 1 351 ? 3.853   26.583 74.156  1.00 97.74  ? 543 CYS A N   1 
ATOM   2508 C  CA  . CYS A 1 351 ? 3.767   26.583 72.697  1.00 95.08  ? 543 CYS A CA  1 
ATOM   2509 C  C   . CYS A 1 351 ? 2.531   27.412 72.356  1.00 94.32  ? 543 CYS A C   1 
ATOM   2510 O  O   . CYS A 1 351 ? 1.401   27.063 72.723  1.00 91.06  ? 543 CYS A O   1 
ATOM   2511 C  CB  . CYS A 1 351 ? 3.693   25.151 72.166  1.00 95.14  ? 543 CYS A CB  1 
ATOM   2512 S  SG  . CYS A 1 351 ? 3.523   24.983 70.384  1.00 98.54  ? 543 CYS A SG  1 
ATOM   2513 N  N   . ARG A 1 352 ? 2.760   28.528 71.670  1.00 92.66  ? 544 ARG A N   1 
ATOM   2514 C  CA  . ARG A 1 352 ? 1.833   29.660 71.740  1.00 91.86  ? 544 ARG A CA  1 
ATOM   2515 C  C   . ARG A 1 352 ? 1.064   29.928 70.449  1.00 90.24  ? 544 ARG A C   1 
ATOM   2516 O  O   . ARG A 1 352 ? 1.471   29.493 69.380  1.00 93.71  ? 544 ARG A O   1 
ATOM   2517 C  CB  . ARG A 1 352 ? 2.594   30.907 72.219  1.00 89.61  ? 544 ARG A CB  1 
ATOM   2518 C  CG  . ARG A 1 352 ? 3.241   30.721 73.593  1.00 88.57  ? 544 ARG A CG  1 
ATOM   2519 C  CD  . ARG A 1 352 ? 2.457   31.442 74.655  1.00 96.80  ? 544 ARG A CD  1 
ATOM   2520 N  NE  . ARG A 1 352 ? 2.558   30.871 76.008  1.00 105.20 ? 544 ARG A NE  1 
ATOM   2521 C  CZ  . ARG A 1 352 ? 3.669   30.816 76.750  1.00 110.42 ? 544 ARG A CZ  1 
ATOM   2522 N  NH1 . ARG A 1 352 ? 4.849   31.260 76.286  1.00 110.61 ? 544 ARG A NH1 1 
ATOM   2523 N  NH2 . ARG A 1 352 ? 3.593   30.300 77.972  1.00 107.49 ? 544 ARG A NH2 1 
ATOM   2524 N  N   . GLY A 1 353 ? -0.057  30.631 70.560  1.00 88.83  ? 545 GLY A N   1 
ATOM   2525 C  CA  . GLY A 1 353 ? -0.880  30.953 69.395  1.00 90.36  ? 545 GLY A CA  1 
ATOM   2526 C  C   . GLY A 1 353 ? -0.411  32.131 68.557  1.00 92.07  ? 545 GLY A C   1 
ATOM   2527 O  O   . GLY A 1 353 ? -1.100  32.553 67.622  1.00 94.80  ? 545 GLY A O   1 
ATOM   2528 N  N   . TYR A 1 354 ? 0.770   32.653 68.873  1.00 89.01  ? 546 TYR A N   1 
ATOM   2529 C  CA  . TYR A 1 354 ? 1.277   33.856 68.226  1.00 86.09  ? 546 TYR A CA  1 
ATOM   2530 C  C   . TYR A 1 354 ? 2.796   33.822 68.202  1.00 86.07  ? 546 TYR A C   1 
ATOM   2531 O  O   . TYR A 1 354 ? 3.416   33.014 68.881  1.00 87.63  ? 546 TYR A O   1 
ATOM   2532 C  CB  . TYR A 1 354 ? 0.802   35.098 68.988  1.00 83.78  ? 546 TYR A CB  1 
ATOM   2533 C  CG  . TYR A 1 354 ? 1.182   35.056 70.452  1.00 84.58  ? 546 TYR A CG  1 
ATOM   2534 C  CD1 . TYR A 1 354 ? 0.298   34.578 71.407  1.00 85.84  ? 546 TYR A CD1 1 
ATOM   2535 C  CD2 . TYR A 1 354 ? 2.438   35.464 70.877  1.00 83.97  ? 546 TYR A CD2 1 
ATOM   2536 C  CE1 . TYR A 1 354 ? 0.657   34.514 72.746  1.00 85.87  ? 546 TYR A CE1 1 
ATOM   2537 C  CE2 . TYR A 1 354 ? 2.797   35.412 72.209  1.00 83.03  ? 546 TYR A CE2 1 
ATOM   2538 C  CZ  . TYR A 1 354 ? 1.913   34.930 73.136  1.00 83.99  ? 546 TYR A CZ  1 
ATOM   2539 O  OH  . TYR A 1 354 ? 2.281   34.882 74.460  1.00 85.10  ? 546 TYR A OH  1 
ATOM   2540 N  N   . PHE A 1 355 ? 3.382   34.716 67.419  1.00 87.12  ? 547 PHE A N   1 
ATOM   2541 C  CA  . PHE A 1 355 ? 4.818   34.942 67.399  1.00 87.62  ? 547 PHE A CA  1 
ATOM   2542 C  C   . PHE A 1 355 ? 5.037   36.435 67.260  1.00 89.58  ? 547 PHE A C   1 
ATOM   2543 O  O   . PHE A 1 355 ? 4.084   37.192 67.023  1.00 88.77  ? 547 PHE A O   1 
ATOM   2544 C  CB  . PHE A 1 355 ? 5.454   34.213 66.225  1.00 89.32  ? 547 PHE A CB  1 
ATOM   2545 C  CG  . PHE A 1 355 ? 4.798   34.501 64.920  1.00 90.23  ? 547 PHE A CG  1 
ATOM   2546 C  CD1 . PHE A 1 355 ? 3.608   33.859 64.571  1.00 89.83  ? 547 PHE A CD1 1 
ATOM   2547 C  CD2 . PHE A 1 355 ? 5.360   35.419 64.038  1.00 90.94  ? 547 PHE A CD2 1 
ATOM   2548 C  CE1 . PHE A 1 355 ? 2.989   34.132 63.365  1.00 92.54  ? 547 PHE A CE1 1 
ATOM   2549 C  CE2 . PHE A 1 355 ? 4.754   35.700 62.820  1.00 92.38  ? 547 PHE A CE2 1 
ATOM   2550 C  CZ  . PHE A 1 355 ? 3.563   35.059 62.482  1.00 93.74  ? 547 PHE A CZ  1 
ATOM   2551 N  N   . SER A 1 356 ? 6.283   36.874 67.396  1.00 88.95  ? 548 SER A N   1 
ATOM   2552 C  CA  . SER A 1 356 ? 6.541   38.306 67.308  1.00 87.61  ? 548 SER A CA  1 
ATOM   2553 C  C   . SER A 1 356 ? 7.005   38.739 65.917  1.00 86.36  ? 548 SER A C   1 
ATOM   2554 O  O   . SER A 1 356 ? 7.624   37.958 65.184  1.00 85.94  ? 548 SER A O   1 
ATOM   2555 C  CB  . SER A 1 356 ? 7.498   38.752 68.402  1.00 84.30  ? 548 SER A CB  1 
ATOM   2556 O  OG  . SER A 1 356 ? 8.463   37.758 68.604  1.00 87.26  ? 548 SER A OG  1 
ATOM   2557 N  N   . GLY A 1 357 ? 6.668   39.976 65.555  1.00 83.48  ? 549 GLY A N   1 
ATOM   2558 C  CA  . GLY A 1 357 ? 7.084   40.546 64.276  1.00 87.65  ? 549 GLY A CA  1 
ATOM   2559 C  C   . GLY A 1 357 ? 6.341   40.026 63.054  1.00 89.12  ? 549 GLY A C   1 
ATOM   2560 O  O   . GLY A 1 357 ? 5.196   39.599 63.152  1.00 91.66  ? 549 GLY A O   1 
ATOM   2561 N  N   . HIS A 1 358 ? 7.004   40.076 61.903  1.00 89.19  ? 550 HIS A N   1 
ATOM   2562 C  CA  . HIS A 1 358 ? 6.413   39.717 60.621  1.00 89.49  ? 550 HIS A CA  1 
ATOM   2563 C  C   . HIS A 1 358 ? 7.178   38.577 59.972  1.00 91.39  ? 550 HIS A C   1 
ATOM   2564 O  O   . HIS A 1 358 ? 8.404   38.478 60.096  1.00 91.54  ? 550 HIS A O   1 
ATOM   2565 C  CB  . HIS A 1 358 ? 6.451   40.905 59.673  1.00 92.91  ? 550 HIS A CB  1 
ATOM   2566 C  CG  . HIS A 1 358 ? 5.772   42.128 60.198  1.00 99.00  ? 550 HIS A CG  1 
ATOM   2567 N  ND1 . HIS A 1 358 ? 4.399   42.243 60.270  1.00 101.01 ? 550 HIS A ND1 1 
ATOM   2568 C  CD2 . HIS A 1 358 ? 6.275   43.302 60.651  1.00 99.66  ? 550 HIS A CD2 1 
ATOM   2569 C  CE1 . HIS A 1 358 ? 4.087   43.431 60.759  1.00 102.96 ? 550 HIS A CE1 1 
ATOM   2570 N  NE2 . HIS A 1 358 ? 5.207   44.094 60.995  1.00 101.49 ? 550 HIS A NE2 1 
ATOM   2571 N  N   . ILE A 1 359 ? 6.458   37.721 59.261  1.00 90.95  ? 551 ILE A N   1 
ATOM   2572 C  CA  . ILE A 1 359 ? 7.092   36.607 58.571  1.00 90.34  ? 551 ILE A CA  1 
ATOM   2573 C  C   . ILE A 1 359 ? 7.879   37.127 57.364  1.00 90.68  ? 551 ILE A C   1 
ATOM   2574 O  O   . ILE A 1 359 ? 7.374   37.946 56.581  1.00 92.40  ? 551 ILE A O   1 
ATOM   2575 C  CB  . ILE A 1 359 ? 6.052   35.539 58.160  1.00 88.24  ? 551 ILE A CB  1 
ATOM   2576 C  CG1 . ILE A 1 359 ? 5.532   34.806 59.401  1.00 88.56  ? 551 ILE A CG1 1 
ATOM   2577 C  CG2 . ILE A 1 359 ? 6.636   34.558 57.146  1.00 85.95  ? 551 ILE A CG2 1 
ATOM   2578 C  CD1 . ILE A 1 359 ? 4.319   33.875 59.129  1.00 91.31  ? 551 ILE A CD1 1 
ATOM   2579 N  N   . LEU A 1 360 ? 9.119   36.663 57.231  1.00 86.39  ? 552 LEU A N   1 
ATOM   2580 C  CA  . LEU A 1 360 ? 9.928   36.993 56.066  1.00 84.73  ? 552 LEU A CA  1 
ATOM   2581 C  C   . LEU A 1 360 ? 10.195  35.784 55.171  1.00 88.82  ? 552 LEU A C   1 
ATOM   2582 O  O   . LEU A 1 360 ? 10.419  35.939 53.968  1.00 92.43  ? 552 LEU A O   1 
ATOM   2583 C  CB  . LEU A 1 360 ? 11.244  37.654 56.481  1.00 83.51  ? 552 LEU A CB  1 
ATOM   2584 C  CG  . LEU A 1 360 ? 11.188  38.895 57.382  1.00 82.81  ? 552 LEU A CG  1 
ATOM   2585 C  CD1 . LEU A 1 360 ? 12.589  39.377 57.717  1.00 82.63  ? 552 LEU A CD1 1 
ATOM   2586 C  CD2 . LEU A 1 360 ? 10.370  40.012 56.779  1.00 80.15  ? 552 LEU A CD2 1 
ATOM   2587 N  N   . GLY A 1 361 ? 10.172  34.586 55.756  1.00 89.87  ? 553 GLY A N   1 
ATOM   2588 C  CA  . GLY A 1 361 ? 10.440  33.354 55.018  1.00 87.49  ? 553 GLY A CA  1 
ATOM   2589 C  C   . GLY A 1 361 ? 10.073  32.119 55.811  1.00 89.11  ? 553 GLY A C   1 
ATOM   2590 O  O   . GLY A 1 361 ? 9.425   32.218 56.847  1.00 91.01  ? 553 GLY A O   1 
ATOM   2591 N  N   . PHE A 1 362 ? 10.508  30.958 55.328  1.00 90.50  ? 554 PHE A N   1 
ATOM   2592 C  CA  . PHE A 1 362 ? 10.094  29.663 55.867  1.00 91.87  ? 554 PHE A CA  1 
ATOM   2593 C  C   . PHE A 1 362 ? 11.273  28.698 55.928  1.00 96.55  ? 554 PHE A C   1 
ATOM   2594 O  O   . PHE A 1 362 ? 12.298  28.924 55.278  1.00 99.99  ? 554 PHE A O   1 
ATOM   2595 C  CB  . PHE A 1 362 ? 9.002   29.054 54.989  1.00 92.41  ? 554 PHE A CB  1 
ATOM   2596 C  CG  . PHE A 1 362 ? 7.704   29.820 54.993  1.00 95.24  ? 554 PHE A CG  1 
ATOM   2597 C  CD1 . PHE A 1 362 ? 7.323   30.576 53.883  1.00 96.54  ? 554 PHE A CD1 1 
ATOM   2598 C  CD2 . PHE A 1 362 ? 6.847   29.770 56.095  1.00 96.42  ? 554 PHE A CD2 1 
ATOM   2599 C  CE1 . PHE A 1 362 ? 6.105   31.282 53.870  1.00 96.23  ? 554 PHE A CE1 1 
ATOM   2600 C  CE2 . PHE A 1 362 ? 5.629   30.475 56.093  1.00 96.56  ? 554 PHE A CE2 1 
ATOM   2601 C  CZ  . PHE A 1 362 ? 5.259   31.231 54.977  1.00 94.55  ? 554 PHE A CZ  1 
ATOM   2602 N  N   . GLY A 1 363 ? 11.126  27.618 56.694  1.00 98.45  ? 555 GLY A N   1 
ATOM   2603 C  CA  . GLY A 1 363 ? 12.212  26.655 56.876  1.00 102.87 ? 555 GLY A CA  1 
ATOM   2604 C  C   . GLY A 1 363 ? 11.770  25.202 56.931  1.00 107.79 ? 555 GLY A C   1 
ATOM   2605 O  O   . GLY A 1 363 ? 10.598  24.925 57.172  1.00 109.35 ? 555 GLY A O   1 
ATOM   2606 N  N   . GLU A 1 364 ? 12.715  24.279 56.714  1.00 108.84 ? 556 GLU A N   1 
ATOM   2607 C  CA  . GLU A 1 364 ? 12.451  22.837 56.806  1.00 108.50 ? 556 GLU A CA  1 
ATOM   2608 C  C   . GLU A 1 364 ? 13.616  22.010 57.391  1.00 106.72 ? 556 GLU A C   1 
ATOM   2609 O  O   . GLU A 1 364 ? 14.765  22.171 56.984  1.00 104.01 ? 556 GLU A O   1 
ATOM   2610 C  CB  . GLU A 1 364 ? 12.057  22.287 55.436  1.00 108.93 ? 556 GLU A CB  1 
ATOM   2611 C  CG  . GLU A 1 364 ? 11.715  20.810 55.450  1.00 111.30 ? 556 GLU A CG  1 
ATOM   2612 C  CD  . GLU A 1 364 ? 11.518  20.215 54.067  1.00 112.59 ? 556 GLU A CD  1 
ATOM   2613 O  OE1 . GLU A 1 364 ? 11.256  18.995 53.992  1.00 116.22 ? 556 GLU A OE1 1 
ATOM   2614 O  OE2 . GLU A 1 364 ? 11.625  20.947 53.061  1.00 112.83 ? 556 GLU A OE2 1 
ATOM   2615 N  N   . ASP A 1 365 ? 13.281  21.136 58.344  1.00 107.07 ? 557 ASP A N   1 
ATOM   2616 C  CA  . ASP A 1 365 ? 14.168  20.110 58.910  1.00 104.11 ? 557 ASP A CA  1 
ATOM   2617 C  C   . ASP A 1 365 ? 14.537  19.072 57.886  1.00 105.18 ? 557 ASP A C   1 
ATOM   2618 O  O   . ASP A 1 365 ? 13.821  18.878 56.901  1.00 105.10 ? 557 ASP A O   1 
ATOM   2619 C  CB  . ASP A 1 365 ? 13.426  19.328 59.997  1.00 106.38 ? 557 ASP A CB  1 
ATOM   2620 C  CG  . ASP A 1 365 ? 13.428  20.019 61.317  1.00 111.60 ? 557 ASP A CG  1 
ATOM   2621 O  OD1 . ASP A 1 365 ? 14.085  21.064 61.410  1.00 119.82 ? 557 ASP A OD1 1 
ATOM   2622 O  OD2 . ASP A 1 365 ? 12.791  19.524 62.273  1.00 111.15 ? 557 ASP A OD2 1 
ATOM   2623 N  N   . GLU A 1 366 ? 15.625  18.354 58.152  1.00 105.21 ? 558 GLU A N   1 
ATOM   2624 C  CA  . GLU A 1 366 ? 15.903  17.105 57.443  1.00 102.97 ? 558 GLU A CA  1 
ATOM   2625 C  C   . GLU A 1 366 ? 14.804  16.088 57.752  1.00 100.21 ? 558 GLU A C   1 
ATOM   2626 O  O   . GLU A 1 366 ? 14.511  15.209 56.944  1.00 102.77 ? 558 GLU A O   1 
ATOM   2627 C  CB  . GLU A 1 366 ? 17.278  16.553 57.817  1.00 103.72 ? 558 GLU A CB  1 
ATOM   2628 C  CG  . GLU A 1 366 ? 17.777  15.486 56.865  1.00 108.83 ? 558 GLU A CG  1 
ATOM   2629 C  CD  . GLU A 1 366 ? 19.290  15.366 56.821  1.00 113.61 ? 558 GLU A CD  1 
ATOM   2630 O  OE1 . GLU A 1 366 ? 19.786  14.417 56.170  1.00 114.88 ? 558 GLU A OE1 1 
ATOM   2631 O  OE2 . GLU A 1 366 ? 19.982  16.216 57.423  1.00 115.33 ? 558 GLU A OE2 1 
ATOM   2632 N  N   . LEU A 1 367 ? 14.198  16.229 58.926  1.00 96.94  ? 559 LEU A N   1 
ATOM   2633 C  CA  . LEU A 1 367 ? 13.055  15.426 59.333  1.00 95.17  ? 559 LEU A CA  1 
ATOM   2634 C  C   . LEU A 1 367 ? 11.743  15.964 58.753  1.00 95.89  ? 559 LEU A C   1 
ATOM   2635 O  O   . LEU A 1 367 ? 10.690  15.339 58.892  1.00 96.84  ? 559 LEU A O   1 
ATOM   2636 C  CB  . LEU A 1 367 ? 12.965  15.382 60.858  1.00 94.86  ? 559 LEU A CB  1 
ATOM   2637 C  CG  . LEU A 1 367 ? 14.158  14.817 61.628  1.00 94.29  ? 559 LEU A CG  1 
ATOM   2638 C  CD1 . LEU A 1 367 ? 14.052  15.196 63.091  1.00 96.64  ? 559 LEU A CD1 1 
ATOM   2639 C  CD2 . LEU A 1 367 ? 14.229  13.321 61.477  1.00 95.73  ? 559 LEU A CD2 1 
ATOM   2640 N  N   . GLY A 1 368 ? 11.800  17.125 58.110  1.00 94.79  ? 560 GLY A N   1 
ATOM   2641 C  CA  . GLY A 1 368 ? 10.632  17.664 57.430  1.00 94.56  ? 560 GLY A CA  1 
ATOM   2642 C  C   . GLY A 1 368 ? 9.730   18.586 58.239  1.00 96.22  ? 560 GLY A C   1 
ATOM   2643 O  O   . GLY A 1 368 ? 8.707   19.042 57.726  1.00 99.36  ? 560 GLY A O   1 
ATOM   2644 N  N   . GLU A 1 369 ? 10.085  18.878 59.489  1.00 91.33  ? 561 GLU A N   1 
ATOM   2645 C  CA  . GLU A 1 369 ? 9.297   19.831 60.262  1.00 90.31  ? 561 GLU A CA  1 
ATOM   2646 C  C   . GLU A 1 369 ? 9.511   21.241 59.721  1.00 91.78  ? 561 GLU A C   1 
ATOM   2647 O  O   . GLU A 1 369 ? 10.539  21.518 59.101  1.00 89.88  ? 561 GLU A O   1 
ATOM   2648 C  CB  . GLU A 1 369 ? 9.608   19.748 61.758  1.00 90.19  ? 561 GLU A CB  1 
ATOM   2649 C  CG  . GLU A 1 369 ? 9.568   18.344 62.356  1.00 90.86  ? 561 GLU A CG  1 
ATOM   2650 C  CD  . GLU A 1 369 ? 8.268   17.584 62.085  1.00 96.74  ? 561 GLU A CD  1 
ATOM   2651 O  OE1 . GLU A 1 369 ? 7.264   18.207 61.655  1.00 99.03  ? 561 GLU A OE1 1 
ATOM   2652 O  OE2 . GLU A 1 369 ? 8.253   16.349 62.317  1.00 97.77  ? 561 GLU A OE2 1 
ATOM   2653 N  N   . VAL A 1 370 ? 8.536   22.124 59.943  1.00 94.82  ? 562 VAL A N   1 
ATOM   2654 C  CA  . VAL A 1 370 ? 8.526   23.432 59.273  1.00 94.85  ? 562 VAL A CA  1 
ATOM   2655 C  C   . VAL A 1 370 ? 8.644   24.619 60.230  1.00 96.57  ? 562 VAL A C   1 
ATOM   2656 O  O   . VAL A 1 370 ? 8.115   24.594 61.343  1.00 101.04 ? 562 VAL A O   1 
ATOM   2657 C  CB  . VAL A 1 370 ? 7.293   23.608 58.361  1.00 95.17  ? 562 VAL A CB  1 
ATOM   2658 C  CG1 . VAL A 1 370 ? 7.580   24.649 57.312  1.00 100.75 ? 562 VAL A CG1 1 
ATOM   2659 C  CG2 . VAL A 1 370 ? 6.958   22.325 57.654  1.00 92.30  ? 562 VAL A CG2 1 
ATOM   2660 N  N   . TYR A 1 371 ? 9.344   25.660 59.783  1.00 95.95  ? 563 TYR A N   1 
ATOM   2661 C  CA  . TYR A 1 371 ? 9.632   26.825 60.619  1.00 93.45  ? 563 TYR A CA  1 
ATOM   2662 C  C   . TYR A 1 371 ? 9.202   28.098 59.935  1.00 92.92  ? 563 TYR A C   1 
ATOM   2663 O  O   . TYR A 1 371 ? 9.092   28.138 58.714  1.00 90.20  ? 563 TYR A O   1 
ATOM   2664 C  CB  . TYR A 1 371 ? 11.130  26.932 60.875  1.00 93.14  ? 563 TYR A CB  1 
ATOM   2665 C  CG  . TYR A 1 371 ? 11.739  25.723 61.518  1.00 92.72  ? 563 TYR A CG  1 
ATOM   2666 C  CD1 . TYR A 1 371 ? 12.049  25.726 62.866  1.00 95.19  ? 563 TYR A CD1 1 
ATOM   2667 C  CD2 . TYR A 1 371 ? 12.011  24.577 60.778  1.00 91.01  ? 563 TYR A CD2 1 
ATOM   2668 C  CE1 . TYR A 1 371 ? 12.615  24.618 63.470  1.00 94.96  ? 563 TYR A CE1 1 
ATOM   2669 C  CE2 . TYR A 1 371 ? 12.560  23.464 61.373  1.00 91.84  ? 563 TYR A CE2 1 
ATOM   2670 C  CZ  . TYR A 1 371 ? 12.867  23.491 62.721  1.00 92.42  ? 563 TYR A CZ  1 
ATOM   2671 O  OH  . TYR A 1 371 ? 13.425  22.396 63.335  1.00 92.16  ? 563 TYR A OH  1 
ATOM   2672 N  N   . ILE A 1 372 ? 8.962   29.143 60.725  1.00 96.78  ? 564 ILE A N   1 
ATOM   2673 C  CA  . ILE A 1 372 ? 8.831   30.492 60.166  1.00 98.60  ? 564 ILE A CA  1 
ATOM   2674 C  C   . ILE A 1 372 ? 9.930   31.376 60.708  1.00 97.18  ? 564 ILE A C   1 
ATOM   2675 O  O   . ILE A 1 372 ? 10.357  31.222 61.857  1.00 96.22  ? 564 ILE A O   1 
ATOM   2676 C  CB  . ILE A 1 372 ? 7.451   31.143 60.401  1.00 100.69 ? 564 ILE A CB  1 
ATOM   2677 C  CG1 . ILE A 1 372 ? 7.216   31.418 61.878  1.00 103.88 ? 564 ILE A CG1 1 
ATOM   2678 C  CG2 . ILE A 1 372 ? 6.336   30.273 59.814  1.00 104.78 ? 564 ILE A CG2 1 
ATOM   2679 C  CD1 . ILE A 1 372 ? 5.966   32.236 62.148  1.00 109.18 ? 564 ILE A CD1 1 
ATOM   2680 N  N   . LEU A 1 373 ? 10.404  32.281 59.859  1.00 97.16  ? 565 LEU A N   1 
ATOM   2681 C  CA  . LEU A 1 373 ? 11.453  33.209 60.239  1.00 96.90  ? 565 LEU A CA  1 
ATOM   2682 C  C   . LEU A 1 373 ? 10.856  34.598 60.229  1.00 97.55  ? 565 LEU A C   1 
ATOM   2683 O  O   . LEU A 1 373 ? 10.307  35.038 59.211  1.00 100.26 ? 565 LEU A O   1 
ATOM   2684 C  CB  . LEU A 1 373 ? 12.662  33.093 59.309  1.00 94.28  ? 565 LEU A CB  1 
ATOM   2685 C  CG  . LEU A 1 373 ? 13.306  31.707 59.383  1.00 95.96  ? 565 LEU A CG  1 
ATOM   2686 C  CD1 . LEU A 1 373 ? 12.978  30.884 58.162  1.00 94.81  ? 565 LEU A CD1 1 
ATOM   2687 C  CD2 . LEU A 1 373 ? 14.791  31.796 59.542  1.00 97.68  ? 565 LEU A CD2 1 
ATOM   2688 N  N   . SER A 1 374 ? 10.931  35.268 61.377  1.00 93.63  ? 566 SER A N   1 
ATOM   2689 C  CA  . SER A 1 374 ? 10.279  36.555 61.538  1.00 95.04  ? 566 SER A CA  1 
ATOM   2690 C  C   . SER A 1 374 ? 11.242  37.670 61.914  1.00 96.79  ? 566 SER A C   1 
ATOM   2691 O  O   . SER A 1 374 ? 12.355  37.410 62.381  1.00 96.27  ? 566 SER A O   1 
ATOM   2692 C  CB  . SER A 1 374 ? 9.175   36.463 62.589  1.00 92.54  ? 566 SER A CB  1 
ATOM   2693 O  OG  . SER A 1 374 ? 9.726   36.298 63.878  1.00 91.32  ? 566 SER A OG  1 
ATOM   2694 N  N   . SER A 1 375 ? 10.788  38.905 61.701  1.00 96.71  ? 567 SER A N   1 
ATOM   2695 C  CA  . SER A 1 375 ? 11.474  40.105 62.151  1.00 98.60  ? 567 SER A CA  1 
ATOM   2696 C  C   . SER A 1 375 ? 10.501  41.278 62.177  1.00 102.90 ? 567 SER A C   1 
ATOM   2697 O  O   . SER A 1 375 ? 9.325   41.123 61.868  1.00 101.51 ? 567 SER A O   1 
ATOM   2698 C  CB  . SER A 1 375 ? 12.651  40.426 61.233  1.00 99.50  ? 567 SER A CB  1 
ATOM   2699 O  OG  . SER A 1 375 ? 13.461  41.433 61.810  1.00 104.48 ? 567 SER A OG  1 
ATOM   2700 N  N   . SER A 1 376 ? 11.001  42.451 62.555  1.00 112.17 ? 568 SER A N   1 
ATOM   2701 C  CA  . SER A 1 376 ? 10.251  43.710 62.458  1.00 118.37 ? 568 SER A CA  1 
ATOM   2702 C  C   . SER A 1 376 ? 11.237  44.872 62.405  1.00 122.09 ? 568 SER A C   1 
ATOM   2703 O  O   . SER A 1 376 ? 12.418  44.690 62.685  1.00 121.72 ? 568 SER A O   1 
ATOM   2704 C  CB  . SER A 1 376 ? 9.281   43.877 63.637  1.00 118.42 ? 568 SER A CB  1 
ATOM   2705 O  OG  . SER A 1 376 ? 9.961   44.225 64.831  1.00 119.33 ? 568 SER A OG  1 
ATOM   2706 N  N   . LYS A 1 377 ? 10.751  46.059 62.043  1.00 127.97 ? 569 LYS A N   1 
ATOM   2707 C  CA  . LYS A 1 377 ? 11.571  47.278 62.056  1.00 130.68 ? 569 LYS A CA  1 
ATOM   2708 C  C   . LYS A 1 377 ? 12.149  47.526 63.448  1.00 133.64 ? 569 LYS A C   1 
ATOM   2709 O  O   . LYS A 1 377 ? 13.238  48.088 63.583  1.00 134.93 ? 569 LYS A O   1 
ATOM   2710 C  CB  . LYS A 1 377 ? 10.754  48.494 61.614  1.00 129.20 ? 569 LYS A CB  1 
ATOM   2711 C  CG  . LYS A 1 377 ? 10.349  48.489 60.153  1.00 129.02 ? 569 LYS A CG  1 
ATOM   2712 C  CD  . LYS A 1 377 ? 9.420   49.658 59.849  1.00 129.13 ? 569 LYS A CD  1 
ATOM   2713 C  CE  . LYS A 1 377 ? 9.053   49.709 58.373  1.00 129.12 ? 569 LYS A CE  1 
ATOM   2714 N  NZ  . LYS A 1 377 ? 8.099   50.814 58.082  1.00 129.15 ? 569 LYS A NZ  1 
ATOM   2715 N  N   . SER A 1 378 ? 11.408  47.103 64.473  1.00 135.58 ? 570 SER A N   1 
ATOM   2716 C  CA  . SER A 1 378 ? 11.854  47.206 65.858  1.00 138.32 ? 570 SER A CA  1 
ATOM   2717 C  C   . SER A 1 378 ? 12.946  46.191 66.169  1.00 141.63 ? 570 SER A C   1 
ATOM   2718 O  O   . SER A 1 378 ? 13.946  46.530 66.809  1.00 141.61 ? 570 SER A O   1 
ATOM   2719 C  CB  . SER A 1 378 ? 10.681  47.019 66.822  1.00 137.68 ? 570 SER A CB  1 
ATOM   2720 O  OG  . SER A 1 378 ? 11.138  46.966 68.164  1.00 136.96 ? 570 SER A OG  1 
ATOM   2721 N  N   . MET A 1 379 ? 12.746  44.952 65.716  1.00 145.69 ? 571 MET A N   1 
ATOM   2722 C  CA  . MET A 1 379 ? 13.702  43.863 65.954  1.00 149.21 ? 571 MET A CA  1 
ATOM   2723 C  C   . MET A 1 379 ? 14.688  43.630 64.787  1.00 150.40 ? 571 MET A C   1 
ATOM   2724 O  O   . MET A 1 379 ? 15.351  42.590 64.711  1.00 151.13 ? 571 MET A O   1 
ATOM   2725 C  CB  . MET A 1 379 ? 12.977  42.571 66.379  1.00 149.96 ? 571 MET A CB  1 
ATOM   2726 C  CG  . MET A 1 379 ? 12.019  41.981 65.343  1.00 150.70 ? 571 MET A CG  1 
ATOM   2727 S  SD  . MET A 1 379 ? 10.917  40.660 65.929  1.00 150.89 ? 571 MET A SD  1 
ATOM   2728 C  CE  . MET A 1 379 ? 10.081  41.474 67.295  1.00 150.87 ? 571 MET A CE  1 
ATOM   2729 N  N   . THR A 1 380 ? 14.773  44.608 63.886  1.00 150.25 ? 572 THR A N   1 
ATOM   2730 C  CA  . THR A 1 380 ? 15.824  44.652 62.870  1.00 149.31 ? 572 THR A CA  1 
ATOM   2731 C  C   . THR A 1 380 ? 16.926  45.571 63.390  1.00 147.50 ? 572 THR A C   1 
ATOM   2732 O  O   . THR A 1 380 ? 18.106  45.215 63.365  1.00 148.20 ? 572 THR A O   1 
ATOM   2733 C  CB  . THR A 1 380 ? 15.288  45.149 61.493  1.00 150.06 ? 572 THR A CB  1 
ATOM   2734 O  OG1 . THR A 1 380 ? 14.384  44.177 60.948  1.00 149.98 ? 572 THR A OG1 1 
ATOM   2735 C  CG2 . THR A 1 380 ? 16.428  45.385 60.496  1.00 149.55 ? 572 THR A CG2 1 
ATOM   2736 N  N   . GLN A 1 381 ? 16.519  46.739 63.889  1.00 145.07 ? 573 GLN A N   1 
ATOM   2737 C  CA  . GLN A 1 381 ? 17.432  47.741 64.447  1.00 142.66 ? 573 GLN A CA  1 
ATOM   2738 C  C   . GLN A 1 381 ? 18.294  47.211 65.594  1.00 140.42 ? 573 GLN A C   1 
ATOM   2739 O  O   . GLN A 1 381 ? 19.347  47.778 65.899  1.00 140.78 ? 573 GLN A O   1 
ATOM   2740 C  CB  . GLN A 1 381 ? 16.649  48.979 64.913  1.00 141.96 ? 573 GLN A CB  1 
ATOM   2741 C  CG  . GLN A 1 381 ? 16.046  49.809 63.782  1.00 141.90 ? 573 GLN A CG  1 
ATOM   2742 C  CD  . GLN A 1 381 ? 17.089  50.308 62.792  1.00 142.29 ? 573 GLN A CD  1 
ATOM   2743 O  OE1 . GLN A 1 381 ? 17.997  51.057 63.152  1.00 142.74 ? 573 GLN A OE1 1 
ATOM   2744 N  NE2 . GLN A 1 381 ? 16.958  49.893 61.538  1.00 141.87 ? 573 GLN A NE2 1 
ATOM   2745 N  N   . THR A 1 382 ? 17.842  46.128 66.221  1.00 137.03 ? 574 THR A N   1 
ATOM   2746 C  CA  . THR A 1 382 ? 18.553  45.527 67.348  1.00 134.88 ? 574 THR A CA  1 
ATOM   2747 C  C   . THR A 1 382 ? 19.186  44.166 67.018  1.00 132.34 ? 574 THR A C   1 
ATOM   2748 O  O   . THR A 1 382 ? 19.817  43.555 67.884  1.00 134.05 ? 574 THR A O   1 
ATOM   2749 C  CB  . THR A 1 382 ? 17.647  45.438 68.624  1.00 135.46 ? 574 THR A CB  1 
ATOM   2750 O  OG1 . THR A 1 382 ? 18.362  44.798 69.687  1.00 136.54 ? 574 THR A OG1 1 
ATOM   2751 C  CG2 . THR A 1 382 ? 16.370  44.661 68.355  1.00 135.59 ? 574 THR A CG2 1 
ATOM   2752 N  N   . HIS A 1 383 ? 19.037  43.716 65.768  1.00 128.07 ? 575 HIS A N   1 
ATOM   2753 C  CA  . HIS A 1 383 ? 19.452  42.368 65.339  1.00 124.16 ? 575 HIS A CA  1 
ATOM   2754 C  C   . HIS A 1 383 ? 18.700  41.264 66.091  1.00 119.26 ? 575 HIS A C   1 
ATOM   2755 O  O   . HIS A 1 383 ? 19.325  40.393 66.693  1.00 119.66 ? 575 HIS A O   1 
ATOM   2756 C  CB  . HIS A 1 383 ? 20.964  42.158 65.509  1.00 127.69 ? 575 HIS A CB  1 
ATOM   2757 C  CG  . HIS A 1 383 ? 21.788  42.686 64.377  1.00 133.02 ? 575 HIS A CG  1 
ATOM   2758 N  ND1 . HIS A 1 383 ? 22.167  44.009 64.281  1.00 134.97 ? 575 HIS A ND1 1 
ATOM   2759 C  CD2 . HIS A 1 383 ? 22.328  42.062 63.304  1.00 134.04 ? 575 HIS A CD2 1 
ATOM   2760 C  CE1 . HIS A 1 383 ? 22.892  44.180 63.189  1.00 134.42 ? 575 HIS A CE1 1 
ATOM   2761 N  NE2 . HIS A 1 383 ? 23.004  43.013 62.577  1.00 134.86 ? 575 HIS A NE2 1 
ATOM   2762 N  N   . ASN A 1 384 ? 17.369  41.295 66.057  1.00 112.52 ? 576 ASN A N   1 
ATOM   2763 C  CA  . ASN A 1 384 ? 16.574  40.291 66.762  1.00 107.40 ? 576 ASN A CA  1 
ATOM   2764 C  C   . ASN A 1 384 ? 15.552  39.544 65.879  1.00 100.93 ? 576 ASN A C   1 
ATOM   2765 O  O   . ASN A 1 384 ? 14.360  39.514 66.171  1.00 97.54  ? 576 ASN A O   1 
ATOM   2766 C  CB  . ASN A 1 384 ? 15.906  40.914 67.994  1.00 112.31 ? 576 ASN A CB  1 
ATOM   2767 C  CG  . ASN A 1 384 ? 15.572  39.886 69.075  1.00 116.91 ? 576 ASN A CG  1 
ATOM   2768 O  OD1 . ASN A 1 384 ? 15.548  38.680 68.829  1.00 119.98 ? 576 ASN A OD1 1 
ATOM   2769 N  ND2 . ASN A 1 384 ? 15.304  40.372 70.281  1.00 118.69 ? 576 ASN A ND2 1 
ATOM   2770 N  N   . GLY A 1 385 ? 16.039  38.938 64.800  1.00 95.80  ? 577 GLY A N   1 
ATOM   2771 C  CA  . GLY A 1 385 ? 15.243  38.013 64.003  1.00 91.83  ? 577 GLY A CA  1 
ATOM   2772 C  C   . GLY A 1 385 ? 15.100  36.691 64.734  1.00 90.68  ? 577 GLY A C   1 
ATOM   2773 O  O   . GLY A 1 385 ? 16.007  36.284 65.450  1.00 90.51  ? 577 GLY A O   1 
ATOM   2774 N  N   . LYS A 1 386 ? 13.966  36.019 64.541  1.00 88.94  ? 578 LYS A N   1 
ATOM   2775 C  CA  . LYS A 1 386 ? 13.615  34.822 65.303  1.00 86.94  ? 578 LYS A CA  1 
ATOM   2776 C  C   . LYS A 1 386 ? 13.385  33.639 64.385  1.00 88.99  ? 578 LYS A C   1 
ATOM   2777 O  O   . LYS A 1 386 ? 12.865  33.807 63.272  1.00 91.27  ? 578 LYS A O   1 
ATOM   2778 C  CB  . LYS A 1 386 ? 12.309  35.052 66.069  1.00 90.28  ? 578 LYS A CB  1 
ATOM   2779 C  CG  . LYS A 1 386 ? 12.287  36.228 67.031  1.00 91.21  ? 578 LYS A CG  1 
ATOM   2780 C  CD  . LYS A 1 386 ? 12.315  35.728 68.451  1.00 92.55  ? 578 LYS A CD  1 
ATOM   2781 C  CE  . LYS A 1 386 ? 11.587  36.667 69.379  1.00 93.03  ? 578 LYS A CE  1 
ATOM   2782 N  NZ  . LYS A 1 386 ? 12.337  37.931 69.540  1.00 98.24  ? 578 LYS A NZ  1 
ATOM   2783 N  N   . LEU A 1 387 ? 13.758  32.446 64.854  1.00 89.00  ? 579 LEU A N   1 
ATOM   2784 C  CA  . LEU A 1 387 ? 13.335  31.194 64.223  1.00 87.67  ? 579 LEU A CA  1 
ATOM   2785 C  C   . LEU A 1 387 ? 12.269  30.566 65.099  1.00 90.12  ? 579 LEU A C   1 
ATOM   2786 O  O   . LEU A 1 387 ? 12.503  30.304 66.287  1.00 90.33  ? 579 LEU A O   1 
ATOM   2787 C  CB  . LEU A 1 387 ? 14.499  30.206 64.048  1.00 88.35  ? 579 LEU A CB  1 
ATOM   2788 C  CG  . LEU A 1 387 ? 14.164  28.842 63.395  1.00 88.60  ? 579 LEU A CG  1 
ATOM   2789 C  CD1 . LEU A 1 387 ? 14.090  28.911 61.871  1.00 85.89  ? 579 LEU A CD1 1 
ATOM   2790 C  CD2 . LEU A 1 387 ? 15.157  27.768 63.790  1.00 87.30  ? 579 LEU A CD2 1 
ATOM   2791 N  N   . TYR A 1 388 ? 11.102  30.335 64.502  1.00 91.36  ? 580 TYR A N   1 
ATOM   2792 C  CA  . TYR A 1 388 ? 9.966   29.712 65.176  1.00 90.92  ? 580 TYR A CA  1 
ATOM   2793 C  C   . TYR A 1 388 ? 9.587   28.411 64.478  1.00 93.00  ? 580 TYR A C   1 
ATOM   2794 O  O   . TYR A 1 388 ? 9.467   28.374 63.248  1.00 94.05  ? 580 TYR A O   1 
ATOM   2795 C  CB  . TYR A 1 388 ? 8.754   30.627 65.101  1.00 90.14  ? 580 TYR A CB  1 
ATOM   2796 C  CG  . TYR A 1 388 ? 8.721   31.795 66.044  1.00 89.34  ? 580 TYR A CG  1 
ATOM   2797 C  CD1 . TYR A 1 388 ? 8.877   33.093 65.569  1.00 89.53  ? 580 TYR A CD1 1 
ATOM   2798 C  CD2 . TYR A 1 388 ? 8.481   31.613 67.410  1.00 88.19  ? 580 TYR A CD2 1 
ATOM   2799 C  CE1 . TYR A 1 388 ? 8.825   34.188 66.438  1.00 90.49  ? 580 TYR A CE1 1 
ATOM   2800 C  CE2 . TYR A 1 388 ? 8.418   32.695 68.282  1.00 86.57  ? 580 TYR A CE2 1 
ATOM   2801 C  CZ  . TYR A 1 388 ? 8.586   33.979 67.785  1.00 89.03  ? 580 TYR A CZ  1 
ATOM   2802 O  OH  . TYR A 1 388 ? 8.520   35.053 68.632  1.00 90.10  ? 580 TYR A OH  1 
ATOM   2803 N  N   . LYS A 1 389 ? 9.361   27.355 65.256  1.00 94.35  ? 581 LYS A N   1 
ATOM   2804 C  CA  . LYS A 1 389 ? 8.920   26.078 64.692  1.00 94.59  ? 581 LYS A CA  1 
ATOM   2805 C  C   . LYS A 1 389 ? 7.405   25.909 64.829  1.00 92.00  ? 581 LYS A C   1 
ATOM   2806 O  O   . LYS A 1 389 ? 6.837   26.288 65.864  1.00 89.80  ? 581 LYS A O   1 
ATOM   2807 C  CB  . LYS A 1 389 ? 9.642   24.907 65.358  1.00 94.29  ? 581 LYS A CB  1 
ATOM   2808 C  CG  . LYS A 1 389 ? 9.468   23.601 64.594  1.00 94.24  ? 581 LYS A CG  1 
ATOM   2809 C  CD  . LYS A 1 389 ? 9.528   22.380 65.486  1.00 93.78  ? 581 LYS A CD  1 
ATOM   2810 C  CE  . LYS A 1 389 ? 10.928  21.856 65.586  1.00 96.76  ? 581 LYS A CE  1 
ATOM   2811 N  NZ  . LYS A 1 389 ? 10.928  20.406 65.260  1.00 103.79 ? 581 LYS A NZ  1 
ATOM   2812 N  N   . ILE A 1 390 ? 6.771   25.352 63.788  1.00 87.18  ? 582 ILE A N   1 
ATOM   2813 C  CA  . ILE A 1 390 ? 5.328   25.043 63.802  1.00 88.30  ? 582 ILE A CA  1 
ATOM   2814 C  C   . ILE A 1 390 ? 5.078   23.655 64.400  1.00 90.97  ? 582 ILE A C   1 
ATOM   2815 O  O   . ILE A 1 390 ? 5.738   22.688 64.023  1.00 95.31  ? 582 ILE A O   1 
ATOM   2816 C  CB  . ILE A 1 390 ? 4.683   25.140 62.388  1.00 85.93  ? 582 ILE A CB  1 
ATOM   2817 C  CG1 . ILE A 1 390 ? 4.614   26.595 61.930  1.00 84.36  ? 582 ILE A CG1 1 
ATOM   2818 C  CG2 . ILE A 1 390 ? 3.271   24.494 62.355  1.00 84.99  ? 582 ILE A CG2 1 
ATOM   2819 C  CD1 . ILE A 1 390 ? 3.909   26.799 60.611  1.00 85.96  ? 582 ILE A CD1 1 
ATOM   2820 N  N   . VAL A 1 391 ? 4.116   23.569 65.318  1.00 89.04  ? 583 VAL A N   1 
ATOM   2821 C  CA  . VAL A 1 391 ? 3.884   22.363 66.113  1.00 91.60  ? 583 VAL A CA  1 
ATOM   2822 C  C   . VAL A 1 391 ? 2.416   21.909 66.092  1.00 92.32  ? 583 VAL A C   1 
ATOM   2823 O  O   . VAL A 1 391 ? 1.488   22.734 66.105  1.00 94.57  ? 583 VAL A O   1 
ATOM   2824 C  CB  . VAL A 1 391 ? 4.356   22.589 67.586  1.00 93.93  ? 583 VAL A CB  1 
ATOM   2825 C  CG1 . VAL A 1 391 ? 4.007   21.409 68.481  1.00 96.40  ? 583 VAL A CG1 1 
ATOM   2826 C  CG2 . VAL A 1 391 ? 5.849   22.825 67.635  1.00 94.81  ? 583 VAL A CG2 1 
ATOM   2827 N  N   . ASP A 1 392 ? 2.211   20.594 66.059  1.00 89.16  ? 584 ASP A N   1 
ATOM   2828 C  CA  . ASP A 1 392 ? 0.872   20.016 66.197  1.00 86.90  ? 584 ASP A CA  1 
ATOM   2829 C  C   . ASP A 1 392 ? 0.666   19.508 67.634  1.00 83.83  ? 584 ASP A C   1 
ATOM   2830 O  O   . ASP A 1 392 ? 1.217   18.467 68.018  1.00 80.66  ? 584 ASP A O   1 
ATOM   2831 C  CB  . ASP A 1 392 ? 0.677   18.892 65.180  1.00 87.73  ? 584 ASP A CB  1 
ATOM   2832 C  CG  . ASP A 1 392 ? -0.752  18.406 65.101  1.00 90.80  ? 584 ASP A CG  1 
ATOM   2833 O  OD1 . ASP A 1 392 ? -1.024  17.511 64.275  1.00 92.75  ? 584 ASP A OD1 1 
ATOM   2834 O  OD2 . ASP A 1 392 ? -1.608  18.903 65.857  1.00 96.14  ? 584 ASP A OD2 1 
ATOM   2835 N  N   . PRO A 1 393 ? -0.131  20.242 68.435  1.00 82.07  ? 585 PRO A N   1 
ATOM   2836 C  CA  . PRO A 1 393 ? -0.237  19.901 69.856  1.00 85.36  ? 585 PRO A CA  1 
ATOM   2837 C  C   . PRO A 1 393 ? -1.017  18.609 70.057  1.00 91.79  ? 585 PRO A C   1 
ATOM   2838 O  O   . PRO A 1 393 ? -0.917  17.984 71.119  1.00 95.72  ? 585 PRO A O   1 
ATOM   2839 C  CB  . PRO A 1 393 ? -1.001  21.086 70.477  1.00 81.17  ? 585 PRO A CB  1 
ATOM   2840 C  CG  . PRO A 1 393 ? -1.326  22.016 69.380  1.00 81.87  ? 585 PRO A CG  1 
ATOM   2841 C  CD  . PRO A 1 393 ? -0.987  21.380 68.061  1.00 81.29  ? 585 PRO A CD  1 
ATOM   2842 N  N   . LYS A 1 394 ? -1.780  18.218 69.037  1.00 91.89  ? 586 LYS A N   1 
ATOM   2843 C  CA  . LYS A 1 394 ? -2.562  16.995 69.081  1.00 92.79  ? 586 LYS A CA  1 
ATOM   2844 C  C   . LYS A 1 394 ? -1.685  15.741 69.054  1.00 87.88  ? 586 LYS A C   1 
ATOM   2845 O  O   . LYS A 1 394 ? -2.111  14.680 69.494  1.00 90.81  ? 586 LYS A O   1 
ATOM   2846 C  CB  . LYS A 1 394 ? -3.634  16.993 67.979  1.00 95.52  ? 586 LYS A CB  1 
ATOM   2847 C  CG  . LYS A 1 394 ? -5.012  17.502 68.476  1.00 99.56  ? 586 LYS A CG  1 
ATOM   2848 C  CD  . LYS A 1 394 ? -5.960  17.924 67.339  1.00 99.28  ? 586 LYS A CD  1 
ATOM   2849 C  CE  . LYS A 1 394 ? -6.809  16.772 66.795  1.00 101.89 ? 586 LYS A CE  1 
ATOM   2850 N  NZ  . LYS A 1 394 ? -8.091  16.582 67.530  1.00 103.31 ? 586 LYS A NZ  1 
ATOM   2851 N  N   . ARG A 1 395 ? -0.456  15.872 68.570  1.00 85.09  ? 587 ARG A N   1 
ATOM   2852 C  CA  . ARG A 1 395 ? 0.500   14.764 68.581  1.00 84.77  ? 587 ARG A CA  1 
ATOM   2853 C  C   . ARG A 1 395 ? 1.639   15.007 69.572  1.00 87.02  ? 587 ARG A C   1 
ATOM   2854 O  O   . ARG A 1 395 ? 1.891   16.150 69.961  1.00 88.54  ? 587 ARG A O   1 
ATOM   2855 C  CB  . ARG A 1 395 ? 1.086   14.534 67.186  1.00 82.07  ? 587 ARG A CB  1 
ATOM   2856 C  CG  . ARG A 1 395 ? 0.102   14.038 66.164  1.00 83.57  ? 587 ARG A CG  1 
ATOM   2857 C  CD  . ARG A 1 395 ? 0.818   13.325 65.047  1.00 86.41  ? 587 ARG A CD  1 
ATOM   2858 N  NE  . ARG A 1 395 ? 1.119   11.930 65.369  1.00 88.50  ? 587 ARG A NE  1 
ATOM   2859 C  CZ  . ARG A 1 395 ? 2.081   11.209 64.794  1.00 89.29  ? 587 ARG A CZ  1 
ATOM   2860 N  NH1 . ARG A 1 395 ? 2.870   11.741 63.869  1.00 89.96  ? 587 ARG A NH1 1 
ATOM   2861 N  NH2 . ARG A 1 395 ? 2.261   9.947  65.153  1.00 89.53  ? 587 ARG A NH2 1 
ATOM   2862 N  N   . PRO A 1 396 ? 2.345   13.931 69.977  1.00 87.91  ? 588 PRO A N   1 
ATOM   2863 C  CA  . PRO A 1 396 ? 3.524   14.094 70.821  1.00 88.09  ? 588 PRO A CA  1 
ATOM   2864 C  C   . PRO A 1 396 ? 4.657   14.746 70.046  1.00 86.89  ? 588 PRO A C   1 
ATOM   2865 O  O   . PRO A 1 396 ? 4.651   14.725 68.819  1.00 86.89  ? 588 PRO A O   1 
ATOM   2866 C  CB  . PRO A 1 396 ? 3.903   12.647 71.175  1.00 85.83  ? 588 PRO A CB  1 
ATOM   2867 C  CG  . PRO A 1 396 ? 2.713   11.839 70.859  1.00 83.17  ? 588 PRO A CG  1 
ATOM   2868 C  CD  . PRO A 1 396 ? 2.097   12.509 69.691  1.00 85.55  ? 588 PRO A CD  1 
ATOM   2869 N  N   . LEU A 1 397 ? 5.626   15.311 70.753  1.00 88.20  ? 589 LEU A N   1 
ATOM   2870 C  CA  . LEU A 1 397 ? 6.779   15.897 70.081  1.00 91.89  ? 589 LEU A CA  1 
ATOM   2871 C  C   . LEU A 1 397 ? 7.643   14.836 69.411  1.00 94.93  ? 589 LEU A C   1 
ATOM   2872 O  O   . LEU A 1 397 ? 8.249   15.090 68.374  1.00 100.17 ? 589 LEU A O   1 
ATOM   2873 C  CB  . LEU A 1 397 ? 7.602   16.751 71.040  1.00 90.56  ? 589 LEU A CB  1 
ATOM   2874 C  CG  . LEU A 1 397 ? 6.932   18.056 71.470  1.00 89.39  ? 589 LEU A CG  1 
ATOM   2875 C  CD1 . LEU A 1 397 ? 7.794   18.750 72.479  1.00 86.83  ? 589 LEU A CD1 1 
ATOM   2876 C  CD2 . LEU A 1 397 ? 6.661   18.961 70.270  1.00 88.03  ? 589 LEU A CD2 1 
ATOM   2877 N  N   . MET A 1 398 ? 7.691   13.645 69.997  1.00 95.30  ? 590 MET A N   1 
ATOM   2878 C  CA  . MET A 1 398 ? 8.430   12.546 69.395  1.00 94.16  ? 590 MET A CA  1 
ATOM   2879 C  C   . MET A 1 398 ? 7.570   11.308 69.285  1.00 92.88  ? 590 MET A C   1 
ATOM   2880 O  O   . MET A 1 398 ? 7.662   10.414 70.121  1.00 93.59  ? 590 MET A O   1 
ATOM   2881 C  CB  . MET A 1 398 ? 9.721   12.242 70.167  1.00 94.31  ? 590 MET A CB  1 
ATOM   2882 C  CG  . MET A 1 398 ? 10.765  11.447 69.372  1.00 92.02  ? 590 MET A CG  1 
ATOM   2883 S  SD  . MET A 1 398 ? 11.015  12.007 67.669  1.00 91.30  ? 590 MET A SD  1 
ATOM   2884 C  CE  . MET A 1 398 ? 11.418  13.745 67.867  1.00 88.51  ? 590 MET A CE  1 
ATOM   2885 N  N   . PRO A 1 399 ? 6.718   11.257 68.250  1.00 92.73  ? 591 PRO A N   1 
ATOM   2886 C  CA  . PRO A 1 399 ? 5.995   10.032 67.960  1.00 92.51  ? 591 PRO A CA  1 
ATOM   2887 C  C   . PRO A 1 399 ? 6.995   8.929  67.666  1.00 94.42  ? 591 PRO A C   1 
ATOM   2888 O  O   . PRO A 1 399 ? 8.063   9.212  67.106  1.00 93.49  ? 591 PRO A O   1 
ATOM   2889 C  CB  . PRO A 1 399 ? 5.212   10.382 66.696  1.00 91.56  ? 591 PRO A CB  1 
ATOM   2890 C  CG  . PRO A 1 399 ? 5.075   11.856 66.733  1.00 93.72  ? 591 PRO A CG  1 
ATOM   2891 C  CD  . PRO A 1 399 ? 6.371   12.332 67.305  1.00 93.61  ? 591 PRO A CD  1 
ATOM   2892 N  N   . GLU A 1 400 ? 6.660   7.697  68.060  1.00 95.48  ? 592 GLU A N   1 
ATOM   2893 C  CA  . GLU A 1 400 ? 7.523   6.535  67.835  1.00 96.38  ? 592 GLU A CA  1 
ATOM   2894 C  C   . GLU A 1 400 ? 8.130   6.545  66.434  1.00 93.60  ? 592 GLU A C   1 
ATOM   2895 O  O   . GLU A 1 400 ? 9.342   6.403  66.282  1.00 92.64  ? 592 GLU A O   1 
ATOM   2896 C  CB  . GLU A 1 400 ? 6.750   5.231  68.052  1.00 99.02  ? 592 GLU A CB  1 
ATOM   2897 C  CG  . GLU A 1 400 ? 6.779   4.676  69.474  1.00 100.75 ? 592 GLU A CG  1 
ATOM   2898 C  CD  . GLU A 1 400 ? 6.443   3.180  69.529  1.00 101.74 ? 592 GLU A CD  1 
ATOM   2899 O  OE1 . GLU A 1 400 ? 6.729   2.456  68.546  1.00 102.89 ? 592 GLU A OE1 1 
ATOM   2900 O  OE2 . GLU A 1 400 ? 5.901   2.720  70.561  1.00 104.03 ? 592 GLU A OE2 1 
ATOM   2901 N  N   . GLU A 1 401 ? 7.279   6.747  65.426  1.00 92.69  ? 593 GLU A N   1 
ATOM   2902 C  CA  . GLU A 1 401 ? 7.677   6.720  64.013  1.00 94.14  ? 593 GLU A CA  1 
ATOM   2903 C  C   . GLU A 1 401 ? 8.706   7.778  63.624  1.00 96.67  ? 593 GLU A C   1 
ATOM   2904 O  O   . GLU A 1 401 ? 9.474   7.578  62.683  1.00 98.77  ? 593 GLU A O   1 
ATOM   2905 C  CB  . GLU A 1 401 ? 6.462   6.881  63.087  1.00 94.05  ? 593 GLU A CB  1 
ATOM   2906 C  CG  . GLU A 1 401 ? 5.116   6.474  63.670  1.00 95.53  ? 593 GLU A CG  1 
ATOM   2907 C  CD  . GLU A 1 401 ? 4.256   7.668  64.063  1.00 96.11  ? 593 GLU A CD  1 
ATOM   2908 O  OE1 . GLU A 1 401 ? 4.327   8.718  63.376  1.00 94.54  ? 593 GLU A OE1 1 
ATOM   2909 O  OE2 . GLU A 1 401 ? 3.492   7.545  65.051  1.00 95.33  ? 593 GLU A OE2 1 
ATOM   2910 N  N   . CYS A 1 402 ? 8.707   8.903  64.333  1.00 97.26  ? 594 CYS A N   1 
ATOM   2911 C  CA  . CYS A 1 402 ? 9.498   10.066 63.932  1.00 98.71  ? 594 CYS A CA  1 
ATOM   2912 C  C   . CYS A 1 402 ? 10.919  10.027 64.452  1.00 98.32  ? 594 CYS A C   1 
ATOM   2913 O  O   . CYS A 1 402 ? 11.739  10.892 64.115  1.00 96.41  ? 594 CYS A O   1 
ATOM   2914 C  CB  . CYS A 1 402 ? 8.803   11.349 64.375  1.00 100.37 ? 594 CYS A CB  1 
ATOM   2915 S  SG  . CYS A 1 402 ? 7.147   11.469 63.700  1.00 102.58 ? 594 CYS A SG  1 
ATOM   2916 N  N   . ARG A 1 403 ? 11.198  9.021  65.278  1.00 98.02  ? 595 ARG A N   1 
ATOM   2917 C  CA  . ARG A 1 403 ? 12.519  8.835  65.841  1.00 99.32  ? 595 ARG A CA  1 
ATOM   2918 C  C   . ARG A 1 403 ? 13.502  8.627  64.712  1.00 97.35  ? 595 ARG A C   1 
ATOM   2919 O  O   . ARG A 1 403 ? 13.248  7.859  63.786  1.00 99.94  ? 595 ARG A O   1 
ATOM   2920 C  CB  . ARG A 1 403 ? 12.540  7.648  66.804  1.00 103.41 ? 595 ARG A CB  1 
ATOM   2921 C  CG  . ARG A 1 403 ? 12.025  7.974  68.194  1.00 109.38 ? 595 ARG A CG  1 
ATOM   2922 C  CD  . ARG A 1 403 ? 11.778  6.710  68.998  1.00 114.99 ? 595 ARG A CD  1 
ATOM   2923 N  NE  . ARG A 1 403 ? 11.298  7.012  70.346  1.00 120.21 ? 595 ARG A NE  1 
ATOM   2924 C  CZ  . ARG A 1 403 ? 10.805  6.114  71.199  1.00 122.39 ? 595 ARG A CZ  1 
ATOM   2925 N  NH1 . ARG A 1 403 ? 10.711  4.829  70.862  1.00 117.44 ? 595 ARG A NH1 1 
ATOM   2926 N  NH2 . ARG A 1 403 ? 10.397  6.508  72.401  1.00 125.70 ? 595 ARG A NH2 1 
ATOM   2927 N  N   . ALA A 1 404 ? 14.605  9.357  64.778  1.00 95.70  ? 596 ALA A N   1 
ATOM   2928 C  CA  . ALA A 1 404 ? 15.689  9.224  63.822  1.00 95.60  ? 596 ALA A CA  1 
ATOM   2929 C  C   . ALA A 1 404 ? 16.992  9.459  64.549  1.00 99.13  ? 596 ALA A C   1 
ATOM   2930 O  O   . ALA A 1 404 ? 17.021  10.126 65.585  1.00 104.81 ? 596 ALA A O   1 
ATOM   2931 C  CB  . ALA A 1 404 ? 15.528  10.210 62.684  1.00 92.81  ? 596 ALA A CB  1 
ATOM   2932 N  N   . THR A 1 405 ? 18.069  8.915  64.003  1.00 101.36 ? 597 THR A N   1 
ATOM   2933 C  CA  . THR A 1 405 ? 19.368  9.001  64.646  1.00 104.79 ? 597 THR A CA  1 
ATOM   2934 C  C   . THR A 1 405 ? 20.319  9.902  63.851  1.00 105.30 ? 597 THR A C   1 
ATOM   2935 O  O   . THR A 1 405 ? 20.456  9.765  62.637  1.00 106.38 ? 597 THR A O   1 
ATOM   2936 C  CB  . THR A 1 405 ? 19.953  7.591  64.926  1.00 106.36 ? 597 THR A CB  1 
ATOM   2937 O  OG1 . THR A 1 405 ? 21.252  7.712  65.514  1.00 107.40 ? 597 THR A OG1 1 
ATOM   2938 C  CG2 . THR A 1 405 ? 20.029  6.744  63.646  1.00 108.61 ? 597 THR A CG2 1 
ATOM   2939 N  N   . VAL A 1 406 ? 20.947  10.842 64.550  1.00 106.75 ? 598 VAL A N   1 
ATOM   2940 C  CA  . VAL A 1 406 ? 21.758  11.880 63.914  1.00 107.04 ? 598 VAL A CA  1 
ATOM   2941 C  C   . VAL A 1 406 ? 23.088  11.315 63.429  1.00 104.83 ? 598 VAL A C   1 
ATOM   2942 O  O   . VAL A 1 406 ? 23.757  10.600 64.164  1.00 105.87 ? 598 VAL A O   1 
ATOM   2943 C  CB  . VAL A 1 406 ? 21.960  13.103 64.860  1.00 108.46 ? 598 VAL A CB  1 
ATOM   2944 C  CG1 . VAL A 1 406 ? 22.426  12.657 66.240  1.00 111.96 ? 598 VAL A CG1 1 
ATOM   2945 C  CG2 . VAL A 1 406 ? 22.921  14.126 64.255  1.00 109.17 ? 598 VAL A CG2 1 
ATOM   2946 N  N   . GLN A 1 407 ? 23.443  11.620 62.180  1.00 104.81 ? 599 GLN A N   1 
ATOM   2947 C  CA  . GLN A 1 407 ? 24.711  11.172 61.583  1.00 101.33 ? 599 GLN A CA  1 
ATOM   2948 C  C   . GLN A 1 407 ? 25.636  12.371 61.359  1.00 95.87  ? 599 GLN A C   1 
ATOM   2949 O  O   . GLN A 1 407 ? 25.561  13.014 60.307  1.00 93.02  ? 599 GLN A O   1 
ATOM   2950 C  CB  . GLN A 1 407 ? 24.476  10.458 60.248  1.00 100.87 ? 599 GLN A CB  1 
ATOM   2951 C  CG  . GLN A 1 407 ? 23.697  9.152  60.311  1.00 101.68 ? 599 GLN A CG  1 
ATOM   2952 C  CD  . GLN A 1 407 ? 23.541  8.521  58.930  1.00 103.87 ? 599 GLN A CD  1 
ATOM   2953 O  OE1 . GLN A 1 407 ? 24.518  8.061  58.330  1.00 104.76 ? 599 GLN A OE1 1 
ATOM   2954 N  NE2 . GLN A 1 407 ? 22.311  8.506  58.416  1.00 103.60 ? 599 GLN A NE2 1 
ATOM   2955 N  N   . PRO A 1 408 ? 26.532  12.651 62.332  1.00 92.34  ? 600 PRO A N   1 
ATOM   2956 C  CA  . PRO A 1 408 ? 27.317  13.887 62.354  1.00 90.54  ? 600 PRO A CA  1 
ATOM   2957 C  C   . PRO A 1 408 ? 28.076  14.112 61.047  1.00 91.12  ? 600 PRO A C   1 
ATOM   2958 O  O   . PRO A 1 408 ? 28.690  13.177 60.510  1.00 88.94  ? 600 PRO A O   1 
ATOM   2959 C  CB  . PRO A 1 408 ? 28.296  13.663 63.510  1.00 89.03  ? 600 PRO A CB  1 
ATOM   2960 C  CG  . PRO A 1 408 ? 27.643  12.668 64.378  1.00 87.98  ? 600 PRO A CG  1 
ATOM   2961 C  CD  . PRO A 1 408 ? 26.887  11.766 63.457  1.00 90.11  ? 600 PRO A CD  1 
ATOM   2962 N  N   . ALA A 1 409 ? 28.016  15.345 60.546  1.00 90.19  ? 601 ALA A N   1 
ATOM   2963 C  CA  . ALA A 1 409 ? 28.647  15.707 59.279  1.00 89.42  ? 601 ALA A CA  1 
ATOM   2964 C  C   . ALA A 1 409 ? 30.152  15.421 59.267  1.00 90.57  ? 601 ALA A C   1 
ATOM   2965 O  O   . ALA A 1 409 ? 30.869  15.726 60.226  1.00 88.95  ? 601 ALA A O   1 
ATOM   2966 C  CB  . ALA A 1 409 ? 28.369  17.162 58.944  1.00 87.66  ? 601 ALA A CB  1 
ATOM   2967 N  N   . GLN A 1 410 ? 30.611  14.833 58.169  1.00 92.40  ? 602 GLN A N   1 
ATOM   2968 C  CA  . GLN A 1 410 ? 31.990  14.405 58.037  1.00 95.43  ? 602 GLN A CA  1 
ATOM   2969 C  C   . GLN A 1 410 ? 32.705  15.240 56.978  1.00 96.48  ? 602 GLN A C   1 
ATOM   2970 O  O   . GLN A 1 410 ? 32.064  15.843 56.119  1.00 97.55  ? 602 GLN A O   1 
ATOM   2971 C  CB  . GLN A 1 410 ? 32.029  12.923 57.656  1.00 98.30  ? 602 GLN A CB  1 
ATOM   2972 C  CG  . GLN A 1 410 ? 32.987  12.069 58.486  1.00 102.07 ? 602 GLN A CG  1 
ATOM   2973 C  CD  . GLN A 1 410 ? 32.377  11.591 59.800  1.00 102.97 ? 602 GLN A CD  1 
ATOM   2974 O  OE1 . GLN A 1 410 ? 31.866  12.384 60.591  1.00 103.69 ? 602 GLN A OE1 1 
ATOM   2975 N  NE2 . GLN A 1 410 ? 32.439  10.286 60.036  1.00 103.52 ? 602 GLN A NE2 1 
ATOM   2976 N  N   . THR A 1 411 ? 34.033  15.278 57.049  1.00 97.06  ? 603 THR A N   1 
ATOM   2977 C  CA  . THR A 1 411 ? 34.847  15.937 56.031  1.00 95.53  ? 603 THR A CA  1 
ATOM   2978 C  C   . THR A 1 411 ? 34.761  15.164 54.728  1.00 96.22  ? 603 THR A C   1 
ATOM   2979 O  O   . THR A 1 411 ? 34.797  13.929 54.731  1.00 98.16  ? 603 THR A O   1 
ATOM   2980 C  CB  . THR A 1 411 ? 36.331  15.997 56.434  1.00 95.24  ? 603 THR A CB  1 
ATOM   2981 O  OG1 . THR A 1 411 ? 36.695  14.775 57.087  1.00 97.42  ? 603 THR A OG1 1 
ATOM   2982 C  CG2 . THR A 1 411 ? 36.602  17.163 57.365  1.00 94.15  ? 603 THR A CG2 1 
ATOM   2983 N  N   . LEU A 1 412 ? 34.649  15.900 53.622  1.00 94.62  ? 604 LEU A N   1 
ATOM   2984 C  CA  . LEU A 1 412 ? 34.695  15.330 52.274  1.00 93.04  ? 604 LEU A CA  1 
ATOM   2985 C  C   . LEU A 1 412 ? 35.815  14.305 52.131  1.00 93.67  ? 604 LEU A C   1 
ATOM   2986 O  O   . LEU A 1 412 ? 36.925  14.511 52.628  1.00 91.76  ? 604 LEU A O   1 
ATOM   2987 C  CB  . LEU A 1 412 ? 34.878  16.443 51.240  1.00 91.78  ? 604 LEU A CB  1 
ATOM   2988 C  CG  . LEU A 1 412 ? 33.689  16.975 50.433  1.00 92.07  ? 604 LEU A CG  1 
ATOM   2989 C  CD1 . LEU A 1 412 ? 32.354  16.805 51.146  1.00 94.55  ? 604 LEU A CD1 1 
ATOM   2990 C  CD2 . LEU A 1 412 ? 33.922  18.432 50.071  1.00 91.72  ? 604 LEU A CD2 1 
ATOM   2991 N  N   . THR A 1 413 ? 35.509  13.196 51.463  1.00 95.89  ? 605 THR A N   1 
ATOM   2992 C  CA  . THR A 1 413 ? 36.478  12.116 51.266  1.00 97.53  ? 605 THR A CA  1 
ATOM   2993 C  C   . THR A 1 413 ? 36.502  11.600 49.827  1.00 98.12  ? 605 THR A C   1 
ATOM   2994 O  O   . THR A 1 413 ? 37.385  10.822 49.459  1.00 98.72  ? 605 THR A O   1 
ATOM   2995 C  CB  . THR A 1 413 ? 36.232  10.935 52.239  1.00 98.83  ? 605 THR A CB  1 
ATOM   2996 O  OG1 . THR A 1 413 ? 34.823  10.721 52.398  1.00 99.36  ? 605 THR A OG1 1 
ATOM   2997 C  CG2 . THR A 1 413 ? 36.850  11.223 53.601  1.00 100.34 ? 605 THR A CG2 1 
ATOM   2998 N  N   . SER A 1 414 ? 35.540  12.050 49.020  1.00 98.82  ? 606 SER A N   1 
ATOM   2999 C  CA  . SER A 1 414 ? 35.396  11.607 47.631  1.00 99.19  ? 606 SER A CA  1 
ATOM   3000 C  C   . SER A 1 414 ? 36.673  11.816 46.825  1.00 98.95  ? 606 SER A C   1 
ATOM   3001 O  O   . SER A 1 414 ? 37.422  12.763 47.072  1.00 99.06  ? 606 SER A O   1 
ATOM   3002 C  CB  . SER A 1 414 ? 34.232  12.332 46.951  1.00 99.85  ? 606 SER A CB  1 
ATOM   3003 O  OG  . SER A 1 414 ? 34.591  13.659 46.603  1.00 101.47 ? 606 SER A OG  1 
ATOM   3004 N  N   . GLU A 1 415 ? 36.897  10.932 45.856  1.00 98.49  ? 607 GLU A N   1 
ATOM   3005 C  CA  . GLU A 1 415 ? 38.124  10.913 45.062  1.00 98.74  ? 607 GLU A CA  1 
ATOM   3006 C  C   . GLU A 1 415 ? 38.536  12.294 44.542  1.00 98.33  ? 607 GLU A C   1 
ATOM   3007 O  O   . GLU A 1 415 ? 39.680  12.709 44.723  1.00 97.23  ? 607 GLU A O   1 
ATOM   3008 C  CB  . GLU A 1 415 ? 37.979  9.919  43.907  1.00 99.36  ? 607 GLU A CB  1 
ATOM   3009 C  CG  . GLU A 1 415 ? 39.274  9.580  43.183  1.00 98.91  ? 607 GLU A CG  1 
ATOM   3010 C  CD  . GLU A 1 415 ? 39.073  8.578  42.056  1.00 99.07  ? 607 GLU A CD  1 
ATOM   3011 O  OE1 . GLU A 1 415 ? 37.922  8.400  41.597  1.00 98.62  ? 607 GLU A OE1 1 
ATOM   3012 O  OE2 . GLU A 1 415 ? 40.074  7.968  41.625  1.00 99.47  ? 607 GLU A OE2 1 
ATOM   3013 N  N   . CYS A 1 416 ? 37.595  13.001 43.919  1.00 99.13  ? 608 CYS A N   1 
ATOM   3014 C  CA  . CYS A 1 416 ? 37.868  14.300 43.302  1.00 99.57  ? 608 CYS A CA  1 
ATOM   3015 C  C   . CYS A 1 416 ? 38.242  15.383 44.315  1.00 100.00 ? 608 CYS A C   1 
ATOM   3016 O  O   . CYS A 1 416 ? 39.034  16.275 44.012  1.00 99.17  ? 608 CYS A O   1 
ATOM   3017 C  CB  . CYS A 1 416 ? 36.670  14.755 42.465  1.00 100.21 ? 608 CYS A CB  1 
ATOM   3018 S  SG  . CYS A 1 416 ? 36.956  16.233 41.449  1.00 101.47 ? 608 CYS A SG  1 
ATOM   3019 N  N   . SER A 1 417 ? 37.674  15.298 45.515  1.00 101.82 ? 609 SER A N   1 
ATOM   3020 C  CA  . SER A 1 417 ? 37.912  16.298 46.557  1.00 103.46 ? 609 SER A CA  1 
ATOM   3021 C  C   . SER A 1 417 ? 39.373  16.377 47.004  1.00 104.80 ? 609 SER A C   1 
ATOM   3022 O  O   . SER A 1 417 ? 39.895  17.468 47.228  1.00 105.09 ? 609 SER A O   1 
ATOM   3023 C  CB  . SER A 1 417 ? 37.013  16.041 47.766  1.00 103.32 ? 609 SER A CB  1 
ATOM   3024 O  OG  . SER A 1 417 ? 37.505  16.727 48.905  1.00 105.04 ? 609 SER A OG  1 
ATOM   3025 N  N   . ARG A 1 418 ? 40.017  15.218 47.131  1.00 106.40 ? 610 ARG A N   1 
ATOM   3026 C  CA  . ARG A 1 418 ? 41.385  15.124 47.657  1.00 107.93 ? 610 ARG A CA  1 
ATOM   3027 C  C   . ARG A 1 418 ? 42.467  15.266 46.596  1.00 105.44 ? 610 ARG A C   1 
ATOM   3028 O  O   . ARG A 1 418 ? 43.563  15.741 46.890  1.00 105.82 ? 610 ARG A O   1 
ATOM   3029 C  CB  . ARG A 1 418 ? 41.589  13.816 48.440  1.00 109.56 ? 610 ARG A CB  1 
ATOM   3030 C  CG  . ARG A 1 418 ? 40.863  12.604 47.860  1.00 111.89 ? 610 ARG A CG  1 
ATOM   3031 C  CD  . ARG A 1 418 ? 40.686  11.491 48.894  1.00 111.94 ? 610 ARG A CD  1 
ATOM   3032 N  NE  . ARG A 1 418 ? 41.611  10.379 48.677  1.00 114.08 ? 610 ARG A NE  1 
ATOM   3033 C  CZ  . ARG A 1 418 ? 41.347  9.306  47.931  1.00 114.37 ? 610 ARG A CZ  1 
ATOM   3034 N  NH1 . ARG A 1 418 ? 40.177  9.179  47.315  1.00 114.24 ? 610 ARG A NH1 1 
ATOM   3035 N  NH2 . ARG A 1 418 ? 42.260  8.353  47.800  1.00 114.64 ? 610 ARG A NH2 1 
ATOM   3036 N  N   . LEU A 1 419 ? 42.155  14.865 45.367  1.00 103.38 ? 611 LEU A N   1 
ATOM   3037 C  CA  . LEU A 1 419 ? 43.156  14.789 44.303  1.00 100.06 ? 611 LEU A CA  1 
ATOM   3038 C  C   . LEU A 1 419 ? 43.166  15.993 43.358  1.00 99.34  ? 611 LEU A C   1 
ATOM   3039 O  O   . LEU A 1 419 ? 44.238  16.451 42.963  1.00 100.52 ? 611 LEU A O   1 
ATOM   3040 C  CB  . LEU A 1 419 ? 43.012  13.476 43.518  1.00 99.32  ? 611 LEU A CB  1 
ATOM   3041 C  CG  . LEU A 1 419 ? 43.767  12.218 43.983  1.00 98.72  ? 611 LEU A CG  1 
ATOM   3042 C  CD1 . LEU A 1 419 ? 43.697  11.965 45.492  1.00 98.60  ? 611 LEU A CD1 1 
ATOM   3043 C  CD2 . LEU A 1 419 ? 43.268  10.997 43.229  1.00 98.82  ? 611 LEU A CD2 1 
ATOM   3044 N  N   . CYS A 1 420 ? 41.985  16.500 43.007  1.00 98.99  ? 612 CYS A N   1 
ATOM   3045 C  CA  . CYS A 1 420 ? 41.857  17.592 42.029  1.00 100.50 ? 612 CYS A CA  1 
ATOM   3046 C  C   . CYS A 1 420 ? 42.632  18.840 42.461  1.00 102.89 ? 612 CYS A C   1 
ATOM   3047 O  O   . CYS A 1 420 ? 42.196  19.585 43.342  1.00 102.81 ? 612 CYS A O   1 
ATOM   3048 C  CB  . CYS A 1 420 ? 40.383  17.912 41.758  1.00 98.93  ? 612 CYS A CB  1 
ATOM   3049 S  SG  . CYS A 1 420 ? 40.059  18.925 40.299  1.00 96.63  ? 612 CYS A SG  1 
ATOM   3050 N  N   . ARG A 1 421 ? 43.780  19.035 41.808  1.00 105.96 ? 613 ARG A N   1 
ATOM   3051 C  CA  . ARG A 1 421 ? 44.801  20.042 42.140  1.00 107.87 ? 613 ARG A CA  1 
ATOM   3052 C  C   . ARG A 1 421 ? 44.245  21.427 42.475  1.00 108.16 ? 613 ARG A C   1 
ATOM   3053 O  O   . ARG A 1 421 ? 43.908  21.714 43.625  1.00 107.88 ? 613 ARG A O   1 
ATOM   3054 C  CB  . ARG A 1 421 ? 45.792  20.154 40.971  1.00 108.79 ? 613 ARG A CB  1 
ATOM   3055 C  CG  . ARG A 1 421 ? 47.177  20.675 41.342  1.00 108.54 ? 613 ARG A CG  1 
ATOM   3056 C  CD  . ARG A 1 421 ? 47.803  21.453 40.194  1.00 106.46 ? 613 ARG A CD  1 
ATOM   3057 N  NE  . ARG A 1 421 ? 47.832  22.895 40.436  1.00 105.72 ? 613 ARG A NE  1 
ATOM   3058 C  CZ  . ARG A 1 421 ? 47.006  23.778 39.883  1.00 105.66 ? 613 ARG A CZ  1 
ATOM   3059 N  NH1 . ARG A 1 421 ? 46.059  23.380 39.045  1.00 106.64 ? 613 ARG A NH1 1 
ATOM   3060 N  NH2 . ARG A 1 421 ? 47.129  25.068 40.175  1.00 105.41 ? 613 ARG A NH2 1 
ATOM   3061 N  N   . ASN A 1 422 ? 44.204  22.285 41.460  1.00 109.62 ? 614 ASN A N   1 
ATOM   3062 C  CA  . ASN A 1 422 ? 43.528  23.570 41.523  1.00 111.85 ? 614 ASN A CA  1 
ATOM   3063 C  C   . ASN A 1 422 ? 42.840  23.769 40.176  1.00 112.64 ? 614 ASN A C   1 
ATOM   3064 O  O   . ASN A 1 422 ? 43.336  23.317 39.128  1.00 109.35 ? 614 ASN A O   1 
ATOM   3065 C  CB  . ASN A 1 422 ? 44.504  24.708 41.842  1.00 113.38 ? 614 ASN A CB  1 
ATOM   3066 C  CG  . ASN A 1 422 ? 43.890  25.787 42.729  1.00 114.69 ? 614 ASN A CG  1 
ATOM   3067 O  OD1 . ASN A 1 422 ? 43.098  25.499 43.629  1.00 115.72 ? 614 ASN A OD1 1 
ATOM   3068 N  ND2 . ASN A 1 422 ? 44.273  27.037 42.486  1.00 114.59 ? 614 ASN A ND2 1 
ATOM   3069 N  N   . GLY A 1 423 ? 41.691  24.435 40.215  1.00 112.79 ? 615 GLY A N   1 
ATOM   3070 C  CA  . GLY A 1 423 ? 40.734  24.374 39.122  1.00 109.17 ? 615 GLY A CA  1 
ATOM   3071 C  C   . GLY A 1 423 ? 39.588  23.516 39.616  1.00 106.65 ? 615 GLY A C   1 
ATOM   3072 O  O   . GLY A 1 423 ? 39.801  22.521 40.320  1.00 104.82 ? 615 GLY A O   1 
ATOM   3073 N  N   . TYR A 1 424 ? 38.373  23.903 39.242  1.00 105.31 ? 616 TYR A N   1 
ATOM   3074 C  CA  . TYR A 1 424 ? 37.163  23.340 39.831  1.00 101.94 ? 616 TYR A CA  1 
ATOM   3075 C  C   . TYR A 1 424 ? 36.940  21.852 39.564  1.00 100.74 ? 616 TYR A C   1 
ATOM   3076 O  O   . TYR A 1 424 ? 37.439  21.290 38.590  1.00 100.20 ? 616 TYR A O   1 
ATOM   3077 C  CB  . TYR A 1 424 ? 35.936  24.170 39.440  1.00 101.25 ? 616 TYR A CB  1 
ATOM   3078 C  CG  . TYR A 1 424 ? 35.598  24.189 37.964  1.00 100.62 ? 616 TYR A CG  1 
ATOM   3079 C  CD1 . TYR A 1 424 ? 36.082  25.194 37.129  1.00 100.22 ? 616 TYR A CD1 1 
ATOM   3080 C  CD2 . TYR A 1 424 ? 34.759  23.223 37.411  1.00 100.54 ? 616 TYR A CD2 1 
ATOM   3081 C  CE1 . TYR A 1 424 ? 35.755  25.223 35.774  1.00 100.68 ? 616 TYR A CE1 1 
ATOM   3082 C  CE2 . TYR A 1 424 ? 34.425  23.246 36.061  1.00 101.15 ? 616 TYR A CE2 1 
ATOM   3083 C  CZ  . TYR A 1 424 ? 34.927  24.243 35.248  1.00 100.89 ? 616 TYR A CZ  1 
ATOM   3084 O  OH  . TYR A 1 424 ? 34.595  24.257 33.913  1.00 100.86 ? 616 TYR A OH  1 
ATOM   3085 N  N   . CYS A 1 425 ? 36.171  21.239 40.455  1.00 100.72 ? 617 CYS A N   1 
ATOM   3086 C  CA  . CYS A 1 425 ? 35.940  19.804 40.481  1.00 98.85  ? 617 CYS A CA  1 
ATOM   3087 C  C   . CYS A 1 425 ? 34.417  19.564 40.481  1.00 95.41  ? 617 CYS A C   1 
ATOM   3088 O  O   . CYS A 1 425 ? 33.755  19.806 41.486  1.00 94.76  ? 617 CYS A O   1 
ATOM   3089 C  CB  . CYS A 1 425 ? 36.658  19.247 41.725  1.00 99.48  ? 617 CYS A CB  1 
ATOM   3090 S  SG  . CYS A 1 425 ? 36.061  17.731 42.498  1.00 102.08 ? 617 CYS A SG  1 
ATOM   3091 N  N   . THR A 1 426 ? 33.867  19.117 39.347  1.00 92.38  ? 618 THR A N   1 
ATOM   3092 C  CA  . THR A 1 426 ? 32.399  19.053 39.151  1.00 92.13  ? 618 THR A CA  1 
ATOM   3093 C  C   . THR A 1 426 ? 31.690  18.095 40.115  1.00 93.79  ? 618 THR A C   1 
ATOM   3094 O  O   . THR A 1 426 ? 32.325  17.184 40.654  1.00 95.38  ? 618 THR A O   1 
ATOM   3095 C  CB  . THR A 1 426 ? 31.970  18.658 37.699  1.00 89.65  ? 618 THR A CB  1 
ATOM   3096 O  OG1 . THR A 1 426 ? 31.795  17.238 37.610  1.00 85.81  ? 618 THR A OG1 1 
ATOM   3097 C  CG2 . THR A 1 426 ? 32.957  19.139 36.649  1.00 91.10  ? 618 THR A CG2 1 
ATOM   3098 N  N   . PRO A 1 427 ? 30.367  18.298 40.326  1.00 92.92  ? 619 PRO A N   1 
ATOM   3099 C  CA  . PRO A 1 427 ? 29.546  17.428 41.175  1.00 92.21  ? 619 PRO A CA  1 
ATOM   3100 C  C   . PRO A 1 427 ? 29.549  15.947 40.799  1.00 93.31  ? 619 PRO A C   1 
ATOM   3101 O  O   . PRO A 1 427 ? 29.279  15.113 41.660  1.00 94.57  ? 619 PRO A O   1 
ATOM   3102 C  CB  . PRO A 1 427 ? 28.134  18.002 41.012  1.00 91.38  ? 619 PRO A CB  1 
ATOM   3103 C  CG  . PRO A 1 427 ? 28.193  18.858 39.803  1.00 90.81  ? 619 PRO A CG  1 
ATOM   3104 C  CD  . PRO A 1 427 ? 29.567  19.410 39.783  1.00 91.53  ? 619 PRO A CD  1 
ATOM   3105 N  N   . THR A 1 428 ? 29.840  15.613 39.542  1.00 94.13  ? 620 THR A N   1 
ATOM   3106 C  CA  . THR A 1 428 ? 29.911  14.201 39.144  1.00 96.43  ? 620 THR A CA  1 
ATOM   3107 C  C   . THR A 1 428 ? 31.199  13.551 39.624  1.00 96.45  ? 620 THR A C   1 
ATOM   3108 O  O   . THR A 1 428 ? 31.264  12.330 39.780  1.00 97.15  ? 620 THR A O   1 
ATOM   3109 C  CB  . THR A 1 428 ? 29.766  13.978 37.615  1.00 97.88  ? 620 THR A CB  1 
ATOM   3110 O  OG1 . THR A 1 428 ? 30.529  14.957 36.902  1.00 100.17 ? 620 THR A OG1 1 
ATOM   3111 C  CG2 . THR A 1 428 ? 28.309  14.061 37.191  1.00 98.00  ? 620 THR A CG2 1 
ATOM   3112 N  N   . GLY A 1 429 ? 32.217  14.372 39.858  1.00 97.07  ? 621 GLY A N   1 
ATOM   3113 C  CA  . GLY A 1 429 ? 33.515  13.882 40.301  1.00 98.27  ? 621 GLY A CA  1 
ATOM   3114 C  C   . GLY A 1 429 ? 34.619  14.102 39.285  1.00 99.28  ? 621 GLY A C   1 
ATOM   3115 O  O   . GLY A 1 429 ? 35.794  13.963 39.616  1.00 99.96  ? 621 GLY A O   1 
ATOM   3116 N  N   . LYS A 1 430 ? 34.242  14.430 38.047  1.00 99.14  ? 622 LYS A N   1 
ATOM   3117 C  CA  . LYS A 1 430 ? 35.208  14.788 37.008  1.00 99.30  ? 622 LYS A CA  1 
ATOM   3118 C  C   . LYS A 1 430 ? 35.918  16.077 37.396  1.00 100.19 ? 622 LYS A C   1 
ATOM   3119 O  O   . LYS A 1 430 ? 35.296  17.007 37.921  1.00 100.36 ? 622 LYS A O   1 
ATOM   3120 C  CB  . LYS A 1 430 ? 34.530  14.952 35.647  1.00 100.87 ? 622 LYS A CB  1 
ATOM   3121 C  CG  . LYS A 1 430 ? 33.938  13.666 35.069  1.00 104.00 ? 622 LYS A CG  1 
ATOM   3122 C  CD  . LYS A 1 430 ? 34.977  12.801 34.340  1.00 104.64 ? 622 LYS A CD  1 
ATOM   3123 C  CE  . LYS A 1 430 ? 34.312  11.576 33.715  1.00 104.48 ? 622 LYS A CE  1 
ATOM   3124 N  NZ  . LYS A 1 430 ? 35.262  10.694 32.992  1.00 104.60 ? 622 LYS A NZ  1 
ATOM   3125 N  N   . CYS A 1 431 ? 37.223  16.116 37.140  1.00 99.75  ? 623 CYS A N   1 
ATOM   3126 C  CA  . CYS A 1 431 ? 38.080  17.210 37.595  1.00 98.13  ? 623 CYS A CA  1 
ATOM   3127 C  C   . CYS A 1 431 ? 38.537  18.077 36.418  1.00 94.85  ? 623 CYS A C   1 
ATOM   3128 O  O   . CYS A 1 431 ? 39.321  17.640 35.578  1.00 94.74  ? 623 CYS A O   1 
ATOM   3129 C  CB  . CYS A 1 431 ? 39.257  16.643 38.408  1.00 97.70  ? 623 CYS A CB  1 
ATOM   3130 S  SG  . CYS A 1 431 ? 40.634  17.758 38.732  1.00 98.50  ? 623 CYS A SG  1 
ATOM   3131 N  N   . CYS A 1 432 ? 38.015  19.302 36.364  1.00 91.82  ? 624 CYS A N   1 
ATOM   3132 C  CA  . CYS A 1 432 ? 38.304  20.238 35.282  1.00 89.46  ? 624 CYS A CA  1 
ATOM   3133 C  C   . CYS A 1 432 ? 39.551  21.058 35.578  1.00 86.17  ? 624 CYS A C   1 
ATOM   3134 O  O   . CYS A 1 432 ? 39.672  21.652 36.648  1.00 85.77  ? 624 CYS A O   1 
ATOM   3135 C  CB  . CYS A 1 432 ? 37.115  21.168 35.047  1.00 91.99  ? 624 CYS A CB  1 
ATOM   3136 S  SG  . CYS A 1 432 ? 35.630  20.341 34.454  1.00 95.02  ? 624 CYS A SG  1 
ATOM   3137 N  N   . CYS A 1 433 ? 40.465  21.094 34.612  1.00 83.33  ? 625 CYS A N   1 
ATOM   3138 C  CA  . CYS A 1 433 ? 41.765  21.735 34.793  1.00 79.33  ? 625 CYS A CA  1 
ATOM   3139 C  C   . CYS A 1 433 ? 41.770  23.203 34.397  1.00 76.87  ? 625 CYS A C   1 
ATOM   3140 O  O   . CYS A 1 433 ? 41.136  23.599 33.422  1.00 76.74  ? 625 CYS A O   1 
ATOM   3141 C  CB  . CYS A 1 433 ? 42.843  20.985 34.008  1.00 79.03  ? 625 CYS A CB  1 
ATOM   3142 S  SG  . CYS A 1 433 ? 43.014  19.235 34.434  1.00 79.16  ? 625 CYS A SG  1 
ATOM   3143 N  N   . SER A 1 434 ? 42.490  24.001 35.175  1.00 76.01  ? 626 SER A N   1 
ATOM   3144 C  CA  . SER A 1 434 ? 42.757  25.395 34.846  1.00 75.30  ? 626 SER A CA  1 
ATOM   3145 C  C   . SER A 1 434 ? 43.790  25.458 33.718  1.00 77.18  ? 626 SER A C   1 
ATOM   3146 O  O   . SER A 1 434 ? 44.514  24.483 33.496  1.00 78.50  ? 626 SER A O   1 
ATOM   3147 C  CB  . SER A 1 434 ? 43.238  26.145 36.093  1.00 73.97  ? 626 SER A CB  1 
ATOM   3148 O  OG  . SER A 1 434 ? 43.577  25.242 37.135  1.00 72.55  ? 626 SER A OG  1 
ATOM   3149 N  N   . PRO A 1 435 ? 43.855  26.591 32.988  1.00 78.60  ? 627 PRO A N   1 
ATOM   3150 C  CA  . PRO A 1 435 ? 44.773  26.702 31.845  1.00 79.39  ? 627 PRO A CA  1 
ATOM   3151 C  C   . PRO A 1 435 ? 46.198  26.212 32.138  1.00 79.30  ? 627 PRO A C   1 
ATOM   3152 O  O   . PRO A 1 435 ? 46.836  26.662 33.098  1.00 78.29  ? 627 PRO A O   1 
ATOM   3153 C  CB  . PRO A 1 435 ? 44.764  28.202 31.538  1.00 80.04  ? 627 PRO A CB  1 
ATOM   3154 C  CG  . PRO A 1 435 ? 43.408  28.642 31.951  1.00 80.71  ? 627 PRO A CG  1 
ATOM   3155 C  CD  . PRO A 1 435 ? 43.072  27.827 33.175  1.00 79.44  ? 627 PRO A CD  1 
ATOM   3156 N  N   . GLY A 1 436 ? 46.670  25.278 31.315  1.00 78.53  ? 628 GLY A N   1 
ATOM   3157 C  CA  . GLY A 1 436 ? 48.016  24.730 31.446  1.00 76.39  ? 628 GLY A CA  1 
ATOM   3158 C  C   . GLY A 1 436 ? 48.178  23.605 32.457  1.00 74.46  ? 628 GLY A C   1 
ATOM   3159 O  O   . GLY A 1 436 ? 49.254  23.443 33.031  1.00 77.09  ? 628 GLY A O   1 
ATOM   3160 N  N   . TRP A 1 437 ? 47.115  22.836 32.682  1.00 70.39  ? 629 TRP A N   1 
ATOM   3161 C  CA  . TRP A 1 437 ? 47.188  21.616 33.492  1.00 68.08  ? 629 TRP A CA  1 
ATOM   3162 C  C   . TRP A 1 437 ? 46.468  20.464 32.791  1.00 68.89  ? 629 TRP A C   1 
ATOM   3163 O  O   . TRP A 1 437 ? 45.504  20.682 32.053  1.00 70.83  ? 629 TRP A O   1 
ATOM   3164 C  CB  . TRP A 1 437 ? 46.611  21.838 34.895  1.00 66.02  ? 629 TRP A CB  1 
ATOM   3165 C  CG  . TRP A 1 437 ? 47.411  22.794 35.754  1.00 66.15  ? 629 TRP A CG  1 
ATOM   3166 C  CD1 . TRP A 1 437 ? 47.189  24.133 35.914  1.00 66.03  ? 629 TRP A CD1 1 
ATOM   3167 C  CD2 . TRP A 1 437 ? 48.549  22.480 36.573  1.00 65.14  ? 629 TRP A CD2 1 
ATOM   3168 N  NE1 . TRP A 1 437 ? 48.114  24.670 36.777  1.00 65.04  ? 629 TRP A NE1 1 
ATOM   3169 C  CE2 . TRP A 1 437 ? 48.964  23.681 37.191  1.00 64.31  ? 629 TRP A CE2 1 
ATOM   3170 C  CE3 . TRP A 1 437 ? 49.264  21.303 36.835  1.00 66.24  ? 629 TRP A CE3 1 
ATOM   3171 C  CZ2 . TRP A 1 437 ? 50.059  23.741 38.061  1.00 64.94  ? 629 TRP A CZ2 1 
ATOM   3172 C  CZ3 . TRP A 1 437 ? 50.359  21.361 37.703  1.00 65.55  ? 629 TRP A CZ3 1 
ATOM   3173 C  CH2 . TRP A 1 437 ? 50.743  22.574 38.304  1.00 65.51  ? 629 TRP A CH2 1 
ATOM   3174 N  N   . GLU A 1 438 ? 46.939  19.241 33.019  1.00 68.81  ? 630 GLU A N   1 
ATOM   3175 C  CA  . GLU A 1 438 ? 46.358  18.063 32.372  1.00 69.89  ? 630 GLU A CA  1 
ATOM   3176 C  C   . GLU A 1 438 ? 46.437  16.825 33.257  1.00 69.60  ? 630 GLU A C   1 
ATOM   3177 O  O   . GLU A 1 438 ? 47.124  16.825 34.279  1.00 67.90  ? 630 GLU A O   1 
ATOM   3178 C  CB  . GLU A 1 438 ? 47.020  17.802 31.013  1.00 70.80  ? 630 GLU A CB  1 
ATOM   3179 C  CG  . GLU A 1 438 ? 48.486  17.394 31.085  1.00 71.93  ? 630 GLU A CG  1 
ATOM   3180 C  CD  . GLU A 1 438 ? 49.079  17.105 29.722  1.00 72.42  ? 630 GLU A CD  1 
ATOM   3181 O  OE1 . GLU A 1 438 ? 49.176  18.039 28.900  1.00 73.93  ? 630 GLU A OE1 1 
ATOM   3182 O  OE2 . GLU A 1 438 ? 49.461  15.943 29.476  1.00 73.65  ? 630 GLU A OE2 1 
ATOM   3183 N  N   . GLY A 1 439 ? 45.735  15.771 32.848  1.00 72.37  ? 631 GLY A N   1 
ATOM   3184 C  CA  . GLY A 1 439 ? 45.612  14.556 33.651  1.00 77.64  ? 631 GLY A CA  1 
ATOM   3185 C  C   . GLY A 1 439 ? 44.245  14.443 34.307  1.00 82.30  ? 631 GLY A C   1 
ATOM   3186 O  O   . GLY A 1 439 ? 43.490  15.423 34.373  1.00 82.31  ? 631 GLY A O   1 
ATOM   3187 N  N   . ASP A 1 440 ? 43.929  13.246 34.801  1.00 84.99  ? 632 ASP A N   1 
ATOM   3188 C  CA  . ASP A 1 440 ? 42.625  12.964 35.416  1.00 86.67  ? 632 ASP A CA  1 
ATOM   3189 C  C   . ASP A 1 440 ? 42.281  13.916 36.559  1.00 88.00  ? 632 ASP A C   1 
ATOM   3190 O  O   . ASP A 1 440 ? 41.110  14.250 36.765  1.00 90.16  ? 632 ASP A O   1 
ATOM   3191 C  CB  . ASP A 1 440 ? 42.562  11.520 35.922  1.00 86.69  ? 632 ASP A CB  1 
ATOM   3192 C  CG  . ASP A 1 440 ? 42.542  10.505 34.797  1.00 86.64  ? 632 ASP A CG  1 
ATOM   3193 O  OD1 . ASP A 1 440 ? 41.498  9.838  34.626  1.00 86.38  ? 632 ASP A OD1 1 
ATOM   3194 O  OD2 . ASP A 1 440 ? 43.566  10.377 34.089  1.00 85.69  ? 632 ASP A OD2 1 
ATOM   3195 N  N   . PHE A 1 441 ? 43.304  14.342 37.299  1.00 86.75  ? 633 PHE A N   1 
ATOM   3196 C  CA  . PHE A 1 441 ? 43.114  15.225 38.446  1.00 83.89  ? 633 PHE A CA  1 
ATOM   3197 C  C   . PHE A 1 441 ? 43.985  16.476 38.358  1.00 82.78  ? 633 PHE A C   1 
ATOM   3198 O  O   . PHE A 1 441 ? 44.231  17.148 39.364  1.00 82.73  ? 633 PHE A O   1 
ATOM   3199 C  CB  . PHE A 1 441 ? 43.347  14.463 39.757  1.00 83.70  ? 633 PHE A CB  1 
ATOM   3200 C  CG  . PHE A 1 441 ? 42.460  13.260 39.920  1.00 83.93  ? 633 PHE A CG  1 
ATOM   3201 C  CD1 . PHE A 1 441 ? 42.957  11.979 39.688  1.00 84.45  ? 633 PHE A CD1 1 
ATOM   3202 C  CD2 . PHE A 1 441 ? 41.121  13.409 40.281  1.00 84.93  ? 633 PHE A CD2 1 
ATOM   3203 C  CE1 . PHE A 1 441 ? 42.138  10.860 39.823  1.00 84.91  ? 633 PHE A CE1 1 
ATOM   3204 C  CE2 . PHE A 1 441 ? 40.291  12.300 40.424  1.00 84.97  ? 633 PHE A CE2 1 
ATOM   3205 C  CZ  . PHE A 1 441 ? 40.801  11.022 40.194  1.00 85.49  ? 633 PHE A CZ  1 
ATOM   3206 N  N   . CYS A 1 442 ? 44.435  16.785 37.141  1.00 81.86  ? 634 CYS A N   1 
ATOM   3207 C  CA  . CYS A 1 442 ? 45.201  18.002 36.849  1.00 82.52  ? 634 CYS A CA  1 
ATOM   3208 C  C   . CYS A 1 442 ? 46.533  18.093 37.603  1.00 83.97  ? 634 CYS A C   1 
ATOM   3209 O  O   . CYS A 1 442 ? 46.915  19.167 38.073  1.00 84.72  ? 634 CYS A O   1 
ATOM   3210 C  CB  . CYS A 1 442 ? 44.355  19.253 37.125  1.00 80.64  ? 634 CYS A CB  1 
ATOM   3211 S  SG  . CYS A 1 442 ? 42.705  19.191 36.440  1.00 78.30  ? 634 CYS A SG  1 
ATOM   3212 N  N   . ARG A 1 443 ? 47.243  16.974 37.710  1.00 84.06  ? 635 ARG A N   1 
ATOM   3213 C  CA  . ARG A 1 443 ? 48.509  16.968 38.441  1.00 84.76  ? 635 ARG A CA  1 
ATOM   3214 C  C   . ARG A 1 443 ? 49.720  17.255 37.548  1.00 82.86  ? 635 ARG A C   1 
ATOM   3215 O  O   . ARG A 1 443 ? 50.738  17.762 38.021  1.00 84.43  ? 635 ARG A O   1 
ATOM   3216 C  CB  . ARG A 1 443 ? 48.699  15.656 39.206  1.00 87.90  ? 635 ARG A CB  1 
ATOM   3217 C  CG  . ARG A 1 443 ? 47.491  15.228 40.023  1.00 91.46  ? 635 ARG A CG  1 
ATOM   3218 C  CD  . ARG A 1 443 ? 47.906  14.815 41.424  1.00 95.13  ? 635 ARG A CD  1 
ATOM   3219 N  NE  . ARG A 1 443 ? 47.150  13.660 41.903  1.00 96.54  ? 635 ARG A NE  1 
ATOM   3220 C  CZ  . ARG A 1 443 ? 47.591  12.406 41.855  1.00 97.12  ? 635 ARG A CZ  1 
ATOM   3221 N  NH1 . ARG A 1 443 ? 48.793  12.135 41.354  1.00 97.25  ? 635 ARG A NH1 1 
ATOM   3222 N  NH2 . ARG A 1 443 ? 46.833  11.419 42.314  1.00 96.37  ? 635 ARG A NH2 1 
ATOM   3223 N  N   . THR A 1 444 ? 49.602  16.942 36.261  1.00 78.97  ? 636 THR A N   1 
ATOM   3224 C  CA  . THR A 1 444 ? 50.695  17.140 35.315  1.00 75.75  ? 636 THR A CA  1 
ATOM   3225 C  C   . THR A 1 444 ? 50.586  18.505 34.625  1.00 73.90  ? 636 THR A C   1 
ATOM   3226 O  O   . THR A 1 444 ? 49.562  18.828 34.026  1.00 72.82  ? 636 THR A O   1 
ATOM   3227 C  CB  . THR A 1 444 ? 50.755  15.982 34.284  1.00 75.07  ? 636 THR A CB  1 
ATOM   3228 O  OG1 . THR A 1 444 ? 50.959  14.742 34.973  1.00 73.45  ? 636 THR A OG1 1 
ATOM   3229 C  CG2 . THR A 1 444 ? 51.887  16.185 33.288  1.00 75.78  ? 636 THR A CG2 1 
ATOM   3230 N  N   . ALA A 1 445 ? 51.655  19.293 34.726  1.00 74.35  ? 637 ALA A N   1 
ATOM   3231 C  CA  . ALA A 1 445 ? 51.722  20.634 34.145  1.00 74.81  ? 637 ALA A CA  1 
ATOM   3232 C  C   . ALA A 1 445 ? 52.108  20.627 32.667  1.00 78.15  ? 637 ALA A C   1 
ATOM   3233 O  O   . ALA A 1 445 ? 52.739  19.690 32.171  1.00 78.48  ? 637 ALA A O   1 
ATOM   3234 C  CB  . ALA A 1 445 ? 52.686  21.508 34.938  1.00 74.02  ? 637 ALA A CB  1 
ATOM   3235 N  N   . LYS A 1 446 ? 51.742  21.708 31.987  1.00 82.33  ? 638 LYS A N   1 
ATOM   3236 C  CA  . LYS A 1 446 ? 51.879  21.833 30.544  1.00 86.68  ? 638 LYS A CA  1 
ATOM   3237 C  C   . LYS A 1 446 ? 52.996  22.822 30.185  1.00 90.59  ? 638 LYS A C   1 
ATOM   3238 O  O   . LYS A 1 446 ? 52.976  23.975 30.619  1.00 91.31  ? 638 LYS A O   1 
ATOM   3239 C  CB  . LYS A 1 446 ? 50.554  22.344 29.986  1.00 86.36  ? 638 LYS A CB  1 
ATOM   3240 C  CG  . LYS A 1 446 ? 50.025  21.617 28.773  1.00 88.31  ? 638 LYS A CG  1 
ATOM   3241 C  CD  . LYS A 1 446 ? 48.611  22.111 28.468  1.00 88.97  ? 638 LYS A CD  1 
ATOM   3242 C  CE  . LYS A 1 446 ? 47.901  21.242 27.448  1.00 88.51  ? 638 LYS A CE  1 
ATOM   3243 N  NZ  . LYS A 1 446 ? 46.554  21.778 27.152  1.00 89.43  ? 638 LYS A NZ  1 
ATOM   3244 N  N   . CYS A 1 447 ? 53.974  22.368 29.405  1.00 93.95  ? 639 CYS A N   1 
ATOM   3245 C  CA  . CYS A 1 447 ? 54.999  23.270 28.872  1.00 96.78  ? 639 CYS A CA  1 
ATOM   3246 C  C   . CYS A 1 447 ? 54.903  23.390 27.342  1.00 100.16 ? 639 CYS A C   1 
ATOM   3247 O  O   . CYS A 1 447 ? 55.320  22.484 26.611  1.00 96.05  ? 639 CYS A O   1 
ATOM   3248 C  CB  . CYS A 1 447 ? 56.390  22.863 29.354  1.00 95.65  ? 639 CYS A CB  1 
ATOM   3249 S  SG  . CYS A 1 447 ? 56.732  23.375 31.077  1.00 98.26  ? 639 CYS A SG  1 
ATOM   3250 N  N   . GLU A 1 448 ? 54.344  24.523 26.892  1.00 105.04 ? 640 GLU A N   1 
ATOM   3251 C  CA  . GLU A 1 448 ? 53.839  24.724 25.517  1.00 109.60 ? 640 GLU A CA  1 
ATOM   3252 C  C   . GLU A 1 448 ? 54.859  24.384 24.439  1.00 111.53 ? 640 GLU A C   1 
ATOM   3253 O  O   . GLU A 1 448 ? 54.538  23.614 23.533  1.00 115.08 ? 640 GLU A O   1 
ATOM   3254 C  CB  . GLU A 1 448 ? 53.265  26.135 25.311  1.00 113.80 ? 640 GLU A CB  1 
ATOM   3255 C  CG  . GLU A 1 448 ? 52.042  26.473 26.176  1.00 117.62 ? 640 GLU A CG  1 
ATOM   3256 C  CD  . GLU A 1 448 ? 50.728  25.962 25.606  1.00 119.84 ? 640 GLU A CD  1 
ATOM   3257 O  OE1 . GLU A 1 448 ? 50.302  26.448 24.535  1.00 121.59 ? 640 GLU A OE1 1 
ATOM   3258 O  OE2 . GLU A 1 448 ? 50.105  25.089 26.248  1.00 120.46 ? 640 GLU A OE2 1 
ATOM   3259 N  N   . PRO A 1 449 ? 56.059  25.008 24.485  1.00 111.89 ? 641 PRO A N   1 
ATOM   3260 C  CA  . PRO A 1 449 ? 57.257  24.337 23.954  1.00 108.91 ? 641 PRO A CA  1 
ATOM   3261 C  C   . PRO A 1 449 ? 57.939  23.581 25.096  1.00 106.68 ? 641 PRO A C   1 
ATOM   3262 O  O   . PRO A 1 449 ? 58.265  24.178 26.127  1.00 104.90 ? 641 PRO A O   1 
ATOM   3263 C  CB  . PRO A 1 449 ? 58.132  25.497 23.457  1.00 107.15 ? 641 PRO A CB  1 
ATOM   3264 C  CG  . PRO A 1 449 ? 57.531  26.766 24.059  1.00 110.26 ? 641 PRO A CG  1 
ATOM   3265 C  CD  . PRO A 1 449 ? 56.365  26.377 24.938  1.00 111.00 ? 641 PRO A CD  1 
ATOM   3266 N  N   . ALA A 1 450 ? 58.128  22.277 24.923  1.00 104.95 ? 642 ALA A N   1 
ATOM   3267 C  CA  . ALA A 1 450 ? 58.578  21.414 26.020  1.00 104.60 ? 642 ALA A CA  1 
ATOM   3268 C  C   . ALA A 1 450 ? 59.927  21.809 26.629  1.00 103.82 ? 642 ALA A C   1 
ATOM   3269 O  O   . ALA A 1 450 ? 60.749  22.457 25.975  1.00 103.02 ? 642 ALA A O   1 
ATOM   3270 C  CB  . ALA A 1 450 ? 58.602  19.962 25.570  1.00 106.56 ? 642 ALA A CB  1 
ATOM   3271 N  N   . CYS A 1 451 ? 60.138  21.424 27.888  1.00 104.28 ? 643 CYS A N   1 
ATOM   3272 C  CA  . CYS A 1 451 ? 61.427  21.634 28.559  1.00 101.82 ? 643 CYS A CA  1 
ATOM   3273 C  C   . CYS A 1 451 ? 62.472  20.726 27.933  1.00 98.90  ? 643 CYS A C   1 
ATOM   3274 O  O   . CYS A 1 451 ? 62.142  19.685 27.372  1.00 102.39 ? 643 CYS A O   1 
ATOM   3275 C  CB  . CYS A 1 451 ? 61.329  21.369 30.062  1.00 100.42 ? 643 CYS A CB  1 
ATOM   3276 S  SG  . CYS A 1 451 ? 60.007  22.279 30.883  1.00 101.58 ? 643 CYS A SG  1 
ATOM   3277 N  N   . ARG A 1 452 ? 63.730  21.130 28.025  1.00 95.91  ? 644 ARG A N   1 
ATOM   3278 C  CA  . ARG A 1 452 ? 64.809  20.424 27.349  1.00 94.10  ? 644 ARG A CA  1 
ATOM   3279 C  C   . ARG A 1 452 ? 65.909  19.986 28.308  1.00 90.40  ? 644 ARG A C   1 
ATOM   3280 O  O   . ARG A 1 452 ? 65.898  20.337 29.491  1.00 90.98  ? 644 ARG A O   1 
ATOM   3281 C  CB  . ARG A 1 452 ? 65.419  21.308 26.266  1.00 94.76  ? 644 ARG A CB  1 
ATOM   3282 C  CG  . ARG A 1 452 ? 64.525  21.611 25.107  1.00 95.32  ? 644 ARG A CG  1 
ATOM   3283 C  CD  . ARG A 1 452 ? 65.406  21.694 23.899  1.00 100.27 ? 644 ARG A CD  1 
ATOM   3284 N  NE  . ARG A 1 452 ? 64.867  22.538 22.843  1.00 102.33 ? 644 ARG A NE  1 
ATOM   3285 C  CZ  . ARG A 1 452 ? 65.610  23.063 21.875  1.00 103.01 ? 644 ARG A CZ  1 
ATOM   3286 N  NH1 . ARG A 1 452 ? 66.923  22.835 21.848  1.00 100.48 ? 644 ARG A NH1 1 
ATOM   3287 N  NH2 . ARG A 1 452 ? 65.043  23.818 20.940  1.00 103.32 ? 644 ARG A NH2 1 
ATOM   3288 N  N   . HIS A 1 453 ? 66.867  19.230 27.775  1.00 86.15  ? 645 HIS A N   1 
ATOM   3289 C  CA  . HIS A 1 453 ? 68.037  18.781 28.534  1.00 84.38  ? 645 HIS A CA  1 
ATOM   3290 C  C   . HIS A 1 453 ? 67.655  18.323 29.943  1.00 84.69  ? 645 HIS A C   1 
ATOM   3291 O  O   . HIS A 1 453 ? 68.289  18.693 30.930  1.00 85.81  ? 645 HIS A O   1 
ATOM   3292 C  CB  . HIS A 1 453 ? 69.122  19.869 28.570  1.00 80.30  ? 645 HIS A CB  1 
ATOM   3293 C  CG  . HIS A 1 453 ? 69.408  20.482 27.234  1.00 77.52  ? 645 HIS A CG  1 
ATOM   3294 N  ND1 . HIS A 1 453 ? 70.063  19.806 26.225  1.00 79.14  ? 645 HIS A ND1 1 
ATOM   3295 C  CD2 . HIS A 1 453 ? 69.128  21.709 26.740  1.00 75.75  ? 645 HIS A CD2 1 
ATOM   3296 C  CE1 . HIS A 1 453 ? 70.177  20.591 25.168  1.00 77.38  ? 645 HIS A CE1 1 
ATOM   3297 N  NE2 . HIS A 1 453 ? 69.617  21.752 25.456  1.00 78.12  ? 645 HIS A NE2 1 
ATOM   3298 N  N   . GLY A 1 454 ? 66.593  17.527 30.016  1.00 86.31  ? 646 GLY A N   1 
ATOM   3299 C  CA  . GLY A 1 454 ? 66.179  16.892 31.258  1.00 87.50  ? 646 GLY A CA  1 
ATOM   3300 C  C   . GLY A 1 454 ? 65.467  17.805 32.229  1.00 88.26  ? 646 GLY A C   1 
ATOM   3301 O  O   . GLY A 1 454 ? 65.344  17.471 33.407  1.00 89.99  ? 646 GLY A O   1 
ATOM   3302 N  N   . GLY A 1 455 ? 65.008  18.955 31.736  1.00 89.56  ? 647 GLY A N   1 
ATOM   3303 C  CA  . GLY A 1 455 ? 64.241  19.916 32.538  1.00 91.28  ? 647 GLY A CA  1 
ATOM   3304 C  C   . GLY A 1 455 ? 62.925  19.306 32.993  1.00 94.39  ? 647 GLY A C   1 
ATOM   3305 O  O   . GLY A 1 455 ? 62.485  18.294 32.439  1.00 95.92  ? 647 GLY A O   1 
ATOM   3306 N  N   . VAL A 1 456 ? 62.312  19.897 34.019  1.00 92.42  ? 648 VAL A N   1 
ATOM   3307 C  CA  . VAL A 1 456 ? 61.037  19.408 34.542  1.00 88.53  ? 648 VAL A CA  1 
ATOM   3308 C  C   . VAL A 1 456 ? 60.006  20.520 34.452  1.00 90.75  ? 648 VAL A C   1 
ATOM   3309 O  O   . VAL A 1 456 ? 60.280  21.643 34.867  1.00 92.49  ? 648 VAL A O   1 
ATOM   3310 C  CB  . VAL A 1 456 ? 61.150  18.921 36.010  1.00 83.47  ? 648 VAL A CB  1 
ATOM   3311 C  CG1 . VAL A 1 456 ? 59.796  18.521 36.537  1.00 83.85  ? 648 VAL A CG1 1 
ATOM   3312 C  CG2 . VAL A 1 456 ? 62.084  17.742 36.122  1.00 80.88  ? 648 VAL A CG2 1 
ATOM   3313 N  N   . CYS A 1 457 ? 58.835  20.206 33.897  1.00 90.77  ? 649 CYS A N   1 
ATOM   3314 C  CA  . CYS A 1 457 ? 57.724  21.154 33.837  1.00 89.03  ? 649 CYS A CA  1 
ATOM   3315 C  C   . CYS A 1 457 ? 57.007  21.156 35.181  1.00 89.20  ? 649 CYS A C   1 
ATOM   3316 O  O   . CYS A 1 457 ? 56.209  20.263 35.476  1.00 91.95  ? 649 CYS A O   1 
ATOM   3317 C  CB  . CYS A 1 457 ? 56.754  20.792 32.705  1.00 90.65  ? 649 CYS A CB  1 
ATOM   3318 S  SG  . CYS A 1 457 ? 55.598  22.119 32.224  1.00 93.98  ? 649 CYS A SG  1 
ATOM   3319 N  N   . VAL A 1 458 ? 57.300  22.163 35.996  1.00 88.30  ? 650 VAL A N   1 
ATOM   3320 C  CA  . VAL A 1 458 ? 56.763  22.248 37.357  1.00 87.95  ? 650 VAL A CA  1 
ATOM   3321 C  C   . VAL A 1 458 ? 55.417  22.979 37.449  1.00 87.68  ? 650 VAL A C   1 
ATOM   3322 O  O   . VAL A 1 458 ? 54.452  22.446 37.996  1.00 88.23  ? 650 VAL A O   1 
ATOM   3323 C  CB  . VAL A 1 458 ? 57.791  22.861 38.328  1.00 87.29  ? 650 VAL A CB  1 
ATOM   3324 C  CG1 . VAL A 1 458 ? 58.757  21.794 38.803  1.00 87.77  ? 650 VAL A CG1 1 
ATOM   3325 C  CG2 . VAL A 1 458 ? 58.545  24.004 37.661  1.00 87.26  ? 650 VAL A CG2 1 
ATOM   3326 N  N   . ARG A 1 459 ? 55.369  24.199 36.923  1.00 87.31  ? 651 ARG A N   1 
ATOM   3327 C  CA  . ARG A 1 459 ? 54.136  24.971 36.806  1.00 86.76  ? 651 ARG A CA  1 
ATOM   3328 C  C   . ARG A 1 459 ? 53.829  25.073 35.310  1.00 85.69  ? 651 ARG A C   1 
ATOM   3329 O  O   . ARG A 1 459 ? 54.644  24.635 34.499  1.00 86.21  ? 651 ARG A O   1 
ATOM   3330 C  CB  . ARG A 1 459 ? 54.320  26.360 37.430  1.00 86.43  ? 651 ARG A CB  1 
ATOM   3331 C  CG  . ARG A 1 459 ? 54.452  26.356 38.980  1.00 87.05  ? 651 ARG A CG  1 
ATOM   3332 C  CD  . ARG A 1 459 ? 55.013  27.781 39.396  1.00 89.50  ? 651 ARG A CD  1 
ATOM   3333 N  NE  . ARG A 1 459 ? 55.174  27.874 40.852  1.00 95.30  ? 651 ARG A NE  1 
ATOM   3334 C  CZ  . ARG A 1 459 ? 54.424  28.634 41.671  1.00 97.85  ? 651 ARG A CZ  1 
ATOM   3335 N  NH1 . ARG A 1 459 ? 53.434  29.394 41.196  1.00 97.96  ? 651 ARG A NH1 1 
ATOM   3336 N  NH2 . ARG A 1 459 ? 54.665  28.634 42.981  1.00 97.56  ? 651 ARG A NH2 1 
ATOM   3337 N  N   . PRO A 1 460 ? 52.658  25.624 34.926  1.00 86.41  ? 652 PRO A N   1 
ATOM   3338 C  CA  . PRO A 1 460 ? 52.422  25.767 33.487  1.00 86.87  ? 652 PRO A CA  1 
ATOM   3339 C  C   . PRO A 1 460 ? 53.437  26.706 32.845  1.00 88.55  ? 652 PRO A C   1 
ATOM   3340 O  O   . PRO A 1 460 ? 53.586  27.848 33.278  1.00 89.11  ? 652 PRO A O   1 
ATOM   3341 C  CB  . PRO A 1 460 ? 51.015  26.365 33.411  1.00 86.10  ? 652 PRO A CB  1 
ATOM   3342 C  CG  . PRO A 1 460 ? 50.397  26.072 34.729  1.00 86.26  ? 652 PRO A CG  1 
ATOM   3343 C  CD  . PRO A 1 460 ? 51.514  26.114 35.713  1.00 86.48  ? 652 PRO A CD  1 
ATOM   3344 N  N   . ASN A 1 461 ? 54.139  26.201 31.834  1.00 90.86  ? 653 ASN A N   1 
ATOM   3345 C  CA  . ASN A 1 461 ? 55.187  26.945 31.127  1.00 94.98  ? 653 ASN A CA  1 
ATOM   3346 C  C   . ASN A 1 461 ? 56.396  27.355 31.973  1.00 98.07  ? 653 ASN A C   1 
ATOM   3347 O  O   . ASN A 1 461 ? 57.137  28.265 31.601  1.00 101.45 ? 653 ASN A O   1 
ATOM   3348 C  CB  . ASN A 1 461 ? 54.609  28.148 30.369  1.00 95.47  ? 653 ASN A CB  1 
ATOM   3349 C  CG  . ASN A 1 461 ? 54.035  27.763 29.017  1.00 96.72  ? 653 ASN A CG  1 
ATOM   3350 O  OD1 . ASN A 1 461 ? 54.491  26.809 28.383  1.00 95.85  ? 653 ASN A OD1 1 
ATOM   3351 N  ND2 . ASN A 1 461 ? 53.030  28.511 28.565  1.00 98.35  ? 653 ASN A ND2 1 
ATOM   3352 N  N   . LYS A 1 462 ? 56.596  26.680 33.100  1.00 98.30  ? 654 LYS A N   1 
ATOM   3353 C  CA  . LYS A 1 462 ? 57.794  26.887 33.901  1.00 98.68  ? 654 LYS A CA  1 
ATOM   3354 C  C   . LYS A 1 462 ? 58.621  25.606 33.922  1.00 99.67  ? 654 LYS A C   1 
ATOM   3355 O  O   . LYS A 1 462 ? 58.113  24.535 34.265  1.00 100.92 ? 654 LYS A O   1 
ATOM   3356 C  CB  . LYS A 1 462 ? 57.433  27.341 35.315  1.00 97.63  ? 654 LYS A CB  1 
ATOM   3357 C  CG  . LYS A 1 462 ? 58.608  27.856 36.132  1.00 99.46  ? 654 LYS A CG  1 
ATOM   3358 C  CD  . LYS A 1 462 ? 58.110  28.472 37.430  1.00 104.28 ? 654 LYS A CD  1 
ATOM   3359 C  CE  . LYS A 1 462 ? 59.189  28.524 38.503  1.00 106.68 ? 654 LYS A CE  1 
ATOM   3360 N  NZ  . LYS A 1 462 ? 58.654  29.092 39.782  1.00 106.16 ? 654 LYS A NZ  1 
ATOM   3361 N  N   . CYS A 1 463 ? 59.887  25.720 33.527  1.00 98.43  ? 655 CYS A N   1 
ATOM   3362 C  CA  . CYS A 1 463 ? 60.802  24.582 33.514  1.00 96.20  ? 655 CYS A CA  1 
ATOM   3363 C  C   . CYS A 1 463 ? 61.792  24.664 34.666  1.00 95.65  ? 655 CYS A C   1 
ATOM   3364 O  O   . CYS A 1 463 ? 62.348  25.727 34.948  1.00 98.53  ? 655 CYS A O   1 
ATOM   3365 C  CB  . CYS A 1 463 ? 61.575  24.519 32.199  1.00 96.79  ? 655 CYS A CB  1 
ATOM   3366 S  SG  . CYS A 1 463 ? 60.582  24.222 30.727  1.00 99.62  ? 655 CYS A SG  1 
ATOM   3367 N  N   . LEU A 1 464 ? 62.009  23.540 35.335  1.00 92.49  ? 656 LEU A N   1 
ATOM   3368 C  CA  . LEU A 1 464 ? 63.055  23.460 36.331  1.00 89.86  ? 656 LEU A CA  1 
ATOM   3369 C  C   . LEU A 1 464 ? 64.267  22.798 35.682  1.00 94.54  ? 656 LEU A C   1 
ATOM   3370 O  O   . LEU A 1 464 ? 64.294  21.580 35.450  1.00 98.19  ? 656 LEU A O   1 
ATOM   3371 C  CB  . LEU A 1 464 ? 62.592  22.676 37.550  1.00 86.30  ? 656 LEU A CB  1 
ATOM   3372 C  CG  . LEU A 1 464 ? 63.115  23.145 38.905  1.00 85.44  ? 656 LEU A CG  1 
ATOM   3373 C  CD1 . LEU A 1 464 ? 62.910  22.031 39.910  1.00 88.06  ? 656 LEU A CD1 1 
ATOM   3374 C  CD2 . LEU A 1 464 ? 64.587  23.576 38.874  1.00 84.13  ? 656 LEU A CD2 1 
ATOM   3375 N  N   . CYS A 1 465 ? 65.273  23.614 35.397  1.00 93.43  ? 657 CYS A N   1 
ATOM   3376 C  CA  . CYS A 1 465 ? 66.428  23.163 34.650  1.00 93.20  ? 657 CYS A CA  1 
ATOM   3377 C  C   . CYS A 1 465 ? 67.521  22.576 35.535  1.00 93.58  ? 657 CYS A C   1 
ATOM   3378 O  O   . CYS A 1 465 ? 67.703  23.004 36.681  1.00 91.92  ? 657 CYS A O   1 
ATOM   3379 C  CB  . CYS A 1 465 ? 66.976  24.317 33.824  1.00 92.90  ? 657 CYS A CB  1 
ATOM   3380 S  SG  . CYS A 1 465 ? 65.709  25.081 32.803  1.00 95.62  ? 657 CYS A SG  1 
ATOM   3381 N  N   . LYS A 1 466 ? 68.236  21.589 34.990  1.00 92.03  ? 658 LYS A N   1 
ATOM   3382 C  CA  . LYS A 1 466 ? 69.435  21.051 35.624  1.00 87.69  ? 658 LYS A CA  1 
ATOM   3383 C  C   . LYS A 1 466 ? 70.571  22.068 35.489  1.00 85.29  ? 658 LYS A C   1 
ATOM   3384 O  O   . LYS A 1 466 ? 70.575  22.882 34.558  1.00 86.04  ? 658 LYS A O   1 
ATOM   3385 C  CB  . LYS A 1 466 ? 69.830  19.718 34.993  1.00 88.02  ? 658 LYS A CB  1 
ATOM   3386 C  CG  . LYS A 1 466 ? 68.715  18.680 34.926  1.00 88.62  ? 658 LYS A CG  1 
ATOM   3387 C  CD  . LYS A 1 466 ? 68.463  17.997 36.276  1.00 90.05  ? 658 LYS A CD  1 
ATOM   3388 C  CE  . LYS A 1 466 ? 67.216  17.094 36.220  1.00 89.57  ? 658 LYS A CE  1 
ATOM   3389 N  NZ  . LYS A 1 466 ? 65.966  17.879 35.952  1.00 87.91  ? 658 LYS A NZ  1 
ATOM   3390 N  N   . LYS A 1 467 ? 71.520  22.029 36.424  1.00 82.39  ? 659 LYS A N   1 
ATOM   3391 C  CA  . LYS A 1 467 ? 72.612  23.000 36.474  1.00 78.09  ? 659 LYS A CA  1 
ATOM   3392 C  C   . LYS A 1 467 ? 73.319  23.086 35.126  1.00 79.88  ? 659 LYS A C   1 
ATOM   3393 O  O   . LYS A 1 467 ? 73.626  22.065 34.503  1.00 82.32  ? 659 LYS A O   1 
ATOM   3394 C  CB  . LYS A 1 467 ? 73.598  22.623 37.574  1.00 75.77  ? 659 LYS A CB  1 
ATOM   3395 C  CG  . LYS A 1 467 ? 74.419  23.769 38.143  1.00 76.33  ? 659 LYS A CG  1 
ATOM   3396 C  CD  . LYS A 1 467 ? 75.309  23.259 39.274  1.00 77.03  ? 659 LYS A CD  1 
ATOM   3397 C  CE  . LYS A 1 467 ? 76.538  24.129 39.446  1.00 79.80  ? 659 LYS A CE  1 
ATOM   3398 N  NZ  . LYS A 1 467 ? 77.746  23.325 39.833  1.00 80.85  ? 659 LYS A NZ  1 
ATOM   3399 N  N   . GLY A 1 468 ? 73.546  24.311 34.665  1.00 80.76  ? 660 GLY A N   1 
ATOM   3400 C  CA  . GLY A 1 468 ? 74.258  24.537 33.410  1.00 79.92  ? 660 GLY A CA  1 
ATOM   3401 C  C   . GLY A 1 468 ? 73.385  24.503 32.171  1.00 79.21  ? 660 GLY A C   1 
ATOM   3402 O  O   . GLY A 1 468 ? 73.895  24.404 31.058  1.00 78.05  ? 660 GLY A O   1 
ATOM   3403 N  N   . TYR A 1 469 ? 72.070  24.561 32.360  1.00 79.91  ? 661 TYR A N   1 
ATOM   3404 C  CA  . TYR A 1 469 ? 71.153  24.754 31.247  1.00 82.54  ? 661 TYR A CA  1 
ATOM   3405 C  C   . TYR A 1 469 ? 70.243  25.928 31.547  1.00 88.30  ? 661 TYR A C   1 
ATOM   3406 O  O   . TYR A 1 469 ? 69.439  25.882 32.474  1.00 94.04  ? 661 TYR A O   1 
ATOM   3407 C  CB  . TYR A 1 469 ? 70.373  23.477 30.922  1.00 80.40  ? 661 TYR A CB  1 
ATOM   3408 C  CG  . TYR A 1 469 ? 71.288  22.369 30.469  1.00 80.45  ? 661 TYR A CG  1 
ATOM   3409 C  CD1 . TYR A 1 469 ? 71.757  21.420 31.376  1.00 79.18  ? 661 TYR A CD1 1 
ATOM   3410 C  CD2 . TYR A 1 469 ? 71.729  22.293 29.142  1.00 80.22  ? 661 TYR A CD2 1 
ATOM   3411 C  CE1 . TYR A 1 469 ? 72.619  20.414 30.979  1.00 81.81  ? 661 TYR A CE1 1 
ATOM   3412 C  CE2 . TYR A 1 469 ? 72.602  21.282 28.729  1.00 80.00  ? 661 TYR A CE2 1 
ATOM   3413 C  CZ  . TYR A 1 469 ? 73.044  20.349 29.659  1.00 82.36  ? 661 TYR A CZ  1 
ATOM   3414 O  OH  . TYR A 1 469 ? 73.908  19.341 29.295  1.00 82.56  ? 661 TYR A OH  1 
ATOM   3415 N  N   . LEU A 1 470 ? 70.397  26.987 30.761  1.00 88.35  ? 662 LEU A N   1 
ATOM   3416 C  CA  . LEU A 1 470 ? 69.681  28.231 30.989  1.00 89.04  ? 662 LEU A CA  1 
ATOM   3417 C  C   . LEU A 1 470 ? 68.609  28.461 29.925  1.00 87.84  ? 662 LEU A C   1 
ATOM   3418 O  O   . LEU A 1 470 ? 68.577  27.767 28.905  1.00 86.21  ? 662 LEU A O   1 
ATOM   3419 C  CB  . LEU A 1 470 ? 70.665  29.411 31.035  1.00 91.76  ? 662 LEU A CB  1 
ATOM   3420 C  CG  . LEU A 1 470 ? 71.856  29.296 31.995  1.00 93.76  ? 662 LEU A CG  1 
ATOM   3421 C  CD1 . LEU A 1 470 ? 73.135  28.906 31.253  1.00 93.98  ? 662 LEU A CD1 1 
ATOM   3422 C  CD2 . LEU A 1 470 ? 72.062  30.598 32.744  1.00 94.89  ? 662 LEU A CD2 1 
ATOM   3423 N  N   . GLY A 1 471 ? 67.735  29.435 30.179  1.00 88.14  ? 663 GLY A N   1 
ATOM   3424 C  CA  . GLY A 1 471 ? 66.649  29.785 29.269  1.00 87.34  ? 663 GLY A CA  1 
ATOM   3425 C  C   . GLY A 1 471 ? 65.308  29.203 29.686  1.00 87.46  ? 663 GLY A C   1 
ATOM   3426 O  O   . GLY A 1 471 ? 65.259  28.276 30.496  1.00 85.34  ? 663 GLY A O   1 
ATOM   3427 N  N   . PRO A 1 472 ? 64.208  29.740 29.125  1.00 88.60  ? 664 PRO A N   1 
ATOM   3428 C  CA  . PRO A 1 472 ? 62.836  29.310 29.417  1.00 89.78  ? 664 PRO A CA  1 
ATOM   3429 C  C   . PRO A 1 472 ? 62.558  27.810 29.246  1.00 92.75  ? 664 PRO A C   1 
ATOM   3430 O  O   . PRO A 1 472 ? 61.604  27.306 29.841  1.00 96.09  ? 664 PRO A O   1 
ATOM   3431 C  CB  . PRO A 1 472 ? 61.993  30.119 28.423  1.00 88.57  ? 664 PRO A CB  1 
ATOM   3432 C  CG  . PRO A 1 472 ? 62.951  30.632 27.410  1.00 89.29  ? 664 PRO A CG  1 
ATOM   3433 C  CD  . PRO A 1 472 ? 64.224  30.840 28.149  1.00 89.09  ? 664 PRO A CD  1 
ATOM   3434 N  N   . GLN A 1 473 ? 63.362  27.111 28.445  1.00 91.58  ? 665 GLN A N   1 
ATOM   3435 C  CA  . GLN A 1 473 ? 63.205  25.663 28.266  1.00 89.25  ? 665 GLN A CA  1 
ATOM   3436 C  C   . GLN A 1 473 ? 64.510  24.912 28.514  1.00 92.14  ? 665 GLN A C   1 
ATOM   3437 O  O   . GLN A 1 473 ? 64.635  23.740 28.158  1.00 93.53  ? 665 GLN A O   1 
ATOM   3438 C  CB  . GLN A 1 473 ? 62.682  25.326 26.867  1.00 87.59  ? 665 GLN A CB  1 
ATOM   3439 C  CG  . GLN A 1 473 ? 61.215  25.635 26.637  1.00 88.07  ? 665 GLN A CG  1 
ATOM   3440 C  CD  . GLN A 1 473 ? 60.953  27.104 26.334  1.00 86.73  ? 665 GLN A CD  1 
ATOM   3441 O  OE1 . GLN A 1 473 ? 61.418  27.639 25.327  1.00 85.15  ? 665 GLN A OE1 1 
ATOM   3442 N  NE2 . GLN A 1 473 ? 60.194  27.760 27.208  1.00 85.73  ? 665 GLN A NE2 1 
ATOM   3443 N  N   . CYS A 1 474 ? 65.476  25.583 29.137  1.00 93.75  ? 666 CYS A N   1 
ATOM   3444 C  CA  . CYS A 1 474 ? 66.780  24.986 29.437  1.00 92.71  ? 666 CYS A CA  1 
ATOM   3445 C  C   . CYS A 1 474 ? 67.525  24.657 28.149  1.00 91.62  ? 666 CYS A C   1 
ATOM   3446 O  O   . CYS A 1 474 ? 68.271  23.680 28.097  1.00 90.68  ? 666 CYS A O   1 
ATOM   3447 C  CB  . CYS A 1 474 ? 66.620  23.707 30.267  1.00 93.43  ? 666 CYS A CB  1 
ATOM   3448 S  SG  . CYS A 1 474 ? 65.217  23.687 31.396  1.00 96.15  ? 666 CYS A SG  1 
ATOM   3449 N  N   . GLU A 1 475 ? 67.321  25.470 27.115  1.00 91.03  ? 667 GLU A N   1 
ATOM   3450 C  CA  . GLU A 1 475 ? 67.820  25.146 25.778  1.00 93.09  ? 667 GLU A CA  1 
ATOM   3451 C  C   . GLU A 1 475 ? 69.261  25.584 25.533  1.00 94.90  ? 667 GLU A C   1 
ATOM   3452 O  O   . GLU A 1 475 ? 69.814  25.320 24.470  1.00 95.41  ? 667 GLU A O   1 
ATOM   3453 C  CB  . GLU A 1 475 ? 66.877  25.688 24.686  1.00 93.19  ? 667 GLU A CB  1 
ATOM   3454 C  CG  . GLU A 1 475 ? 66.828  27.215 24.536  1.00 94.08  ? 667 GLU A CG  1 
ATOM   3455 C  CD  . GLU A 1 475 ? 65.826  27.898 25.468  1.00 94.72  ? 667 GLU A CD  1 
ATOM   3456 O  OE1 . GLU A 1 475 ? 65.506  27.342 26.544  1.00 93.89  ? 667 GLU A OE1 1 
ATOM   3457 O  OE2 . GLU A 1 475 ? 65.366  29.011 25.119  1.00 94.50  ? 667 GLU A OE2 1 
ATOM   3458 N  N   . HIS A 1 476 ? 69.866  26.240 26.520  1.00 99.12  ? 668 HIS A N   1 
ATOM   3459 C  CA  . HIS A 1 476 ? 71.194  26.818 26.354  1.00 104.55 ? 668 HIS A CA  1 
ATOM   3460 C  C   . HIS A 1 476 ? 72.226  26.249 27.303  1.00 106.68 ? 668 HIS A C   1 
ATOM   3461 O  O   . HIS A 1 476 ? 71.927  25.974 28.458  1.00 105.33 ? 668 HIS A O   1 
ATOM   3462 C  CB  . HIS A 1 476 ? 71.140  28.334 26.523  1.00 109.43 ? 668 HIS A CB  1 
ATOM   3463 C  CG  . HIS A 1 476 ? 70.538  29.049 25.357  1.00 113.00 ? 668 HIS A CG  1 
ATOM   3464 N  ND1 . HIS A 1 476 ? 69.845  30.233 25.488  1.00 115.21 ? 668 HIS A ND1 1 
ATOM   3465 C  CD2 . HIS A 1 476 ? 70.516  28.742 24.038  1.00 114.43 ? 668 HIS A CD2 1 
ATOM   3466 C  CE1 . HIS A 1 476 ? 69.432  30.631 24.298  1.00 116.86 ? 668 HIS A CE1 1 
ATOM   3467 N  NE2 . HIS A 1 476 ? 69.822  29.742 23.401  1.00 116.57 ? 668 HIS A NE2 1 
ATOM   3468 N  N   . HIS A 1 477 ? 73.449  26.100 26.804  1.00 112.88 ? 669 HIS A N   1 
ATOM   3469 C  CA  . HIS A 1 477 ? 74.557  25.586 27.593  1.00 121.22 ? 669 HIS A CA  1 
ATOM   3470 C  C   . HIS A 1 477 ? 75.887  26.181 27.134  1.00 127.11 ? 669 HIS A C   1 
ATOM   3471 O  O   . HIS A 1 477 ? 76.250  26.065 25.963  1.00 130.09 ? 669 HIS A O   1 
ATOM   3472 C  CB  . HIS A 1 477 ? 74.593  24.052 27.513  1.00 122.94 ? 669 HIS A CB  1 
ATOM   3473 C  CG  . HIS A 1 477 ? 75.834  23.439 28.091  1.00 126.14 ? 669 HIS A CG  1 
ATOM   3474 N  ND1 . HIS A 1 477 ? 75.997  23.206 29.440  1.00 126.88 ? 669 HIS A ND1 1 
ATOM   3475 C  CD2 . HIS A 1 477 ? 76.972  23.010 27.495  1.00 127.62 ? 669 HIS A CD2 1 
ATOM   3476 C  CE1 . HIS A 1 477 ? 77.185  22.665 29.651  1.00 127.59 ? 669 HIS A CE1 1 
ATOM   3477 N  NE2 . HIS A 1 477 ? 77.796  22.535 28.487  1.00 128.24 ? 669 HIS A NE2 1 
ATOM   3478 N  N   . HIS A 1 478 ? 76.583  26.835 28.064  1.00 132.23 ? 670 HIS A N   1 
ATOM   3479 C  CA  . HIS A 1 478 ? 78.003  27.227 27.935  1.00 137.03 ? 670 HIS A CA  1 
ATOM   3480 C  C   . HIS A 1 478 ? 78.345  28.312 28.954  1.00 138.31 ? 670 HIS A C   1 
ATOM   3481 O  O   . HIS A 1 478 ? 77.770  28.346 30.046  1.00 138.70 ? 670 HIS A O   1 
ATOM   3482 C  CB  . HIS A 1 478 ? 78.419  27.640 26.503  1.00 139.36 ? 670 HIS A CB  1 
ATOM   3483 C  CG  . HIS A 1 478 ? 77.694  28.839 25.965  1.00 142.66 ? 670 HIS A CG  1 
ATOM   3484 N  ND1 . HIS A 1 478 ? 76.757  28.751 24.956  1.00 143.66 ? 670 HIS A ND1 1 
ATOM   3485 C  CD2 . HIS A 1 478 ? 77.781  30.153 26.283  1.00 143.93 ? 670 HIS A CD2 1 
ATOM   3486 C  CE1 . HIS A 1 478 ? 76.292  29.958 24.684  1.00 144.37 ? 670 HIS A CE1 1 
ATOM   3487 N  NE2 . HIS A 1 478 ? 76.896  30.826 25.475  1.00 144.49 ? 670 HIS A NE2 1 
ATOM   3488 N  N   . HIS B 1 22  ? 14.027  6.972  73.619  1.00 121.99 ? 214 HIS B N   1 
ATOM   3489 C  CA  . HIS B 1 22  ? 13.898  6.236  74.915  1.00 120.58 ? 214 HIS B CA  1 
ATOM   3490 C  C   . HIS B 1 22  ? 12.817  6.813  75.839  1.00 113.99 ? 214 HIS B C   1 
ATOM   3491 O  O   . HIS B 1 22  ? 11.731  7.186  75.382  1.00 111.97 ? 214 HIS B O   1 
ATOM   3492 C  CB  . HIS B 1 22  ? 15.255  6.104  75.644  1.00 125.72 ? 214 HIS B CB  1 
ATOM   3493 C  CG  . HIS B 1 22  ? 16.318  7.046  75.161  1.00 129.18 ? 214 HIS B CG  1 
ATOM   3494 N  ND1 . HIS B 1 22  ? 17.604  6.630  74.881  1.00 130.86 ? 214 HIS B ND1 1 
ATOM   3495 C  CD2 . HIS B 1 22  ? 16.290  8.379  74.909  1.00 130.51 ? 214 HIS B CD2 1 
ATOM   3496 C  CE1 . HIS B 1 22  ? 18.322  7.664  74.479  1.00 131.54 ? 214 HIS B CE1 1 
ATOM   3497 N  NE2 . HIS B 1 22  ? 17.547  8.736  74.484  1.00 131.49 ? 214 HIS B NE2 1 
ATOM   3498 N  N   . ASN B 1 23  ? 13.121  6.875  77.134  1.00 106.99 ? 215 ASN B N   1 
ATOM   3499 C  CA  . ASN B 1 23  ? 12.148  7.279  78.144  1.00 101.17 ? 215 ASN B CA  1 
ATOM   3500 C  C   . ASN B 1 23  ? 12.482  8.624  78.780  1.00 95.40  ? 215 ASN B C   1 
ATOM   3501 O  O   . ASN B 1 23  ? 11.967  8.967  79.845  1.00 89.80  ? 215 ASN B O   1 
ATOM   3502 C  CB  . ASN B 1 23  ? 12.032  6.194  79.220  1.00 100.59 ? 215 ASN B CB  1 
ATOM   3503 C  CG  . ASN B 1 23  ? 11.661  4.839  78.650  1.00 98.63  ? 215 ASN B CG  1 
ATOM   3504 O  OD1 . ASN B 1 23  ? 11.025  4.736  77.598  1.00 96.60  ? 215 ASN B OD1 1 
ATOM   3505 N  ND2 . ASN B 1 23  ? 12.055  3.787  79.349  1.00 100.40 ? 215 ASN B ND2 1 
ATOM   3506 N  N   . CYS B 1 24  ? 13.349  9.377  78.113  1.00 94.41  ? 216 CYS B N   1 
ATOM   3507 C  CA  . CYS B 1 24  ? 13.798  10.667 78.614  1.00 91.69  ? 216 CYS B CA  1 
ATOM   3508 C  C   . CYS B 1 24  ? 12.702  11.705 78.564  1.00 88.58  ? 216 CYS B C   1 
ATOM   3509 O  O   . CYS B 1 24  ? 11.798  11.638 77.730  1.00 90.34  ? 216 CYS B O   1 
ATOM   3510 C  CB  . CYS B 1 24  ? 14.999  11.170 77.819  1.00 94.68  ? 216 CYS B CB  1 
ATOM   3511 S  SG  . CYS B 1 24  ? 16.586  10.417 78.238  1.00 100.32 ? 216 CYS B SG  1 
ATOM   3512 N  N   . PHE B 1 25  ? 12.798  12.663 79.474  1.00 84.48  ? 217 PHE B N   1 
ATOM   3513 C  CA  . PHE B 1 25  ? 11.909  13.799 79.494  1.00 82.89  ? 217 PHE B CA  1 
ATOM   3514 C  C   . PHE B 1 25  ? 12.589  15.017 78.870  1.00 86.58  ? 217 PHE B C   1 
ATOM   3515 O  O   . PHE B 1 25  ? 13.716  14.948 78.387  1.00 89.22  ? 217 PHE B O   1 
ATOM   3516 C  CB  . PHE B 1 25  ? 11.450  14.078 80.924  1.00 82.23  ? 217 PHE B CB  1 
ATOM   3517 C  CG  . PHE B 1 25  ? 10.339  13.186 81.380  1.00 81.29  ? 217 PHE B CG  1 
ATOM   3518 C  CD1 . PHE B 1 25  ? 10.597  11.884 81.790  1.00 81.66  ? 217 PHE B CD1 1 
ATOM   3519 C  CD2 . PHE B 1 25  ? 9.025   13.645 81.392  1.00 82.13  ? 217 PHE B CD2 1 
ATOM   3520 C  CE1 . PHE B 1 25  ? 9.568   11.050 82.203  1.00 82.02  ? 217 PHE B CE1 1 
ATOM   3521 C  CE2 . PHE B 1 25  ? 7.989   12.823 81.803  1.00 82.86  ? 217 PHE B CE2 1 
ATOM   3522 C  CZ  . PHE B 1 25  ? 8.262   11.517 82.208  1.00 83.42  ? 217 PHE B CZ  1 
ATOM   3523 N  N   . CYS B 1 26  ? 11.910  16.147 78.933  1.00 90.97  ? 218 CYS B N   1 
ATOM   3524 C  CA  . CYS B 1 26  ? 12.138  17.239 78.019  1.00 91.84  ? 218 CYS B CA  1 
ATOM   3525 C  C   . CYS B 1 26  ? 11.939  18.562 78.759  1.00 93.48  ? 218 CYS B C   1 
ATOM   3526 O  O   . CYS B 1 26  ? 11.020  18.673 79.584  1.00 94.10  ? 218 CYS B O   1 
ATOM   3527 C  CB  . CYS B 1 26  ? 11.052  17.104 76.969  1.00 93.98  ? 218 CYS B CB  1 
ATOM   3528 S  SG  . CYS B 1 26  ? 11.452  17.675 75.408  1.00 97.18  ? 218 CYS B SG  1 
ATOM   3529 N  N   . ILE B 1 27  ? 12.775  19.562 78.486  1.00 92.27  ? 219 ILE B N   1 
ATOM   3530 C  CA  . ILE B 1 27  ? 12.498  20.917 79.014  1.00 94.43  ? 219 ILE B CA  1 
ATOM   3531 C  C   . ILE B 1 27  ? 12.328  21.976 77.953  1.00 90.49  ? 219 ILE B C   1 
ATOM   3532 O  O   . ILE B 1 27  ? 13.033  21.982 76.942  1.00 90.78  ? 219 ILE B O   1 
ATOM   3533 C  CB  . ILE B 1 27  ? 13.511  21.424 80.068  1.00 96.91  ? 219 ILE B CB  1 
ATOM   3534 C  CG1 . ILE B 1 27  ? 14.898  20.892 79.768  1.00 100.71 ? 219 ILE B CG1 1 
ATOM   3535 C  CG2 . ILE B 1 27  ? 13.046  21.062 81.474  1.00 99.16  ? 219 ILE B CG2 1 
ATOM   3536 C  CD1 . ILE B 1 27  ? 15.613  20.376 80.974  1.00 106.93 ? 219 ILE B CD1 1 
ATOM   3537 N  N   . GLN B 1 28  ? 11.383  22.876 78.213  1.00 87.93  ? 220 GLN B N   1 
ATOM   3538 C  CA  . GLN B 1 28  ? 11.059  23.960 77.301  1.00 87.07  ? 220 GLN B CA  1 
ATOM   3539 C  C   . GLN B 1 28  ? 11.079  25.310 78.033  1.00 87.30  ? 220 GLN B C   1 
ATOM   3540 O  O   . GLN B 1 28  ? 10.464  25.456 79.089  1.00 90.27  ? 220 GLN B O   1 
ATOM   3541 C  CB  . GLN B 1 28  ? 9.699   23.699 76.664  1.00 86.08  ? 220 GLN B CB  1 
ATOM   3542 C  CG  . GLN B 1 28  ? 9.446   24.504 75.420  1.00 93.67  ? 220 GLN B CG  1 
ATOM   3543 C  CD  . GLN B 1 28  ? 10.025  23.858 74.190  1.00 100.49 ? 220 GLN B CD  1 
ATOM   3544 O  OE1 . GLN B 1 28  ? 9.538   22.818 73.742  1.00 102.56 ? 220 GLN B OE1 1 
ATOM   3545 N  NE2 . GLN B 1 28  ? 11.068  24.474 73.622  1.00 104.41 ? 220 GLN B NE2 1 
ATOM   3546 N  N   . GLU B 1 29  ? 11.806  26.284 77.485  1.00 87.68  ? 221 GLU B N   1 
ATOM   3547 C  CA  . GLU B 1 29  ? 11.888  27.612 78.098  1.00 85.81  ? 221 GLU B CA  1 
ATOM   3548 C  C   . GLU B 1 29  ? 10.551  28.327 77.941  1.00 86.07  ? 221 GLU B C   1 
ATOM   3549 O  O   . GLU B 1 29  ? 10.036  28.430 76.827  1.00 88.44  ? 221 GLU B O   1 
ATOM   3550 C  CB  . GLU B 1 29  ? 13.018  28.434 77.486  1.00 80.91  ? 221 GLU B CB  1 
ATOM   3551 C  CG  . GLU B 1 29  ? 13.362  29.691 78.264  1.00 82.26  ? 221 GLU B CG  1 
ATOM   3552 C  CD  . GLU B 1 29  ? 14.205  30.674 77.460  1.00 89.09  ? 221 GLU B CD  1 
ATOM   3553 O  OE1 . GLU B 1 29  ? 15.274  30.269 76.961  1.00 91.31  ? 221 GLU B OE1 1 
ATOM   3554 O  OE2 . GLU B 1 29  ? 13.812  31.860 77.335  1.00 94.07  ? 221 GLU B OE2 1 
ATOM   3555 N  N   . VAL B 1 30  ? 9.990   28.797 79.057  1.00 82.92  ? 222 VAL B N   1 
ATOM   3556 C  CA  . VAL B 1 30  ? 8.671   29.426 79.055  1.00 82.80  ? 222 VAL B CA  1 
ATOM   3557 C  C   . VAL B 1 30  ? 8.785   30.937 79.108  1.00 88.53  ? 222 VAL B C   1 
ATOM   3558 O  O   . VAL B 1 30  ? 8.088   31.644 78.377  1.00 96.02  ? 222 VAL B O   1 
ATOM   3559 C  CB  . VAL B 1 30  ? 7.806   28.962 80.243  1.00 81.71  ? 222 VAL B CB  1 
ATOM   3560 C  CG1 . VAL B 1 30  ? 6.444   29.626 80.186  1.00 77.42  ? 222 VAL B CG1 1 
ATOM   3561 C  CG2 . VAL B 1 30  ? 7.668   27.436 80.261  1.00 83.73  ? 222 VAL B CG2 1 
ATOM   3562 N  N   . VAL B 1 31  ? 9.660   31.417 79.990  1.00 88.60  ? 223 VAL B N   1 
ATOM   3563 C  CA  . VAL B 1 31  ? 9.866   32.838 80.241  1.00 85.94  ? 223 VAL B CA  1 
ATOM   3564 C  C   . VAL B 1 31  ? 11.311  33.045 80.688  1.00 86.97  ? 223 VAL B C   1 
ATOM   3565 O  O   . VAL B 1 31  ? 11.903  32.168 81.326  1.00 85.49  ? 223 VAL B O   1 
ATOM   3566 C  CB  . VAL B 1 31  ? 8.883   33.356 81.332  1.00 85.63  ? 223 VAL B CB  1 
ATOM   3567 C  CG1 . VAL B 1 31  ? 9.450   34.548 82.107  1.00 83.16  ? 223 VAL B CG1 1 
ATOM   3568 C  CG2 . VAL B 1 31  ? 7.544   33.721 80.724  1.00 86.78  ? 223 VAL B CG2 1 
ATOM   3569 N  N   . SER B 1 32  ? 11.878  34.196 80.337  1.00 87.11  ? 224 SER B N   1 
ATOM   3570 C  CA  . SER B 1 32  ? 13.141  34.617 80.911  1.00 86.14  ? 224 SER B CA  1 
ATOM   3571 C  C   . SER B 1 32  ? 13.037  36.039 81.446  1.00 89.37  ? 224 SER B C   1 
ATOM   3572 O  O   . SER B 1 32  ? 11.953  36.500 81.782  1.00 92.39  ? 224 SER B O   1 
ATOM   3573 C  CB  . SER B 1 32  ? 14.270  34.477 79.901  1.00 87.08  ? 224 SER B CB  1 
ATOM   3574 O  OG  . SER B 1 32  ? 14.159  35.437 78.882  1.00 92.05  ? 224 SER B OG  1 
ATOM   3575 N  N   . GLY B 1 33  ? 14.169  36.725 81.560  1.00 92.17  ? 225 GLY B N   1 
ATOM   3576 C  CA  . GLY B 1 33  ? 14.196  38.074 82.111  1.00 90.13  ? 225 GLY B CA  1 
ATOM   3577 C  C   . GLY B 1 33  ? 13.802  38.185 83.572  1.00 90.72  ? 225 GLY B C   1 
ATOM   3578 O  O   . GLY B 1 33  ? 13.696  39.283 84.098  1.00 97.08  ? 225 GLY B O   1 
ATOM   3579 N  N   . LEU B 1 34  ? 13.573  37.055 84.229  1.00 91.11  ? 226 LEU B N   1 
ATOM   3580 C  CA  . LEU B 1 34  ? 13.263  37.035 85.656  1.00 91.61  ? 226 LEU B CA  1 
ATOM   3581 C  C   . LEU B 1 34  ? 14.505  37.371 86.486  1.00 93.43  ? 226 LEU B C   1 
ATOM   3582 O  O   . LEU B 1 34  ? 15.641  37.216 86.021  1.00 94.81  ? 226 LEU B O   1 
ATOM   3583 C  CB  . LEU B 1 34  ? 12.723  35.659 86.068  1.00 91.46  ? 226 LEU B CB  1 
ATOM   3584 C  CG  . LEU B 1 34  ? 11.508  35.128 85.307  1.00 91.53  ? 226 LEU B CG  1 
ATOM   3585 C  CD1 . LEU B 1 34  ? 11.382  33.648 85.524  1.00 91.50  ? 226 LEU B CD1 1 
ATOM   3586 C  CD2 . LEU B 1 34  ? 10.229  35.844 85.721  1.00 92.02  ? 226 LEU B CD2 1 
ATOM   3587 N  N   . ARG B 1 35  ? 14.291  37.832 87.712  1.00 89.72  ? 227 ARG B N   1 
ATOM   3588 C  CA  . ARG B 1 35  ? 15.403  38.096 88.598  1.00 92.13  ? 227 ARG B CA  1 
ATOM   3589 C  C   . ARG B 1 35  ? 15.343  37.179 89.795  1.00 93.52  ? 227 ARG B C   1 
ATOM   3590 O  O   . ARG B 1 35  ? 14.437  37.285 90.612  1.00 97.98  ? 227 ARG B O   1 
ATOM   3591 C  CB  . ARG B 1 35  ? 15.444  39.562 89.034  1.00 94.40  ? 227 ARG B CB  1 
ATOM   3592 C  CG  . ARG B 1 35  ? 14.142  40.300 88.884  1.00 95.23  ? 227 ARG B CG  1 
ATOM   3593 C  CD  . ARG B 1 35  ? 14.039  41.436 89.858  1.00 97.37  ? 227 ARG B CD  1 
ATOM   3594 N  NE  . ARG B 1 35  ? 12.651  41.869 89.962  1.00 102.63 ? 227 ARG B NE  1 
ATOM   3595 C  CZ  . ARG B 1 35  ? 12.207  43.079 89.641  1.00 106.10 ? 227 ARG B CZ  1 
ATOM   3596 N  NH1 . ARG B 1 35  ? 13.048  44.014 89.212  1.00 107.91 ? 227 ARG B NH1 1 
ATOM   3597 N  NH2 . ARG B 1 35  ? 10.915  43.360 89.771  1.00 108.00 ? 227 ARG B NH2 1 
ATOM   3598 N  N   . GLN B 1 36  ? 16.330  36.292 89.894  1.00 92.64  ? 228 GLN B N   1 
ATOM   3599 C  CA  . GLN B 1 36  ? 16.385  35.274 90.940  1.00 89.26  ? 228 GLN B CA  1 
ATOM   3600 C  C   . GLN B 1 36  ? 15.024  34.675 91.277  1.00 88.61  ? 228 GLN B C   1 
ATOM   3601 O  O   . GLN B 1 36  ? 14.451  34.959 92.334  1.00 86.33  ? 228 GLN B O   1 
ATOM   3602 C  CB  . GLN B 1 36  ? 17.084  35.793 92.184  1.00 89.30  ? 228 GLN B CB  1 
ATOM   3603 C  CG  . GLN B 1 36  ? 18.572  35.607 92.115  1.00 96.55  ? 228 GLN B CG  1 
ATOM   3604 C  CD  . GLN B 1 36  ? 19.256  35.938 93.417  1.00 101.21 ? 228 GLN B CD  1 
ATOM   3605 O  OE1 . GLN B 1 36  ? 19.333  37.110 93.820  1.00 98.96  ? 228 GLN B OE1 1 
ATOM   3606 N  NE2 . GLN B 1 36  ? 19.763  34.902 94.091  1.00 103.58 ? 228 GLN B NE2 1 
ATOM   3607 N  N   . PRO B 1 37  ? 14.503  33.838 90.368  1.00 89.51  ? 229 PRO B N   1 
ATOM   3608 C  CA  . PRO B 1 37  ? 13.267  33.138 90.627  1.00 90.65  ? 229 PRO B CA  1 
ATOM   3609 C  C   . PRO B 1 37  ? 13.494  32.195 91.779  1.00 94.32  ? 229 PRO B C   1 
ATOM   3610 O  O   . PRO B 1 37  ? 14.603  31.668 91.943  1.00 96.70  ? 229 PRO B O   1 
ATOM   3611 C  CB  . PRO B 1 37  ? 13.039  32.348 89.345  1.00 93.04  ? 229 PRO B CB  1 
ATOM   3612 C  CG  . PRO B 1 37  ? 14.380  32.202 88.746  1.00 96.74  ? 229 PRO B CG  1 
ATOM   3613 C  CD  . PRO B 1 37  ? 15.060  33.488 89.053  1.00 93.27  ? 229 PRO B CD  1 
ATOM   3614 N  N   . VAL B 1 38  ? 12.453  31.996 92.577  1.00 93.84  ? 230 VAL B N   1 
ATOM   3615 C  CA  . VAL B 1 38  ? 12.554  31.172 93.767  1.00 90.15  ? 230 VAL B CA  1 
ATOM   3616 C  C   . VAL B 1 38  ? 11.623  29.978 93.667  1.00 88.78  ? 230 VAL B C   1 
ATOM   3617 O  O   . VAL B 1 38  ? 11.913  28.921 94.218  1.00 92.27  ? 230 VAL B O   1 
ATOM   3618 C  CB  . VAL B 1 38  ? 12.308  32.030 95.021  1.00 90.65  ? 230 VAL B CB  1 
ATOM   3619 C  CG1 . VAL B 1 38  ? 11.496  31.292 96.067  1.00 90.83  ? 230 VAL B CG1 1 
ATOM   3620 C  CG2 . VAL B 1 38  ? 13.644  32.474 95.584  1.00 94.85  ? 230 VAL B CG2 1 
ATOM   3621 N  N   . GLY B 1 39  ? 10.530  30.160 92.928  1.00 87.60  ? 231 GLY B N   1 
ATOM   3622 C  CA  . GLY B 1 39  ? 9.482   29.159 92.752  1.00 86.82  ? 231 GLY B CA  1 
ATOM   3623 C  C   . GLY B 1 39  ? 8.275   29.740 92.028  1.00 89.71  ? 231 GLY B C   1 
ATOM   3624 O  O   . GLY B 1 39  ? 8.217   30.948 91.750  1.00 91.85  ? 231 GLY B O   1 
ATOM   3625 N  N   . ALA B 1 40  ? 7.305   28.886 91.714  1.00 88.45  ? 232 ALA B N   1 
ATOM   3626 C  CA  . ALA B 1 40  ? 6.103   29.337 91.024  1.00 88.92  ? 232 ALA B CA  1 
ATOM   3627 C  C   . ALA B 1 40  ? 4.904   28.494 91.412  1.00 89.88  ? 232 ALA B C   1 
ATOM   3628 O  O   . ALA B 1 40  ? 5.057   27.307 91.676  1.00 94.65  ? 232 ALA B O   1 
ATOM   3629 C  CB  . ALA B 1 40  ? 6.313   29.300 89.527  1.00 89.05  ? 232 ALA B CB  1 
ATOM   3630 N  N   . LEU B 1 41  ? 3.721   29.109 91.454  1.00 86.43  ? 233 LEU B N   1 
ATOM   3631 C  CA  . LEU B 1 41  ? 2.476   28.387 91.756  1.00 88.91  ? 233 LEU B CA  1 
ATOM   3632 C  C   . LEU B 1 41  ? 1.234   29.138 91.272  1.00 90.46  ? 233 LEU B C   1 
ATOM   3633 O  O   . LEU B 1 41  ? 1.313   30.317 90.912  1.00 94.07  ? 233 LEU B O   1 
ATOM   3634 C  CB  . LEU B 1 41  ? 2.349   28.101 93.260  1.00 87.95  ? 233 LEU B CB  1 
ATOM   3635 C  CG  . LEU B 1 41  ? 2.000   29.249 94.210  1.00 86.93  ? 233 LEU B CG  1 
ATOM   3636 C  CD1 . LEU B 1 41  ? 1.624   28.694 95.545  1.00 84.56  ? 233 LEU B CD1 1 
ATOM   3637 C  CD2 . LEU B 1 41  ? 3.175   30.213 94.365  1.00 91.91  ? 233 LEU B CD2 1 
ATOM   3638 N  N   . HIS B 1 42  ? 0.097   28.445 91.275  1.00 84.23  ? 234 HIS B N   1 
ATOM   3639 C  CA  . HIS B 1 42  ? -1.183  29.023 90.893  1.00 83.06  ? 234 HIS B CA  1 
ATOM   3640 C  C   . HIS B 1 42  ? -2.045  29.332 92.128  1.00 86.77  ? 234 HIS B C   1 
ATOM   3641 O  O   . HIS B 1 42  ? -1.692  28.967 93.248  1.00 92.37  ? 234 HIS B O   1 
ATOM   3642 C  CB  . HIS B 1 42  ? -1.918  28.036 90.004  1.00 85.71  ? 234 HIS B CB  1 
ATOM   3643 C  CG  . HIS B 1 42  ? -2.358  26.801 90.723  1.00 84.62  ? 234 HIS B CG  1 
ATOM   3644 N  ND1 . HIS B 1 42  ? -1.504  25.755 90.994  1.00 87.18  ? 234 HIS B ND1 1 
ATOM   3645 C  CD2 . HIS B 1 42  ? -3.554  26.456 91.248  1.00 81.47  ? 234 HIS B CD2 1 
ATOM   3646 C  CE1 . HIS B 1 42  ? -2.159  24.811 91.646  1.00 86.57  ? 234 HIS B CE1 1 
ATOM   3647 N  NE2 . HIS B 1 42  ? -3.404  25.216 91.817  1.00 85.18  ? 234 HIS B NE2 1 
ATOM   3648 N  N   . SER B 1 43  ? -3.190  29.971 91.925  1.00 85.98  ? 235 SER B N   1 
ATOM   3649 C  CA  . SER B 1 43  ? -4.054  30.339 93.046  1.00 87.43  ? 235 SER B CA  1 
ATOM   3650 C  C   . SER B 1 43  ? -5.327  29.481 93.159  1.00 89.32  ? 235 SER B C   1 
ATOM   3651 O  O   . SER B 1 43  ? -6.142  29.681 94.058  1.00 93.88  ? 235 SER B O   1 
ATOM   3652 C  CB  . SER B 1 43  ? -4.420  31.820 92.955  1.00 89.25  ? 235 SER B CB  1 
ATOM   3653 O  OG  . SER B 1 43  ? -5.207  32.074 91.805  1.00 90.64  ? 235 SER B OG  1 
ATOM   3654 N  N   . GLY B 1 44  ? -5.489  28.530 92.246  1.00 85.84  ? 236 GLY B N   1 
ATOM   3655 C  CA  . GLY B 1 44  ? -6.614  27.613 92.268  1.00 82.75  ? 236 GLY B CA  1 
ATOM   3656 C  C   . GLY B 1 44  ? -7.958  28.291 92.152  1.00 86.43  ? 236 GLY B C   1 
ATOM   3657 O  O   . GLY B 1 44  ? -8.927  27.864 92.782  1.00 89.10  ? 236 GLY B O   1 
ATOM   3658 N  N   . ASP B 1 45  ? -8.022  29.353 91.357  1.00 88.08  ? 237 ASP B N   1 
ATOM   3659 C  CA  . ASP B 1 45  ? -9.266  30.096 91.187  1.00 90.87  ? 237 ASP B CA  1 
ATOM   3660 C  C   . ASP B 1 45  ? -9.876  29.905 89.800  1.00 92.86  ? 237 ASP B C   1 
ATOM   3661 O  O   . ASP B 1 45  ? -10.926 30.488 89.489  1.00 92.50  ? 237 ASP B O   1 
ATOM   3662 C  CB  . ASP B 1 45  ? -9.050  31.582 91.491  1.00 93.32  ? 237 ASP B CB  1 
ATOM   3663 C  CG  . ASP B 1 45  ? -8.023  32.232 90.582  1.00 94.44  ? 237 ASP B CG  1 
ATOM   3664 O  OD1 . ASP B 1 45  ? -7.414  31.532 89.744  1.00 93.20  ? 237 ASP B OD1 1 
ATOM   3665 O  OD2 . ASP B 1 45  ? -7.828  33.462 90.711  1.00 97.07  ? 237 ASP B OD2 1 
ATOM   3666 N  N   . GLY B 1 46  ? -9.207  29.099 88.973  1.00 91.84  ? 238 GLY B N   1 
ATOM   3667 C  CA  . GLY B 1 46  ? -9.704  28.754 87.642  1.00 92.05  ? 238 GLY B CA  1 
ATOM   3668 C  C   . GLY B 1 46  ? -9.034  29.526 86.529  1.00 95.10  ? 238 GLY B C   1 
ATOM   3669 O  O   . GLY B 1 46  ? -9.047  29.091 85.380  1.00 99.46  ? 238 GLY B O   1 
ATOM   3670 N  N   . SER B 1 47  ? -8.469  30.683 86.870  1.00 96.19  ? 239 SER B N   1 
ATOM   3671 C  CA  . SER B 1 47  ? -7.706  31.508 85.940  1.00 94.82  ? 239 SER B CA  1 
ATOM   3672 C  C   . SER B 1 47  ? -6.331  30.940 85.955  1.00 98.07  ? 239 SER B C   1 
ATOM   3673 O  O   . SER B 1 47  ? -5.657  31.026 86.975  1.00 111.72 ? 239 SER B O   1 
ATOM   3674 C  CB  . SER B 1 47  ? -7.633  32.943 86.455  1.00 93.94  ? 239 SER B CB  1 
ATOM   3675 O  OG  . SER B 1 47  ? -6.926  33.016 87.688  1.00 87.05  ? 239 SER B OG  1 
ATOM   3676 N  N   . GLN B 1 48  ? -5.894  30.345 84.860  1.00 94.13  ? 240 GLN B N   1 
ATOM   3677 C  CA  . GLN B 1 48  ? -4.670  29.544 84.909  1.00 94.18  ? 240 GLN B CA  1 
ATOM   3678 C  C   . GLN B 1 48  ? -3.387  30.378 85.054  1.00 95.25  ? 240 GLN B C   1 
ATOM   3679 O  O   . GLN B 1 48  ? -2.415  30.203 84.318  1.00 101.44 ? 240 GLN B O   1 
ATOM   3680 C  CB  . GLN B 1 48  ? -4.608  28.604 83.711  1.00 94.11  ? 240 GLN B CB  1 
ATOM   3681 C  CG  . GLN B 1 48  ? -5.591  27.476 83.809  1.00 94.80  ? 240 GLN B CG  1 
ATOM   3682 C  CD  . GLN B 1 48  ? -5.932  26.903 82.462  1.00 97.66  ? 240 GLN B CD  1 
ATOM   3683 O  OE1 . GLN B 1 48  ? -5.118  26.947 81.533  1.00 100.00 ? 240 GLN B OE1 1 
ATOM   3684 N  NE2 . GLN B 1 48  ? -7.144  26.361 82.339  1.00 93.87  ? 240 GLN B NE2 1 
ATOM   3685 N  N   . ARG B 1 49  ? -3.412  31.284 86.024  1.00 92.82  ? 241 ARG B N   1 
ATOM   3686 C  CA  . ARG B 1 49  ? -2.312  32.174 86.334  1.00 89.16  ? 241 ARG B CA  1 
ATOM   3687 C  C   . ARG B 1 49  ? -1.178  31.391 86.952  1.00 88.70  ? 241 ARG B C   1 
ATOM   3688 O  O   . ARG B 1 49  ? -1.415  30.422 87.662  1.00 93.87  ? 241 ARG B O   1 
ATOM   3689 C  CB  . ARG B 1 49  ? -2.796  33.234 87.310  1.00 88.34  ? 241 ARG B CB  1 
ATOM   3690 C  CG  . ARG B 1 49  ? -3.002  34.585 86.674  1.00 90.00  ? 241 ARG B CG  1 
ATOM   3691 C  CD  . ARG B 1 49  ? -4.418  35.115 86.818  1.00 90.51  ? 241 ARG B CD  1 
ATOM   3692 N  NE  . ARG B 1 49  ? -5.021  34.942 88.140  1.00 91.53  ? 241 ARG B NE  1 
ATOM   3693 C  CZ  . ARG B 1 49  ? -5.185  35.923 89.022  1.00 91.55  ? 241 ARG B CZ  1 
ATOM   3694 N  NH1 . ARG B 1 49  ? -4.771  37.155 88.737  1.00 88.48  ? 241 ARG B NH1 1 
ATOM   3695 N  NH2 . ARG B 1 49  ? -5.775  35.676 90.188  1.00 90.42  ? 241 ARG B NH2 1 
ATOM   3696 N  N   . LEU B 1 50  ? 0.051   31.782 86.643  1.00 83.23  ? 242 LEU B N   1 
ATOM   3697 C  CA  . LEU B 1 50  ? 1.197   31.234 87.328  1.00 85.62  ? 242 LEU B CA  1 
ATOM   3698 C  C   . LEU B 1 50  ? 1.940   32.384 87.985  1.00 89.16  ? 242 LEU B C   1 
ATOM   3699 O  O   . LEU B 1 50  ? 2.387   33.323 87.323  1.00 87.97  ? 242 LEU B O   1 
ATOM   3700 C  CB  . LEU B 1 50  ? 2.106   30.449 86.379  1.00 86.21  ? 242 LEU B CB  1 
ATOM   3701 C  CG  . LEU B 1 50  ? 3.299   29.709 87.006  1.00 85.24  ? 242 LEU B CG  1 
ATOM   3702 C  CD1 . LEU B 1 50  ? 2.842   28.679 88.009  1.00 80.85  ? 242 LEU B CD1 1 
ATOM   3703 C  CD2 . LEU B 1 50  ? 4.171   29.047 85.939  1.00 86.37  ? 242 LEU B CD2 1 
ATOM   3704 N  N   . PHE B 1 51  ? 2.032   32.317 89.304  1.00 90.98  ? 243 PHE B N   1 
ATOM   3705 C  CA  . PHE B 1 51  ? 2.650   33.366 90.085  1.00 89.55  ? 243 PHE B CA  1 
ATOM   3706 C  C   . PHE B 1 51  ? 4.090   32.966 90.338  1.00 88.84  ? 243 PHE B C   1 
ATOM   3707 O  O   . PHE B 1 51  ? 4.336   31.922 90.950  1.00 91.09  ? 243 PHE B O   1 
ATOM   3708 C  CB  . PHE B 1 51  ? 1.890   33.534 91.404  1.00 87.74  ? 243 PHE B CB  1 
ATOM   3709 C  CG  . PHE B 1 51  ? 0.473   34.002 91.232  1.00 85.49  ? 243 PHE B CG  1 
ATOM   3710 C  CD1 . PHE B 1 51  ? -0.551  33.091 91.013  1.00 83.39  ? 243 PHE B CD1 1 
ATOM   3711 C  CD2 . PHE B 1 51  ? 0.163   35.365 91.297  1.00 88.33  ? 243 PHE B CD2 1 
ATOM   3712 C  CE1 . PHE B 1 51  ? -1.872  33.522 90.859  1.00 88.20  ? 243 PHE B CE1 1 
ATOM   3713 C  CE2 . PHE B 1 51  ? -1.158  35.816 91.146  1.00 90.74  ? 243 PHE B CE2 1 
ATOM   3714 C  CZ  . PHE B 1 51  ? -2.183  34.888 90.922  1.00 89.28  ? 243 PHE B CZ  1 
ATOM   3715 N  N   . ILE B 1 52  ? 5.042   33.763 89.855  1.00 85.55  ? 244 ILE B N   1 
ATOM   3716 C  CA  . ILE B 1 52  ? 6.452   33.413 90.069  1.00 87.73  ? 244 ILE B CA  1 
ATOM   3717 C  C   . ILE B 1 52  ? 7.137   34.288 91.115  1.00 86.08  ? 244 ILE B C   1 
ATOM   3718 O  O   . ILE B 1 52  ? 7.092   35.509 91.032  1.00 87.30  ? 244 ILE B O   1 
ATOM   3719 C  CB  . ILE B 1 52  ? 7.329   33.247 88.753  1.00 87.32  ? 244 ILE B CB  1 
ATOM   3720 C  CG1 . ILE B 1 52  ? 8.662   33.951 88.930  1.00 94.53  ? 244 ILE B CG1 1 
ATOM   3721 C  CG2 . ILE B 1 52  ? 6.660   33.745 87.463  1.00 78.18  ? 244 ILE B CG2 1 
ATOM   3722 C  CD1 . ILE B 1 52  ? 9.772   33.322 88.177  1.00 102.66 ? 244 ILE B CD1 1 
ATOM   3723 N  N   . LEU B 1 53  ? 7.762   33.650 92.100  1.00 84.45  ? 245 LEU B N   1 
ATOM   3724 C  CA  . LEU B 1 53  ? 8.424   34.382 93.175  1.00 85.16  ? 245 LEU B CA  1 
ATOM   3725 C  C   . LEU B 1 53  ? 9.827   34.790 92.777  1.00 88.58  ? 245 LEU B C   1 
ATOM   3726 O  O   . LEU B 1 53  ? 10.612  33.965 92.301  1.00 92.92  ? 245 LEU B O   1 
ATOM   3727 C  CB  . LEU B 1 53  ? 8.519   33.554 94.457  1.00 82.28  ? 245 LEU B CB  1 
ATOM   3728 C  CG  . LEU B 1 53  ? 7.507   32.510 94.940  1.00 82.86  ? 245 LEU B CG  1 
ATOM   3729 C  CD1 . LEU B 1 53  ? 7.622   32.440 96.447  1.00 84.01  ? 245 LEU B CD1 1 
ATOM   3730 C  CD2 . LEU B 1 53  ? 6.058   32.775 94.562  1.00 82.33  ? 245 LEU B CD2 1 
ATOM   3731 N  N   . GLU B 1 54  ? 10.143  36.062 92.989  1.00 87.27  ? 246 GLU B N   1 
ATOM   3732 C  CA  . GLU B 1 54  ? 11.507  36.547 92.869  1.00 83.81  ? 246 GLU B CA  1 
ATOM   3733 C  C   . GLU B 1 54  ? 12.051  36.867 94.261  1.00 85.36  ? 246 GLU B C   1 
ATOM   3734 O  O   . GLU B 1 54  ? 11.384  37.526 95.074  1.00 83.69  ? 246 GLU B O   1 
ATOM   3735 C  CB  . GLU B 1 54  ? 11.561  37.764 91.959  1.00 82.15  ? 246 GLU B CB  1 
ATOM   3736 C  CG  . GLU B 1 54  ? 11.283  37.427 90.518  1.00 85.39  ? 246 GLU B CG  1 
ATOM   3737 C  CD  . GLU B 1 54  ? 11.231  38.644 89.608  1.00 90.50  ? 246 GLU B CD  1 
ATOM   3738 O  OE1 . GLU B 1 54  ? 11.455  38.467 88.396  1.00 94.26  ? 246 GLU B OE1 1 
ATOM   3739 O  OE2 . GLU B 1 54  ? 10.959  39.771 90.081  1.00 92.18  ? 246 GLU B OE2 1 
ATOM   3740 N  N   . LYS B 1 55  ? 13.265  36.395 94.526  1.00 85.25  ? 247 LYS B N   1 
ATOM   3741 C  CA  . LYS B 1 55  ? 13.880  36.476 95.854  1.00 86.41  ? 247 LYS B CA  1 
ATOM   3742 C  C   . LYS B 1 55  ? 13.977  37.877 96.455  1.00 87.58  ? 247 LYS B C   1 
ATOM   3743 O  O   . LYS B 1 55  ? 13.856  38.024 97.668  1.00 89.98  ? 247 LYS B O   1 
ATOM   3744 C  CB  . LYS B 1 55  ? 15.268  35.841 95.826  1.00 84.80  ? 247 LYS B CB  1 
ATOM   3745 C  CG  . LYS B 1 55  ? 15.737  35.349 97.164  1.00 84.79  ? 247 LYS B CG  1 
ATOM   3746 C  CD  . LYS B 1 55  ? 17.114  34.715 97.046  1.00 86.29  ? 247 LYS B CD  1 
ATOM   3747 C  CE  . LYS B 1 55  ? 17.677  34.390 98.418  1.00 86.24  ? 247 LYS B CE  1 
ATOM   3748 N  NZ  . LYS B 1 55  ? 18.989  33.746 98.266  1.00 90.09  ? 247 LYS B NZ  1 
ATOM   3749 N  N   . GLU B 1 56  ? 14.212  38.895 95.626  1.00 86.72  ? 248 GLU B N   1 
ATOM   3750 C  CA  . GLU B 1 56  ? 14.334  40.275 96.126  1.00 89.22  ? 248 GLU B CA  1 
ATOM   3751 C  C   . GLU B 1 56  ? 13.045  40.797 96.767  1.00 87.13  ? 248 GLU B C   1 
ATOM   3752 O  O   . GLU B 1 56  ? 13.059  41.803 97.468  1.00 86.39  ? 248 GLU B O   1 
ATOM   3753 C  CB  . GLU B 1 56  ? 14.797  41.229 95.023  1.00 94.57  ? 248 GLU B CB  1 
ATOM   3754 C  CG  . GLU B 1 56  ? 16.297  41.367 94.897  1.00 101.85 ? 248 GLU B CG  1 
ATOM   3755 C  CD  . GLU B 1 56  ? 16.752  41.500 93.448  1.00 110.29 ? 248 GLU B CD  1 
ATOM   3756 O  OE1 . GLU B 1 56  ? 16.534  40.548 92.655  1.00 114.38 ? 248 GLU B OE1 1 
ATOM   3757 O  OE2 . GLU B 1 56  ? 17.340  42.550 93.105  1.00 112.70 ? 248 GLU B OE2 1 
ATOM   3758 N  N   . GLY B 1 57  ? 11.938  40.106 96.525  1.00 86.77  ? 249 GLY B N   1 
ATOM   3759 C  CA  . GLY B 1 57  ? 10.680  40.425 97.179  1.00 85.69  ? 249 GLY B CA  1 
ATOM   3760 C  C   . GLY B 1 57  ? 9.581   40.814 96.220  1.00 85.88  ? 249 GLY B C   1 
ATOM   3761 O  O   . GLY B 1 57  ? 8.820   41.739 96.502  1.00 86.34  ? 249 GLY B O   1 
ATOM   3762 N  N   . TYR B 1 58  ? 9.502   40.105 95.091  1.00 86.38  ? 250 TYR B N   1 
ATOM   3763 C  CA  . TYR B 1 58  ? 8.462   40.328 94.088  1.00 86.37  ? 250 TYR B CA  1 
ATOM   3764 C  C   . TYR B 1 58  ? 7.734   39.033 93.725  1.00 88.42  ? 250 TYR B C   1 
ATOM   3765 O  O   . TYR B 1 58  ? 8.358   37.971 93.687  1.00 92.87  ? 250 TYR B O   1 
ATOM   3766 C  CB  . TYR B 1 58  ? 9.068   40.884 92.805  1.00 82.72  ? 250 TYR B CB  1 
ATOM   3767 C  CG  . TYR B 1 58  ? 9.927   42.118 92.944  1.00 81.90  ? 250 TYR B CG  1 
ATOM   3768 C  CD1 . TYR B 1 58  ? 11.311  42.013 93.105  1.00 81.03  ? 250 TYR B CD1 1 
ATOM   3769 C  CD2 . TYR B 1 58  ? 9.369   43.392 92.856  1.00 79.08  ? 250 TYR B CD2 1 
ATOM   3770 C  CE1 . TYR B 1 58  ? 12.113  43.151 93.200  1.00 80.87  ? 250 TYR B CE1 1 
ATOM   3771 C  CE2 . TYR B 1 58  ? 10.158  44.529 92.951  1.00 79.05  ? 250 TYR B CE2 1 
ATOM   3772 C  CZ  . TYR B 1 58  ? 11.531  44.406 93.123  1.00 80.32  ? 250 TYR B CZ  1 
ATOM   3773 O  OH  . TYR B 1 58  ? 12.316  45.537 93.226  1.00 80.34  ? 250 TYR B OH  1 
ATOM   3774 N  N   . VAL B 1 59  ? 6.430   39.129 93.449  1.00 85.66  ? 251 VAL B N   1 
ATOM   3775 C  CA  . VAL B 1 59  ? 5.669   38.045 92.808  1.00 87.45  ? 251 VAL B CA  1 
ATOM   3776 C  C   . VAL B 1 59  ? 5.113   38.548 91.477  1.00 87.42  ? 251 VAL B C   1 
ATOM   3777 O  O   . VAL B 1 59  ? 4.365   39.521 91.443  1.00 92.91  ? 251 VAL B O   1 
ATOM   3778 C  CB  . VAL B 1 59  ? 4.478   37.540 93.684  1.00 90.73  ? 251 VAL B CB  1 
ATOM   3779 C  CG1 . VAL B 1 59  ? 3.750   36.377 93.009  1.00 86.28  ? 251 VAL B CG1 1 
ATOM   3780 C  CG2 . VAL B 1 59  ? 4.943   37.120 95.065  1.00 93.40  ? 251 VAL B CG2 1 
ATOM   3781 N  N   . LYS B 1 60  ? 5.476   37.892 90.383  1.00 87.64  ? 252 LYS B N   1 
ATOM   3782 C  CA  . LYS B 1 60  ? 4.967   38.267 89.061  1.00 87.89  ? 252 LYS B CA  1 
ATOM   3783 C  C   . LYS B 1 60  ? 3.929   37.269 88.542  1.00 89.72  ? 252 LYS B C   1 
ATOM   3784 O  O   . LYS B 1 60  ? 3.984   36.072 88.862  1.00 92.00  ? 252 LYS B O   1 
ATOM   3785 C  CB  . LYS B 1 60  ? 6.106   38.385 88.055  1.00 84.63  ? 252 LYS B CB  1 
ATOM   3786 C  CG  . LYS B 1 60  ? 7.022   39.552 88.283  1.00 85.25  ? 252 LYS B CG  1 
ATOM   3787 C  CD  . LYS B 1 60  ? 8.188   39.496 87.313  1.00 89.05  ? 252 LYS B CD  1 
ATOM   3788 C  CE  . LYS B 1 60  ? 9.181   40.612 87.565  1.00 91.88  ? 252 LYS B CE  1 
ATOM   3789 N  NZ  . LYS B 1 60  ? 10.480  40.394 86.855  1.00 92.83  ? 252 LYS B NZ  1 
ATOM   3790 N  N   . ILE B 1 61  ? 2.991   37.769 87.740  1.00 85.39  ? 253 ILE B N   1 
ATOM   3791 C  CA  . ILE B 1 61  ? 1.956   36.935 87.145  1.00 86.56  ? 253 ILE B CA  1 
ATOM   3792 C  C   . ILE B 1 61  ? 2.328   36.537 85.716  1.00 90.98  ? 253 ILE B C   1 
ATOM   3793 O  O   . ILE B 1 61  ? 2.610   37.401 84.864  1.00 91.43  ? 253 ILE B O   1 
ATOM   3794 C  CB  . ILE B 1 61  ? 0.582   37.660 87.123  1.00 83.47  ? 253 ILE B CB  1 
ATOM   3795 C  CG1 . ILE B 1 61  ? -0.017  37.730 88.528  1.00 78.88  ? 253 ILE B CG1 1 
ATOM   3796 C  CG2 . ILE B 1 61  ? -0.386  36.969 86.160  1.00 80.77  ? 253 ILE B CG2 1 
ATOM   3797 C  CD1 . ILE B 1 61  ? -1.061  38.817 88.686  1.00 78.94  ? 253 ILE B CD1 1 
ATOM   3798 N  N   . LEU B 1 62  ? 2.327   35.229 85.464  1.00 90.45  ? 254 LEU B N   1 
ATOM   3799 C  CA  . LEU B 1 62  ? 2.428   34.711 84.106  1.00 88.21  ? 254 LEU B CA  1 
ATOM   3800 C  C   . LEU B 1 62  ? 1.075   34.235 83.635  1.00 90.24  ? 254 LEU B C   1 
ATOM   3801 O  O   . LEU B 1 62  ? 0.509   33.265 84.147  1.00 97.24  ? 254 LEU B O   1 
ATOM   3802 C  CB  . LEU B 1 62  ? 3.447   33.580 83.980  1.00 85.38  ? 254 LEU B CB  1 
ATOM   3803 C  CG  . LEU B 1 62  ? 3.466   32.903 82.601  1.00 81.64  ? 254 LEU B CG  1 
ATOM   3804 C  CD1 . LEU B 1 62  ? 3.829   33.888 81.488  1.00 80.63  ? 254 LEU B CD1 1 
ATOM   3805 C  CD2 . LEU B 1 62  ? 4.409   31.710 82.604  1.00 78.02  ? 254 LEU B CD2 1 
ATOM   3806 N  N   . THR B 1 63  ? 0.595   34.932 82.622  1.00 91.26  ? 255 THR B N   1 
ATOM   3807 C  CA  . THR B 1 63  ? -0.700  34.743 82.004  1.00 89.37  ? 255 THR B CA  1 
ATOM   3808 C  C   . THR B 1 63  ? -0.684  33.415 81.246  1.00 92.45  ? 255 THR B C   1 
ATOM   3809 O  O   . THR B 1 63  ? 0.363   33.006 80.741  0.70 93.92  ? 255 THR B O   1 
ATOM   3810 C  CB  . THR B 1 63  ? -0.967  35.991 81.123  1.00 90.47  ? 255 THR B CB  1 
ATOM   3811 O  OG1 . THR B 1 63  ? -2.116  36.689 81.606  1.00 100.02 ? 255 THR B OG1 1 
ATOM   3812 C  CG2 . THR B 1 63  ? -1.071  35.702 79.640  1.00 86.97  ? 255 THR B CG2 1 
ATOM   3813 N  N   . PRO B 1 64  ? -1.833  32.713 81.191  1.00 95.02  ? 256 PRO B N   1 
ATOM   3814 C  CA  . PRO B 1 64  ? -1.866  31.357 80.625  1.00 91.02  ? 256 PRO B CA  1 
ATOM   3815 C  C   . PRO B 1 64  ? -1.654  31.398 79.129  1.00 90.41  ? 256 PRO B C   1 
ATOM   3816 O  O   . PRO B 1 64  ? -1.555  30.360 78.483  1.00 94.07  ? 256 PRO B O   1 
ATOM   3817 C  CB  . PRO B 1 64  ? -3.288  30.889 80.929  1.00 88.44  ? 256 PRO B CB  1 
ATOM   3818 C  CG  . PRO B 1 64  ? -4.073  32.124 80.974  1.00 91.49  ? 256 PRO B CG  1 
ATOM   3819 C  CD  . PRO B 1 64  ? -3.175  33.151 81.609  1.00 94.75  ? 256 PRO B CD  1 
ATOM   3820 N  N   . GLU B 1 65  ? -1.585  32.614 78.603  1.00 90.96  ? 257 GLU B N   1 
ATOM   3821 C  CA  . GLU B 1 65  ? -1.434  32.880 77.190  1.00 91.15  ? 257 GLU B CA  1 
ATOM   3822 C  C   . GLU B 1 65  ? 0.004   33.347 76.923  1.00 93.07  ? 257 GLU B C   1 
ATOM   3823 O  O   . GLU B 1 65  ? 0.396   33.588 75.781  1.00 95.97  ? 257 GLU B O   1 
ATOM   3824 C  CB  . GLU B 1 65  ? -2.457  33.943 76.783  1.00 89.67  ? 257 GLU B CB  1 
ATOM   3825 C  CG  . GLU B 1 65  ? -2.734  34.041 75.310  1.00 92.79  ? 257 GLU B CG  1 
ATOM   3826 C  CD  . GLU B 1 65  ? -3.322  32.777 74.735  1.00 95.95  ? 257 GLU B CD  1 
ATOM   3827 O  OE1 . GLU B 1 65  ? -4.410  32.351 75.193  1.00 94.60  ? 257 GLU B OE1 1 
ATOM   3828 O  OE2 . GLU B 1 65  ? -2.692  32.219 73.805  1.00 99.04  ? 257 GLU B OE2 1 
ATOM   3829 N  N   . GLY B 1 66  ? 0.789   33.478 77.987  1.00 91.08  ? 258 GLY B N   1 
ATOM   3830 C  CA  . GLY B 1 66  ? 2.221   33.700 77.850  1.00 84.18  ? 258 GLY B CA  1 
ATOM   3831 C  C   . GLY B 1 66  ? 2.812   35.019 78.289  1.00 83.28  ? 258 GLY B C   1 
ATOM   3832 O  O   . GLY B 1 66  ? 4.037   35.154 78.279  1.00 89.21  ? 258 GLY B O   1 
ATOM   3833 N  N   . GLU B 1 67  ? 1.973   35.990 78.664  1.00 80.43  ? 259 GLU B N   1 
ATOM   3834 C  CA  . GLU B 1 67  ? 2.449   37.337 78.998  1.00 81.81  ? 259 GLU B CA  1 
ATOM   3835 C  C   . GLU B 1 67  ? 2.848   37.464 80.458  1.00 82.96  ? 259 GLU B C   1 
ATOM   3836 O  O   . GLU B 1 67  ? 2.252   36.853 81.320  1.00 84.98  ? 259 GLU B O   1 
ATOM   3837 C  CB  . GLU B 1 67  ? 1.410   38.406 78.678  1.00 87.15  ? 259 GLU B CB  1 
ATOM   3838 C  CG  . GLU B 1 67  ? 1.055   38.536 77.208  1.00 98.92  ? 259 GLU B CG  1 
ATOM   3839 C  CD  . GLU B 1 67  ? 2.039   39.363 76.408  1.00 107.33 ? 259 GLU B CD  1 
ATOM   3840 O  OE1 . GLU B 1 67  ? 2.232   40.553 76.736  1.00 113.63 ? 259 GLU B OE1 1 
ATOM   3841 O  OE2 . GLU B 1 67  ? 2.603   38.828 75.428  1.00 111.49 ? 259 GLU B OE2 1 
ATOM   3842 N  N   . ILE B 1 68  ? 3.879   38.253 80.732  1.00 84.80  ? 260 ILE B N   1 
ATOM   3843 C  CA  . ILE B 1 68  ? 4.192   38.620 82.100  1.00 81.85  ? 260 ILE B CA  1 
ATOM   3844 C  C   . ILE B 1 68  ? 3.664   40.037 82.290  1.00 86.74  ? 260 ILE B C   1 
ATOM   3845 O  O   . ILE B 1 68  ? 4.130   40.977 81.632  1.00 90.82  ? 260 ILE B O   1 
ATOM   3846 C  CB  . ILE B 1 68  ? 5.703   38.552 82.382  1.00 76.09  ? 260 ILE B CB  1 
ATOM   3847 C  CG1 . ILE B 1 68  ? 6.207   37.107 82.287  1.00 79.68  ? 260 ILE B CG1 1 
ATOM   3848 C  CG2 . ILE B 1 68  ? 6.014   39.113 83.752  1.00 71.22  ? 260 ILE B CG2 1 
ATOM   3849 C  CD1 . ILE B 1 68  ? 6.203   36.329 83.611  1.00 82.11  ? 260 ILE B CD1 1 
ATOM   3850 N  N   . PHE B 1 69  ? 2.672   40.191 83.163  1.00 85.09  ? 261 PHE B N   1 
ATOM   3851 C  CA  . PHE B 1 69  ? 2.118   41.507 83.411  1.00 83.79  ? 261 PHE B CA  1 
ATOM   3852 C  C   . PHE B 1 69  ? 3.224   42.451 83.855  1.00 87.72  ? 261 PHE B C   1 
ATOM   3853 O  O   . PHE B 1 69  ? 4.122   42.053 84.602  1.00 89.01  ? 261 PHE B O   1 
ATOM   3854 C  CB  . PHE B 1 69  ? 1.043   41.451 84.479  1.00 82.80  ? 261 PHE B CB  1 
ATOM   3855 C  CG  . PHE B 1 69  ? -0.239  40.851 84.015  1.00 84.34  ? 261 PHE B CG  1 
ATOM   3856 C  CD1 . PHE B 1 69  ? -1.100  40.247 84.926  1.00 84.83  ? 261 PHE B CD1 1 
ATOM   3857 C  CD2 . PHE B 1 69  ? -0.598  40.884 82.671  1.00 85.14  ? 261 PHE B CD2 1 
ATOM   3858 C  CE1 . PHE B 1 69  ? -2.292  39.689 84.507  1.00 85.71  ? 261 PHE B CE1 1 
ATOM   3859 C  CE2 . PHE B 1 69  ? -1.794  40.318 82.242  1.00 85.12  ? 261 PHE B CE2 1 
ATOM   3860 C  CZ  . PHE B 1 69  ? -2.639  39.718 83.160  1.00 85.12  ? 261 PHE B CZ  1 
ATOM   3861 N  N   . LYS B 1 70  ? 3.152   43.694 83.387  1.00 88.12  ? 262 LYS B N   1 
ATOM   3862 C  CA  . LYS B 1 70  ? 4.144   44.705 83.716  1.00 87.64  ? 262 LYS B CA  1 
ATOM   3863 C  C   . LYS B 1 70  ? 4.237   44.934 85.221  1.00 88.02  ? 262 LYS B C   1 
ATOM   3864 O  O   . LYS B 1 70  ? 5.332   44.922 85.784  1.00 90.09  ? 262 LYS B O   1 
ATOM   3865 C  CB  . LYS B 1 70  ? 3.831   46.020 83.005  1.00 90.16  ? 262 LYS B CB  1 
ATOM   3866 C  CG  . LYS B 1 70  ? 4.913   47.054 83.198  1.00 94.85  ? 262 LYS B CG  1 
ATOM   3867 C  CD  . LYS B 1 70  ? 4.478   48.442 82.765  1.00 95.82  ? 262 LYS B CD  1 
ATOM   3868 C  CE  . LYS B 1 70  ? 5.678   49.378 82.751  1.00 96.18  ? 262 LYS B CE  1 
ATOM   3869 N  NZ  . LYS B 1 70  ? 5.370   50.635 82.028  1.00 100.36 ? 262 LYS B NZ  1 
ATOM   3870 N  N   . GLU B 1 71  ? 3.088   45.133 85.864  1.00 87.30  ? 263 GLU B N   1 
ATOM   3871 C  CA  . GLU B 1 71  ? 3.053   45.434 87.291  1.00 86.24  ? 263 GLU B CA  1 
ATOM   3872 C  C   . GLU B 1 71  ? 3.063   44.150 88.122  1.00 85.09  ? 263 GLU B C   1 
ATOM   3873 O  O   . GLU B 1 71  ? 2.268   43.234 87.887  1.00 87.48  ? 263 GLU B O   1 
ATOM   3874 C  CB  . GLU B 1 71  ? 1.835   46.290 87.625  1.00 89.70  ? 263 GLU B CB  1 
ATOM   3875 C  CG  . GLU B 1 71  ? 2.098   47.364 88.672  1.00 100.06 ? 263 GLU B CG  1 
ATOM   3876 C  CD  . GLU B 1 71  ? 2.970   48.512 88.154  1.00 105.79 ? 263 GLU B CD  1 
ATOM   3877 O  OE1 . GLU B 1 71  ? 2.779   48.964 86.997  1.00 105.93 ? 263 GLU B OE1 1 
ATOM   3878 O  OE2 . GLU B 1 71  ? 3.848   48.966 88.917  1.00 109.12 ? 263 GLU B OE2 1 
ATOM   3879 N  N   . PRO B 1 72  ? 3.980   44.062 89.090  1.00 82.49  ? 264 PRO B N   1 
ATOM   3880 C  CA  . PRO B 1 72  ? 4.026   42.873 89.937  1.00 81.68  ? 264 PRO B CA  1 
ATOM   3881 C  C   . PRO B 1 72  ? 2.710   42.679 90.671  1.00 82.74  ? 264 PRO B C   1 
ATOM   3882 O  O   . PRO B 1 72  ? 2.015   43.661 90.970  1.00 84.91  ? 264 PRO B O   1 
ATOM   3883 C  CB  . PRO B 1 72  ? 5.125   43.202 90.946  1.00 81.94  ? 264 PRO B CB  1 
ATOM   3884 C  CG  . PRO B 1 72  ? 5.943   44.254 90.295  1.00 83.36  ? 264 PRO B CG  1 
ATOM   3885 C  CD  . PRO B 1 72  ? 5.011   45.046 89.450  1.00 81.91  ? 264 PRO B CD  1 
ATOM   3886 N  N   . TYR B 1 73  ? 2.373   41.424 90.950  1.00 79.16  ? 265 TYR B N   1 
ATOM   3887 C  CA  . TYR B 1 73  ? 1.218   41.099 91.766  1.00 79.10  ? 265 TYR B CA  1 
ATOM   3888 C  C   . TYR B 1 73  ? 1.484   41.508 93.203  1.00 82.65  ? 265 TYR B C   1 
ATOM   3889 O  O   . TYR B 1 73  ? 0.605   42.064 93.858  1.00 87.74  ? 265 TYR B O   1 
ATOM   3890 C  CB  . TYR B 1 73  ? 0.952   39.611 91.692  1.00 84.05  ? 265 TYR B CB  1 
ATOM   3891 C  CG  . TYR B 1 73  ? -0.120  39.076 92.616  1.00 86.54  ? 265 TYR B CG  1 
ATOM   3892 C  CD1 . TYR B 1 73  ? -1.464  39.396 92.426  1.00 88.69  ? 265 TYR B CD1 1 
ATOM   3893 C  CD2 . TYR B 1 73  ? 0.207   38.206 93.650  1.00 86.14  ? 265 TYR B CD2 1 
ATOM   3894 C  CE1 . TYR B 1 73  ? -2.452  38.877 93.258  1.00 87.24  ? 265 TYR B CE1 1 
ATOM   3895 C  CE2 . TYR B 1 73  ? -0.771  37.683 94.485  1.00 86.71  ? 265 TYR B CE2 1 
ATOM   3896 C  CZ  . TYR B 1 73  ? -2.097  38.019 94.282  1.00 86.15  ? 265 TYR B CZ  1 
ATOM   3897 O  OH  . TYR B 1 73  ? -3.064  37.498 95.111  1.00 85.40  ? 265 TYR B OH  1 
ATOM   3898 N  N   . LEU B 1 74  ? 2.694   41.225 93.685  1.00 80.98  ? 266 LEU B N   1 
ATOM   3899 C  CA  . LEU B 1 74  ? 3.123   41.624 95.020  1.00 82.93  ? 266 LEU B CA  1 
ATOM   3900 C  C   . LEU B 1 74  ? 4.501   42.262 94.903  1.00 89.36  ? 266 LEU B C   1 
ATOM   3901 O  O   . LEU B 1 74  ? 5.426   41.647 94.364  1.00 94.32  ? 266 LEU B O   1 
ATOM   3902 C  CB  . LEU B 1 74  ? 3.198   40.408 95.951  1.00 82.04  ? 266 LEU B CB  1 
ATOM   3903 C  CG  . LEU B 1 74  ? 2.981   40.519 97.473  1.00 79.62  ? 266 LEU B CG  1 
ATOM   3904 C  CD1 . LEU B 1 74  ? 3.698   39.389 98.185  1.00 77.04  ? 266 LEU B CD1 1 
ATOM   3905 C  CD2 . LEU B 1 74  ? 3.455   41.817 98.050  1.00 82.67  ? 266 LEU B CD2 1 
ATOM   3906 N  N   . ASP B 1 75  ? 4.634   43.497 95.380  1.00 90.87  ? 267 ASP B N   1 
ATOM   3907 C  CA  . ASP B 1 75  ? 5.934   44.159 95.413  1.00 90.24  ? 267 ASP B CA  1 
ATOM   3908 C  C   . ASP B 1 75  ? 6.296   44.525 96.841  1.00 91.25  ? 267 ASP B C   1 
ATOM   3909 O  O   . ASP B 1 75  ? 5.801   45.512 97.398  1.00 90.21  ? 267 ASP B O   1 
ATOM   3910 C  CB  . ASP B 1 75  ? 5.969   45.393 94.510  1.00 89.79  ? 267 ASP B CB  1 
ATOM   3911 C  CG  . ASP B 1 75  ? 7.322   46.087 94.526  1.00 90.00  ? 267 ASP B CG  1 
ATOM   3912 O  OD1 . ASP B 1 75  ? 8.144   45.783 95.416  1.00 89.38  ? 267 ASP B OD1 1 
ATOM   3913 O  OD2 . ASP B 1 75  ? 7.570   46.936 93.645  1.00 91.17  ? 267 ASP B OD2 1 
ATOM   3914 N  N   . ILE B 1 76  ? 7.190   43.731 97.416  1.00 91.10  ? 268 ILE B N   1 
ATOM   3915 C  CA  . ILE B 1 76  ? 7.452   43.798 98.842  1.00 88.95  ? 268 ILE B CA  1 
ATOM   3916 C  C   . ILE B 1 76  ? 8.945   44.026 99.144  1.00 88.87  ? 268 ILE B C   1 
ATOM   3917 O  O   . ILE B 1 76  ? 9.382   43.966 100.298 1.00 87.48  ? 268 ILE B O   1 
ATOM   3918 C  CB  . ILE B 1 76  ? 6.827   42.552 99.529  1.00 87.08  ? 268 ILE B CB  1 
ATOM   3919 C  CG1 . ILE B 1 76  ? 5.974   42.963 100.711 1.00 91.05  ? 268 ILE B CG1 1 
ATOM   3920 C  CG2 . ILE B 1 76  ? 7.840   41.456 99.882  1.00 86.53  ? 268 ILE B CG2 1 
ATOM   3921 C  CD1 . ILE B 1 76  ? 5.324   41.768 101.369 1.00 97.68  ? 268 ILE B CD1 1 
ATOM   3922 N  N   . HIS B 1 77  ? 9.705   44.360 98.102  1.00 88.06  ? 269 HIS B N   1 
ATOM   3923 C  CA  . HIS B 1 77  ? 11.162  44.440 98.198  1.00 87.14  ? 269 HIS B CA  1 
ATOM   3924 C  C   . HIS B 1 77  ? 11.681  45.414 99.246  1.00 88.18  ? 269 HIS B C   1 
ATOM   3925 O  O   . HIS B 1 77  ? 12.762  45.206 99.797  1.00 87.48  ? 269 HIS B O   1 
ATOM   3926 C  CB  . HIS B 1 77  ? 11.812  44.680 96.826  1.00 85.56  ? 269 HIS B CB  1 
ATOM   3927 C  CG  . HIS B 1 77  ? 11.866  46.115 96.408  1.00 84.72  ? 269 HIS B CG  1 
ATOM   3928 N  ND1 . HIS B 1 77  ? 10.802  46.759 95.816  1.00 86.25  ? 269 HIS B ND1 1 
ATOM   3929 C  CD2 . HIS B 1 77  ? 12.870  47.021 96.465  1.00 84.29  ? 269 HIS B CD2 1 
ATOM   3930 C  CE1 . HIS B 1 77  ? 11.142  48.004 95.541  1.00 86.70  ? 269 HIS B CE1 1 
ATOM   3931 N  NE2 . HIS B 1 77  ? 12.392  48.190 95.926  1.00 85.30  ? 269 HIS B NE2 1 
ATOM   3932 N  N   . LYS B 1 78  ? 10.917  46.466 99.529  1.00 93.62  ? 270 LYS B N   1 
ATOM   3933 C  CA  . LYS B 1 78  ? 11.310  47.413 100.580 1.00 97.50  ? 270 LYS B CA  1 
ATOM   3934 C  C   . LYS B 1 78  ? 11.306  46.727 101.945 1.00 92.65  ? 270 LYS B C   1 
ATOM   3935 O  O   . LYS B 1 78  ? 12.213  46.922 102.740 1.00 91.76  ? 270 LYS B O   1 
ATOM   3936 C  CB  . LYS B 1 78  ? 10.408  48.646 100.593 1.00 99.82  ? 270 LYS B CB  1 
ATOM   3937 C  CG  . LYS B 1 78  ? 10.524  49.531 99.357  1.00 103.11 ? 270 LYS B CG  1 
ATOM   3938 C  CD  . LYS B 1 78  ? 9.606   50.749 99.480  1.00 104.12 ? 270 LYS B CD  1 
ATOM   3939 C  CE  . LYS B 1 78  ? 9.557   51.569 98.193  1.00 106.71 ? 270 LYS B CE  1 
ATOM   3940 N  NZ  . LYS B 1 78  ? 8.756   52.818 98.377  1.00 107.10 ? 270 LYS B NZ  1 
ATOM   3941 N  N   . LEU B 1 79  ? 10.295  45.898 102.185 1.00 90.77  ? 271 LEU B N   1 
ATOM   3942 C  CA  . LEU B 1 79  ? 10.168  45.136 103.424 1.00 90.79  ? 271 LEU B CA  1 
ATOM   3943 C  C   . LEU B 1 79  ? 11.221  44.050 103.619 1.00 90.06  ? 271 LEU B C   1 
ATOM   3944 O  O   . LEU B 1 79  ? 11.661  43.800 104.743 1.00 87.27  ? 271 LEU B O   1 
ATOM   3945 C  CB  . LEU B 1 79  ? 8.798   44.470 103.483 1.00 91.86  ? 271 LEU B CB  1 
ATOM   3946 C  CG  . LEU B 1 79  ? 7.714   45.123 104.323 1.00 92.84  ? 271 LEU B CG  1 
ATOM   3947 C  CD1 . LEU B 1 79  ? 6.376   44.471 104.008 1.00 91.60  ? 271 LEU B CD1 1 
ATOM   3948 C  CD2 . LEU B 1 79  ? 8.059   44.992 105.805 1.00 94.25  ? 271 LEU B CD2 1 
ATOM   3949 N  N   . VAL B 1 80  ? 11.601  43.387 102.531 1.00 91.25  ? 272 VAL B N   1 
ATOM   3950 C  CA  . VAL B 1 80  ? 12.450  42.196 102.633 1.00 90.81  ? 272 VAL B CA  1 
ATOM   3951 C  C   . VAL B 1 80  ? 13.949  42.481 102.526 1.00 91.46  ? 272 VAL B C   1 
ATOM   3952 O  O   . VAL B 1 80  ? 14.400  43.217 101.647 1.00 93.34  ? 272 VAL B O   1 
ATOM   3953 C  CB  . VAL B 1 80  ? 11.971  41.030 101.691 1.00 88.94  ? 272 VAL B CB  1 
ATOM   3954 C  CG1 . VAL B 1 80  ? 11.313  41.558 100.464 1.00 87.65  ? 272 VAL B CG1 1 
ATOM   3955 C  CG2 . VAL B 1 80  ? 13.111  40.067 101.327 1.00 91.12  ? 272 VAL B CG2 1 
ATOM   3956 N  N   . GLN B 1 81  ? 14.697  41.921 103.472 1.00 93.15  ? 273 GLN B N   1 
ATOM   3957 C  CA  . GLN B 1 81  ? 16.140  41.893 103.404 1.00 96.82  ? 273 GLN B CA  1 
ATOM   3958 C  C   . GLN B 1 81  ? 16.488  40.610 102.679 1.00 100.38 ? 273 GLN B C   1 
ATOM   3959 O  O   . GLN B 1 81  ? 16.126  39.524 103.132 1.00 99.71  ? 273 GLN B O   1 
ATOM   3960 C  CB  . GLN B 1 81  ? 16.740  41.892 104.808 1.00 99.10  ? 273 GLN B CB  1 
ATOM   3961 C  CG  . GLN B 1 81  ? 18.201  42.305 104.859 1.00 101.87 ? 273 GLN B CG  1 
ATOM   3962 C  CD  . GLN B 1 81  ? 18.441  43.657 104.214 1.00 105.53 ? 273 GLN B CD  1 
ATOM   3963 O  OE1 . GLN B 1 81  ? 19.193  43.767 103.249 1.00 108.37 ? 273 GLN B OE1 1 
ATOM   3964 N  NE2 . GLN B 1 81  ? 17.781  44.689 104.727 1.00 106.81 ? 273 GLN B NE2 1 
ATOM   3965 N  N   . SER B 1 82  ? 17.171  40.738 101.545 1.00 104.61 ? 274 SER B N   1 
ATOM   3966 C  CA  . SER B 1 82  ? 17.439  39.594 100.675 1.00 109.02 ? 274 SER B CA  1 
ATOM   3967 C  C   . SER B 1 82  ? 18.925  39.256 100.579 1.00 111.51 ? 274 SER B C   1 
ATOM   3968 O  O   . SER B 1 82  ? 19.777  40.036 101.011 1.00 109.01 ? 274 SER B O   1 
ATOM   3969 C  CB  . SER B 1 82  ? 16.850  39.831 99.276  1.00 110.59 ? 274 SER B CB  1 
ATOM   3970 O  OG  . SER B 1 82  ? 17.442  40.955 98.650  1.00 112.09 ? 274 SER B OG  1 
ATOM   3971 N  N   . GLY B 1 83  ? 19.215  38.089 100.002 1.00 116.39 ? 275 GLY B N   1 
ATOM   3972 C  CA  . GLY B 1 83  ? 20.581  37.581 99.852  1.00 119.87 ? 275 GLY B CA  1 
ATOM   3973 C  C   . GLY B 1 83  ? 21.552  38.496 99.127  1.00 122.07 ? 275 GLY B C   1 
ATOM   3974 O  O   . GLY B 1 83  ? 21.147  39.365 98.352  1.00 122.35 ? 275 GLY B O   1 
ATOM   3975 N  N   . ILE B 1 84  ? 22.841  38.296 99.390  1.00 124.36 ? 276 ILE B N   1 
ATOM   3976 C  CA  . ILE B 1 84  ? 23.907  39.091 98.770  1.00 127.97 ? 276 ILE B CA  1 
ATOM   3977 C  C   . ILE B 1 84  ? 25.045  38.203 98.248  1.00 127.78 ? 276 ILE B C   1 
ATOM   3978 O  O   . ILE B 1 84  ? 25.399  38.265 97.069  1.00 128.96 ? 276 ILE B O   1 
ATOM   3979 C  CB  . ILE B 1 84  ? 24.453  40.208 99.723  1.00 129.17 ? 276 ILE B CB  1 
ATOM   3980 C  CG1 . ILE B 1 84  ? 24.693  39.663 101.143 1.00 128.97 ? 276 ILE B CG1 1 
ATOM   3981 C  CG2 . ILE B 1 84  ? 23.493  41.399 99.754  1.00 129.74 ? 276 ILE B CG2 1 
ATOM   3982 C  CD1 . ILE B 1 84  ? 25.586  40.533 102.017 1.00 128.58 ? 276 ILE B CD1 1 
ATOM   3983 N  N   . LYS B 1 85  ? 25.602  37.381 99.137  1.00 126.53 ? 277 LYS B N   1 
ATOM   3984 C  CA  . LYS B 1 85  ? 26.644  36.417 98.787  1.00 122.84 ? 277 LYS B CA  1 
ATOM   3985 C  C   . LYS B 1 85  ? 25.992  35.131 98.277  1.00 119.44 ? 277 LYS B C   1 
ATOM   3986 O  O   . LYS B 1 85  ? 24.765  35.029 98.242  1.00 114.07 ? 277 LYS B O   1 
ATOM   3987 C  CB  . LYS B 1 85  ? 27.550  36.129 99.997  1.00 121.41 ? 277 LYS B CB  1 
ATOM   3988 C  CG  . LYS B 1 85  ? 28.225  37.360 100.589 1.00 121.70 ? 277 LYS B CG  1 
ATOM   3989 C  CD  . LYS B 1 85  ? 29.462  36.979 101.397 1.00 123.88 ? 277 LYS B CD  1 
ATOM   3990 C  CE  . LYS B 1 85  ? 30.356  38.188 101.683 1.00 123.51 ? 277 LYS B CE  1 
ATOM   3991 N  NZ  . LYS B 1 85  ? 29.797  39.092 102.735 1.00 123.89 ? 277 LYS B NZ  1 
ATOM   3992 N  N   . GLY B 1 86  ? 26.821  34.161 97.893  1.00 120.72 ? 278 GLY B N   1 
ATOM   3993 C  CA  . GLY B 1 86  ? 26.366  32.891 97.325  1.00 121.76 ? 278 GLY B CA  1 
ATOM   3994 C  C   . GLY B 1 86  ? 25.223  32.203 98.054  1.00 121.70 ? 278 GLY B C   1 
ATOM   3995 O  O   . GLY B 1 86  ? 24.073  32.272 97.616  1.00 122.81 ? 278 GLY B O   1 
ATOM   3996 N  N   . GLY B 1 87  ? 25.538  31.538 99.164  1.00 119.56 ? 279 GLY B N   1 
ATOM   3997 C  CA  . GLY B 1 87  ? 24.544  30.754 99.906  1.00 117.15 ? 279 GLY B CA  1 
ATOM   3998 C  C   . GLY B 1 87  ? 23.856  31.518 101.025 1.00 113.53 ? 279 GLY B C   1 
ATOM   3999 O  O   . GLY B 1 87  ? 23.763  31.036 102.160 1.00 114.18 ? 279 GLY B O   1 
ATOM   4000 N  N   . ASP B 1 88  ? 23.374  32.712 100.699 1.00 107.13 ? 280 ASP B N   1 
ATOM   4001 C  CA  . ASP B 1 88  ? 22.682  33.562 101.650 1.00 101.58 ? 280 ASP B CA  1 
ATOM   4002 C  C   . ASP B 1 88  ? 21.186  33.453 101.376 1.00 100.34 ? 280 ASP B C   1 
ATOM   4003 O  O   . ASP B 1 88  ? 20.689  34.014 100.403 1.00 102.51 ? 280 ASP B O   1 
ATOM   4004 C  CB  . ASP B 1 88  ? 23.177  35.000 101.490 1.00 99.51  ? 280 ASP B CB  1 
ATOM   4005 C  CG  . ASP B 1 88  ? 22.523  35.964 102.456 1.00 97.86  ? 280 ASP B CG  1 
ATOM   4006 O  OD1 . ASP B 1 88  ? 21.848  35.519 103.404 1.00 97.80  ? 280 ASP B OD1 1 
ATOM   4007 O  OD2 . ASP B 1 88  ? 22.693  37.183 102.263 1.00 97.87  ? 280 ASP B OD2 1 
ATOM   4008 N  N   . GLU B 1 89  ? 20.474  32.735 102.238 1.00 98.61  ? 281 GLU B N   1 
ATOM   4009 C  CA  . GLU B 1 89  ? 19.089  32.338 101.966 1.00 100.99 ? 281 GLU B CA  1 
ATOM   4010 C  C   . GLU B 1 89  ? 18.055  33.428 102.267 1.00 98.52  ? 281 GLU B C   1 
ATOM   4011 O  O   . GLU B 1 89  ? 16.859  33.153 102.370 1.00 99.01  ? 281 GLU B O   1 
ATOM   4012 C  CB  . GLU B 1 89  ? 18.743  31.085 102.773 1.00 101.91 ? 281 GLU B CB  1 
ATOM   4013 C  CG  . GLU B 1 89  ? 19.428  29.802 102.340 1.00 102.75 ? 281 GLU B CG  1 
ATOM   4014 C  CD  . GLU B 1 89  ? 19.121  28.649 103.286 1.00 105.92 ? 281 GLU B CD  1 
ATOM   4015 O  OE1 . GLU B 1 89  ? 19.980  27.746 103.427 1.00 109.72 ? 281 GLU B OE1 1 
ATOM   4016 O  OE2 . GLU B 1 89  ? 18.027  28.651 103.902 1.00 106.89 ? 281 GLU B OE2 1 
ATOM   4017 N  N   . ARG B 1 90  ? 18.510  34.667 102.351 1.00 95.10  ? 282 ARG B N   1 
ATOM   4018 C  CA  . ARG B 1 90  ? 17.780  35.702 103.070 1.00 91.58  ? 282 ARG B CA  1 
ATOM   4019 C  C   . ARG B 1 90  ? 16.497  36.293 102.438 1.00 90.49  ? 282 ARG B C   1 
ATOM   4020 O  O   . ARG B 1 90  ? 15.757  36.995 103.120 1.00 94.54  ? 282 ARG B O   1 
ATOM   4021 C  CB  . ARG B 1 90  ? 18.758  36.810 103.488 1.00 86.99  ? 282 ARG B CB  1 
ATOM   4022 C  CG  . ARG B 1 90  ? 18.642  37.208 104.928 1.00 83.33  ? 282 ARG B CG  1 
ATOM   4023 C  CD  . ARG B 1 90  ? 19.987  37.547 105.530 1.00 86.72  ? 282 ARG B CD  1 
ATOM   4024 N  NE  . ARG B 1 90  ? 20.308  38.973 105.502 1.00 87.84  ? 282 ARG B NE  1 
ATOM   4025 C  CZ  . ARG B 1 90  ? 21.336  39.504 104.847 1.00 87.86  ? 282 ARG B CZ  1 
ATOM   4026 N  NH1 . ARG B 1 90  ? 22.161  38.733 104.156 1.00 87.25  ? 282 ARG B NH1 1 
ATOM   4027 N  NH2 . ARG B 1 90  ? 21.547  40.812 104.893 1.00 89.79  ? 282 ARG B NH2 1 
ATOM   4028 N  N   . GLY B 1 91  ? 16.200  36.009 101.177 1.00 86.20  ? 283 GLY B N   1 
ATOM   4029 C  CA  . GLY B 1 91  ? 15.059  36.703 100.510 1.00 89.85  ? 283 GLY B CA  1 
ATOM   4030 C  C   . GLY B 1 91  ? 13.588  36.430 100.870 1.00 84.20  ? 283 GLY B C   1 
ATOM   4031 O  O   . GLY B 1 91  ? 13.245  36.192 102.025 1.00 82.16  ? 283 GLY B O   1 
ATOM   4032 N  N   . LEU B 1 92  ? 12.717  36.523 99.863  1.00 83.73  ? 284 LEU B N   1 
ATOM   4033 C  CA  . LEU B 1 92  ? 11.354  35.964 99.912  1.00 84.72  ? 284 LEU B CA  1 
ATOM   4034 C  C   . LEU B 1 92  ? 11.459  34.441 99.802  1.00 90.15  ? 284 LEU B C   1 
ATOM   4035 O  O   . LEU B 1 92  ? 12.307  33.922 99.065  1.00 95.83  ? 284 LEU B O   1 
ATOM   4036 C  CB  . LEU B 1 92  ? 10.481  36.523 98.769  1.00 80.95  ? 284 LEU B CB  1 
ATOM   4037 C  CG  . LEU B 1 92  ? 9.070   35.959 98.512  1.00 79.27  ? 284 LEU B CG  1 
ATOM   4038 C  CD1 . LEU B 1 92  ? 8.023   36.448 99.523  1.00 76.28  ? 284 LEU B CD1 1 
ATOM   4039 C  CD2 . LEU B 1 92  ? 8.610   36.281 97.106  1.00 79.34  ? 284 LEU B CD2 1 
ATOM   4040 N  N   . LEU B 1 93  ? 10.601  33.726 100.526 1.00 89.36  ? 285 LEU B N   1 
ATOM   4041 C  CA  . LEU B 1 93  ? 10.797  32.294 100.725 1.00 86.55  ? 285 LEU B CA  1 
ATOM   4042 C  C   . LEU B 1 93  ? 9.667   31.421 100.205 1.00 88.71  ? 285 LEU B C   1 
ATOM   4043 O  O   . LEU B 1 93  ? 9.927   30.369 99.628  1.00 93.70  ? 285 LEU B O   1 
ATOM   4044 C  CB  . LEU B 1 93  ? 11.083  31.986 102.203 1.00 86.52  ? 285 LEU B CB  1 
ATOM   4045 C  CG  . LEU B 1 93  ? 12.268  32.706 102.871 1.00 86.10  ? 285 LEU B CG  1 
ATOM   4046 C  CD1 . LEU B 1 93  ? 12.482  32.248 104.308 1.00 85.35  ? 285 LEU B CD1 1 
ATOM   4047 C  CD2 . LEU B 1 93  ? 13.550  32.544 102.070 1.00 85.98  ? 285 LEU B CD2 1 
ATOM   4048 N  N   . SER B 1 94  ? 8.421   31.830 100.408 1.00 87.68  ? 286 SER B N   1 
ATOM   4049 C  CA  . SER B 1 94  ? 7.306   31.024 99.930  1.00 88.95  ? 286 SER B CA  1 
ATOM   4050 C  C   . SER B 1 94  ? 5.992   31.800 99.791  1.00 91.12  ? 286 SER B C   1 
ATOM   4051 O  O   . SER B 1 94  ? 5.790   32.823 100.448 1.00 91.41  ? 286 SER B O   1 
ATOM   4052 C  CB  . SER B 1 94  ? 7.122   29.797 100.824 1.00 89.05  ? 286 SER B CB  1 
ATOM   4053 O  OG  . SER B 1 94  ? 6.084   28.963 100.338 1.00 94.06  ? 286 SER B OG  1 
ATOM   4054 N  N   . LEU B 1 95  ? 5.116   31.294 98.921  1.00 91.54  ? 287 LEU B N   1 
ATOM   4055 C  CA  . LEU B 1 95  ? 3.768   31.825 98.741  1.00 93.01  ? 287 LEU B CA  1 
ATOM   4056 C  C   . LEU B 1 95  ? 2.791   30.674 98.868  1.00 93.92  ? 287 LEU B C   1 
ATOM   4057 O  O   . LEU B 1 95  ? 3.079   29.568 98.407  1.00 99.08  ? 287 LEU B O   1 
ATOM   4058 C  CB  . LEU B 1 95  ? 3.613   32.422 97.342  1.00 93.62  ? 287 LEU B CB  1 
ATOM   4059 C  CG  . LEU B 1 95  ? 2.794   33.687 97.057  1.00 92.30  ? 287 LEU B CG  1 
ATOM   4060 C  CD1 . LEU B 1 95  ? 2.266   33.641 95.637  1.00 91.48  ? 287 LEU B CD1 1 
ATOM   4061 C  CD2 . LEU B 1 95  ? 1.661   33.874 98.011  1.00 93.95  ? 287 LEU B CD2 1 
ATOM   4062 N  N   . ALA B 1 96  ? 1.642   30.926 99.488  1.00 90.38  ? 288 ALA B N   1 
ATOM   4063 C  CA  . ALA B 1 96  ? 0.556   29.946 99.537  1.00 87.31  ? 288 ALA B CA  1 
ATOM   4064 C  C   . ALA B 1 96  ? -0.761  30.670 99.406  1.00 88.58  ? 288 ALA B C   1 
ATOM   4065 O  O   . ALA B 1 96  ? -0.986  31.680 100.078 1.00 91.80  ? 288 ALA B O   1 
ATOM   4066 C  CB  . ALA B 1 96  ? 0.594   29.161 100.822 1.00 85.64  ? 288 ALA B CB  1 
ATOM   4067 N  N   . PHE B 1 97  ? -1.626  30.178 98.526  1.00 87.13  ? 289 PHE B N   1 
ATOM   4068 C  CA  . PHE B 1 97  ? -2.942  30.783 98.371  1.00 86.12  ? 289 PHE B CA  1 
ATOM   4069 C  C   . PHE B 1 97  ? -3.937  30.017 99.215  1.00 87.44  ? 289 PHE B C   1 
ATOM   4070 O  O   . PHE B 1 97  ? -3.863  28.793 99.317  1.00 89.62  ? 289 PHE B O   1 
ATOM   4071 C  CB  . PHE B 1 97  ? -3.380  30.801 96.901  1.00 86.38  ? 289 PHE B CB  1 
ATOM   4072 C  CG  . PHE B 1 97  ? -2.632  31.795 96.052  1.00 88.50  ? 289 PHE B CG  1 
ATOM   4073 C  CD1 . PHE B 1 97  ? -1.499  31.414 95.343  1.00 89.16  ? 289 PHE B CD1 1 
ATOM   4074 C  CD2 . PHE B 1 97  ? -3.060  33.121 95.962  1.00 90.05  ? 289 PHE B CD2 1 
ATOM   4075 C  CE1 . PHE B 1 97  ? -0.807  32.335 94.548  1.00 89.21  ? 289 PHE B CE1 1 
ATOM   4076 C  CE2 . PHE B 1 97  ? -2.365  34.050 95.180  1.00 89.25  ? 289 PHE B CE2 1 
ATOM   4077 C  CZ  . PHE B 1 97  ? -1.237  33.656 94.475  1.00 86.96  ? 289 PHE B CZ  1 
ATOM   4078 N  N   . HIS B 1 98  ? -4.867  30.737 99.830  1.00 90.79  ? 290 HIS B N   1 
ATOM   4079 C  CA  . HIS B 1 98  ? -5.955  30.092 100.565 1.00 88.09  ? 290 HIS B CA  1 
ATOM   4080 C  C   . HIS B 1 98  ? -6.786  29.225 99.611  1.00 88.24  ? 290 HIS B C   1 
ATOM   4081 O  O   . HIS B 1 98  ? -7.058  29.635 98.478  1.00 88.31  ? 290 HIS B O   1 
ATOM   4082 C  CB  . HIS B 1 98  ? -6.841  31.124 101.266 1.00 84.27  ? 290 HIS B CB  1 
ATOM   4083 C  CG  . HIS B 1 98  ? -7.814  30.513 102.222 1.00 84.74  ? 290 HIS B CG  1 
ATOM   4084 N  ND1 . HIS B 1 98  ? -8.994  29.931 101.811 1.00 83.61  ? 290 HIS B ND1 1 
ATOM   4085 C  CD2 . HIS B 1 98  ? -7.770  30.364 103.566 1.00 83.45  ? 290 HIS B CD2 1 
ATOM   4086 C  CE1 . HIS B 1 98  ? -9.638  29.457 102.860 1.00 81.77  ? 290 HIS B CE1 1 
ATOM   4087 N  NE2 . HIS B 1 98  ? -8.919  29.709 103.938 1.00 82.59  ? 290 HIS B NE2 1 
ATOM   4088 N  N   . PRO B 1 99  ? -7.177  28.016 100.060 1.00 88.01  ? 291 PRO B N   1 
ATOM   4089 C  CA  . PRO B 1 99  ? -7.989  27.119 99.233  1.00 87.39  ? 291 PRO B CA  1 
ATOM   4090 C  C   . PRO B 1 99  ? -9.273  27.766 98.718  1.00 90.12  ? 291 PRO B C   1 
ATOM   4091 O  O   . PRO B 1 99  ? -9.794  27.350 97.686  1.00 94.79  ? 291 PRO B O   1 
ATOM   4092 C  CB  . PRO B 1 99  ? -8.311  25.973 100.183 1.00 87.55  ? 291 PRO B CB  1 
ATOM   4093 C  CG  . PRO B 1 99  ? -7.172  25.969 101.146 1.00 88.57  ? 291 PRO B CG  1 
ATOM   4094 C  CD  . PRO B 1 99  ? -6.861  27.410 101.366 1.00 86.97  ? 291 PRO B CD  1 
ATOM   4095 N  N   . ASN B 1 100 ? -9.770  28.772 99.431  1.00 90.89  ? 292 ASN B N   1 
ATOM   4096 C  CA  . ASN B 1 100 ? -10.893 29.576 98.961  1.00 92.38  ? 292 ASN B CA  1 
ATOM   4097 C  C   . ASN B 1 100 ? -10.525 30.985 98.497  1.00 92.10  ? 292 ASN B C   1 
ATOM   4098 O  O   . ASN B 1 100 ? -11.232 31.953 98.787  1.00 91.39  ? 292 ASN B O   1 
ATOM   4099 C  CB  . ASN B 1 100 ? -11.979 29.638 100.018 1.00 96.84  ? 292 ASN B CB  1 
ATOM   4100 C  CG  . ASN B 1 100 ? -13.249 29.019 99.547  1.00 102.40 ? 292 ASN B CG  1 
ATOM   4101 O  OD1 . ASN B 1 100 ? -14.016 29.637 98.805  1.00 104.60 ? 292 ASN B OD1 1 
ATOM   4102 N  ND2 . ASN B 1 100 ? -13.484 27.779 99.955  1.00 106.04 ? 292 ASN B ND2 1 
ATOM   4103 N  N   . TYR B 1 101 ? -9.427  31.087 97.754  1.00 91.85  ? 293 TYR B N   1 
ATOM   4104 C  CA  . TYR B 1 101 ? -8.930  32.374 97.290  1.00 88.21  ? 293 TYR B CA  1 
ATOM   4105 C  C   . TYR B 1 101 ? -9.924  33.032 96.335  1.00 89.84  ? 293 TYR B C   1 
ATOM   4106 O  O   . TYR B 1 101 ? -10.040 34.261 96.300  1.00 91.92  ? 293 TYR B O   1 
ATOM   4107 C  CB  . TYR B 1 101 ? -7.556  32.207 96.637  1.00 83.46  ? 293 TYR B CB  1 
ATOM   4108 C  CG  . TYR B 1 101 ? -7.056  33.433 95.918  1.00 84.19  ? 293 TYR B CG  1 
ATOM   4109 C  CD1 . TYR B 1 101 ? -6.394  34.451 96.604  1.00 85.80  ? 293 TYR B CD1 1 
ATOM   4110 C  CD2 . TYR B 1 101 ? -7.235  33.573 94.542  1.00 82.88  ? 293 TYR B CD2 1 
ATOM   4111 C  CE1 . TYR B 1 101 ? -5.930  35.587 95.935  1.00 83.21  ? 293 TYR B CE1 1 
ATOM   4112 C  CE2 . TYR B 1 101 ? -6.782  34.697 93.873  1.00 81.07  ? 293 TYR B CE2 1 
ATOM   4113 C  CZ  . TYR B 1 101 ? -6.129  35.692 94.574  1.00 81.92  ? 293 TYR B CZ  1 
ATOM   4114 O  OH  . TYR B 1 101 ? -5.696  36.798 93.896  1.00 83.71  ? 293 TYR B OH  1 
ATOM   4115 N  N   . LYS B 1 102 ? -10.644 32.206 95.574  1.00 87.89  ? 294 LYS B N   1 
ATOM   4116 C  CA  . LYS B 1 102 ? -11.608 32.690 94.583  1.00 86.77  ? 294 LYS B CA  1 
ATOM   4117 C  C   . LYS B 1 102 ? -12.706 33.527 95.244  1.00 87.97  ? 294 LYS B C   1 
ATOM   4118 O  O   . LYS B 1 102 ? -13.332 34.375 94.594  1.00 90.62  ? 294 LYS B O   1 
ATOM   4119 C  CB  . LYS B 1 102 ? -12.203 31.505 93.814  1.00 86.97  ? 294 LYS B CB  1 
ATOM   4120 C  CG  . LYS B 1 102 ? -12.959 31.859 92.541  1.00 87.63  ? 294 LYS B CG  1 
ATOM   4121 C  CD  . LYS B 1 102 ? -13.322 30.609 91.734  1.00 89.88  ? 294 LYS B CD  1 
ATOM   4122 C  CE  . LYS B 1 102 ? -14.071 30.967 90.442  1.00 94.74  ? 294 LYS B CE  1 
ATOM   4123 N  NZ  . LYS B 1 102 ? -13.912 29.948 89.350  1.00 96.10  ? 294 LYS B NZ  1 
ATOM   4124 N  N   . LYS B 1 103 ? -12.919 33.291 96.539  1.00 87.47  ? 295 LYS B N   1 
ATOM   4125 C  CA  . LYS B 1 103 ? -13.911 34.020 97.321  1.00 87.58  ? 295 LYS B CA  1 
ATOM   4126 C  C   . LYS B 1 103 ? -13.265 35.068 98.224  1.00 87.17  ? 295 LYS B C   1 
ATOM   4127 O  O   . LYS B 1 103 ? -13.526 36.255 98.071  1.00 89.88  ? 295 LYS B O   1 
ATOM   4128 C  CB  . LYS B 1 103 ? -14.749 33.053 98.162  1.00 90.30  ? 295 LYS B CB  1 
ATOM   4129 C  CG  . LYS B 1 103 ? -15.815 33.737 99.001  1.00 92.16  ? 295 LYS B CG  1 
ATOM   4130 C  CD  . LYS B 1 103 ? -16.366 32.820 100.082 1.00 93.28  ? 295 LYS B CD  1 
ATOM   4131 C  CE  . LYS B 1 103 ? -17.394 33.550 100.942 1.00 93.13  ? 295 LYS B CE  1 
ATOM   4132 N  NZ  . LYS B 1 103 ? -17.860 32.714 102.084 1.00 92.99  ? 295 LYS B NZ  1 
ATOM   4133 N  N   . ASN B 1 104 ? -12.428 34.626 99.160  1.00 86.34  ? 296 ASN B N   1 
ATOM   4134 C  CA  . ASN B 1 104 ? -11.865 35.520 100.175 1.00 85.25  ? 296 ASN B CA  1 
ATOM   4135 C  C   . ASN B 1 104 ? -10.604 36.284 99.764  1.00 84.59  ? 296 ASN B C   1 
ATOM   4136 O  O   . ASN B 1 104 ? -10.233 37.259 100.409 1.00 85.28  ? 296 ASN B O   1 
ATOM   4137 C  CB  . ASN B 1 104 ? -11.648 34.778 101.505 1.00 85.76  ? 296 ASN B CB  1 
ATOM   4138 C  CG  . ASN B 1 104 ? -10.598 33.675 101.416 1.00 86.46  ? 296 ASN B CG  1 
ATOM   4139 O  OD1 . ASN B 1 104 ? -9.658  33.746 100.620 1.00 88.50  ? 296 ASN B OD1 1 
ATOM   4140 N  ND2 . ASN B 1 104 ? -10.744 32.657 102.262 1.00 83.81  ? 296 ASN B ND2 1 
ATOM   4141 N  N   . GLY B 1 105 ? -9.946  35.830 98.703  1.00 85.37  ? 297 GLY B N   1 
ATOM   4142 C  CA  . GLY B 1 105 ? -8.776  36.526 98.147  1.00 85.80  ? 297 GLY B CA  1 
ATOM   4143 C  C   . GLY B 1 105 ? -7.538  36.599 99.024  1.00 83.05  ? 297 GLY B C   1 
ATOM   4144 O  O   . GLY B 1 105 ? -6.794  37.575 98.974  1.00 81.58  ? 297 GLY B O   1 
ATOM   4145 N  N   . LYS B 1 106 ? -7.300  35.546 99.798  1.00 81.70  ? 298 LYS B N   1 
ATOM   4146 C  CA  . LYS B 1 106 ? -6.253  35.555 100.800 1.00 81.74  ? 298 LYS B CA  1 
ATOM   4147 C  C   . LYS B 1 106 ? -4.984  34.807 100.404 1.00 87.06  ? 298 LYS B C   1 
ATOM   4148 O  O   . LYS B 1 106 ? -5.045  33.644 100.006 1.00 91.97  ? 298 LYS B O   1 
ATOM   4149 C  CB  . LYS B 1 106 ? -6.816  34.994 102.094 1.00 79.26  ? 298 LYS B CB  1 
ATOM   4150 C  CG  . LYS B 1 106 ? -7.965  35.811 102.595 1.00 77.08  ? 298 LYS B CG  1 
ATOM   4151 C  CD  . LYS B 1 106 ? -7.851  36.020 104.072 1.00 76.21  ? 298 LYS B CD  1 
ATOM   4152 C  CE  . LYS B 1 106 ? -8.597  37.267 104.499 1.00 75.59  ? 298 LYS B CE  1 
ATOM   4153 N  NZ  . LYS B 1 106 ? -7.798  38.498 104.312 1.00 75.91  ? 298 LYS B NZ  1 
ATOM   4154 N  N   . LEU B 1 107 ? -3.839  35.487 100.506 1.00 88.61  ? 299 LEU B N   1 
ATOM   4155 C  CA  . LEU B 1 107 ? -2.532  34.859 100.293 1.00 86.78  ? 299 LEU B CA  1 
ATOM   4156 C  C   . LEU B 1 107 ? -1.841  34.728 101.623 1.00 86.05  ? 299 LEU B C   1 
ATOM   4157 O  O   . LEU B 1 107 ? -2.193  35.406 102.586 1.00 83.95  ? 299 LEU B O   1 
ATOM   4158 C  CB  . LEU B 1 107 ? -1.586  35.714 99.454  1.00 84.53  ? 299 LEU B CB  1 
ATOM   4159 C  CG  . LEU B 1 107 ? -1.801  36.738 98.354  1.00 86.70  ? 299 LEU B CG  1 
ATOM   4160 C  CD1 . LEU B 1 107 ? -2.849  37.792 98.656  1.00 87.23  ? 299 LEU B CD1 1 
ATOM   4161 C  CD2 . LEU B 1 107 ? -0.442  37.396 98.170  1.00 86.58  ? 299 LEU B CD2 1 
ATOM   4162 N  N   . TYR B 1 108 ? -0.817  33.882 101.650 1.00 86.62  ? 300 TYR B N   1 
ATOM   4163 C  CA  . TYR B 1 108 ? 0.109   33.811 102.770 1.00 86.64  ? 300 TYR B CA  1 
ATOM   4164 C  C   . TYR B 1 108 ? 1.522   33.784 102.233 1.00 88.45  ? 300 TYR B C   1 
ATOM   4165 O  O   . TYR B 1 108 ? 1.826   33.090 101.259 1.00 92.17  ? 300 TYR B O   1 
ATOM   4166 C  CB  . TYR B 1 108 ? -0.204  32.610 103.663 1.00 84.63  ? 300 TYR B CB  1 
ATOM   4167 C  CG  . TYR B 1 108 ? -1.613  32.707 104.162 1.00 84.35  ? 300 TYR B CG  1 
ATOM   4168 C  CD1 . TYR B 1 108 ? -2.672  32.236 103.387 1.00 85.31  ? 300 TYR B CD1 1 
ATOM   4169 C  CD2 . TYR B 1 108 ? -1.901  33.338 105.372 1.00 82.61  ? 300 TYR B CD2 1 
ATOM   4170 C  CE1 . TYR B 1 108 ? -3.972  32.364 103.815 1.00 85.33  ? 300 TYR B CE1 1 
ATOM   4171 C  CE2 . TYR B 1 108 ? -3.198  33.457 105.816 1.00 80.76  ? 300 TYR B CE2 1 
ATOM   4172 C  CZ  . TYR B 1 108 ? -4.224  32.975 105.029 1.00 83.24  ? 300 TYR B CZ  1 
ATOM   4173 O  OH  . TYR B 1 108 ? -5.514  33.102 105.442 1.00 84.92  ? 300 TYR B OH  1 
ATOM   4174 N  N   . VAL B 1 109 ? 2.377   34.572 102.860 1.00 87.52  ? 301 VAL B N   1 
ATOM   4175 C  CA  . VAL B 1 109 ? 3.722   34.774 102.363 1.00 86.94  ? 301 VAL B CA  1 
ATOM   4176 C  C   . VAL B 1 109 ? 4.724   34.691 103.506 1.00 87.28  ? 301 VAL B C   1 
ATOM   4177 O  O   . VAL B 1 109 ? 4.473   35.194 104.606 1.00 89.55  ? 301 VAL B O   1 
ATOM   4178 C  CB  . VAL B 1 109 ? 3.805   36.110 101.568 1.00 85.20  ? 301 VAL B CB  1 
ATOM   4179 C  CG1 . VAL B 1 109 ? 4.721   37.121 102.235 1.00 84.28  ? 301 VAL B CG1 1 
ATOM   4180 C  CG2 . VAL B 1 109 ? 4.198   35.843 100.129 1.00 83.90  ? 301 VAL B CG2 1 
ATOM   4181 N  N   . SER B 1 110 ? 5.838   34.016 103.255 1.00 88.55  ? 302 SER B N   1 
ATOM   4182 C  CA  . SER B 1 110 ? 6.922   33.952 104.233 1.00 89.90  ? 302 SER B CA  1 
ATOM   4183 C  C   . SER B 1 110 ? 8.162   34.617 103.665 1.00 90.10  ? 302 SER B C   1 
ATOM   4184 O  O   . SER B 1 110 ? 8.585   34.311 102.546 1.00 89.44  ? 302 SER B O   1 
ATOM   4185 C  CB  . SER B 1 110 ? 7.218   32.511 104.661 1.00 88.09  ? 302 SER B CB  1 
ATOM   4186 O  OG  . SER B 1 110 ? 7.445   31.684 103.538 1.00 87.89  ? 302 SER B OG  1 
ATOM   4187 N  N   . TYR B 1 111 ? 8.722   35.548 104.431 1.00 89.53  ? 303 TYR B N   1 
ATOM   4188 C  CA  . TYR B 1 111 ? 9.905   36.272 103.989 1.00 90.58  ? 303 TYR B CA  1 
ATOM   4189 C  C   . TYR B 1 111 ? 10.784  36.705 105.135 1.00 92.05  ? 303 TYR B C   1 
ATOM   4190 O  O   . TYR B 1 111 ? 10.348  36.758 106.286 1.00 93.99  ? 303 TYR B O   1 
ATOM   4191 C  CB  . TYR B 1 111 ? 9.526   37.492 103.152 1.00 89.25  ? 303 TYR B CB  1 
ATOM   4192 C  CG  . TYR B 1 111 ? 8.782   38.578 103.901 1.00 88.70  ? 303 TYR B CG  1 
ATOM   4193 C  CD1 . TYR B 1 111 ? 9.466   39.564 104.612 1.00 87.74  ? 303 TYR B CD1 1 
ATOM   4194 C  CD2 . TYR B 1 111 ? 7.392   38.639 103.868 1.00 86.32  ? 303 TYR B CD2 1 
ATOM   4195 C  CE1 . TYR B 1 111 ? 8.773   40.569 105.280 1.00 87.74  ? 303 TYR B CE1 1 
ATOM   4196 C  CE2 . TYR B 1 111 ? 6.700   39.634 104.530 1.00 85.08  ? 303 TYR B CE2 1 
ATOM   4197 C  CZ  . TYR B 1 111 ? 7.389   40.593 105.233 1.00 87.02  ? 303 TYR B CZ  1 
ATOM   4198 O  OH  . TYR B 1 111 ? 6.685   41.578 105.886 1.00 89.40  ? 303 TYR B OH  1 
ATOM   4199 N  N   . THR B 1 112 ? 12.023  37.036 104.792 1.00 93.32  ? 304 THR B N   1 
ATOM   4200 C  CA  . THR B 1 112 ? 13.011  37.480 105.755 1.00 94.96  ? 304 THR B CA  1 
ATOM   4201 C  C   . THR B 1 112 ? 13.101  39.003 105.771 1.00 98.23  ? 304 THR B C   1 
ATOM   4202 O  O   . THR B 1 112 ? 13.328  39.636 104.735 1.00 99.37  ? 304 THR B O   1 
ATOM   4203 C  CB  . THR B 1 112 ? 14.380  36.850 105.456 1.00 91.92  ? 304 THR B CB  1 
ATOM   4204 O  OG1 . THR B 1 112 ? 14.501  35.618 106.175 1.00 90.65  ? 304 THR B OG1 1 
ATOM   4205 C  CG2 . THR B 1 112 ? 15.506  37.774 105.875 1.00 94.79  ? 304 THR B CG2 1 
ATOM   4206 N  N   . THR B 1 113 ? 12.927  39.584 106.955 1.00 98.48  ? 305 THR B N   1 
ATOM   4207 C  CA  . THR B 1 113 ? 12.966  41.030 107.096 1.00 99.34  ? 305 THR B CA  1 
ATOM   4208 C  C   . THR B 1 113 ? 13.904  41.491 108.195 1.00 101.37 ? 305 THR B C   1 
ATOM   4209 O  O   . THR B 1 113 ? 14.296  40.715 109.070 1.00 96.67  ? 305 THR B O   1 
ATOM   4210 C  CB  . THR B 1 113 ? 11.569  41.622 107.358 1.00 99.41  ? 305 THR B CB  1 
ATOM   4211 O  OG1 . THR B 1 113 ? 11.676  43.045 107.491 1.00 99.19  ? 305 THR B OG1 1 
ATOM   4212 C  CG2 . THR B 1 113 ? 10.954  41.039 108.634 1.00 97.93  ? 305 THR B CG2 1 
ATOM   4213 N  N   . ASN B 1 114 ? 14.238  42.777 108.138 1.00 108.13 ? 306 ASN B N   1 
ATOM   4214 C  CA  . ASN B 1 114 ? 15.105  43.391 109.121 1.00 114.26 ? 306 ASN B CA  1 
ATOM   4215 C  C   . ASN B 1 114 ? 14.399  44.178 110.208 1.00 119.68 ? 306 ASN B C   1 
ATOM   4216 O  O   . ASN B 1 114 ? 13.809  45.232 109.956 1.00 118.98 ? 306 ASN B O   1 
ATOM   4217 C  CB  . ASN B 1 114 ? 16.169  44.259 108.449 1.00 115.36 ? 306 ASN B CB  1 
ATOM   4218 C  CG  . ASN B 1 114 ? 17.538  43.616 108.475 1.00 117.56 ? 306 ASN B CG  1 
ATOM   4219 O  OD1 . ASN B 1 114 ? 17.774  42.650 109.208 1.00 117.73 ? 306 ASN B OD1 1 
ATOM   4220 N  ND2 . ASN B 1 114 ? 18.456  44.154 107.682 1.00 118.90 ? 306 ASN B ND2 1 
ATOM   4221 N  N   . GLN B 1 115 ? 14.431  43.600 111.406 1.00 126.81 ? 307 GLN B N   1 
ATOM   4222 C  CA  . GLN B 1 115 ? 14.379  44.333 112.674 1.00 132.81 ? 307 GLN B CA  1 
ATOM   4223 C  C   . GLN B 1 115 ? 13.121  45.161 113.017 1.00 136.18 ? 307 GLN B C   1 
ATOM   4224 O  O   . GLN B 1 115 ? 12.556  44.975 114.097 1.00 138.14 ? 307 GLN B O   1 
ATOM   4225 C  CB  . GLN B 1 115 ? 15.687  45.131 112.855 1.00 133.82 ? 307 GLN B CB  1 
ATOM   4226 C  CG  . GLN B 1 115 ? 15.745  46.073 114.045 1.00 135.58 ? 307 GLN B CG  1 
ATOM   4227 C  CD  . GLN B 1 115 ? 15.539  47.520 113.645 1.00 136.44 ? 307 GLN B CD  1 
ATOM   4228 O  OE1 . GLN B 1 115 ? 15.061  47.814 112.547 1.00 136.21 ? 307 GLN B OE1 1 
ATOM   4229 N  NE2 . GLN B 1 115 ? 15.896  48.436 114.539 1.00 137.00 ? 307 GLN B NE2 1 
ATOM   4230 N  N   . GLU B 1 116 ? 12.680  46.053 112.123 1.00 137.89 ? 308 GLU B N   1 
ATOM   4231 C  CA  . GLU B 1 116 ? 11.580  47.002 112.431 1.00 138.40 ? 308 GLU B CA  1 
ATOM   4232 C  C   . GLU B 1 116 ? 11.470  47.336 113.931 1.00 137.51 ? 308 GLU B C   1 
ATOM   4233 O  O   . GLU B 1 116 ? 10.399  47.238 114.537 1.00 138.95 ? 308 GLU B O   1 
ATOM   4234 C  CB  . GLU B 1 116 ? 10.227  46.556 111.834 1.00 139.52 ? 308 GLU B CB  1 
ATOM   4235 C  CG  . GLU B 1 116 ? 10.074  45.057 111.530 1.00 141.50 ? 308 GLU B CG  1 
ATOM   4236 C  CD  . GLU B 1 116 ? 9.744   44.207 112.752 1.00 141.30 ? 308 GLU B CD  1 
ATOM   4237 O  OE1 . GLU B 1 116 ? 10.191  43.040 112.793 1.00 140.14 ? 308 GLU B OE1 1 
ATOM   4238 O  OE2 . GLU B 1 116 ? 9.036   44.694 113.662 1.00 141.44 ? 308 GLU B OE2 1 
ATOM   4239 N  N   . ARG B 1 117 ? 12.607  47.738 114.499 1.00 134.95 ? 309 ARG B N   1 
ATOM   4240 C  CA  . ARG B 1 117 ? 12.795  47.944 115.941 1.00 132.62 ? 309 ARG B CA  1 
ATOM   4241 C  C   . ARG B 1 117 ? 12.312  46.784 116.816 1.00 128.99 ? 309 ARG B C   1 
ATOM   4242 O  O   . ARG B 1 117 ? 11.515  46.963 117.742 1.00 129.76 ? 309 ARG B O   1 
ATOM   4243 C  CB  . ARG B 1 117 ? 12.233  49.299 116.402 1.00 134.76 ? 309 ARG B CB  1 
ATOM   4244 C  CG  . ARG B 1 117 ? 13.008  50.502 115.862 1.00 135.67 ? 309 ARG B CG  1 
ATOM   4245 C  CD  . ARG B 1 117 ? 13.080  51.631 116.883 1.00 136.31 ? 309 ARG B CD  1 
ATOM   4246 N  NE  . ARG B 1 117 ? 14.060  51.352 117.933 1.00 136.56 ? 309 ARG B NE  1 
ATOM   4247 C  CZ  . ARG B 1 117 ? 14.269  52.117 119.003 1.00 136.40 ? 309 ARG B CZ  1 
ATOM   4248 N  NH1 . ARG B 1 117 ? 13.565  53.228 119.187 1.00 136.43 ? 309 ARG B NH1 1 
ATOM   4249 N  NH2 . ARG B 1 117 ? 15.185  51.769 119.896 1.00 136.20 ? 309 ARG B NH2 1 
ATOM   4250 N  N   . TRP B 1 118 ? 12.813  45.593 116.489 1.00 123.49 ? 310 TRP B N   1 
ATOM   4251 C  CA  . TRP B 1 118 ? 12.647  44.380 117.291 1.00 118.61 ? 310 TRP B CA  1 
ATOM   4252 C  C   . TRP B 1 118 ? 13.606  44.480 118.477 1.00 116.87 ? 310 TRP B C   1 
ATOM   4253 O  O   . TRP B 1 118 ? 14.821  44.313 118.334 1.00 117.26 ? 310 TRP B O   1 
ATOM   4254 C  CB  . TRP B 1 118 ? 12.932  43.144 116.420 1.00 114.90 ? 310 TRP B CB  1 
ATOM   4255 C  CG  . TRP B 1 118 ? 13.045  41.799 117.115 1.00 114.07 ? 310 TRP B CG  1 
ATOM   4256 C  CD1 . TRP B 1 118 ? 14.091  41.352 117.874 1.00 113.16 ? 310 TRP B CD1 1 
ATOM   4257 C  CD2 . TRP B 1 118 ? 12.106  40.712 117.053 1.00 114.02 ? 310 TRP B CD2 1 
ATOM   4258 N  NE1 . TRP B 1 118 ? 13.850  40.073 118.313 1.00 112.87 ? 310 TRP B NE1 1 
ATOM   4259 C  CE2 . TRP B 1 118 ? 12.641  39.654 117.823 1.00 113.73 ? 310 TRP B CE2 1 
ATOM   4260 C  CE3 . TRP B 1 118 ? 10.857  40.536 116.436 1.00 113.01 ? 310 TRP B CE3 1 
ATOM   4261 C  CZ2 . TRP B 1 118 ? 11.972  38.434 117.992 1.00 113.83 ? 310 TRP B CZ2 1 
ATOM   4262 C  CZ3 . TRP B 1 118 ? 10.191  39.320 116.606 1.00 112.82 ? 310 TRP B CZ3 1 
ATOM   4263 C  CH2 . TRP B 1 118 ? 10.753  38.287 117.377 1.00 113.26 ? 310 TRP B CH2 1 
ATOM   4264 N  N   . ALA B 1 119 ? 13.044  44.786 119.641 1.00 113.72 ? 311 ALA B N   1 
ATOM   4265 C  CA  . ALA B 1 119 ? 13.815  44.958 120.864 1.00 111.16 ? 311 ALA B CA  1 
ATOM   4266 C  C   . ALA B 1 119 ? 13.700  43.717 121.747 1.00 108.88 ? 311 ALA B C   1 
ATOM   4267 O  O   . ALA B 1 119 ? 14.211  43.685 122.866 1.00 109.73 ? 311 ALA B O   1 
ATOM   4268 C  CB  . ALA B 1 119 ? 13.327  46.194 121.609 1.00 112.40 ? 311 ALA B CB  1 
ATOM   4269 N  N   . ILE B 1 120 ? 13.044  42.691 121.214 1.00 106.78 ? 312 ILE B N   1 
ATOM   4270 C  CA  . ILE B 1 120 ? 12.677  41.491 121.964 1.00 104.45 ? 312 ILE B CA  1 
ATOM   4271 C  C   . ILE B 1 120 ? 13.874  40.567 122.259 1.00 103.76 ? 312 ILE B C   1 
ATOM   4272 O  O   . ILE B 1 120 ? 13.858  39.826 123.243 1.00 104.76 ? 312 ILE B O   1 
ATOM   4273 C  CB  . ILE B 1 120 ? 11.515  40.731 121.246 1.00 104.44 ? 312 ILE B CB  1 
ATOM   4274 C  CG1 . ILE B 1 120 ? 10.368  41.705 120.920 1.00 105.28 ? 312 ILE B CG1 1 
ATOM   4275 C  CG2 . ILE B 1 120 ? 11.007  39.560 122.091 1.00 103.31 ? 312 ILE B CG2 1 
ATOM   4276 C  CD1 . ILE B 1 120 ? 9.451   41.288 119.769 1.00 104.05 ? 312 ILE B CD1 1 
ATOM   4277 N  N   . GLY B 1 121 ? 14.911  40.621 121.426 1.00 102.44 ? 313 GLY B N   1 
ATOM   4278 C  CA  . GLY B 1 121 ? 16.100  39.789 121.632 1.00 100.52 ? 313 GLY B CA  1 
ATOM   4279 C  C   . GLY B 1 121 ? 17.081  39.772 120.470 1.00 99.38  ? 313 GLY B C   1 
ATOM   4280 O  O   . GLY B 1 121 ? 16.868  40.463 119.472 1.00 100.57 ? 313 GLY B O   1 
ATOM   4281 N  N   . PRO B 1 122 ? 18.165  38.973 120.591 1.00 96.71  ? 314 PRO B N   1 
ATOM   4282 C  CA  . PRO B 1 122 ? 19.230  38.910 119.591 1.00 94.02  ? 314 PRO B CA  1 
ATOM   4283 C  C   . PRO B 1 122 ? 18.766  38.260 118.295 1.00 93.22  ? 314 PRO B C   1 
ATOM   4284 O  O   . PRO B 1 122 ? 17.947  37.337 118.321 1.00 94.35  ? 314 PRO B O   1 
ATOM   4285 C  CB  . PRO B 1 122 ? 20.288  38.037 120.266 1.00 93.89  ? 314 PRO B CB  1 
ATOM   4286 C  CG  . PRO B 1 122 ? 19.521  37.178 121.194 1.00 94.14  ? 314 PRO B CG  1 
ATOM   4287 C  CD  . PRO B 1 122 ? 18.430  38.060 121.718 1.00 95.90  ? 314 PRO B CD  1 
ATOM   4288 N  N   . HIS B 1 123 ? 19.295  38.744 117.175 1.00 90.55  ? 315 HIS B N   1 
ATOM   4289 C  CA  . HIS B 1 123 ? 18.895  38.266 115.859 1.00 88.29  ? 315 HIS B CA  1 
ATOM   4290 C  C   . HIS B 1 123 ? 19.784  38.850 114.772 1.00 88.18  ? 315 HIS B C   1 
ATOM   4291 O  O   . HIS B 1 123 ? 20.405  39.896 114.959 1.00 89.06  ? 315 HIS B O   1 
ATOM   4292 C  CB  . HIS B 1 123 ? 17.438  38.652 115.574 1.00 87.61  ? 315 HIS B CB  1 
ATOM   4293 C  CG  . HIS B 1 123 ? 17.218  40.129 115.446 1.00 87.48  ? 315 HIS B CG  1 
ATOM   4294 N  ND1 . HIS B 1 123 ? 16.983  40.743 114.234 1.00 88.10  ? 315 HIS B ND1 1 
ATOM   4295 C  CD2 . HIS B 1 123 ? 17.213  41.115 116.374 1.00 85.53  ? 315 HIS B CD2 1 
ATOM   4296 C  CE1 . HIS B 1 123 ? 16.834  42.042 114.423 1.00 87.28  ? 315 HIS B CE1 1 
ATOM   4297 N  NE2 . HIS B 1 123 ? 16.971  42.293 115.712 1.00 86.19  ? 315 HIS B NE2 1 
ATOM   4298 N  N   . ASP B 1 124 ? 19.844  38.153 113.642 1.00 87.80  ? 316 ASP B N   1 
ATOM   4299 C  CA  . ASP B 1 124 ? 20.379  38.710 112.410 1.00 87.40  ? 316 ASP B CA  1 
ATOM   4300 C  C   . ASP B 1 124 ? 19.214  39.321 111.638 1.00 87.36  ? 316 ASP B C   1 
ATOM   4301 O  O   . ASP B 1 124 ? 19.278  40.459 111.178 1.00 89.23  ? 316 ASP B O   1 
ATOM   4302 C  CB  . ASP B 1 124 ? 21.049  37.618 111.577 1.00 86.70  ? 316 ASP B CB  1 
ATOM   4303 C  CG  . ASP B 1 124 ? 21.617  38.145 110.276 1.00 87.58  ? 316 ASP B CG  1 
ATOM   4304 O  OD1 . ASP B 1 124 ? 22.540  38.985 110.324 1.00 86.40  ? 316 ASP B OD1 1 
ATOM   4305 O  OD2 . ASP B 1 124 ? 21.141  37.720 109.202 1.00 90.47  ? 316 ASP B OD2 1 
ATOM   4306 N  N   . HIS B 1 125 ? 18.146  38.545 111.514 1.00 86.77  ? 317 HIS B N   1 
ATOM   4307 C  CA  . HIS B 1 125 ? 16.924  38.976 110.865 1.00 86.49  ? 317 HIS B CA  1 
ATOM   4308 C  C   . HIS B 1 125 ? 15.780  38.207 111.506 1.00 87.75  ? 317 HIS B C   1 
ATOM   4309 O  O   . HIS B 1 125 ? 16.011  37.405 112.413 1.00 88.07  ? 317 HIS B O   1 
ATOM   4310 C  CB  . HIS B 1 125 ? 16.998  38.683 109.373 1.00 86.44  ? 317 HIS B CB  1 
ATOM   4311 C  CG  . HIS B 1 125 ? 17.222  37.239 109.051 1.00 87.76  ? 317 HIS B CG  1 
ATOM   4312 N  ND1 . HIS B 1 125 ? 16.195  36.386 108.714 1.00 89.22  ? 317 HIS B ND1 1 
ATOM   4313 C  CD2 . HIS B 1 125 ? 18.353  36.498 109.016 1.00 89.05  ? 317 HIS B CD2 1 
ATOM   4314 C  CE1 . HIS B 1 125 ? 16.685  35.184 108.472 1.00 90.20  ? 317 HIS B CE1 1 
ATOM   4315 N  NE2 . HIS B 1 125 ? 17.992  35.223 108.655 1.00 90.16  ? 317 HIS B NE2 1 
ATOM   4316 N  N   . ILE B 1 126 ? 14.548  38.462 111.068 1.00 88.60  ? 318 ILE B N   1 
ATOM   4317 C  CA  . ILE B 1 126 ? 13.411  37.666 111.538 1.00 88.57  ? 318 ILE B CA  1 
ATOM   4318 C  C   . ILE B 1 126 ? 12.534  37.190 110.375 1.00 88.78  ? 318 ILE B C   1 
ATOM   4319 O  O   . ILE B 1 126 ? 12.136  37.974 109.505 1.00 90.20  ? 318 ILE B O   1 
ATOM   4320 C  CB  . ILE B 1 126 ? 12.573  38.353 112.685 1.00 88.93  ? 318 ILE B CB  1 
ATOM   4321 C  CG1 . ILE B 1 126 ? 11.689  39.475 112.157 1.00 92.26  ? 318 ILE B CG1 1 
ATOM   4322 C  CG2 . ILE B 1 126 ? 13.466  38.888 113.808 1.00 87.69  ? 318 ILE B CG2 1 
ATOM   4323 C  CD1 . ILE B 1 126 ? 10.374  39.596 112.898 1.00 94.20  ? 318 ILE B CD1 1 
ATOM   4324 N  N   . LEU B 1 127 ? 12.275  35.886 110.359 1.00 88.25  ? 319 LEU B N   1 
ATOM   4325 C  CA  . LEU B 1 127 ? 11.439  35.256 109.348 1.00 87.60  ? 319 LEU B CA  1 
ATOM   4326 C  C   . LEU B 1 127 ? 9.975   35.495 109.686 1.00 87.69  ? 319 LEU B C   1 
ATOM   4327 O  O   . LEU B 1 127 ? 9.536   35.153 110.782 1.00 89.94  ? 319 LEU B O   1 
ATOM   4328 C  CB  . LEU B 1 127 ? 11.731  33.753 109.298 1.00 86.55  ? 319 LEU B CB  1 
ATOM   4329 C  CG  . LEU B 1 127 ? 11.047  32.896 108.225 1.00 86.58  ? 319 LEU B CG  1 
ATOM   4330 C  CD1 . LEU B 1 127 ? 11.832  31.611 107.965 1.00 84.02  ? 319 LEU B CD1 1 
ATOM   4331 C  CD2 . LEU B 1 127 ? 9.594   32.587 108.585 1.00 84.96  ? 319 LEU B CD2 1 
ATOM   4332 N  N   . ARG B 1 128 ? 9.232   36.077 108.745 1.00 87.80  ? 320 ARG B N   1 
ATOM   4333 C  CA  . ARG B 1 128 ? 7.804   36.371 108.930 1.00 89.26  ? 320 ARG B CA  1 
ATOM   4334 C  C   . ARG B 1 128 ? 6.907   35.480 108.092 1.00 90.33  ? 320 ARG B C   1 
ATOM   4335 O  O   . ARG B 1 128 ? 7.218   35.200 106.928 1.00 91.51  ? 320 ARG B O   1 
ATOM   4336 C  CB  . ARG B 1 128 ? 7.503   37.805 108.524 1.00 91.04  ? 320 ARG B CB  1 
ATOM   4337 C  CG  . ARG B 1 128 ? 7.792   38.840 109.575 1.00 96.31  ? 320 ARG B CG  1 
ATOM   4338 C  CD  . ARG B 1 128 ? 7.549   40.211 108.993 1.00 98.28  ? 320 ARG B CD  1 
ATOM   4339 N  NE  . ARG B 1 128 ? 7.444   41.233 110.023 1.00 100.80 ? 320 ARG B NE  1 
ATOM   4340 C  CZ  . ARG B 1 128 ? 7.278   42.526 109.770 1.00 102.89 ? 320 ARG B CZ  1 
ATOM   4341 N  NH1 . ARG B 1 128 ? 7.205   42.961 108.516 1.00 101.08 ? 320 ARG B NH1 1 
ATOM   4342 N  NH2 . ARG B 1 128 ? 7.191   43.386 110.775 1.00 104.35 ? 320 ARG B NH2 1 
ATOM   4343 N  N   . VAL B 1 129 ? 5.796   35.040 108.682 1.00 88.51  ? 321 VAL B N   1 
ATOM   4344 C  CA  . VAL B 1 129 ? 4.688   34.477 107.904 1.00 87.37  ? 321 VAL B CA  1 
ATOM   4345 C  C   . VAL B 1 129 ? 3.565   35.488 107.996 1.00 86.99  ? 321 VAL B C   1 
ATOM   4346 O  O   . VAL B 1 129 ? 3.147   35.862 109.097 1.00 89.38  ? 321 VAL B O   1 
ATOM   4347 C  CB  . VAL B 1 129 ? 4.199   33.110 108.425 1.00 87.52  ? 321 VAL B CB  1 
ATOM   4348 C  CG1 . VAL B 1 129 ? 3.121   32.557 107.503 1.00 86.17  ? 321 VAL B CG1 1 
ATOM   4349 C  CG2 . VAL B 1 129 ? 5.350   32.121 108.529 1.00 87.50  ? 321 VAL B CG2 1 
ATOM   4350 N  N   . VAL B 1 130 ? 3.103   35.959 106.843 1.00 84.21  ? 322 VAL B N   1 
ATOM   4351 C  CA  . VAL B 1 130 ? 2.184   37.093 106.804 1.00 82.42  ? 322 VAL B CA  1 
ATOM   4352 C  C   . VAL B 1 130 ? 1.046   36.843 105.827 1.00 83.76  ? 322 VAL B C   1 
ATOM   4353 O  O   . VAL B 1 130 ? 1.263   36.350 104.710 1.00 85.46  ? 322 VAL B O   1 
ATOM   4354 C  CB  . VAL B 1 130 ? 2.918   38.411 106.424 1.00 81.03  ? 322 VAL B CB  1 
ATOM   4355 C  CG1 . VAL B 1 130 ? 1.930   39.552 106.226 1.00 82.38  ? 322 VAL B CG1 1 
ATOM   4356 C  CG2 . VAL B 1 130 ? 3.933   38.794 107.487 1.00 81.79  ? 322 VAL B CG2 1 
ATOM   4357 N  N   . GLU B 1 131 ? -0.166  37.187 106.254 1.00 81.92  ? 323 GLU B N   1 
ATOM   4358 C  CA  . GLU B 1 131 ? -1.317  37.145 105.373 1.00 82.28  ? 323 GLU B CA  1 
ATOM   4359 C  C   . GLU B 1 131 ? -1.450  38.441 104.581 1.00 83.84  ? 323 GLU B C   1 
ATOM   4360 O  O   . GLU B 1 131 ? -1.342  39.538 105.141 1.00 85.92  ? 323 GLU B O   1 
ATOM   4361 C  CB  . GLU B 1 131 ? -2.588  36.922 106.175 1.00 84.63  ? 323 GLU B CB  1 
ATOM   4362 C  CG  . GLU B 1 131 ? -3.783  36.561 105.312 1.00 88.10  ? 323 GLU B CG  1 
ATOM   4363 C  CD  . GLU B 1 131 ? -5.085  36.885 105.979 1.00 89.75  ? 323 GLU B CD  1 
ATOM   4364 O  OE1 . GLU B 1 131 ? -5.429  38.082 106.014 1.00 91.20  ? 323 GLU B OE1 1 
ATOM   4365 O  OE2 . GLU B 1 131 ? -5.761  35.953 106.467 1.00 90.54  ? 323 GLU B OE2 1 
ATOM   4366 N  N   . TYR B 1 132 ? -1.685  38.304 103.278 1.00 82.01  ? 324 TYR B N   1 
ATOM   4367 C  CA  . TYR B 1 132 ? -2.095  39.431 102.442 1.00 81.89  ? 324 TYR B CA  1 
ATOM   4368 C  C   . TYR B 1 132 ? -3.472  39.199 101.785 1.00 84.99  ? 324 TYR B C   1 
ATOM   4369 O  O   . TYR B 1 132 ? -4.003  38.083 101.802 1.00 88.81  ? 324 TYR B O   1 
ATOM   4370 C  CB  . TYR B 1 132 ? -1.034  39.731 101.384 1.00 75.58  ? 324 TYR B CB  1 
ATOM   4371 C  CG  . TYR B 1 132 ? 0.080   40.626 101.855 1.00 72.97  ? 324 TYR B CG  1 
ATOM   4372 C  CD1 . TYR B 1 132 ? -0.073  42.008 101.874 1.00 75.11  ? 324 TYR B CD1 1 
ATOM   4373 C  CD2 . TYR B 1 132 ? 1.298   40.092 102.272 1.00 74.54  ? 324 TYR B CD2 1 
ATOM   4374 C  CE1 . TYR B 1 132 ? 0.964   42.842 102.296 1.00 76.90  ? 324 TYR B CE1 1 
ATOM   4375 C  CE2 . TYR B 1 132 ? 2.348   40.910 102.695 1.00 72.69  ? 324 TYR B CE2 1 
ATOM   4376 C  CZ  . TYR B 1 132 ? 2.175   42.280 102.700 1.00 76.47  ? 324 TYR B CZ  1 
ATOM   4377 O  OH  . TYR B 1 132 ? 3.200   43.091 103.120 1.00 77.13  ? 324 TYR B OH  1 
ATOM   4378 N  N   . THR B 1 133 ? -4.038  40.254 101.205 1.00 82.55  ? 325 THR B N   1 
ATOM   4379 C  CA  . THR B 1 133 ? -5.320  40.164 100.511 1.00 82.82  ? 325 THR B CA  1 
ATOM   4380 C  C   . THR B 1 133 ? -5.245  40.899 99.170  1.00 81.57  ? 325 THR B C   1 
ATOM   4381 O  O   . THR B 1 133 ? -4.694  41.995 99.103  1.00 85.18  ? 325 THR B O   1 
ATOM   4382 C  CB  . THR B 1 133 ? -6.441  40.777 101.384 1.00 83.43  ? 325 THR B CB  1 
ATOM   4383 O  OG1 . THR B 1 133 ? -6.336  40.258 102.713 1.00 84.03  ? 325 THR B OG1 1 
ATOM   4384 C  CG2 . THR B 1 133 ? -7.824  40.470 100.831 1.00 82.41  ? 325 THR B CG2 1 
ATOM   4385 N  N   . VAL B 1 134 ? -5.782  40.298 98.109  1.00 79.17  ? 326 VAL B N   1 
ATOM   4386 C  CA  . VAL B 1 134 ? -5.873  40.985 96.816  1.00 81.99  ? 326 VAL B CA  1 
ATOM   4387 C  C   . VAL B 1 134 ? -6.649  42.274 96.931  1.00 85.14  ? 326 VAL B C   1 
ATOM   4388 O  O   . VAL B 1 134 ? -7.591  42.369 97.725  1.00 88.73  ? 326 VAL B O   1 
ATOM   4389 C  CB  . VAL B 1 134 ? -6.600  40.169 95.706  1.00 81.37  ? 326 VAL B CB  1 
ATOM   4390 C  CG1 . VAL B 1 134 ? -5.632  39.297 94.954  1.00 83.45  ? 326 VAL B CG1 1 
ATOM   4391 C  CG2 . VAL B 1 134 ? -7.798  39.394 96.253  1.00 77.65  ? 326 VAL B CG2 1 
ATOM   4392 N  N   . SER B 1 135 ? -6.258  43.251 96.117  1.00 84.11  ? 327 SER B N   1 
ATOM   4393 C  CA  . SER B 1 135 ? -7.038  44.459 95.907  1.00 86.18  ? 327 SER B CA  1 
ATOM   4394 C  C   . SER B 1 135 ? -8.459  44.114 95.448  1.00 87.57  ? 327 SER B C   1 
ATOM   4395 O  O   . SER B 1 135 ? -8.640  43.300 94.545  1.00 90.75  ? 327 SER B O   1 
ATOM   4396 C  CB  . SER B 1 135 ? -6.342  45.327 94.862  1.00 86.76  ? 327 SER B CB  1 
ATOM   4397 O  OG  . SER B 1 135 ? -7.206  46.326 94.358  1.00 92.55  ? 327 SER B OG  1 
ATOM   4398 N  N   . ARG B 1 136 ? -9.466  44.720 96.071  1.00 88.66  ? 328 ARG B N   1 
ATOM   4399 C  CA  . ARG B 1 136 ? -10.841 44.526 95.607  1.00 92.63  ? 328 ARG B CA  1 
ATOM   4400 C  C   . ARG B 1 136 ? -11.090 45.254 94.295  1.00 91.83  ? 328 ARG B C   1 
ATOM   4401 O  O   . ARG B 1 136 ? -12.051 44.961 93.592  1.00 94.15  ? 328 ARG B O   1 
ATOM   4402 C  CB  . ARG B 1 136 ? -11.879 44.915 96.672  1.00 99.03  ? 328 ARG B CB  1 
ATOM   4403 C  CG  . ARG B 1 136 ? -11.463 46.042 97.593  1.00 107.55 ? 328 ARG B CG  1 
ATOM   4404 C  CD  . ARG B 1 136 ? -11.977 45.804 99.001  1.00 114.87 ? 328 ARG B CD  1 
ATOM   4405 N  NE  . ARG B 1 136 ? -10.988 46.205 100.007 1.00 122.68 ? 328 ARG B NE  1 
ATOM   4406 C  CZ  . ARG B 1 136 ? -11.093 45.983 101.318 1.00 126.28 ? 328 ARG B CZ  1 
ATOM   4407 N  NH1 . ARG B 1 136 ? -12.155 45.361 101.819 1.00 128.04 ? 328 ARG B NH1 1 
ATOM   4408 N  NH2 . ARG B 1 136 ? -10.129 46.390 102.136 1.00 127.31 ? 328 ARG B NH2 1 
ATOM   4409 N  N   . LYS B 1 137 ? -10.205 46.189 93.963  1.00 91.47  ? 329 LYS B N   1 
ATOM   4410 C  CA  . LYS B 1 137 ? -10.313 46.964 92.730  1.00 92.34  ? 329 LYS B CA  1 
ATOM   4411 C  C   . LYS B 1 137 ? -9.617  46.283 91.564  1.00 89.11  ? 329 LYS B C   1 
ATOM   4412 O  O   . LYS B 1 137 ? -10.028 46.429 90.416  1.00 90.06  ? 329 LYS B O   1 
ATOM   4413 C  CB  . LYS B 1 137 ? -9.756  48.374 92.933  1.00 97.61  ? 329 LYS B CB  1 
ATOM   4414 C  CG  . LYS B 1 137 ? -10.673 49.253 93.775  1.00 104.34 ? 329 LYS B CG  1 
ATOM   4415 C  CD  . LYS B 1 137 ? -10.007 50.550 94.203  1.00 109.15 ? 329 LYS B CD  1 
ATOM   4416 C  CE  . LYS B 1 137 ? -10.962 51.379 95.050  1.00 111.40 ? 329 LYS B CE  1 
ATOM   4417 N  NZ  . LYS B 1 137 ? -10.339 52.640 95.535  1.00 114.01 ? 329 LYS B NZ  1 
ATOM   4418 N  N   . ASN B 1 138 ? -8.564  45.533 91.858  1.00 86.08  ? 330 ASN B N   1 
ATOM   4419 C  CA  . ASN B 1 138 ? -7.775  44.907 90.811  1.00 84.49  ? 330 ASN B CA  1 
ATOM   4420 C  C   . ASN B 1 138 ? -7.338  43.510 91.205  1.00 81.68  ? 330 ASN B C   1 
ATOM   4421 O  O   . ASN B 1 138 ? -6.505  43.352 92.091  1.00 87.03  ? 330 ASN B O   1 
ATOM   4422 C  CB  . ASN B 1 138 ? -6.570  45.789 90.464  1.00 87.35  ? 330 ASN B CB  1 
ATOM   4423 C  CG  . ASN B 1 138 ? -5.610  45.130 89.494  1.00 88.88  ? 330 ASN B CG  1 
ATOM   4424 O  OD1 . ASN B 1 138 ? -5.958  44.183 88.782  1.00 89.38  ? 330 ASN B OD1 1 
ATOM   4425 N  ND2 . ASN B 1 138 ? -4.385  45.636 89.462  1.00 89.88  ? 330 ASN B ND2 1 
ATOM   4426 N  N   . PRO B 1 139 ? -7.889  42.485 90.538  1.00 78.66  ? 331 PRO B N   1 
ATOM   4427 C  CA  . PRO B 1 139 ? -7.578  41.113 90.897  1.00 79.85  ? 331 PRO B CA  1 
ATOM   4428 C  C   . PRO B 1 139 ? -6.151  40.705 90.528  1.00 83.03  ? 331 PRO B C   1 
ATOM   4429 O  O   . PRO B 1 139 ? -5.774  39.542 90.722  1.00 88.28  ? 331 PRO B O   1 
ATOM   4430 C  CB  . PRO B 1 139 ? -8.592  40.306 90.076  1.00 77.85  ? 331 PRO B CB  1 
ATOM   4431 C  CG  . PRO B 1 139 ? -8.854  41.132 88.908  1.00 76.03  ? 331 PRO B CG  1 
ATOM   4432 C  CD  . PRO B 1 139 ? -8.832  42.545 89.408  1.00 77.31  ? 331 PRO B CD  1 
ATOM   4433 N  N   . HIS B 1 140 ? -5.368  41.646 90.004  1.00 81.86  ? 332 HIS B N   1 
ATOM   4434 C  CA  . HIS B 1 140 ? -4.017  41.337 89.549  1.00 82.10  ? 332 HIS B CA  1 
ATOM   4435 C  C   . HIS B 1 140 ? -2.940  42.020 90.388  1.00 86.70  ? 332 HIS B C   1 
ATOM   4436 O  O   . HIS B 1 140 ? -1.782  42.130 89.965  1.00 91.46  ? 332 HIS B O   1 
ATOM   4437 C  CB  . HIS B 1 140 ? -3.865  41.662 88.064  1.00 78.66  ? 332 HIS B CB  1 
ATOM   4438 C  CG  . HIS B 1 140 ? -4.647  40.752 87.171  1.00 81.15  ? 332 HIS B CG  1 
ATOM   4439 N  ND1 . HIS B 1 140 ? -5.611  41.209 86.300  1.00 82.72  ? 332 HIS B ND1 1 
ATOM   4440 C  CD2 . HIS B 1 140 ? -4.624  39.406 87.030  1.00 83.66  ? 332 HIS B CD2 1 
ATOM   4441 C  CE1 . HIS B 1 140 ? -6.139  40.187 85.650  1.00 82.02  ? 332 HIS B CE1 1 
ATOM   4442 N  NE2 . HIS B 1 140 ? -5.557  39.080 86.075  1.00 82.98  ? 332 HIS B NE2 1 
ATOM   4443 N  N   . GLN B 1 141 ? -3.325  42.440 91.592  1.00 86.59  ? 333 GLN B N   1 
ATOM   4444 C  CA  . GLN B 1 141 ? -2.432  43.132 92.508  1.00 87.76  ? 333 GLN B CA  1 
ATOM   4445 C  C   . GLN B 1 141 ? -2.940  42.999 93.946  1.00 87.23  ? 333 GLN B C   1 
ATOM   4446 O  O   . GLN B 1 141 ? -4.142  43.101 94.182  1.00 88.76  ? 333 GLN B O   1 
ATOM   4447 C  CB  . GLN B 1 141 ? -2.373  44.596 92.111  1.00 90.58  ? 333 GLN B CB  1 
ATOM   4448 C  CG  . GLN B 1 141 ? -1.051  45.263 92.366  1.00 95.79  ? 333 GLN B CG  1 
ATOM   4449 C  CD  . GLN B 1 141 ? -0.903  46.513 91.541  1.00 98.78  ? 333 GLN B CD  1 
ATOM   4450 O  OE1 . GLN B 1 141 ? -1.062  46.486 90.318  1.00 99.21  ? 333 GLN B OE1 1 
ATOM   4451 N  NE2 . GLN B 1 141 ? -0.609  47.624 92.202  1.00 100.84 ? 333 GLN B NE2 1 
ATOM   4452 N  N   . VAL B 1 142 ? -2.039  42.772 94.901  1.00 85.19  ? 334 VAL B N   1 
ATOM   4453 C  CA  . VAL B 1 142 ? -2.443  42.654 96.305  1.00 89.55  ? 334 VAL B CA  1 
ATOM   4454 C  C   . VAL B 1 142 ? -2.444  44.025 96.982  1.00 92.69  ? 334 VAL B C   1 
ATOM   4455 O  O   . VAL B 1 142 ? -1.599  44.865 96.670  1.00 95.74  ? 334 VAL B O   1 
ATOM   4456 C  CB  . VAL B 1 142 ? -1.585  41.607 97.116  1.00 92.27  ? 334 VAL B CB  1 
ATOM   4457 C  CG1 . VAL B 1 142 ? -0.943  40.587 96.196  1.00 93.60  ? 334 VAL B CG1 1 
ATOM   4458 C  CG2 . VAL B 1 142 ? -0.514  42.268 97.977  1.00 93.83  ? 334 VAL B CG2 1 
ATOM   4459 N  N   . ASP B 1 143 ? -3.401  44.260 97.881  1.00 93.93  ? 335 ASP B N   1 
ATOM   4460 C  CA  . ASP B 1 143 ? -3.439  45.502 98.655  1.00 95.33  ? 335 ASP B CA  1 
ATOM   4461 C  C   . ASP B 1 143 ? -2.479  45.398 99.829  1.00 94.69  ? 335 ASP B C   1 
ATOM   4462 O  O   . ASP B 1 143 ? -2.749  44.679 100.794 1.00 94.58  ? 335 ASP B O   1 
ATOM   4463 C  CB  . ASP B 1 143 ? -4.855  45.808 99.160  1.00 99.06  ? 335 ASP B CB  1 
ATOM   4464 C  CG  . ASP B 1 143 ? -4.946  47.156 99.889  1.00 104.23 ? 335 ASP B CG  1 
ATOM   4465 O  OD1 . ASP B 1 143 ? -5.432  47.195 101.039 1.00 107.49 ? 335 ASP B OD1 1 
ATOM   4466 O  OD2 . ASP B 1 143 ? -4.532  48.188 99.319  1.00 106.74 ? 335 ASP B OD2 1 
ATOM   4467 N  N   . LEU B 1 144 ? -1.365  46.126 99.744  1.00 93.73  ? 336 LEU B N   1 
ATOM   4468 C  CA  . LEU B 1 144 ? -0.293  46.060 100.753 1.00 90.43  ? 336 LEU B CA  1 
ATOM   4469 C  C   . LEU B 1 144 ? -0.719  46.512 102.149 1.00 87.55  ? 336 LEU B C   1 
ATOM   4470 O  O   . LEU B 1 144 ? -0.021  46.255 103.131 1.00 91.64  ? 336 LEU B O   1 
ATOM   4471 C  CB  . LEU B 1 144 ? 0.939   46.858 100.310 1.00 87.14  ? 336 LEU B CB  1 
ATOM   4472 C  CG  . LEU B 1 144 ? 1.592   46.510 98.974  1.00 85.66  ? 336 LEU B CG  1 
ATOM   4473 C  CD1 . LEU B 1 144 ? 2.803   47.396 98.740  1.00 84.14  ? 336 LEU B CD1 1 
ATOM   4474 C  CD2 . LEU B 1 144 ? 1.979   45.037 98.902  1.00 86.01  ? 336 LEU B CD2 1 
ATOM   4475 N  N   . ARG B 1 145 ? -1.869  47.168 102.233 1.00 82.17  ? 337 ARG B N   1 
ATOM   4476 C  CA  . ARG B 1 145 ? -2.391  47.642 103.511 1.00 80.25  ? 337 ARG B CA  1 
ATOM   4477 C  C   . ARG B 1 145 ? -2.986  46.503 104.334 1.00 81.20  ? 337 ARG B C   1 
ATOM   4478 O  O   . ARG B 1 145 ? -3.205  46.655 105.536 1.00 84.42  ? 337 ARG B O   1 
ATOM   4479 C  CB  . ARG B 1 145 ? -3.436  48.734 103.280 1.00 77.24  ? 337 ARG B CB  1 
ATOM   4480 C  CG  . ARG B 1 145 ? -3.116  49.601 102.081 1.00 80.32  ? 337 ARG B CG  1 
ATOM   4481 C  CD  . ARG B 1 145 ? -3.843  50.909 102.107 1.00 84.75  ? 337 ARG B CD  1 
ATOM   4482 N  NE  . ARG B 1 145 ? -5.207  50.794 101.596 1.00 90.99  ? 337 ARG B NE  1 
ATOM   4483 C  CZ  . ARG B 1 145 ? -5.557  50.938 100.321 1.00 94.11  ? 337 ARG B CZ  1 
ATOM   4484 N  NH1 . ARG B 1 145 ? -4.642  51.191 99.389  1.00 96.10  ? 337 ARG B NH1 1 
ATOM   4485 N  NH2 . ARG B 1 145 ? -6.831  50.823 99.976  1.00 95.60  ? 337 ARG B NH2 1 
ATOM   4486 N  N   . THR B 1 146 ? -3.225  45.360 103.691 1.00 80.27  ? 338 THR B N   1 
ATOM   4487 C  CA  . THR B 1 146 ? -3.961  44.254 104.312 1.00 76.66  ? 338 THR B CA  1 
ATOM   4488 C  C   . THR B 1 146 ? -3.084  43.269 105.070 1.00 77.00  ? 338 THR B C   1 
ATOM   4489 O  O   . THR B 1 146 ? -3.573  42.231 105.516 1.00 78.49  ? 338 THR B O   1 
ATOM   4490 C  CB  . THR B 1 146 ? -4.766  43.449 103.274 1.00 75.06  ? 338 THR B CB  1 
ATOM   4491 O  OG1 . THR B 1 146 ? -3.880  42.913 102.283 1.00 76.90  ? 338 THR B OG1 1 
ATOM   4492 C  CG2 . THR B 1 146 ? -5.808  44.314 102.609 1.00 74.78  ? 338 THR B CG2 1 
ATOM   4493 N  N   . ALA B 1 147 ? -1.800  43.585 105.212 1.00 76.80  ? 339 ALA B N   1 
ATOM   4494 C  CA  . ALA B 1 147 ? -0.853  42.660 105.828 1.00 76.98  ? 339 ALA B CA  1 
ATOM   4495 C  C   . ALA B 1 147 ? -1.240  42.369 107.268 1.00 75.55  ? 339 ALA B C   1 
ATOM   4496 O  O   . ALA B 1 147 ? -1.466  43.298 108.040 1.00 76.28  ? 339 ALA B O   1 
ATOM   4497 C  CB  . ALA B 1 147 ? 0.552   43.226 105.765 1.00 79.05  ? 339 ALA B CB  1 
ATOM   4498 N  N   . ARG B 1 148 ? -1.345  41.086 107.613 1.00 73.85  ? 340 ARG B N   1 
ATOM   4499 C  CA  . ARG B 1 148 ? -1.529  40.669 109.002 0.50 73.82  ? 340 ARG B CA  1 
ATOM   4500 C  C   . ARG B 1 148 ? -0.451  39.663 109.303 1.00 81.95  ? 340 ARG B C   1 
ATOM   4501 O  O   . ARG B 1 148 ? -0.427  38.583 108.706 1.00 87.83  ? 340 ARG B O   1 
ATOM   4502 C  CB  . ARG B 1 148 ? -2.876  39.990 109.247 0.50 66.19  ? 340 ARG B CB  1 
ATOM   4503 C  CG  . ARG B 1 148 ? -4.086  40.690 108.704 0.50 61.43  ? 340 ARG B CG  1 
ATOM   4504 C  CD  . ARG B 1 148 ? -5.317  40.374 109.528 0.50 57.30  ? 340 ARG B CD  1 
ATOM   4505 N  NE  . ARG B 1 148 ? -5.356  39.021 110.083 0.50 55.34  ? 340 ARG B NE  1 
ATOM   4506 C  CZ  . ARG B 1 148 ? -5.932  37.973 109.499 0.50 54.96  ? 340 ARG B CZ  1 
ATOM   4507 N  NH1 . ARG B 1 148 ? -6.520  38.100 108.322 0.50 56.07  ? 340 ARG B NH1 1 
ATOM   4508 N  NH2 . ARG B 1 148 ? -5.922  36.788 110.093 0.50 53.93  ? 340 ARG B NH2 1 
ATOM   4509 N  N   . VAL B 1 149 ? 0.438   40.019 110.225 1.00 86.27  ? 341 VAL B N   1 
ATOM   4510 C  CA  . VAL B 1 149 ? 1.525   39.137 110.647 1.00 88.23  ? 341 VAL B CA  1 
ATOM   4511 C  C   . VAL B 1 149 ? 0.959   37.957 111.436 1.00 86.26  ? 341 VAL B C   1 
ATOM   4512 O  O   . VAL B 1 149 ? 0.052   38.127 112.237 1.00 86.79  ? 341 VAL B O   1 
ATOM   4513 C  CB  . VAL B 1 149 ? 2.574   39.904 111.487 1.00 89.73  ? 341 VAL B CB  1 
ATOM   4514 C  CG1 . VAL B 1 149 ? 3.806   39.053 111.712 1.00 90.92  ? 341 VAL B CG1 1 
ATOM   4515 C  CG2 . VAL B 1 149 ? 2.970   41.201 110.786 1.00 91.26  ? 341 VAL B CG2 1 
ATOM   4516 N  N   . PHE B 1 150 ? 1.483   36.764 111.181 1.00 87.45  ? 342 PHE B N   1 
ATOM   4517 C  CA  . PHE B 1 150 ? 1.035   35.550 111.859 1.00 88.83  ? 342 PHE B CA  1 
ATOM   4518 C  C   . PHE B 1 150 ? 2.133   35.033 112.770 1.00 90.33  ? 342 PHE B C   1 
ATOM   4519 O  O   . PHE B 1 150 ? 1.903   34.771 113.950 1.00 93.54  ? 342 PHE B O   1 
ATOM   4520 C  CB  . PHE B 1 150 ? 0.692   34.464 110.839 1.00 89.35  ? 342 PHE B CB  1 
ATOM   4521 C  CG  . PHE B 1 150 ? -0.716  34.517 110.325 1.00 89.50  ? 342 PHE B CG  1 
ATOM   4522 C  CD1 . PHE B 1 150 ? -1.403  33.336 110.055 1.00 89.32  ? 342 PHE B CD1 1 
ATOM   4523 C  CD2 . PHE B 1 150 ? -1.357  35.731 110.097 1.00 90.25  ? 342 PHE B CD2 1 
ATOM   4524 C  CE1 . PHE B 1 150 ? -2.699  33.359 109.567 1.00 88.54  ? 342 PHE B CE1 1 
ATOM   4525 C  CE2 . PHE B 1 150 ? -2.662  35.765 109.612 1.00 90.09  ? 342 PHE B CE2 1 
ATOM   4526 C  CZ  . PHE B 1 150 ? -3.332  34.576 109.346 1.00 88.95  ? 342 PHE B CZ  1 
ATOM   4527 N  N   . LEU B 1 151 ? 3.325   34.870 112.204 1.00 89.89  ? 343 LEU B N   1 
ATOM   4528 C  CA  . LEU B 1 151 ? 4.478   34.384 112.947 1.00 88.85  ? 343 LEU B CA  1 
ATOM   4529 C  C   . LEU B 1 151 ? 5.668   35.290 112.717 1.00 88.69  ? 343 LEU B C   1 
ATOM   4530 O  O   . LEU B 1 151 ? 5.822   35.885 111.647 1.00 90.40  ? 343 LEU B O   1 
ATOM   4531 C  CB  . LEU B 1 151 ? 4.835   32.957 112.532 1.00 89.36  ? 343 LEU B CB  1 
ATOM   4532 C  CG  . LEU B 1 151 ? 3.753   31.884 112.686 1.00 90.97  ? 343 LEU B CG  1 
ATOM   4533 C  CD1 . LEU B 1 151 ? 4.097   30.639 111.865 1.00 90.57  ? 343 LEU B CD1 1 
ATOM   4534 C  CD2 . LEU B 1 151 ? 3.518   31.534 114.154 1.00 89.80  ? 343 LEU B CD2 1 
ATOM   4535 N  N   . GLU B 1 152 ? 6.498   35.393 113.744 1.00 88.45  ? 344 GLU B N   1 
ATOM   4536 C  CA  . GLU B 1 152 ? 7.728   36.157 113.697 1.00 88.17  ? 344 GLU B CA  1 
ATOM   4537 C  C   . GLU B 1 152 ? 8.784   35.316 114.384 1.00 89.61  ? 344 GLU B C   1 
ATOM   4538 O  O   . GLU B 1 152 ? 8.863   35.272 115.619 1.00 91.39  ? 344 GLU B O   1 
ATOM   4539 C  CB  . GLU B 1 152 ? 7.562   37.507 114.397 1.00 87.72  ? 344 GLU B CB  1 
ATOM   4540 C  CG  . GLU B 1 152 ? 6.756   38.503 113.590 1.00 88.72  ? 344 GLU B CG  1 
ATOM   4541 C  CD  . GLU B 1 152 ? 6.728   39.889 114.204 1.00 90.88  ? 344 GLU B CD  1 
ATOM   4542 O  OE1 . GLU B 1 152 ? 7.278   40.817 113.568 1.00 93.53  ? 344 GLU B OE1 1 
ATOM   4543 O  OE2 . GLU B 1 152 ? 6.156   40.055 115.308 1.00 89.04  ? 344 GLU B OE2 1 
ATOM   4544 N  N   . VAL B 1 153 ? 9.574   34.626 113.570 1.00 88.05  ? 345 VAL B N   1 
ATOM   4545 C  CA  . VAL B 1 153 ? 10.591  33.707 114.061 1.00 86.21  ? 345 VAL B CA  1 
ATOM   4546 C  C   . VAL B 1 153 ? 11.939  34.406 114.053 1.00 82.50  ? 345 VAL B C   1 
ATOM   4547 O  O   . VAL B 1 153 ? 12.487  34.681 112.991 1.00 79.78  ? 345 VAL B O   1 
ATOM   4548 C  CB  . VAL B 1 153 ? 10.666  32.440 113.176 1.00 88.69  ? 345 VAL B CB  1 
ATOM   4549 C  CG1 . VAL B 1 153 ? 11.497  31.365 113.843 1.00 87.56  ? 345 VAL B CG1 1 
ATOM   4550 C  CG2 . VAL B 1 153 ? 9.270   31.913 112.866 1.00 91.04  ? 345 VAL B CG2 1 
ATOM   4551 N  N   . ALA B 1 154 ? 12.462  34.709 115.238 1.00 84.37  ? 346 ALA B N   1 
ATOM   4552 C  CA  . ALA B 1 154 ? 13.804  35.284 115.363 1.00 84.79  ? 346 ALA B CA  1 
ATOM   4553 C  C   . ALA B 1 154 ? 14.822  34.365 114.697 1.00 84.84  ? 346 ALA B C   1 
ATOM   4554 O  O   . ALA B 1 154 ? 14.732  33.142 114.809 1.00 85.77  ? 346 ALA B O   1 
ATOM   4555 C  CB  . ALA B 1 154 ? 14.162  35.504 116.820 1.00 83.99  ? 346 ALA B CB  1 
ATOM   4556 N  N   . GLU B 1 155 ? 15.777  34.958 113.993 1.00 84.34  ? 347 GLU B N   1 
ATOM   4557 C  CA  . GLU B 1 155 ? 16.764  34.182 113.260 1.00 84.61  ? 347 GLU B CA  1 
ATOM   4558 C  C   . GLU B 1 155 ? 18.174  34.693 113.543 1.00 82.94  ? 347 GLU B C   1 
ATOM   4559 O  O   . GLU B 1 155 ? 18.436  35.890 113.468 1.00 83.80  ? 347 GLU B O   1 
ATOM   4560 C  CB  . GLU B 1 155 ? 16.450  34.227 111.760 1.00 85.35  ? 347 GLU B CB  1 
ATOM   4561 C  CG  . GLU B 1 155 ? 16.605  32.890 111.044 1.00 89.77  ? 347 GLU B CG  1 
ATOM   4562 C  CD  . GLU B 1 155 ? 15.513  31.890 111.390 1.00 92.30  ? 347 GLU B CD  1 
ATOM   4563 O  OE1 . GLU B 1 155 ? 14.580  32.261 112.127 1.00 95.58  ? 347 GLU B OE1 1 
ATOM   4564 O  OE2 . GLU B 1 155 ? 15.580  30.731 110.926 1.00 93.02  ? 347 GLU B OE2 1 
ATOM   4565 N  N   . LEU B 1 156 ? 19.080  33.781 113.873 1.00 81.51  ? 348 LEU B N   1 
ATOM   4566 C  CA  . LEU B 1 156 ? 20.465  34.158 114.143 1.00 79.73  ? 348 LEU B CA  1 
ATOM   4567 C  C   . LEU B 1 156 ? 21.367  34.030 112.921 1.00 79.97  ? 348 LEU B C   1 
ATOM   4568 O  O   . LEU B 1 156 ? 22.417  34.670 112.865 1.00 81.18  ? 348 LEU B O   1 
ATOM   4569 C  CB  . LEU B 1 156 ? 21.038  33.324 115.281 1.00 78.10  ? 348 LEU B CB  1 
ATOM   4570 C  CG  . LEU B 1 156 ? 20.274  33.359 116.600 1.00 80.18  ? 348 LEU B CG  1 
ATOM   4571 C  CD1 . LEU B 1 156 ? 20.688  32.163 117.431 1.00 80.99  ? 348 LEU B CD1 1 
ATOM   4572 C  CD2 . LEU B 1 156 ? 20.499  34.667 117.358 1.00 80.83  ? 348 LEU B CD2 1 
ATOM   4573 N  N   . HIS B 1 157 ? 20.968  33.207 111.950 1.00 77.19  ? 349 HIS B N   1 
ATOM   4574 C  CA  . HIS B 1 157 ? 21.813  32.957 110.786 1.00 78.05  ? 349 HIS B CA  1 
ATOM   4575 C  C   . HIS B 1 157 ? 21.080  33.105 109.455 1.00 81.77  ? 349 HIS B C   1 
ATOM   4576 O  O   . HIS B 1 157 ? 19.906  33.477 109.418 1.00 84.14  ? 349 HIS B O   1 
ATOM   4577 C  CB  . HIS B 1 157 ? 22.500  31.595 110.899 1.00 76.76  ? 349 HIS B CB  1 
ATOM   4578 C  CG  . HIS B 1 157 ? 23.255  31.417 112.175 1.00 75.61  ? 349 HIS B CG  1 
ATOM   4579 N  ND1 . HIS B 1 157 ? 24.360  32.176 112.493 1.00 76.17  ? 349 HIS B ND1 1 
ATOM   4580 C  CD2 . HIS B 1 157 ? 23.049  30.592 113.227 1.00 75.07  ? 349 HIS B CD2 1 
ATOM   4581 C  CE1 . HIS B 1 157 ? 24.810  31.816 113.681 1.00 75.82  ? 349 HIS B CE1 1 
ATOM   4582 N  NE2 . HIS B 1 157 ? 24.032  30.858 114.149 1.00 74.93  ? 349 HIS B NE2 1 
ATOM   4583 N  N   . ARG B 1 158 ? 21.782  32.808 108.365 1.00 81.78  ? 350 ARG B N   1 
ATOM   4584 C  CA  . ARG B 1 158 ? 21.270  33.070 107.028 1.00 81.88  ? 350 ARG B CA  1 
ATOM   4585 C  C   . ARG B 1 158 ? 21.244  31.807 106.186 1.00 86.04  ? 350 ARG B C   1 
ATOM   4586 O  O   . ARG B 1 158 ? 21.194  31.869 104.954 1.00 87.03  ? 350 ARG B O   1 
ATOM   4587 C  CB  . ARG B 1 158 ? 22.114  34.146 106.350 1.00 78.52  ? 350 ARG B CB  1 
ATOM   4588 C  CG  . ARG B 1 158 ? 22.167  35.441 107.126 1.00 77.50  ? 350 ARG B CG  1 
ATOM   4589 C  CD  . ARG B 1 158 ? 23.254  36.338 106.605 1.00 78.96  ? 350 ARG B CD  1 
ATOM   4590 N  NE  . ARG B 1 158 ? 23.255  37.629 107.282 1.00 78.83  ? 350 ARG B NE  1 
ATOM   4591 C  CZ  . ARG B 1 158 ? 23.980  38.673 106.900 1.00 79.17  ? 350 ARG B CZ  1 
ATOM   4592 N  NH1 . ARG B 1 158 ? 24.772  38.591 105.838 1.00 81.12  ? 350 ARG B NH1 1 
ATOM   4593 N  NH2 . ARG B 1 158 ? 23.907  39.808 107.575 1.00 79.91  ? 350 ARG B NH2 1 
ATOM   4594 N  N   . LYS B 1 159 ? 21.284  30.665 106.865 1.00 89.50  ? 351 LYS B N   1 
ATOM   4595 C  CA  . LYS B 1 159 ? 21.189  29.361 106.220 1.00 94.91  ? 351 LYS B CA  1 
ATOM   4596 C  C   . LYS B 1 159 ? 20.226  28.500 107.026 1.00 93.83  ? 351 LYS B C   1 
ATOM   4597 O  O   . LYS B 1 159 ? 19.942  28.821 108.184 1.00 93.05  ? 351 LYS B O   1 
ATOM   4598 C  CB  . LYS B 1 159 ? 22.566  28.699 106.152 1.00 96.89  ? 351 LYS B CB  1 
ATOM   4599 C  CG  . LYS B 1 159 ? 23.516  29.329 105.144 1.00 99.92  ? 351 LYS B CG  1 
ATOM   4600 C  CD  . LYS B 1 159 ? 24.932  28.774 105.292 1.00 100.96 ? 351 LYS B CD  1 
ATOM   4601 C  CE  . LYS B 1 159 ? 25.751  29.006 104.023 1.00 104.04 ? 351 LYS B CE  1 
ATOM   4602 N  NZ  . LYS B 1 159 ? 27.123  28.436 104.122 1.00 104.95 ? 351 LYS B NZ  1 
ATOM   4603 N  N   . HIS B 1 160 ? 19.723  27.421 106.420 1.00 93.34  ? 352 HIS B N   1 
ATOM   4604 C  CA  . HIS B 1 160 ? 18.830  26.471 107.104 1.00 94.80  ? 352 HIS B CA  1 
ATOM   4605 C  C   . HIS B 1 160 ? 17.491  27.118 107.468 1.00 94.98  ? 352 HIS B C   1 
ATOM   4606 O  O   . HIS B 1 160 ? 16.844  26.716 108.441 1.00 94.02  ? 352 HIS B O   1 
ATOM   4607 C  CB  . HIS B 1 160 ? 19.483  25.923 108.389 1.00 95.74  ? 352 HIS B CB  1 
ATOM   4608 C  CG  . HIS B 1 160 ? 20.589  24.938 108.159 1.00 96.82  ? 352 HIS B CG  1 
ATOM   4609 N  ND1 . HIS B 1 160 ? 21.395  24.957 107.041 1.00 97.35  ? 352 HIS B ND1 1 
ATOM   4610 C  CD2 . HIS B 1 160 ? 21.047  23.926 108.934 1.00 96.57  ? 352 HIS B CD2 1 
ATOM   4611 C  CE1 . HIS B 1 160 ? 22.286  23.985 107.125 1.00 97.46  ? 352 HIS B CE1 1 
ATOM   4612 N  NE2 . HIS B 1 160 ? 22.096  23.346 108.265 1.00 97.43  ? 352 HIS B NE2 1 
ATOM   4613 N  N   . LEU B 1 161 ? 17.085  28.120 106.694 1.00 94.83  ? 353 LEU B N   1 
ATOM   4614 C  CA  . LEU B 1 161 ? 15.902  28.919 107.021 1.00 93.24  ? 353 LEU B CA  1 
ATOM   4615 C  C   . LEU B 1 161 ? 14.589  28.145 106.875 1.00 94.81  ? 353 LEU B C   1 
ATOM   4616 O  O   . LEU B 1 161 ? 13.881  27.938 107.864 1.00 97.45  ? 353 LEU B O   1 
ATOM   4617 C  CB  . LEU B 1 161 ? 15.883  30.217 106.200 1.00 89.74  ? 353 LEU B CB  1 
ATOM   4618 C  CG  . LEU B 1 161 ? 16.499  31.505 106.769 1.00 85.97  ? 353 LEU B CG  1 
ATOM   4619 C  CD1 . LEU B 1 161 ? 17.579  31.279 107.818 1.00 82.02  ? 353 LEU B CD1 1 
ATOM   4620 C  CD2 . LEU B 1 161 ? 17.062  32.322 105.629 1.00 85.19  ? 353 LEU B CD2 1 
ATOM   4621 N  N   . GLY B 1 162 ? 14.285  27.702 105.656 1.00 95.20  ? 354 GLY B N   1 
ATOM   4622 C  CA  . GLY B 1 162 ? 13.032  27.000 105.366 1.00 94.40  ? 354 GLY B CA  1 
ATOM   4623 C  C   . GLY B 1 162 ? 11.969  27.978 104.917 1.00 96.37  ? 354 GLY B C   1 
ATOM   4624 O  O   . GLY B 1 162 ? 12.250  28.895 104.147 1.00 99.61  ? 354 GLY B O   1 
ATOM   4625 N  N   . GLY B 1 163 ? 10.747  27.789 105.401 1.00 96.77  ? 355 GLY B N   1 
ATOM   4626 C  CA  . GLY B 1 163 ? 9.657   28.722 105.124 1.00 94.08  ? 355 GLY B CA  1 
ATOM   4627 C  C   . GLY B 1 163 ? 8.691   28.285 104.040 1.00 93.43  ? 355 GLY B C   1 
ATOM   4628 O  O   . GLY B 1 163 ? 7.876   29.079 103.581 1.00 96.90  ? 355 GLY B O   1 
ATOM   4629 N  N   . GLN B 1 164 ? 8.778   27.029 103.624 1.00 91.52  ? 356 GLN B N   1 
ATOM   4630 C  CA  . GLN B 1 164 ? 7.830   26.482 102.666 1.00 92.47  ? 356 GLN B CA  1 
ATOM   4631 C  C   . GLN B 1 164 ? 6.440   26.488 103.291 1.00 92.50  ? 356 GLN B C   1 
ATOM   4632 O  O   . GLN B 1 164 ? 6.250   26.023 104.418 1.00 92.08  ? 356 GLN B O   1 
ATOM   4633 C  CB  . GLN B 1 164 ? 8.237   25.064 102.273 1.00 93.90  ? 356 GLN B CB  1 
ATOM   4634 C  CG  . GLN B 1 164 ? 7.356   24.376 101.231 1.00 92.12  ? 356 GLN B CG  1 
ATOM   4635 C  CD  . GLN B 1 164 ? 7.881   22.986 100.850 1.00 93.88  ? 356 GLN B CD  1 
ATOM   4636 O  OE1 . GLN B 1 164 ? 9.030   22.626 101.138 1.00 94.12  ? 356 GLN B OE1 1 
ATOM   4637 N  NE2 . GLN B 1 164 ? 7.038   22.206 100.195 1.00 96.45  ? 356 GLN B NE2 1 
ATOM   4638 N  N   . LEU B 1 165 ? 5.486   27.049 102.557 1.00 92.38  ? 357 LEU B N   1 
ATOM   4639 C  CA  . LEU B 1 165 ? 4.102   27.106 102.989 1.00 91.74  ? 357 LEU B CA  1 
ATOM   4640 C  C   . LEU B 1 165 ? 3.250   26.260 102.058 1.00 93.60  ? 357 LEU B C   1 
ATOM   4641 O  O   . LEU B 1 165 ? 3.366   26.362 100.829 1.00 96.77  ? 357 LEU B O   1 
ATOM   4642 C  CB  . LEU B 1 165 ? 3.585   28.546 102.971 1.00 91.15  ? 357 LEU B CB  1 
ATOM   4643 C  CG  . LEU B 1 165 ? 4.367   29.692 103.619 1.00 92.20  ? 357 LEU B CG  1 
ATOM   4644 C  CD1 . LEU B 1 165 ? 3.762   31.037 103.194 1.00 91.83  ? 357 LEU B CD1 1 
ATOM   4645 C  CD2 . LEU B 1 165 ? 4.419   29.571 105.138 1.00 90.14  ? 357 LEU B CD2 1 
ATOM   4646 N  N   . LEU B 1 166 ? 2.388   25.433 102.642 1.00 89.72  ? 358 LEU B N   1 
ATOM   4647 C  CA  . LEU B 1 166 ? 1.422   24.663 101.864 1.00 87.64  ? 358 LEU B CA  1 
ATOM   4648 C  C   . LEU B 1 166 ? 0.113   24.499 102.628 1.00 89.93  ? 358 LEU B C   1 
ATOM   4649 O  O   . LEU B 1 166 ? 0.095   24.522 103.867 1.00 92.00  ? 358 LEU B O   1 
ATOM   4650 C  CB  . LEU B 1 166 ? 1.995   23.292 101.468 1.00 85.77  ? 358 LEU B CB  1 
ATOM   4651 C  CG  . LEU B 1 166 ? 2.419   22.312 102.576 1.00 83.82  ? 358 LEU B CG  1 
ATOM   4652 C  CD1 . LEU B 1 166 ? 1.656   21.011 102.477 1.00 80.79  ? 358 LEU B CD1 1 
ATOM   4653 C  CD2 . LEU B 1 166 ? 3.922   22.068 102.582 1.00 83.48  ? 358 LEU B CD2 1 
ATOM   4654 N  N   . PHE B 1 167 ? -0.981  24.340 101.890 1.00 90.30  ? 359 PHE B N   1 
ATOM   4655 C  CA  . PHE B 1 167 ? -2.269  24.007 102.506 1.00 89.74  ? 359 PHE B CA  1 
ATOM   4656 C  C   . PHE B 1 167 ? -2.560  22.521 102.340 1.00 89.73  ? 359 PHE B C   1 
ATOM   4657 O  O   . PHE B 1 167 ? -2.523  21.994 101.233 1.00 90.16  ? 359 PHE B O   1 
ATOM   4658 C  CB  . PHE B 1 167 ? -3.413  24.833 101.901 1.00 86.52  ? 359 PHE B CB  1 
ATOM   4659 C  CG  . PHE B 1 167 ? -3.569  26.202 102.499 1.00 85.37  ? 359 PHE B CG  1 
ATOM   4660 C  CD1 . PHE B 1 167 ? -2.938  27.306 101.923 1.00 85.17  ? 359 PHE B CD1 1 
ATOM   4661 C  CD2 . PHE B 1 167 ? -4.357  26.395 103.630 1.00 84.34  ? 359 PHE B CD2 1 
ATOM   4662 C  CE1 . PHE B 1 167 ? -3.087  28.591 102.469 1.00 84.09  ? 359 PHE B CE1 1 
ATOM   4663 C  CE2 . PHE B 1 167 ? -4.504  27.672 104.188 1.00 83.62  ? 359 PHE B CE2 1 
ATOM   4664 C  CZ  . PHE B 1 167 ? -3.869  28.771 103.602 1.00 84.11  ? 359 PHE B CZ  1 
ATOM   4665 N  N   . GLY B 1 168 ? -2.849  21.840 103.439 1.00 93.80  ? 360 GLY B N   1 
ATOM   4666 C  CA  . GLY B 1 168 ? -3.226  20.435 103.361 1.00 98.71  ? 360 GLY B CA  1 
ATOM   4667 C  C   . GLY B 1 168 ? -4.604  20.272 102.741 1.00 102.42 ? 360 GLY B C   1 
ATOM   4668 O  O   . GLY B 1 168 ? -5.349  21.249 102.623 1.00 104.26 ? 360 GLY B O   1 
ATOM   4669 N  N   . PRO B 1 169 ? -4.950  19.038 102.322 1.00 102.86 ? 361 PRO B N   1 
ATOM   4670 C  CA  . PRO B 1 169 ? -6.322  18.721 101.922 1.00 99.34  ? 361 PRO B CA  1 
ATOM   4671 C  C   . PRO B 1 169 ? -7.270  18.950 103.085 1.00 94.82  ? 361 PRO B C   1 
ATOM   4672 O  O   . PRO B 1 169 ? -8.461  19.161 102.880 1.00 95.96  ? 361 PRO B O   1 
ATOM   4673 C  CB  . PRO B 1 169 ? -6.255  17.229 101.591 1.00 101.48 ? 361 PRO B CB  1 
ATOM   4674 C  CG  . PRO B 1 169 ? -4.825  16.974 101.270 1.00 103.16 ? 361 PRO B CG  1 
ATOM   4675 C  CD  . PRO B 1 169 ? -4.058  17.875 102.179 1.00 102.91 ? 361 PRO B CD  1 
ATOM   4676 N  N   . ASP B 1 170 ? -6.722  18.907 104.296 1.00 92.47  ? 362 ASP B N   1 
ATOM   4677 C  CA  . ASP B 1 170 ? -7.447  19.238 105.519 1.00 92.97  ? 362 ASP B CA  1 
ATOM   4678 C  C   . ASP B 1 170 ? -7.867  20.708 105.555 1.00 91.54  ? 362 ASP B C   1 
ATOM   4679 O  O   . ASP B 1 170 ? -8.773  21.082 106.305 1.00 91.53  ? 362 ASP B O   1 
ATOM   4680 C  CB  . ASP B 1 170 ? -6.581  18.920 106.744 1.00 95.78  ? 362 ASP B CB  1 
ATOM   4681 C  CG  . ASP B 1 170 ? -5.123  19.355 106.573 1.00 99.24  ? 362 ASP B CG  1 
ATOM   4682 O  OD1 . ASP B 1 170 ? -4.868  20.494 106.121 1.00 99.98  ? 362 ASP B OD1 1 
ATOM   4683 O  OD2 . ASP B 1 170 ? -4.224  18.550 106.895 1.00 101.47 ? 362 ASP B OD2 1 
ATOM   4684 N  N   . GLY B 1 171 ? -7.195  21.532 104.750 1.00 88.44  ? 363 GLY B N   1 
ATOM   4685 C  CA  . GLY B 1 171 ? -7.465  22.965 104.695 1.00 85.86  ? 363 GLY B CA  1 
ATOM   4686 C  C   . GLY B 1 171 ? -6.616  23.782 105.651 1.00 86.33  ? 363 GLY B C   1 
ATOM   4687 O  O   . GLY B 1 171 ? -6.719  25.008 105.680 1.00 87.17  ? 363 GLY B O   1 
ATOM   4688 N  N   . PHE B 1 172 ? -5.785  23.104 106.441 1.00 86.89  ? 364 PHE B N   1 
ATOM   4689 C  CA  . PHE B 1 172 ? -4.896  23.769 107.388 1.00 86.45  ? 364 PHE B CA  1 
ATOM   4690 C  C   . PHE B 1 172 ? -3.624  24.176 106.684 1.00 88.04  ? 364 PHE B C   1 
ATOM   4691 O  O   . PHE B 1 172 ? -3.271  23.601 105.653 1.00 89.77  ? 364 PHE B O   1 
ATOM   4692 C  CB  . PHE B 1 172 ? -4.562  22.863 108.576 1.00 84.11  ? 364 PHE B CB  1 
ATOM   4693 C  CG  . PHE B 1 172 ? -5.768  22.374 109.333 1.00 85.10  ? 364 PHE B CG  1 
ATOM   4694 C  CD1 . PHE B 1 172 ? -6.743  23.264 109.783 1.00 85.24  ? 364 PHE B CD1 1 
ATOM   4695 C  CD2 . PHE B 1 172 ? -5.921  21.021 109.618 1.00 85.37  ? 364 PHE B CD2 1 
ATOM   4696 C  CE1 . PHE B 1 172 ? -7.858  22.807 110.497 1.00 83.79  ? 364 PHE B CE1 1 
ATOM   4697 C  CE2 . PHE B 1 172 ? -7.033  20.558 110.331 1.00 84.16  ? 364 PHE B CE2 1 
ATOM   4698 C  CZ  . PHE B 1 172 ? -8.002  21.454 110.765 1.00 82.90  ? 364 PHE B CZ  1 
ATOM   4699 N  N   . LEU B 1 173 ? -2.938  25.166 107.249 1.00 89.89  ? 365 LEU B N   1 
ATOM   4700 C  CA  . LEU B 1 173 ? -1.703  25.700 106.671 1.00 89.53  ? 365 LEU B CA  1 
ATOM   4701 C  C   . LEU B 1 173 ? -0.478  25.088 107.347 1.00 90.84  ? 365 LEU B C   1 
ATOM   4702 O  O   . LEU B 1 173 ? -0.398  25.040 108.578 1.00 92.13  ? 365 LEU B O   1 
ATOM   4703 C  CB  . LEU B 1 173 ? -1.677  27.223 106.816 1.00 86.08  ? 365 LEU B CB  1 
ATOM   4704 C  CG  . LEU B 1 173 ? -0.419  27.966 106.388 1.00 82.69  ? 365 LEU B CG  1 
ATOM   4705 C  CD1 . LEU B 1 173 ? -0.463  28.209 104.909 1.00 84.60  ? 365 LEU B CD1 1 
ATOM   4706 C  CD2 . LEU B 1 173 ? -0.321  29.272 107.129 1.00 82.69  ? 365 LEU B CD2 1 
ATOM   4707 N  N   . TYR B 1 174 ? 0.468   24.618 106.538 1.00 89.37  ? 366 TYR B N   1 
ATOM   4708 C  CA  . TYR B 1 174 ? 1.701   24.032 107.053 1.00 87.26  ? 366 TYR B CA  1 
ATOM   4709 C  C   . TYR B 1 174 ? 2.858   24.963 106.747 1.00 87.73  ? 366 TYR B C   1 
ATOM   4710 O  O   . TYR B 1 174 ? 2.949   25.502 105.643 1.00 86.79  ? 366 TYR B O   1 
ATOM   4711 C  CB  . TYR B 1 174 ? 1.960   22.666 106.419 1.00 84.77  ? 366 TYR B CB  1 
ATOM   4712 C  CG  . TYR B 1 174 ? 0.972   21.580 106.807 1.00 83.89  ? 366 TYR B CG  1 
ATOM   4713 C  CD1 . TYR B 1 174 ? -0.362  21.632 106.389 1.00 83.30  ? 366 TYR B CD1 1 
ATOM   4714 C  CD2 . TYR B 1 174 ? 1.382   20.481 107.557 1.00 81.70  ? 366 TYR B CD2 1 
ATOM   4715 C  CE1 . TYR B 1 174 ? -1.267  20.634 106.738 1.00 83.24  ? 366 TYR B CE1 1 
ATOM   4716 C  CE2 . TYR B 1 174 ? 0.489   19.478 107.905 1.00 82.76  ? 366 TYR B CE2 1 
ATOM   4717 C  CZ  . TYR B 1 174 ? -0.836  19.559 107.496 1.00 83.34  ? 366 TYR B CZ  1 
ATOM   4718 O  OH  . TYR B 1 174 ? -1.722  18.560 107.848 1.00 81.95  ? 366 TYR B OH  1 
ATOM   4719 N  N   . ILE B 1 175 ? 3.726   25.156 107.736 1.00 88.03  ? 367 ILE B N   1 
ATOM   4720 C  CA  . ILE B 1 175 ? 4.927   25.975 107.581 1.00 86.21  ? 367 ILE B CA  1 
ATOM   4721 C  C   . ILE B 1 175 ? 6.118   25.106 107.930 1.00 87.71  ? 367 ILE B C   1 
ATOM   4722 O  O   . ILE B 1 175 ? 6.241   24.632 109.066 1.00 90.52  ? 367 ILE B O   1 
ATOM   4723 C  CB  . ILE B 1 175 ? 4.921   27.217 108.517 1.00 85.45  ? 367 ILE B CB  1 
ATOM   4724 C  CG1 . ILE B 1 175 ? 3.686   28.093 108.282 1.00 86.35  ? 367 ILE B CG1 1 
ATOM   4725 C  CG2 . ILE B 1 175 ? 6.197   28.031 108.360 1.00 82.77  ? 367 ILE B CG2 1 
ATOM   4726 C  CD1 . ILE B 1 175 ? 2.556   27.840 109.269 1.00 86.64  ? 367 ILE B CD1 1 
ATOM   4727 N  N   . ILE B 1 176 ? 6.986   24.887 106.951 1.00 87.40  ? 368 ILE B N   1 
ATOM   4728 C  CA  . ILE B 1 176 ? 8.160   24.046 107.148 1.00 88.83  ? 368 ILE B CA  1 
ATOM   4729 C  C   . ILE B 1 176 ? 9.379   24.896 107.500 1.00 88.28  ? 368 ILE B C   1 
ATOM   4730 O  O   . ILE B 1 176 ? 10.009  25.493 106.628 1.00 93.67  ? 368 ILE B O   1 
ATOM   4731 C  CB  . ILE B 1 176 ? 8.426   23.166 105.911 1.00 90.25  ? 368 ILE B CB  1 
ATOM   4732 C  CG1 . ILE B 1 176 ? 7.299   22.143 105.752 1.00 93.27  ? 368 ILE B CG1 1 
ATOM   4733 C  CG2 . ILE B 1 176 ? 9.764   22.459 106.035 1.00 91.74  ? 368 ILE B CG2 1 
ATOM   4734 C  CD1 . ILE B 1 176 ? 7.253   21.453 104.398 1.00 95.84  ? 368 ILE B CD1 1 
ATOM   4735 N  N   . LEU B 1 177 ? 9.703   24.957 108.783 1.00 84.37  ? 369 LEU B N   1 
ATOM   4736 C  CA  . LEU B 1 177 ? 10.846  25.741 109.235 1.00 84.85  ? 369 LEU B CA  1 
ATOM   4737 C  C   . LEU B 1 177 ? 12.095  24.889 109.427 1.00 84.83  ? 369 LEU B C   1 
ATOM   4738 O  O   . LEU B 1 177 ? 12.049  23.846 110.078 1.00 86.74  ? 369 LEU B O   1 
ATOM   4739 C  CB  . LEU B 1 177 ? 10.515  26.482 110.531 1.00 83.11  ? 369 LEU B CB  1 
ATOM   4740 C  CG  . LEU B 1 177 ? 9.519   27.638 110.452 1.00 81.18  ? 369 LEU B CG  1 
ATOM   4741 C  CD1 . LEU B 1 177 ? 9.281   28.171 111.845 1.00 80.10  ? 369 LEU B CD1 1 
ATOM   4742 C  CD2 . LEU B 1 177 ? 10.006  28.745 109.524 1.00 78.28  ? 369 LEU B CD2 1 
ATOM   4743 N  N   . GLY B 1 178 ? 13.208  25.347 108.862 1.00 83.18  ? 370 GLY B N   1 
ATOM   4744 C  CA  . GLY B 1 178 ? 14.479  24.661 109.002 1.00 83.82  ? 370 GLY B CA  1 
ATOM   4745 C  C   . GLY B 1 178 ? 15.161  24.973 110.317 1.00 87.93  ? 370 GLY B C   1 
ATOM   4746 O  O   . GLY B 1 178 ? 14.618  25.699 111.146 1.00 88.80  ? 370 GLY B O   1 
ATOM   4747 N  N   . ASP B 1 179 ? 16.364  24.424 110.481 1.00 92.88  ? 371 ASP B N   1 
ATOM   4748 C  CA  . ASP B 1 179 ? 17.196  24.535 111.689 1.00 92.64  ? 371 ASP B CA  1 
ATOM   4749 C  C   . ASP B 1 179 ? 17.424  25.970 112.141 1.00 92.49  ? 371 ASP B C   1 
ATOM   4750 O  O   . ASP B 1 179 ? 17.478  26.245 113.339 1.00 92.33  ? 371 ASP B O   1 
ATOM   4751 C  CB  . ASP B 1 179 ? 18.572  23.941 111.397 1.00 94.29  ? 371 ASP B CB  1 
ATOM   4752 C  CG  . ASP B 1 179 ? 18.933  22.810 112.316 1.00 99.16  ? 371 ASP B CG  1 
ATOM   4753 O  OD1 . ASP B 1 179 ? 18.292  22.643 113.372 1.00 103.30 ? 371 ASP B OD1 1 
ATOM   4754 O  OD2 . ASP B 1 179 ? 19.874  22.072 111.970 1.00 102.22 ? 371 ASP B OD2 1 
ATOM   4755 N  N   . GLY B 1 180 ? 17.585  26.866 111.165 1.00 93.05  ? 372 GLY B N   1 
ATOM   4756 C  CA  . GLY B 1 180 ? 18.019  28.242 111.402 1.00 92.30  ? 372 GLY B CA  1 
ATOM   4757 C  C   . GLY B 1 180 ? 19.474  28.256 111.824 1.00 92.34  ? 372 GLY B C   1 
ATOM   4758 O  O   . GLY B 1 180 ? 20.044  29.317 112.094 1.00 92.87  ? 372 GLY B O   1 
ATOM   4759 N  N   . MET B 1 181 ? 20.064  27.061 111.856 1.00 91.61  ? 373 MET B N   1 
ATOM   4760 C  CA  . MET B 1 181 ? 21.369  26.798 112.465 1.00 92.67  ? 373 MET B CA  1 
ATOM   4761 C  C   . MET B 1 181 ? 21.426  27.121 113.962 1.00 92.74  ? 373 MET B C   1 
ATOM   4762 O  O   . MET B 1 181 ? 22.502  27.084 114.566 1.00 92.62  ? 373 MET B O   1 
ATOM   4763 C  CB  . MET B 1 181 ? 22.508  27.467 111.690 1.00 92.46  ? 373 MET B CB  1 
ATOM   4764 C  CG  . MET B 1 181 ? 22.975  26.651 110.497 1.00 93.82  ? 373 MET B CG  1 
ATOM   4765 S  SD  . MET B 1 181 ? 24.421  27.345 109.679 1.00 94.16  ? 373 MET B SD  1 
ATOM   4766 C  CE  . MET B 1 181 ? 25.738  26.823 110.789 1.00 94.39  ? 373 MET B CE  1 
ATOM   4767 N  N   . ILE B 1 182 ? 20.261  27.417 114.547 1.00 92.60  ? 374 ILE B N   1 
ATOM   4768 C  CA  . ILE B 1 182 ? 20.108  27.604 115.995 1.00 93.14  ? 374 ILE B CA  1 
ATOM   4769 C  C   . ILE B 1 182 ? 20.557  26.339 116.729 1.00 93.11  ? 374 ILE B C   1 
ATOM   4770 O  O   . ILE B 1 182 ? 20.081  25.241 116.426 1.00 92.69  ? 374 ILE B O   1 
ATOM   4771 C  CB  . ILE B 1 182 ? 18.629  27.874 116.392 1.00 92.55  ? 374 ILE B CB  1 
ATOM   4772 C  CG1 . ILE B 1 182 ? 17.948  28.861 115.433 1.00 92.41  ? 374 ILE B CG1 1 
ATOM   4773 C  CG2 . ILE B 1 182 ? 18.530  28.320 117.856 1.00 92.82  ? 374 ILE B CG2 1 
ATOM   4774 C  CD1 . ILE B 1 182 ? 18.227  30.324 115.701 1.00 92.16  ? 374 ILE B CD1 1 
ATOM   4775 N  N   . THR B 1 183 ? 21.471  26.495 117.683 1.00 93.33  ? 375 THR B N   1 
ATOM   4776 C  CA  . THR B 1 183 ? 21.965  25.354 118.458 1.00 95.28  ? 375 THR B CA  1 
ATOM   4777 C  C   . THR B 1 183 ? 21.369  25.328 119.865 1.00 96.11  ? 375 THR B C   1 
ATOM   4778 O  O   . THR B 1 183 ? 21.175  26.376 120.478 1.00 97.23  ? 375 THR B O   1 
ATOM   4779 C  CB  . THR B 1 183 ? 23.526  25.288 118.497 1.00 96.08  ? 375 THR B CB  1 
ATOM   4780 O  OG1 . THR B 1 183 ? 23.938  24.134 119.236 1.00 98.72  ? 375 THR B OG1 1 
ATOM   4781 C  CG2 . THR B 1 183 ? 24.142  26.523 119.140 1.00 96.14  ? 375 THR B CG2 1 
ATOM   4782 N  N   . LEU B 1 184 ? 21.077  24.131 120.375 1.00 96.60  ? 376 LEU B N   1 
ATOM   4783 C  CA  . LEU B 1 184 ? 20.522  23.986 121.727 1.00 97.04  ? 376 LEU B CA  1 
ATOM   4784 C  C   . LEU B 1 184 ? 21.336  24.762 122.765 1.00 96.32  ? 376 LEU B C   1 
ATOM   4785 O  O   . LEU B 1 184 ? 20.813  25.150 123.812 1.00 93.77  ? 376 LEU B O   1 
ATOM   4786 C  CB  . LEU B 1 184 ? 20.411  22.511 122.132 1.00 98.14  ? 376 LEU B CB  1 
ATOM   4787 C  CG  . LEU B 1 184 ? 19.707  22.225 123.473 1.00 100.24 ? 376 LEU B CG  1 
ATOM   4788 C  CD1 . LEU B 1 184 ? 18.190  22.359 123.350 1.00 100.81 ? 376 LEU B CD1 1 
ATOM   4789 C  CD2 . LEU B 1 184 ? 20.077  20.859 124.048 1.00 99.30  ? 376 LEU B CD2 1 
ATOM   4790 N  N   . ASP B 1 185 ? 22.613  24.985 122.462 1.00 99.24  ? 377 ASP B N   1 
ATOM   4791 C  CA  . ASP B 1 185 ? 23.462  25.847 123.276 1.00 101.94 ? 377 ASP B CA  1 
ATOM   4792 C  C   . ASP B 1 185 ? 22.881  27.251 123.385 1.00 102.15 ? 377 ASP B C   1 
ATOM   4793 O  O   . ASP B 1 185 ? 22.375  27.627 124.444 1.00 99.80  ? 377 ASP B O   1 
ATOM   4794 C  CB  . ASP B 1 185 ? 24.899  25.884 122.742 1.00 103.55 ? 377 ASP B CB  1 
ATOM   4795 C  CG  . ASP B 1 185 ? 25.881  25.197 123.670 1.00 105.22 ? 377 ASP B CG  1 
ATOM   4796 O  OD1 . ASP B 1 185 ? 26.936  25.796 123.961 1.00 106.99 ? 377 ASP B OD1 1 
ATOM   4797 O  OD2 . ASP B 1 185 ? 25.593  24.071 124.128 1.00 105.72 ? 377 ASP B OD2 1 
ATOM   4798 N  N   . ASP B 1 186 ? 22.925  28.007 122.287 1.00 104.54 ? 378 ASP B N   1 
ATOM   4799 C  CA  . ASP B 1 186 ? 22.422  29.383 122.281 1.00 105.76 ? 378 ASP B CA  1 
ATOM   4800 C  C   . ASP B 1 186 ? 20.914  29.472 122.576 1.00 104.13 ? 378 ASP B C   1 
ATOM   4801 O  O   . ASP B 1 186 ? 20.420  30.509 123.016 1.00 103.52 ? 378 ASP B O   1 
ATOM   4802 C  CB  . ASP B 1 186 ? 22.824  30.132 120.995 1.00 107.67 ? 378 ASP B CB  1 
ATOM   4803 C  CG  . ASP B 1 186 ? 22.458  29.382 119.720 1.00 111.97 ? 378 ASP B CG  1 
ATOM   4804 O  OD1 . ASP B 1 186 ? 21.424  28.687 119.693 1.00 114.86 ? 378 ASP B OD1 1 
ATOM   4805 O  OD2 . ASP B 1 186 ? 23.202  29.503 118.722 1.00 113.42 ? 378 ASP B OD2 1 
ATOM   4806 N  N   . MET B 1 187 ? 20.205  28.364 122.369 1.00 103.14 ? 379 MET B N   1 
ATOM   4807 C  CA  . MET B 1 187 ? 18.786  28.268 122.705 1.00 103.00 ? 379 MET B CA  1 
ATOM   4808 C  C   . MET B 1 187 ? 18.562  28.280 124.214 1.00 99.55  ? 379 MET B C   1 
ATOM   4809 O  O   . MET B 1 187 ? 17.554  28.799 124.685 1.00 99.81  ? 379 MET B O   1 
ATOM   4810 C  CB  . MET B 1 187 ? 18.179  27.005 122.097 1.00 104.70 ? 379 MET B CB  1 
ATOM   4811 C  CG  . MET B 1 187 ? 16.711  27.129 121.737 1.00 105.45 ? 379 MET B CG  1 
ATOM   4812 S  SD  . MET B 1 187 ? 16.151  25.692 120.807 1.00 106.85 ? 379 MET B SD  1 
ATOM   4813 C  CE  . MET B 1 187 ? 14.867  26.416 119.778 1.00 106.21 ? 379 MET B CE  1 
ATOM   4814 N  N   . GLU B 1 188 ? 19.503  27.703 124.960 1.00 98.33  ? 380 GLU B N   1 
ATOM   4815 C  CA  . GLU B 1 188 ? 19.461  27.709 126.426 1.00 97.31  ? 380 GLU B CA  1 
ATOM   4816 C  C   . GLU B 1 188 ? 19.905  29.044 127.014 1.00 96.49  ? 380 GLU B C   1 
ATOM   4817 O  O   . GLU B 1 188 ? 19.525  29.390 128.132 1.00 96.49  ? 380 GLU B O   1 
ATOM   4818 C  CB  . GLU B 1 188 ? 20.348  26.598 127.000 1.00 95.92  ? 380 GLU B CB  1 
ATOM   4819 C  CG  . GLU B 1 188 ? 19.657  25.256 127.185 1.00 95.81  ? 380 GLU B CG  1 
ATOM   4820 C  CD  . GLU B 1 188 ? 20.523  24.233 127.911 1.00 97.25  ? 380 GLU B CD  1 
ATOM   4821 O  OE1 . GLU B 1 188 ? 21.695  24.532 128.230 1.00 98.18  ? 380 GLU B OE1 1 
ATOM   4822 O  OE2 . GLU B 1 188 ? 20.025  23.118 128.168 1.00 98.15  ? 380 GLU B OE2 1 
ATOM   4823 N  N   . GLU B 1 189 ? 20.700  29.789 126.249 1.00 96.28  ? 381 GLU B N   1 
ATOM   4824 C  CA  . GLU B 1 189 ? 21.435  30.945 126.770 1.00 94.60  ? 381 GLU B CA  1 
ATOM   4825 C  C   . GLU B 1 189 ? 20.969  32.303 126.220 1.00 93.80  ? 381 GLU B C   1 
ATOM   4826 O  O   . GLU B 1 189 ? 21.650  33.317 126.414 1.00 94.03  ? 381 GLU B O   1 
ATOM   4827 C  CB  . GLU B 1 189 ? 22.937  30.762 126.506 1.00 93.57  ? 381 GLU B CB  1 
ATOM   4828 C  CG  . GLU B 1 189 ? 23.528  29.455 127.039 1.00 92.23  ? 381 GLU B CG  1 
ATOM   4829 C  CD  . GLU B 1 189 ? 24.598  28.868 126.127 1.00 92.34  ? 381 GLU B CD  1 
ATOM   4830 O  OE1 . GLU B 1 189 ? 24.720  29.318 124.965 1.00 94.62  ? 381 GLU B OE1 1 
ATOM   4831 O  OE2 . GLU B 1 189 ? 25.310  27.940 126.565 1.00 89.16  ? 381 GLU B OE2 1 
ATOM   4832 N  N   . MET B 1 190 ? 19.822  32.328 125.542 1.00 91.42  ? 382 MET B N   1 
ATOM   4833 C  CA  . MET B 1 190 ? 19.312  33.571 124.948 1.00 89.69  ? 382 MET B CA  1 
ATOM   4834 C  C   . MET B 1 190 ? 17.799  33.742 125.104 1.00 88.69  ? 382 MET B C   1 
ATOM   4835 O  O   . MET B 1 190 ? 17.048  32.767 125.050 1.00 89.58  ? 382 MET B O   1 
ATOM   4836 C  CB  . MET B 1 190 ? 19.708  33.675 123.467 1.00 89.97  ? 382 MET B CB  1 
ATOM   4837 C  CG  . MET B 1 190 ? 21.221  33.624 123.197 1.00 90.39  ? 382 MET B CG  1 
ATOM   4838 S  SD  . MET B 1 190 ? 21.753  33.954 121.496 1.00 89.61  ? 382 MET B SD  1 
ATOM   4839 C  CE  . MET B 1 190 ? 20.703  32.830 120.595 1.00 89.95  ? 382 MET B CE  1 
ATOM   4840 N  N   . ASP B 1 191 ? 17.367  34.989 125.289 1.00 87.17  ? 383 ASP B N   1 
ATOM   4841 C  CA  . ASP B 1 191 ? 15.945  35.333 125.418 1.00 86.07  ? 383 ASP B CA  1 
ATOM   4842 C  C   . ASP B 1 191 ? 15.354  35.855 124.106 1.00 86.36  ? 383 ASP B C   1 
ATOM   4843 O  O   . ASP B 1 191 ? 16.050  36.483 123.307 1.00 86.02  ? 383 ASP B O   1 
ATOM   4844 C  CB  . ASP B 1 191 ? 15.746  36.379 126.522 1.00 84.48  ? 383 ASP B CB  1 
ATOM   4845 C  CG  . ASP B 1 191 ? 16.000  35.825 127.920 1.00 84.58  ? 383 ASP B CG  1 
ATOM   4846 O  OD1 . ASP B 1 191 ? 16.176  34.596 128.067 1.00 85.36  ? 383 ASP B OD1 1 
ATOM   4847 O  OD2 . ASP B 1 191 ? 16.016  36.620 128.887 1.00 83.69  ? 383 ASP B OD2 1 
ATOM   4848 N  N   . GLY B 1 192 ? 14.065  35.603 123.895 1.00 87.26  ? 384 GLY B N   1 
ATOM   4849 C  CA  . GLY B 1 192 ? 13.358  36.097 122.708 1.00 87.57  ? 384 GLY B CA  1 
ATOM   4850 C  C   . GLY B 1 192 ? 13.713  35.310 121.463 1.00 88.03  ? 384 GLY B C   1 
ATOM   4851 O  O   . GLY B 1 192 ? 13.903  35.876 120.382 1.00 87.09  ? 384 GLY B O   1 
ATOM   4852 N  N   . LEU B 1 193 ? 13.796  33.995 121.633 1.00 88.45  ? 385 LEU B N   1 
ATOM   4853 C  CA  . LEU B 1 193 ? 14.198  33.086 120.577 1.00 88.07  ? 385 LEU B CA  1 
ATOM   4854 C  C   . LEU B 1 193 ? 13.084  32.078 120.328 1.00 89.60  ? 385 LEU B C   1 
ATOM   4855 O  O   . LEU B 1 193 ? 12.603  31.432 121.264 1.00 90.08  ? 385 LEU B O   1 
ATOM   4856 C  CB  . LEU B 1 193 ? 15.472  32.357 120.997 1.00 87.54  ? 385 LEU B CB  1 
ATOM   4857 C  CG  . LEU B 1 193 ? 16.479  31.987 119.913 1.00 86.87  ? 385 LEU B CG  1 
ATOM   4858 C  CD1 . LEU B 1 193 ? 17.218  33.229 119.439 1.00 87.40  ? 385 LEU B CD1 1 
ATOM   4859 C  CD2 . LEU B 1 193 ? 17.454  30.958 120.450 1.00 85.65  ? 385 LEU B CD2 1 
ATOM   4860 N  N   . SER B 1 194 ? 12.677  31.945 119.067 1.00 90.97  ? 386 SER B N   1 
ATOM   4861 C  CA  . SER B 1 194 ? 11.546  31.088 118.711 1.00 91.62  ? 386 SER B CA  1 
ATOM   4862 C  C   . SER B 1 194 ? 11.733  29.626 119.093 1.00 93.12  ? 386 SER B C   1 
ATOM   4863 O  O   . SER B 1 194 ? 12.858  29.140 119.219 1.00 96.29  ? 386 SER B O   1 
ATOM   4864 C  CB  . SER B 1 194 ? 11.237  31.182 117.222 1.00 90.47  ? 386 SER B CB  1 
ATOM   4865 O  OG  . SER B 1 194 ? 10.290  30.193 116.851 1.00 89.02  ? 386 SER B OG  1 
ATOM   4866 N  N   . ASP B 1 195 ? 10.607  28.943 119.274 1.00 92.96  ? 387 ASP B N   1 
ATOM   4867 C  CA  . ASP B 1 195 ? 10.582  27.511 119.518 1.00 93.25  ? 387 ASP B CA  1 
ATOM   4868 C  C   . ASP B 1 195 ? 9.992   26.769 118.325 1.00 92.83  ? 387 ASP B C   1 
ATOM   4869 O  O   . ASP B 1 195 ? 9.654   25.585 118.420 1.00 93.38  ? 387 ASP B O   1 
ATOM   4870 C  CB  . ASP B 1 195 ? 9.786   27.208 120.782 1.00 95.00  ? 387 ASP B CB  1 
ATOM   4871 C  CG  . ASP B 1 195 ? 10.631  27.298 122.031 1.00 98.86  ? 387 ASP B CG  1 
ATOM   4872 O  OD1 . ASP B 1 195 ? 11.660  26.582 122.111 1.00 100.11 ? 387 ASP B OD1 1 
ATOM   4873 O  OD2 . ASP B 1 195 ? 10.265  28.078 122.935 1.00 99.44  ? 387 ASP B OD2 1 
ATOM   4874 N  N   . PHE B 1 196 ? 9.884   27.470 117.200 1.00 90.64  ? 388 PHE B N   1 
ATOM   4875 C  CA  . PHE B 1 196 ? 9.313   26.887 115.994 1.00 89.27  ? 388 PHE B CA  1 
ATOM   4876 C  C   . PHE B 1 196 ? 10.359  26.343 115.006 1.00 88.64  ? 388 PHE B C   1 
ATOM   4877 O  O   . PHE B 1 196 ? 10.027  25.515 114.157 1.00 90.70  ? 388 PHE B O   1 
ATOM   4878 C  CB  . PHE B 1 196 ? 8.373   27.882 115.298 1.00 88.97  ? 388 PHE B CB  1 
ATOM   4879 C  CG  . PHE B 1 196 ? 7.267   28.410 116.180 1.00 89.85  ? 388 PHE B CG  1 
ATOM   4880 C  CD1 . PHE B 1 196 ? 7.016   29.782 116.252 1.00 90.20  ? 388 PHE B CD1 1 
ATOM   4881 C  CD2 . PHE B 1 196 ? 6.474   27.545 116.937 1.00 88.10  ? 388 PHE B CD2 1 
ATOM   4882 C  CE1 . PHE B 1 196 ? 5.995   30.281 117.063 1.00 88.69  ? 388 PHE B CE1 1 
ATOM   4883 C  CE2 . PHE B 1 196 ? 5.453   28.036 117.750 1.00 86.45  ? 388 PHE B CE2 1 
ATOM   4884 C  CZ  . PHE B 1 196 ? 5.212   29.403 117.812 1.00 87.50  ? 388 PHE B CZ  1 
ATOM   4885 N  N   . THR B 1 197 ? 11.609  26.801 115.112 1.00 84.98  ? 389 THR B N   1 
ATOM   4886 C  CA  . THR B 1 197 ? 12.655  26.393 114.162 1.00 82.37  ? 389 THR B CA  1 
ATOM   4887 C  C   . THR B 1 197 ? 12.862  24.888 114.181 1.00 82.51  ? 389 THR B C   1 
ATOM   4888 O  O   . THR B 1 197 ? 12.766  24.260 115.225 1.00 81.90  ? 389 THR B O   1 
ATOM   4889 C  CB  . THR B 1 197 ? 14.013  27.077 114.421 1.00 81.06  ? 389 THR B CB  1 
ATOM   4890 O  OG1 . THR B 1 197 ? 14.438  26.823 115.766 1.00 85.48  ? 389 THR B OG1 1 
ATOM   4891 C  CG2 . THR B 1 197 ? 13.927  28.570 114.188 1.00 77.74  ? 389 THR B CG2 1 
ATOM   4892 N  N   . GLY B 1 198 ? 13.138  24.318 113.013 1.00 86.29  ? 390 GLY B N   1 
ATOM   4893 C  CA  . GLY B 1 198 ? 13.336  22.876 112.871 1.00 87.88  ? 390 GLY B CA  1 
ATOM   4894 C  C   . GLY B 1 198 ? 12.056  22.076 113.040 1.00 88.51  ? 390 GLY B C   1 
ATOM   4895 O  O   . GLY B 1 198 ? 12.099  20.866 113.283 1.00 90.09  ? 390 GLY B O   1 
ATOM   4896 N  N   . SER B 1 199 ? 10.917  22.752 112.909 1.00 87.63  ? 391 SER B N   1 
ATOM   4897 C  CA  . SER B 1 199 ? 9.620   22.125 113.120 1.00 87.46  ? 391 SER B CA  1 
ATOM   4898 C  C   . SER B 1 199 ? 8.691   22.337 111.943 1.00 85.86  ? 391 SER B C   1 
ATOM   4899 O  O   . SER B 1 199 ? 8.777   23.348 111.257 1.00 87.87  ? 391 SER B O   1 
ATOM   4900 C  CB  . SER B 1 199 ? 8.954   22.695 114.371 1.00 89.32  ? 391 SER B CB  1 
ATOM   4901 O  OG  . SER B 1 199 ? 9.812   22.620 115.493 1.00 93.13  ? 391 SER B OG  1 
ATOM   4902 N  N   . VAL B 1 200 ? 7.804   21.377 111.716 1.00 84.49  ? 392 VAL B N   1 
ATOM   4903 C  CA  . VAL B 1 200 ? 6.674   21.575 110.822 1.00 84.93  ? 392 VAL B CA  1 
ATOM   4904 C  C   . VAL B 1 200 ? 5.532   22.096 111.678 1.00 87.46  ? 392 VAL B C   1 
ATOM   4905 O  O   . VAL B 1 200 ? 5.157   21.464 112.673 1.00 88.15  ? 392 VAL B O   1 
ATOM   4906 C  CB  . VAL B 1 200 ? 6.244   20.264 110.136 1.00 83.63  ? 392 VAL B CB  1 
ATOM   4907 C  CG1 . VAL B 1 200 ? 5.104   20.515 109.154 1.00 81.75  ? 392 VAL B CG1 1 
ATOM   4908 C  CG2 . VAL B 1 200 ? 7.420   19.628 109.425 1.00 84.29  ? 392 VAL B CG2 1 
ATOM   4909 N  N   . LEU B 1 201 ? 4.997   23.256 111.304 1.00 88.50  ? 393 LEU B N   1 
ATOM   4910 C  CA  . LEU B 1 201 ? 3.868   23.855 112.027 1.00 88.45  ? 393 LEU B CA  1 
ATOM   4911 C  C   . LEU B 1 201 ? 2.568   23.698 111.240 1.00 88.86  ? 393 LEU B C   1 
ATOM   4912 O  O   . LEU B 1 201 ? 2.577   23.707 109.997 1.00 90.78  ? 393 LEU B O   1 
ATOM   4913 C  CB  . LEU B 1 201 ? 4.125   25.341 112.299 1.00 87.03  ? 393 LEU B CB  1 
ATOM   4914 C  CG  . LEU B 1 201 ? 5.489   25.788 112.825 1.00 83.88  ? 393 LEU B CG  1 
ATOM   4915 C  CD1 . LEU B 1 201 ? 5.559   27.295 112.850 1.00 82.99  ? 393 LEU B CD1 1 
ATOM   4916 C  CD2 . LEU B 1 201 ? 5.757   25.223 114.199 1.00 83.42  ? 393 LEU B CD2 1 
ATOM   4917 N  N   . ARG B 1 202 ? 1.457   23.571 111.963 1.00 85.02  ? 394 ARG B N   1 
ATOM   4918 C  CA  . ARG B 1 202 ? 0.140   23.444 111.336 1.00 84.22  ? 394 ARG B CA  1 
ATOM   4919 C  C   . ARG B 1 202 ? -0.887  24.374 111.983 1.00 82.57  ? 394 ARG B C   1 
ATOM   4920 O  O   . ARG B 1 202 ? -1.251  24.179 113.142 1.00 85.47  ? 394 ARG B O   1 
ATOM   4921 C  CB  . ARG B 1 202 ? -0.343  21.996 111.405 1.00 85.80  ? 394 ARG B CB  1 
ATOM   4922 C  CG  . ARG B 1 202 ? -1.503  21.691 110.486 1.00 88.02  ? 394 ARG B CG  1 
ATOM   4923 C  CD  . ARG B 1 202 ? -1.811  20.213 110.472 1.00 89.18  ? 394 ARG B CD  1 
ATOM   4924 N  NE  . ARG B 1 202 ? -2.826  19.830 111.441 1.00 90.75  ? 394 ARG B NE  1 
ATOM   4925 C  CZ  . ARG B 1 202 ? -3.376  18.621 111.504 1.00 94.22  ? 394 ARG B CZ  1 
ATOM   4926 N  NH1 . ARG B 1 202 ? -3.009  17.671 110.652 1.00 96.42  ? 394 ARG B NH1 1 
ATOM   4927 N  NH2 . ARG B 1 202 ? -4.297  18.356 112.420 1.00 95.98  ? 394 ARG B NH2 1 
ATOM   4928 N  N   . LEU B 1 203 ? -1.359  25.369 111.233 1.00 80.02  ? 395 LEU B N   1 
ATOM   4929 C  CA  . LEU B 1 203 ? -2.305  26.359 111.768 1.00 78.46  ? 395 LEU B CA  1 
ATOM   4930 C  C   . LEU B 1 203 ? -3.668  26.337 111.080 1.00 78.96  ? 395 LEU B C   1 
ATOM   4931 O  O   . LEU B 1 203 ? -3.755  26.132 109.868 1.00 80.63  ? 395 LEU B O   1 
ATOM   4932 C  CB  . LEU B 1 203 ? -1.726  27.769 111.677 1.00 77.21  ? 395 LEU B CB  1 
ATOM   4933 C  CG  . LEU B 1 203 ? -0.237  28.000 111.943 1.00 77.42  ? 395 LEU B CG  1 
ATOM   4934 C  CD1 . LEU B 1 203 ? 0.122   29.458 111.652 1.00 79.18  ? 395 LEU B CD1 1 
ATOM   4935 C  CD2 . LEU B 1 203 ? 0.142   27.631 113.360 1.00 77.72  ? 395 LEU B CD2 1 
ATOM   4936 N  N   . ASP B 1 204 ? -4.722  26.545 111.869 1.00 79.45  ? 396 ASP B N   1 
ATOM   4937 C  CA  . ASP B 1 204 ? -6.081  26.661 111.350 1.00 82.48  ? 396 ASP B CA  1 
ATOM   4938 C  C   . ASP B 1 204 ? -6.371  28.131 111.114 1.00 84.19  ? 396 ASP B C   1 
ATOM   4939 O  O   . ASP B 1 204 ? -6.744  28.867 112.034 1.00 82.34  ? 396 ASP B O   1 
ATOM   4940 C  CB  . ASP B 1 204 ? -7.110  26.056 112.316 1.00 85.29  ? 396 ASP B CB  1 
ATOM   4941 C  CG  . ASP B 1 204 ? -8.528  26.023 111.735 1.00 88.31  ? 396 ASP B CG  1 
ATOM   4942 O  OD1 . ASP B 1 204 ? -8.689  26.229 110.509 1.00 92.05  ? 396 ASP B OD1 1 
ATOM   4943 O  OD2 . ASP B 1 204 ? -9.483  25.779 112.508 1.00 87.04  ? 396 ASP B OD2 1 
ATOM   4944 N  N   . VAL B 1 205 ? -6.203  28.542 109.863 1.00 85.08  ? 397 VAL B N   1 
ATOM   4945 C  CA  . VAL B 1 205 ? -6.296  29.939 109.481 1.00 83.96  ? 397 VAL B CA  1 
ATOM   4946 C  C   . VAL B 1 205 ? -7.739  30.450 109.500 1.00 86.44  ? 397 VAL B C   1 
ATOM   4947 O  O   . VAL B 1 205 ? -7.969  31.659 109.577 1.00 88.50  ? 397 VAL B O   1 
ATOM   4948 C  CB  . VAL B 1 205 ? -5.682  30.154 108.096 1.00 84.52  ? 397 VAL B CB  1 
ATOM   4949 C  CG1 . VAL B 1 205 ? -5.833  31.566 107.696 1.00 89.24  ? 397 VAL B CG1 1 
ATOM   4950 C  CG2 . VAL B 1 205 ? -4.209  29.810 108.111 1.00 86.54  ? 397 VAL B CG2 1 
ATOM   4951 N  N   . ASP B 1 206 ? -8.700  29.527 109.447 1.00 87.24  ? 398 ASP B N   1 
ATOM   4952 C  CA  . ASP B 1 206 ? -10.122 29.865 109.373 1.00 87.65  ? 398 ASP B CA  1 
ATOM   4953 C  C   . ASP B 1 206 ? -10.718 30.182 110.743 1.00 89.18  ? 398 ASP B C   1 
ATOM   4954 O  O   . ASP B 1 206 ? -11.490 29.388 111.274 1.00 89.48  ? 398 ASP B O   1 
ATOM   4955 C  CB  . ASP B 1 206 ? -10.916 28.713 108.743 1.00 87.54  ? 398 ASP B CB  1 
ATOM   4956 C  CG  . ASP B 1 206 ? -10.346 28.249 107.412 1.00 89.15  ? 398 ASP B CG  1 
ATOM   4957 O  OD1 . ASP B 1 206 ? -10.048 29.088 106.535 1.00 87.32  ? 398 ASP B OD1 1 
ATOM   4958 O  OD2 . ASP B 1 206 ? -10.215 27.022 107.238 1.00 92.44  ? 398 ASP B OD2 1 
ATOM   4959 N  N   . THR B 1 207 ? -10.376 31.343 111.302 1.00 90.74  ? 399 THR B N   1 
ATOM   4960 C  CA  . THR B 1 207 ? -10.872 31.742 112.623 1.00 92.47  ? 399 THR B CA  1 
ATOM   4961 C  C   . THR B 1 207 ? -12.140 32.575 112.525 1.00 94.79  ? 399 THR B C   1 
ATOM   4962 O  O   . THR B 1 207 ? -12.339 33.313 111.558 1.00 96.42  ? 399 THR B O   1 
ATOM   4963 C  CB  . THR B 1 207 ? -9.848  32.589 113.402 1.00 92.64  ? 399 THR B CB  1 
ATOM   4964 O  OG1 . THR B 1 207 ? -8.528  32.337 112.911 1.00 96.24  ? 399 THR B OG1 1 
ATOM   4965 C  CG2 . THR B 1 207 ? -9.912  32.276 114.891 1.00 90.67  ? 399 THR B CG2 1 
ATOM   4966 N  N   . ASP B 1 208 ? -12.991 32.453 113.540 1.00 95.55  ? 400 ASP B N   1 
ATOM   4967 C  CA  . ASP B 1 208 ? -14.121 33.351 113.719 1.00 95.28  ? 400 ASP B CA  1 
ATOM   4968 C  C   . ASP B 1 208 ? -13.849 34.270 114.909 1.00 96.59  ? 400 ASP B C   1 
ATOM   4969 O  O   . ASP B 1 208 ? -14.756 34.936 115.410 1.00 98.23  ? 400 ASP B O   1 
ATOM   4970 C  CB  . ASP B 1 208 ? -15.413 32.557 113.920 1.00 95.75  ? 400 ASP B CB  1 
ATOM   4971 C  CG  . ASP B 1 208 ? -15.963 31.984 112.620 1.00 97.83  ? 400 ASP B CG  1 
ATOM   4972 O  OD1 . ASP B 1 208 ? -17.184 32.097 112.395 1.00 98.63  ? 400 ASP B OD1 1 
ATOM   4973 O  OD2 . ASP B 1 208 ? -15.187 31.422 111.819 1.00 99.51  ? 400 ASP B OD2 1 
ATOM   4974 N  N   . MET B 1 209 ? -12.592 34.296 115.354 1.00 96.81  ? 401 MET B N   1 
ATOM   4975 C  CA  . MET B 1 209 ? -12.165 35.121 116.484 1.00 97.86  ? 401 MET B CA  1 
ATOM   4976 C  C   . MET B 1 209 ? -11.273 36.253 115.994 1.00 95.31  ? 401 MET B C   1 
ATOM   4977 O  O   . MET B 1 209 ? -10.624 36.125 114.962 1.00 98.04  ? 401 MET B O   1 
ATOM   4978 C  CB  . MET B 1 209 ? -11.412 34.282 117.528 1.00 103.08 ? 401 MET B CB  1 
ATOM   4979 C  CG  . MET B 1 209 ? -12.094 32.974 117.937 1.00 107.11 ? 401 MET B CG  1 
ATOM   4980 S  SD  . MET B 1 209 ? -13.599 33.193 118.905 1.00 111.59 ? 401 MET B SD  1 
ATOM   4981 C  CE  . MET B 1 209 ? -12.946 33.198 120.576 1.00 112.35 ? 401 MET B CE  1 
ATOM   4982 N  N   . CYS B 1 210 ? -11.234 37.354 116.739 1.00 93.81  ? 402 CYS B N   1 
ATOM   4983 C  CA  . CYS B 1 210 ? -10.423 38.512 116.360 1.00 93.54  ? 402 CYS B CA  1 
ATOM   4984 C  C   . CYS B 1 210 ? -9.313  38.826 117.361 1.00 93.61  ? 402 CYS B C   1 
ATOM   4985 O  O   . CYS B 1 210 ? -8.536  39.759 117.156 1.00 95.64  ? 402 CYS B O   1 
ATOM   4986 C  CB  . CYS B 1 210 ? -11.304 39.742 116.143 1.00 93.20  ? 402 CYS B CB  1 
ATOM   4987 S  SG  . CYS B 1 210 ? -12.672 39.458 115.008 1.00 93.59  ? 402 CYS B SG  1 
ATOM   4988 N  N   . ASN B 1 211 ? -9.236  38.034 118.428 1.00 92.83  ? 403 ASN B N   1 
ATOM   4989 C  CA  . ASN B 1 211 ? -8.236  38.229 119.477 1.00 93.28  ? 403 ASN B CA  1 
ATOM   4990 C  C   . ASN B 1 211 ? -6.847  37.719 119.095 1.00 93.94  ? 403 ASN B C   1 
ATOM   4991 O  O   . ASN B 1 211 ? -5.840  38.253 119.562 1.00 95.43  ? 403 ASN B O   1 
ATOM   4992 C  CB  . ASN B 1 211 ? -8.704  37.578 120.782 1.00 93.83  ? 403 ASN B CB  1 
ATOM   4993 C  CG  . ASN B 1 211 ? -9.994  38.195 121.317 1.00 96.09  ? 403 ASN B CG  1 
ATOM   4994 O  OD1 . ASN B 1 211 ? -10.781 38.787 120.569 1.00 96.73  ? 403 ASN B OD1 1 
ATOM   4995 N  ND2 . ASN B 1 211 ? -10.215 38.057 122.619 1.00 96.56  ? 403 ASN B ND2 1 
ATOM   4996 N  N   . VAL B 1 212 ? -6.807  36.687 118.251 1.00 92.33  ? 404 VAL B N   1 
ATOM   4997 C  CA  . VAL B 1 212 ? -5.563  36.050 117.809 1.00 90.68  ? 404 VAL B CA  1 
ATOM   4998 C  C   . VAL B 1 212 ? -5.569  35.982 116.269 1.00 90.85  ? 404 VAL B C   1 
ATOM   4999 O  O   . VAL B 1 212 ? -6.646  35.896 115.666 1.00 92.95  ? 404 VAL B O   1 
ATOM   5000 C  CB  . VAL B 1 212 ? -5.427  34.615 118.403 1.00 91.39  ? 404 VAL B CB  1 
ATOM   5001 C  CG1 . VAL B 1 212 ? -4.000  34.091 118.283 1.00 93.83  ? 404 VAL B CG1 1 
ATOM   5002 C  CG2 . VAL B 1 212 ? -5.847  34.583 119.862 1.00 93.60  ? 404 VAL B CG2 1 
ATOM   5003 N  N   . PRO B 1 213 ? -4.383  36.066 115.623 1.00 87.56  ? 405 PRO B N   1 
ATOM   5004 C  CA  . PRO B 1 213 ? -4.304  35.893 114.165 1.00 86.04  ? 405 PRO B CA  1 
ATOM   5005 C  C   . PRO B 1 213 ? -4.763  34.539 113.617 1.00 85.78  ? 405 PRO B C   1 
ATOM   5006 O  O   . PRO B 1 213 ? -5.327  34.495 112.527 1.00 86.40  ? 405 PRO B O   1 
ATOM   5007 C  CB  . PRO B 1 213 ? -2.817  36.118 113.856 1.00 84.77  ? 405 PRO B CB  1 
ATOM   5008 C  CG  . PRO B 1 213 ? -2.115  35.963 115.145 1.00 84.14  ? 405 PRO B CG  1 
ATOM   5009 C  CD  . PRO B 1 213 ? -3.068  36.411 116.192 1.00 86.61  ? 405 PRO B CD  1 
ATOM   5010 N  N   . TYR B 1 214 ? -4.518  33.454 114.350 1.00 87.15  ? 406 TYR B N   1 
ATOM   5011 C  CA  . TYR B 1 214 ? -4.837  32.102 113.867 1.00 87.65  ? 406 TYR B CA  1 
ATOM   5012 C  C   . TYR B 1 214 ? -5.313  31.191 114.983 1.00 90.59  ? 406 TYR B C   1 
ATOM   5013 O  O   . TYR B 1 214 ? -5.044  31.434 116.160 1.00 93.81  ? 406 TYR B O   1 
ATOM   5014 C  CB  . TYR B 1 214 ? -3.630  31.461 113.165 1.00 87.81  ? 406 TYR B CB  1 
ATOM   5015 C  CG  . TYR B 1 214 ? -2.394  31.382 114.029 1.00 88.18  ? 406 TYR B CG  1 
ATOM   5016 C  CD1 . TYR B 1 214 ? -1.379  32.330 113.914 1.00 87.88  ? 406 TYR B CD1 1 
ATOM   5017 C  CD2 . TYR B 1 214 ? -2.241  30.365 114.969 1.00 89.29  ? 406 TYR B CD2 1 
ATOM   5018 C  CE1 . TYR B 1 214 ? -0.245  32.267 114.716 1.00 88.58  ? 406 TYR B CE1 1 
ATOM   5019 C  CE2 . TYR B 1 214 ? -1.111  30.292 115.775 1.00 89.66  ? 406 TYR B CE2 1 
ATOM   5020 C  CZ  . TYR B 1 214 ? -0.119  31.246 115.645 1.00 89.15  ? 406 TYR B CZ  1 
ATOM   5021 O  OH  . TYR B 1 214 ? 0.999   31.172 116.444 1.00 88.84  ? 406 TYR B OH  1 
ATOM   5022 N  N   . SER B 1 215 ? -6.006  30.127 114.591 1.00 91.99  ? 407 SER B N   1 
ATOM   5023 C  CA  . SER B 1 215 ? -6.556  29.142 115.519 1.00 90.32  ? 407 SER B CA  1 
ATOM   5024 C  C   . SER B 1 215 ? -5.788  27.829 115.364 1.00 90.01  ? 407 SER B C   1 
ATOM   5025 O  O   . SER B 1 215 ? -5.147  27.604 114.344 1.00 90.70  ? 407 SER B O   1 
ATOM   5026 C  CB  . SER B 1 215 ? -8.036  28.928 115.204 1.00 88.80  ? 407 SER B CB  1 
ATOM   5027 O  OG  . SER B 1 215 ? -8.814  28.868 116.377 1.00 88.75  ? 407 SER B OG  1 
ATOM   5028 N  N   . ILE B 1 216 ? -5.848  26.965 116.371 1.00 92.29  ? 408 ILE B N   1 
ATOM   5029 C  CA  . ILE B 1 216 ? -5.153  25.675 116.308 1.00 94.41  ? 408 ILE B CA  1 
ATOM   5030 C  C   . ILE B 1 216 ? -6.151  24.518 116.185 1.00 95.48  ? 408 ILE B C   1 
ATOM   5031 O  O   . ILE B 1 216 ? -7.087  24.422 116.981 1.00 96.85  ? 408 ILE B O   1 
ATOM   5032 C  CB  . ILE B 1 216 ? -4.182  25.493 117.508 1.00 94.72  ? 408 ILE B CB  1 
ATOM   5033 C  CG1 . ILE B 1 216 ? -2.969  26.406 117.325 1.00 95.88  ? 408 ILE B CG1 1 
ATOM   5034 C  CG2 . ILE B 1 216 ? -3.707  24.044 117.636 1.00 93.36  ? 408 ILE B CG2 1 
ATOM   5035 C  CD1 . ILE B 1 216 ? -2.627  27.222 118.541 1.00 97.28  ? 408 ILE B CD1 1 
ATOM   5036 N  N   . PRO B 1 217 ? -5.967  23.656 115.164 1.00 95.60  ? 409 PRO B N   1 
ATOM   5037 C  CA  . PRO B 1 217 ? -6.838  22.501 114.926 1.00 97.01  ? 409 PRO B CA  1 
ATOM   5038 C  C   . PRO B 1 217 ? -6.915  21.545 116.108 1.00 98.79  ? 409 PRO B C   1 
ATOM   5039 O  O   . PRO B 1 217 ? -5.901  21.282 116.755 1.00 99.56  ? 409 PRO B O   1 
ATOM   5040 C  CB  . PRO B 1 217 ? -6.185  21.795 113.730 1.00 96.43  ? 409 PRO B CB  1 
ATOM   5041 C  CG  . PRO B 1 217 ? -4.865  22.408 113.557 1.00 95.08  ? 409 PRO B CG  1 
ATOM   5042 C  CD  . PRO B 1 217 ? -4.913  23.766 114.143 1.00 94.60  ? 409 PRO B CD  1 
ATOM   5043 N  N   . ARG B 1 218 ? -8.117  21.035 116.376 1.00 100.82 ? 410 ARG B N   1 
ATOM   5044 C  CA  . ARG B 1 218 ? -8.352  20.083 117.466 1.00 101.41 ? 410 ARG B CA  1 
ATOM   5045 C  C   . ARG B 1 218 ? -7.597  18.779 117.227 1.00 103.52 ? 410 ARG B C   1 
ATOM   5046 O  O   . ARG B 1 218 ? -7.286  18.052 118.170 1.00 105.12 ? 410 ARG B O   1 
ATOM   5047 C  CB  . ARG B 1 218 ? -9.669  19.716 117.732 0.00 20.00  ? 410 ARG B CB  1 
ATOM   5048 C  CG  . ARG B 1 218 ? -10.501 20.873 118.263 0.00 20.00  ? 410 ARG B CG  1 
ATOM   5049 C  CD  . ARG B 1 218 ? -11.959 20.524 118.514 0.00 20.00  ? 410 ARG B CD  1 
ATOM   5050 N  NE  . ARG B 1 218 ? -12.731 21.682 118.956 0.00 20.00  ? 410 ARG B NE  1 
ATOM   5051 C  CZ  . ARG B 1 218 ? -14.044 21.679 119.132 0.00 20.00  ? 410 ARG B CZ  1 
ATOM   5052 N  NH1 . ARG B 1 218 ? -14.743 20.574 118.909 0.00 20.00  ? 410 ARG B NH1 1 
ATOM   5053 N  NH2 . ARG B 1 218 ? -14.664 22.780 119.537 0.00 20.00  ? 410 ARG B NH2 1 
ATOM   5054 N  N   . SER B 1 219 ? -7.300  18.505 115.957 1.00 104.94 ? 411 SER B N   1 
ATOM   5055 C  CA  . SER B 1 219 ? -6.568  17.307 115.540 1.00 104.32 ? 411 SER B CA  1 
ATOM   5056 C  C   . SER B 1 219 ? -5.044  17.435 115.692 1.00 103.84 ? 411 SER B C   1 
ATOM   5057 O  O   . SER B 1 219 ? -4.313  16.463 115.488 1.00 102.47 ? 411 SER B O   1 
ATOM   5058 C  CB  . SER B 1 219 ? -6.945  16.929 114.098 1.00 104.41 ? 411 SER B CB  1 
ATOM   5059 O  OG  . SER B 1 219 ? -7.098  18.078 113.276 1.00 102.71 ? 411 SER B OG  1 
ATOM   5060 N  N   . ASN B 1 220 ? -4.577  18.633 116.043 1.00 104.84 ? 412 ASN B N   1 
ATOM   5061 C  CA  . ASN B 1 220 ? -3.163  18.874 116.341 1.00 105.29 ? 412 ASN B CA  1 
ATOM   5062 C  C   . ASN B 1 220 ? -2.712  18.180 117.621 1.00 106.44 ? 412 ASN B C   1 
ATOM   5063 O  O   . ASN B 1 220 ? -3.479  18.100 118.591 1.00 105.15 ? 412 ASN B O   1 
ATOM   5064 C  CB  . ASN B 1 220 ? -2.892  20.373 116.502 1.00 105.44 ? 412 ASN B CB  1 
ATOM   5065 C  CG  . ASN B 1 220 ? -2.326  21.014 115.257 1.00 106.80 ? 412 ASN B CG  1 
ATOM   5066 O  OD1 . ASN B 1 220 ? -2.011  22.201 115.261 1.00 107.97 ? 412 ASN B OD1 1 
ATOM   5067 N  ND2 . ASN B 1 220 ? -2.193  20.243 114.186 1.00 107.86 ? 412 ASN B ND2 1 
ATOM   5068 N  N   . PRO B 1 221 ? -1.457  17.688 117.641 1.00 106.44 ? 413 PRO B N   1 
ATOM   5069 C  CA  . PRO B 1 221 ? -0.893  17.301 118.929 1.00 104.74 ? 413 PRO B CA  1 
ATOM   5070 C  C   . PRO B 1 221 ? -0.518  18.586 119.661 1.00 104.10 ? 413 PRO B C   1 
ATOM   5071 O  O   . PRO B 1 221 ? -0.056  19.544 119.025 1.00 108.37 ? 413 PRO B O   1 
ATOM   5072 C  CB  . PRO B 1 221 ? 0.352   16.499 118.546 1.00 104.68 ? 413 PRO B CB  1 
ATOM   5073 C  CG  . PRO B 1 221 ? 0.746   17.018 117.203 1.00 104.67 ? 413 PRO B CG  1 
ATOM   5074 C  CD  . PRO B 1 221 ? -0.511  17.487 116.525 1.00 104.82 ? 413 PRO B CD  1 
ATOM   5075 N  N   . HIS B 1 222 ? -0.735  18.607 120.971 1.00 99.47  ? 414 HIS B N   1 
ATOM   5076 C  CA  . HIS B 1 222 ? -0.534  19.801 121.806 1.00 97.78  ? 414 HIS B CA  1 
ATOM   5077 C  C   . HIS B 1 222 ? -1.672  20.823 121.693 1.00 97.55  ? 414 HIS B C   1 
ATOM   5078 O  O   . HIS B 1 222 ? -1.520  21.965 122.131 1.00 96.60  ? 414 HIS B O   1 
ATOM   5079 C  CB  . HIS B 1 222 ? 0.817   20.495 121.536 1.00 96.08  ? 414 HIS B CB  1 
ATOM   5080 C  CG  . HIS B 1 222 ? 1.979   19.558 121.413 1.00 96.46  ? 414 HIS B CG  1 
ATOM   5081 N  ND1 . HIS B 1 222 ? 2.871   19.620 120.365 1.00 95.80  ? 414 HIS B ND1 1 
ATOM   5082 C  CD2 . HIS B 1 222 ? 2.392   18.535 122.199 1.00 97.62  ? 414 HIS B CD2 1 
ATOM   5083 C  CE1 . HIS B 1 222 ? 3.787   18.681 120.513 1.00 95.22  ? 414 HIS B CE1 1 
ATOM   5084 N  NE2 . HIS B 1 222 ? 3.519   18.007 121.616 1.00 96.65  ? 414 HIS B NE2 1 
ATOM   5085 N  N   . PHE B 1 223 ? -2.808  20.407 121.132 1.00 99.39  ? 415 PHE B N   1 
ATOM   5086 C  CA  . PHE B 1 223 ? -3.937  21.315 120.872 1.00 102.73 ? 415 PHE B CA  1 
ATOM   5087 C  C   . PHE B 1 223 ? -4.307  22.220 122.054 1.00 105.37 ? 415 PHE B C   1 
ATOM   5088 O  O   . PHE B 1 223 ? -4.396  23.440 121.897 1.00 107.15 ? 415 PHE B O   1 
ATOM   5089 C  CB  . PHE B 1 223 ? -5.168  20.542 120.367 1.00 102.63 ? 415 PHE B CB  1 
ATOM   5090 C  CG  . PHE B 1 223 ? -6.463  21.318 120.459 1.00 102.43 ? 415 PHE B CG  1 
ATOM   5091 C  CD1 . PHE B 1 223 ? -6.680  22.449 119.668 1.00 101.93 ? 415 PHE B CD1 1 
ATOM   5092 C  CD2 . PHE B 1 223 ? -7.466  20.915 121.336 1.00 100.55 ? 415 PHE B CD2 1 
ATOM   5093 C  CE1 . PHE B 1 223 ? -7.873  23.166 119.756 1.00 101.29 ? 415 PHE B CE1 1 
ATOM   5094 C  CE2 . PHE B 1 223 ? -8.662  21.624 121.427 1.00 100.25 ? 415 PHE B CE2 1 
ATOM   5095 C  CZ  . PHE B 1 223 ? -8.866  22.751 120.635 1.00 101.35 ? 415 PHE B CZ  1 
ATOM   5096 N  N   . ASN B 1 224 ? -4.526  21.618 123.219 1.00 106.25 ? 416 ASN B N   1 
ATOM   5097 C  CA  . ASN B 1 224 ? -4.870  22.360 124.431 1.00 109.42 ? 416 ASN B CA  1 
ATOM   5098 C  C   . ASN B 1 224 ? -3.664  22.446 125.375 1.00 111.49 ? 416 ASN B C   1 
ATOM   5099 O  O   . ASN B 1 224 ? -3.727  23.092 126.424 1.00 112.07 ? 416 ASN B O   1 
ATOM   5100 C  CB  . ASN B 1 224 ? -6.055  21.676 125.135 1.00 110.34 ? 416 ASN B CB  1 
ATOM   5101 C  CG  . ASN B 1 224 ? -6.999  22.662 125.830 1.00 109.07 ? 416 ASN B CG  1 
ATOM   5102 O  OD1 . ASN B 1 224 ? -7.090  23.834 125.462 1.00 108.96 ? 416 ASN B OD1 1 
ATOM   5103 N  ND2 . ASN B 1 224 ? -7.722  22.170 126.830 1.00 107.14 ? 416 ASN B ND2 1 
ATOM   5104 N  N   . SER B 1 225 ? -2.566  21.804 124.973 1.00 112.79 ? 417 SER B N   1 
ATOM   5105 C  CA  . SER B 1 225 ? -1.391  21.582 125.827 1.00 114.20 ? 417 SER B CA  1 
ATOM   5106 C  C   . SER B 1 225 ? -0.812  22.830 126.494 1.00 115.59 ? 417 SER B C   1 
ATOM   5107 O  O   . SER B 1 225 ? -0.848  23.925 125.930 1.00 115.88 ? 417 SER B O   1 
ATOM   5108 C  CB  . SER B 1 225 ? -0.303  20.846 125.037 1.00 113.84 ? 417 SER B CB  1 
ATOM   5109 O  OG  . SER B 1 225 ? 0.955   20.885 125.688 1.00 114.41 ? 417 SER B OG  1 
ATOM   5110 N  N   . THR B 1 226 ? -0.280  22.636 127.700 1.00 117.00 ? 418 THR B N   1 
ATOM   5111 C  CA  . THR B 1 226 ? 0.350   23.704 128.481 1.00 117.89 ? 418 THR B CA  1 
ATOM   5112 C  C   . THR B 1 226 ? 1.866   23.512 128.620 1.00 117.90 ? 418 THR B C   1 
ATOM   5113 O  O   . THR B 1 226 ? 2.588   24.458 128.939 1.00 118.57 ? 418 THR B O   1 
ATOM   5114 C  CB  . THR B 1 226 ? -0.285  23.847 129.894 1.00 118.36 ? 418 THR B CB  1 
ATOM   5115 O  OG1 . THR B 1 226 ? -0.350  22.566 130.535 1.00 118.49 ? 418 THR B OG1 1 
ATOM   5116 C  CG2 . THR B 1 226 ? -1.690  24.438 129.805 1.00 118.01 ? 418 THR B CG2 1 
ATOM   5117 N  N   . ASN B 1 227 ? 2.338   22.290 128.383 1.00 116.94 ? 419 ASN B N   1 
ATOM   5118 C  CA  . ASN B 1 227 ? 3.767   21.985 128.440 1.00 116.43 ? 419 ASN B CA  1 
ATOM   5119 C  C   . ASN B 1 227 ? 4.490   22.183 127.101 1.00 114.77 ? 419 ASN B C   1 
ATOM   5120 O  O   . ASN B 1 227 ? 5.722   22.243 127.058 1.00 115.08 ? 419 ASN B O   1 
ATOM   5121 C  CB  . ASN B 1 227 ? 3.985   20.561 128.965 1.00 118.74 ? 419 ASN B CB  1 
ATOM   5122 C  CG  . ASN B 1 227 ? 3.521   20.388 130.408 1.00 123.16 ? 419 ASN B CG  1 
ATOM   5123 O  OD1 . ASN B 1 227 ? 3.198   21.359 131.098 1.00 125.39 ? 419 ASN B OD1 1 
ATOM   5124 N  ND2 . ASN B 1 227 ? 3.492   19.142 130.872 1.00 124.41 ? 419 ASN B ND2 1 
ATOM   5125 N  N   . GLN B 1 228 ? 3.717   22.301 126.021 1.00 111.46 ? 420 GLN B N   1 
ATOM   5126 C  CA  . GLN B 1 228 ? 4.262   22.373 124.661 1.00 109.21 ? 420 GLN B CA  1 
ATOM   5127 C  C   . GLN B 1 228 ? 3.639   23.514 123.835 1.00 106.84 ? 420 GLN B C   1 
ATOM   5128 O  O   . GLN B 1 228 ? 2.625   24.087 124.248 1.00 106.80 ? 420 GLN B O   1 
ATOM   5129 C  CB  . GLN B 1 228 ? 4.066   21.027 123.948 1.00 109.30 ? 420 GLN B CB  1 
ATOM   5130 C  CG  . GLN B 1 228 ? 4.896   19.870 124.505 1.00 109.66 ? 420 GLN B CG  1 
ATOM   5131 C  CD  . GLN B 1 228 ? 6.396   20.133 124.469 1.00 110.46 ? 420 GLN B CD  1 
ATOM   5132 O  OE1 . GLN B 1 228 ? 7.069   20.068 125.498 1.00 111.16 ? 420 GLN B OE1 1 
ATOM   5133 N  NE2 . GLN B 1 228 ? 6.924   20.436 123.287 1.00 110.10 ? 420 GLN B NE2 1 
ATOM   5134 N  N   . PRO B 1 229 ? 4.236   23.844 122.664 1.00 103.44 ? 421 PRO B N   1 
ATOM   5135 C  CA  . PRO B 1 229 ? 3.689   24.903 121.823 1.00 101.23 ? 421 PRO B CA  1 
ATOM   5136 C  C   . PRO B 1 229 ? 2.643   24.332 120.865 1.00 99.66  ? 421 PRO B C   1 
ATOM   5137 O  O   . PRO B 1 229 ? 2.963   23.466 120.047 1.00 99.42  ? 421 PRO B O   1 
ATOM   5138 C  CB  . PRO B 1 229 ? 4.911   25.388 121.052 1.00 100.74 ? 421 PRO B CB  1 
ATOM   5139 C  CG  . PRO B 1 229 ? 5.716   24.155 120.860 1.00 101.26 ? 421 PRO B CG  1 
ATOM   5140 C  CD  . PRO B 1 229 ? 5.430   23.241 122.043 1.00 102.22 ? 421 PRO B CD  1 
ATOM   5141 N  N   . PRO B 1 230 ? 1.393   24.810 120.965 1.00 99.25  ? 422 PRO B N   1 
ATOM   5142 C  CA  . PRO B 1 230 ? 0.286   24.203 120.219 1.00 97.72  ? 422 PRO B CA  1 
ATOM   5143 C  C   . PRO B 1 230 ? 0.413   24.288 118.694 1.00 96.70  ? 422 PRO B C   1 
ATOM   5144 O  O   . PRO B 1 230 ? -0.308  23.585 117.986 1.00 97.30  ? 422 PRO B O   1 
ATOM   5145 C  CB  . PRO B 1 230 ? -0.943  24.975 120.713 1.00 98.21  ? 422 PRO B CB  1 
ATOM   5146 C  CG  . PRO B 1 230 ? -0.415  26.244 121.269 1.00 99.52  ? 422 PRO B CG  1 
ATOM   5147 C  CD  . PRO B 1 230 ? 0.950   25.947 121.792 1.00 100.53 ? 422 PRO B CD  1 
ATOM   5148 N  N   . GLU B 1 231 ? 1.328   25.130 118.209 1.00 95.63  ? 423 GLU B N   1 
ATOM   5149 C  CA  . GLU B 1 231 ? 1.585   25.305 116.771 1.00 92.62  ? 423 GLU B CA  1 
ATOM   5150 C  C   . GLU B 1 231 ? 2.381   24.155 116.156 1.00 93.14  ? 423 GLU B C   1 
ATOM   5151 O  O   . GLU B 1 231 ? 2.186   23.821 114.983 1.00 96.35  ? 423 GLU B O   1 
ATOM   5152 C  CB  . GLU B 1 231 ? 2.338   26.615 116.502 1.00 90.63  ? 423 GLU B CB  1 
ATOM   5153 C  CG  . GLU B 1 231 ? 1.541   27.894 116.718 1.00 90.24  ? 423 GLU B CG  1 
ATOM   5154 C  CD  . GLU B 1 231 ? 1.483   28.344 118.173 1.00 91.54  ? 423 GLU B CD  1 
ATOM   5155 O  OE1 . GLU B 1 231 ? 0.841   29.382 118.430 1.00 93.04  ? 423 GLU B OE1 1 
ATOM   5156 O  OE2 . GLU B 1 231 ? 2.066   27.676 119.060 1.00 90.51  ? 423 GLU B OE2 1 
ATOM   5157 N  N   . VAL B 1 232 ? 3.289   23.570 116.936 1.00 91.05  ? 424 VAL B N   1 
ATOM   5158 C  CA  . VAL B 1 232 ? 4.187   22.529 116.433 1.00 90.16  ? 424 VAL B CA  1 
ATOM   5159 C  C   . VAL B 1 232 ? 3.430   21.227 116.187 1.00 90.13  ? 424 VAL B C   1 
ATOM   5160 O  O   . VAL B 1 232 ? 2.732   20.728 117.075 1.00 90.55  ? 424 VAL B O   1 
ATOM   5161 C  CB  . VAL B 1 232 ? 5.397   22.289 117.381 1.00 89.62  ? 424 VAL B CB  1 
ATOM   5162 C  CG1 . VAL B 1 232 ? 6.199   21.073 116.947 1.00 89.71  ? 424 VAL B CG1 1 
ATOM   5163 C  CG2 . VAL B 1 232 ? 6.300   23.507 117.421 1.00 88.82  ? 424 VAL B CG2 1 
ATOM   5164 N  N   . PHE B 1 233 ? 3.568   20.704 114.970 1.00 90.09  ? 425 PHE B N   1 
ATOM   5165 C  CA  . PHE B 1 233 ? 2.962   19.434 114.577 1.00 90.44  ? 425 PHE B CA  1 
ATOM   5166 C  C   . PHE B 1 233 ? 3.996   18.316 114.616 1.00 89.33  ? 425 PHE B C   1 
ATOM   5167 O  O   . PHE B 1 233 ? 3.711   17.225 115.105 1.00 88.75  ? 425 PHE B O   1 
ATOM   5168 C  CB  . PHE B 1 233 ? 2.336   19.541 113.182 1.00 94.00  ? 425 PHE B CB  1 
ATOM   5169 C  CG  . PHE B 1 233 ? 1.594   18.308 112.752 1.00 94.79  ? 425 PHE B CG  1 
ATOM   5170 C  CD1 . PHE B 1 233 ? 0.273   18.108 113.136 1.00 94.96  ? 425 PHE B CD1 1 
ATOM   5171 C  CD2 . PHE B 1 233 ? 2.212   17.350 111.955 1.00 96.56  ? 425 PHE B CD2 1 
ATOM   5172 C  CE1 . PHE B 1 233 ? -0.422  16.967 112.748 1.00 95.34  ? 425 PHE B CE1 1 
ATOM   5173 C  CE2 . PHE B 1 233 ? 1.525   16.205 111.557 1.00 97.95  ? 425 PHE B CE2 1 
ATOM   5174 C  CZ  . PHE B 1 233 ? 0.203   16.013 111.957 1.00 96.44  ? 425 PHE B CZ  1 
ATOM   5175 N  N   . ALA B 1 234 ? 5.186   18.598 114.088 1.00 90.11  ? 426 ALA B N   1 
ATOM   5176 C  CA  . ALA B 1 234 ? 6.337   17.691 114.162 1.00 91.74  ? 426 ALA B CA  1 
ATOM   5177 C  C   . ALA B 1 234 ? 7.633   18.501 114.235 1.00 94.00  ? 426 ALA B C   1 
ATOM   5178 O  O   . ALA B 1 234 ? 7.650   19.672 113.862 1.00 96.09  ? 426 ALA B O   1 
ATOM   5179 C  CB  . ALA B 1 234 ? 6.355   16.754 112.963 1.00 90.99  ? 426 ALA B CB  1 
ATOM   5180 N  N   . HIS B 1 235 ? 8.709   17.883 114.718 1.00 96.20  ? 427 HIS B N   1 
ATOM   5181 C  CA  . HIS B 1 235 ? 10.008  18.555 114.829 1.00 99.04  ? 427 HIS B CA  1 
ATOM   5182 C  C   . HIS B 1 235 ? 11.154  17.638 114.409 1.00 98.68  ? 427 HIS B C   1 
ATOM   5183 O  O   . HIS B 1 235 ? 11.013  16.411 114.408 1.00 98.71  ? 427 HIS B O   1 
ATOM   5184 C  CB  . HIS B 1 235 ? 10.247  19.049 116.264 1.00 102.08 ? 427 HIS B CB  1 
ATOM   5185 C  CG  . HIS B 1 235 ? 10.732  17.982 117.200 1.00 107.31 ? 427 HIS B CG  1 
ATOM   5186 N  ND1 . HIS B 1 235 ? 12.071  17.709 117.389 1.00 110.17 ? 427 HIS B ND1 1 
ATOM   5187 C  CD2 . HIS B 1 235 ? 10.058  17.117 117.996 1.00 109.55 ? 427 HIS B CD2 1 
ATOM   5188 C  CE1 . HIS B 1 235 ? 12.201  16.723 118.262 1.00 110.77 ? 427 HIS B CE1 1 
ATOM   5189 N  NE2 . HIS B 1 235 ? 10.994  16.346 118.645 1.00 110.81 ? 427 HIS B NE2 1 
ATOM   5190 N  N   . GLY B 1 236 ? 12.291  18.243 114.072 1.00 97.24  ? 428 GLY B N   1 
ATOM   5191 C  CA  . GLY B 1 236 ? 13.520  17.498 113.822 1.00 95.17  ? 428 GLY B CA  1 
ATOM   5192 C  C   . GLY B 1 236 ? 14.146  17.770 112.472 1.00 94.53  ? 428 GLY B C   1 
ATOM   5193 O  O   . GLY B 1 236 ? 14.898  16.941 111.959 1.00 96.75  ? 428 GLY B O   1 
ATOM   5194 N  N   . LEU B 1 237 ? 13.833  18.930 111.899 1.00 92.87  ? 429 LEU B N   1 
ATOM   5195 C  CA  . LEU B 1 237 ? 14.348  19.340 110.591 1.00 89.10  ? 429 LEU B CA  1 
ATOM   5196 C  C   . LEU B 1 237 ? 15.620  20.157 110.721 1.00 88.56  ? 429 LEU B C   1 
ATOM   5197 O  O   . LEU B 1 237 ? 15.783  20.920 111.674 1.00 89.78  ? 429 LEU B O   1 
ATOM   5198 C  CB  . LEU B 1 237 ? 13.302  20.169 109.852 1.00 87.58  ? 429 LEU B CB  1 
ATOM   5199 C  CG  . LEU B 1 237 ? 12.516  19.566 108.688 1.00 88.20  ? 429 LEU B CG  1 
ATOM   5200 C  CD1 . LEU B 1 237 ? 12.173  18.109 108.885 1.00 86.33  ? 429 LEU B CD1 1 
ATOM   5201 C  CD2 . LEU B 1 237 ? 11.255  20.376 108.480 1.00 89.94  ? 429 LEU B CD2 1 
ATOM   5202 N  N   . HIS B 1 238 ? 16.512  20.005 109.749 1.00 87.97  ? 430 HIS B N   1 
ATOM   5203 C  CA  . HIS B 1 238 ? 17.758  20.754 109.736 1.00 88.50  ? 430 HIS B CA  1 
ATOM   5204 C  C   . HIS B 1 238 ? 17.848  21.688 108.530 1.00 90.15  ? 430 HIS B C   1 
ATOM   5205 O  O   . HIS B 1 238 ? 17.582  22.885 108.640 1.00 87.96  ? 430 HIS B O   1 
ATOM   5206 C  CB  . HIS B 1 238 ? 18.949  19.802 109.827 1.00 89.62  ? 430 HIS B CB  1 
ATOM   5207 C  CG  . HIS B 1 238 ? 18.983  19.016 111.102 1.00 93.38  ? 430 HIS B CG  1 
ATOM   5208 N  ND1 . HIS B 1 238 ? 19.674  19.436 112.218 1.00 94.23  ? 430 HIS B ND1 1 
ATOM   5209 C  CD2 . HIS B 1 238 ? 18.386  17.850 111.448 1.00 93.55  ? 430 HIS B CD2 1 
ATOM   5210 C  CE1 . HIS B 1 238 ? 19.514  18.557 113.191 1.00 94.56  ? 430 HIS B CE1 1 
ATOM   5211 N  NE2 . HIS B 1 238 ? 18.736  17.586 112.750 1.00 94.44  ? 430 HIS B NE2 1 
ATOM   5212 N  N   . ASP B 1 239 ? 18.203  21.141 107.376 1.00 91.73  ? 431 ASP B N   1 
ATOM   5213 C  CA  . ASP B 1 239 ? 18.301  21.940 106.170 1.00 94.10  ? 431 ASP B CA  1 
ATOM   5214 C  C   . ASP B 1 239 ? 17.389  21.351 105.094 1.00 94.88  ? 431 ASP B C   1 
ATOM   5215 O  O   . ASP B 1 239 ? 17.859  20.626 104.213 1.00 95.89  ? 431 ASP B O   1 
ATOM   5216 C  CB  . ASP B 1 239 ? 19.758  22.006 105.699 1.00 96.62  ? 431 ASP B CB  1 
ATOM   5217 C  CG  . ASP B 1 239 ? 19.989  23.081 104.653 1.00 99.99  ? 431 ASP B CG  1 
ATOM   5218 O  OD1 . ASP B 1 239 ? 19.302  24.126 104.695 1.00 101.65 ? 431 ASP B OD1 1 
ATOM   5219 O  OD2 . ASP B 1 239 ? 20.865  22.881 103.786 1.00 101.06 ? 431 ASP B OD2 1 
ATOM   5220 N  N   . PRO B 1 240 ? 16.075  21.656 105.163 1.00 94.55  ? 432 PRO B N   1 
ATOM   5221 C  CA  . PRO B 1 240 ? 15.158  21.039 104.216 1.00 93.58  ? 432 PRO B CA  1 
ATOM   5222 C  C   . PRO B 1 240 ? 15.188  21.756 102.883 1.00 93.20  ? 432 PRO B C   1 
ATOM   5223 O  O   . PRO B 1 240 ? 15.415  22.962 102.836 1.00 94.42  ? 432 PRO B O   1 
ATOM   5224 C  CB  . PRO B 1 240 ? 13.791  21.196 104.887 1.00 92.23  ? 432 PRO B CB  1 
ATOM   5225 C  CG  . PRO B 1 240 ? 13.920  22.382 105.756 1.00 92.70  ? 432 PRO B CG  1 
ATOM   5226 C  CD  . PRO B 1 240 ? 15.379  22.577 106.081 1.00 94.83  ? 432 PRO B CD  1 
ATOM   5227 N  N   . GLY B 1 241 ? 14.990  21.007 101.806 1.00 93.00  ? 433 GLY B N   1 
ATOM   5228 C  CA  . GLY B 1 241 ? 14.872  21.602 100.487 1.00 93.79  ? 433 GLY B CA  1 
ATOM   5229 C  C   . GLY B 1 241 ? 13.418  21.941 100.249 1.00 94.15  ? 433 GLY B C   1 
ATOM   5230 O  O   . GLY B 1 241 ? 12.659  22.165 101.203 1.00 93.94  ? 433 GLY B O   1 
ATOM   5231 N  N   . ARG B 1 242 ? 13.027  21.986 98.978  1.00 94.11  ? 434 ARG B N   1 
ATOM   5232 C  CA  . ARG B 1 242 ? 11.624  22.124 98.628  1.00 95.46  ? 434 ARG B CA  1 
ATOM   5233 C  C   . ARG B 1 242 ? 11.009  20.745 98.806  1.00 95.16  ? 434 ARG B C   1 
ATOM   5234 O  O   . ARG B 1 242 ? 11.365  19.811 98.095  1.00 97.95  ? 434 ARG B O   1 
ATOM   5235 C  CB  . ARG B 1 242 ? 11.475  22.629 97.190  1.00 98.07  ? 434 ARG B CB  1 
ATOM   5236 C  CG  . ARG B 1 242 ? 10.083  23.143 96.823  1.00 102.06 ? 434 ARG B CG  1 
ATOM   5237 C  CD  . ARG B 1 242 ? 9.171   22.002 96.412  1.00 105.52 ? 434 ARG B CD  1 
ATOM   5238 N  NE  . ARG B 1 242 ? 7.807   22.423 96.111  1.00 106.62 ? 434 ARG B NE  1 
ATOM   5239 C  CZ  . ARG B 1 242 ? 6.781   21.585 96.000  1.00 107.97 ? 434 ARG B CZ  1 
ATOM   5240 N  NH1 . ARG B 1 242 ? 6.953   20.280 96.176  1.00 108.64 ? 434 ARG B NH1 1 
ATOM   5241 N  NH2 . ARG B 1 242 ? 5.575   22.052 95.724  1.00 109.22 ? 434 ARG B NH2 1 
ATOM   5242 N  N   . CYS B 1 243 ? 10.111  20.613 99.776  1.00 92.63  ? 435 CYS B N   1 
ATOM   5243 C  CA  . CYS B 1 243 ? 9.529   19.317 100.106 1.00 91.75  ? 435 CYS B CA  1 
ATOM   5244 C  C   . CYS B 1 243 ? 8.388   18.941 99.164  1.00 91.53  ? 435 CYS B C   1 
ATOM   5245 O  O   . CYS B 1 243 ? 7.503   19.749 98.880  1.00 92.32  ? 435 CYS B O   1 
ATOM   5246 C  CB  . CYS B 1 243 ? 9.027   19.306 101.546 1.00 95.06  ? 435 CYS B CB  1 
ATOM   5247 S  SG  . CYS B 1 243 ? 10.236  19.818 102.772 1.00 98.20  ? 435 CYS B SG  1 
ATOM   5248 N  N   . ALA B 1 244 ? 8.418   17.700 98.690  1.00 89.96  ? 436 ALA B N   1 
ATOM   5249 C  CA  . ALA B 1 244 ? 7.372   17.168 97.830  1.00 87.46  ? 436 ALA B CA  1 
ATOM   5250 C  C   . ALA B 1 244 ? 6.109   16.927 98.648  1.00 86.02  ? 436 ALA B C   1 
ATOM   5251 O  O   . ALA B 1 244 ? 6.177   16.506 99.801  1.00 81.77  ? 436 ALA B O   1 
ATOM   5252 C  CB  . ALA B 1 244 ? 7.840   15.885 97.173  1.00 88.49  ? 436 ALA B CB  1 
ATOM   5253 N  N   . VAL B 1 245 ? 4.957   17.205 98.050  1.00 90.28  ? 437 VAL B N   1 
ATOM   5254 C  CA  . VAL B 1 245 ? 3.687   17.102 98.765  1.00 92.67  ? 437 VAL B CA  1 
ATOM   5255 C  C   . VAL B 1 245 ? 2.708   16.180 98.035  1.00 96.06  ? 437 VAL B C   1 
ATOM   5256 O  O   . VAL B 1 245 ? 2.309   16.455 96.901  1.00 98.06  ? 437 VAL B O   1 
ATOM   5257 C  CB  . VAL B 1 245 ? 3.046   18.499 98.988  1.00 90.05  ? 437 VAL B CB  1 
ATOM   5258 C  CG1 . VAL B 1 245 ? 1.741   18.368 99.744  1.00 89.33  ? 437 VAL B CG1 1 
ATOM   5259 C  CG2 . VAL B 1 245 ? 4.004   19.432 99.736  1.00 86.83  ? 437 VAL B CG2 1 
ATOM   5260 N  N   . ASP B 1 246 ? 2.333   15.088 98.695  1.00 96.49  ? 438 ASP B N   1 
ATOM   5261 C  CA  . ASP B 1 246 ? 1.391   14.125 98.141  1.00 100.56 ? 438 ASP B CA  1 
ATOM   5262 C  C   . ASP B 1 246 ? 0.024   14.338 98.779  1.00 103.75 ? 438 ASP B C   1 
ATOM   5263 O  O   . ASP B 1 246 ? -0.112  14.259 100.003 1.00 106.06 ? 438 ASP B O   1 
ATOM   5264 C  CB  . ASP B 1 246 ? 1.889   12.696 98.405  1.00 102.39 ? 438 ASP B CB  1 
ATOM   5265 C  CG  . ASP B 1 246 ? 1.169   11.639 97.563  1.00 101.94 ? 438 ASP B CG  1 
ATOM   5266 O  OD1 . ASP B 1 246 ? 0.380   11.996 96.668  1.00 103.28 ? 438 ASP B OD1 1 
ATOM   5267 O  OD2 . ASP B 1 246 ? 1.404   10.436 97.799  1.00 100.96 ? 438 ASP B OD2 1 
ATOM   5268 N  N   . ARG B 1 247 ? -0.987  14.601 97.953  1.00 104.77 ? 439 ARG B N   1 
ATOM   5269 C  CA  . ARG B 1 247 ? -2.332  14.899 98.456  1.00 105.32 ? 439 ARG B CA  1 
ATOM   5270 C  C   . ARG B 1 247 ? -3.329  13.744 98.332  1.00 107.66 ? 439 ARG B C   1 
ATOM   5271 O  O   . ARG B 1 247 ? -4.364  13.749 99.002  1.00 110.30 ? 439 ARG B O   1 
ATOM   5272 C  CB  . ARG B 1 247 ? -2.884  16.166 97.797  1.00 104.95 ? 439 ARG B CB  1 
ATOM   5273 C  CG  . ARG B 1 247 ? -2.037  17.396 98.070  1.00 105.07 ? 439 ARG B CG  1 
ATOM   5274 C  CD  . ARG B 1 247 ? -2.585  18.657 97.416  1.00 104.88 ? 439 ARG B CD  1 
ATOM   5275 N  NE  . ARG B 1 247 ? -1.500  19.608 97.168  1.00 106.54 ? 439 ARG B NE  1 
ATOM   5276 C  CZ  . ARG B 1 247 ? -1.107  20.563 98.010  1.00 105.38 ? 439 ARG B CZ  1 
ATOM   5277 N  NH1 . ARG B 1 247 ? -1.721  20.728 99.172  1.00 103.68 ? 439 ARG B NH1 1 
ATOM   5278 N  NH2 . ARG B 1 247 ? -0.094  21.362 97.683  1.00 105.18 ? 439 ARG B NH2 1 
ATOM   5279 N  N   . HIS B 1 248 ? -3.011  12.762 97.487  1.00 108.19 ? 440 HIS B N   1 
ATOM   5280 C  CA  . HIS B 1 248 ? -3.835  11.556 97.292  1.00 109.39 ? 440 HIS B CA  1 
ATOM   5281 C  C   . HIS B 1 248 ? -5.236  11.865 96.772  1.00 109.53 ? 440 HIS B C   1 
ATOM   5282 O  O   . HIS B 1 248 ? -5.390  12.441 95.694  1.00 109.48 ? 440 HIS B O   1 
ATOM   5283 C  CB  . HIS B 1 248 ? -3.914  10.728 98.578  1.00 110.64 ? 440 HIS B CB  1 
ATOM   5284 C  CG  . HIS B 1 248 ? -2.579  10.301 99.103  1.00 112.74 ? 440 HIS B CG  1 
ATOM   5285 N  ND1 . HIS B 1 248 ? -1.861  11.053 100.009 1.00 112.61 ? 440 HIS B ND1 1 
ATOM   5286 C  CD2 . HIS B 1 248 ? -1.828  9.203  98.847  1.00 113.21 ? 440 HIS B CD2 1 
ATOM   5287 C  CE1 . HIS B 1 248 ? -0.727  10.436 100.289 1.00 112.74 ? 440 HIS B CE1 1 
ATOM   5288 N  NE2 . HIS B 1 248 ? -0.682  9.311  99.597  1.00 113.32 ? 440 HIS B NE2 1 
ATOM   5289 N  N   . ASN B 1 255 ? -5.716  11.650 103.874 1.00 105.88 ? 447 ASN B N   1 
ATOM   5290 C  CA  . ASN B 1 255 ? -4.360  11.902 104.354 1.00 104.82 ? 447 ASN B CA  1 
ATOM   5291 C  C   . ASN B 1 255 ? -3.547  12.890 103.500 1.00 104.93 ? 447 ASN B C   1 
ATOM   5292 O  O   . ASN B 1 255 ? -4.050  13.457 102.523 1.00 105.11 ? 447 ASN B O   1 
ATOM   5293 C  CB  . ASN B 1 255 ? -3.587  10.582 104.589 1.00 104.74 ? 447 ASN B CB  1 
ATOM   5294 C  CG  . ASN B 1 255 ? -3.822  9.529  103.495 1.00 105.06 ? 447 ASN B CG  1 
ATOM   5295 O  OD1 . ASN B 1 255 ? -4.469  9.784  102.477 1.00 105.42 ? 447 ASN B OD1 1 
ATOM   5296 N  ND2 . ASN B 1 255 ? -3.290  8.329  103.718 1.00 103.67 ? 447 ASN B ND2 1 
ATOM   5297 N  N   . LEU B 1 256 ? -2.294  13.090 103.906 1.00 102.42 ? 448 LEU B N   1 
ATOM   5298 C  CA  . LEU B 1 256 ? -1.369  14.037 103.298 1.00 98.92  ? 448 LEU B CA  1 
ATOM   5299 C  C   . LEU B 1 256 ? 0.035   13.533 103.602 1.00 97.85  ? 448 LEU B C   1 
ATOM   5300 O  O   . LEU B 1 256 ? 0.320   13.152 104.740 1.00 100.29 ? 448 LEU B O   1 
ATOM   5301 C  CB  . LEU B 1 256 ? -1.549  15.414 103.946 1.00 99.88  ? 448 LEU B CB  1 
ATOM   5302 C  CG  . LEU B 1 256 ? -0.970  16.744 103.422 1.00 101.78 ? 448 LEU B CG  1 
ATOM   5303 C  CD1 . LEU B 1 256 ? -0.436  17.558 104.595 1.00 101.23 ? 448 LEU B CD1 1 
ATOM   5304 C  CD2 . LEU B 1 256 ? 0.107   16.621 102.357 1.00 101.25 ? 448 LEU B CD2 1 
ATOM   5305 N  N   . THR B 1 257 ? 0.908   13.518 102.598 1.00 94.05  ? 449 THR B N   1 
ATOM   5306 C  CA  . THR B 1 257 ? 2.309   13.163 102.809 1.00 91.26  ? 449 THR B CA  1 
ATOM   5307 C  C   . THR B 1 257 ? 3.209   14.309 102.394 1.00 92.89  ? 449 THR B C   1 
ATOM   5308 O  O   . THR B 1 257 ? 3.057   14.863 101.300 1.00 97.89  ? 449 THR B O   1 
ATOM   5309 C  CB  . THR B 1 257 ? 2.720   11.918 102.001 1.00 90.14  ? 449 THR B CB  1 
ATOM   5310 O  OG1 . THR B 1 257 ? 1.812   10.845 102.268 1.00 93.45  ? 449 THR B OG1 1 
ATOM   5311 C  CG2 . THR B 1 257 ? 4.124   11.477 102.372 1.00 88.36  ? 449 THR B CG2 1 
ATOM   5312 N  N   . ILE B 1 258 ? 4.145   14.672 103.262 1.00 90.06  ? 450 ILE B N   1 
ATOM   5313 C  CA  . ILE B 1 258 ? 5.224   15.562 102.841 1.00 91.16  ? 450 ILE B CA  1 
ATOM   5314 C  C   . ILE B 1 258 ? 6.594   14.886 103.025 1.00 91.47  ? 450 ILE B C   1 
ATOM   5315 O  O   . ILE B 1 258 ? 6.902   14.359 104.095 1.00 92.98  ? 450 ILE B O   1 
ATOM   5316 C  CB  . ILE B 1 258 ? 5.078   17.042 103.397 1.00 93.30  ? 450 ILE B CB  1 
ATOM   5317 C  CG1 . ILE B 1 258 ? 6.437   17.739 103.582 1.00 94.21  ? 450 ILE B CG1 1 
ATOM   5318 C  CG2 . ILE B 1 258 ? 4.181   17.113 104.652 1.00 93.58  ? 450 ILE B CG2 1 
ATOM   5319 C  CD1 . ILE B 1 258 ? 7.027   17.650 104.982 1.00 97.98  ? 450 ILE B CD1 1 
ATOM   5320 N  N   . LEU B 1 259 ? 7.380   14.870 101.947 1.00 90.03  ? 451 LEU B N   1 
ATOM   5321 C  CA  . LEU B 1 259 ? 8.674   14.192 101.907 1.00 87.51  ? 451 LEU B CA  1 
ATOM   5322 C  C   . LEU B 1 259 ? 9.772   15.201 101.621 1.00 87.82  ? 451 LEU B C   1 
ATOM   5323 O  O   . LEU B 1 259 ? 9.827   15.762 100.526 1.00 87.29  ? 451 LEU B O   1 
ATOM   5324 C  CB  . LEU B 1 259 ? 8.665   13.121 100.814 1.00 87.83  ? 451 LEU B CB  1 
ATOM   5325 C  CG  . LEU B 1 259 ? 9.686   11.971 100.851 1.00 87.72  ? 451 LEU B CG  1 
ATOM   5326 C  CD1 . LEU B 1 259 ? 9.186   10.810 100.014 1.00 85.95  ? 451 LEU B CD1 1 
ATOM   5327 C  CD2 . LEU B 1 259 ? 11.073  12.390 100.383 1.00 86.77  ? 451 LEU B CD2 1 
ATOM   5328 N  N   . CYS B 1 260 ? 10.646  15.429 102.598 1.00 89.28  ? 452 CYS B N   1 
ATOM   5329 C  CA  . CYS B 1 260 ? 11.700  16.435 102.460 1.00 92.22  ? 452 CYS B CA  1 
ATOM   5330 C  C   . CYS B 1 260 ? 13.064  15.811 102.256 1.00 92.32  ? 452 CYS B C   1 
ATOM   5331 O  O   . CYS B 1 260 ? 13.341  14.730 102.772 1.00 95.11  ? 452 CYS B O   1 
ATOM   5332 C  CB  . CYS B 1 260 ? 11.769  17.337 103.696 1.00 95.86  ? 452 CYS B CB  1 
ATOM   5333 S  SG  . CYS B 1 260 ? 10.266  18.274 104.091 1.00 103.77 ? 452 CYS B SG  1 
ATOM   5334 N  N   . SER B 1 261 ? 13.912  16.497 101.499 1.00 91.85  ? 453 SER B N   1 
ATOM   5335 C  CA  . SER B 1 261 ? 15.340  16.214 101.502 1.00 92.68  ? 453 SER B CA  1 
ATOM   5336 C  C   . SER B 1 261 ? 15.963  17.100 102.570 1.00 93.10  ? 453 SER B C   1 
ATOM   5337 O  O   . SER B 1 261 ? 15.613  18.269 102.676 1.00 99.04  ? 453 SER B O   1 
ATOM   5338 C  CB  . SER B 1 261 ? 15.951  16.544 100.147 1.00 92.88  ? 453 SER B CB  1 
ATOM   5339 O  OG  . SER B 1 261 ? 15.825  17.930 99.877  1.00 95.72  ? 453 SER B OG  1 
ATOM   5340 N  N   . ASP B 1 262 ? 16.876  16.553 103.360 1.00 90.16  ? 454 ASP B N   1 
ATOM   5341 C  CA  . ASP B 1 262 ? 17.549  17.324 104.393 1.00 91.58  ? 454 ASP B CA  1 
ATOM   5342 C  C   . ASP B 1 262 ? 19.065  17.198 104.212 1.00 96.13  ? 454 ASP B C   1 
ATOM   5343 O  O   . ASP B 1 262 ? 19.612  16.091 104.224 1.00 95.29  ? 454 ASP B O   1 
ATOM   5344 C  CB  . ASP B 1 262 ? 17.109  16.826 105.775 1.00 92.72  ? 454 ASP B CB  1 
ATOM   5345 C  CG  . ASP B 1 262 ? 17.341  17.845 106.890 1.00 92.48  ? 454 ASP B CG  1 
ATOM   5346 O  OD1 . ASP B 1 262 ? 16.691  17.711 107.950 1.00 91.89  ? 454 ASP B OD1 1 
ATOM   5347 O  OD2 . ASP B 1 262 ? 18.166  18.764 106.730 1.00 92.90  ? 454 ASP B OD2 1 
ATOM   5348 N  N   . SER B 1 263 ? 19.735  18.335 104.023 1.00 101.04 ? 455 SER B N   1 
ATOM   5349 C  CA  . SER B 1 263 ? 21.192  18.363 103.861 1.00 105.22 ? 455 SER B CA  1 
ATOM   5350 C  C   . SER B 1 263 ? 21.907  18.068 105.171 1.00 108.19 ? 455 SER B C   1 
ATOM   5351 O  O   . SER B 1 263 ? 22.900  17.336 105.193 1.00 109.11 ? 455 SER B O   1 
ATOM   5352 C  CB  . SER B 1 263 ? 21.656  19.717 103.319 1.00 106.10 ? 455 SER B CB  1 
ATOM   5353 O  OG  . SER B 1 263 ? 21.278  19.885 101.963 1.00 108.83 ? 455 SER B OG  1 
ATOM   5354 N  N   . ASN B 1 264 ? 21.391  18.652 106.254 1.00 111.02 ? 456 ASN B N   1 
ATOM   5355 C  CA  . ASN B 1 264 ? 21.941  18.506 107.607 1.00 113.57 ? 456 ASN B CA  1 
ATOM   5356 C  C   . ASN B 1 264 ? 23.340  19.117 107.784 1.00 115.68 ? 456 ASN B C   1 
ATOM   5357 O  O   . ASN B 1 264 ? 24.074  18.758 108.708 1.00 115.51 ? 456 ASN B O   1 
ATOM   5358 C  CB  . ASN B 1 264 ? 21.907  17.038 108.062 1.00 113.49 ? 456 ASN B CB  1 
ATOM   5359 C  CG  . ASN B 1 264 ? 20.521  16.426 107.962 1.00 113.67 ? 456 ASN B CG  1 
ATOM   5360 O  OD1 . ASN B 1 264 ? 19.693  16.581 108.860 1.00 114.55 ? 456 ASN B OD1 1 
ATOM   5361 N  ND2 . ASN B 1 264 ? 20.268  15.714 106.872 1.00 113.00 ? 456 ASN B ND2 1 
ATOM   5362 N  N   . GLY B 1 265 ? 23.686  20.056 106.901 1.00 118.62 ? 457 GLY B N   1 
ATOM   5363 C  CA  . GLY B 1 265 ? 24.974  20.750 106.941 1.00 120.89 ? 457 GLY B CA  1 
ATOM   5364 C  C   . GLY B 1 265 ? 26.154  19.837 106.666 1.00 123.09 ? 457 GLY B C   1 
ATOM   5365 O  O   . GLY B 1 265 ? 26.276  19.278 105.571 1.00 121.45 ? 457 GLY B O   1 
ATOM   5366 N  N   . LYS B 1 266 ? 27.021  19.693 107.671 1.00 126.47 ? 458 LYS B N   1 
ATOM   5367 C  CA  . LYS B 1 266 ? 28.176  18.795 107.612 1.00 128.84 ? 458 LYS B CA  1 
ATOM   5368 C  C   . LYS B 1 266 ? 27.698  17.348 107.629 1.00 131.20 ? 458 LYS B C   1 
ATOM   5369 O  O   . LYS B 1 266 ? 27.950  16.608 108.583 1.00 131.42 ? 458 LYS B O   1 
ATOM   5370 C  CB  . LYS B 1 266 ? 29.238  19.232 108.392 0.00 20.00  ? 458 LYS B CB  1 
ATOM   5371 C  CG  . LYS B 1 266 ? 30.316  20.146 107.833 0.00 20.00  ? 458 LYS B CG  1 
ATOM   5372 C  CD  . LYS B 1 266 ? 31.468  20.305 108.812 0.00 20.00  ? 458 LYS B CD  1 
ATOM   5373 C  CE  . LYS B 1 266 ? 32.267  21.565 108.523 0.00 20.00  ? 458 LYS B CE  1 
ATOM   5374 N  NZ  . LYS B 1 266 ? 33.345  21.781 109.528 0.00 20.00  ? 458 LYS B NZ  1 
ATOM   5375 N  N   . ASN B 1 267 ? 27.010  16.970 106.552 1.00 133.07 ? 459 ASN B N   1 
ATOM   5376 C  CA  . ASN B 1 267 ? 26.335  15.683 106.408 1.00 133.84 ? 459 ASN B CA  1 
ATOM   5377 C  C   . ASN B 1 267 ? 25.911  15.524 104.946 1.00 133.32 ? 459 ASN B C   1 
ATOM   5378 O  O   . ASN B 1 267 ? 25.671  16.523 104.261 1.00 132.26 ? 459 ASN B O   1 
ATOM   5379 C  CB  . ASN B 1 267 ? 25.117  15.623 107.338 1.00 134.14 ? 459 ASN B CB  1 
ATOM   5380 C  CG  . ASN B 1 267 ? 24.551  14.223 107.484 1.00 134.46 ? 459 ASN B CG  1 
ATOM   5381 O  OD1 . ASN B 1 267 ? 24.072  13.626 106.517 1.00 135.37 ? 459 ASN B OD1 1 
ATOM   5382 N  ND2 . ASN B 1 267 ? 24.583  13.698 108.703 1.00 133.73 ? 459 ASN B ND2 1 
ATOM   5383 N  N   . ARG B 1 268 ? 25.822  14.276 104.480 1.00 133.60 ? 460 ARG B N   1 
ATOM   5384 C  CA  . ARG B 1 268 ? 25.538  13.959 103.070 1.00 134.10 ? 460 ARG B CA  1 
ATOM   5385 C  C   . ARG B 1 268 ? 24.187  14.470 102.555 1.00 133.99 ? 460 ARG B C   1 
ATOM   5386 O  O   . ARG B 1 268 ? 24.068  15.633 102.157 1.00 133.97 ? 460 ARG B O   1 
ATOM   5387 C  CB  . ARG B 1 268 ? 25.506  12.682 103.332 0.00 20.00  ? 460 ARG B CB  1 
ATOM   5388 C  CG  . ARG B 1 268 ? 26.905  12.098 103.431 0.00 20.00  ? 460 ARG B CG  1 
ATOM   5389 C  CD  . ARG B 1 268 ? 26.985  11.040 104.520 0.00 20.00  ? 460 ARG B CD  1 
ATOM   5390 N  NE  . ARG B 1 268 ? 28.348  10.868 105.016 0.00 20.00  ? 460 ARG B NE  1 
ATOM   5391 C  CZ  . ARG B 1 268 ? 28.811  9.745  105.555 0.00 20.00  ? 460 ARG B CZ  1 
ATOM   5392 N  NH1 . ARG B 1 268 ? 28.019  8.687  105.669 0.00 20.00  ? 460 ARG B NH1 1 
ATOM   5393 N  NH2 . ARG B 1 268 ? 30.065  9.679  105.980 0.00 20.00  ? 460 ARG B NH2 1 
ATOM   5394 N  N   . SER B 1 269 ? 23.189  13.584 102.542 1.00 132.99 ? 461 SER B N   1 
ATOM   5395 C  CA  . SER B 1 269 ? 21.808  13.937 102.180 1.00 131.05 ? 461 SER B CA  1 
ATOM   5396 C  C   . SER B 1 269 ? 20.824  12.828 102.550 1.00 128.17 ? 461 SER B C   1 
ATOM   5397 O  O   . SER B 1 269 ? 20.791  11.772 101.909 1.00 128.13 ? 461 SER B O   1 
ATOM   5398 C  CB  . SER B 1 269 ? 21.687  14.258 100.687 1.00 132.79 ? 461 SER B CB  1 
ATOM   5399 O  OG  . SER B 1 269 ? 20.381  14.711 100.370 1.00 133.95 ? 461 SER B OG  1 
ATOM   5400 N  N   . SER B 1 270 ? 20.022  13.087 103.580 1.00 124.60 ? 462 SER B N   1 
ATOM   5401 C  CA  . SER B 1 270 ? 19.019  12.139 104.058 1.00 121.19 ? 462 SER B CA  1 
ATOM   5402 C  C   . SER B 1 270 ? 17.606  12.656 103.800 1.00 117.80 ? 462 SER B C   1 
ATOM   5403 O  O   . SER B 1 270 ? 17.401  13.858 103.652 1.00 117.68 ? 462 SER B O   1 
ATOM   5404 C  CB  . SER B 1 270 ? 19.212  11.886 105.551 1.00 121.84 ? 462 SER B CB  1 
ATOM   5405 O  OG  . SER B 1 270 ? 19.001  13.079 106.287 1.00 122.56 ? 462 SER B OG  1 
ATOM   5406 N  N   . ALA B 1 271 ? 16.637  11.744 103.752 1.00 115.21 ? 463 ALA B N   1 
ATOM   5407 C  CA  . ALA B 1 271 ? 15.231  12.106 103.549 1.00 112.23 ? 463 ALA B CA  1 
ATOM   5408 C  C   . ALA B 1 271 ? 14.392  11.925 104.814 1.00 109.44 ? 463 ALA B C   1 
ATOM   5409 O  O   . ALA B 1 271 ? 14.722  11.115 105.684 1.00 109.10 ? 463 ALA B O   1 
ATOM   5410 C  CB  . ALA B 1 271 ? 14.635  11.304 102.404 1.00 112.36 ? 463 ALA B CB  1 
ATOM   5411 N  N   . ARG B 1 272 ? 13.310  12.694 104.904 1.00 105.99 ? 464 ARG B N   1 
ATOM   5412 C  CA  . ARG B 1 272 ? 12.373  12.624 106.025 1.00 103.70 ? 464 ARG B CA  1 
ATOM   5413 C  C   . ARG B 1 272 ? 10.951  12.631 105.485 1.00 103.11 ? 464 ARG B C   1 
ATOM   5414 O  O   . ARG B 1 272 ? 10.667  13.272 104.470 1.00 106.50 ? 464 ARG B O   1 
ATOM   5415 C  CB  . ARG B 1 272 ? 12.573  13.801 106.983 1.00 103.21 ? 464 ARG B CB  1 
ATOM   5416 C  CG  . ARG B 1 272 ? 14.028  14.133 107.251 1.00 104.78 ? 464 ARG B CG  1 
ATOM   5417 C  CD  . ARG B 1 272 ? 14.216  15.017 108.466 1.00 106.68 ? 464 ARG B CD  1 
ATOM   5418 N  NE  . ARG B 1 272 ? 15.631  15.113 108.819 1.00 109.10 ? 464 ARG B NE  1 
ATOM   5419 C  CZ  . ARG B 1 272 ? 16.293  14.212 109.543 1.00 110.72 ? 464 ARG B CZ  1 
ATOM   5420 N  NH1 . ARG B 1 272 ? 15.675  13.132 110.014 1.00 110.24 ? 464 ARG B NH1 1 
ATOM   5421 N  NH2 . ARG B 1 272 ? 17.582  14.393 109.799 1.00 111.35 ? 464 ARG B NH2 1 
ATOM   5422 N  N   . ILE B 1 273 ? 10.055  11.924 106.163 1.00 99.73  ? 465 ILE B N   1 
ATOM   5423 C  CA  . ILE B 1 273 ? 8.684   11.792 105.684 1.00 98.25  ? 465 ILE B CA  1 
ATOM   5424 C  C   . ILE B 1 273 ? 7.658   11.963 106.805 1.00 99.04  ? 465 ILE B C   1 
ATOM   5425 O  O   . ILE B 1 273 ? 7.738   11.311 107.855 1.00 99.66  ? 465 ILE B O   1 
ATOM   5426 C  CB  . ILE B 1 273 ? 8.475   10.456 104.915 1.00 96.64  ? 465 ILE B CB  1 
ATOM   5427 C  CG1 . ILE B 1 273 ? 7.013   10.296 104.476 1.00 97.39  ? 465 ILE B CG1 1 
ATOM   5428 C  CG2 . ILE B 1 273 ? 8.948   9.283  105.751 1.00 95.68  ? 465 ILE B CG2 1 
ATOM   5429 C  CD1 . ILE B 1 273 ? 6.749   9.110  103.570 1.00 98.19  ? 465 ILE B CD1 1 
ATOM   5430 N  N   . LEU B 1 274 ? 6.700   12.853 106.569 1.00 98.30  ? 466 LEU B N   1 
ATOM   5431 C  CA  . LEU B 1 274 ? 5.609   13.075 107.499 1.00 99.62  ? 466 LEU B CA  1 
ATOM   5432 C  C   . LEU B 1 274 ? 4.283   12.647 106.878 1.00 102.60 ? 466 LEU B C   1 
ATOM   5433 O  O   . LEU B 1 274 ? 3.966   13.038 105.753 1.00 104.97 ? 466 LEU B O   1 
ATOM   5434 C  CB  . LEU B 1 274 ? 5.563   14.546 107.905 1.00 99.06  ? 466 LEU B CB  1 
ATOM   5435 C  CG  . LEU B 1 274 ? 4.620   14.947 109.039 1.00 100.07 ? 466 LEU B CG  1 
ATOM   5436 C  CD1 . LEU B 1 274 ? 5.001   14.262 110.349 1.00 100.28 ? 466 LEU B CD1 1 
ATOM   5437 C  CD2 . LEU B 1 274 ? 4.623   16.460 109.204 1.00 99.87  ? 466 LEU B CD2 1 
ATOM   5438 N  N   . GLN B 1 275 ? 3.529   11.828 107.608 1.00 104.81 ? 467 GLN B N   1 
ATOM   5439 C  CA  . GLN B 1 275 ? 2.178   11.436 107.207 1.00 107.95 ? 467 GLN B CA  1 
ATOM   5440 C  C   . GLN B 1 275 ? 1.191   11.829 108.288 1.00 111.89 ? 467 GLN B C   1 
ATOM   5441 O  O   . GLN B 1 275 ? 1.432   11.576 109.471 1.00 112.16 ? 467 GLN B O   1 
ATOM   5442 C  CB  . GLN B 1 275 ? 2.090   9.936  106.959 1.00 108.77 ? 467 GLN B CB  1 
ATOM   5443 C  CG  . GLN B 1 275 ? 2.620   9.498  105.609 1.00 111.65 ? 467 GLN B CG  1 
ATOM   5444 C  CD  . GLN B 1 275 ? 1.970   8.219  105.104 1.00 112.87 ? 467 GLN B CD  1 
ATOM   5445 O  OE1 . GLN B 1 275 ? 1.524   7.372  105.885 1.00 112.32 ? 467 GLN B OE1 1 
ATOM   5446 N  NE2 . GLN B 1 275 ? 1.913   8.074  103.783 1.00 113.38 ? 467 GLN B NE2 1 
ATOM   5447 N  N   . ILE B 1 276 ? 0.081   12.442 107.885 1.00 116.84 ? 468 ILE B N   1 
ATOM   5448 C  CA  . ILE B 1 276 ? -0.890  12.964 108.850 1.00 122.78 ? 468 ILE B CA  1 
ATOM   5449 C  C   . ILE B 1 276 ? -2.075  12.025 109.092 1.00 127.11 ? 468 ILE B C   1 
ATOM   5450 O  O   . ILE B 1 276 ? -2.923  12.295 109.953 1.00 129.35 ? 468 ILE B O   1 
ATOM   5451 C  CB  . ILE B 1 276 ? -1.413  14.368 108.461 1.00 123.58 ? 468 ILE B CB  1 
ATOM   5452 C  CG1 . ILE B 1 276 ? -2.430  14.264 107.318 1.00 126.69 ? 468 ILE B CG1 1 
ATOM   5453 C  CG2 . ILE B 1 276 ? -0.249  15.308 108.125 1.00 121.61 ? 468 ILE B CG2 1 
ATOM   5454 C  CD1 . ILE B 1 276 ? -3.713  15.055 107.551 1.00 128.44 ? 468 ILE B CD1 1 
ATOM   5455 N  N   . ILE B 1 277 ? -2.113  10.921 108.344 1.00 129.70 ? 469 ILE B N   1 
ATOM   5456 C  CA  . ILE B 1 277 ? -3.195  9.916  108.418 1.00 130.78 ? 469 ILE B CA  1 
ATOM   5457 C  C   . ILE B 1 277 ? -4.560  10.545 108.078 1.00 131.90 ? 469 ILE B C   1 
ATOM   5458 O  O   . ILE B 1 277 ? -4.621  11.691 107.621 1.00 134.70 ? 469 ILE B O   1 
ATOM   5459 C  CB  . ILE B 1 277 ? -3.207  9.118  109.771 1.00 129.57 ? 469 ILE B CB  1 
ATOM   5460 C  CG1 . ILE B 1 277 ? -1.779  8.773  110.217 1.00 129.21 ? 469 ILE B CG1 1 
ATOM   5461 C  CG2 . ILE B 1 277 ? -4.021  7.823  109.636 1.00 129.67 ? 469 ILE B CG2 1 
ATOM   5462 C  CD1 . ILE B 1 277 ? -1.666  8.247  111.641 1.00 129.93 ? 469 ILE B CD1 1 
ATOM   5463 N  N   . LYS B 1 278 ? -5.642  9.799  108.280 1.00 129.67 ? 470 LYS B N   1 
ATOM   5464 C  CA  . LYS B 1 278 ? -6.957  10.232 107.823 1.00 128.61 ? 470 LYS B CA  1 
ATOM   5465 C  C   . LYS B 1 278 ? -7.876  10.601 108.988 1.00 127.83 ? 470 LYS B C   1 
ATOM   5466 O  O   . LYS B 1 278 ? -8.497  9.726  109.602 1.00 127.22 ? 470 LYS B O   1 
ATOM   5467 C  CB  . LYS B 1 278 ? -7.594  9.159  106.926 1.00 129.44 ? 470 LYS B CB  1 
ATOM   5468 C  CG  . LYS B 1 278 ? -6.806  8.848  105.646 1.00 129.02 ? 470 LYS B CG  1 
ATOM   5469 C  CD  . LYS B 1 278 ? -7.423  7.685  104.871 1.00 128.11 ? 470 LYS B CD  1 
ATOM   5470 C  CE  . LYS B 1 278 ? -6.634  7.363  103.609 1.00 125.76 ? 470 LYS B CE  1 
ATOM   5471 N  NZ  . LYS B 1 278 ? -7.313  6.335  102.775 1.00 123.56 ? 470 LYS B NZ  1 
ATOM   5472 N  N   . GLY B 1 279 ? -7.941  11.900 109.286 1.00 126.49 ? 471 GLY B N   1 
ATOM   5473 C  CA  . GLY B 1 279 ? -8.815  12.444 110.334 1.00 124.32 ? 471 GLY B CA  1 
ATOM   5474 C  C   . GLY B 1 279 ? -8.660  11.771 111.687 1.00 122.12 ? 471 GLY B C   1 
ATOM   5475 O  O   . GLY B 1 279 ? -9.542  11.031 112.126 1.00 121.12 ? 471 GLY B O   1 
ATOM   5476 N  N   . LYS B 1 280 ? -7.531  12.033 112.342 1.00 120.28 ? 472 LYS B N   1 
ATOM   5477 C  CA  . LYS B 1 280 ? -7.189  11.411 113.620 1.00 116.23 ? 472 LYS B CA  1 
ATOM   5478 C  C   . LYS B 1 280 ? -6.695  12.463 114.615 1.00 115.59 ? 472 LYS B C   1 
ATOM   5479 O  O   . LYS B 1 280 ? -5.819  13.270 114.291 1.00 116.68 ? 472 LYS B O   1 
ATOM   5480 C  CB  . LYS B 1 280 ? -6.141  10.304 113.404 1.00 114.65 ? 472 LYS B CB  1 
ATOM   5481 C  CG  . LYS B 1 280 ? -5.226  10.014 114.592 1.00 114.36 ? 472 LYS B CG  1 
ATOM   5482 C  CD  . LYS B 1 280 ? -4.406  8.744  114.391 1.00 115.19 ? 472 LYS B CD  1 
ATOM   5483 C  CE  . LYS B 1 280 ? -5.162  7.503  114.868 1.00 114.67 ? 472 LYS B CE  1 
ATOM   5484 N  NZ  . LYS B 1 280 ? -4.317  6.276  114.829 1.00 113.54 ? 472 LYS B NZ  1 
ATOM   5485 N  N   . ASP B 1 281 ? -7.275  12.457 115.814 1.00 114.26 ? 473 ASP B N   1 
ATOM   5486 C  CA  . ASP B 1 281 ? -6.842  13.343 116.895 1.00 113.17 ? 473 ASP B CA  1 
ATOM   5487 C  C   . ASP B 1 281 ? -5.483  12.932 117.442 1.00 111.77 ? 473 ASP B C   1 
ATOM   5488 O  O   . ASP B 1 281 ? -5.334  11.854 118.020 1.00 113.21 ? 473 ASP B O   1 
ATOM   5489 C  CB  . ASP B 1 281 ? -7.873  13.383 118.028 1.00 114.16 ? 473 ASP B CB  1 
ATOM   5490 C  CG  . ASP B 1 281 ? -8.503  14.754 118.198 1.00 115.25 ? 473 ASP B CG  1 
ATOM   5491 O  OD1 . ASP B 1 281 ? -8.814  15.408 117.180 1.00 117.09 ? 473 ASP B OD1 1 
ATOM   5492 O  OD2 . ASP B 1 281 ? -8.691  15.178 119.359 1.00 114.78 ? 473 ASP B OD2 1 
ATOM   5493 N  N   . TYR B 1 282 ? -4.496  13.800 117.245 1.00 109.77 ? 474 TYR B N   1 
ATOM   5494 C  CA  . TYR B 1 282 ? -3.146  13.561 117.733 1.00 108.02 ? 474 TYR B CA  1 
ATOM   5495 C  C   . TYR B 1 282 ? -2.992  14.087 119.152 1.00 108.90 ? 474 TYR B C   1 
ATOM   5496 O  O   . TYR B 1 282 ? -3.413  15.206 119.454 1.00 109.42 ? 474 TYR B O   1 
ATOM   5497 C  CB  . TYR B 1 282 ? -2.117  14.218 116.811 1.00 105.32 ? 474 TYR B CB  1 
ATOM   5498 C  CG  . TYR B 1 282 ? -1.915  13.497 115.500 1.00 104.09 ? 474 TYR B CG  1 
ATOM   5499 C  CD1 . TYR B 1 282 ? -2.471  13.984 114.317 1.00 102.62 ? 474 TYR B CD1 1 
ATOM   5500 C  CD2 . TYR B 1 282 ? -1.166  12.324 115.443 1.00 104.70 ? 474 TYR B CD2 1 
ATOM   5501 C  CE1 . TYR B 1 282 ? -2.282  13.318 113.111 1.00 102.76 ? 474 TYR B CE1 1 
ATOM   5502 C  CE2 . TYR B 1 282 ? -0.975  11.652 114.249 1.00 104.58 ? 474 TYR B CE2 1 
ATOM   5503 C  CZ  . TYR B 1 282 ? -1.530  12.152 113.089 1.00 104.04 ? 474 TYR B CZ  1 
ATOM   5504 O  OH  . TYR B 1 282 ? -1.324  11.470 111.916 1.00 103.74 ? 474 TYR B OH  1 
ATOM   5505 N  N   . GLU B 1 283 ? -2.399  13.267 120.018 1.00 109.73 ? 475 GLU B N   1 
ATOM   5506 C  CA  . GLU B 1 283 ? -2.149  13.655 121.403 1.00 109.95 ? 475 GLU B CA  1 
ATOM   5507 C  C   . GLU B 1 283 ? -0.647  13.722 121.679 1.00 110.04 ? 475 GLU B C   1 
ATOM   5508 O  O   . GLU B 1 283 ? -0.202  14.447 122.572 1.00 109.97 ? 475 GLU B O   1 
ATOM   5509 C  CB  . GLU B 1 283 ? -2.840  12.693 122.371 1.00 110.25 ? 475 GLU B CB  1 
ATOM   5510 C  CG  . GLU B 1 283 ? -3.853  13.356 123.312 1.00 110.71 ? 475 GLU B CG  1 
ATOM   5511 C  CD  . GLU B 1 283 ? -3.252  14.439 124.203 1.00 110.65 ? 475 GLU B CD  1 
ATOM   5512 O  OE1 . GLU B 1 283 ? -2.814  15.487 123.673 1.00 109.58 ? 475 GLU B OE1 1 
ATOM   5513 O  OE2 . GLU B 1 283 ? -3.241  14.245 125.440 1.00 109.78 ? 475 GLU B OE2 1 
ATOM   5514 N  N   . SER B 1 284 ? 0.117   12.953 120.905 1.00 109.94 ? 476 SER B N   1 
ATOM   5515 C  CA  . SER B 1 284 ? 1.574   13.040 120.876 1.00 109.46 ? 476 SER B CA  1 
ATOM   5516 C  C   . SER B 1 284 ? 2.032   13.081 119.419 1.00 109.39 ? 476 SER B C   1 
ATOM   5517 O  O   . SER B 1 284 ? 1.491   12.356 118.580 1.00 109.93 ? 476 SER B O   1 
ATOM   5518 C  CB  . SER B 1 284 ? 2.204   11.851 121.600 1.00 109.91 ? 476 SER B CB  1 
ATOM   5519 O  OG  . SER B 1 284 ? 1.897   10.634 120.942 1.00 110.63 ? 476 SER B OG  1 
ATOM   5520 N  N   . GLU B 1 285 ? 3.025   13.928 119.137 1.00 108.49 ? 477 GLU B N   1 
ATOM   5521 C  CA  . GLU B 1 285 ? 3.524   14.193 117.775 1.00 106.40 ? 477 GLU B CA  1 
ATOM   5522 C  C   . GLU B 1 285 ? 3.739   12.949 116.911 1.00 105.55 ? 477 GLU B C   1 
ATOM   5523 O  O   . GLU B 1 285 ? 4.225   11.928 117.406 1.00 106.37 ? 477 GLU B O   1 
ATOM   5524 C  CB  . GLU B 1 285 ? 4.858   14.946 117.834 1.00 106.44 ? 477 GLU B CB  1 
ATOM   5525 C  CG  . GLU B 1 285 ? 4.797   16.388 118.313 1.00 106.42 ? 477 GLU B CG  1 
ATOM   5526 C  CD  . GLU B 1 285 ? 6.165   17.061 118.309 1.00 106.29 ? 477 GLU B CD  1 
ATOM   5527 O  OE1 . GLU B 1 285 ? 7.012   16.687 117.471 1.00 107.22 ? 477 GLU B OE1 1 
ATOM   5528 O  OE2 . GLU B 1 285 ? 6.398   17.966 119.137 1.00 105.36 ? 477 GLU B OE2 1 
ATOM   5529 N  N   . PRO B 1 286 ? 3.378   13.028 115.614 1.00 104.28 ? 478 PRO B N   1 
ATOM   5530 C  CA  . PRO B 1 286 ? 3.862   12.040 114.653 1.00 103.39 ? 478 PRO B CA  1 
ATOM   5531 C  C   . PRO B 1 286 ? 5.370   12.177 114.481 1.00 103.12 ? 478 PRO B C   1 
ATOM   5532 O  O   . PRO B 1 286 ? 5.914   13.277 114.620 1.00 100.90 ? 478 PRO B O   1 
ATOM   5533 C  CB  . PRO B 1 286 ? 3.153   12.428 113.352 1.00 102.56 ? 478 PRO B CB  1 
ATOM   5534 C  CG  . PRO B 1 286 ? 2.019   13.279 113.762 1.00 103.21 ? 478 PRO B CG  1 
ATOM   5535 C  CD  . PRO B 1 286 ? 2.479   14.004 114.979 1.00 104.30 ? 478 PRO B CD  1 
ATOM   5536 N  N   . SER B 1 287 ? 6.033   11.062 114.191 1.00 105.04 ? 479 SER B N   1 
ATOM   5537 C  CA  . SER B 1 287 ? 7.481   11.050 114.027 1.00 107.29 ? 479 SER B CA  1 
ATOM   5538 C  C   . SER B 1 287 ? 7.908   11.598 112.670 1.00 109.53 ? 479 SER B C   1 
ATOM   5539 O  O   . SER B 1 287 ? 7.093   11.748 111.753 1.00 109.28 ? 479 SER B O   1 
ATOM   5540 C  CB  . SER B 1 287 ? 8.039   9.640  114.233 1.00 107.32 ? 479 SER B CB  1 
ATOM   5541 O  OG  . SER B 1 287 ? 7.950   9.254  115.594 1.00 107.72 ? 479 SER B OG  1 
ATOM   5542 N  N   . LEU B 1 288 ? 9.195   11.898 112.559 1.00 111.61 ? 480 LEU B N   1 
ATOM   5543 C  CA  . LEU B 1 288 ? 9.766   12.404 111.327 1.00 113.30 ? 480 LEU B CA  1 
ATOM   5544 C  C   . LEU B 1 288 ? 10.674  11.333 110.726 1.00 116.58 ? 480 LEU B C   1 
ATOM   5545 O  O   . LEU B 1 288 ? 11.894  11.514 110.632 1.00 117.32 ? 480 LEU B O   1 
ATOM   5546 C  CB  . LEU B 1 288 ? 10.542  13.682 111.626 1.00 112.78 ? 480 LEU B CB  1 
ATOM   5547 C  CG  . LEU B 1 288 ? 10.430  14.846 110.646 1.00 112.72 ? 480 LEU B CG  1 
ATOM   5548 C  CD1 . LEU B 1 288 ? 8.980   15.274 110.434 1.00 112.58 ? 480 LEU B CD1 1 
ATOM   5549 C  CD2 . LEU B 1 288 ? 11.242  15.994 111.189 1.00 112.76 ? 480 LEU B CD2 1 
ATOM   5550 N  N   . LEU B 1 289 ? 10.060  10.219 110.324 1.00 119.83 ? 481 LEU B N   1 
ATOM   5551 C  CA  . LEU B 1 289 ? 10.778  9.012  109.903 1.00 119.63 ? 481 LEU B CA  1 
ATOM   5552 C  C   . LEU B 1 289 ? 11.890  9.319  108.909 1.00 119.60 ? 481 LEU B C   1 
ATOM   5553 O  O   . LEU B 1 289 ? 11.657  9.937  107.874 1.00 119.38 ? 481 LEU B O   1 
ATOM   5554 C  CB  . LEU B 1 289 ? 9.806   7.968  109.328 1.00 120.25 ? 481 LEU B CB  1 
ATOM   5555 C  CG  . LEU B 1 289 ? 10.264  6.518  109.062 1.00 122.94 ? 481 LEU B CG  1 
ATOM   5556 C  CD1 . LEU B 1 289 ? 11.195  6.393  107.839 1.00 123.78 ? 481 LEU B CD1 1 
ATOM   5557 C  CD2 . LEU B 1 289 ? 10.880  5.820  110.299 1.00 123.69 ? 481 LEU B CD2 1 
ATOM   5558 N  N   . GLU B 1 290 ? 13.098  8.875  109.245 1.00 120.97 ? 482 GLU B N   1 
ATOM   5559 C  CA  . GLU B 1 290 ? 14.283  9.129  108.437 1.00 122.77 ? 482 GLU B CA  1 
ATOM   5560 C  C   . GLU B 1 290 ? 14.648  7.923  107.575 1.00 122.96 ? 482 GLU B C   1 
ATOM   5561 O  O   . GLU B 1 290 ? 14.592  6.780  108.033 1.00 123.34 ? 482 GLU B O   1 
ATOM   5562 C  CB  . GLU B 1 290 ? 15.458  9.503  109.343 1.00 123.42 ? 482 GLU B CB  1 
ATOM   5563 C  CG  . GLU B 1 290 ? 16.663  10.099 108.620 1.00 124.24 ? 482 GLU B CG  1 
ATOM   5564 C  CD  . GLU B 1 290 ? 17.833  10.371 109.552 1.00 124.34 ? 482 GLU B CD  1 
ATOM   5565 O  OE1 . GLU B 1 290 ? 18.094  9.538  110.452 1.00 124.76 ? 482 GLU B OE1 1 
ATOM   5566 O  OE2 . GLU B 1 290 ? 18.498  11.418 109.378 1.00 124.03 ? 482 GLU B OE2 1 
ATOM   5567 N  N   . PHE B 1 291 ? 15.016  8.195  106.325 1.00 123.92 ? 483 PHE B N   1 
ATOM   5568 C  CA  . PHE B 1 291 ? 15.497  7.172  105.392 1.00 125.65 ? 483 PHE B CA  1 
ATOM   5569 C  C   . PHE B 1 291 ? 16.388  7.794  104.312 1.00 125.69 ? 483 PHE B C   1 
ATOM   5570 O  O   . PHE B 1 291 ? 16.263  8.978  104.006 1.00 125.06 ? 483 PHE B O   1 
ATOM   5571 C  CB  . PHE B 1 291 ? 14.334  6.367  104.783 1.00 126.88 ? 483 PHE B CB  1 
ATOM   5572 C  CG  . PHE B 1 291 ? 13.416  7.170  103.897 1.00 126.97 ? 483 PHE B CG  1 
ATOM   5573 C  CD1 . PHE B 1 291 ? 12.514  8.083  104.437 1.00 127.59 ? 483 PHE B CD1 1 
ATOM   5574 C  CD2 . PHE B 1 291 ? 13.430  6.986  102.522 1.00 127.03 ? 483 PHE B CD2 1 
ATOM   5575 C  CE1 . PHE B 1 291 ? 11.663  8.819  103.615 1.00 127.80 ? 483 PHE B CE1 1 
ATOM   5576 C  CE2 . PHE B 1 291 ? 12.580  7.717  101.694 1.00 127.86 ? 483 PHE B CE2 1 
ATOM   5577 C  CZ  . PHE B 1 291 ? 11.694  8.632  102.242 1.00 127.49 ? 483 PHE B CZ  1 
ATOM   5578 N  N   . LYS B 1 292 ? 17.291  6.994  103.749 1.00 126.63 ? 484 LYS B N   1 
ATOM   5579 C  CA  . LYS B 1 292 ? 18.327  7.511  102.847 1.00 126.71 ? 484 LYS B CA  1 
ATOM   5580 C  C   . LYS B 1 292 ? 18.347  6.825  101.472 1.00 128.27 ? 484 LYS B C   1 
ATOM   5581 O  O   . LYS B 1 292 ? 19.168  5.933  101.232 1.00 128.99 ? 484 LYS B O   1 
ATOM   5582 C  CB  . LYS B 1 292 ? 19.711  7.420  103.515 1.00 126.14 ? 484 LYS B CB  1 
ATOM   5583 C  CG  . LYS B 1 292 ? 19.822  8.164  104.839 1.00 125.01 ? 484 LYS B CG  1 
ATOM   5584 C  CD  . LYS B 1 292 ? 21.180  7.977  105.484 1.00 123.98 ? 484 LYS B CD  1 
ATOM   5585 C  CE  . LYS B 1 292 ? 21.178  8.534  106.897 1.00 121.94 ? 484 LYS B CE  1 
ATOM   5586 N  NZ  . LYS B 1 292 ? 22.551  8.718  107.423 1.00 120.42 ? 484 LYS B NZ  1 
ATOM   5587 N  N   . PRO B 1 293 ? 17.435  7.230  100.565 1.00 128.73 ? 485 PRO B N   1 
ATOM   5588 C  CA  . PRO B 1 293 ? 17.453  6.708  99.204  1.00 129.68 ? 485 PRO B CA  1 
ATOM   5589 C  C   . PRO B 1 293 ? 18.165  7.645  98.216  1.00 131.21 ? 485 PRO B C   1 
ATOM   5590 O  O   . PRO B 1 293 ? 17.812  7.676  97.033  1.00 130.39 ? 485 PRO B O   1 
ATOM   5591 C  CB  . PRO B 1 293 ? 15.964  6.618  98.870  1.00 128.90 ? 485 PRO B CB  1 
ATOM   5592 C  CG  . PRO B 1 293 ? 15.341  7.752  99.654  1.00 128.22 ? 485 PRO B CG  1 
ATOM   5593 C  CD  . PRO B 1 293 ? 16.306  8.157  100.755 1.00 128.33 ? 485 PRO B CD  1 
ATOM   5594 N  N   . PHE B 1 294 ? 19.150  8.399  98.702  1.00 133.28 ? 486 PHE B N   1 
ATOM   5595 C  CA  . PHE B 1 294 ? 19.889  9.351  97.867  1.00 135.14 ? 486 PHE B CA  1 
ATOM   5596 C  C   . PHE B 1 294 ? 21.398  9.146  97.977  1.00 137.75 ? 486 PHE B C   1 
ATOM   5597 O  O   . PHE B 1 294 ? 21.927  8.939  99.073  1.00 139.06 ? 486 PHE B O   1 
ATOM   5598 C  CB  . PHE B 1 294 ? 19.511  10.793 98.225  1.00 133.79 ? 486 PHE B CB  1 
ATOM   5599 C  CG  . PHE B 1 294 ? 18.027  11.056 98.203  1.00 133.18 ? 486 PHE B CG  1 
ATOM   5600 C  CD1 . PHE B 1 294 ? 17.307  10.976 97.013  1.00 133.23 ? 486 PHE B CD1 1 
ATOM   5601 C  CD2 . PHE B 1 294 ? 17.348  11.381 99.368  1.00 132.18 ? 486 PHE B CD2 1 
ATOM   5602 C  CE1 . PHE B 1 294 ? 15.931  11.214 96.985  1.00 131.62 ? 486 PHE B CE1 1 
ATOM   5603 C  CE2 . PHE B 1 294 ? 15.976  11.622 99.346  1.00 131.68 ? 486 PHE B CE2 1 
ATOM   5604 C  CZ  . PHE B 1 294 ? 15.268  11.538 98.153  1.00 131.56 ? 486 PHE B CZ  1 
ATOM   5605 N  N   . SER B 1 295 ? 22.083  9.214  96.837  1.00 139.23 ? 487 SER B N   1 
ATOM   5606 C  CA  . SER B 1 295 ? 23.511  8.902  96.772  1.00 140.51 ? 487 SER B CA  1 
ATOM   5607 C  C   . SER B 1 295 ? 24.336  10.001 96.104  1.00 141.65 ? 487 SER B C   1 
ATOM   5608 O  O   . SER B 1 295 ? 25.477  10.255 96.501  1.00 141.96 ? 487 SER B O   1 
ATOM   5609 C  CB  . SER B 1 295 ? 23.724  7.580  96.033  1.00 139.99 ? 487 SER B CB  1 
ATOM   5610 O  OG  . SER B 1 295 ? 22.789  6.606  96.458  1.00 139.98 ? 487 SER B OG  1 
ATOM   5611 N  N   . ASN B 1 296 ? 23.747  10.648 95.098  1.00 142.30 ? 488 ASN B N   1 
ATOM   5612 C  CA  . ASN B 1 296 ? 24.445  11.627 94.253  1.00 142.55 ? 488 ASN B CA  1 
ATOM   5613 C  C   . ASN B 1 296 ? 24.923  12.902 94.962  1.00 140.71 ? 488 ASN B C   1 
ATOM   5614 O  O   . ASN B 1 296 ? 25.775  13.626 94.435  1.00 141.21 ? 488 ASN B O   1 
ATOM   5615 C  CB  . ASN B 1 296 ? 23.578  11.994 93.039  1.00 143.90 ? 488 ASN B CB  1 
ATOM   5616 C  CG  . ASN B 1 296 ? 22.275  12.679 93.431  1.00 144.95 ? 488 ASN B CG  1 
ATOM   5617 O  OD1 . ASN B 1 296 ? 21.604  12.277 94.387  1.00 145.34 ? 488 ASN B OD1 1 
ATOM   5618 N  ND2 . ASN B 1 296 ? 21.910  13.716 92.686  1.00 144.53 ? 488 ASN B ND2 1 
ATOM   5619 N  N   . GLY B 1 297 ? 24.371  13.173 96.145  1.00 137.12 ? 489 GLY B N   1 
ATOM   5620 C  CA  . GLY B 1 297 ? 24.739  14.356 96.924  1.00 131.20 ? 489 GLY B CA  1 
ATOM   5621 C  C   . GLY B 1 297 ? 23.549  15.205 97.339  1.00 125.39 ? 489 GLY B C   1 
ATOM   5622 O  O   . GLY B 1 297 ? 22.450  14.675 97.529  1.00 125.72 ? 489 GLY B O   1 
ATOM   5623 N  N   . PRO B 1 298 ? 23.754  16.534 97.467  1.00 119.49 ? 490 PRO B N   1 
ATOM   5624 C  CA  . PRO B 1 298 ? 22.711  17.408 98.001  1.00 114.12 ? 490 PRO B CA  1 
ATOM   5625 C  C   . PRO B 1 298 ? 21.653  17.757 96.963  1.00 110.84 ? 490 PRO B C   1 
ATOM   5626 O  O   . PRO B 1 298 ? 21.973  18.112 95.827  1.00 112.23 ? 490 PRO B O   1 
ATOM   5627 C  CB  . PRO B 1 298 ? 23.482  18.655 98.440  1.00 113.44 ? 490 PRO B CB  1 
ATOM   5628 C  CG  . PRO B 1 298 ? 24.686  18.689 97.574  1.00 115.01 ? 490 PRO B CG  1 
ATOM   5629 C  CD  . PRO B 1 298 ? 24.970  17.286 97.099  1.00 117.57 ? 490 PRO B CD  1 
ATOM   5630 N  N   . LEU B 1 299 ? 20.395  17.646 97.367  1.00 106.30 ? 491 LEU B N   1 
ATOM   5631 C  CA  . LEU B 1 299 ? 19.271  17.928 96.491  1.00 101.41 ? 491 LEU B CA  1 
ATOM   5632 C  C   . LEU B 1 299 ? 18.749  19.346 96.709  1.00 98.79  ? 491 LEU B C   1 
ATOM   5633 O  O   . LEU B 1 299 ? 18.931  19.925 97.782  1.00 99.14  ? 491 LEU B O   1 
ATOM   5634 C  CB  . LEU B 1 299 ? 18.159  16.917 96.755  1.00 101.27 ? 491 LEU B CB  1 
ATOM   5635 C  CG  . LEU B 1 299 ? 18.147  15.557 96.054  1.00 102.23 ? 491 LEU B CG  1 
ATOM   5636 C  CD1 . LEU B 1 299 ? 19.510  14.886 95.979  1.00 104.12 ? 491 LEU B CD1 1 
ATOM   5637 C  CD2 . LEU B 1 299 ? 17.170  14.663 96.779  1.00 103.18 ? 491 LEU B CD2 1 
ATOM   5638 N  N   . VAL B 1 300 ? 18.111  19.905 95.685  1.00 95.44  ? 492 VAL B N   1 
ATOM   5639 C  CA  . VAL B 1 300 ? 17.447  21.199 95.806  1.00 93.17  ? 492 VAL B CA  1 
ATOM   5640 C  C   . VAL B 1 300 ? 16.092  20.963 96.449  1.00 93.84  ? 492 VAL B C   1 
ATOM   5641 O  O   . VAL B 1 300 ? 15.613  21.780 97.249  1.00 92.17  ? 492 VAL B O   1 
ATOM   5642 C  CB  . VAL B 1 300 ? 17.287  21.896 94.427  1.00 93.77  ? 492 VAL B CB  1 
ATOM   5643 C  CG1 . VAL B 1 300 ? 16.151  22.940 94.444  1.00 95.35  ? 492 VAL B CG1 1 
ATOM   5644 C  CG2 . VAL B 1 300 ? 18.596  22.544 94.002  1.00 91.70  ? 492 VAL B CG2 1 
ATOM   5645 N  N   . GLY B 1 301 ? 15.493  19.825 96.095  1.00 94.41  ? 493 GLY B N   1 
ATOM   5646 C  CA  . GLY B 1 301 ? 14.164  19.445 96.566  1.00 94.20  ? 493 GLY B CA  1 
ATOM   5647 C  C   . GLY B 1 301 ? 13.392  18.634 95.543  1.00 92.09  ? 493 GLY B C   1 
ATOM   5648 O  O   . GLY B 1 301 ? 13.965  18.129 94.575  1.00 93.27  ? 493 GLY B O   1 
ATOM   5649 N  N   . GLY B 1 302 ? 12.086  18.511 95.756  1.00 88.97  ? 494 GLY B N   1 
ATOM   5650 C  CA  . GLY B 1 302 ? 11.254  17.680 94.901  1.00 87.91  ? 494 GLY B CA  1 
ATOM   5651 C  C   . GLY B 1 302 ? 9.781   18.022 94.900  1.00 89.43  ? 494 GLY B C   1 
ATOM   5652 O  O   . GLY B 1 302 ? 9.332   18.913 95.629  1.00 89.54  ? 494 GLY B O   1 
ATOM   5653 N  N   . PHE B 1 303 ? 9.032   17.304 94.067  1.00 89.47  ? 495 PHE B N   1 
ATOM   5654 C  CA  . PHE B 1 303 ? 7.596   17.505 93.910  1.00 90.21  ? 495 PHE B CA  1 
ATOM   5655 C  C   . PHE B 1 303 ? 6.935   16.185 93.560  1.00 93.15  ? 495 PHE B C   1 
ATOM   5656 O  O   . PHE B 1 303 ? 7.608   15.234 93.153  1.00 98.47  ? 495 PHE B O   1 
ATOM   5657 C  CB  . PHE B 1 303 ? 7.317   18.536 92.812  1.00 89.39  ? 495 PHE B CB  1 
ATOM   5658 C  CG  . PHE B 1 303 ? 8.002   18.239 91.513  1.00 88.30  ? 495 PHE B CG  1 
ATOM   5659 C  CD1 . PHE B 1 303 ? 9.230   18.817 91.216  1.00 87.10  ? 495 PHE B CD1 1 
ATOM   5660 C  CD2 . PHE B 1 303 ? 7.419   17.376 90.583  1.00 88.43  ? 495 PHE B CD2 1 
ATOM   5661 C  CE1 . PHE B 1 303 ? 9.871   18.534 90.012  1.00 89.50  ? 495 PHE B CE1 1 
ATOM   5662 C  CE2 . PHE B 1 303 ? 8.048   17.091 89.371  1.00 86.47  ? 495 PHE B CE2 1 
ATOM   5663 C  CZ  . PHE B 1 303 ? 9.277   17.664 89.086  1.00 88.11  ? 495 PHE B CZ  1 
ATOM   5664 N  N   . VAL B 1 304 ? 5.619   16.124 93.720  1.00 92.79  ? 496 VAL B N   1 
ATOM   5665 C  CA  . VAL B 1 304 ? 4.840   14.953 93.315  1.00 89.87  ? 496 VAL B CA  1 
ATOM   5666 C  C   . VAL B 1 304 ? 4.070   15.323 92.053  1.00 90.08  ? 496 VAL B C   1 
ATOM   5667 O  O   . VAL B 1 304 ? 3.090   16.063 92.125  1.00 92.95  ? 496 VAL B O   1 
ATOM   5668 C  CB  . VAL B 1 304 ? 3.838   14.535 94.419  1.00 87.96  ? 496 VAL B CB  1 
ATOM   5669 C  CG1 . VAL B 1 304 ? 2.950   13.401 93.940  1.00 90.44  ? 496 VAL B CG1 1 
ATOM   5670 C  CG2 . VAL B 1 304 ? 4.566   14.146 95.699  1.00 87.55  ? 496 VAL B CG2 1 
ATOM   5671 N  N   . TYR B 1 305 ? 4.508   14.823 90.901  1.00 90.04  ? 497 TYR B N   1 
ATOM   5672 C  CA  . TYR B 1 305 ? 3.825   15.122 89.640  1.00 89.48  ? 497 TYR B CA  1 
ATOM   5673 C  C   . TYR B 1 305 ? 2.404   14.583 89.603  1.00 89.38  ? 497 TYR B C   1 
ATOM   5674 O  O   . TYR B 1 305 ? 2.178   13.371 89.643  1.00 87.58  ? 497 TYR B O   1 
ATOM   5675 C  CB  . TYR B 1 305 ? 4.599   14.594 88.435  1.00 91.52  ? 497 TYR B CB  1 
ATOM   5676 C  CG  . TYR B 1 305 ? 3.915   14.882 87.115  1.00 91.26  ? 497 TYR B CG  1 
ATOM   5677 C  CD1 . TYR B 1 305 ? 3.951   16.160 86.556  1.00 88.70  ? 497 TYR B CD1 1 
ATOM   5678 C  CD2 . TYR B 1 305 ? 3.232   13.879 86.426  1.00 90.85  ? 497 TYR B CD2 1 
ATOM   5679 C  CE1 . TYR B 1 305 ? 3.330   16.437 85.351  1.00 88.29  ? 497 TYR B CE1 1 
ATOM   5680 C  CE2 . TYR B 1 305 ? 2.603   14.142 85.214  1.00 91.62  ? 497 TYR B CE2 1 
ATOM   5681 C  CZ  . TYR B 1 305 ? 2.660   15.429 84.681  1.00 92.35  ? 497 TYR B CZ  1 
ATOM   5682 O  OH  . TYR B 1 305 ? 2.044   15.707 83.477  1.00 93.98  ? 497 TYR B OH  1 
ATOM   5683 N  N   . ARG B 1 306 ? 1.452   15.501 89.511  1.00 92.78  ? 498 ARG B N   1 
ATOM   5684 C  CA  . ARG B 1 306 ? 0.042   15.138 89.447  1.00 96.16  ? 498 ARG B CA  1 
ATOM   5685 C  C   . ARG B 1 306 ? -0.646  15.860 88.289  1.00 96.12  ? 498 ARG B C   1 
ATOM   5686 O  O   . ARG B 1 306 ? -1.842  16.157 88.335  1.00 98.44  ? 498 ARG B O   1 
ATOM   5687 C  CB  . ARG B 1 306 ? -0.639  15.416 90.790  1.00 97.17  ? 498 ARG B CB  1 
ATOM   5688 C  CG  . ARG B 1 306 ? -0.446  14.310 91.814  1.00 96.09  ? 498 ARG B CG  1 
ATOM   5689 C  CD  . ARG B 1 306 ? -1.730  13.529 92.018  1.00 98.47  ? 498 ARG B CD  1 
ATOM   5690 N  NE  . ARG B 1 306 ? -1.496  12.101 92.247  1.00 101.67 ? 498 ARG B NE  1 
ATOM   5691 C  CZ  . ARG B 1 306 ? -1.027  11.581 93.379  1.00 102.69 ? 498 ARG B CZ  1 
ATOM   5692 N  NH1 . ARG B 1 306 ? -0.722  12.373 94.399  1.00 103.34 ? 498 ARG B NH1 1 
ATOM   5693 N  NH2 . ARG B 1 306 ? -0.857  10.269 93.488  1.00 103.12 ? 498 ARG B NH2 1 
ATOM   5694 N  N   . GLY B 1 307 ? 0.130   16.124 87.242  1.00 94.12  ? 499 GLY B N   1 
ATOM   5695 C  CA  . GLY B 1 307 ? -0.376  16.761 86.043  1.00 93.27  ? 499 GLY B CA  1 
ATOM   5696 C  C   . GLY B 1 307 ? -1.119  15.811 85.129  1.00 93.60  ? 499 GLY B C   1 
ATOM   5697 O  O   . GLY B 1 307 ? -1.349  14.648 85.461  1.00 95.05  ? 499 GLY B O   1 
ATOM   5698 N  N   . CYS B 1 308 ? -1.483  16.325 83.961  1.00 93.41  ? 500 CYS B N   1 
ATOM   5699 C  CA  . CYS B 1 308 ? -2.282  15.600 82.996  1.00 90.10  ? 500 CYS B CA  1 
ATOM   5700 C  C   . CYS B 1 308 ? -1.456  15.228 81.764  1.00 87.74  ? 500 CYS B C   1 
ATOM   5701 O  O   . CYS B 1 308 ? -1.762  14.248 81.082  1.00 87.36  ? 500 CYS B O   1 
ATOM   5702 C  CB  . CYS B 1 308 ? -3.487  16.461 82.605  1.00 93.13  ? 500 CYS B CB  1 
ATOM   5703 S  SG  . CYS B 1 308 ? -4.590  15.802 81.321  1.00 97.25  ? 500 CYS B SG  1 
ATOM   5704 N  N   . GLN B 1 309 ? -0.409  16.003 81.484  1.00 86.04  ? 501 GLN B N   1 
ATOM   5705 C  CA  . GLN B 1 309 ? 0.319   15.854 80.227  1.00 85.32  ? 501 GLN B CA  1 
ATOM   5706 C  C   . GLN B 1 309 ? 1.080   14.528 80.143  1.00 84.85  ? 501 GLN B C   1 
ATOM   5707 O  O   . GLN B 1 309 ? 1.006   13.845 79.126  1.00 82.44  ? 501 GLN B O   1 
ATOM   5708 C  CB  . GLN B 1 309 ? 1.237   17.054 79.952  1.00 83.94  ? 501 GLN B CB  1 
ATOM   5709 C  CG  . GLN B 1 309 ? 1.720   17.152 78.492  1.00 84.93  ? 501 GLN B CG  1 
ATOM   5710 C  CD  . GLN B 1 309 ? 3.046   16.428 78.236  1.00 87.70  ? 501 GLN B CD  1 
ATOM   5711 O  OE1 . GLN B 1 309 ? 4.009   16.587 78.984  1.00 90.44  ? 501 GLN B OE1 1 
ATOM   5712 N  NE2 . GLN B 1 309 ? 3.101   15.649 77.165  1.00 88.30  ? 501 GLN B NE2 1 
ATOM   5713 N  N   . SER B 1 310 ? 1.810   14.177 81.199  1.00 84.42  ? 502 SER B N   1 
ATOM   5714 C  CA  . SER B 1 310 ? 2.471   12.880 81.261  1.00 85.93  ? 502 SER B CA  1 
ATOM   5715 C  C   . SER B 1 310 ? 1.594   11.874 81.996  1.00 88.28  ? 502 SER B C   1 
ATOM   5716 O  O   . SER B 1 310 ? 0.984   12.191 83.019  1.00 94.77  ? 502 SER B O   1 
ATOM   5717 C  CB  . SER B 1 310 ? 3.841   12.981 81.941  1.00 84.48  ? 502 SER B CB  1 
ATOM   5718 O  OG  . SER B 1 310 ? 4.543   11.741 81.887  1.00 80.57  ? 502 SER B OG  1 
ATOM   5719 N  N   . GLU B 1 311 ? 1.520   10.661 81.471  1.00 86.20  ? 503 GLU B N   1 
ATOM   5720 C  CA  . GLU B 1 311 ? 0.874   9.603  82.215  1.00 88.75  ? 503 GLU B CA  1 
ATOM   5721 C  C   . GLU B 1 311 ? 1.901   8.817  83.021  1.00 88.28  ? 503 GLU B C   1 
ATOM   5722 O  O   . GLU B 1 311 ? 1.682   8.530  84.200  1.00 89.08  ? 503 GLU B O   1 
ATOM   5723 C  CB  . GLU B 1 311 ? 0.059   8.698  81.293  1.00 92.14  ? 503 GLU B CB  1 
ATOM   5724 C  CG  . GLU B 1 311 ? -1.203  9.382  80.793  1.00 94.67  ? 503 GLU B CG  1 
ATOM   5725 C  CD  . GLU B 1 311 ? -2.171  8.442  80.118  1.00 93.99  ? 503 GLU B CD  1 
ATOM   5726 O  OE1 . GLU B 1 311 ? -1.742  7.681  79.225  1.00 94.23  ? 503 GLU B OE1 1 
ATOM   5727 O  OE2 . GLU B 1 311 ? -3.370  8.487  80.475  1.00 93.96  ? 503 GLU B OE2 1 
ATOM   5728 N  N   . ARG B 1 312 ? 3.032   8.505  82.390  1.00 86.09  ? 504 ARG B N   1 
ATOM   5729 C  CA  . ARG B 1 312 ? 4.080   7.702  83.019  1.00 84.39  ? 504 ARG B CA  1 
ATOM   5730 C  C   . ARG B 1 312 ? 4.694   8.336  84.256  1.00 86.44  ? 504 ARG B C   1 
ATOM   5731 O  O   . ARG B 1 312 ? 5.234   7.636  85.111  1.00 90.13  ? 504 ARG B O   1 
ATOM   5732 C  CB  . ARG B 1 312 ? 5.180   7.365  82.019  1.00 82.72  ? 504 ARG B CB  1 
ATOM   5733 C  CG  . ARG B 1 312 ? 5.743   8.537  81.257  1.00 80.86  ? 504 ARG B CG  1 
ATOM   5734 C  CD  . ARG B 1 312 ? 6.318   8.043  79.952  1.00 81.40  ? 504 ARG B CD  1 
ATOM   5735 N  NE  . ARG B 1 312 ? 7.178   9.034  79.329  1.00 82.92  ? 504 ARG B NE  1 
ATOM   5736 C  CZ  . ARG B 1 312 ? 8.484   9.124  79.536  1.00 85.68  ? 504 ARG B CZ  1 
ATOM   5737 N  NH1 . ARG B 1 312 ? 9.095   8.274  80.347  1.00 85.74  ? 504 ARG B NH1 1 
ATOM   5738 N  NH2 . ARG B 1 312 ? 9.181   10.069 78.922  1.00 89.52  ? 504 ARG B NH2 1 
ATOM   5739 N  N   . LEU B 1 313 ? 4.612   9.657  84.349  1.00 85.72  ? 505 LEU B N   1 
ATOM   5740 C  CA  . LEU B 1 313 ? 5.209   10.372 85.464  1.00 86.36  ? 505 LEU B CA  1 
ATOM   5741 C  C   . LEU B 1 313 ? 4.208   10.553 86.598  1.00 89.02  ? 505 LEU B C   1 
ATOM   5742 O  O   . LEU B 1 313 ? 4.594   10.821 87.736  1.00 92.83  ? 505 LEU B O   1 
ATOM   5743 C  CB  . LEU B 1 313 ? 5.706   11.743 85.007  1.00 83.91  ? 505 LEU B CB  1 
ATOM   5744 C  CG  . LEU B 1 313 ? 7.086   12.261 85.416  1.00 81.53  ? 505 LEU B CG  1 
ATOM   5745 C  CD1 . LEU B 1 313 ? 6.975   13.758 85.681  1.00 81.18  ? 505 LEU B CD1 1 
ATOM   5746 C  CD2 . LEU B 1 313 ? 7.685   11.547 86.613  1.00 78.67  ? 505 LEU B CD2 1 
ATOM   5747 N  N   . TYR B 1 314 ? 2.923   10.416 86.282  1.00 88.19  ? 506 TYR B N   1 
ATOM   5748 C  CA  . TYR B 1 314 ? 1.858   10.722 87.233  1.00 84.98  ? 506 TYR B CA  1 
ATOM   5749 C  C   . TYR B 1 314 ? 2.012   9.910  88.503  1.00 83.96  ? 506 TYR B C   1 
ATOM   5750 O  O   . TYR B 1 314 ? 2.248   8.710  88.447  1.00 85.03  ? 506 TYR B O   1 
ATOM   5751 C  CB  . TYR B 1 314 ? 0.486   10.478 86.604  1.00 82.92  ? 506 TYR B CB  1 
ATOM   5752 C  CG  . TYR B 1 314 ? -0.654  10.789 87.531  1.00 81.21  ? 506 TYR B CG  1 
ATOM   5753 C  CD1 . TYR B 1 314 ? -1.101  12.097 87.702  1.00 83.54  ? 506 TYR B CD1 1 
ATOM   5754 C  CD2 . TYR B 1 314 ? -1.279  9.780  88.250  1.00 76.35  ? 506 TYR B CD2 1 
ATOM   5755 C  CE1 . TYR B 1 314 ? -2.154  12.383 88.565  1.00 84.99  ? 506 TYR B CE1 1 
ATOM   5756 C  CE2 . TYR B 1 314 ? -2.321  10.053 89.112  1.00 76.16  ? 506 TYR B CE2 1 
ATOM   5757 C  CZ  . TYR B 1 314 ? -2.759  11.343 89.265  1.00 81.98  ? 506 TYR B CZ  1 
ATOM   5758 O  OH  . TYR B 1 314 ? -3.794  11.600 90.127  1.00 83.35  ? 506 TYR B OH  1 
ATOM   5759 N  N   . GLY B 1 315 ? 1.899   10.577 89.644  1.00 84.14  ? 507 GLY B N   1 
ATOM   5760 C  CA  . GLY B 1 315 ? 2.012   9.914  90.938  1.00 84.77  ? 507 GLY B CA  1 
ATOM   5761 C  C   . GLY B 1 315 ? 3.434   9.766  91.451  1.00 87.00  ? 507 GLY B C   1 
ATOM   5762 O  O   . GLY B 1 315 ? 3.638   9.475  92.632  1.00 87.99  ? 507 GLY B O   1 
ATOM   5763 N  N   . SER B 1 316 ? 4.416   9.967  90.573  1.00 87.86  ? 508 SER B N   1 
ATOM   5764 C  CA  . SER B 1 316 ? 5.826   9.854  90.945  1.00 88.88  ? 508 SER B CA  1 
ATOM   5765 C  C   . SER B 1 316 ? 6.316   11.029 91.775  1.00 93.34  ? 508 SER B C   1 
ATOM   5766 O  O   . SER B 1 316 ? 5.889   12.176 91.581  1.00 94.42  ? 508 SER B O   1 
ATOM   5767 C  CB  . SER B 1 316 ? 6.709   9.742  89.706  1.00 86.28  ? 508 SER B CB  1 
ATOM   5768 O  OG  . SER B 1 316 ? 6.325   8.647  88.902  1.00 88.64  ? 508 SER B OG  1 
ATOM   5769 N  N   . TYR B 1 317 ? 7.220   10.729 92.702  1.00 95.16  ? 509 TYR B N   1 
ATOM   5770 C  CA  . TYR B 1 317 ? 8.012   11.758 93.355  1.00 97.30  ? 509 TYR B CA  1 
ATOM   5771 C  C   . TYR B 1 317 ? 9.192   12.070 92.451  1.00 94.76  ? 509 TYR B C   1 
ATOM   5772 O  O   . TYR B 1 317 ? 9.815   11.162 91.914  1.00 95.61  ? 509 TYR B O   1 
ATOM   5773 C  CB  . TYR B 1 317 ? 8.521   11.264 94.704  1.00 100.83 ? 509 TYR B CB  1 
ATOM   5774 C  CG  . TYR B 1 317 ? 7.482   11.217 95.799  1.00 102.85 ? 509 TYR B CG  1 
ATOM   5775 C  CD1 . TYR B 1 317 ? 6.423   10.311 95.751  1.00 103.53 ? 509 TYR B CD1 1 
ATOM   5776 C  CD2 . TYR B 1 317 ? 7.573   12.064 96.904  1.00 104.89 ? 509 TYR B CD2 1 
ATOM   5777 C  CE1 . TYR B 1 317 ? 5.475   10.255 96.768  1.00 104.95 ? 509 TYR B CE1 1 
ATOM   5778 C  CE2 . TYR B 1 317 ? 6.628   12.018 97.928  1.00 105.56 ? 509 TYR B CE2 1 
ATOM   5779 C  CZ  . TYR B 1 317 ? 5.585   11.109 97.854  1.00 104.87 ? 509 TYR B CZ  1 
ATOM   5780 O  OH  . TYR B 1 317 ? 4.651   11.053 98.865  1.00 104.53 ? 509 TYR B OH  1 
ATOM   5781 N  N   . VAL B 1 318 ? 9.487   13.348 92.261  1.00 93.85  ? 510 VAL B N   1 
ATOM   5782 C  CA  . VAL B 1 318 ? 10.678  13.736 91.506  1.00 94.81  ? 510 VAL B CA  1 
ATOM   5783 C  C   . VAL B 1 318 ? 11.546  14.641 92.369  1.00 95.87  ? 510 VAL B C   1 
ATOM   5784 O  O   . VAL B 1 318 ? 11.055  15.613 92.946  1.00 94.78  ? 510 VAL B O   1 
ATOM   5785 C  CB  . VAL B 1 318 ? 10.339  14.466 90.175  1.00 93.05  ? 510 VAL B CB  1 
ATOM   5786 C  CG1 . VAL B 1 318 ? 11.542  14.488 89.268  1.00 92.06  ? 510 VAL B CG1 1 
ATOM   5787 C  CG2 . VAL B 1 318 ? 9.182   13.793 89.452  1.00 94.37  ? 510 VAL B CG2 1 
ATOM   5788 N  N   . PHE B 1 319 ? 12.829  14.303 92.472  1.00 95.99  ? 511 PHE B N   1 
ATOM   5789 C  CA  . PHE B 1 319 ? 13.800  15.167 93.145  1.00 96.34  ? 511 PHE B CA  1 
ATOM   5790 C  C   . PHE B 1 319 ? 14.970  15.450 92.217  1.00 96.43  ? 511 PHE B C   1 
ATOM   5791 O  O   . PHE B 1 319 ? 15.418  14.561 91.491  1.00 98.61  ? 511 PHE B O   1 
ATOM   5792 C  CB  . PHE B 1 319 ? 14.291  14.537 94.449  1.00 95.44  ? 511 PHE B CB  1 
ATOM   5793 C  CG  . PHE B 1 319 ? 13.267  14.539 95.547  1.00 95.51  ? 511 PHE B CG  1 
ATOM   5794 C  CD1 . PHE B 1 319 ? 12.280  13.553 95.603  1.00 95.19  ? 511 PHE B CD1 1 
ATOM   5795 C  CD2 . PHE B 1 319 ? 13.291  15.522 96.530  1.00 96.02  ? 511 PHE B CD2 1 
ATOM   5796 C  CE1 . PHE B 1 319 ? 11.326  13.553 96.617  1.00 95.09  ? 511 PHE B CE1 1 
ATOM   5797 C  CE2 . PHE B 1 319 ? 12.341  15.538 97.550  1.00 96.28  ? 511 PHE B CE2 1 
ATOM   5798 C  CZ  . PHE B 1 319 ? 11.356  14.549 97.592  1.00 96.79  ? 511 PHE B CZ  1 
ATOM   5799 N  N   . GLY B 1 320 ? 15.450  16.691 92.231  1.00 93.37  ? 512 GLY B N   1 
ATOM   5800 C  CA  . GLY B 1 320 ? 16.554  17.093 91.368  1.00 90.49  ? 512 GLY B CA  1 
ATOM   5801 C  C   . GLY B 1 320 ? 17.610  17.885 92.102  1.00 89.49  ? 512 GLY B C   1 
ATOM   5802 O  O   . GLY B 1 320 ? 17.317  18.534 93.108  1.00 90.78  ? 512 GLY B O   1 
ATOM   5803 N  N   . ASP B 1 321 ? 18.840  17.837 91.601  1.00 88.56  ? 513 ASP B N   1 
ATOM   5804 C  CA  . ASP B 1 321 ? 19.917  18.615 92.194  1.00 92.14  ? 513 ASP B CA  1 
ATOM   5805 C  C   . ASP B 1 321 ? 20.185  19.909 91.431  1.00 95.77  ? 513 ASP B C   1 
ATOM   5806 O  O   . ASP B 1 321 ? 19.709  20.104 90.314  1.00 95.73  ? 513 ASP B O   1 
ATOM   5807 C  CB  . ASP B 1 321 ? 21.195  17.778 92.354  1.00 94.40  ? 513 ASP B CB  1 
ATOM   5808 C  CG  . ASP B 1 321 ? 21.937  17.550 91.043  1.00 96.60  ? 513 ASP B CG  1 
ATOM   5809 O  OD1 . ASP B 1 321 ? 23.069  17.021 91.089  1.00 94.91  ? 513 ASP B OD1 1 
ATOM   5810 O  OD2 . ASP B 1 321 ? 21.407  17.891 89.967  1.00 101.04 ? 513 ASP B OD2 1 
ATOM   5811 N  N   . ARG B 1 322 ? 20.955  20.784 92.066  1.00 100.39 ? 514 ARG B N   1 
ATOM   5812 C  CA  . ARG B 1 322 ? 21.344  22.086 91.532  1.00 102.82 ? 514 ARG B CA  1 
ATOM   5813 C  C   . ARG B 1 322 ? 21.627  22.085 90.028  1.00 103.10 ? 514 ARG B C   1 
ATOM   5814 O  O   . ARG B 1 322 ? 21.232  23.007 89.318  1.00 105.19 ? 514 ARG B O   1 
ATOM   5815 C  CB  . ARG B 1 322 ? 22.573  22.573 92.304  1.00 106.19 ? 514 ARG B CB  1 
ATOM   5816 C  CG  . ARG B 1 322 ? 22.961  23.999 92.058  1.00 109.94 ? 514 ARG B CG  1 
ATOM   5817 C  CD  . ARG B 1 322 ? 23.738  24.561 93.234  1.00 116.24 ? 514 ARG B CD  1 
ATOM   5818 N  NE  . ARG B 1 322 ? 23.340  25.949 93.459  1.00 121.96 ? 514 ARG B NE  1 
ATOM   5819 C  CZ  . ARG B 1 322 ? 24.011  27.009 93.021  1.00 122.98 ? 514 ARG B CZ  1 
ATOM   5820 N  NH1 . ARG B 1 322 ? 25.151  26.852 92.347  1.00 122.03 ? 514 ARG B NH1 1 
ATOM   5821 N  NH2 . ARG B 1 322 ? 23.538  28.229 93.269  1.00 122.84 ? 514 ARG B NH2 1 
ATOM   5822 N  N   . ASN B 1 323 ? 22.295  21.040 89.551  1.00 102.40 ? 515 ASN B N   1 
ATOM   5823 C  CA  . ASN B 1 323 ? 22.778  20.990 88.175  1.00 101.61 ? 515 ASN B CA  1 
ATOM   5824 C  C   . ASN B 1 323 ? 21.884  20.207 87.205  1.00 102.86 ? 515 ASN B C   1 
ATOM   5825 O  O   . ASN B 1 323 ? 22.274  19.965 86.058  1.00 105.01 ? 515 ASN B O   1 
ATOM   5826 C  CB  . ASN B 1 323 ? 24.211  20.454 88.149  1.00 100.01 ? 515 ASN B CB  1 
ATOM   5827 C  CG  . ASN B 1 323 ? 24.910  20.703 86.831  1.00 99.38  ? 515 ASN B CG  1 
ATOM   5828 O  OD1 . ASN B 1 323 ? 25.525  19.800 86.273  1.00 99.28  ? 515 ASN B OD1 1 
ATOM   5829 N  ND2 . ASN B 1 323 ? 24.822  21.930 86.327  1.00 100.47 ? 515 ASN B ND2 1 
ATOM   5830 N  N   . GLY B 1 324 ? 20.695  19.812 87.668  1.00 100.91 ? 516 GLY B N   1 
ATOM   5831 C  CA  . GLY B 1 324 ? 19.676  19.203 86.807  1.00 98.14  ? 516 GLY B CA  1 
ATOM   5832 C  C   . GLY B 1 324 ? 19.636  17.684 86.725  1.00 99.10  ? 516 GLY B C   1 
ATOM   5833 O  O   . GLY B 1 324 ? 18.998  17.132 85.829  1.00 101.07 ? 516 GLY B O   1 
ATOM   5834 N  N   . ASN B 1 325 ? 20.320  17.003 87.640  1.00 97.29  ? 517 ASN B N   1 
ATOM   5835 C  CA  . ASN B 1 325 ? 20.250  15.549 87.722  1.00 97.13  ? 517 ASN B CA  1 
ATOM   5836 C  C   . ASN B 1 325 ? 18.979  15.135 88.441  1.00 95.90  ? 517 ASN B C   1 
ATOM   5837 O  O   . ASN B 1 325 ? 18.820  15.438 89.620  1.00 96.35  ? 517 ASN B O   1 
ATOM   5838 C  CB  . ASN B 1 325 ? 21.456  15.000 88.480  1.00 100.16 ? 517 ASN B CB  1 
ATOM   5839 C  CG  . ASN B 1 325 ? 22.771  15.425 87.869  1.00 104.74 ? 517 ASN B CG  1 
ATOM   5840 O  OD1 . ASN B 1 325 ? 23.078  15.085 86.727  1.00 107.72 ? 517 ASN B OD1 1 
ATOM   5841 N  ND2 . ASN B 1 325 ? 23.566  16.161 88.635  1.00 105.80 ? 517 ASN B ND2 1 
ATOM   5842 N  N   . PHE B 1 326 ? 18.077  14.443 87.747  1.00 94.95  ? 518 PHE B N   1 
ATOM   5843 C  CA  . PHE B 1 326 ? 16.793  14.067 88.351  1.00 95.01  ? 518 PHE B CA  1 
ATOM   5844 C  C   . PHE B 1 326 ? 16.679  12.613 88.831  1.00 97.55  ? 518 PHE B C   1 
ATOM   5845 O  O   . PHE B 1 326 ? 17.358  11.721 88.317  1.00 99.88  ? 518 PHE B O   1 
ATOM   5846 C  CB  . PHE B 1 326 ? 15.633  14.448 87.434  1.00 91.77  ? 518 PHE B CB  1 
ATOM   5847 C  CG  . PHE B 1 326 ? 15.435  15.931 87.311  1.00 92.96  ? 518 PHE B CG  1 
ATOM   5848 C  CD1 . PHE B 1 326 ? 15.957  16.630 86.225  1.00 93.29  ? 518 PHE B CD1 1 
ATOM   5849 C  CD2 . PHE B 1 326 ? 14.743  16.639 88.287  1.00 92.14  ? 518 PHE B CD2 1 
ATOM   5850 C  CE1 . PHE B 1 326 ? 15.786  18.012 86.105  1.00 89.51  ? 518 PHE B CE1 1 
ATOM   5851 C  CE2 . PHE B 1 326 ? 14.563  18.023 88.173  1.00 91.28  ? 518 PHE B CE2 1 
ATOM   5852 C  CZ  . PHE B 1 326 ? 15.088  18.706 87.081  1.00 90.36  ? 518 PHE B CZ  1 
ATOM   5853 N  N   . LEU B 1 327 ? 15.831  12.405 89.841  1.00 97.89  ? 519 LEU B N   1 
ATOM   5854 C  CA  . LEU B 1 327 ? 15.517  11.085 90.398  1.00 95.98  ? 519 LEU B CA  1 
ATOM   5855 C  C   . LEU B 1 327 ? 14.010  10.900 90.420  1.00 98.60  ? 519 LEU B C   1 
ATOM   5856 O  O   . LEU B 1 327 ? 13.255  11.880 90.423  1.00 100.77 ? 519 LEU B O   1 
ATOM   5857 C  CB  . LEU B 1 327 ? 16.012  10.969 91.837  1.00 93.40  ? 519 LEU B CB  1 
ATOM   5858 C  CG  . LEU B 1 327 ? 17.406  11.476 92.176  1.00 96.43  ? 519 LEU B CG  1 
ATOM   5859 C  CD1 . LEU B 1 327 ? 17.432  11.920 93.614  1.00 97.13  ? 519 LEU B CD1 1 
ATOM   5860 C  CD2 . LEU B 1 327 ? 18.469  10.409 91.909  1.00 100.32 ? 519 LEU B CD2 1 
ATOM   5861 N  N   . THR B 1 328 ? 13.574  9.646  90.460  1.00 98.18  ? 520 THR B N   1 
ATOM   5862 C  CA  . THR B 1 328 ? 12.165  9.339  90.645  1.00 100.43 ? 520 THR B CA  1 
ATOM   5863 C  C   . THR B 1 328 ? 12.011  8.283  91.723  1.00 104.15 ? 520 THR B C   1 
ATOM   5864 O  O   . THR B 1 328 ? 12.365  7.121  91.515  1.00 109.03 ? 520 THR B O   1 
ATOM   5865 C  CB  . THR B 1 328 ? 11.496  8.890  89.324  1.00 100.97 ? 520 THR B CB  1 
ATOM   5866 O  OG1 . THR B 1 328 ? 11.345  10.023 88.467  1.00 103.03 ? 520 THR B OG1 1 
ATOM   5867 C  CG2 . THR B 1 328 ? 10.119  8.298  89.568  1.00 100.64 ? 520 THR B CG2 1 
ATOM   5868 N  N   . LEU B 1 329 ? 11.502  8.695  92.881  1.00 105.95 ? 521 LEU B N   1 
ATOM   5869 C  CA  . LEU B 1 329 ? 11.147  7.756  93.941  1.00 107.89 ? 521 LEU B CA  1 
ATOM   5870 C  C   . LEU B 1 329 ? 9.811   7.102  93.616  1.00 111.85 ? 521 LEU B C   1 
ATOM   5871 O  O   . LEU B 1 329 ? 8.750   7.632  93.941  1.00 110.05 ? 521 LEU B O   1 
ATOM   5872 C  CB  . LEU B 1 329 ? 11.105  8.442  95.312  1.00 105.51 ? 521 LEU B CB  1 
ATOM   5873 C  CG  . LEU B 1 329 ? 12.433  8.846  95.965  1.00 104.73 ? 521 LEU B CG  1 
ATOM   5874 C  CD1 . LEU B 1 329 ? 12.186  9.579  97.267  1.00 104.29 ? 521 LEU B CD1 1 
ATOM   5875 C  CD2 . LEU B 1 329 ? 13.330  7.640  96.211  1.00 106.30 ? 521 LEU B CD2 1 
ATOM   5876 N  N   . GLN B 1 330 ? 9.876   5.958  92.944  1.00 119.90 ? 522 GLN B N   1 
ATOM   5877 C  CA  . GLN B 1 330 ? 8.677   5.207  92.607  1.00 128.00 ? 522 GLN B CA  1 
ATOM   5878 C  C   . GLN B 1 330 ? 8.321   4.249  93.737  1.00 133.13 ? 522 GLN B C   1 
ATOM   5879 O  O   . GLN B 1 330 ? 9.102   3.362  94.100  1.00 133.75 ? 522 GLN B O   1 
ATOM   5880 C  CB  . GLN B 1 330 ? 8.838   4.455  91.279  1.00 129.59 ? 522 GLN B CB  1 
ATOM   5881 C  CG  . GLN B 1 330 ? 7.520   3.947  90.691  1.00 129.51 ? 522 GLN B CG  1 
ATOM   5882 C  CD  . GLN B 1 330 ? 6.499   5.057  90.509  1.00 128.58 ? 522 GLN B CD  1 
ATOM   5883 O  OE1 . GLN B 1 330 ? 6.751   6.038  89.808  1.00 127.57 ? 522 GLN B OE1 1 
ATOM   5884 N  NE2 . GLN B 1 330 ? 5.342   4.910  91.146  1.00 127.72 ? 522 GLN B NE2 1 
ATOM   5885 N  N   . GLN B 1 331 ? 7.131   4.453  94.291  1.00 137.82 ? 523 GLN B N   1 
ATOM   5886 C  CA  . GLN B 1 331 ? 6.619   3.640  95.382  1.00 141.02 ? 523 GLN B CA  1 
ATOM   5887 C  C   . GLN B 1 331 ? 6.077   2.319  94.834  1.00 141.34 ? 523 GLN B C   1 
ATOM   5888 O  O   . GLN B 1 331 ? 4.928   2.247  94.388  1.00 140.77 ? 523 GLN B O   1 
ATOM   5889 C  CB  . GLN B 1 331 ? 5.529   4.418  96.123  1.00 141.94 ? 523 GLN B CB  1 
ATOM   5890 C  CG  . GLN B 1 331 ? 5.058   3.783  97.411  1.00 142.57 ? 523 GLN B CG  1 
ATOM   5891 C  CD  . GLN B 1 331 ? 4.093   4.658  98.185  1.00 142.83 ? 523 GLN B CD  1 
ATOM   5892 O  OE1 . GLN B 1 331 ? 4.217   5.883  98.200  1.00 144.66 ? 523 GLN B OE1 1 
ATOM   5893 N  NE2 . GLN B 1 331 ? 3.122   4.030  98.837  1.00 142.69 ? 523 GLN B NE2 1 
ATOM   5894 N  N   . SER B 1 332 ? 6.915   1.285  94.853  1.00 142.25 ? 524 SER B N   1 
ATOM   5895 C  CA  . SER B 1 332 ? 6.519   -0.032 94.362  1.00 144.37 ? 524 SER B CA  1 
ATOM   5896 C  C   . SER B 1 332 ? 5.394   -0.598 95.232  1.00 145.62 ? 524 SER B C   1 
ATOM   5897 O  O   . SER B 1 332 ? 5.582   -0.799 96.432  1.00 144.90 ? 524 SER B O   1 
ATOM   5898 C  CB  . SER B 1 332 ? 7.717   -0.988 94.320  1.00 145.05 ? 524 SER B CB  1 
ATOM   5899 O  OG  . SER B 1 332 ? 7.375   -2.220 93.703  1.00 144.70 ? 524 SER B OG  1 
ATOM   5900 N  N   . PRO B 1 333 ? 4.211   -0.833 94.630  1.00 147.07 ? 525 PRO B N   1 
ATOM   5901 C  CA  . PRO B 1 333 ? 3.042   -1.289 95.388  1.00 148.36 ? 525 PRO B CA  1 
ATOM   5902 C  C   . PRO B 1 333 ? 3.109   -2.765 95.795  1.00 150.30 ? 525 PRO B C   1 
ATOM   5903 O  O   . PRO B 1 333 ? 2.625   -3.129 96.871  1.00 150.43 ? 525 PRO B O   1 
ATOM   5904 C  CB  . PRO B 1 333 ? 1.878   -1.040 94.422  1.00 147.63 ? 525 PRO B CB  1 
ATOM   5905 C  CG  . PRO B 1 333 ? 2.482   -1.112 93.065  1.00 146.87 ? 525 PRO B CG  1 
ATOM   5906 C  CD  . PRO B 1 333 ? 3.915   -0.676 93.191  1.00 146.92 ? 525 PRO B CD  1 
ATOM   5907 N  N   . VAL B 1 334 ? 3.704   -3.597 94.942  1.00 151.79 ? 526 VAL B N   1 
ATOM   5908 C  CA  . VAL B 1 334 ? 3.856   -5.028 95.216  1.00 153.24 ? 526 VAL B CA  1 
ATOM   5909 C  C   . VAL B 1 334 ? 4.921   -5.318 96.278  1.00 153.10 ? 526 VAL B C   1 
ATOM   5910 O  O   . VAL B 1 334 ? 4.845   -6.329 96.982  1.00 153.51 ? 526 VAL B O   1 
ATOM   5911 C  CB  . VAL B 1 334 ? 4.158   -5.850 93.926  1.00 154.28 ? 526 VAL B CB  1 
ATOM   5912 C  CG1 . VAL B 1 334 ? 2.877   -6.117 93.145  1.00 154.80 ? 526 VAL B CG1 1 
ATOM   5913 C  CG2 . VAL B 1 334 ? 5.200   -5.150 93.047  1.00 154.92 ? 526 VAL B CG2 1 
ATOM   5914 N  N   . THR B 1 335 ? 5.910   -4.429 96.382  1.00 152.29 ? 527 THR B N   1 
ATOM   5915 C  CA  . THR B 1 335 ? 7.020   -4.595 97.321  1.00 151.30 ? 527 THR B CA  1 
ATOM   5916 C  C   . THR B 1 335 ? 7.295   -3.296 98.061  1.00 151.44 ? 527 THR B C   1 
ATOM   5917 O  O   . THR B 1 335 ? 7.570   -2.268 97.438  1.00 151.95 ? 527 THR B O   1 
ATOM   5918 C  CB  . THR B 1 335 ? 8.316   -5.049 96.609  1.00 150.72 ? 527 THR B CB  1 
ATOM   5919 O  OG1 . THR B 1 335 ? 8.853   -3.968 95.836  1.00 149.80 ? 527 THR B OG1 1 
ATOM   5920 C  CG2 . THR B 1 335 ? 8.039   -6.226 95.696  1.00 150.97 ? 527 THR B CG2 1 
ATOM   5921 N  N   . LYS B 1 336 ? 7.224   -3.348 99.388  1.00 151.55 ? 528 LYS B N   1 
ATOM   5922 C  CA  . LYS B 1 336 ? 7.451   -2.171 100.220 1.00 152.34 ? 528 LYS B CA  1 
ATOM   5923 C  C   . LYS B 1 336 ? 8.902   -1.706 100.084 1.00 152.36 ? 528 LYS B C   1 
ATOM   5924 O  O   . LYS B 1 336 ? 9.805   -2.291 100.689 1.00 153.22 ? 528 LYS B O   1 
ATOM   5925 C  CB  . LYS B 1 336 ? 7.111   -2.480 101.681 1.00 152.70 ? 528 LYS B CB  1 
ATOM   5926 C  CG  . LYS B 1 336 ? 6.407   -1.348 102.420 1.00 153.32 ? 528 LYS B CG  1 
ATOM   5927 C  CD  . LYS B 1 336 ? 4.908   -1.350 102.139 1.00 153.52 ? 528 LYS B CD  1 
ATOM   5928 C  CE  . LYS B 1 336 ? 4.180   -0.295 102.956 1.00 153.64 ? 528 LYS B CE  1 
ATOM   5929 N  NZ  . LYS B 1 336 ? 2.759   -0.133 102.539 1.00 153.67 ? 528 LYS B NZ  1 
ATOM   5930 N  N   . GLN B 1 337 ? 9.116   -0.672 99.268  1.00 150.79 ? 529 GLN B N   1 
ATOM   5931 C  CA  . GLN B 1 337 ? 10.459  -0.163 98.974  1.00 150.03 ? 529 GLN B CA  1 
ATOM   5932 C  C   . GLN B 1 337 ? 10.423  1.215  98.323  1.00 149.05 ? 529 GLN B C   1 
ATOM   5933 O  O   . GLN B 1 337 ? 9.707   1.426  97.338  1.00 149.64 ? 529 GLN B O   1 
ATOM   5934 C  CB  . GLN B 1 337 ? 11.210  -1.125 98.045  1.00 151.44 ? 529 GLN B CB  1 
ATOM   5935 C  CG  . GLN B 1 337 ? 12.728  -1.073 98.176  1.00 151.87 ? 529 GLN B CG  1 
ATOM   5936 C  CD  . GLN B 1 337 ? 13.265  -2.085 99.171  1.00 151.82 ? 529 GLN B CD  1 
ATOM   5937 O  OE1 . GLN B 1 337 ? 13.067  -3.291 99.016  1.00 151.41 ? 529 GLN B OE1 1 
ATOM   5938 N  NE2 . GLN B 1 337 ? 13.958  -1.599 100.194 1.00 152.07 ? 529 GLN B NE2 1 
ATOM   5939 N  N   . TRP B 1 338 ? 11.198  2.145  98.880  1.00 147.18 ? 530 TRP B N   1 
ATOM   5940 C  CA  . TRP B 1 338 ? 11.435  3.442  98.248  1.00 144.43 ? 530 TRP B CA  1 
ATOM   5941 C  C   . TRP B 1 338 ? 12.559  3.293  97.220  1.00 141.51 ? 530 TRP B C   1 
ATOM   5942 O  O   . TRP B 1 338 ? 13.710  3.666  97.480  1.00 141.62 ? 530 TRP B O   1 
ATOM   5943 C  CB  . TRP B 1 338 ? 11.797  4.521  99.282  1.00 145.00 ? 530 TRP B CB  1 
ATOM   5944 C  CG  . TRP B 1 338 ? 10.627  5.220  99.957  1.00 145.80 ? 530 TRP B CG  1 
ATOM   5945 C  CD1 . TRP B 1 338 ? 10.442  5.381  101.302 1.00 146.04 ? 530 TRP B CD1 1 
ATOM   5946 C  CD2 . TRP B 1 338 ? 9.507   5.862  99.322  1.00 145.70 ? 530 TRP B CD2 1 
ATOM   5947 N  NE1 . TRP B 1 338 ? 9.282   6.078  101.545 1.00 145.85 ? 530 TRP B NE1 1 
ATOM   5948 C  CE2 . TRP B 1 338 ? 8.686   6.382  100.350 1.00 145.07 ? 530 TRP B CE2 1 
ATOM   5949 C  CE3 . TRP B 1 338 ? 9.112   6.040  97.988  1.00 145.78 ? 530 TRP B CE3 1 
ATOM   5950 C  CZ2 . TRP B 1 338 ? 7.496   7.065  100.087 1.00 144.56 ? 530 TRP B CZ2 1 
ATOM   5951 C  CZ3 . TRP B 1 338 ? 7.928   6.723  97.728  1.00 145.40 ? 530 TRP B CZ3 1 
ATOM   5952 C  CH2 . TRP B 1 338 ? 7.136   7.226  98.774  1.00 145.27 ? 530 TRP B CH2 1 
ATOM   5953 N  N   . GLN B 1 339 ? 12.220  2.730  96.061  1.00 137.03 ? 531 GLN B N   1 
ATOM   5954 C  CA  . GLN B 1 339 ? 13.193  2.492  94.994  1.00 131.70 ? 531 GLN B CA  1 
ATOM   5955 C  C   . GLN B 1 339 ? 13.339  3.683  94.047  1.00 126.52 ? 531 GLN B C   1 
ATOM   5956 O  O   . GLN B 1 339 ? 12.412  4.031  93.311  1.00 126.05 ? 531 GLN B O   1 
ATOM   5957 C  CB  . GLN B 1 339 ? 12.850  1.217  94.214  1.00 132.27 ? 531 GLN B CB  1 
ATOM   5958 C  CG  . GLN B 1 339 ? 13.513  -0.048 94.758  1.00 133.39 ? 531 GLN B CG  1 
ATOM   5959 C  CD  . GLN B 1 339 ? 15.021  -0.082 94.532  1.00 134.24 ? 531 GLN B CD  1 
ATOM   5960 O  OE1 . GLN B 1 339 ? 15.524  0.409  93.519  1.00 135.33 ? 531 GLN B OE1 1 
ATOM   5961 N  NE2 . GLN B 1 339 ? 15.746  -0.670 95.479  1.00 133.80 ? 531 GLN B NE2 1 
ATOM   5962 N  N   . GLU B 1 340 ? 14.514  4.303  94.079  1.00 120.61 ? 532 GLU B N   1 
ATOM   5963 C  CA  . GLU B 1 340 ? 14.816  5.408  93.181  1.00 116.35 ? 532 GLU B CA  1 
ATOM   5964 C  C   . GLU B 1 340 ? 15.211  4.910  91.789  1.00 113.27 ? 532 GLU B C   1 
ATOM   5965 O  O   . GLU B 1 340 ? 15.975  3.949  91.653  1.00 114.89 ? 532 GLU B O   1 
ATOM   5966 C  CB  . GLU B 1 340 ? 15.900  6.328  93.770  1.00 116.34 ? 532 GLU B CB  1 
ATOM   5967 C  CG  . GLU B 1 340 ? 17.228  5.652  94.134  1.00 117.29 ? 532 GLU B CG  1 
ATOM   5968 C  CD  . GLU B 1 340 ? 18.400  6.628  94.207  1.00 116.82 ? 532 GLU B CD  1 
ATOM   5969 O  OE1 . GLU B 1 340 ? 19.430  6.280  94.826  1.00 116.70 ? 532 GLU B OE1 1 
ATOM   5970 O  OE2 . GLU B 1 340 ? 18.297  7.740  93.646  1.00 116.42 ? 532 GLU B OE2 1 
ATOM   5971 N  N   . LYS B 1 341 ? 14.655  5.555  90.765  1.00 108.42 ? 533 LYS B N   1 
ATOM   5972 C  CA  . LYS B 1 341 ? 15.063  5.346  89.375  1.00 104.38 ? 533 LYS B CA  1 
ATOM   5973 C  C   . LYS B 1 341 ? 15.401  6.702  88.771  1.00 101.15 ? 533 LYS B C   1 
ATOM   5974 O  O   . LYS B 1 341 ? 14.651  7.667  88.962  1.00 102.85 ? 533 LYS B O   1 
ATOM   5975 C  CB  . LYS B 1 341 ? 13.958  4.671  88.549  1.00 105.57 ? 533 LYS B CB  1 
ATOM   5976 C  CG  . LYS B 1 341 ? 13.388  3.408  89.172  1.00 108.54 ? 533 LYS B CG  1 
ATOM   5977 C  CD  . LYS B 1 341 ? 12.939  2.407  88.125  1.00 110.09 ? 533 LYS B CD  1 
ATOM   5978 C  CE  . LYS B 1 341 ? 13.016  0.993  88.696  1.00 111.69 ? 533 LYS B CE  1 
ATOM   5979 N  NZ  . LYS B 1 341 ? 12.913  -0.054 87.642  1.00 112.24 ? 533 LYS B NZ  1 
ATOM   5980 N  N   . PRO B 1 342 ? 16.525  6.790  88.037  1.00 96.15  ? 534 PRO B N   1 
ATOM   5981 C  CA  . PRO B 1 342 ? 16.898  8.068  87.423  1.00 92.96  ? 534 PRO B CA  1 
ATOM   5982 C  C   . PRO B 1 342 ? 15.868  8.557  86.402  1.00 88.55  ? 534 PRO B C   1 
ATOM   5983 O  O   . PRO B 1 342 ? 15.098  7.771  85.864  1.00 86.54  ? 534 PRO B O   1 
ATOM   5984 C  CB  . PRO B 1 342 ? 18.229  7.753  86.731  1.00 93.90  ? 534 PRO B CB  1 
ATOM   5985 C  CG  . PRO B 1 342 ? 18.230  6.274  86.551  1.00 94.07  ? 534 PRO B CG  1 
ATOM   5986 C  CD  . PRO B 1 342 ? 17.499  5.729  87.733  1.00 94.58  ? 534 PRO B CD  1 
ATOM   5987 N  N   . LEU B 1 343 ? 15.851  9.857  86.161  1.00 88.78  ? 535 LEU B N   1 
ATOM   5988 C  CA  . LEU B 1 343 ? 14.976  10.445 85.162  1.00 89.34  ? 535 LEU B CA  1 
ATOM   5989 C  C   . LEU B 1 343 ? 15.876  11.237 84.240  1.00 89.66  ? 535 LEU B C   1 
ATOM   5990 O  O   . LEU B 1 343 ? 16.524  12.187 84.671  1.00 93.15  ? 535 LEU B O   1 
ATOM   5991 C  CB  . LEU B 1 343 ? 13.936  11.352 85.828  1.00 88.44  ? 535 LEU B CB  1 
ATOM   5992 C  CG  . LEU B 1 343 ? 12.810  11.974 84.998  1.00 89.61  ? 535 LEU B CG  1 
ATOM   5993 C  CD1 . LEU B 1 343 ? 11.685  12.454 85.912  1.00 90.67  ? 535 LEU B CD1 1 
ATOM   5994 C  CD2 . LEU B 1 343 ? 13.313  13.123 84.133  1.00 90.35  ? 535 LEU B CD2 1 
ATOM   5995 N  N   . CYS B 1 344 ? 15.933  10.836 82.978  1.00 90.27  ? 536 CYS B N   1 
ATOM   5996 C  CA  . CYS B 1 344 ? 16.876  11.442 82.050  1.00 93.60  ? 536 CYS B CA  1 
ATOM   5997 C  C   . CYS B 1 344 ? 16.233  12.547 81.228  1.00 92.43  ? 536 CYS B C   1 
ATOM   5998 O  O   . CYS B 1 344 ? 15.041  12.507 80.937  1.00 93.27  ? 536 CYS B O   1 
ATOM   5999 C  CB  . CYS B 1 344 ? 17.505  10.387 81.136  1.00 96.51  ? 536 CYS B CB  1 
ATOM   6000 S  SG  . CYS B 1 344 ? 16.324  9.539  80.059  1.00 101.18 ? 536 CYS B SG  1 
ATOM   6001 N  N   . LEU B 1 345 ? 17.035  13.544 80.875  1.00 91.02  ? 537 LEU B N   1 
ATOM   6002 C  CA  . LEU B 1 345 ? 16.611  14.573 79.940  1.00 87.20  ? 537 LEU B CA  1 
ATOM   6003 C  C   . LEU B 1 345 ? 17.157  14.255 78.555  1.00 86.53  ? 537 LEU B C   1 
ATOM   6004 O  O   . LEU B 1 345 ? 18.315  13.840 78.407  1.00 85.22  ? 537 LEU B O   1 
ATOM   6005 C  CB  . LEU B 1 345 ? 17.074  15.946 80.411  1.00 83.57  ? 537 LEU B CB  1 
ATOM   6006 C  CG  . LEU B 1 345 ? 16.145  16.737 81.336  1.00 83.80  ? 537 LEU B CG  1 
ATOM   6007 C  CD1 . LEU B 1 345 ? 15.014  15.901 81.953  1.00 82.19  ? 537 LEU B CD1 1 
ATOM   6008 C  CD2 . LEU B 1 345 ? 16.958  17.468 82.406  1.00 82.56  ? 537 LEU B CD2 1 
ATOM   6009 N  N   . GLY B 1 346 ? 16.307  14.431 77.551  1.00 83.59  ? 538 GLY B N   1 
ATOM   6010 C  CA  . GLY B 1 346 ? 16.666  14.147 76.173  1.00 84.02  ? 538 GLY B CA  1 
ATOM   6011 C  C   . GLY B 1 346 ? 16.009  15.150 75.259  1.00 86.51  ? 538 GLY B C   1 
ATOM   6012 O  O   . GLY B 1 346 ? 14.864  15.541 75.477  1.00 92.69  ? 538 GLY B O   1 
ATOM   6013 N  N   . THR B 1 347 ? 16.736  15.569 74.233  1.00 86.12  ? 539 THR B N   1 
ATOM   6014 C  CA  . THR B 1 347 ? 16.260  16.603 73.319  1.00 86.66  ? 539 THR B CA  1 
ATOM   6015 C  C   . THR B 1 347 ? 15.451  16.003 72.164  1.00 83.63  ? 539 THR B C   1 
ATOM   6016 O  O   . THR B 1 347 ? 15.935  15.151 71.424  1.00 85.48  ? 539 THR B O   1 
ATOM   6017 C  CB  . THR B 1 347 ? 17.441  17.446 72.786  1.00 88.20  ? 539 THR B CB  1 
ATOM   6018 O  OG1 . THR B 1 347 ? 16.995  18.301 71.728  1.00 88.39  ? 539 THR B OG1 1 
ATOM   6019 C  CG2 . THR B 1 347 ? 18.521  16.532 72.261  1.00 91.25  ? 539 THR B CG2 1 
ATOM   6020 N  N   . SER B 1 348 ? 14.206  16.437 72.033  1.00 81.85  ? 540 SER B N   1 
ATOM   6021 C  CA  . SER B 1 348 ? 13.358  16.014 70.926  1.00 80.27  ? 540 SER B CA  1 
ATOM   6022 C  C   . SER B 1 348 ? 12.625  17.217 70.398  1.00 78.59  ? 540 SER B C   1 
ATOM   6023 O  O   . SER B 1 348 ? 11.874  17.865 71.132  1.00 77.25  ? 540 SER B O   1 
ATOM   6024 C  CB  . SER B 1 348 ? 12.379  14.911 71.341  1.00 81.51  ? 540 SER B CB  1 
ATOM   6025 O  OG  . SER B 1 348 ? 12.170  14.892 72.741  1.00 84.60  ? 540 SER B OG  1 
ATOM   6026 N  N   . GLY B 1 349 ? 12.864  17.515 69.125  1.00 79.78  ? 541 GLY B N   1 
ATOM   6027 C  CA  . GLY B 1 349 ? 12.395  18.749 68.518  1.00 86.37  ? 541 GLY B CA  1 
ATOM   6028 C  C   . GLY B 1 349 ? 13.219  19.916 69.029  1.00 92.70  ? 541 GLY B C   1 
ATOM   6029 O  O   . GLY B 1 349 ? 14.446  19.844 69.079  1.00 96.56  ? 541 GLY B O   1 
ATOM   6030 N  N   . SER B 1 350 ? 12.537  20.990 69.410  1.00 94.51  ? 542 SER B N   1 
ATOM   6031 C  CA  . SER B 1 350 ? 13.183  22.159 69.979  1.00 95.69  ? 542 SER B CA  1 
ATOM   6032 C  C   . SER B 1 350 ? 12.969  22.128 71.486  1.00 97.60  ? 542 SER B C   1 
ATOM   6033 O  O   . SER B 1 350 ? 13.199  23.122 72.195  1.00 103.17 ? 542 SER B O   1 
ATOM   6034 C  CB  . SER B 1 350 ? 12.578  23.430 69.389  1.00 96.81  ? 542 SER B CB  1 
ATOM   6035 O  OG  . SER B 1 350 ? 11.256  23.608 69.868  1.00 100.34 ? 542 SER B OG  1 
ATOM   6036 N  N   . CYS B 1 351 ? 12.487  20.986 71.964  1.00 93.04  ? 543 CYS B N   1 
ATOM   6037 C  CA  . CYS B 1 351 ? 12.321  20.749 73.382  1.00 89.53  ? 543 CYS B CA  1 
ATOM   6038 C  C   . CYS B 1 351 ? 13.552  19.937 73.777  1.00 90.90  ? 543 CYS B C   1 
ATOM   6039 O  O   . CYS B 1 351 ? 13.792  18.837 73.263  1.00 92.52  ? 543 CYS B O   1 
ATOM   6040 C  CB  . CYS B 1 351 ? 11.005  20.022 73.638  1.00 88.91  ? 543 CYS B CB  1 
ATOM   6041 S  SG  . CYS B 1 351 ? 10.663  19.569 75.342  1.00 94.90  ? 543 CYS B SG  1 
ATOM   6042 N  N   . ARG B 1 352 ? 14.356  20.504 74.667  1.00 87.21  ? 544 ARG B N   1 
ATOM   6043 C  CA  . ARG B 1 352 ? 15.757  20.117 74.736  1.00 85.58  ? 544 ARG B CA  1 
ATOM   6044 C  C   . ARG B 1 352 ? 16.107  19.354 76.001  1.00 88.89  ? 544 ARG B C   1 
ATOM   6045 O  O   . ARG B 1 352 ? 15.373  19.416 76.981  1.00 94.12  ? 544 ARG B O   1 
ATOM   6046 C  CB  . ARG B 1 352 ? 16.646  21.347 74.516  1.00 78.02  ? 544 ARG B CB  1 
ATOM   6047 C  CG  . ARG B 1 352 ? 16.125  22.218 73.387  1.00 72.54  ? 544 ARG B CG  1 
ATOM   6048 C  CD  . ARG B 1 352 ? 17.205  22.779 72.558  1.00 76.52  ? 544 ARG B CD  1 
ATOM   6049 N  NE  . ARG B 1 352 ? 17.310  22.147 71.242  1.00 81.44  ? 544 ARG B NE  1 
ATOM   6050 C  CZ  . ARG B 1 352 ? 16.899  22.700 70.102  1.00 83.82  ? 544 ARG B CZ  1 
ATOM   6051 N  NH1 . ARG B 1 352 ? 16.338  23.902 70.095  1.00 91.07  ? 544 ARG B NH1 1 
ATOM   6052 N  NH2 . ARG B 1 352 ? 17.064  22.061 68.958  1.00 82.60  ? 544 ARG B NH2 1 
ATOM   6053 N  N   . GLY B 1 353 ? 17.212  18.609 75.956  1.00 87.91  ? 545 GLY B N   1 
ATOM   6054 C  CA  . GLY B 1 353 ? 17.640  17.777 77.075  1.00 88.59  ? 545 GLY B CA  1 
ATOM   6055 C  C   . GLY B 1 353 ? 18.557  18.502 78.040  1.00 90.38  ? 545 GLY B C   1 
ATOM   6056 O  O   . GLY B 1 353 ? 19.406  17.884 78.686  1.00 92.05  ? 545 GLY B O   1 
ATOM   6057 N  N   . TYR B 1 354 ? 18.385  19.818 78.128  1.00 88.61  ? 546 TYR B N   1 
ATOM   6058 C  CA  . TYR B 1 354 ? 19.162  20.665 79.029  1.00 85.28  ? 546 TYR B CA  1 
ATOM   6059 C  C   . TYR B 1 354 ? 18.416  21.972 79.267  1.00 84.35  ? 546 TYR B C   1 
ATOM   6060 O  O   . TYR B 1 354 ? 17.425  22.270 78.594  1.00 86.08  ? 546 TYR B O   1 
ATOM   6061 C  CB  . TYR B 1 354 ? 20.551  20.960 78.452  1.00 80.22  ? 546 TYR B CB  1 
ATOM   6062 C  CG  . TYR B 1 354 ? 20.505  21.537 77.058  1.00 80.73  ? 546 TYR B CG  1 
ATOM   6063 C  CD1 . TYR B 1 354 ? 20.741  20.734 75.942  1.00 81.82  ? 546 TYR B CD1 1 
ATOM   6064 C  CD2 . TYR B 1 354 ? 20.222  22.883 76.848  1.00 80.69  ? 546 TYR B CD2 1 
ATOM   6065 C  CE1 . TYR B 1 354 ? 20.697  21.256 74.652  1.00 80.23  ? 546 TYR B CE1 1 
ATOM   6066 C  CE2 . TYR B 1 354 ? 20.168  23.411 75.560  1.00 80.31  ? 546 TYR B CE2 1 
ATOM   6067 C  CZ  . TYR B 1 354 ? 20.400  22.592 74.476  1.00 79.65  ? 546 TYR B CZ  1 
ATOM   6068 O  OH  . TYR B 1 354 ? 20.345  23.125 73.220  1.00 80.99  ? 546 TYR B OH  1 
ATOM   6069 N  N   . PHE B 1 355 ? 18.905  22.740 80.233  1.00 81.77  ? 547 PHE B N   1 
ATOM   6070 C  CA  . PHE B 1 355 ? 18.399  24.067 80.539  1.00 80.74  ? 547 PHE B CA  1 
ATOM   6071 C  C   . PHE B 1 355 ? 19.608  24.866 81.031  1.00 79.01  ? 547 PHE B C   1 
ATOM   6072 O  O   . PHE B 1 355 ? 20.614  24.278 81.442  1.00 74.52  ? 547 PHE B O   1 
ATOM   6073 C  CB  . PHE B 1 355 ? 17.311  23.980 81.610  1.00 81.31  ? 547 PHE B CB  1 
ATOM   6074 C  CG  . PHE B 1 355 ? 17.784  23.364 82.892  1.00 82.34  ? 547 PHE B CG  1 
ATOM   6075 C  CD1 . PHE B 1 355 ? 17.881  21.990 83.021  1.00 80.77  ? 547 PHE B CD1 1 
ATOM   6076 C  CD2 . PHE B 1 355 ? 18.169  24.170 83.964  1.00 85.50  ? 547 PHE B CD2 1 
ATOM   6077 C  CE1 . PHE B 1 355 ? 18.339  21.420 84.200  1.00 86.91  ? 547 PHE B CE1 1 
ATOM   6078 C  CE2 . PHE B 1 355 ? 18.634  23.616 85.147  1.00 84.75  ? 547 PHE B CE2 1 
ATOM   6079 C  CZ  . PHE B 1 355 ? 18.717  22.234 85.268  1.00 86.00  ? 547 PHE B CZ  1 
ATOM   6080 N  N   . SER B 1 356 ? 19.533  26.191 80.997  1.00 78.46  ? 548 SER B N   1 
ATOM   6081 C  CA  . SER B 1 356 ? 20.676  26.971 81.447  1.00 84.28  ? 548 SER B CA  1 
ATOM   6082 C  C   . SER B 1 356 ? 20.620  27.276 82.959  1.00 86.64  ? 548 SER B C   1 
ATOM   6083 O  O   . SER B 1 356 ? 19.543  27.277 83.565  1.00 84.50  ? 548 SER B O   1 
ATOM   6084 C  CB  . SER B 1 356 ? 20.835  28.233 80.607  1.00 84.86  ? 548 SER B CB  1 
ATOM   6085 O  OG  . SER B 1 356 ? 19.694  29.044 80.753  1.00 91.26  ? 548 SER B OG  1 
ATOM   6086 N  N   . GLY B 1 357 ? 21.795  27.488 83.558  1.00 86.77  ? 549 GLY B N   1 
ATOM   6087 C  CA  . GLY B 1 357 ? 21.906  27.843 84.975  1.00 87.58  ? 549 GLY B CA  1 
ATOM   6088 C  C   . GLY B 1 357 ? 21.786  26.698 85.972  1.00 89.10  ? 549 GLY B C   1 
ATOM   6089 O  O   . GLY B 1 357 ? 21.875  25.522 85.602  1.00 88.46  ? 549 GLY B O   1 
ATOM   6090 N  N   . HIS B 1 358 ? 21.590  27.067 87.242  1.00 86.99  ? 550 HIS B N   1 
ATOM   6091 C  CA  . HIS B 1 358 ? 21.390  26.136 88.349  1.00 82.83  ? 550 HIS B CA  1 
ATOM   6092 C  C   . HIS B 1 358 ? 19.936  26.197 88.822  1.00 85.07  ? 550 HIS B C   1 
ATOM   6093 O  O   . HIS B 1 358 ? 19.349  27.278 88.867  1.00 86.98  ? 550 HIS B O   1 
ATOM   6094 C  CB  . HIS B 1 358 ? 22.285  26.524 89.518  1.00 81.82  ? 550 HIS B CB  1 
ATOM   6095 C  CG  . HIS B 1 358 ? 23.736  26.617 89.173  1.00 87.22  ? 550 HIS B CG  1 
ATOM   6096 N  ND1 . HIS B 1 358 ? 24.494  25.517 88.828  1.00 90.99  ? 550 HIS B ND1 1 
ATOM   6097 C  CD2 . HIS B 1 358 ? 24.578  27.677 89.144  1.00 88.03  ? 550 HIS B CD2 1 
ATOM   6098 C  CE1 . HIS B 1 358 ? 25.738  25.897 88.593  1.00 90.04  ? 550 HIS B CE1 1 
ATOM   6099 N  NE2 . HIS B 1 358 ? 25.816  27.204 88.779  1.00 88.18  ? 550 HIS B NE2 1 
ATOM   6100 N  N   . ILE B 1 359 ? 19.364  25.050 89.196  1.00 83.74  ? 551 ILE B N   1 
ATOM   6101 C  CA  . ILE B 1 359 ? 17.983  24.996 89.697  1.00 85.06  ? 551 ILE B CA  1 
ATOM   6102 C  C   . ILE B 1 359 ? 17.836  25.653 91.076  1.00 85.97  ? 551 ILE B C   1 
ATOM   6103 O  O   . ILE B 1 359 ? 18.482  25.232 92.045  1.00 85.36  ? 551 ILE B O   1 
ATOM   6104 C  CB  . ILE B 1 359 ? 17.449  23.542 89.778  1.00 84.88  ? 551 ILE B CB  1 
ATOM   6105 C  CG1 . ILE B 1 359 ? 17.415  22.905 88.387  1.00 84.64  ? 551 ILE B CG1 1 
ATOM   6106 C  CG2 . ILE B 1 359 ? 16.056  23.513 90.432  1.00 81.24  ? 551 ILE B CG2 1 
ATOM   6107 C  CD1 . ILE B 1 359 ? 17.181  21.404 88.388  1.00 84.71  ? 551 ILE B CD1 1 
ATOM   6108 N  N   . LEU B 1 360 ? 16.989  26.679 91.165  1.00 83.92  ? 552 LEU B N   1 
ATOM   6109 C  CA  . LEU B 1 360 ? 16.749  27.324 92.452  1.00 81.55  ? 552 LEU B CA  1 
ATOM   6110 C  C   . LEU B 1 360 ? 15.413  26.925 93.056  1.00 86.09  ? 552 LEU B C   1 
ATOM   6111 O  O   . LEU B 1 360 ? 15.257  26.967 94.275  1.00 89.47  ? 552 LEU B O   1 
ATOM   6112 C  CB  . LEU B 1 360 ? 16.848  28.839 92.364  1.00 77.61  ? 552 LEU B CB  1 
ATOM   6113 C  CG  . LEU B 1 360 ? 18.016  29.527 91.673  1.00 82.39  ? 552 LEU B CG  1 
ATOM   6114 C  CD1 . LEU B 1 360 ? 17.978  31.020 92.002  1.00 87.03  ? 552 LEU B CD1 1 
ATOM   6115 C  CD2 . LEU B 1 360 ? 19.356  28.936 92.051  1.00 82.02  ? 552 LEU B CD2 1 
ATOM   6116 N  N   . GLY B 1 361 ? 14.456  26.534 92.213  1.00 86.96  ? 553 GLY B N   1 
ATOM   6117 C  CA  . GLY B 1 361 ? 13.158  26.058 92.700  1.00 84.87  ? 553 GLY B CA  1 
ATOM   6118 C  C   . GLY B 1 361 ? 12.288  25.388 91.657  1.00 85.21  ? 553 GLY B C   1 
ATOM   6119 O  O   . GLY B 1 361 ? 12.670  25.270 90.492  1.00 87.97  ? 553 GLY B O   1 
ATOM   6120 N  N   . PHE B 1 362 ? 11.101  24.969 92.081  1.00 84.39  ? 554 PHE B N   1 
ATOM   6121 C  CA  . PHE B 1 362 ? 10.167  24.265 91.218  1.00 84.15  ? 554 PHE B CA  1 
ATOM   6122 C  C   . PHE B 1 362 ? 8.828   24.980 91.173  1.00 88.37  ? 554 PHE B C   1 
ATOM   6123 O  O   . PHE B 1 362 ? 8.491   25.732 92.086  1.00 92.43  ? 554 PHE B O   1 
ATOM   6124 C  CB  . PHE B 1 362 ? 9.974   22.843 91.730  1.00 85.48  ? 554 PHE B CB  1 
ATOM   6125 C  CG  . PHE B 1 362 ? 11.254  22.055 91.838  1.00 87.50  ? 554 PHE B CG  1 
ATOM   6126 C  CD1 . PHE B 1 362 ? 11.837  21.826 93.072  1.00 86.91  ? 554 PHE B CD1 1 
ATOM   6127 C  CD2 . PHE B 1 362 ? 11.873  21.541 90.698  1.00 88.16  ? 554 PHE B CD2 1 
ATOM   6128 C  CE1 . PHE B 1 362 ? 13.015  21.098 93.176  1.00 85.88  ? 554 PHE B CE1 1 
ATOM   6129 C  CE2 . PHE B 1 362 ? 13.043  20.818 90.790  1.00 85.96  ? 554 PHE B CE2 1 
ATOM   6130 C  CZ  . PHE B 1 362 ? 13.616  20.596 92.036  1.00 86.83  ? 554 PHE B CZ  1 
ATOM   6131 N  N   . GLY B 1 363 ? 8.062   24.751 90.111  1.00 90.87  ? 555 GLY B N   1 
ATOM   6132 C  CA  . GLY B 1 363 ? 6.762   25.399 89.959  1.00 92.75  ? 555 GLY B CA  1 
ATOM   6133 C  C   . GLY B 1 363 ? 5.663   24.401 89.673  1.00 96.17  ? 555 GLY B C   1 
ATOM   6134 O  O   . GLY B 1 363 ? 5.948   23.252 89.359  1.00 101.05 ? 555 GLY B O   1 
ATOM   6135 N  N   . GLU B 1 364 ? 4.409   24.837 89.783  1.00 95.16  ? 556 GLU B N   1 
ATOM   6136 C  CA  . GLU B 1 364 ? 3.271   24.001 89.418  1.00 96.23  ? 556 GLU B CA  1 
ATOM   6137 C  C   . GLU B 1 364 ? 2.060   24.793 88.883  1.00 97.22  ? 556 GLU B C   1 
ATOM   6138 O  O   . GLU B 1 364 ? 1.642   25.798 89.461  1.00 97.51  ? 556 GLU B O   1 
ATOM   6139 C  CB  . GLU B 1 364 ? 2.876   23.112 90.590  1.00 95.90  ? 556 GLU B CB  1 
ATOM   6140 C  CG  . GLU B 1 364 ? 1.749   22.136 90.291  1.00 101.15 ? 556 GLU B CG  1 
ATOM   6141 C  CD  . GLU B 1 364 ? 1.196   21.467 91.549  1.00 103.47 ? 556 GLU B CD  1 
ATOM   6142 O  OE1 . GLU B 1 364 ? 0.008   21.063 91.535  1.00 107.07 ? 556 GLU B OE1 1 
ATOM   6143 O  OE2 . GLU B 1 364 ? 1.942   21.351 92.550  1.00 105.04 ? 556 GLU B OE2 1 
ATOM   6144 N  N   . ASP B 1 365 ? 1.531   24.314 87.759  1.00 99.07  ? 557 ASP B N   1 
ATOM   6145 C  CA  . ASP B 1 365 ? 0.304   24.787 87.120  1.00 98.38  ? 557 ASP B CA  1 
ATOM   6146 C  C   . ASP B 1 365 ? -0.956  24.488 87.917  1.00 102.35 ? 557 ASP B C   1 
ATOM   6147 O  O   . ASP B 1 365 ? -1.000  23.545 88.732  1.00 103.05 ? 557 ASP B O   1 
ATOM   6148 C  CB  . ASP B 1 365 ? 0.124   24.056 85.783  1.00 98.44  ? 557 ASP B CB  1 
ATOM   6149 C  CG  . ASP B 1 365 ? 0.872   24.701 84.673  1.00 103.57 ? 557 ASP B CG  1 
ATOM   6150 O  OD1 . ASP B 1 365 ? 1.468   25.763 84.931  1.00 111.06 ? 557 ASP B OD1 1 
ATOM   6151 O  OD2 . ASP B 1 365 ? 0.863   24.169 83.544  1.00 103.09 ? 557 ASP B OD2 1 
ATOM   6152 N  N   . GLU B 1 366 ? -2.005  25.256 87.628  1.00 97.79  ? 558 GLU B N   1 
ATOM   6153 C  CA  . GLU B 1 366 ? -3.348  24.865 88.017  1.00 92.51  ? 558 GLU B CA  1 
ATOM   6154 C  C   . GLU B 1 366 ? -3.763  23.546 87.357  1.00 87.05  ? 558 GLU B C   1 
ATOM   6155 O  O   . GLU B 1 366 ? -4.683  22.886 87.812  1.00 90.98  ? 558 GLU B O   1 
ATOM   6156 C  CB  . GLU B 1 366 ? -4.338  25.964 87.665  1.00 95.71  ? 558 GLU B CB  1 
ATOM   6157 C  CG  . GLU B 1 366 ? -5.590  25.937 88.515  1.00 98.58  ? 558 GLU B CG  1 
ATOM   6158 C  CD  . GLU B 1 366 ? -6.336  27.248 88.499  1.00 101.89 ? 558 GLU B CD  1 
ATOM   6159 O  OE1 . GLU B 1 366 ? -7.430  27.294 89.107  1.00 105.81 ? 558 GLU B OE1 1 
ATOM   6160 O  OE2 . GLU B 1 366 ? -5.836  28.224 87.889  1.00 98.78  ? 558 GLU B OE2 1 
ATOM   6161 N  N   . LEU B 1 367 ? -3.082  23.172 86.283  1.00 85.85  ? 559 LEU B N   1 
ATOM   6162 C  CA  . LEU B 1 367 ? -3.315  21.903 85.617  1.00 86.10  ? 559 LEU B CA  1 
ATOM   6163 C  C   . LEU B 1 367 ? -2.339  20.861 86.140  1.00 88.91  ? 559 LEU B C   1 
ATOM   6164 O  O   . LEU B 1 367 ? -2.438  19.677 85.814  1.00 88.86  ? 559 LEU B O   1 
ATOM   6165 C  CB  . LEU B 1 367 ? -3.183  22.052 84.104  1.00 89.33  ? 559 LEU B CB  1 
ATOM   6166 C  CG  . LEU B 1 367 ? -3.962  23.194 83.438  1.00 93.87  ? 559 LEU B CG  1 
ATOM   6167 C  CD1 . LEU B 1 367 ? -3.692  23.200 81.939  1.00 97.82  ? 559 LEU B CD1 1 
ATOM   6168 C  CD2 . LEU B 1 367 ? -5.471  23.118 83.717  1.00 92.73  ? 559 LEU B CD2 1 
ATOM   6169 N  N   . GLY B 1 368 ? -1.396  21.305 86.962  1.00 91.05  ? 560 GLY B N   1 
ATOM   6170 C  CA  . GLY B 1 368 ? -0.532  20.380 87.683  1.00 89.76  ? 560 GLY B CA  1 
ATOM   6171 C  C   . GLY B 1 368 ? 0.736   20.023 86.945  1.00 88.11  ? 560 GLY B C   1 
ATOM   6172 O  O   . GLY B 1 368 ? 1.467   19.129 87.371  1.00 89.84  ? 560 GLY B O   1 
ATOM   6173 N  N   . GLU B 1 369 ? 1.001   20.715 85.841  1.00 85.70  ? 561 GLU B N   1 
ATOM   6174 C  CA  . GLU B 1 369 ? 2.246   20.517 85.123  1.00 86.12  ? 561 GLU B CA  1 
ATOM   6175 C  C   . GLU B 1 369 ? 3.361   21.146 85.948  1.00 90.42  ? 561 GLU B C   1 
ATOM   6176 O  O   . GLU B 1 369 ? 3.098   21.980 86.811  1.00 91.27  ? 561 GLU B O   1 
ATOM   6177 C  CB  . GLU B 1 369 ? 2.179   21.098 83.711  1.00 83.23  ? 561 GLU B CB  1 
ATOM   6178 C  CG  . GLU B 1 369 ? 1.078   20.522 82.832  1.00 83.17  ? 561 GLU B CG  1 
ATOM   6179 C  CD  . GLU B 1 369 ? 1.002   18.992 82.865  1.00 90.05  ? 561 GLU B CD  1 
ATOM   6180 O  OE1 . GLU B 1 369 ? 2.051   18.334 83.038  1.00 93.08  ? 561 GLU B OE1 1 
ATOM   6181 O  OE2 . GLU B 1 369 ? -0.114  18.443 82.699  1.00 91.31  ? 561 GLU B OE2 1 
ATOM   6182 N  N   . VAL B 1 370 ? 4.603   20.733 85.719  1.00 91.91  ? 562 VAL B N   1 
ATOM   6183 C  CA  . VAL B 1 370 ? 5.660   21.143 86.630  1.00 89.81  ? 562 VAL B CA  1 
ATOM   6184 C  C   . VAL B 1 370 ? 6.728   22.017 85.964  1.00 90.34  ? 562 VAL B C   1 
ATOM   6185 O  O   . VAL B 1 370 ? 6.854   22.050 84.735  1.00 92.82  ? 562 VAL B O   1 
ATOM   6186 C  CB  . VAL B 1 370 ? 6.238   19.928 87.370  1.00 90.86  ? 562 VAL B CB  1 
ATOM   6187 C  CG1 . VAL B 1 370 ? 7.184   20.375 88.447  1.00 97.57  ? 562 VAL B CG1 1 
ATOM   6188 C  CG2 . VAL B 1 370 ? 5.122   19.161 88.029  1.00 89.01  ? 562 VAL B CG2 1 
ATOM   6189 N  N   . TYR B 1 371 ? 7.464   22.769 86.776  1.00 88.00  ? 563 TYR B N   1 
ATOM   6190 C  CA  . TYR B 1 371 ? 8.477   23.676 86.252  1.00 88.87  ? 563 TYR B CA  1 
ATOM   6191 C  C   . TYR B 1 371 ? 9.772   23.579 87.029  1.00 89.38  ? 563 TYR B C   1 
ATOM   6192 O  O   . TYR B 1 371 ? 9.777   23.127 88.175  1.00 89.70  ? 563 TYR B O   1 
ATOM   6193 C  CB  . TYR B 1 371 ? 7.976   25.120 86.316  1.00 86.25  ? 563 TYR B CB  1 
ATOM   6194 C  CG  . TYR B 1 371 ? 6.745   25.389 85.482  1.00 86.06  ? 563 TYR B CG  1 
ATOM   6195 C  CD1 . TYR B 1 371 ? 6.858   25.881 84.183  1.00 84.70  ? 563 TYR B CD1 1 
ATOM   6196 C  CD2 . TYR B 1 371 ? 5.463   25.150 85.993  1.00 85.48  ? 563 TYR B CD2 1 
ATOM   6197 C  CE1 . TYR B 1 371 ? 5.734   26.134 83.407  1.00 83.38  ? 563 TYR B CE1 1 
ATOM   6198 C  CE2 . TYR B 1 371 ? 4.342   25.386 85.228  1.00 86.02  ? 563 TYR B CE2 1 
ATOM   6199 C  CZ  . TYR B 1 371 ? 4.481   25.886 83.935  1.00 84.97  ? 563 TYR B CZ  1 
ATOM   6200 O  OH  . TYR B 1 371 ? 3.369   26.127 83.168  1.00 83.03  ? 563 TYR B OH  1 
ATOM   6201 N  N   . ILE B 1 372 ? 10.871  23.990 86.406  1.00 87.65  ? 564 ILE B N   1 
ATOM   6202 C  CA  . ILE B 1 372 ? 12.052  24.332 87.180  1.00 93.15  ? 564 ILE B CA  1 
ATOM   6203 C  C   . ILE B 1 372 ? 12.297  25.815 87.003  1.00 94.94  ? 564 ILE B C   1 
ATOM   6204 O  O   . ILE B 1 372 ? 11.951  26.393 85.964  1.00 98.14  ? 564 ILE B O   1 
ATOM   6205 C  CB  . ILE B 1 372 ? 13.326  23.505 86.818  1.00 93.44  ? 564 ILE B CB  1 
ATOM   6206 C  CG1 . ILE B 1 372 ? 13.694  23.667 85.351  1.00 96.47  ? 564 ILE B CG1 1 
ATOM   6207 C  CG2 . ILE B 1 372 ? 13.148  22.025 87.173  1.00 94.34  ? 564 ILE B CG2 1 
ATOM   6208 C  CD1 . ILE B 1 372 ? 14.841  22.778 84.914  1.00 98.64  ? 564 ILE B CD1 1 
ATOM   6209 N  N   . LEU B 1 373 ? 12.861  26.435 88.035  1.00 93.43  ? 565 LEU B N   1 
ATOM   6210 C  CA  . LEU B 1 373 ? 13.311  27.819 87.949  1.00 91.21  ? 565 LEU B CA  1 
ATOM   6211 C  C   . LEU B 1 373 ? 14.822  27.852 88.159  1.00 90.33  ? 565 LEU B C   1 
ATOM   6212 O  O   . LEU B 1 373 ? 15.348  27.222 89.090  1.00 91.27  ? 565 LEU B O   1 
ATOM   6213 C  CB  . LEU B 1 373 ? 12.554  28.712 88.941  1.00 89.92  ? 565 LEU B CB  1 
ATOM   6214 C  CG  . LEU B 1 373 ? 11.050  28.765 88.616  1.00 91.11  ? 565 LEU B CG  1 
ATOM   6215 C  CD1 . LEU B 1 373 ? 10.235  27.784 89.451  1.00 90.79  ? 565 LEU B CD1 1 
ATOM   6216 C  CD2 . LEU B 1 373 ? 10.491  30.135 88.787  1.00 90.83  ? 565 LEU B CD2 1 
ATOM   6217 N  N   . SER B 1 374 ? 15.517  28.554 87.268  1.00 85.27  ? 566 SER B N   1 
ATOM   6218 C  CA  . SER B 1 374 ? 16.969  28.589 87.308  1.00 86.13  ? 566 SER B CA  1 
ATOM   6219 C  C   . SER B 1 374 ? 17.572  29.987 87.160  1.00 89.48  ? 566 SER B C   1 
ATOM   6220 O  O   . SER B 1 374 ? 16.971  30.890 86.565  1.00 91.68  ? 566 SER B O   1 
ATOM   6221 C  CB  . SER B 1 374 ? 17.546  27.682 86.227  1.00 84.78  ? 566 SER B CB  1 
ATOM   6222 O  OG  . SER B 1 374 ? 17.428  28.288 84.957  1.00 81.76  ? 566 SER B OG  1 
ATOM   6223 N  N   . SER B 1 375 ? 18.774  30.135 87.710  1.00 89.38  ? 567 SER B N   1 
ATOM   6224 C  CA  . SER B 1 375 ? 19.594  31.320 87.543  1.00 88.95  ? 567 SER B CA  1 
ATOM   6225 C  C   . SER B 1 375 ? 21.058  30.917 87.648  1.00 92.89  ? 567 SER B C   1 
ATOM   6226 O  O   . SER B 1 375 ? 21.381  29.800 88.053  1.00 96.44  ? 567 SER B O   1 
ATOM   6227 C  CB  . SER B 1 375 ? 19.254  32.365 88.607  1.00 89.22  ? 567 SER B CB  1 
ATOM   6228 O  OG  . SER B 1 375 ? 19.729  33.652 88.236  1.00 89.07  ? 567 SER B OG  1 
ATOM   6229 N  N   . SER B 1 376 ? 21.941  31.823 87.259  1.00 96.38  ? 568 SER B N   1 
ATOM   6230 C  CA  . SER B 1 376 ? 23.361  31.662 87.501  1.00 101.12 ? 568 SER B CA  1 
ATOM   6231 C  C   . SER B 1 376 ? 23.900  33.002 88.004  1.00 103.43 ? 568 SER B C   1 
ATOM   6232 O  O   . SER B 1 376 ? 23.122  33.886 88.355  1.00 103.30 ? 568 SER B O   1 
ATOM   6233 C  CB  . SER B 1 376 ? 24.075  31.193 86.231  1.00 103.41 ? 568 SER B CB  1 
ATOM   6234 O  OG  . SER B 1 376 ? 23.882  32.108 85.171  1.00 107.17 ? 568 SER B OG  1 
ATOM   6235 N  N   . LYS B 1 377 ? 25.220  33.152 88.066  1.00 106.95 ? 569 LYS B N   1 
ATOM   6236 C  CA  . LYS B 1 377 ? 25.792  34.435 88.448  1.00 107.26 ? 569 LYS B CA  1 
ATOM   6237 C  C   . LYS B 1 377 ? 25.706  35.384 87.256  1.00 109.38 ? 569 LYS B C   1 
ATOM   6238 O  O   . LYS B 1 377 ? 25.346  36.553 87.422  1.00 109.88 ? 569 LYS B O   1 
ATOM   6239 C  CB  . LYS B 1 377 ? 27.213  34.284 88.996  1.00 106.44 ? 569 LYS B CB  1 
ATOM   6240 C  CG  . LYS B 1 377 ? 27.295  33.301 90.162  1.00 107.11 ? 569 LYS B CG  1 
ATOM   6241 C  CD  . LYS B 1 377 ? 28.058  33.864 91.347  1.00 108.54 ? 569 LYS B CD  1 
ATOM   6242 C  CE  . LYS B 1 377 ? 27.728  33.086 92.616  1.00 110.87 ? 569 LYS B CE  1 
ATOM   6243 N  NZ  . LYS B 1 377 ? 27.836  33.915 93.858  1.00 112.50 ? 569 LYS B NZ  1 
ATOM   6244 N  N   . SER B 1 378 ? 25.993  34.865 86.058  1.00 109.94 ? 570 SER B N   1 
ATOM   6245 C  CA  . SER B 1 378 ? 25.726  35.585 84.809  1.00 112.20 ? 570 SER B CA  1 
ATOM   6246 C  C   . SER B 1 378 ? 24.261  35.975 84.706  1.00 113.74 ? 570 SER B C   1 
ATOM   6247 O  O   . SER B 1 378 ? 23.935  37.037 84.189  1.00 115.82 ? 570 SER B O   1 
ATOM   6248 C  CB  . SER B 1 378 ? 26.077  34.732 83.590  1.00 114.93 ? 570 SER B CB  1 
ATOM   6249 O  OG  . SER B 1 378 ? 27.470  34.720 83.332  1.00 122.03 ? 570 SER B OG  1 
ATOM   6250 N  N   . MET B 1 379 ? 23.382  35.105 85.200  1.00 114.29 ? 571 MET B N   1 
ATOM   6251 C  CA  . MET B 1 379 ? 21.937  35.288 85.065  1.00 113.79 ? 571 MET B CA  1 
ATOM   6252 C  C   . MET B 1 379 ? 21.319  36.214 86.118  1.00 114.84 ? 571 MET B C   1 
ATOM   6253 O  O   . MET B 1 379 ? 20.345  36.913 85.833  1.00 116.19 ? 571 MET B O   1 
ATOM   6254 C  CB  . MET B 1 379 ? 21.232  33.931 85.076  1.00 112.67 ? 571 MET B CB  1 
ATOM   6255 C  CG  . MET B 1 379 ? 20.834  33.422 83.703  1.00 113.29 ? 571 MET B CG  1 
ATOM   6256 S  SD  . MET B 1 379 ? 20.451  31.650 83.686  1.00 113.34 ? 571 MET B SD  1 
ATOM   6257 C  CE  . MET B 1 379 ? 22.008  31.026 83.062  1.00 117.16 ? 571 MET B CE  1 
ATOM   6258 N  N   . THR B 1 380 ? 21.870  36.206 87.333  1.00 114.14 ? 572 THR B N   1 
ATOM   6259 C  CA  . THR B 1 380 ? 21.363  37.051 88.420  1.00 111.87 ? 572 THR B CA  1 
ATOM   6260 C  C   . THR B 1 380 ? 21.676  38.507 88.113  1.00 112.16 ? 572 THR B C   1 
ATOM   6261 O  O   . THR B 1 380 ? 20.799  39.367 88.151  1.00 114.55 ? 572 THR B O   1 
ATOM   6262 C  CB  . THR B 1 380 ? 21.959  36.646 89.797  1.00 108.28 ? 572 THR B CB  1 
ATOM   6263 O  OG1 . THR B 1 380 ? 21.525  35.323 90.134  1.00 107.77 ? 572 THR B OG1 1 
ATOM   6264 C  CG2 . THR B 1 380 ? 21.520  37.603 90.900  1.00 104.85 ? 572 THR B CG2 1 
ATOM   6265 N  N   . GLN B 1 381 ? 22.935  38.753 87.775  1.00 112.61 ? 573 GLN B N   1 
ATOM   6266 C  CA  . GLN B 1 381 ? 23.433  40.080 87.464  1.00 112.06 ? 573 GLN B CA  1 
ATOM   6267 C  C   . GLN B 1 381 ? 22.728  40.695 86.253  1.00 108.55 ? 573 GLN B C   1 
ATOM   6268 O  O   . GLN B 1 381 ? 22.521  41.900 86.203  1.00 108.64 ? 573 GLN B O   1 
ATOM   6269 C  CB  . GLN B 1 381 ? 24.936  39.994 87.208  1.00 115.19 ? 573 GLN B CB  1 
ATOM   6270 C  CG  . GLN B 1 381 ? 25.683  41.284 87.433  1.00 117.92 ? 573 GLN B CG  1 
ATOM   6271 C  CD  . GLN B 1 381 ? 26.662  41.579 86.317  1.00 119.35 ? 573 GLN B CD  1 
ATOM   6272 O  OE1 . GLN B 1 381 ? 27.053  40.690 85.551  1.00 118.20 ? 573 GLN B OE1 1 
ATOM   6273 N  NE2 . GLN B 1 381 ? 27.055  42.843 86.207  1.00 121.34 ? 573 GLN B NE2 1 
ATOM   6274 N  N   . THR B 1 382 ? 22.358  39.856 85.291  1.00 108.03 ? 574 THR B N   1 
ATOM   6275 C  CA  . THR B 1 382 ? 21.696  40.295 84.059  1.00 107.71 ? 574 THR B CA  1 
ATOM   6276 C  C   . THR B 1 382 ? 20.183  40.494 84.220  1.00 104.93 ? 574 THR B C   1 
ATOM   6277 O  O   . THR B 1 382 ? 19.549  41.122 83.373  1.00 105.75 ? 574 THR B O   1 
ATOM   6278 C  CB  . THR B 1 382 ? 21.978  39.293 82.898  1.00 109.54 ? 574 THR B CB  1 
ATOM   6279 O  OG1 . THR B 1 382 ? 23.384  39.261 82.642  1.00 115.53 ? 574 THR B OG1 1 
ATOM   6280 C  CG2 . THR B 1 382 ? 21.273  39.696 81.607  1.00 110.94 ? 574 THR B CG2 1 
ATOM   6281 N  N   . HIS B 1 383 ? 19.617  39.992 85.317  1.00 102.93 ? 575 HIS B N   1 
ATOM   6282 C  CA  . HIS B 1 383 ? 18.168  39.835 85.437  1.00 102.84 ? 575 HIS B CA  1 
ATOM   6283 C  C   . HIS B 1 383 ? 17.717  38.981 84.276  1.00 101.06 ? 575 HIS B C   1 
ATOM   6284 O  O   . HIS B 1 383 ? 17.035  39.457 83.379  1.00 104.02 ? 575 HIS B O   1 
ATOM   6285 C  CB  . HIS B 1 383 ? 17.428  41.175 85.397  1.00 106.56 ? 575 HIS B CB  1 
ATOM   6286 C  CG  . HIS B 1 383 ? 17.684  42.043 86.584  1.00 111.34 ? 575 HIS B CG  1 
ATOM   6287 N  ND1 . HIS B 1 383 ? 18.774  42.883 86.671  1.00 114.56 ? 575 HIS B ND1 1 
ATOM   6288 C  CD2 . HIS B 1 383 ? 16.984  42.213 87.729  1.00 112.39 ? 575 HIS B CD2 1 
ATOM   6289 C  CE1 . HIS B 1 383 ? 18.738  43.528 87.823  1.00 115.69 ? 575 HIS B CE1 1 
ATOM   6290 N  NE2 . HIS B 1 383 ? 17.663  43.136 88.485  1.00 115.67 ? 575 HIS B NE2 1 
ATOM   6291 N  N   . ASN B 1 384 ? 18.138  37.726 84.278  1.00 100.98 ? 576 ASN B N   1 
ATOM   6292 C  CA  . ASN B 1 384 ? 17.788  36.805 83.209  1.00 101.13 ? 576 ASN B CA  1 
ATOM   6293 C  C   . ASN B 1 384 ? 17.538  35.402 83.735  1.00 98.24  ? 576 ASN B C   1 
ATOM   6294 O  O   . ASN B 1 384 ? 18.026  34.425 83.179  1.00 98.52  ? 576 ASN B O   1 
ATOM   6295 C  CB  . ASN B 1 384 ? 18.876  36.790 82.139  1.00 103.91 ? 576 ASN B CB  1 
ATOM   6296 C  CG  . ASN B 1 384 ? 18.346  36.407 80.773  1.00 107.04 ? 576 ASN B CG  1 
ATOM   6297 O  OD1 . ASN B 1 384 ? 17.180  36.045 80.617  1.00 109.86 ? 576 ASN B OD1 1 
ATOM   6298 N  ND2 . ASN B 1 384 ? 19.205  36.497 79.769  1.00 109.34 ? 576 ASN B ND2 1 
ATOM   6299 N  N   . GLY B 1 385 ? 16.782  35.320 84.824  1.00 95.32  ? 577 GLY B N   1 
ATOM   6300 C  CA  . GLY B 1 385 ? 16.372  34.046 85.387  1.00 92.71  ? 577 GLY B CA  1 
ATOM   6301 C  C   . GLY B 1 385 ? 15.319  33.480 84.473  1.00 89.17  ? 577 GLY B C   1 
ATOM   6302 O  O   . GLY B 1 385 ? 14.621  34.231 83.799  1.00 87.19  ? 577 GLY B O   1 
ATOM   6303 N  N   . LYS B 1 386 ? 15.214  32.157 84.438  1.00 86.36  ? 578 LYS B N   1 
ATOM   6304 C  CA  . LYS B 1 386 ? 14.364  31.501 83.465  1.00 83.64  ? 578 LYS B CA  1 
ATOM   6305 C  C   . LYS B 1 386 ? 13.363  30.620 84.172  1.00 86.22  ? 578 LYS B C   1 
ATOM   6306 O  O   . LYS B 1 386 ? 13.662  30.060 85.233  1.00 87.49  ? 578 LYS B O   1 
ATOM   6307 C  CB  . LYS B 1 386 ? 15.188  30.632 82.511  1.00 84.81  ? 578 LYS B CB  1 
ATOM   6308 C  CG  . LYS B 1 386 ? 16.626  31.081 82.253  1.00 87.86  ? 578 LYS B CG  1 
ATOM   6309 C  CD  . LYS B 1 386 ? 16.711  32.156 81.195  1.00 89.07  ? 578 LYS B CD  1 
ATOM   6310 C  CE  . LYS B 1 386 ? 16.581  31.581 79.809  1.00 91.67  ? 578 LYS B CE  1 
ATOM   6311 N  NZ  . LYS B 1 386 ? 17.903  31.235 79.244  1.00 96.03  ? 578 LYS B NZ  1 
ATOM   6312 N  N   . LEU B 1 387 ? 12.169  30.519 83.586  1.00 87.55  ? 579 LEU B N   1 
ATOM   6313 C  CA  . LEU B 1 387 ? 11.202  29.491 83.950  1.00 88.12  ? 579 LEU B CA  1 
ATOM   6314 C  C   . LEU B 1 387 ? 11.190  28.431 82.864  1.00 89.62  ? 579 LEU B C   1 
ATOM   6315 O  O   . LEU B 1 387 ? 11.062  28.746 81.673  1.00 89.87  ? 579 LEU B O   1 
ATOM   6316 C  CB  . LEU B 1 387 ? 9.801   30.074 84.096  1.00 87.64  ? 579 LEU B CB  1 
ATOM   6317 C  CG  . LEU B 1 387 ? 8.701   29.045 84.371  1.00 85.26  ? 579 LEU B CG  1 
ATOM   6318 C  CD1 . LEU B 1 387 ? 8.847   28.502 85.769  1.00 87.53  ? 579 LEU B CD1 1 
ATOM   6319 C  CD2 . LEU B 1 387 ? 7.342   29.670 84.209  1.00 84.46  ? 579 LEU B CD2 1 
ATOM   6320 N  N   . TYR B 1 388 ? 11.324  27.177 83.276  1.00 90.74  ? 580 TYR B N   1 
ATOM   6321 C  CA  . TYR B 1 388 ? 11.348  26.056 82.338  1.00 92.00  ? 580 TYR B CA  1 
ATOM   6322 C  C   . TYR B 1 388 ? 10.253  25.037 82.645  1.00 91.14  ? 580 TYR B C   1 
ATOM   6323 O  O   . TYR B 1 388 ? 10.073  24.651 83.807  1.00 95.96  ? 580 TYR B O   1 
ATOM   6324 C  CB  . TYR B 1 388 ? 12.693  25.345 82.417  1.00 88.62  ? 580 TYR B CB  1 
ATOM   6325 C  CG  . TYR B 1 388 ? 13.861  26.041 81.764  1.00 87.10  ? 580 TYR B CG  1 
ATOM   6326 C  CD1 . TYR B 1 388 ? 14.824  26.692 82.534  1.00 89.07  ? 580 TYR B CD1 1 
ATOM   6327 C  CD2 . TYR B 1 388 ? 14.042  25.993 80.380  1.00 85.18  ? 580 TYR B CD2 1 
ATOM   6328 C  CE1 . TYR B 1 388 ? 15.936  27.302 81.940  1.00 90.14  ? 580 TYR B CE1 1 
ATOM   6329 C  CE2 . TYR B 1 388 ? 15.141  26.598 79.777  1.00 87.63  ? 580 TYR B CE2 1 
ATOM   6330 C  CZ  . TYR B 1 388 ? 16.088  27.252 80.561  1.00 89.06  ? 580 TYR B CZ  1 
ATOM   6331 O  OH  . TYR B 1 388 ? 17.168  27.864 79.966  1.00 86.43  ? 580 TYR B OH  1 
ATOM   6332 N  N   . LYS B 1 389 ? 9.539   24.588 81.617  1.00 86.10  ? 581 LYS B N   1 
ATOM   6333 C  CA  . LYS B 1 389 ? 8.539   23.531 81.801  1.00 88.74  ? 581 LYS B CA  1 
ATOM   6334 C  C   . LYS B 1 389 ? 9.085   22.145 81.445  1.00 88.49  ? 581 LYS B C   1 
ATOM   6335 O  O   . LYS B 1 389 ? 9.793   21.992 80.443  1.00 87.65  ? 581 LYS B O   1 
ATOM   6336 C  CB  . LYS B 1 389 ? 7.274   23.816 80.990  1.00 88.47  ? 581 LYS B CB  1 
ATOM   6337 C  CG  . LYS B 1 389 ? 6.212   22.731 81.133  1.00 88.97  ? 581 LYS B CG  1 
ATOM   6338 C  CD  . LYS B 1 389 ? 4.980   23.004 80.295  1.00 91.68  ? 581 LYS B CD  1 
ATOM   6339 C  CE  . LYS B 1 389 ? 3.969   23.800 81.072  1.00 95.67  ? 581 LYS B CE  1 
ATOM   6340 N  NZ  . LYS B 1 389 ? 2.599   23.612 80.532  1.00 101.64 ? 581 LYS B NZ  1 
ATOM   6341 N  N   . ILE B 1 390 ? 8.756   21.153 82.275  1.00 84.61  ? 582 ILE B N   1 
ATOM   6342 C  CA  . ILE B 1 390 ? 9.055   19.752 81.987  1.00 88.30  ? 582 ILE B CA  1 
ATOM   6343 C  C   . ILE B 1 390 ? 7.976   19.149 81.074  1.00 90.47  ? 582 ILE B C   1 
ATOM   6344 O  O   . ILE B 1 390 ? 6.787   19.176 81.384  1.00 91.87  ? 582 ILE B O   1 
ATOM   6345 C  CB  . ILE B 1 390 ? 9.217   18.908 83.282  1.00 89.40  ? 582 ILE B CB  1 
ATOM   6346 C  CG1 . ILE B 1 390 ? 10.507  19.299 84.014  1.00 91.41  ? 582 ILE B CG1 1 
ATOM   6347 C  CG2 . ILE B 1 390 ? 9.208   17.406 82.971  1.00 87.05  ? 582 ILE B CG2 1 
ATOM   6348 C  CD1 . ILE B 1 390 ? 10.779  18.519 85.303  1.00 89.93  ? 582 ILE B CD1 1 
ATOM   6349 N  N   . VAL B 1 391 ? 8.410   18.607 79.944  1.00 90.53  ? 583 VAL B N   1 
ATOM   6350 C  CA  . VAL B 1 391 ? 7.506   18.036 78.960  1.00 91.56  ? 583 VAL B CA  1 
ATOM   6351 C  C   . VAL B 1 391 ? 7.743   16.524 78.863  1.00 91.47  ? 583 VAL B C   1 
ATOM   6352 O  O   . VAL B 1 391 ? 8.844   16.050 79.134  1.00 93.29  ? 583 VAL B O   1 
ATOM   6353 C  CB  . VAL B 1 391 ? 7.720   18.721 77.584  1.00 92.06  ? 583 VAL B CB  1 
ATOM   6354 C  CG1 . VAL B 1 391 ? 7.092   17.925 76.457  1.00 95.62  ? 583 VAL B CG1 1 
ATOM   6355 C  CG2 . VAL B 1 391 ? 7.160   20.114 77.601  1.00 88.80  ? 583 VAL B CG2 1 
ATOM   6356 N  N   . ASP B 1 392 ? 6.706   15.770 78.509  1.00 89.75  ? 584 ASP B N   1 
ATOM   6357 C  CA  . ASP B 1 392 ? 6.860   14.356 78.183  1.00 88.29  ? 584 ASP B CA  1 
ATOM   6358 C  C   . ASP B 1 392 ? 6.688   14.230 76.672  1.00 84.69  ? 584 ASP B C   1 
ATOM   6359 O  O   . ASP B 1 392 ? 5.581   14.392 76.161  1.00 84.62  ? 584 ASP B O   1 
ATOM   6360 C  CB  . ASP B 1 392 ? 5.842   13.491 78.942  1.00 90.62  ? 584 ASP B CB  1 
ATOM   6361 C  CG  . ASP B 1 392 ? 5.989   11.991 78.650  1.00 93.83  ? 584 ASP B CG  1 
ATOM   6362 O  OD1 . ASP B 1 392 ? 5.255   11.192 79.279  1.00 95.32  ? 584 ASP B OD1 1 
ATOM   6363 O  OD2 . ASP B 1 392 ? 6.824   11.599 77.801  1.00 93.73  ? 584 ASP B OD2 1 
ATOM   6364 N  N   . PRO B 1 393 ? 7.795   13.976 75.949  1.00 81.91  ? 585 PRO B N   1 
ATOM   6365 C  CA  . PRO B 1 393 ? 7.746   13.934 74.486  1.00 79.77  ? 585 PRO B CA  1 
ATOM   6366 C  C   . PRO B 1 393 ? 7.023   12.719 73.915  1.00 79.44  ? 585 PRO B C   1 
ATOM   6367 O  O   . PRO B 1 393 ? 6.759   12.674 72.715  1.00 78.92  ? 585 PRO B O   1 
ATOM   6368 C  CB  . PRO B 1 393 ? 9.223   13.946 74.076  1.00 76.95  ? 585 PRO B CB  1 
ATOM   6369 C  CG  . PRO B 1 393 ? 9.956   13.443 75.241  1.00 78.59  ? 585 PRO B CG  1 
ATOM   6370 C  CD  . PRO B 1 393 ? 9.157   13.754 76.469  1.00 80.32  ? 585 PRO B CD  1 
ATOM   6371 N  N   . LYS B 1 394 ? 6.705   11.749 74.768  1.00 81.67  ? 586 LYS B N   1 
ATOM   6372 C  CA  . LYS B 1 394 ? 5.946   10.570 74.355  1.00 80.34  ? 586 LYS B CA  1 
ATOM   6373 C  C   . LYS B 1 394 ? 4.449   10.851 74.294  1.00 78.81  ? 586 LYS B C   1 
ATOM   6374 O  O   . LYS B 1 394 ? 3.723   10.138 73.606  1.00 79.98  ? 586 LYS B O   1 
ATOM   6375 C  CB  . LYS B 1 394 ? 6.232   9.389  75.279  1.00 82.47  ? 586 LYS B CB  1 
ATOM   6376 C  CG  . LYS B 1 394 ? 7.484   8.615  74.911  1.00 87.74  ? 586 LYS B CG  1 
ATOM   6377 C  CD  . LYS B 1 394 ? 8.133   7.967  76.139  1.00 92.37  ? 586 LYS B CD  1 
ATOM   6378 C  CE  . LYS B 1 394 ? 7.529   6.611  76.482  1.00 93.57  ? 586 LYS B CE  1 
ATOM   6379 N  NZ  . LYS B 1 394 ? 7.894   5.589  75.467  1.00 94.46  ? 586 LYS B NZ  1 
ATOM   6380 N  N   . ARG B 1 395 ? 3.996   11.882 75.010  1.00 77.70  ? 587 ARG B N   1 
ATOM   6381 C  CA  . ARG B 1 395 ? 2.585   12.302 74.987  1.00 77.72  ? 587 ARG B CA  1 
ATOM   6382 C  C   . ARG B 1 395 ? 2.373   13.604 74.227  1.00 77.37  ? 587 ARG B C   1 
ATOM   6383 O  O   . ARG B 1 395 ? 3.264   14.446 74.192  1.00 77.28  ? 587 ARG B O   1 
ATOM   6384 C  CB  . ARG B 1 395 ? 2.023   12.457 76.401  1.00 77.25  ? 587 ARG B CB  1 
ATOM   6385 C  CG  . ARG B 1 395 ? 1.815   11.146 77.132  1.00 81.05  ? 587 ARG B CG  1 
ATOM   6386 C  CD  . ARG B 1 395 ? 0.662   11.248 78.099  1.00 81.71  ? 587 ARG B CD  1 
ATOM   6387 N  NE  . ARG B 1 395 ? -0.613  10.915 77.474  1.00 83.06  ? 587 ARG B NE  1 
ATOM   6388 C  CZ  . ARG B 1 395 ? -1.791  11.403 77.851  1.00 84.73  ? 587 ARG B CZ  1 
ATOM   6389 N  NH1 . ARG B 1 395 ? -1.875  12.280 78.844  1.00 84.88  ? 587 ARG B NH1 1 
ATOM   6390 N  NH2 . ARG B 1 395 ? -2.894  11.017 77.222  1.00 87.23  ? 587 ARG B NH2 1 
ATOM   6391 N  N   . PRO B 1 396 ? 1.182   13.779 73.622  1.00 79.44  ? 588 PRO B N   1 
ATOM   6392 C  CA  . PRO B 1 396 ? 0.858   15.020 72.926  1.00 81.00  ? 588 PRO B CA  1 
ATOM   6393 C  C   . PRO B 1 396 ? 1.005   16.216 73.844  1.00 82.46  ? 588 PRO B C   1 
ATOM   6394 O  O   . PRO B 1 396 ? 0.857   16.069 75.057  1.00 84.86  ? 588 PRO B O   1 
ATOM   6395 C  CB  . PRO B 1 396 ? -0.616  14.833 72.564  1.00 80.38  ? 588 PRO B CB  1 
ATOM   6396 C  CG  . PRO B 1 396 ? -0.788  13.381 72.460  1.00 77.20  ? 588 PRO B CG  1 
ATOM   6397 C  CD  . PRO B 1 396 ? 0.068   12.819 73.545  1.00 78.16  ? 588 PRO B CD  1 
ATOM   6398 N  N   . LEU B 1 397 ? 1.296   17.386 73.285  1.00 82.42  ? 589 LEU B N   1 
ATOM   6399 C  CA  . LEU B 1 397 ? 1.354   18.598 74.100  1.00 85.25  ? 589 LEU B CA  1 
ATOM   6400 C  C   . LEU B 1 397 ? 0.023   18.913 74.775  1.00 88.76  ? 589 LEU B C   1 
ATOM   6401 O  O   . LEU B 1 397 ? -0.008  19.334 75.927  1.00 93.09  ? 589 LEU B O   1 
ATOM   6402 C  CB  . LEU B 1 397 ? 1.832   19.792 73.287  1.00 85.51  ? 589 LEU B CB  1 
ATOM   6403 C  CG  . LEU B 1 397 ? 3.318   20.085 73.438  1.00 86.64  ? 589 LEU B CG  1 
ATOM   6404 C  CD1 . LEU B 1 397 ? 3.669   21.313 72.621  1.00 88.05  ? 589 LEU B CD1 1 
ATOM   6405 C  CD2 . LEU B 1 397 ? 3.681   20.277 74.917  1.00 85.37  ? 589 LEU B CD2 1 
ATOM   6406 N  N   . MET B 1 398 ? -1.072  18.698 74.054  1.00 88.50  ? 590 MET B N   1 
ATOM   6407 C  CA  . MET B 1 398 ? -2.390  18.832 74.625  1.00 88.96  ? 590 MET B CA  1 
ATOM   6408 C  C   . MET B 1 398 ? -3.229  17.600 74.281  1.00 92.86  ? 590 MET B C   1 
ATOM   6409 O  O   . MET B 1 398 ? -3.842  17.538 73.212  1.00 96.33  ? 590 MET B O   1 
ATOM   6410 C  CB  . MET B 1 398 ? -3.045  20.110 74.114  1.00 92.22  ? 590 MET B CB  1 
ATOM   6411 C  CG  . MET B 1 398 ? -4.326  20.509 74.835  1.00 96.93  ? 590 MET B CG  1 
ATOM   6412 S  SD  . MET B 1 398 ? -4.158  20.753 76.620  1.00 99.55  ? 590 MET B SD  1 
ATOM   6413 C  CE  . MET B 1 398 ? -2.694  21.779 76.749  1.00 100.55 ? 590 MET B CE  1 
ATOM   6414 N  N   . PRO B 1 399 ? -3.225  16.588 75.166  1.00 92.61  ? 591 PRO B N   1 
ATOM   6415 C  CA  . PRO B 1 399 ? -4.167  15.485 75.013  1.00 90.86  ? 591 PRO B CA  1 
ATOM   6416 C  C   . PRO B 1 399 ? -5.589  15.974 75.256  1.00 90.49  ? 591 PRO B C   1 
ATOM   6417 O  O   . PRO B 1 399 ? -5.777  16.902 76.049  1.00 91.40  ? 591 PRO B O   1 
ATOM   6418 C  CB  . PRO B 1 399 ? -3.750  14.508 76.126  1.00 89.73  ? 591 PRO B CB  1 
ATOM   6419 C  CG  . PRO B 1 399 ? -2.370  14.889 76.490  1.00 90.86  ? 591 PRO B CG  1 
ATOM   6420 C  CD  . PRO B 1 399 ? -2.335  16.382 76.321  1.00 92.44  ? 591 PRO B CD  1 
ATOM   6421 N  N   . GLU B 1 400 ? -6.568  15.359 74.587  1.00 89.31  ? 592 GLU B N   1 
ATOM   6422 C  CA  . GLU B 1 400 ? -7.990  15.675 74.778  1.00 90.19  ? 592 GLU B CA  1 
ATOM   6423 C  C   . GLU B 1 400 ? -8.344  15.902 76.248  1.00 85.34  ? 592 GLU B C   1 
ATOM   6424 O  O   . GLU B 1 400 ? -8.922  16.929 76.592  1.00 79.18  ? 592 GLU B O   1 
ATOM   6425 C  CB  . GLU B 1 400 ? -8.877  14.555 74.227  1.00 94.63  ? 592 GLU B CB  1 
ATOM   6426 C  CG  . GLU B 1 400 ? -8.853  14.372 72.708  1.00 99.11  ? 592 GLU B CG  1 
ATOM   6427 C  CD  . GLU B 1 400 ? -9.933  13.400 72.213  1.00 99.60  ? 592 GLU B CD  1 
ATOM   6428 O  OE1 . GLU B 1 400 ? -11.065 13.422 72.755  1.00 101.57 ? 592 GLU B OE1 1 
ATOM   6429 O  OE2 . GLU B 1 400 ? -9.652  12.616 71.275  1.00 102.61 ? 592 GLU B OE2 1 
ATOM   6430 N  N   . GLU B 1 401 ? -7.986  14.937 77.102  1.00 86.28  ? 593 GLU B N   1 
ATOM   6431 C  CA  . GLU B 1 401 ? -8.274  14.974 78.546  1.00 87.44  ? 593 GLU B CA  1 
ATOM   6432 C  C   . GLU B 1 401 ? -7.759  16.229 79.225  1.00 90.80  ? 593 GLU B C   1 
ATOM   6433 O  O   . GLU B 1 401 ? -8.364  16.724 80.177  1.00 92.02  ? 593 GLU B O   1 
ATOM   6434 C  CB  . GLU B 1 401 ? -7.650  13.779 79.274  1.00 85.88  ? 593 GLU B CB  1 
ATOM   6435 C  CG  . GLU B 1 401 ? -7.581  12.501 78.471  1.00 89.51  ? 593 GLU B CG  1 
ATOM   6436 C  CD  . GLU B 1 401 ? -6.214  12.262 77.873  1.00 87.63  ? 593 GLU B CD  1 
ATOM   6437 O  OE1 . GLU B 1 401 ? -5.230  12.257 78.641  1.00 86.07  ? 593 GLU B OE1 1 
ATOM   6438 O  OE2 . GLU B 1 401 ? -6.131  12.064 76.641  1.00 87.54  ? 593 GLU B OE2 1 
ATOM   6439 N  N   . CYS B 1 402 ? -6.625  16.728 78.748  1.00 92.60  ? 594 CYS B N   1 
ATOM   6440 C  CA  . CYS B 1 402 ? -5.959  17.832 79.408  1.00 94.92  ? 594 CYS B CA  1 
ATOM   6441 C  C   . CYS B 1 402 ? -6.580  19.168 79.081  1.00 96.24  ? 594 CYS B C   1 
ATOM   6442 O  O   . CYS B 1 402 ? -6.322  20.143 79.784  1.00 96.94  ? 594 CYS B O   1 
ATOM   6443 C  CB  . CYS B 1 402 ? -4.475  17.829 79.075  1.00 96.82  ? 594 CYS B CB  1 
ATOM   6444 S  SG  . CYS B 1 402 ? -3.672  16.298 79.568  1.00 99.26  ? 594 CYS B SG  1 
ATOM   6445 N  N   . ARG B 1 403 ? -7.406  19.197 78.032  1.00 99.52  ? 595 ARG B N   1 
ATOM   6446 C  CA  . ARG B 1 403 ? -8.034  20.430 77.551  1.00 102.08 ? 595 ARG B CA  1 
ATOM   6447 C  C   . ARG B 1 403 ? -8.573  21.250 78.704  1.00 101.17 ? 595 ARG B C   1 
ATOM   6448 O  O   . ARG B 1 403 ? -9.387  20.794 79.497  1.00 94.22  ? 595 ARG B O   1 
ATOM   6449 C  CB  . ARG B 1 403 ? -9.126  20.157 76.515  1.00 106.57 ? 595 ARG B CB  1 
ATOM   6450 C  CG  . ARG B 1 403 ? -8.607  19.844 75.107  1.00 110.52 ? 595 ARG B CG  1 
ATOM   6451 C  CD  . ARG B 1 403 ? -9.724  19.276 74.237  1.00 113.10 ? 595 ARG B CD  1 
ATOM   6452 N  NE  . ARG B 1 403 ? -9.238  18.612 73.028  1.00 115.08 ? 595 ARG B NE  1 
ATOM   6453 C  CZ  . ARG B 1 403 ? -9.996  17.876 72.213  1.00 117.68 ? 595 ARG B CZ  1 
ATOM   6454 N  NH1 . ARG B 1 403 ? -11.292 17.694 72.467  1.00 118.17 ? 595 ARG B NH1 1 
ATOM   6455 N  NH2 . ARG B 1 403 ? -9.457  17.315 71.137  1.00 117.60 ? 595 ARG B NH2 1 
ATOM   6456 N  N   . ALA B 1 404 ? -8.052  22.466 78.780  1.00 108.73 ? 596 ALA B N   1 
ATOM   6457 C  CA  . ALA B 1 404 ? -8.294  23.410 79.861  1.00 108.11 ? 596 ALA B CA  1 
ATOM   6458 C  C   . ALA B 1 404 ? -9.576  24.162 79.584  1.00 98.87  ? 596 ALA B C   1 
ATOM   6459 O  O   . ALA B 1 404 ? -10.133 24.050 78.496  1.00 104.21 ? 596 ALA B O   1 
ATOM   6460 C  CB  . ALA B 1 404 ? -7.103  24.409 79.906  1.00 112.09 ? 596 ALA B CB  1 
ATOM   6461 N  N   . THR B 1 405 ? -10.041 24.941 80.546  1.00 88.07  ? 597 THR B N   1 
ATOM   6462 C  CA  . THR B 1 405 ? -10.931 26.050 80.202  1.00 89.57  ? 597 THR B CA  1 
ATOM   6463 C  C   . THR B 1 405 ? -10.861 27.181 81.217  1.00 92.06  ? 597 THR B C   1 
ATOM   6464 O  O   . THR B 1 405 ? -11.399 27.089 82.325  1.00 93.09  ? 597 THR B O   1 
ATOM   6465 C  CB  . THR B 1 405 ? -12.386 25.614 79.882  1.00 91.66  ? 597 THR B CB  1 
ATOM   6466 O  OG1 . THR B 1 405 ? -13.137 26.763 79.478  1.00 87.51  ? 597 THR B OG1 1 
ATOM   6467 C  CG2 . THR B 1 405 ? -13.068 24.907 81.083  1.00 94.68  ? 597 THR B CG2 1 
ATOM   6468 N  N   . VAL B 1 406 ? -10.182 28.252 80.814  1.00 95.39  ? 598 VAL B N   1 
ATOM   6469 C  CA  . VAL B 1 406 ? -9.768  29.308 81.743  1.00 97.20  ? 598 VAL B CA  1 
ATOM   6470 C  C   . VAL B 1 406 ? -10.915 30.231 82.145  1.00 96.11  ? 598 VAL B C   1 
ATOM   6471 O  O   . VAL B 1 406 ? -11.613 30.768 81.295  1.00 94.57  ? 598 VAL B O   1 
ATOM   6472 C  CB  . VAL B 1 406 ? -8.503  30.097 81.237  1.00 96.60  ? 598 VAL B CB  1 
ATOM   6473 C  CG1 . VAL B 1 406 ? -8.357  30.009 79.721  1.00 101.42 ? 598 VAL B CG1 1 
ATOM   6474 C  CG2 . VAL B 1 406 ? -8.517  31.548 81.707  1.00 95.21  ? 598 VAL B CG2 1 
ATOM   6475 N  N   . GLN B 1 407 ? -11.105 30.370 83.456  1.00 98.30  ? 599 GLN B N   1 
ATOM   6476 C  CA  . GLN B 1 407 ? -12.069 31.297 84.029  1.00 101.04 ? 599 GLN B CA  1 
ATOM   6477 C  C   . GLN B 1 407 ? -11.309 32.472 84.631  1.00 97.90  ? 599 GLN B C   1 
ATOM   6478 O  O   . GLN B 1 407 ? -10.708 32.338 85.705  1.00 95.67  ? 599 GLN B O   1 
ATOM   6479 C  CB  . GLN B 1 407 ? -12.908 30.605 85.099  1.00 107.68 ? 599 GLN B CB  1 
ATOM   6480 C  CG  . GLN B 1 407 ? -13.824 29.520 84.563  1.00 113.09 ? 599 GLN B CG  1 
ATOM   6481 C  CD  . GLN B 1 407 ? -13.847 28.302 85.456  1.00 117.40 ? 599 GLN B CD  1 
ATOM   6482 O  OE1 . GLN B 1 407 ? -13.863 28.411 86.688  1.00 118.80 ? 599 GLN B OE1 1 
ATOM   6483 N  NE2 . GLN B 1 407 ? -13.837 27.126 84.840  1.00 119.46 ? 599 GLN B NE2 1 
ATOM   6484 N  N   . PRO B 1 408 ? -11.343 33.634 83.944  1.00 94.45  ? 600 PRO B N   1 
ATOM   6485 C  CA  . PRO B 1 408 ? -10.485 34.772 84.266  1.00 89.79  ? 600 PRO B CA  1 
ATOM   6486 C  C   . PRO B 1 408 ? -10.739 35.290 85.671  1.00 89.48  ? 600 PRO B C   1 
ATOM   6487 O  O   . PRO B 1 408 ? -11.883 35.301 86.126  1.00 88.52  ? 600 PRO B O   1 
ATOM   6488 C  CB  . PRO B 1 408 ? -10.894 35.820 83.228  1.00 86.03  ? 600 PRO B CB  1 
ATOM   6489 C  CG  . PRO B 1 408 ? -11.491 35.042 82.124  1.00 86.79  ? 600 PRO B CG  1 
ATOM   6490 C  CD  . PRO B 1 408 ? -12.231 33.944 82.811  1.00 90.13  ? 600 PRO B CD  1 
ATOM   6491 N  N   . ALA B 1 409 ? -9.671  35.703 86.347  1.00 90.63  ? 601 ALA B N   1 
ATOM   6492 C  CA  . ALA B 1 409 ? -9.764  36.230 87.707  1.00 91.15  ? 601 ALA B CA  1 
ATOM   6493 C  C   . ALA B 1 409 ? -10.778 37.366 87.809  1.00 91.73  ? 601 ALA B C   1 
ATOM   6494 O  O   . ALA B 1 409 ? -10.870 38.208 86.913  1.00 89.89  ? 601 ALA B O   1 
ATOM   6495 C  CB  . ALA B 1 409 ? -8.406  36.689 88.189  1.00 89.30  ? 601 ALA B CB  1 
ATOM   6496 N  N   . GLN B 1 410 ? -11.532 37.369 88.908  1.00 94.37  ? 602 GLN B N   1 
ATOM   6497 C  CA  . GLN B 1 410 ? -12.634 38.308 89.118  1.00 93.28  ? 602 GLN B CA  1 
ATOM   6498 C  C   . GLN B 1 410 ? -12.467 39.023 90.454  1.00 91.32  ? 602 GLN B C   1 
ATOM   6499 O  O   . GLN B 1 410 ? -11.961 38.440 91.414  1.00 92.70  ? 602 GLN B O   1 
ATOM   6500 C  CB  . GLN B 1 410 ? -13.956 37.548 89.099  1.00 95.02  ? 602 GLN B CB  1 
ATOM   6501 C  CG  . GLN B 1 410 ? -14.974 38.104 88.127  1.00 100.97 ? 602 GLN B CG  1 
ATOM   6502 C  CD  . GLN B 1 410 ? -14.557 37.922 86.678  1.00 103.71 ? 602 GLN B CD  1 
ATOM   6503 O  OE1 . GLN B 1 410 ? -14.458 38.890 85.930  1.00 106.94 ? 602 GLN B OE1 1 
ATOM   6504 N  NE2 . GLN B 1 410 ? -14.298 36.680 86.280  1.00 104.07 ? 602 GLN B NE2 1 
ATOM   6505 N  N   . THR B 1 411 ? -12.890 40.281 90.523  1.00 89.90  ? 603 THR B N   1 
ATOM   6506 C  CA  . THR B 1 411 ? -12.737 41.060 91.753  1.00 92.49  ? 603 THR B CA  1 
ATOM   6507 C  C   . THR B 1 411 ? -13.534 40.438 92.885  1.00 96.53  ? 603 THR B C   1 
ATOM   6508 O  O   . THR B 1 411 ? -14.587 39.840 92.653  1.00 99.10  ? 603 THR B O   1 
ATOM   6509 C  CB  . THR B 1 411 ? -13.178 42.532 91.592  1.00 91.41  ? 603 THR B CB  1 
ATOM   6510 O  OG1 . THR B 1 411 ? -14.512 42.593 91.067  1.00 94.00  ? 603 THR B OG1 1 
ATOM   6511 C  CG2 . THR B 1 411 ? -12.229 43.283 90.677  1.00 90.70  ? 603 THR B CG2 1 
ATOM   6512 N  N   . LEU B 1 412 ? -13.015 40.575 94.103  1.00 98.85  ? 604 LEU B N   1 
ATOM   6513 C  CA  . LEU B 1 412 ? -13.693 40.114 95.315  1.00 99.28  ? 604 LEU B CA  1 
ATOM   6514 C  C   . LEU B 1 412 ? -15.123 40.641 95.420  1.00 104.05 ? 604 LEU B C   1 
ATOM   6515 O  O   . LEU B 1 412 ? -15.365 41.834 95.222  1.00 105.78 ? 604 LEU B O   1 
ATOM   6516 C  CB  . LEU B 1 412 ? -12.896 40.553 96.543  1.00 94.76  ? 604 LEU B CB  1 
ATOM   6517 C  CG  . LEU B 1 412 ? -12.089 39.520 97.317  1.00 92.38  ? 604 LEU B CG  1 
ATOM   6518 C  CD1 . LEU B 1 412 ? -11.458 38.486 96.411  1.00 95.43  ? 604 LEU B CD1 1 
ATOM   6519 C  CD2 . LEU B 1 412 ? -11.041 40.231 98.113  1.00 93.90  ? 604 LEU B CD2 1 
ATOM   6520 N  N   . THR B 1 413 ? -16.067 39.747 95.711  1.00 107.74 ? 605 THR B N   1 
ATOM   6521 C  CA  . THR B 1 413 ? -17.462 40.147 95.932  1.00 109.57 ? 605 THR B CA  1 
ATOM   6522 C  C   . THR B 1 413 ? -18.068 39.505 97.184  1.00 111.87 ? 605 THR B C   1 
ATOM   6523 O  O   . THR B 1 413 ? -19.292 39.543 97.373  1.00 113.47 ? 605 THR B O   1 
ATOM   6524 C  CB  . THR B 1 413 ? -18.377 39.836 94.717  1.00 108.44 ? 605 THR B CB  1 
ATOM   6525 O  OG1 . THR B 1 413 ? -18.505 38.420 94.565  1.00 110.54 ? 605 THR B OG1 1 
ATOM   6526 C  CG2 . THR B 1 413 ? -17.833 40.441 93.428  1.00 108.76 ? 605 THR B CG2 1 
ATOM   6527 N  N   . SER B 1 414 ? -17.220 38.918 98.030  1.00 112.00 ? 606 SER B N   1 
ATOM   6528 C  CA  . SER B 1 414 ? -17.681 38.306 99.274  1.00 112.00 ? 606 SER B CA  1 
ATOM   6529 C  C   . SER B 1 414 ? -18.202 39.397 100.197 1.00 112.84 ? 606 SER B C   1 
ATOM   6530 O  O   . SER B 1 414 ? -17.566 40.442 100.329 1.00 114.07 ? 606 SER B O   1 
ATOM   6531 C  CB  . SER B 1 414 ? -16.555 37.535 99.955  1.00 111.32 ? 606 SER B CB  1 
ATOM   6532 O  OG  . SER B 1 414 ? -15.585 38.416 100.486 1.00 111.48 ? 606 SER B OG  1 
ATOM   6533 N  N   . GLU B 1 415 ? -19.357 39.152 100.821 1.00 111.27 ? 607 GLU B N   1 
ATOM   6534 C  CA  . GLU B 1 415 ? -20.011 40.141 101.687 1.00 107.92 ? 607 GLU B CA  1 
ATOM   6535 C  C   . GLU B 1 415 ? -19.014 40.936 102.535 1.00 104.24 ? 607 GLU B C   1 
ATOM   6536 O  O   . GLU B 1 415 ? -19.056 42.169 102.546 1.00 102.11 ? 607 GLU B O   1 
ATOM   6537 C  CB  . GLU B 1 415 ? -21.064 39.476 102.581 1.00 108.22 ? 607 GLU B CB  1 
ATOM   6538 C  CG  . GLU B 1 415 ? -22.001 40.461 103.292 1.00 109.70 ? 607 GLU B CG  1 
ATOM   6539 C  CD  . GLU B 1 415 ? -22.972 39.779 104.249 1.00 110.61 ? 607 GLU B CD  1 
ATOM   6540 O  OE1 . GLU B 1 415 ? -22.515 38.991 105.106 1.00 112.09 ? 607 GLU B OE1 1 
ATOM   6541 O  OE2 . GLU B 1 415 ? -24.192 40.039 104.151 1.00 110.46 ? 607 GLU B OE2 1 
ATOM   6542 N  N   . CYS B 1 416 ? -18.113 40.228 103.220 1.00 101.76 ? 608 CYS B N   1 
ATOM   6543 C  CA  . CYS B 1 416 ? -17.134 40.867 104.097 1.00 100.67 ? 608 CYS B CA  1 
ATOM   6544 C  C   . CYS B 1 416 ? -16.163 41.771 103.338 1.00 99.37  ? 608 CYS B C   1 
ATOM   6545 O  O   . CYS B 1 416 ? -15.775 42.824 103.841 1.00 101.25 ? 608 CYS B O   1 
ATOM   6546 C  CB  . CYS B 1 416 ? -16.368 39.831 104.925 1.00 101.80 ? 608 CYS B CB  1 
ATOM   6547 S  SG  . CYS B 1 416 ? -15.178 40.534 106.130 1.00 104.40 ? 608 CYS B SG  1 
ATOM   6548 N  N   . SER B 1 417 ? -15.775 41.369 102.133 1.00 96.66  ? 609 SER B N   1 
ATOM   6549 C  CA  . SER B 1 417 ? -14.886 42.190 101.320 1.00 97.54  ? 609 SER B CA  1 
ATOM   6550 C  C   . SER B 1 417 ? -15.485 43.565 101.110 1.00 96.01  ? 609 SER B C   1 
ATOM   6551 O  O   . SER B 1 417 ? -14.813 44.571 101.309 1.00 93.63  ? 609 SER B O   1 
ATOM   6552 C  CB  . SER B 1 417 ? -14.602 41.523 99.970  1.00 103.01 ? 609 SER B CB  1 
ATOM   6553 O  OG  . SER B 1 417 ? -14.342 42.484 98.957  1.00 107.28 ? 609 SER B OG  1 
ATOM   6554 N  N   . ARG B 1 418 ? -16.761 43.591 100.732 1.00 100.40 ? 610 ARG B N   1 
ATOM   6555 C  CA  . ARG B 1 418 ? -17.449 44.828 100.343 1.00 103.91 ? 610 ARG B CA  1 
ATOM   6556 C  C   . ARG B 1 418 ? -17.876 45.727 101.494 1.00 102.76 ? 610 ARG B C   1 
ATOM   6557 O  O   . ARG B 1 418 ? -17.921 46.940 101.329 1.00 102.11 ? 610 ARG B O   1 
ATOM   6558 C  CB  . ARG B 1 418 ? -18.641 44.546 99.410  1.00 105.63 ? 610 ARG B CB  1 
ATOM   6559 C  CG  . ARG B 1 418 ? -19.136 43.099 99.402  1.00 107.48 ? 610 ARG B CG  1 
ATOM   6560 C  CD  . ARG B 1 418 ? -20.040 42.794 98.205  1.00 106.70 ? 610 ARG B CD  1 
ATOM   6561 N  NE  . ARG B 1 418 ? -21.342 43.450 98.323  1.00 110.04 ? 610 ARG B NE  1 
ATOM   6562 C  CZ  . ARG B 1 418 ? -22.385 42.965 98.997  1.00 110.79 ? 610 ARG B CZ  1 
ATOM   6563 N  NH1 . ARG B 1 418 ? -22.303 41.801 99.633  1.00 110.98 ? 610 ARG B NH1 1 
ATOM   6564 N  NH2 . ARG B 1 418 ? -23.520 43.652 99.035  1.00 110.94 ? 610 ARG B NH2 1 
ATOM   6565 N  N   . LEU B 1 419 ? -18.163 45.140 102.654 1.00 105.99 ? 611 LEU B N   1 
ATOM   6566 C  CA  . LEU B 1 419 ? -18.780 45.879 103.766 1.00 108.27 ? 611 LEU B CA  1 
ATOM   6567 C  C   . LEU B 1 419 ? -17.873 46.176 104.960 1.00 109.66 ? 611 LEU B C   1 
ATOM   6568 O  O   . LEU B 1 419 ? -18.063 47.185 105.643 1.00 111.16 ? 611 LEU B O   1 
ATOM   6569 C  CB  . LEU B 1 419 ? -20.044 45.158 104.245 1.00 107.96 ? 611 LEU B CB  1 
ATOM   6570 C  CG  . LEU B 1 419 ? -21.406 45.454 103.596 1.00 108.06 ? 611 LEU B CG  1 
ATOM   6571 C  CD1 . LEU B 1 419 ? -21.362 45.696 102.079 1.00 106.16 ? 611 LEU B CD1 1 
ATOM   6572 C  CD2 . LEU B 1 419 ? -22.364 44.315 103.919 1.00 109.15 ? 611 LEU B CD2 1 
ATOM   6573 N  N   . CYS B 1 420 ? -16.901 45.304 105.212 1.00 109.95 ? 612 CYS B N   1 
ATOM   6574 C  CA  . CYS B 1 420 ? -16.055 45.419 106.398 1.00 111.06 ? 612 CYS B CA  1 
ATOM   6575 C  C   . CYS B 1 420 ? -14.886 46.372 106.207 1.00 114.52 ? 612 CYS B C   1 
ATOM   6576 O  O   . CYS B 1 420 ? -13.835 45.989 105.687 1.00 118.49 ? 612 CYS B O   1 
ATOM   6577 C  CB  . CYS B 1 420 ? -15.539 44.044 106.826 1.00 110.74 ? 612 CYS B CB  1 
ATOM   6578 S  SG  . CYS B 1 420 ? -14.335 44.074 108.173 1.00 110.23 ? 612 CYS B SG  1 
ATOM   6579 N  N   . ARG B 1 421 ? -15.077 47.618 106.626 1.00 116.22 ? 613 ARG B N   1 
ATOM   6580 C  CA  . ARG B 1 421 ? -13.984 48.586 106.684 1.00 118.97 ? 613 ARG B CA  1 
ATOM   6581 C  C   . ARG B 1 421 ? -13.902 49.129 108.106 1.00 118.60 ? 613 ARG B C   1 
ATOM   6582 O  O   . ARG B 1 421 ? -14.900 49.117 108.837 1.00 121.63 ? 613 ARG B O   1 
ATOM   6583 C  CB  . ARG B 1 421 ? -14.178 49.723 105.672 1.00 123.13 ? 613 ARG B CB  1 
ATOM   6584 C  CG  . ARG B 1 421 ? -14.797 49.313 104.323 1.00 127.90 ? 613 ARG B CG  1 
ATOM   6585 C  CD  . ARG B 1 421 ? -13.837 48.571 103.392 1.00 128.75 ? 613 ARG B CD  1 
ATOM   6586 N  NE  . ARG B 1 421 ? -14.561 48.002 102.253 1.00 131.79 ? 613 ARG B NE  1 
ATOM   6587 C  CZ  . ARG B 1 421 ? -14.104 47.959 101.001 1.00 134.69 ? 613 ARG B CZ  1 
ATOM   6588 N  NH1 . ARG B 1 421 ? -12.913 48.463 100.695 1.00 136.28 ? 613 ARG B NH1 1 
ATOM   6589 N  NH2 . ARG B 1 421 ? -14.848 47.422 100.041 1.00 134.62 ? 613 ARG B NH2 1 
ATOM   6590 N  N   . ASN B 1 422 ? -12.720 49.617 108.481 1.00 114.58 ? 614 ASN B N   1 
ATOM   6591 C  CA  . ASN B 1 422 ? -12.372 49.939 109.875 1.00 110.49 ? 614 ASN B CA  1 
ATOM   6592 C  C   . ASN B 1 422 ? -12.022 48.679 110.649 1.00 110.33 ? 614 ASN B C   1 
ATOM   6593 O  O   . ASN B 1 422 ? -12.182 48.601 111.869 1.00 109.91 ? 614 ASN B O   1 
ATOM   6594 C  CB  . ASN B 1 422 ? -13.466 50.734 110.595 1.00 106.11 ? 614 ASN B CB  1 
ATOM   6595 C  CG  . ASN B 1 422 ? -13.609 52.135 110.066 1.00 103.78 ? 614 ASN B CG  1 
ATOM   6596 O  OD1 . ASN B 1 422 ? -14.678 52.726 110.157 1.00 103.68 ? 614 ASN B OD1 1 
ATOM   6597 N  ND2 . ASN B 1 422 ? -12.533 52.679 109.510 1.00 102.79 ? 614 ASN B ND2 1 
ATOM   6598 N  N   . GLY B 1 423 ? -11.531 47.692 109.911 1.00 110.99 ? 615 GLY B N   1 
ATOM   6599 C  CA  . GLY B 1 423 ? -11.066 46.445 110.484 1.00 109.31 ? 615 GLY B CA  1 
ATOM   6600 C  C   . GLY B 1 423 ? -10.514 45.537 109.409 1.00 107.60 ? 615 GLY B C   1 
ATOM   6601 O  O   . GLY B 1 423 ? -10.554 45.862 108.220 1.00 107.07 ? 615 GLY B O   1 
ATOM   6602 N  N   . TYR B 1 424 ? -9.975  44.403 109.832 1.00 107.11 ? 616 TYR B N   1 
ATOM   6603 C  CA  . TYR B 1 424 ? -9.567  43.375 108.892 1.00 103.56 ? 616 TYR B CA  1 
ATOM   6604 C  C   . TYR B 1 424 ? -10.676 42.341 108.793 1.00 103.44 ? 616 TYR B C   1 
ATOM   6605 O  O   . TYR B 1 424 ? -11.671 42.402 109.519 1.00 104.18 ? 616 TYR B O   1 
ATOM   6606 C  CB  . TYR B 1 424 ? -8.227  42.748 109.289 1.00 100.36 ? 616 TYR B CB  1 
ATOM   6607 C  CG  . TYR B 1 424 ? -8.252  41.912 110.549 1.00 98.38  ? 616 TYR B CG  1 
ATOM   6608 C  CD1 . TYR B 1 424 ? -8.008  42.485 111.792 1.00 96.29  ? 616 TYR B CD1 1 
ATOM   6609 C  CD2 . TYR B 1 424 ? -8.491  40.540 110.490 1.00 98.36  ? 616 TYR B CD2 1 
ATOM   6610 C  CE1 . TYR B 1 424 ? -8.012  41.717 112.950 1.00 98.46  ? 616 TYR B CE1 1 
ATOM   6611 C  CE2 . TYR B 1 424 ? -8.497  39.763 111.638 1.00 99.90  ? 616 TYR B CE2 1 
ATOM   6612 C  CZ  . TYR B 1 424 ? -8.260  40.356 112.867 1.00 99.84  ? 616 TYR B CZ  1 
ATOM   6613 O  OH  . TYR B 1 424 ? -8.274  39.584 114.010 1.00 100.51 ? 616 TYR B OH  1 
ATOM   6614 N  N   . CYS B 1 425 ? -10.490 41.387 107.897 1.00 104.34 ? 617 CYS B N   1 
ATOM   6615 C  CA  . CYS B 1 425 ? -11.548 40.485 107.519 1.00 103.72 ? 617 CYS B CA  1 
ATOM   6616 C  C   . CYS B 1 425 ? -10.931 39.092 107.375 1.00 102.56 ? 617 CYS B C   1 
ATOM   6617 O  O   . CYS B 1 425 ? -10.018 38.902 106.571 1.00 103.33 ? 617 CYS B O   1 
ATOM   6618 C  CB  . CYS B 1 425 ? -12.168 41.025 106.224 1.00 105.80 ? 617 CYS B CB  1 
ATOM   6619 S  SG  . CYS B 1 425 ? -13.363 40.008 105.386 1.00 110.16 ? 617 CYS B SG  1 
ATOM   6620 N  N   . THR B 1 426 ? -11.398 38.143 108.192 1.00 99.98  ? 618 THR B N   1 
ATOM   6621 C  CA  . THR B 1 426 ? -10.805 36.793 108.272 1.00 99.41  ? 618 THR B CA  1 
ATOM   6622 C  C   . THR B 1 426 ? -11.173 35.927 107.069 1.00 97.98  ? 618 THR B C   1 
ATOM   6623 O  O   . THR B 1 426 ? -12.128 36.238 106.363 1.00 98.12  ? 618 THR B O   1 
ATOM   6624 C  CB  . THR B 1 426 ? -11.229 36.020 109.551 1.00 100.74 ? 618 THR B CB  1 
ATOM   6625 O  OG1 . THR B 1 426 ? -12.606 35.630 109.453 1.00 102.77 ? 618 THR B OG1 1 
ATOM   6626 C  CG2 . THR B 1 426 ? -10.997 36.842 110.813 1.00 100.51 ? 618 THR B CG2 1 
ATOM   6627 N  N   . PRO B 1 427 ? -10.416 34.833 106.832 1.00 97.09  ? 619 PRO B N   1 
ATOM   6628 C  CA  . PRO B 1 427 ? -10.724 33.939 105.708 1.00 97.05  ? 619 PRO B CA  1 
ATOM   6629 C  C   . PRO B 1 427 ? -12.134 33.343 105.734 1.00 97.82  ? 619 PRO B C   1 
ATOM   6630 O  O   . PRO B 1 427 ? -12.613 32.901 104.691 1.00 98.69  ? 619 PRO B O   1 
ATOM   6631 C  CB  . PRO B 1 427 ? -9.668  32.834 105.836 1.00 94.36  ? 619 PRO B CB  1 
ATOM   6632 C  CG  . PRO B 1 427 ? -8.565  33.454 106.599 1.00 92.53  ? 619 PRO B CG  1 
ATOM   6633 C  CD  . PRO B 1 427 ? -9.212  34.387 107.559 1.00 95.02  ? 619 PRO B CD  1 
ATOM   6634 N  N   . THR B 1 428 ? -12.786 33.324 106.898 1.00 96.83  ? 620 THR B N   1 
ATOM   6635 C  CA  . THR B 1 428 ? -14.160 32.824 106.989 1.00 98.90  ? 620 THR B CA  1 
ATOM   6636 C  C   . THR B 1 428 ? -15.164 33.939 106.764 1.00 100.17 ? 620 THR B C   1 
ATOM   6637 O  O   . THR B 1 428 ? -16.378 33.718 106.801 1.00 101.44 ? 620 THR B O   1 
ATOM   6638 C  CB  . THR B 1 428 ? -14.474 32.161 108.345 1.00 100.99 ? 620 THR B CB  1 
ATOM   6639 O  OG1 . THR B 1 428 ? -14.291 33.107 109.408 1.00 101.56 ? 620 THR B OG1 1 
ATOM   6640 C  CG2 . THR B 1 428 ? -13.600 30.936 108.566 1.00 101.52 ? 620 THR B CG2 1 
ATOM   6641 N  N   . GLY B 1 429 ? -14.652 35.143 106.547 1.00 101.28 ? 621 GLY B N   1 
ATOM   6642 C  CA  . GLY B 1 429 ? -15.501 36.293 106.278 1.00 103.45 ? 621 GLY B CA  1 
ATOM   6643 C  C   . GLY B 1 429 ? -15.934 37.068 107.505 1.00 105.34 ? 621 GLY B C   1 
ATOM   6644 O  O   . GLY B 1 429 ? -16.728 37.995 107.387 1.00 107.82 ? 621 GLY B O   1 
ATOM   6645 N  N   . LYS B 1 430 ? -15.426 36.699 108.681 1.00 106.19 ? 622 LYS B N   1 
ATOM   6646 C  CA  . LYS B 1 430 ? -15.731 37.454 109.893 1.00 106.25 ? 622 LYS B CA  1 
ATOM   6647 C  C   . LYS B 1 430 ? -14.970 38.770 109.920 1.00 106.88 ? 622 LYS B C   1 
ATOM   6648 O  O   . LYS B 1 430 ? -13.751 38.795 109.763 1.00 109.90 ? 622 LYS B O   1 
ATOM   6649 C  CB  . LYS B 1 430 ? -15.421 36.661 111.159 1.00 106.82 ? 622 LYS B CB  1 
ATOM   6650 C  CG  . LYS B 1 430 ? -16.265 37.132 112.332 1.00 108.72 ? 622 LYS B CG  1 
ATOM   6651 C  CD  . LYS B 1 430 ? -15.440 37.426 113.567 1.00 109.51 ? 622 LYS B CD  1 
ATOM   6652 C  CE  . LYS B 1 430 ? -16.273 38.149 114.628 1.00 109.79 ? 622 LYS B CE  1 
ATOM   6653 N  NZ  . LYS B 1 430 ? -17.419 37.333 115.128 1.00 109.56 ? 622 LYS B NZ  1 
ATOM   6654 N  N   . CYS B 1 431 ? -15.700 39.861 110.116 1.00 107.05 ? 623 CYS B N   1 
ATOM   6655 C  CA  . CYS B 1 431 ? -15.099 41.184 110.194 1.00 106.18 ? 623 CYS B CA  1 
ATOM   6656 C  C   . CYS B 1 431 ? -14.522 41.424 111.592 1.00 103.55 ? 623 CYS B C   1 
ATOM   6657 O  O   . CYS B 1 431 ? -15.148 41.080 112.592 1.00 104.43 ? 623 CYS B O   1 
ATOM   6658 C  CB  . CYS B 1 431 ? -16.133 42.251 109.829 1.00 108.29 ? 623 CYS B CB  1 
ATOM   6659 S  SG  . CYS B 1 431 ? -15.510 43.946 109.829 1.00 111.26 ? 623 CYS B SG  1 
ATOM   6660 N  N   . CYS B 1 432 ? -13.323 41.999 111.650 1.00 100.27 ? 624 CYS B N   1 
ATOM   6661 C  CA  . CYS B 1 432 ? -12.626 42.237 112.915 1.00 96.94  ? 624 CYS B CA  1 
ATOM   6662 C  C   . CYS B 1 432 ? -12.163 43.676 113.022 1.00 96.34  ? 624 CYS B C   1 
ATOM   6663 O  O   . CYS B 1 432 ? -11.432 44.168 112.165 1.00 96.38  ? 624 CYS B O   1 
ATOM   6664 C  CB  . CYS B 1 432 ? -11.425 41.316 113.038 1.00 95.02  ? 624 CYS B CB  1 
ATOM   6665 S  SG  . CYS B 1 432 ? -11.838 39.593 113.164 1.00 93.23  ? 624 CYS B SG  1 
ATOM   6666 N  N   . CYS B 1 433 ? -12.573 44.337 114.093 1.00 95.29  ? 625 CYS B N   1 
ATOM   6667 C  CA  . CYS B 1 433 ? -12.461 45.783 114.177 1.00 95.24  ? 625 CYS B CA  1 
ATOM   6668 C  C   . CYS B 1 433 ? -11.128 46.257 114.724 1.00 94.40  ? 625 CYS B C   1 
ATOM   6669 O  O   . CYS B 1 433 ? -10.591 45.675 115.666 1.00 96.12  ? 625 CYS B O   1 
ATOM   6670 C  CB  . CYS B 1 433 ? -13.595 46.342 115.035 1.00 96.16  ? 625 CYS B CB  1 
ATOM   6671 S  SG  . CYS B 1 433 ? -15.254 45.839 114.532 1.00 96.53  ? 625 CYS B SG  1 
ATOM   6672 N  N   . SER B 1 434 ? -10.604 47.324 114.128 1.00 92.55  ? 626 SER B N   1 
ATOM   6673 C  CA  . SER B 1 434 ? -9.442  48.019 114.676 1.00 92.91  ? 626 SER B CA  1 
ATOM   6674 C  C   . SER B 1 434 ? -9.854  48.864 115.884 1.00 92.07  ? 626 SER B C   1 
ATOM   6675 O  O   . SER B 1 434 ? -10.997 49.313 115.952 1.00 94.07  ? 626 SER B O   1 
ATOM   6676 C  CB  . SER B 1 434 ? -8.742  48.867 113.601 1.00 93.92  ? 626 SER B CB  1 
ATOM   6677 O  OG  . SER B 1 434 ? -9.625  49.278 112.573 1.00 92.74  ? 626 SER B OG  1 
ATOM   6678 N  N   . PRO B 1 435 ? -8.940  49.052 116.858 1.00 92.12  ? 627 PRO B N   1 
ATOM   6679 C  CA  . PRO B 1 435 ? -9.209  49.833 118.076 1.00 93.24  ? 627 PRO B CA  1 
ATOM   6680 C  C   . PRO B 1 435 ? -10.223 50.985 117.930 1.00 93.15  ? 627 PRO B C   1 
ATOM   6681 O  O   . PRO B 1 435 ? -9.986  51.956 117.205 1.00 92.17  ? 627 PRO B O   1 
ATOM   6682 C  CB  . PRO B 1 435 ? -7.824  50.371 118.450 1.00 92.41  ? 627 PRO B CB  1 
ATOM   6683 C  CG  . PRO B 1 435 ? -6.870  49.328 117.936 1.00 93.98  ? 627 PRO B CG  1 
ATOM   6684 C  CD  . PRO B 1 435 ? -7.576  48.495 116.881 1.00 91.98  ? 627 PRO B CD  1 
ATOM   6685 N  N   . GLY B 1 436 ? -11.352 50.855 118.621 1.00 93.88  ? 628 GLY B N   1 
ATOM   6686 C  CA  . GLY B 1 436 ? -12.352 51.918 118.672 1.00 94.90  ? 628 GLY B CA  1 
ATOM   6687 C  C   . GLY B 1 436 ? -13.479 51.771 117.670 1.00 93.66  ? 628 GLY B C   1 
ATOM   6688 O  O   . GLY B 1 436 ? -14.049 52.761 117.220 1.00 93.64  ? 628 GLY B O   1 
ATOM   6689 N  N   . TRP B 1 437 ? -13.788 50.530 117.312 1.00 91.99  ? 629 TRP B N   1 
ATOM   6690 C  CA  . TRP B 1 437 ? -14.927 50.235 116.457 1.00 89.27  ? 629 TRP B CA  1 
ATOM   6691 C  C   . TRP B 1 437 ? -15.623 48.951 116.915 1.00 88.98  ? 629 TRP B C   1 
ATOM   6692 O  O   . TRP B 1 437 ? -14.997 48.069 117.505 1.00 89.66  ? 629 TRP B O   1 
ATOM   6693 C  CB  . TRP B 1 437 ? -14.494 50.123 114.993 1.00 89.62  ? 629 TRP B CB  1 
ATOM   6694 C  CG  . TRP B 1 437 ? -13.885 51.380 114.421 1.00 89.59  ? 629 TRP B CG  1 
ATOM   6695 C  CD1 . TRP B 1 437 ? -12.566 51.708 114.402 1.00 90.78  ? 629 TRP B CD1 1 
ATOM   6696 C  CD2 . TRP B 1 437 ? -14.573 52.461 113.778 1.00 89.59  ? 629 TRP B CD2 1 
ATOM   6697 N  NE1 . TRP B 1 437 ? -12.383 52.924 113.795 1.00 90.10  ? 629 TRP B NE1 1 
ATOM   6698 C  CE2 . TRP B 1 437 ? -13.599 53.410 113.401 1.00 88.78  ? 629 TRP B CE2 1 
ATOM   6699 C  CE3 . TRP B 1 437 ? -15.918 52.722 113.484 1.00 91.27  ? 629 TRP B CE3 1 
ATOM   6700 C  CZ2 . TRP B 1 437 ? -13.922 54.599 112.745 1.00 89.56  ? 629 TRP B CZ2 1 
ATOM   6701 C  CZ3 . TRP B 1 437 ? -16.241 53.912 112.836 1.00 90.83  ? 629 TRP B CZ3 1 
ATOM   6702 C  CH2 . TRP B 1 437 ? -15.245 54.836 112.476 1.00 90.52  ? 629 TRP B CH2 1 
ATOM   6703 N  N   . GLU B 1 438 ? -16.923 48.865 116.654 1.00 88.60  ? 630 GLU B N   1 
ATOM   6704 C  CA  . GLU B 1 438 ? -17.710 47.676 116.968 1.00 90.14  ? 630 GLU B CA  1 
ATOM   6705 C  C   . GLU B 1 438 ? -18.773 47.461 115.893 1.00 90.88  ? 630 GLU B C   1 
ATOM   6706 O  O   . GLU B 1 438 ? -18.835 48.213 114.917 1.00 90.12  ? 630 GLU B O   1 
ATOM   6707 C  CB  . GLU B 1 438 ? -18.343 47.781 118.367 1.00 90.69  ? 630 GLU B CB  1 
ATOM   6708 C  CG  . GLU B 1 438 ? -19.154 49.057 118.636 1.00 90.44  ? 630 GLU B CG  1 
ATOM   6709 C  CD  . GLU B 1 438 ? -19.559 49.216 120.102 1.00 92.61  ? 630 GLU B CD  1 
ATOM   6710 O  OE1 . GLU B 1 438 ? -20.153 50.263 120.454 1.00 93.26  ? 630 GLU B OE1 1 
ATOM   6711 O  OE2 . GLU B 1 438 ? -19.288 48.299 120.909 1.00 94.81  ? 630 GLU B OE2 1 
ATOM   6712 N  N   . GLY B 1 439 ? -19.599 46.434 116.073 1.00 92.31  ? 631 GLY B N   1 
ATOM   6713 C  CA  . GLY B 1 439 ? -20.662 46.126 115.127 1.00 93.35  ? 631 GLY B CA  1 
ATOM   6714 C  C   . GLY B 1 439 ? -20.268 45.099 114.087 1.00 98.01  ? 631 GLY B C   1 
ATOM   6715 O  O   . GLY B 1 439 ? -19.080 44.787 113.913 1.00 98.87  ? 631 GLY B O   1 
ATOM   6716 N  N   . ASP B 1 440 ? -21.273 44.587 113.382 1.00 100.27 ? 632 ASP B N   1 
ATOM   6717 C  CA  . ASP B 1 440 ? -21.085 43.515 112.406 1.00 102.31 ? 632 ASP B CA  1 
ATOM   6718 C  C   . ASP B 1 440 ? -19.974 43.809 111.411 1.00 103.54 ? 632 ASP B C   1 
ATOM   6719 O  O   . ASP B 1 440 ? -19.169 42.930 111.105 1.00 107.25 ? 632 ASP B O   1 
ATOM   6720 C  CB  . ASP B 1 440 ? -22.387 43.228 111.657 1.00 104.36 ? 632 ASP B CB  1 
ATOM   6721 C  CG  . ASP B 1 440 ? -23.510 42.794 112.579 1.00 106.42 ? 632 ASP B CG  1 
ATOM   6722 O  OD1 . ASP B 1 440 ? -24.685 42.951 112.184 1.00 107.89 ? 632 ASP B OD1 1 
ATOM   6723 O  OD2 . ASP B 1 440 ? -23.224 42.302 113.694 1.00 106.57 ? 632 ASP B OD2 1 
ATOM   6724 N  N   . PHE B 1 441 ? -19.922 45.043 110.918 1.00 102.25 ? 633 PHE B N   1 
ATOM   6725 C  CA  . PHE B 1 441 ? -18.928 45.406 109.908 1.00 101.02 ? 633 PHE B CA  1 
ATOM   6726 C  C   . PHE B 1 441 ? -18.049 46.592 110.309 1.00 99.77  ? 633 PHE B C   1 
ATOM   6727 O  O   . PHE B 1 441 ? -17.524 47.319 109.461 1.00 98.65  ? 633 PHE B O   1 
ATOM   6728 C  CB  . PHE B 1 441 ? -19.598 45.574 108.537 1.00 102.17 ? 633 PHE B CB  1 
ATOM   6729 C  CG  . PHE B 1 441 ? -20.248 44.308 108.037 1.00 104.09 ? 633 PHE B CG  1 
ATOM   6730 C  CD1 . PHE B 1 441 ? -21.633 44.163 108.066 1.00 103.96 ? 633 PHE B CD1 1 
ATOM   6731 C  CD2 . PHE B 1 441 ? -19.466 43.240 107.578 1.00 105.31 ? 633 PHE B CD2 1 
ATOM   6732 C  CE1 . PHE B 1 441 ? -22.234 42.984 107.623 1.00 104.75 ? 633 PHE B CE1 1 
ATOM   6733 C  CE2 . PHE B 1 441 ? -20.050 42.058 107.136 1.00 103.94 ? 633 PHE B CE2 1 
ATOM   6734 C  CZ  . PHE B 1 441 ? -21.439 41.929 107.158 1.00 104.76 ? 633 PHE B CZ  1 
ATOM   6735 N  N   . CYS B 1 442 ? -17.882 46.753 111.622 1.00 99.60  ? 634 CYS B N   1 
ATOM   6736 C  CA  . CYS B 1 442 ? -17.016 47.773 112.209 1.00 98.48  ? 634 CYS B CA  1 
ATOM   6737 C  C   . CYS B 1 442 ? -17.313 49.170 111.680 1.00 98.96  ? 634 CYS B C   1 
ATOM   6738 O  O   . CYS B 1 442 ? -16.404 49.893 111.276 1.00 100.88 ? 634 CYS B O   1 
ATOM   6739 C  CB  . CYS B 1 442 ? -15.550 47.413 111.985 1.00 97.14  ? 634 CYS B CB  1 
ATOM   6740 S  SG  . CYS B 1 442 ? -15.156 45.747 112.512 1.00 96.95  ? 634 CYS B SG  1 
ATOM   6741 N  N   . ARG B 1 443 ? -18.591 49.536 111.683 1.00 98.01  ? 635 ARG B N   1 
ATOM   6742 C  CA  . ARG B 1 443 ? -19.015 50.845 111.206 1.00 96.96  ? 635 ARG B CA  1 
ATOM   6743 C  C   . ARG B 1 443 ? -19.321 51.755 112.380 1.00 95.10  ? 635 ARG B C   1 
ATOM   6744 O  O   . ARG B 1 443 ? -19.338 52.976 112.227 1.00 98.54  ? 635 ARG B O   1 
ATOM   6745 C  CB  . ARG B 1 443 ? -20.242 50.740 110.297 1.00 100.09 ? 635 ARG B CB  1 
ATOM   6746 C  CG  . ARG B 1 443 ? -20.179 49.625 109.269 1.00 104.95 ? 635 ARG B CG  1 
ATOM   6747 C  CD  . ARG B 1 443 ? -21.024 49.950 108.050 1.00 109.36 ? 635 ARG B CD  1 
ATOM   6748 N  NE  . ARG B 1 443 ? -21.792 48.789 107.601 1.00 112.50 ? 635 ARG B NE  1 
ATOM   6749 C  CZ  . ARG B 1 443 ? -23.113 48.667 107.716 1.00 112.81 ? 635 ARG B CZ  1 
ATOM   6750 N  NH1 . ARG B 1 443 ? -23.839 49.643 108.250 1.00 113.05 ? 635 ARG B NH1 1 
ATOM   6751 N  NH2 . ARG B 1 443 ? -23.714 47.569 107.283 1.00 113.32 ? 635 ARG B NH2 1 
ATOM   6752 N  N   . THR B 1 444 ? -19.564 51.157 113.547 1.00 89.52  ? 636 THR B N   1 
ATOM   6753 C  CA  . THR B 1 444 ? -19.907 51.911 114.754 1.00 84.95  ? 636 THR B CA  1 
ATOM   6754 C  C   . THR B 1 444 ? -18.667 52.235 115.581 1.00 81.90  ? 636 THR B C   1 
ATOM   6755 O  O   . THR B 1 444 ? -17.898 51.348 115.938 1.00 78.36  ? 636 THR B O   1 
ATOM   6756 C  CB  . THR B 1 444 ? -20.965 51.170 115.620 1.00 83.56  ? 636 THR B CB  1 
ATOM   6757 O  OG1 . THR B 1 444 ? -22.230 51.209 114.959 1.00 83.41  ? 636 THR B OG1 1 
ATOM   6758 C  CG2 . THR B 1 444 ? -21.124 51.821 116.979 1.00 81.23  ? 636 THR B CG2 1 
ATOM   6759 N  N   . ALA B 1 445 ? -18.498 53.519 115.884 1.00 82.40  ? 637 ALA B N   1 
ATOM   6760 C  CA  . ALA B 1 445 ? -17.371 54.004 116.663 1.00 83.31  ? 637 ALA B CA  1 
ATOM   6761 C  C   . ALA B 1 445 ? -17.642 53.986 118.167 1.00 86.12  ? 637 ALA B C   1 
ATOM   6762 O  O   . ALA B 1 445 ? -18.726 54.370 118.627 1.00 89.37  ? 637 ALA B O   1 
ATOM   6763 C  CB  . ALA B 1 445 ? -17.004 55.398 116.213 1.00 82.54  ? 637 ALA B CB  1 
ATOM   6764 N  N   . LYS B 1 446 ? -16.644 53.536 118.923 1.00 87.42  ? 638 LYS B N   1 
ATOM   6765 C  CA  . LYS B 1 446 ? -16.693 53.533 120.387 1.00 90.60  ? 638 LYS B CA  1 
ATOM   6766 C  C   . LYS B 1 446 ? -16.195 54.868 120.951 1.00 96.32  ? 638 LYS B C   1 
ATOM   6767 O  O   . LYS B 1 446 ? -15.259 55.465 120.418 1.00 98.26  ? 638 LYS B O   1 
ATOM   6768 C  CB  . LYS B 1 446 ? -15.838 52.391 120.957 1.00 88.28  ? 638 LYS B CB  1 
ATOM   6769 C  CG  . LYS B 1 446 ? -16.258 50.989 120.541 1.00 84.69  ? 638 LYS B CG  1 
ATOM   6770 C  CD  . LYS B 1 446 ? -15.364 49.947 121.186 1.00 85.73  ? 638 LYS B CD  1 
ATOM   6771 C  CE  . LYS B 1 446 ? -16.057 48.598 121.265 1.00 85.74  ? 638 LYS B CE  1 
ATOM   6772 N  NZ  . LYS B 1 446 ? -15.115 47.490 121.594 1.00 85.80  ? 638 LYS B NZ  1 
ATOM   6773 N  N   . CYS B 1 447 ? -16.829 55.339 122.019 1.00 100.20 ? 639 CYS B N   1 
ATOM   6774 C  CA  . CYS B 1 447 ? -16.335 56.500 122.747 1.00 102.93 ? 639 CYS B CA  1 
ATOM   6775 C  C   . CYS B 1 447 ? -16.077 56.123 124.215 1.00 106.45 ? 639 CYS B C   1 
ATOM   6776 O  O   . CYS B 1 447 ? -17.012 55.791 124.945 1.00 105.78 ? 639 CYS B O   1 
ATOM   6777 C  CB  . CYS B 1 447 ? -17.303 57.671 122.606 1.00 104.91 ? 639 CYS B CB  1 
ATOM   6778 S  SG  . CYS B 1 447 ? -17.131 58.615 121.048 1.00 109.49 ? 639 CYS B SG  1 
ATOM   6779 N  N   . GLU B 1 448 ? -14.800 56.177 124.618 1.00 108.94 ? 640 GLU B N   1 
ATOM   6780 C  CA  . GLU B 1 448 ? -14.297 55.598 125.879 1.00 112.18 ? 640 GLU B CA  1 
ATOM   6781 C  C   . GLU B 1 448 ? -14.952 56.172 127.127 1.00 111.89 ? 640 GLU B C   1 
ATOM   6782 O  O   . GLU B 1 448 ? -15.405 55.406 127.978 1.00 113.66 ? 640 GLU B O   1 
ATOM   6783 C  CB  . GLU B 1 448 ? -12.766 55.702 125.977 1.00 115.91 ? 640 GLU B CB  1 
ATOM   6784 C  CG  . GLU B 1 448 ? -11.980 54.798 125.010 1.00 117.62 ? 640 GLU B CG  1 
ATOM   6785 C  CD  . GLU B 1 448 ? -10.519 55.214 124.854 1.00 117.94 ? 640 GLU B CD  1 
ATOM   6786 O  OE1 . GLU B 1 448 ? -10.164 56.352 125.235 1.00 120.34 ? 640 GLU B OE1 1 
ATOM   6787 O  OE2 . GLU B 1 448 ? -9.720  54.401 124.341 1.00 120.89 ? 640 GLU B OE2 1 
ATOM   6788 N  N   . PRO B 1 449 ? -14.943 57.516 127.278 1.00 111.83 ? 641 PRO B N   1 
ATOM   6789 C  CA  . PRO B 1 449 ? -16.025 58.155 128.030 1.00 109.42 ? 641 PRO B CA  1 
ATOM   6790 C  C   . PRO B 1 449 ? -17.127 58.546 127.041 1.00 108.00 ? 641 PRO B C   1 
ATOM   6791 O  O   . PRO B 1 449 ? -16.870 59.282 126.087 1.00 107.47 ? 641 PRO B O   1 
ATOM   6792 C  CB  . PRO B 1 449 ? -15.356 59.396 128.641 1.00 107.86 ? 641 PRO B CB  1 
ATOM   6793 C  CG  . PRO B 1 449 ? -14.032 59.561 127.913 1.00 110.09 ? 641 PRO B CG  1 
ATOM   6794 C  CD  . PRO B 1 449 ? -13.933 58.501 126.849 1.00 111.23 ? 641 PRO B CD  1 
ATOM   6795 N  N   . ALA B 1 450 ? -18.336 58.035 127.249 1.00 107.95 ? 642 ALA B N   1 
ATOM   6796 C  CA  . ALA B 1 450 ? -19.429 58.211 126.288 1.00 108.07 ? 642 ALA B CA  1 
ATOM   6797 C  C   . ALA B 1 450 ? -19.787 59.677 126.045 1.00 111.77 ? 642 ALA B C   1 
ATOM   6798 O  O   . ALA B 1 450 ? -19.569 60.524 126.912 1.00 116.67 ? 642 ALA B O   1 
ATOM   6799 C  CB  . ALA B 1 450 ? -20.646 57.444 126.746 1.00 106.44 ? 642 ALA B CB  1 
ATOM   6800 N  N   . CYS B 1 451 ? -20.324 59.970 124.863 1.00 112.50 ? 643 CYS B N   1 
ATOM   6801 C  CA  . CYS B 1 451 ? -20.830 61.304 124.554 1.00 113.96 ? 643 CYS B CA  1 
ATOM   6802 C  C   . CYS B 1 451 ? -22.105 61.554 125.347 1.00 114.21 ? 643 CYS B C   1 
ATOM   6803 O  O   . CYS B 1 451 ? -22.988 60.703 125.387 1.00 116.03 ? 643 CYS B O   1 
ATOM   6804 C  CB  . CYS B 1 451 ? -21.128 61.443 123.064 1.00 117.08 ? 643 CYS B CB  1 
ATOM   6805 S  SG  . CYS B 1 451 ? -19.832 60.821 121.963 1.00 124.04 ? 643 CYS B SG  1 
ATOM   6806 N  N   . ARG B 1 452 ? -22.187 62.721 125.978 1.00 114.45 ? 644 ARG B N   1 
ATOM   6807 C  CA  . ARG B 1 452 ? -23.330 63.097 126.808 1.00 110.52 ? 644 ARG B CA  1 
ATOM   6808 C  C   . ARG B 1 452 ? -24.348 63.897 125.992 1.00 109.77 ? 644 ARG B C   1 
ATOM   6809 O  O   . ARG B 1 452 ? -24.054 64.343 124.874 1.00 108.24 ? 644 ARG B O   1 
ATOM   6810 C  CB  . ARG B 1 452 ? -22.866 63.946 127.995 1.00 110.45 ? 644 ARG B CB  1 
ATOM   6811 C  CG  . ARG B 1 452 ? -21.635 63.443 128.729 1.00 109.63 ? 644 ARG B CG  1 
ATOM   6812 C  CD  . ARG B 1 452 ? -21.996 62.801 130.047 1.00 109.31 ? 644 ARG B CD  1 
ATOM   6813 N  NE  . ARG B 1 452 ? -20.914 62.908 131.027 1.00 109.60 ? 644 ARG B NE  1 
ATOM   6814 C  CZ  . ARG B 1 452 ? -20.911 63.737 132.071 1.00 108.89 ? 644 ARG B CZ  1 
ATOM   6815 N  NH1 . ARG B 1 452 ? -21.938 64.552 132.291 1.00 109.01 ? 644 ARG B NH1 1 
ATOM   6816 N  NH2 . ARG B 1 452 ? -19.879 63.743 132.907 1.00 107.94 ? 644 ARG B NH2 1 
ATOM   6817 N  N   . HIS B 1 453 ? -25.540 64.073 126.567 1.00 111.24 ? 645 HIS B N   1 
ATOM   6818 C  CA  . HIS B 1 453 ? -26.611 64.910 125.997 1.00 111.13 ? 645 HIS B CA  1 
ATOM   6819 C  C   . HIS B 1 453 ? -26.938 64.575 124.538 1.00 111.36 ? 645 HIS B C   1 
ATOM   6820 O  O   . HIS B 1 453 ? -26.928 65.439 123.661 1.00 111.60 ? 645 HIS B O   1 
ATOM   6821 C  CB  . HIS B 1 453 ? -26.285 66.397 126.183 1.00 109.76 ? 645 HIS B CB  1 
ATOM   6822 C  CG  . HIS B 1 453 ? -25.811 66.735 127.563 1.00 109.26 ? 645 HIS B CG  1 
ATOM   6823 N  ND1 . HIS B 1 453 ? -26.517 66.394 128.697 1.00 109.61 ? 645 HIS B ND1 1 
ATOM   6824 C  CD2 . HIS B 1 453 ? -24.702 67.377 127.992 1.00 107.69 ? 645 HIS B CD2 1 
ATOM   6825 C  CE1 . HIS B 1 453 ? -25.865 66.817 129.765 1.00 107.49 ? 645 HIS B CE1 1 
ATOM   6826 N  NE2 . HIS B 1 453 ? -24.761 67.417 129.363 1.00 107.96 ? 645 HIS B NE2 1 
ATOM   6827 N  N   . GLY B 1 454 ? -27.204 63.295 124.301 1.00 113.24 ? 646 GLY B N   1 
ATOM   6828 C  CA  . GLY B 1 454 ? -27.581 62.792 122.987 1.00 114.64 ? 646 GLY B CA  1 
ATOM   6829 C  C   . GLY B 1 454 ? -26.630 63.048 121.838 1.00 114.07 ? 646 GLY B C   1 
ATOM   6830 O  O   . GLY B 1 454 ? -27.067 63.161 120.699 1.00 112.32 ? 646 GLY B O   1 
ATOM   6831 N  N   . GLY B 1 455 ? -25.336 63.142 122.137 1.00 118.55 ? 647 GLY B N   1 
ATOM   6832 C  CA  . GLY B 1 455 ? -24.300 63.346 121.116 1.00 119.00 ? 647 GLY B CA  1 
ATOM   6833 C  C   . GLY B 1 455 ? -23.887 62.038 120.459 1.00 120.50 ? 647 GLY B C   1 
ATOM   6834 O  O   . GLY B 1 455 ? -23.886 60.986 121.104 1.00 123.76 ? 647 GLY B O   1 
ATOM   6835 N  N   . VAL B 1 456 ? -23.539 62.093 119.177 1.00 116.69 ? 648 VAL B N   1 
ATOM   6836 C  CA  . VAL B 1 456 ? -23.207 60.880 118.440 1.00 113.13 ? 648 VAL B CA  1 
ATOM   6837 C  C   . VAL B 1 456 ? -21.698 60.656 118.440 1.00 115.34 ? 648 VAL B C   1 
ATOM   6838 O  O   . VAL B 1 456 ? -20.922 61.617 118.365 1.00 114.39 ? 648 VAL B O   1 
ATOM   6839 C  CB  . VAL B 1 456 ? -23.715 60.941 116.987 1.00 110.83 ? 648 VAL B CB  1 
ATOM   6840 C  CG1 . VAL B 1 456 ? -23.494 59.612 116.286 1.00 111.28 ? 648 VAL B CG1 1 
ATOM   6841 C  CG2 . VAL B 1 456 ? -25.182 61.314 116.944 1.00 110.71 ? 648 VAL B CG2 1 
ATOM   6842 N  N   . CYS B 1 457 ? -21.294 59.386 118.523 1.00 113.94 ? 649 CYS B N   1 
ATOM   6843 C  CA  . CYS B 1 457 ? -19.887 59.001 118.416 1.00 111.97 ? 649 CYS B CA  1 
ATOM   6844 C  C   . CYS B 1 457 ? -19.526 58.695 116.947 1.00 110.79 ? 649 CYS B C   1 
ATOM   6845 O  O   . CYS B 1 457 ? -19.564 57.542 116.514 1.00 110.25 ? 649 CYS B O   1 
ATOM   6846 C  CB  . CYS B 1 457 ? -19.599 57.812 119.351 1.00 110.86 ? 649 CYS B CB  1 
ATOM   6847 S  SG  . CYS B 1 457 ? -17.844 57.372 119.590 1.00 114.28 ? 649 CYS B SG  1 
ATOM   6848 N  N   . VAL B 1 458 ? -19.193 59.741 116.190 1.00 109.48 ? 650 VAL B N   1 
ATOM   6849 C  CA  . VAL B 1 458 ? -18.892 59.622 114.751 1.00 111.75 ? 650 VAL B CA  1 
ATOM   6850 C  C   . VAL B 1 458 ? -17.587 58.897 114.439 1.00 109.93 ? 650 VAL B C   1 
ATOM   6851 O  O   . VAL B 1 458 ? -17.509 58.103 113.497 1.00 108.11 ? 650 VAL B O   1 
ATOM   6852 C  CB  . VAL B 1 458 ? -18.845 60.996 114.043 1.00 115.84 ? 650 VAL B CB  1 
ATOM   6853 C  CG1 . VAL B 1 458 ? -20.088 61.203 113.179 1.00 119.12 ? 650 VAL B CG1 1 
ATOM   6854 C  CG2 . VAL B 1 458 ? -18.645 62.128 115.052 1.00 116.35 ? 650 VAL B CG2 1 
ATOM   6855 N  N   . ARG B 1 459 ? -16.561 59.208 115.221 1.00 109.02 ? 651 ARG B N   1 
ATOM   6856 C  CA  . ARG B 1 459 ? -15.265 58.556 115.118 1.00 106.79 ? 651 ARG B CA  1 
ATOM   6857 C  C   . ARG B 1 459 ? -14.879 58.089 116.519 1.00 102.75 ? 651 ARG B C   1 
ATOM   6858 O  O   . ARG B 1 459 ? -15.538 58.478 117.493 1.00 102.56 ? 651 ARG B O   1 
ATOM   6859 C  CB  . ARG B 1 459 ? -14.234 59.516 114.532 1.00 108.75 ? 651 ARG B CB  1 
ATOM   6860 C  CG  . ARG B 1 459 ? -14.308 59.618 113.024 1.00 113.92 ? 651 ARG B CG  1 
ATOM   6861 C  CD  . ARG B 1 459 ? -13.660 60.887 112.513 1.00 119.80 ? 651 ARG B CD  1 
ATOM   6862 N  NE  . ARG B 1 459 ? -14.502 62.057 112.755 1.00 125.29 ? 651 ARG B NE  1 
ATOM   6863 C  CZ  . ARG B 1 459 ? -14.395 63.216 112.106 1.00 129.47 ? 651 ARG B CZ  1 
ATOM   6864 N  NH1 . ARG B 1 459 ? -13.477 63.384 111.154 1.00 129.60 ? 651 ARG B NH1 1 
ATOM   6865 N  NH2 . ARG B 1 459 ? -15.216 64.215 112.413 1.00 130.98 ? 651 ARG B NH2 1 
ATOM   6866 N  N   . PRO B 1 460 ? -13.863 57.208 116.628 1.00 96.45  ? 652 PRO B N   1 
ATOM   6867 C  CA  . PRO B 1 460 ? -13.443 56.743 117.946 1.00 96.32  ? 652 PRO B CA  1 
ATOM   6868 C  C   . PRO B 1 460 ? -13.033 57.897 118.854 1.00 99.60  ? 652 PRO B C   1 
ATOM   6869 O  O   . PRO B 1 460 ? -12.139 58.661 118.512 1.00 100.46 ? 652 PRO B O   1 
ATOM   6870 C  CB  . PRO B 1 460 ? -12.259 55.834 117.633 1.00 93.59  ? 652 PRO B CB  1 
ATOM   6871 C  CG  . PRO B 1 460 ? -12.510 55.373 116.249 1.00 91.91  ? 652 PRO B CG  1 
ATOM   6872 C  CD  . PRO B 1 460 ? -13.090 56.557 115.558 1.00 91.80  ? 652 PRO B CD  1 
ATOM   6873 N  N   . ASN B 1 461 ? -13.726 58.028 119.984 1.00 103.80 ? 653 ASN B N   1 
ATOM   6874 C  CA  . ASN B 1 461 ? -13.514 59.109 120.953 1.00 105.37 ? 653 ASN B CA  1 
ATOM   6875 C  C   . ASN B 1 461 ? -13.750 60.530 120.440 1.00 107.63 ? 653 ASN B C   1 
ATOM   6876 O  O   . ASN B 1 461 ? -13.457 61.498 121.141 1.00 111.34 ? 653 ASN B O   1 
ATOM   6877 C  CB  . ASN B 1 461 ? -12.150 58.983 121.635 1.00 105.28 ? 653 ASN B CB  1 
ATOM   6878 C  CG  . ASN B 1 461 ? -12.102 57.836 122.615 1.00 105.84 ? 653 ASN B CG  1 
ATOM   6879 O  OD1 . ASN B 1 461 ? -12.362 56.684 122.265 1.00 104.06 ? 653 ASN B OD1 1 
ATOM   6880 N  ND2 . ASN B 1 461 ? -11.762 58.145 123.858 1.00 108.76 ? 653 ASN B ND2 1 
ATOM   6881 N  N   . LYS B 1 462 ? -14.286 60.655 119.229 1.00 108.60 ? 654 LYS B N   1 
ATOM   6882 C  CA  . LYS B 1 462 ? -14.780 61.940 118.739 1.00 111.35 ? 654 LYS B CA  1 
ATOM   6883 C  C   . LYS B 1 462 ? -16.298 61.974 118.882 1.00 114.63 ? 654 LYS B C   1 
ATOM   6884 O  O   . LYS B 1 462 ? -16.990 61.031 118.470 1.00 116.00 ? 654 LYS B O   1 
ATOM   6885 C  CB  . LYS B 1 462 ? -14.395 62.148 117.277 1.00 111.36 ? 654 LYS B CB  1 
ATOM   6886 C  CG  . LYS B 1 462 ? -13.875 63.541 116.966 1.00 112.89 ? 654 LYS B CG  1 
ATOM   6887 C  CD  . LYS B 1 462 ? -14.007 63.870 115.491 1.00 113.35 ? 654 LYS B CD  1 
ATOM   6888 C  CE  . LYS B 1 462 ? -12.725 64.478 114.924 1.00 114.75 ? 654 LYS B CE  1 
ATOM   6889 N  NZ  . LYS B 1 462 ? -11.711 63.447 114.507 1.00 113.38 ? 654 LYS B NZ  1 
ATOM   6890 N  N   . CYS B 1 463 ? -16.813 63.047 119.479 1.00 115.83 ? 655 CYS B N   1 
ATOM   6891 C  CA  . CYS B 1 463 ? -18.261 63.213 119.646 1.00 115.23 ? 655 CYS B CA  1 
ATOM   6892 C  C   . CYS B 1 463 ? -18.789 64.345 118.789 1.00 116.47 ? 655 CYS B C   1 
ATOM   6893 O  O   . CYS B 1 463 ? -18.204 65.419 118.740 1.00 120.16 ? 655 CYS B O   1 
ATOM   6894 C  CB  . CYS B 1 463 ? -18.628 63.485 121.101 1.00 114.60 ? 655 CYS B CB  1 
ATOM   6895 S  SG  . CYS B 1 463 ? -18.279 62.126 122.225 1.00 122.04 ? 655 CYS B SG  1 
ATOM   6896 N  N   . LEU B 1 464 ? -19.889 64.092 118.096 1.00 118.08 ? 656 LEU B N   1 
ATOM   6897 C  CA  . LEU B 1 464 ? -20.635 65.151 117.453 1.00 117.29 ? 656 LEU B CA  1 
ATOM   6898 C  C   . LEU B 1 464 ? -21.713 65.527 118.453 1.00 120.92 ? 656 LEU B C   1 
ATOM   6899 O  O   . LEU B 1 464 ? -22.519 64.675 118.860 1.00 120.71 ? 656 LEU B O   1 
ATOM   6900 C  CB  . LEU B 1 464 ? -21.274 64.649 116.165 1.00 116.05 ? 656 LEU B CB  1 
ATOM   6901 C  CG  . LEU B 1 464 ? -21.534 65.587 114.986 1.00 113.91 ? 656 LEU B CG  1 
ATOM   6902 C  CD1 . LEU B 1 464 ? -22.702 65.029 114.188 1.00 114.31 ? 656 LEU B CD1 1 
ATOM   6903 C  CD2 . LEU B 1 464 ? -21.821 67.015 115.404 1.00 113.93 ? 656 LEU B CD2 1 
ATOM   6904 N  N   . CYS B 1 465 ? -21.713 66.796 118.857 1.00 122.68 ? 657 CYS B N   1 
ATOM   6905 C  CA  . CYS B 1 465 ? -22.638 67.300 119.875 1.00 120.09 ? 657 CYS B CA  1 
ATOM   6906 C  C   . CYS B 1 465 ? -23.857 68.003 119.285 1.00 116.86 ? 657 CYS B C   1 
ATOM   6907 O  O   . CYS B 1 465 ? -23.844 68.434 118.129 1.00 114.58 ? 657 CYS B O   1 
ATOM   6908 C  CB  . CYS B 1 465 ? -21.904 68.254 120.814 1.00 119.03 ? 657 CYS B CB  1 
ATOM   6909 S  SG  . CYS B 1 465 ? -20.529 67.491 121.680 1.00 119.79 ? 657 CYS B SG  1 
ATOM   6910 N  N   . LYS B 1 466 ? -24.906 68.123 120.093 1.00 115.28 ? 658 LYS B N   1 
ATOM   6911 C  CA  . LYS B 1 466 ? -26.070 68.907 119.700 1.00 115.41 ? 658 LYS B CA  1 
ATOM   6912 C  C   . LYS B 1 466 ? -25.971 70.335 120.234 1.00 114.50 ? 658 LYS B C   1 
ATOM   6913 O  O   . LYS B 1 466 ? -25.316 70.585 121.246 1.00 116.43 ? 658 LYS B O   1 
ATOM   6914 C  CB  . LYS B 1 466 ? -27.352 68.220 120.149 1.00 117.30 ? 658 LYS B CB  1 
ATOM   6915 C  CG  . LYS B 1 466 ? -27.424 66.787 119.678 1.00 119.58 ? 658 LYS B CG  1 
ATOM   6916 C  CD  . LYS B 1 466 ? -28.748 66.482 119.009 1.00 122.96 ? 658 LYS B CD  1 
ATOM   6917 C  CE  . LYS B 1 466 ? -28.604 65.345 118.013 1.00 123.79 ? 658 LYS B CE  1 
ATOM   6918 N  NZ  . LYS B 1 466 ? -27.688 64.281 118.503 1.00 122.11 ? 658 LYS B NZ  1 
ATOM   6919 N  N   . LYS B 1 467 ? -26.610 71.269 119.538 1.00 113.29 ? 659 LYS B N   1 
ATOM   6920 C  CA  . LYS B 1 467 ? -26.517 72.699 119.869 1.00 111.45 ? 659 LYS B CA  1 
ATOM   6921 C  C   . LYS B 1 467 ? -26.725 72.966 121.363 1.00 110.20 ? 659 LYS B C   1 
ATOM   6922 O  O   . LYS B 1 467 ? -27.654 72.429 121.991 1.00 110.53 ? 659 LYS B O   1 
ATOM   6923 C  CB  . LYS B 1 467 ? -27.522 73.495 119.037 1.00 110.72 ? 659 LYS B CB  1 
ATOM   6924 C  CG  . LYS B 1 467 ? -27.140 74.916 118.723 1.00 112.01 ? 659 LYS B CG  1 
ATOM   6925 C  CD  . LYS B 1 467 ? -28.060 75.426 117.626 1.00 117.31 ? 659 LYS B CD  1 
ATOM   6926 C  CE  . LYS B 1 467 ? -28.194 76.938 117.636 1.00 121.16 ? 659 LYS B CE  1 
ATOM   6927 N  NZ  . LYS B 1 467 ? -29.388 77.360 116.847 1.00 123.41 ? 659 LYS B NZ  1 
ATOM   6928 N  N   . GLY B 1 468 ? -25.834 73.779 121.925 1.00 106.20 ? 660 GLY B N   1 
ATOM   6929 C  CA  . GLY B 1 468 ? -25.878 74.122 123.340 1.00 101.31 ? 660 GLY B CA  1 
ATOM   6930 C  C   . GLY B 1 468 ? -25.114 73.181 124.253 1.00 98.77  ? 660 GLY B C   1 
ATOM   6931 O  O   . GLY B 1 468 ? -25.209 73.299 125.473 1.00 96.19  ? 660 GLY B O   1 
ATOM   6932 N  N   . TYR B 1 469 ? -24.368 72.240 123.678 1.00 99.63  ? 661 TYR B N   1 
ATOM   6933 C  CA  . TYR B 1 469 ? -23.548 71.333 124.481 1.00 100.63 ? 661 TYR B CA  1 
ATOM   6934 C  C   . TYR B 1 469 ? -22.125 71.248 123.981 1.00 106.38 ? 661 TYR B C   1 
ATOM   6935 O  O   . TYR B 1 469 ? -21.844 70.555 123.007 1.00 111.36 ? 661 TYR B O   1 
ATOM   6936 C  CB  . TYR B 1 469 ? -24.173 69.951 124.566 1.00 98.35  ? 661 TYR B CB  1 
ATOM   6937 C  CG  . TYR B 1 469 ? -25.554 69.985 125.166 1.00 99.57  ? 661 TYR B CG  1 
ATOM   6938 C  CD1 . TYR B 1 469 ? -26.680 70.090 124.353 1.00 99.83  ? 661 TYR B CD1 1 
ATOM   6939 C  CD2 . TYR B 1 469 ? -25.736 69.948 126.548 1.00 98.59  ? 661 TYR B CD2 1 
ATOM   6940 C  CE1 . TYR B 1 469 ? -27.952 70.134 124.899 1.00 102.10 ? 661 TYR B CE1 1 
ATOM   6941 C  CE2 . TYR B 1 469 ? -27.002 69.986 127.106 1.00 99.68  ? 661 TYR B CE2 1 
ATOM   6942 C  CZ  . TYR B 1 469 ? -28.110 70.084 126.277 1.00 101.17 ? 661 TYR B CZ  1 
ATOM   6943 O  OH  . TYR B 1 469 ? -29.380 70.132 126.812 1.00 100.13 ? 661 TYR B OH  1 
ATOM   6944 N  N   . LEU B 1 470 ? -21.240 71.974 124.663 1.00 108.91 ? 662 LEU B N   1 
ATOM   6945 C  CA  . LEU B 1 470 ? -19.816 72.033 124.338 1.00 108.61 ? 662 LEU B CA  1 
ATOM   6946 C  C   . LEU B 1 470 ? -19.022 71.007 125.149 1.00 107.75 ? 662 LEU B C   1 
ATOM   6947 O  O   . LEU B 1 470 ? -19.533 70.433 126.112 1.00 106.64 ? 662 LEU B O   1 
ATOM   6948 C  CB  . LEU B 1 470 ? -19.280 73.439 124.618 1.00 109.39 ? 662 LEU B CB  1 
ATOM   6949 C  CG  . LEU B 1 470 ? -20.044 74.636 124.040 1.00 110.70 ? 662 LEU B CG  1 
ATOM   6950 C  CD1 . LEU B 1 470 ? -20.080 75.778 125.045 1.00 110.46 ? 662 LEU B CD1 1 
ATOM   6951 C  CD2 . LEU B 1 470 ? -19.461 75.099 122.703 1.00 111.16 ? 662 LEU B CD2 1 
ATOM   6952 N  N   . GLY B 1 471 ? -17.773 70.781 124.752 1.00 108.46 ? 663 GLY B N   1 
ATOM   6953 C  CA  . GLY B 1 471 ? -16.883 69.881 125.479 1.00 110.48 ? 663 GLY B CA  1 
ATOM   6954 C  C   . GLY B 1 471 ? -16.597 68.592 124.736 1.00 113.70 ? 663 GLY B C   1 
ATOM   6955 O  O   . GLY B 1 471 ? -17.389 68.186 123.879 1.00 116.77 ? 663 GLY B O   1 
ATOM   6956 N  N   . PRO B 1 472 ? -15.468 67.930 125.067 1.00 114.11 ? 664 PRO B N   1 
ATOM   6957 C  CA  . PRO B 1 472 ? -15.020 66.688 124.428 1.00 114.15 ? 664 PRO B CA  1 
ATOM   6958 C  C   . PRO B 1 472 ? -16.115 65.630 124.289 1.00 114.65 ? 664 PRO B C   1 
ATOM   6959 O  O   . PRO B 1 472 ? -16.160 64.945 123.270 1.00 118.09 ? 664 PRO B O   1 
ATOM   6960 C  CB  . PRO B 1 472 ? -13.917 66.194 125.365 1.00 113.78 ? 664 PRO B CB  1 
ATOM   6961 C  CG  . PRO B 1 472 ? -13.359 67.428 125.953 1.00 114.99 ? 664 PRO B CG  1 
ATOM   6962 C  CD  . PRO B 1 472 ? -14.527 68.365 126.117 1.00 114.88 ? 664 PRO B CD  1 
ATOM   6963 N  N   . GLN B 1 473 ? -16.978 65.505 125.299 1.00 112.38 ? 665 GLN B N   1 
ATOM   6964 C  CA  . GLN B 1 473 ? -18.106 64.566 125.258 1.00 109.73 ? 665 GLN B CA  1 
ATOM   6965 C  C   . GLN B 1 473 ? -19.456 65.275 125.368 1.00 110.24 ? 665 GLN B C   1 
ATOM   6966 O  O   . GLN B 1 473 ? -20.432 64.687 125.839 1.00 106.42 ? 665 GLN B O   1 
ATOM   6967 C  CB  . GLN B 1 473 ? -18.001 63.531 126.379 1.00 106.40 ? 665 GLN B CB  1 
ATOM   6968 C  CG  . GLN B 1 473 ? -16.826 62.597 126.269 1.00 105.67 ? 665 GLN B CG  1 
ATOM   6969 C  CD  . GLN B 1 473 ? -15.655 63.012 127.131 1.00 102.56 ? 665 GLN B CD  1 
ATOM   6970 O  OE1 . GLN B 1 473 ? -15.774 63.144 128.352 1.00 100.75 ? 665 GLN B OE1 1 
ATOM   6971 N  NE2 . GLN B 1 473 ? -14.509 63.198 126.501 1.00 101.98 ? 665 GLN B NE2 1 
ATOM   6972 N  N   . CYS B 1 474 ? -19.512 66.533 124.931 1.00 111.38 ? 666 CYS B N   1 
ATOM   6973 C  CA  . CYS B 1 474 ? -20.714 67.352 125.088 1.00 113.49 ? 666 CYS B CA  1 
ATOM   6974 C  C   . CYS B 1 474 ? -21.094 67.433 126.571 1.00 112.60 ? 666 CYS B C   1 
ATOM   6975 O  O   . CYS B 1 474 ? -22.268 67.400 126.936 1.00 111.19 ? 666 CYS B O   1 
ATOM   6976 C  CB  . CYS B 1 474 ? -21.869 66.766 124.273 1.00 116.14 ? 666 CYS B CB  1 
ATOM   6977 S  SG  . CYS B 1 474 ? -21.366 65.978 122.745 1.00 119.49 ? 666 CYS B SG  1 
ATOM   6978 N  N   . GLU B 1 475 ? -20.077 67.536 127.419 1.00 110.45 ? 667 GLU B N   1 
ATOM   6979 C  CA  . GLU B 1 475 ? -20.251 67.434 128.859 1.00 108.36 ? 667 GLU B CA  1 
ATOM   6980 C  C   . GLU B 1 475 ? -20.920 68.663 129.471 1.00 105.73 ? 667 GLU B C   1 
ATOM   6981 O  O   . GLU B 1 475 ? -21.742 68.523 130.367 1.00 104.31 ? 667 GLU B O   1 
ATOM   6982 C  CB  . GLU B 1 475 ? -18.902 67.133 129.525 1.00 110.56 ? 667 GLU B CB  1 
ATOM   6983 C  CG  . GLU B 1 475 ? -17.753 67.998 129.001 1.00 113.98 ? 667 GLU B CG  1 
ATOM   6984 C  CD  . GLU B 1 475 ? -16.383 67.386 129.213 1.00 114.65 ? 667 GLU B CD  1 
ATOM   6985 O  OE1 . GLU B 1 475 ? -15.646 67.861 130.109 1.00 111.54 ? 667 GLU B OE1 1 
ATOM   6986 O  OE2 . GLU B 1 475 ? -16.045 66.434 128.474 1.00 116.28 ? 667 GLU B OE2 1 
ATOM   6987 N  N   . HIS B 1 476 ? -20.579 69.855 128.975 1.00 106.72 ? 668 HIS B N   1 
ATOM   6988 C  CA  . HIS B 1 476 ? -21.076 71.122 129.540 1.00 107.99 ? 668 HIS B CA  1 
ATOM   6989 C  C   . HIS B 1 476 ? -22.115 71.798 128.644 1.00 107.22 ? 668 HIS B C   1 
ATOM   6990 O  O   . HIS B 1 476 ? -22.195 71.507 127.458 1.00 107.57 ? 668 HIS B O   1 
ATOM   6991 C  CB  . HIS B 1 476 ? -19.922 72.100 129.811 1.00 108.69 ? 668 HIS B CB  1 
ATOM   6992 C  CG  . HIS B 1 476 ? -18.755 71.488 130.520 1.00 109.22 ? 668 HIS B CG  1 
ATOM   6993 N  ND1 . HIS B 1 476 ? -18.739 71.265 131.880 1.00 109.35 ? 668 HIS B ND1 1 
ATOM   6994 C  CD2 . HIS B 1 476 ? -17.556 71.063 130.055 1.00 109.97 ? 668 HIS B CD2 1 
ATOM   6995 C  CE1 . HIS B 1 476 ? -17.584 70.722 132.221 1.00 110.80 ? 668 HIS B CE1 1 
ATOM   6996 N  NE2 . HIS B 1 476 ? -16.849 70.586 131.132 1.00 111.37 ? 668 HIS B NE2 1 
ATOM   6997 N  N   . HIS B 1 477 ? -22.880 72.726 129.215 1.00 108.55 ? 669 HIS B N   1 
ATOM   6998 C  CA  . HIS B 1 477 ? -23.984 73.376 128.505 1.00 110.56 ? 669 HIS B CA  1 
ATOM   6999 C  C   . HIS B 1 477 ? -23.940 74.926 128.532 1.00 114.04 ? 669 HIS B C   1 
ATOM   7000 O  O   . HIS B 1 477 ? -23.647 75.567 127.514 1.00 112.95 ? 669 HIS B O   1 
ATOM   7001 C  CB  . HIS B 1 477 ? -25.321 72.806 129.025 1.00 108.70 ? 669 HIS B CB  1 
ATOM   7002 C  CG  . HIS B 1 477 ? -26.488 73.736 128.885 1.00 108.18 ? 669 HIS B CG  1 
ATOM   7003 N  ND1 . HIS B 1 477 ? -27.129 73.961 127.685 1.00 109.00 ? 669 HIS B ND1 1 
ATOM   7004 C  CD2 . HIS B 1 477 ? -27.139 74.488 129.804 1.00 107.13 ? 669 HIS B CD2 1 
ATOM   7005 C  CE1 . HIS B 1 477 ? -28.115 74.822 127.869 1.00 106.87 ? 669 HIS B CE1 1 
ATOM   7006 N  NE2 . HIS B 1 477 ? -28.143 75.156 129.146 1.00 106.29 ? 669 HIS B NE2 1 
ATOM   7007 N  N   . HIS B 1 478 ? -24.225 75.509 129.698 1.00 118.67 ? 670 HIS B N   1 
ATOM   7008 C  CA  . HIS B 1 478 ? -24.329 76.969 129.892 1.00 122.77 ? 670 HIS B CA  1 
ATOM   7009 C  C   . HIS B 1 478 ? -25.389 77.660 129.036 1.00 121.61 ? 670 HIS B C   1 
ATOM   7010 O  O   . HIS B 1 478 ? -26.132 78.509 129.534 1.00 119.74 ? 670 HIS B O   1 
ATOM   7011 C  CB  . HIS B 1 478 ? -22.969 77.656 129.726 1.00 127.81 ? 670 HIS B CB  1 
ATOM   7012 C  CG  . HIS B 1 478 ? -21.902 77.084 130.605 1.00 132.15 ? 670 HIS B CG  1 
ATOM   7013 N  ND1 . HIS B 1 478 ? -22.091 76.860 131.953 1.00 133.28 ? 670 HIS B ND1 1 
ATOM   7014 C  CD2 . HIS B 1 478 ? -20.636 76.687 130.331 1.00 132.90 ? 670 HIS B CD2 1 
ATOM   7015 C  CE1 . HIS B 1 478 ? -20.989 76.349 132.470 1.00 133.79 ? 670 HIS B CE1 1 
ATOM   7016 N  NE2 . HIS B 1 478 ? -20.090 76.234 131.508 1.00 133.94 ? 670 HIS B NE2 1 
ATOM   7017 N  N   . LYS C 2 10  ? -1.501  21.641 145.570 1.00 96.99  ? 38  LYS H N   1 
ATOM   7018 C  CA  . LYS C 2 10  ? -0.945  22.820 146.293 1.00 96.55  ? 38  LYS H CA  1 
ATOM   7019 C  C   . LYS C 2 10  ? -0.034  23.645 145.380 1.00 95.85  ? 38  LYS H C   1 
ATOM   7020 O  O   . LYS C 2 10  ? -0.204  24.861 145.264 1.00 96.41  ? 38  LYS H O   1 
ATOM   7021 C  CB  . LYS C 2 10  ? -0.200  22.369 147.558 1.00 96.95  ? 38  LYS H CB  1 
ATOM   7022 C  CG  . LYS C 2 10  ? -0.088  23.429 148.655 1.00 97.16  ? 38  LYS H CG  1 
ATOM   7023 C  CD  . LYS C 2 10  ? 1.205   24.239 148.550 1.00 97.12  ? 38  LYS H CD  1 
ATOM   7024 C  CE  . LYS C 2 10  ? 1.252   25.365 149.581 1.00 96.95  ? 38  LYS H CE  1 
ATOM   7025 N  NZ  . LYS C 2 10  ? 1.301   24.870 150.988 1.00 96.59  ? 38  LYS H NZ  1 
ATOM   7026 N  N   . LEU C 2 11  ? 0.926   22.978 144.738 1.00 94.40  ? 39  LEU H N   1 
ATOM   7027 C  CA  . LEU C 2 11  ? 1.868   23.634 143.828 1.00 92.60  ? 39  LEU H CA  1 
ATOM   7028 C  C   . LEU C 2 11  ? 1.657   23.201 142.378 1.00 91.53  ? 39  LEU H C   1 
ATOM   7029 O  O   . LEU C 2 11  ? 2.159   22.155 141.953 1.00 91.52  ? 39  LEU H O   1 
ATOM   7030 C  CB  . LEU C 2 11  ? 3.319   23.354 144.247 1.00 91.75  ? 39  LEU H CB  1 
ATOM   7031 C  CG  . LEU C 2 11  ? 3.846   23.822 145.607 1.00 90.95  ? 39  LEU H CG  1 
ATOM   7032 C  CD1 . LEU C 2 11  ? 5.229   23.236 145.845 1.00 90.47  ? 39  LEU H CD1 1 
ATOM   7033 C  CD2 . LEU C 2 11  ? 3.881   25.343 145.707 1.00 90.74  ? 39  LEU H CD2 1 
ATOM   7034 N  N   . THR C 2 12  ? 0.912   24.008 141.626 1.00 90.30  ? 40  THR H N   1 
ATOM   7035 C  CA  . THR C 2 12  ? 0.682   23.748 140.203 1.00 89.41  ? 40  THR H CA  1 
ATOM   7036 C  C   . THR C 2 12  ? 1.810   24.331 139.346 1.00 87.20  ? 40  THR H C   1 
ATOM   7037 O  O   . THR C 2 12  ? 2.252   25.456 139.592 1.00 87.28  ? 40  THR H O   1 
ATOM   7038 C  CB  . THR C 2 12  ? -0.688  24.293 139.719 1.00 90.20  ? 40  THR H CB  1 
ATOM   7039 O  OG1 . THR C 2 12  ? -0.939  25.573 140.314 1.00 91.33  ? 40  THR H OG1 1 
ATOM   7040 C  CG2 . THR C 2 12  ? -1.814  23.333 140.092 1.00 90.06  ? 40  THR H CG2 1 
ATOM   7041 N  N   . PRO C 2 13  ? 2.284   23.562 138.344 1.00 84.75  ? 41  PRO H N   1 
ATOM   7042 C  CA  . PRO C 2 13  ? 3.353   24.033 137.465 1.00 82.35  ? 41  PRO H CA  1 
ATOM   7043 C  C   . PRO C 2 13  ? 2.871   25.139 136.533 1.00 80.22  ? 41  PRO H C   1 
ATOM   7044 O  O   . PRO C 2 13  ? 1.716   25.121 136.099 1.00 79.92  ? 41  PRO H O   1 
ATOM   7045 C  CB  . PRO C 2 13  ? 3.720   22.782 136.659 1.00 82.28  ? 41  PRO H CB  1 
ATOM   7046 C  CG  . PRO C 2 13  ? 2.494   21.955 136.659 1.00 82.70  ? 41  PRO H CG  1 
ATOM   7047 C  CD  . PRO C 2 13  ? 1.841   22.200 137.986 1.00 84.25  ? 41  PRO H CD  1 
ATOM   7048 N  N   . LEU C 2 14  ? 3.749   26.096 136.245 1.00 78.24  ? 42  LEU H N   1 
ATOM   7049 C  CA  . LEU C 2 14  ? 3.443   27.155 135.289 1.00 76.23  ? 42  LEU H CA  1 
ATOM   7050 C  C   . LEU C 2 14  ? 3.280   26.594 133.880 1.00 75.34  ? 42  LEU H C   1 
ATOM   7051 O  O   . LEU C 2 14  ? 4.007   25.683 133.474 1.00 75.66  ? 42  LEU H O   1 
ATOM   7052 C  CB  . LEU C 2 14  ? 4.522   28.243 135.303 1.00 75.00  ? 42  LEU H CB  1 
ATOM   7053 C  CG  . LEU C 2 14  ? 4.279   29.472 136.184 1.00 74.26  ? 42  LEU H CG  1 
ATOM   7054 C  CD1 . LEU C 2 14  ? 4.535   29.175 137.654 1.00 72.79  ? 42  LEU H CD1 1 
ATOM   7055 C  CD2 . LEU C 2 14  ? 5.144   30.632 135.713 1.00 74.61  ? 42  LEU H CD2 1 
ATOM   7056 N  N   . ALA C 2 15  ? 2.306   27.132 133.152 1.00 73.49  ? 43  ALA H N   1 
ATOM   7057 C  CA  . ALA C 2 15  ? 2.097   26.778 131.757 1.00 71.23  ? 43  ALA H CA  1 
ATOM   7058 C  C   . ALA C 2 15  ? 3.154   27.469 130.907 1.00 70.68  ? 43  ALA H C   1 
ATOM   7059 O  O   . ALA C 2 15  ? 3.755   28.459 131.335 1.00 69.19  ? 43  ALA H O   1 
ATOM   7060 C  CB  . ALA C 2 15  ? 0.704   27.187 131.314 1.00 71.19  ? 43  ALA H CB  1 
ATOM   7061 N  N   . TYR C 2 16  ? 3.383   26.931 129.711 1.00 71.12  ? 44  TYR H N   1 
ATOM   7062 C  CA  . TYR C 2 16  ? 4.329   27.505 128.762 1.00 71.03  ? 44  TYR H CA  1 
ATOM   7063 C  C   . TYR C 2 16  ? 3.939   28.947 128.430 1.00 69.88  ? 44  TYR H C   1 
ATOM   7064 O  O   . TYR C 2 16  ? 2.761   29.241 128.201 1.00 68.14  ? 44  TYR H O   1 
ATOM   7065 C  CB  . TYR C 2 16  ? 4.400   26.635 127.500 1.00 74.05  ? 44  TYR H CB  1 
ATOM   7066 C  CG  . TYR C 2 16  ? 5.312   27.156 126.408 1.00 75.75  ? 44  TYR H CG  1 
ATOM   7067 C  CD1 . TYR C 2 16  ? 6.684   27.315 126.626 1.00 77.09  ? 44  TYR H CD1 1 
ATOM   7068 C  CD2 . TYR C 2 16  ? 4.805   27.473 125.148 1.00 74.51  ? 44  TYR H CD2 1 
ATOM   7069 C  CE1 . TYR C 2 16  ? 7.521   27.795 125.618 1.00 76.73  ? 44  TYR H CE1 1 
ATOM   7070 C  CE2 . TYR C 2 16  ? 5.631   27.946 124.138 1.00 74.87  ? 44  TYR H CE2 1 
ATOM   7071 C  CZ  . TYR C 2 16  ? 6.983   28.109 124.379 1.00 75.34  ? 44  TYR H CZ  1 
ATOM   7072 O  OH  . TYR C 2 16  ? 7.795   28.578 123.372 1.00 76.42  ? 44  TYR H OH  1 
ATOM   7073 N  N   . LYS C 2 17  ? 4.937   29.834 128.445 1.00 69.86  ? 45  LYS H N   1 
ATOM   7074 C  CA  . LYS C 2 17  ? 4.772   31.274 128.163 1.00 70.78  ? 45  LYS H CA  1 
ATOM   7075 C  C   . LYS C 2 17  ? 3.939   32.031 129.199 1.00 72.53  ? 45  LYS H C   1 
ATOM   7076 O  O   . LYS C 2 17  ? 3.476   33.145 128.934 1.00 73.19  ? 45  LYS H O   1 
ATOM   7077 C  CB  . LYS C 2 17  ? 4.223   31.524 126.749 1.00 69.76  ? 45  LYS H CB  1 
ATOM   7078 C  CG  . LYS C 2 17  ? 5.141   31.082 125.614 1.00 69.59  ? 45  LYS H CG  1 
ATOM   7079 C  CD  . LYS C 2 17  ? 6.322   32.021 125.410 1.00 69.31  ? 45  LYS H CD  1 
ATOM   7080 C  CE  . LYS C 2 17  ? 7.031   31.706 124.108 1.00 69.77  ? 45  LYS H CE  1 
ATOM   7081 N  NZ  . LYS C 2 17  ? 8.180   32.611 123.853 1.00 71.01  ? 45  LYS H NZ  1 
ATOM   7082 N  N   . GLN C 2 18  ? 3.754   31.426 130.372 1.00 73.35  ? 46  GLN H N   1 
ATOM   7083 C  CA  . GLN C 2 18  ? 3.064   32.087 131.475 1.00 72.84  ? 46  GLN H CA  1 
ATOM   7084 C  C   . GLN C 2 18  ? 4.070   32.842 132.323 1.00 73.74  ? 46  GLN H C   1 
ATOM   7085 O  O   . GLN C 2 18  ? 5.154   32.336 132.616 1.00 74.38  ? 46  GLN H O   1 
ATOM   7086 C  CB  . GLN C 2 18  ? 2.299   31.081 132.342 1.00 72.80  ? 46  GLN H CB  1 
ATOM   7087 C  CG  . GLN C 2 18  ? 1.389   31.731 133.393 1.00 71.98  ? 46  GLN H CG  1 
ATOM   7088 C  CD  . GLN C 2 18  ? 0.833   30.750 134.416 1.00 70.92  ? 46  GLN H CD  1 
ATOM   7089 O  OE1 . GLN C 2 18  ? 1.292   29.614 134.530 1.00 69.50  ? 46  GLN H OE1 1 
ATOM   7090 N  NE2 . GLN C 2 18  ? -0.161  31.196 135.172 1.00 70.18  ? 46  GLN H NE2 1 
ATOM   7091 N  N   . PHE C 2 19  ? 3.702   34.059 132.709 1.00 74.88  ? 47  PHE H N   1 
ATOM   7092 C  CA  . PHE C 2 19  ? 4.502   34.838 133.643 1.00 76.69  ? 47  PHE H CA  1 
ATOM   7093 C  C   . PHE C 2 19  ? 3.722   35.204 134.908 1.00 78.11  ? 47  PHE H C   1 
ATOM   7094 O  O   . PHE C 2 19  ? 2.553   35.591 134.844 1.00 80.15  ? 47  PHE H O   1 
ATOM   7095 C  CB  . PHE C 2 19  ? 5.115   36.077 132.970 1.00 76.71  ? 47  PHE H CB  1 
ATOM   7096 C  CG  . PHE C 2 19  ? 4.157   36.853 132.098 1.00 77.70  ? 47  PHE H CG  1 
ATOM   7097 C  CD1 . PHE C 2 19  ? 3.962   36.501 130.763 1.00 77.68  ? 47  PHE H CD1 1 
ATOM   7098 C  CD2 . PHE C 2 19  ? 3.475   37.955 132.602 1.00 77.97  ? 47  PHE H CD2 1 
ATOM   7099 C  CE1 . PHE C 2 19  ? 3.087   37.222 129.953 1.00 77.13  ? 47  PHE H CE1 1 
ATOM   7100 C  CE2 . PHE C 2 19  ? 2.598   38.684 131.796 1.00 77.51  ? 47  PHE H CE2 1 
ATOM   7101 C  CZ  . PHE C 2 19  ? 2.406   38.316 130.471 1.00 77.02  ? 47  PHE H CZ  1 
ATOM   7102 N  N   . ILE C 2 20  ? 4.375   35.046 136.056 1.00 77.05  ? 48  ILE H N   1 
ATOM   7103 C  CA  . ILE C 2 20  ? 3.784   35.382 137.347 1.00 76.18  ? 48  ILE H CA  1 
ATOM   7104 C  C   . ILE C 2 20  ? 4.726   36.322 138.108 1.00 76.22  ? 48  ILE H C   1 
ATOM   7105 O  O   . ILE C 2 20  ? 5.896   35.985 138.317 1.00 76.95  ? 48  ILE H O   1 
ATOM   7106 C  CB  . ILE C 2 20  ? 3.450   34.112 138.172 1.00 76.29  ? 48  ILE H CB  1 
ATOM   7107 C  CG1 . ILE C 2 20  ? 2.318   33.327 137.496 1.00 76.11  ? 48  ILE H CG1 1 
ATOM   7108 C  CG2 . ILE C 2 20  ? 3.078   34.474 139.615 1.00 76.44  ? 48  ILE H CG2 1 
ATOM   7109 C  CD1 . ILE C 2 20  ? 2.062   31.944 138.082 1.00 76.04  ? 48  ILE H CD1 1 
ATOM   7110 N  N   . PRO C 2 21  ? 4.223   37.507 138.519 1.00 75.62  ? 49  PRO H N   1 
ATOM   7111 C  CA  . PRO C 2 21  ? 2.841   37.981 138.378 1.00 74.62  ? 49  PRO H CA  1 
ATOM   7112 C  C   . PRO C 2 21  ? 2.443   38.242 136.928 1.00 73.36  ? 49  PRO H C   1 
ATOM   7113 O  O   . PRO C 2 21  ? 3.301   38.534 136.091 1.00 72.65  ? 49  PRO H O   1 
ATOM   7114 C  CB  . PRO C 2 21  ? 2.839   39.293 139.168 1.00 74.88  ? 49  PRO H CB  1 
ATOM   7115 C  CG  . PRO C 2 21  ? 4.244   39.759 139.120 1.00 75.61  ? 49  PRO H CG  1 
ATOM   7116 C  CD  . PRO C 2 21  ? 5.071   38.512 139.187 1.00 76.04  ? 49  PRO H CD  1 
ATOM   7117 N  N   . ASN C 2 22  ? 1.146   38.137 136.649 1.00 72.10  ? 50  ASN H N   1 
ATOM   7118 C  CA  . ASN C 2 22  ? 0.621   38.312 135.299 1.00 71.09  ? 50  ASN H CA  1 
ATOM   7119 C  C   . ASN C 2 22  ? 0.620   39.777 134.847 1.00 70.53  ? 50  ASN H C   1 
ATOM   7120 O  O   . ASN C 2 22  ? -0.396  40.305 134.393 1.00 69.33  ? 50  ASN H O   1 
ATOM   7121 C  CB  . ASN C 2 22  ? -0.773  37.685 135.182 1.00 72.47  ? 50  ASN H CB  1 
ATOM   7122 C  CG  . ASN C 2 22  ? -1.104  37.237 133.762 1.00 74.14  ? 50  ASN H CG  1 
ATOM   7123 O  OD1 . ASN C 2 22  ? -0.322  37.433 132.827 1.00 74.78  ? 50  ASN H OD1 1 
ATOM   7124 N  ND2 . ASN C 2 22  ? -2.272  36.627 133.598 1.00 74.91  ? 50  ASN H ND2 1 
ATOM   7125 N  N   . VAL C 2 23  ? 1.778   40.418 134.989 1.00 71.11  ? 51  VAL H N   1 
ATOM   7126 C  CA  . VAL C 2 23  ? 2.033   41.769 134.480 1.00 71.40  ? 51  VAL H CA  1 
ATOM   7127 C  C   . VAL C 2 23  ? 3.413   41.812 133.819 1.00 71.83  ? 51  VAL H C   1 
ATOM   7128 O  O   . VAL C 2 23  ? 4.189   40.857 133.932 1.00 71.73  ? 51  VAL H O   1 
ATOM   7129 C  CB  . VAL C 2 23  ? 1.951   42.854 135.594 1.00 71.17  ? 51  VAL H CB  1 
ATOM   7130 C  CG1 . VAL C 2 23  ? 0.503   43.154 135.959 1.00 71.23  ? 51  VAL H CG1 1 
ATOM   7131 C  CG2 . VAL C 2 23  ? 2.761   42.450 136.828 1.00 71.19  ? 51  VAL H CG2 1 
ATOM   7132 N  N   . ALA C 2 24  ? 3.714   42.914 133.132 1.00 72.34  ? 52  ALA H N   1 
ATOM   7133 C  CA  . ALA C 2 24  ? 5.017   43.099 132.491 1.00 73.07  ? 52  ALA H CA  1 
ATOM   7134 C  C   . ALA C 2 24  ? 6.137   43.106 133.527 1.00 75.47  ? 52  ALA H C   1 
ATOM   7135 O  O   . ALA C 2 24  ? 5.928   43.508 134.672 1.00 76.94  ? 52  ALA H O   1 
ATOM   7136 C  CB  . ALA C 2 24  ? 5.036   44.382 131.679 1.00 72.04  ? 52  ALA H CB  1 
ATOM   7137 N  N   . GLU C 2 25  ? 7.318   42.655 133.111 1.00 77.01  ? 53  GLU H N   1 
ATOM   7138 C  CA  . GLU C 2 25  ? 8.492   42.545 133.983 1.00 77.86  ? 53  GLU H CA  1 
ATOM   7139 C  C   . GLU C 2 25  ? 8.870   43.867 134.658 1.00 78.24  ? 53  GLU H C   1 
ATOM   7140 O  O   . GLU C 2 25  ? 9.189   43.899 135.848 1.00 77.39  ? 53  GLU H O   1 
ATOM   7141 C  CB  . GLU C 2 25  ? 9.681   42.015 133.171 1.00 78.08  ? 53  GLU H CB  1 
ATOM   7142 C  CG  . GLU C 2 25  ? 10.957  41.773 133.969 1.00 78.15  ? 53  GLU H CG  1 
ATOM   7143 C  CD  . GLU C 2 25  ? 12.045  41.112 133.143 1.00 78.03  ? 53  GLU H CD  1 
ATOM   7144 O  OE1 . GLU C 2 25  ? 12.409  41.654 132.077 1.00 77.46  ? 53  GLU H OE1 1 
ATOM   7145 O  OE2 . GLU C 2 25  ? 12.545  40.050 133.568 1.00 78.06  ? 53  GLU H OE2 1 
ATOM   7146 N  N   . LYS C 2 26  ? 8.817   44.950 133.886 1.00 80.04  ? 54  LYS H N   1 
ATOM   7147 C  CA  . LYS C 2 26  ? 9.302   46.263 134.316 1.00 81.00  ? 54  LYS H CA  1 
ATOM   7148 C  C   . LYS C 2 26  ? 8.278   47.077 135.118 1.00 80.70  ? 54  LYS H C   1 
ATOM   7149 O  O   . LYS C 2 26  ? 8.568   48.203 135.531 1.00 80.05  ? 54  LYS H O   1 
ATOM   7150 C  CB  . LYS C 2 26  ? 9.775   47.082 133.103 1.00 82.64  ? 54  LYS H CB  1 
ATOM   7151 C  CG  . LYS C 2 26  ? 10.676  46.338 132.114 1.00 83.63  ? 54  LYS H CG  1 
ATOM   7152 C  CD  . LYS C 2 26  ? 12.140  46.326 132.548 1.00 83.43  ? 54  LYS H CD  1 
ATOM   7153 C  CE  . LYS C 2 26  ? 13.010  45.593 131.531 1.00 82.82  ? 54  LYS H CE  1 
ATOM   7154 N  NZ  . LYS C 2 26  ? 13.049  46.270 130.199 1.00 80.92  ? 54  LYS H NZ  1 
ATOM   7155 N  N   . THR C 2 27  ? 7.089   46.515 135.331 1.00 80.72  ? 55  THR H N   1 
ATOM   7156 C  CA  . THR C 2 27  ? 6.043   47.201 136.096 1.00 80.58  ? 55  THR H CA  1 
ATOM   7157 C  C   . THR C 2 27  ? 6.328   47.163 137.599 1.00 81.48  ? 55  THR H C   1 
ATOM   7158 O  O   . THR C 2 27  ? 7.158   46.375 138.066 1.00 81.92  ? 55  THR H O   1 
ATOM   7159 C  CB  . THR C 2 27  ? 4.628   46.643 135.808 1.00 79.87  ? 55  THR H CB  1 
ATOM   7160 O  OG1 . THR C 2 27  ? 4.578   45.247 136.128 1.00 79.58  ? 55  THR H OG1 1 
ATOM   7161 C  CG2 . THR C 2 27  ? 4.251   46.849 134.347 1.00 79.69  ? 55  THR H CG2 1 
ATOM   7162 N  N   . LEU C 2 28  ? 5.631   48.021 138.341 1.00 81.69  ? 56  LEU H N   1 
ATOM   7163 C  CA  . LEU C 2 28  ? 5.854   48.204 139.775 1.00 81.79  ? 56  LEU H CA  1 
ATOM   7164 C  C   . LEU C 2 28  ? 5.539   46.944 140.584 1.00 81.28  ? 56  LEU H C   1 
ATOM   7165 O  O   . LEU C 2 28  ? 6.190   46.672 141.594 1.00 81.48  ? 56  LEU H O   1 
ATOM   7166 C  CB  . LEU C 2 28  ? 5.026   49.392 140.280 1.00 82.33  ? 56  LEU H CB  1 
ATOM   7167 C  CG  . LEU C 2 28  ? 5.647   50.336 141.315 1.00 83.02  ? 56  LEU H CG  1 
ATOM   7168 C  CD1 . LEU C 2 28  ? 5.164   51.766 141.097 1.00 82.70  ? 56  LEU H CD1 1 
ATOM   7169 C  CD2 . LEU C 2 28  ? 5.382   49.878 142.750 1.00 83.73  ? 56  LEU H CD2 1 
ATOM   7170 N  N   . GLY C 2 29  ? 4.550   46.178 140.126 1.00 80.60  ? 57  GLY H N   1 
ATOM   7171 C  CA  . GLY C 2 29  ? 4.138   44.944 140.795 1.00 79.46  ? 57  GLY H CA  1 
ATOM   7172 C  C   . GLY C 2 29  ? 5.069   43.766 140.567 1.00 78.47  ? 57  GLY H C   1 
ATOM   7173 O  O   . GLY C 2 29  ? 5.015   42.776 141.300 1.00 77.87  ? 57  GLY H O   1 
ATOM   7174 N  N   . ALA C 2 30  ? 5.925   43.875 139.552 1.00 78.17  ? 58  ALA H N   1 
ATOM   7175 C  CA  . ALA C 2 30  ? 6.837   42.794 139.189 1.00 77.82  ? 58  ALA H CA  1 
ATOM   7176 C  C   . ALA C 2 30  ? 8.276   43.062 139.643 1.00 77.66  ? 58  ALA H C   1 
ATOM   7177 O  O   . ALA C 2 30  ? 8.581   42.937 140.830 1.00 78.20  ? 58  ALA H O   1 
ATOM   7178 C  CB  . ALA C 2 30  ? 6.771   42.518 137.692 1.00 77.33  ? 58  ALA H CB  1 
ATOM   7179 N  N   . SER C 2 31  ? 9.145   43.441 138.706 1.00 76.90  ? 59  SER H N   1 
ATOM   7180 C  CA  . SER C 2 31  ? 10.578  43.567 138.986 1.00 76.91  ? 59  SER H CA  1 
ATOM   7181 C  C   . SER C 2 31  ? 11.147  44.979 138.810 1.00 77.39  ? 59  SER H C   1 
ATOM   7182 O  O   . SER C 2 31  ? 12.365  45.172 138.854 1.00 76.84  ? 59  SER H O   1 
ATOM   7183 C  CB  . SER C 2 31  ? 11.372  42.560 138.149 1.00 76.63  ? 59  SER H CB  1 
ATOM   7184 O  OG  . SER C 2 31  ? 11.154  41.237 138.608 1.00 75.83  ? 59  SER H OG  1 
ATOM   7185 N  N   . GLY C 2 32  ? 10.267  45.959 138.613 1.00 78.81  ? 60  GLY H N   1 
ATOM   7186 C  CA  . GLY C 2 32  ? 10.674  47.366 138.539 1.00 80.64  ? 60  GLY H CA  1 
ATOM   7187 C  C   . GLY C 2 32  ? 11.403  47.758 137.266 1.00 81.77  ? 60  GLY H C   1 
ATOM   7188 O  O   . GLY C 2 32  ? 11.709  46.910 136.426 1.00 82.89  ? 60  GLY H O   1 
ATOM   7189 N  N   . ARG C 2 33  ? 11.694  49.051 137.139 1.00 82.21  ? 61  ARG H N   1 
ATOM   7190 C  CA  . ARG C 2 33  ? 12.283  49.612 135.920 1.00 83.45  ? 61  ARG H CA  1 
ATOM   7191 C  C   . ARG C 2 33  ? 13.749  49.248 135.697 1.00 83.35  ? 61  ARG H C   1 
ATOM   7192 O  O   . ARG C 2 33  ? 14.520  49.104 136.648 1.00 83.60  ? 61  ARG H O   1 
ATOM   7193 C  CB  . ARG C 2 33  ? 12.132  51.134 135.897 1.00 84.63  ? 61  ARG H CB  1 
ATOM   7194 C  CG  . ARG C 2 33  ? 10.782  51.621 135.394 1.00 86.21  ? 61  ARG H CG  1 
ATOM   7195 C  CD  . ARG C 2 33  ? 10.795  53.123 135.136 1.00 86.59  ? 61  ARG H CD  1 
ATOM   7196 N  NE  . ARG C 2 33  ? 11.124  53.884 136.342 1.00 85.94  ? 61  ARG H NE  1 
ATOM   7197 C  CZ  . ARG C 2 33  ? 11.327  55.198 136.374 1.00 85.36  ? 61  ARG H CZ  1 
ATOM   7198 N  NH1 . ARG C 2 33  ? 11.236  55.923 135.265 1.00 85.28  ? 61  ARG H NH1 1 
ATOM   7199 N  NH2 . ARG C 2 33  ? 11.623  55.791 137.522 1.00 84.90  ? 61  ARG H NH2 1 
ATOM   7200 N  N   . TYR C 2 34  ? 14.108  49.113 134.421 1.00 82.81  ? 62  TYR H N   1 
ATOM   7201 C  CA  . TYR C 2 34  ? 15.489  48.936 133.980 1.00 81.73  ? 62  TYR H CA  1 
ATOM   7202 C  C   . TYR C 2 34  ? 16.272  50.210 134.300 1.00 81.49  ? 62  TYR H C   1 
ATOM   7203 O  O   . TYR C 2 34  ? 15.912  51.298 133.844 1.00 82.31  ? 62  TYR H O   1 
ATOM   7204 C  CB  . TYR C 2 34  ? 15.500  48.631 132.474 1.00 80.24  ? 62  TYR H CB  1 
ATOM   7205 C  CG  . TYR C 2 34  ? 16.863  48.546 131.813 1.00 79.72  ? 62  TYR H CG  1 
ATOM   7206 C  CD1 . TYR C 2 34  ? 17.636  47.387 131.899 1.00 79.67  ? 62  TYR H CD1 1 
ATOM   7207 C  CD2 . TYR C 2 34  ? 17.361  49.616 131.069 1.00 79.45  ? 62  TYR H CD2 1 
ATOM   7208 C  CE1 . TYR C 2 34  ? 18.882  47.305 131.277 1.00 79.71  ? 62  TYR H CE1 1 
ATOM   7209 C  CE2 . TYR C 2 34  ? 18.602  49.545 130.445 1.00 79.82  ? 62  TYR H CE2 1 
ATOM   7210 C  CZ  . TYR C 2 34  ? 19.357  48.389 130.553 1.00 79.83  ? 62  TYR H CZ  1 
ATOM   7211 O  OH  . TYR C 2 34  ? 20.583  48.326 129.932 1.00 79.71  ? 62  TYR H OH  1 
ATOM   7212 N  N   . GLU C 2 35  ? 17.326  50.073 135.100 1.00 80.45  ? 63  GLU H N   1 
ATOM   7213 C  CA  . GLU C 2 35  ? 18.098  51.230 135.556 1.00 79.72  ? 63  GLU H CA  1 
ATOM   7214 C  C   . GLU C 2 35  ? 19.294  51.557 134.664 1.00 78.96  ? 63  GLU H C   1 
ATOM   7215 O  O   . GLU C 2 35  ? 19.755  52.699 134.638 1.00 79.77  ? 63  GLU H O   1 
ATOM   7216 C  CB  . GLU C 2 35  ? 18.549  51.044 137.007 1.00 79.72  ? 63  GLU H CB  1 
ATOM   7217 C  CG  . GLU C 2 35  ? 17.432  51.227 138.026 1.00 79.95  ? 63  GLU H CG  1 
ATOM   7218 C  CD  . GLU C 2 35  ? 17.884  50.972 139.453 1.00 80.34  ? 63  GLU H CD  1 
ATOM   7219 O  OE1 . GLU C 2 35  ? 18.675  50.030 139.678 1.00 80.54  ? 63  GLU H OE1 1 
ATOM   7220 O  OE2 . GLU C 2 35  ? 17.439  51.712 140.354 1.00 80.86  ? 63  GLU H OE2 1 
ATOM   7221 N  N   . GLY C 2 36  ? 19.788  50.561 133.935 1.00 77.92  ? 64  GLY H N   1 
ATOM   7222 C  CA  . GLY C 2 36  ? 20.921  50.756 133.035 1.00 76.53  ? 64  GLY H CA  1 
ATOM   7223 C  C   . GLY C 2 36  ? 21.835  49.550 132.955 1.00 75.68  ? 64  GLY H C   1 
ATOM   7224 O  O   . GLY C 2 36  ? 21.882  48.728 133.876 1.00 74.53  ? 64  GLY H O   1 
ATOM   7225 N  N   . LYS C 2 37  ? 22.562  49.455 131.844 1.00 75.52  ? 65  LYS H N   1 
ATOM   7226 C  CA  . LYS C 2 37  ? 23.486  48.351 131.602 1.00 75.61  ? 65  LYS H CA  1 
ATOM   7227 C  C   . LYS C 2 37  ? 24.711  48.462 132.503 1.00 75.13  ? 65  LYS H C   1 
ATOM   7228 O  O   . LYS C 2 37  ? 25.269  49.548 132.668 1.00 75.28  ? 65  LYS H O   1 
ATOM   7229 C  CB  . LYS C 2 37  ? 23.908  48.325 130.128 1.00 75.34  ? 65  LYS H CB  1 
ATOM   7230 C  CG  . LYS C 2 37  ? 24.638  47.055 129.697 1.00 75.77  ? 65  LYS H CG  1 
ATOM   7231 C  CD  . LYS C 2 37  ? 24.777  46.950 128.178 1.00 76.53  ? 65  LYS H CD  1 
ATOM   7232 C  CE  . LYS C 2 37  ? 26.080  47.561 127.665 1.00 77.24  ? 65  LYS H CE  1 
ATOM   7233 N  NZ  . LYS C 2 37  ? 26.040  49.049 127.591 1.00 77.21  ? 65  LYS H NZ  1 
ATOM   7234 N  N   . ILE C 2 38  ? 25.115  47.337 133.087 1.00 74.71  ? 66  ILE H N   1 
ATOM   7235 C  CA  . ILE C 2 38  ? 26.313  47.289 133.920 1.00 74.95  ? 66  ILE H CA  1 
ATOM   7236 C  C   . ILE C 2 38  ? 27.431  46.524 133.207 1.00 74.28  ? 66  ILE H C   1 
ATOM   7237 O  O   . ILE C 2 38  ? 27.448  45.291 133.192 1.00 72.41  ? 66  ILE H O   1 
ATOM   7238 C  CB  . ILE C 2 38  ? 26.020  46.695 135.324 1.00 75.49  ? 66  ILE H CB  1 
ATOM   7239 C  CG1 . ILE C 2 38  ? 24.984  47.558 136.057 1.00 75.68  ? 66  ILE H CG1 1 
ATOM   7240 C  CG2 . ILE C 2 38  ? 27.305  46.595 136.140 1.00 75.88  ? 66  ILE H CG2 1 
ATOM   7241 C  CD1 . ILE C 2 38  ? 24.594  47.059 137.445 1.00 75.85  ? 66  ILE H CD1 1 
ATOM   7242 N  N   . SER C 2 39  ? 28.352  47.277 132.608 1.00 75.65  ? 67  SER H N   1 
ATOM   7243 C  CA  . SER C 2 39  ? 29.477  46.706 131.871 1.00 77.27  ? 67  SER H CA  1 
ATOM   7244 C  C   . SER C 2 39  ? 30.626  46.343 132.812 1.00 79.19  ? 67  SER H C   1 
ATOM   7245 O  O   . SER C 2 39  ? 30.640  46.754 133.973 1.00 79.25  ? 67  SER H O   1 
ATOM   7246 C  CB  . SER C 2 39  ? 29.954  47.674 130.784 1.00 76.95  ? 67  SER H CB  1 
ATOM   7247 O  OG  . SER C 2 39  ? 30.429  48.885 131.347 1.00 76.85  ? 67  SER H OG  1 
ATOM   7248 N  N   . ARG C 2 40  ? 31.583  45.575 132.294 1.00 81.36  ? 68  ARG H N   1 
ATOM   7249 C  CA  . ARG C 2 40  ? 32.716  45.064 133.072 1.00 82.55  ? 68  ARG H CA  1 
ATOM   7250 C  C   . ARG C 2 40  ? 33.612  46.168 133.647 1.00 83.70  ? 68  ARG H C   1 
ATOM   7251 O  O   . ARG C 2 40  ? 34.105  46.054 134.774 1.00 83.60  ? 68  ARG H O   1 
ATOM   7252 C  CB  . ARG C 2 40  ? 33.540  44.096 132.210 1.00 82.54  ? 68  ARG H CB  1 
ATOM   7253 C  CG  . ARG C 2 40  ? 34.618  43.323 132.958 1.00 82.78  ? 68  ARG H CG  1 
ATOM   7254 C  CD  . ARG C 2 40  ? 35.168  42.177 132.118 1.00 82.62  ? 68  ARG H CD  1 
ATOM   7255 N  NE  . ARG C 2 40  ? 34.235  41.053 132.038 1.00 82.69  ? 68  ARG H NE  1 
ATOM   7256 C  CZ  . ARG C 2 40  ? 34.148  40.074 132.937 1.00 82.81  ? 68  ARG H CZ  1 
ATOM   7257 N  NH1 . ARG C 2 40  ? 34.938  40.064 134.005 1.00 82.46  ? 68  ARG H NH1 1 
ATOM   7258 N  NH2 . ARG C 2 40  ? 33.263  39.101 132.768 1.00 82.92  ? 68  ARG H NH2 1 
ATOM   7259 N  N   . ASN C 2 41  ? 33.804  47.234 132.872 1.00 84.96  ? 69  ASN H N   1 
ATOM   7260 C  CA  . ASN C 2 41  ? 34.703  48.331 133.244 1.00 85.52  ? 69  ASN H CA  1 
ATOM   7261 C  C   . ASN C 2 41  ? 34.048  49.412 134.115 1.00 84.10  ? 69  ASN H C   1 
ATOM   7262 O  O   . ASN C 2 41  ? 34.659  50.447 134.395 1.00 83.33  ? 69  ASN H O   1 
ATOM   7263 C  CB  . ASN C 2 41  ? 35.306  48.971 131.983 1.00 87.37  ? 69  ASN H CB  1 
ATOM   7264 C  CG  . ASN C 2 41  ? 36.402  48.119 131.342 1.00 88.81  ? 69  ASN H CG  1 
ATOM   7265 O  OD1 . ASN C 2 41  ? 37.230  48.634 130.590 1.00 89.43  ? 69  ASN H OD1 1 
ATOM   7266 N  ND2 . ASN C 2 41  ? 36.405  46.818 131.627 1.00 89.27  ? 69  ASN H ND2 1 
ATOM   7267 N  N   . SER C 2 42  ? 32.813  49.161 134.548 1.00 83.02  ? 70  SER H N   1 
ATOM   7268 C  CA  . SER C 2 42  ? 32.026  50.153 135.283 1.00 81.22  ? 70  SER H CA  1 
ATOM   7269 C  C   . SER C 2 42  ? 32.245  50.085 136.791 1.00 79.75  ? 70  SER H C   1 
ATOM   7270 O  O   . SER C 2 42  ? 32.825  49.127 137.304 1.00 78.79  ? 70  SER H O   1 
ATOM   7271 C  CB  . SER C 2 42  ? 30.534  50.000 134.965 1.00 81.55  ? 70  SER H CB  1 
ATOM   7272 O  OG  . SER C 2 42  ? 29.988  48.845 135.580 1.00 81.36  ? 70  SER H OG  1 
ATOM   7273 N  N   . GLU C 2 43  ? 31.769  51.116 137.486 1.00 79.39  ? 71  GLU H N   1 
ATOM   7274 C  CA  . GLU C 2 43  ? 31.822  51.175 138.943 1.00 79.16  ? 71  GLU H CA  1 
ATOM   7275 C  C   . GLU C 2 43  ? 30.736  50.287 139.554 1.00 79.46  ? 71  GLU H C   1 
ATOM   7276 O  O   . GLU C 2 43  ? 30.948  49.664 140.595 1.00 79.30  ? 71  GLU H O   1 
ATOM   7277 C  CB  . GLU C 2 43  ? 31.672  52.625 139.426 1.00 78.53  ? 71  GLU H CB  1 
ATOM   7278 C  CG  . GLU C 2 43  ? 32.099  52.871 140.878 1.00 77.71  ? 71  GLU H CG  1 
ATOM   7279 C  CD  . GLU C 2 43  ? 33.594  52.698 141.105 1.00 77.28  ? 71  GLU H CD  1 
ATOM   7280 O  OE1 . GLU C 2 43  ? 34.391  53.187 140.276 1.00 77.67  ? 71  GLU H OE1 1 
ATOM   7281 O  OE2 . GLU C 2 43  ? 33.971  52.080 142.123 1.00 76.61  ? 71  GLU H OE2 1 
ATOM   7282 N  N   . ARG C 2 44  ? 29.582  50.226 138.891 1.00 80.39  ? 72  ARG H N   1 
ATOM   7283 C  CA  . ARG C 2 44  ? 28.457  49.400 139.343 1.00 81.50  ? 72  ARG H CA  1 
ATOM   7284 C  C   . ARG C 2 44  ? 28.698  47.897 139.170 1.00 82.71  ? 72  ARG H C   1 
ATOM   7285 O  O   . ARG C 2 44  ? 27.929  47.077 139.682 1.00 82.43  ? 72  ARG H O   1 
ATOM   7286 C  CB  . ARG C 2 44  ? 27.166  49.809 138.631 1.00 81.23  ? 72  ARG H CB  1 
ATOM   7287 C  CG  . ARG C 2 44  ? 26.524  51.076 139.173 1.00 81.22  ? 72  ARG H CG  1 
ATOM   7288 C  CD  . ARG C 2 44  ? 25.073  51.173 138.735 1.00 81.46  ? 72  ARG H CD  1 
ATOM   7289 N  NE  . ARG C 2 44  ? 24.944  51.417 137.298 1.00 81.93  ? 72  ARG H NE  1 
ATOM   7290 C  CZ  . ARG C 2 44  ? 23.938  50.979 136.545 1.00 82.12  ? 72  ARG H CZ  1 
ATOM   7291 N  NH1 . ARG C 2 44  ? 22.962  50.254 137.077 1.00 82.29  ? 72  ARG H NH1 1 
ATOM   7292 N  NH2 . ARG C 2 44  ? 23.913  51.258 135.249 1.00 82.22  ? 72  ARG H NH2 1 
ATOM   7293 N  N   . PHE C 2 45  ? 29.758  47.548 138.443 1.00 84.35  ? 73  PHE H N   1 
ATOM   7294 C  CA  . PHE C 2 45  ? 30.185  46.157 138.275 1.00 85.64  ? 73  PHE H CA  1 
ATOM   7295 C  C   . PHE C 2 45  ? 30.727  45.584 139.586 1.00 86.53  ? 73  PHE H C   1 
ATOM   7296 O  O   . PHE C 2 45  ? 30.623  44.381 139.838 1.00 86.87  ? 73  PHE H O   1 
ATOM   7297 C  CB  . PHE C 2 45  ? 31.240  46.061 137.166 1.00 85.81  ? 73  PHE H CB  1 
ATOM   7298 C  CG  . PHE C 2 45  ? 31.726  44.663 136.900 1.00 85.81  ? 73  PHE H CG  1 
ATOM   7299 C  CD1 . PHE C 2 45  ? 30.960  43.775 136.151 1.00 86.13  ? 73  PHE H CD1 1 
ATOM   7300 C  CD2 . PHE C 2 45  ? 32.958  44.238 137.390 1.00 85.91  ? 73  PHE H CD2 1 
ATOM   7301 C  CE1 . PHE C 2 45  ? 31.409  42.480 135.902 1.00 86.51  ? 73  PHE H CE1 1 
ATOM   7302 C  CE2 . PHE C 2 45  ? 33.417  42.946 137.147 1.00 86.28  ? 73  PHE H CE2 1 
ATOM   7303 C  CZ  . PHE C 2 45  ? 32.642  42.065 136.400 1.00 86.38  ? 73  PHE H CZ  1 
ATOM   7304 N  N   . LYS C 2 46  ? 31.296  46.460 140.412 1.00 86.88  ? 74  LYS H N   1 
ATOM   7305 C  CA  . LYS C 2 46  ? 31.844  46.083 141.715 1.00 87.66  ? 74  LYS H CA  1 
ATOM   7306 C  C   . LYS C 2 46  ? 30.765  45.668 142.714 1.00 88.10  ? 74  LYS H C   1 
ATOM   7307 O  O   . LYS C 2 46  ? 31.047  44.928 143.661 1.00 88.56  ? 74  LYS H O   1 
ATOM   7308 C  CB  . LYS C 2 46  ? 32.677  47.229 142.295 1.00 87.97  ? 74  LYS H CB  1 
ATOM   7309 C  CG  . LYS C 2 46  ? 34.014  47.455 141.596 1.00 87.81  ? 74  LYS H CG  1 
ATOM   7310 C  CD  . LYS C 2 46  ? 34.710  48.715 142.100 1.00 87.50  ? 74  LYS H CD  1 
ATOM   7311 C  CE  . LYS C 2 46  ? 35.291  48.529 143.496 1.00 87.32  ? 74  LYS H CE  1 
ATOM   7312 N  NZ  . LYS C 2 46  ? 35.909  49.784 143.998 1.00 87.33  ? 74  LYS H NZ  1 
ATOM   7313 N  N   . GLU C 2 47  ? 29.541  46.150 142.503 1.00 88.16  ? 75  GLU H N   1 
ATOM   7314 C  CA  . GLU C 2 47  ? 28.397  45.784 143.340 1.00 88.67  ? 75  GLU H CA  1 
ATOM   7315 C  C   . GLU C 2 47  ? 28.058  44.302 143.191 1.00 86.46  ? 75  GLU H C   1 
ATOM   7316 O  O   . GLU C 2 47  ? 27.576  43.670 144.133 1.00 86.19  ? 75  GLU H O   1 
ATOM   7317 C  CB  . GLU C 2 47  ? 27.172  46.634 142.988 1.00 90.06  ? 75  GLU H CB  1 
ATOM   7318 C  CG  . GLU C 2 47  ? 27.305  48.118 143.324 1.00 90.81  ? 75  GLU H CG  1 
ATOM   7319 C  CD  . GLU C 2 47  ? 26.145  48.955 142.798 1.00 91.06  ? 75  GLU H CD  1 
ATOM   7320 O  OE1 . GLU C 2 47  ? 25.449  48.512 141.854 1.00 92.38  ? 75  GLU H OE1 1 
ATOM   7321 O  OE2 . GLU C 2 47  ? 25.935  50.066 143.332 1.00 91.15  ? 75  GLU H OE2 1 
ATOM   7322 N  N   . LEU C 2 48  ? 28.320  43.762 142.004 1.00 84.34  ? 76  LEU H N   1 
ATOM   7323 C  CA  . LEU C 2 48  ? 28.039  42.365 141.690 1.00 82.23  ? 76  LEU H CA  1 
ATOM   7324 C  C   . LEU C 2 48  ? 29.069  41.441 142.333 1.00 80.67  ? 76  LEU H C   1 
ATOM   7325 O  O   . LEU C 2 48  ? 30.269  41.720 142.302 1.00 80.87  ? 76  LEU H O   1 
ATOM   7326 C  CB  . LEU C 2 48  ? 28.021  42.156 140.173 1.00 81.75  ? 76  LEU H CB  1 
ATOM   7327 C  CG  . LEU C 2 48  ? 27.197  43.141 139.339 1.00 80.91  ? 76  LEU H CG  1 
ATOM   7328 C  CD1 . LEU C 2 48  ? 27.704  43.184 137.909 1.00 80.48  ? 76  LEU H CD1 1 
ATOM   7329 C  CD2 . LEU C 2 48  ? 25.714  42.800 139.384 1.00 81.38  ? 76  LEU H CD2 1 
ATOM   7330 N  N   . THR C 2 49  ? 28.587  40.344 142.912 1.00 79.13  ? 77  THR H N   1 
ATOM   7331 C  CA  . THR C 2 49  ? 29.445  39.364 143.582 1.00 77.93  ? 77  THR H CA  1 
ATOM   7332 C  C   . THR C 2 49  ? 29.094  37.932 143.139 1.00 75.41  ? 77  THR H C   1 
ATOM   7333 O  O   . THR C 2 49  ? 27.913  37.578 143.084 1.00 74.96  ? 77  THR H O   1 
ATOM   7334 C  CB  . THR C 2 49  ? 29.411  39.534 145.137 1.00 79.01  ? 77  THR H CB  1 
ATOM   7335 O  OG1 . THR C 2 49  ? 30.201  38.516 145.765 1.00 79.42  ? 77  THR H OG1 1 
ATOM   7336 C  CG2 . THR C 2 49  ? 27.980  39.491 145.686 1.00 79.39  ? 77  THR H CG2 1 
ATOM   7337 N  N   . PRO C 2 50  ? 30.118  37.112 142.812 1.00 73.26  ? 78  PRO H N   1 
ATOM   7338 C  CA  . PRO C 2 50  ? 29.876  35.792 142.219 1.00 71.65  ? 78  PRO H CA  1 
ATOM   7339 C  C   . PRO C 2 50  ? 29.175  34.836 143.173 1.00 70.38  ? 78  PRO H C   1 
ATOM   7340 O  O   . PRO C 2 50  ? 29.530  34.764 144.350 1.00 70.27  ? 78  PRO H O   1 
ATOM   7341 C  CB  . PRO C 2 50  ? 31.287  35.273 141.904 1.00 71.48  ? 78  PRO H CB  1 
ATOM   7342 C  CG  . PRO C 2 50  ? 32.184  36.458 141.988 1.00 71.43  ? 78  PRO H CG  1 
ATOM   7343 C  CD  . PRO C 2 50  ? 31.559  37.372 142.984 1.00 71.95  ? 78  PRO H CD  1 
ATOM   7344 N  N   . ASN C 2 51  ? 28.180  34.121 142.660 1.00 69.85  ? 79  ASN H N   1 
ATOM   7345 C  CA  . ASN C 2 51  ? 27.473  33.115 143.437 1.00 70.14  ? 79  ASN H CA  1 
ATOM   7346 C  C   . ASN C 2 51  ? 28.233  31.791 143.374 1.00 70.44  ? 79  ASN H C   1 
ATOM   7347 O  O   . ASN C 2 51  ? 28.314  31.164 142.315 1.00 71.27  ? 79  ASN H O   1 
ATOM   7348 C  CB  . ASN C 2 51  ? 26.041  32.951 142.915 1.00 70.04  ? 79  ASN H CB  1 
ATOM   7349 C  CG  . ASN C 2 51  ? 25.086  32.378 143.956 1.00 70.56  ? 79  ASN H CG  1 
ATOM   7350 O  OD1 . ASN C 2 51  ? 23.907  32.727 143.977 1.00 71.57  ? 79  ASN H OD1 1 
ATOM   7351 N  ND2 . ASN C 2 51  ? 25.586  31.498 144.818 1.00 70.61  ? 79  ASN H ND2 1 
ATOM   7352 N  N   . TYR C 2 52  ? 28.797  31.378 144.508 1.00 70.11  ? 80  TYR H N   1 
ATOM   7353 C  CA  . TYR C 2 52  ? 29.589  30.148 144.572 1.00 69.28  ? 80  TYR H CA  1 
ATOM   7354 C  C   . TYR C 2 52  ? 28.884  29.000 145.297 1.00 68.10  ? 80  TYR H C   1 
ATOM   7355 O  O   . TYR C 2 52  ? 29.535  28.075 145.785 1.00 66.66  ? 80  TYR H O   1 
ATOM   7356 C  CB  . TYR C 2 52  ? 30.966  30.418 145.189 1.00 70.47  ? 80  TYR H CB  1 
ATOM   7357 C  CG  . TYR C 2 52  ? 31.907  31.198 144.293 1.00 71.35  ? 80  TYR H CG  1 
ATOM   7358 C  CD1 . TYR C 2 52  ? 32.201  30.757 142.999 1.00 71.50  ? 80  TYR H CD1 1 
ATOM   7359 C  CD2 . TYR C 2 52  ? 32.520  32.367 144.743 1.00 72.18  ? 80  TYR H CD2 1 
ATOM   7360 C  CE1 . TYR C 2 52  ? 33.070  31.469 142.173 1.00 71.42  ? 80  TYR H CE1 1 
ATOM   7361 C  CE2 . TYR C 2 52  ? 33.394  33.085 143.924 1.00 72.31  ? 80  TYR H CE2 1 
ATOM   7362 C  CZ  . TYR C 2 52  ? 33.662  32.630 142.641 1.00 71.37  ? 80  TYR H CZ  1 
ATOM   7363 O  OH  . TYR C 2 52  ? 34.522  33.332 141.827 1.00 70.84  ? 80  TYR H OH  1 
ATOM   7364 N  N   . ASN C 2 53  ? 27.555  29.063 145.347 1.00 68.98  ? 81  ASN H N   1 
ATOM   7365 C  CA  . ASN C 2 53  ? 26.726  28.009 145.934 1.00 69.99  ? 81  ASN H CA  1 
ATOM   7366 C  C   . ASN C 2 53  ? 27.039  26.638 145.324 1.00 70.48  ? 81  ASN H C   1 
ATOM   7367 O  O   . ASN C 2 53  ? 26.863  26.445 144.117 1.00 72.11  ? 81  ASN H O   1 
ATOM   7368 C  CB  . ASN C 2 53  ? 25.240  28.351 145.747 1.00 70.14  ? 81  ASN H CB  1 
ATOM   7369 C  CG  . ASN C 2 53  ? 24.314  27.523 146.635 1.00 70.45  ? 81  ASN H CG  1 
ATOM   7370 O  OD1 . ASN C 2 53  ? 24.624  26.392 147.015 1.00 70.20  ? 81  ASN H OD1 1 
ATOM   7371 N  ND2 . ASN C 2 53  ? 23.156  28.090 146.957 1.00 70.52  ? 81  ASN H ND2 1 
ATOM   7372 N  N   . PRO C 2 54  ? 27.515  25.689 146.156 1.00 70.28  ? 82  PRO H N   1 
ATOM   7373 C  CA  . PRO C 2 54  ? 27.851  24.334 145.702 1.00 70.45  ? 82  PRO H CA  1 
ATOM   7374 C  C   . PRO C 2 54  ? 26.637  23.504 145.269 1.00 71.00  ? 82  PRO H C   1 
ATOM   7375 O  O   . PRO C 2 54  ? 26.802  22.451 144.651 1.00 70.90  ? 82  PRO H O   1 
ATOM   7376 C  CB  . PRO C 2 54  ? 28.508  23.706 146.936 1.00 70.61  ? 82  PRO H CB  1 
ATOM   7377 C  CG  . PRO C 2 54  ? 27.947  24.457 148.087 1.00 70.27  ? 82  PRO H CG  1 
ATOM   7378 C  CD  . PRO C 2 54  ? 27.777  25.861 147.598 1.00 70.42  ? 82  PRO H CD  1 
ATOM   7379 N  N   . ASP C 2 55  ? 25.436  23.979 145.594 1.00 72.06  ? 83  ASP H N   1 
ATOM   7380 C  CA  . ASP C 2 55  ? 24.197  23.294 145.222 1.00 74.08  ? 83  ASP H CA  1 
ATOM   7381 C  C   . ASP C 2 55  ? 23.580  23.846 143.926 1.00 74.92  ? 83  ASP H C   1 
ATOM   7382 O  O   . ASP C 2 55  ? 22.431  23.531 143.587 1.00 74.46  ? 83  ASP H O   1 
ATOM   7383 C  CB  . ASP C 2 55  ? 23.186  23.356 146.376 1.00 75.32  ? 83  ASP H CB  1 
ATOM   7384 C  CG  . ASP C 2 55  ? 23.642  22.577 147.604 1.00 77.23  ? 83  ASP H CG  1 
ATOM   7385 O  OD1 . ASP C 2 55  ? 24.264  21.503 147.448 1.00 78.16  ? 83  ASP H OD1 1 
ATOM   7386 O  OD2 . ASP C 2 55  ? 23.366  23.035 148.734 1.00 77.55  ? 83  ASP H OD2 1 
ATOM   7387 N  N   . ILE C 2 56  ? 24.346  24.669 143.210 1.00 75.09  ? 84  ILE H N   1 
ATOM   7388 C  CA  . ILE C 2 56  ? 23.901  25.241 141.938 1.00 75.16  ? 84  ILE H CA  1 
ATOM   7389 C  C   . ILE C 2 56  ? 24.945  25.018 140.838 1.00 74.22  ? 84  ILE H C   1 
ATOM   7390 O  O   . ILE C 2 56  ? 26.113  25.392 140.988 1.00 74.26  ? 84  ILE H O   1 
ATOM   7391 C  CB  . ILE C 2 56  ? 23.543  26.756 142.060 1.00 75.48  ? 84  ILE H CB  1 
ATOM   7392 C  CG1 . ILE C 2 56  ? 22.572  26.993 143.225 1.00 75.21  ? 84  ILE H CG1 1 
ATOM   7393 C  CG2 . ILE C 2 56  ? 22.954  27.288 140.741 1.00 75.28  ? 84  ILE H CG2 1 
ATOM   7394 C  CD1 . ILE C 2 56  ? 22.320  28.453 143.564 1.00 75.46  ? 84  ILE H CD1 1 
ATOM   7395 N  N   . ILE C 2 57  ? 24.509  24.394 139.746 1.00 72.45  ? 85  ILE H N   1 
ATOM   7396 C  CA  . ILE C 2 57  ? 25.343  24.201 138.567 1.00 71.72  ? 85  ILE H CA  1 
ATOM   7397 C  C   . ILE C 2 57  ? 25.273  25.457 137.707 1.00 72.95  ? 85  ILE H C   1 
ATOM   7398 O  O   . ILE C 2 57  ? 24.197  25.850 137.260 1.00 73.46  ? 85  ILE H O   1 
ATOM   7399 C  CB  . ILE C 2 57  ? 24.887  22.967 137.729 1.00 70.74  ? 85  ILE H CB  1 
ATOM   7400 C  CG1 . ILE C 2 57  ? 24.775  21.705 138.600 1.00 71.07  ? 85  ILE H CG1 1 
ATOM   7401 C  CG2 . ILE C 2 57  ? 25.805  22.740 136.519 1.00 69.63  ? 85  ILE H CG2 1 
ATOM   7402 C  CD1 . ILE C 2 57  ? 26.088  21.221 139.222 1.00 71.92  ? 85  ILE H CD1 1 
ATOM   7403 N  N   . PHE C 2 58  ? 26.420  26.095 137.499 1.00 74.01  ? 86  PHE H N   1 
ATOM   7404 C  CA  . PHE C 2 58  ? 26.519  27.211 136.563 1.00 75.81  ? 86  PHE H CA  1 
ATOM   7405 C  C   . PHE C 2 58  ? 27.154  26.701 135.277 1.00 78.40  ? 86  PHE H C   1 
ATOM   7406 O  O   . PHE C 2 58  ? 28.263  26.159 135.305 1.00 80.32  ? 86  PHE H O   1 
ATOM   7407 C  CB  . PHE C 2 58  ? 27.340  28.359 137.158 1.00 75.11  ? 86  PHE H CB  1 
ATOM   7408 C  CG  . PHE C 2 58  ? 26.676  29.042 138.320 1.00 75.44  ? 86  PHE H CG  1 
ATOM   7409 C  CD1 . PHE C 2 58  ? 25.874  30.160 138.120 1.00 75.73  ? 86  PHE H CD1 1 
ATOM   7410 C  CD2 . PHE C 2 58  ? 26.854  28.570 139.618 1.00 75.71  ? 86  PHE H CD2 1 
ATOM   7411 C  CE1 . PHE C 2 58  ? 25.252  30.797 139.193 1.00 75.25  ? 86  PHE H CE1 1 
ATOM   7412 C  CE2 . PHE C 2 58  ? 26.238  29.200 140.697 1.00 75.62  ? 86  PHE H CE2 1 
ATOM   7413 C  CZ  . PHE C 2 58  ? 25.435  30.316 140.481 1.00 75.25  ? 86  PHE H CZ  1 
ATOM   7414 N  N   . LYS C 2 59  ? 26.443  26.859 134.160 1.00 79.54  ? 87  LYS H N   1 
ATOM   7415 C  CA  . LYS C 2 59  ? 26.897  26.341 132.867 1.00 79.63  ? 87  LYS H CA  1 
ATOM   7416 C  C   . LYS C 2 59  ? 28.232  26.956 132.461 1.00 80.13  ? 87  LYS H C   1 
ATOM   7417 O  O   . LYS C 2 59  ? 29.137  26.244 132.019 1.00 79.60  ? 87  LYS H O   1 
ATOM   7418 C  CB  . LYS C 2 59  ? 25.842  26.572 131.778 1.00 80.12  ? 87  LYS H CB  1 
ATOM   7419 C  CG  . LYS C 2 59  ? 26.060  25.756 130.507 1.00 79.66  ? 87  LYS H CG  1 
ATOM   7420 C  CD  . LYS C 2 59  ? 25.005  26.067 129.458 1.00 79.29  ? 87  LYS H CD  1 
ATOM   7421 C  CE  . LYS C 2 59  ? 25.129  25.136 128.262 1.00 78.99  ? 87  LYS H CE  1 
ATOM   7422 N  NZ  . LYS C 2 59  ? 24.126  25.450 127.210 1.00 78.15  ? 87  LYS H NZ  1 
ATOM   7423 N  N   . ASP C 2 60  ? 28.346  28.274 132.635 1.00 81.54  ? 88  ASP H N   1 
ATOM   7424 C  CA  . ASP C 2 60  ? 29.551  29.026 132.282 1.00 84.86  ? 88  ASP H CA  1 
ATOM   7425 C  C   . ASP C 2 60  ? 30.141  28.577 130.938 1.00 86.78  ? 88  ASP H C   1 
ATOM   7426 O  O   . ASP C 2 60  ? 31.278  28.098 130.866 1.00 86.03  ? 88  ASP H O   1 
ATOM   7427 C  CB  . ASP C 2 60  ? 30.593  28.947 133.407 1.00 86.86  ? 88  ASP H CB  1 
ATOM   7428 C  CG  . ASP C 2 60  ? 31.646  30.046 133.319 1.00 87.96  ? 88  ASP H CG  1 
ATOM   7429 O  OD1 . ASP C 2 60  ? 31.493  30.972 132.487 1.00 88.44  ? 88  ASP H OD1 1 
ATOM   7430 O  OD2 . ASP C 2 60  ? 32.628  29.983 134.092 1.00 87.40  ? 88  ASP H OD2 1 
ATOM   7431 N  N   . GLU C 2 61  ? 29.338  28.722 129.884 1.00 88.72  ? 89  GLU H N   1 
ATOM   7432 C  CA  . GLU C 2 61  ? 29.767  28.454 128.513 1.00 89.50  ? 89  GLU H CA  1 
ATOM   7433 C  C   . GLU C 2 61  ? 30.738  29.541 128.044 1.00 89.16  ? 89  GLU H C   1 
ATOM   7434 O  O   . GLU C 2 61  ? 31.642  29.281 127.245 1.00 87.93  ? 89  GLU H O   1 
ATOM   7435 C  CB  . GLU C 2 61  ? 28.550  28.355 127.573 1.00 90.79  ? 89  GLU H CB  1 
ATOM   7436 C  CG  . GLU C 2 61  ? 27.874  29.692 127.186 1.00 91.38  ? 89  GLU H CG  1 
ATOM   7437 C  CD  . GLU C 2 61  ? 26.923  30.255 128.252 1.00 91.93  ? 89  GLU H CD  1 
ATOM   7438 O  OE1 . GLU C 2 61  ? 26.858  29.723 129.383 1.00 91.36  ? 89  GLU H OE1 1 
ATOM   7439 O  OE2 . GLU C 2 61  ? 26.237  31.258 127.958 1.00 91.45  ? 89  GLU H OE2 1 
ATOM   7440 N  N   . GLU C 2 62  ? 30.537  30.751 128.569 1.00 90.03  ? 90  GLU H N   1 
ATOM   7441 C  CA  . GLU C 2 62  ? 31.350  31.925 128.254 1.00 91.27  ? 90  GLU H CA  1 
ATOM   7442 C  C   . GLU C 2 62  ? 32.795  31.757 128.731 1.00 92.55  ? 90  GLU H C   1 
ATOM   7443 O  O   . GLU C 2 62  ? 33.709  32.401 128.203 1.00 92.36  ? 90  GLU H O   1 
ATOM   7444 C  CB  . GLU C 2 62  ? 30.740  33.188 128.887 1.00 91.07  ? 90  GLU H CB  1 
ATOM   7445 C  CG  . GLU C 2 62  ? 29.284  33.504 128.496 1.00 90.93  ? 90  GLU H CG  1 
ATOM   7446 C  CD  . GLU C 2 62  ? 28.245  33.014 129.514 1.00 91.33  ? 90  GLU H CD  1 
ATOM   7447 O  OE1 . GLU C 2 62  ? 28.406  31.912 130.077 1.00 91.76  ? 90  GLU H OE1 1 
ATOM   7448 O  OE2 . GLU C 2 62  ? 27.240  33.727 129.742 1.00 91.24  ? 90  GLU H OE2 1 
ATOM   7449 N  N   . ASN C 2 63  ? 32.980  30.888 129.729 1.00 94.02  ? 91  ASN H N   1 
ATOM   7450 C  CA  . ASN C 2 63  ? 34.273  30.627 130.380 1.00 95.05  ? 91  ASN H CA  1 
ATOM   7451 C  C   . ASN C 2 63  ? 34.865  31.863 131.074 1.00 96.04  ? 91  ASN H C   1 
ATOM   7452 O  O   . ASN C 2 63  ? 36.078  31.964 131.282 1.00 96.06  ? 91  ASN H O   1 
ATOM   7453 C  CB  . ASN C 2 63  ? 35.271  29.981 129.404 1.00 94.82  ? 91  ASN H CB  1 
ATOM   7454 C  CG  . ASN C 2 63  ? 36.359  29.189 130.112 1.00 95.35  ? 91  ASN H CG  1 
ATOM   7455 O  OD1 . ASN C 2 63  ? 37.531  29.269 129.746 1.00 96.17  ? 91  ASN H OD1 1 
ATOM   7456 N  ND2 . ASN C 2 63  ? 35.975  28.422 131.131 1.00 94.95  ? 91  ASN H ND2 1 
ATOM   7457 N  N   . THR C 2 64  ? 33.983  32.791 131.444 1.00 97.12  ? 92  THR H N   1 
ATOM   7458 C  CA  . THR C 2 64  ? 34.368  34.044 132.097 1.00 97.37  ? 92  THR H CA  1 
ATOM   7459 C  C   . THR C 2 64  ? 33.875  34.115 133.546 1.00 96.58  ? 92  THR H C   1 
ATOM   7460 O  O   . THR C 2 64  ? 34.305  34.979 134.314 1.00 96.58  ? 92  THR H O   1 
ATOM   7461 C  CB  . THR C 2 64  ? 33.844  35.281 131.316 1.00 97.98  ? 92  THR H CB  1 
ATOM   7462 O  OG1 . THR C 2 64  ? 32.433  35.154 131.090 1.00 98.15  ? 92  THR H OG1 1 
ATOM   7463 C  CG2 . THR C 2 64  ? 34.566  35.429 129.977 1.00 98.04  ? 92  THR H CG2 1 
ATOM   7464 N  N   . GLY C 2 65  ? 32.979  33.200 133.911 1.00 95.54  ? 93  GLY H N   1 
ATOM   7465 C  CA  . GLY C 2 65  ? 32.349  33.202 135.230 1.00 94.02  ? 93  GLY H CA  1 
ATOM   7466 C  C   . GLY C 2 65  ? 31.249  34.243 135.329 1.00 93.06  ? 93  GLY H C   1 
ATOM   7467 O  O   . GLY C 2 65  ? 30.838  34.620 136.428 1.00 93.04  ? 93  GLY H O   1 
ATOM   7468 N  N   . ALA C 2 66  ? 30.772  34.699 134.171 1.00 92.23  ? 94  ALA H N   1 
ATOM   7469 C  CA  . ALA C 2 66  ? 29.758  35.746 134.087 1.00 91.02  ? 94  ALA H CA  1 
ATOM   7470 C  C   . ALA C 2 66  ? 28.424  35.308 134.687 1.00 90.39  ? 94  ALA H C   1 
ATOM   7471 O  O   . ALA C 2 66  ? 27.754  36.098 135.358 1.00 89.95  ? 94  ALA H O   1 
ATOM   7472 C  CB  . ALA C 2 66  ? 29.576  36.190 132.639 1.00 90.99  ? 94  ALA H CB  1 
ATOM   7473 N  N   . ASP C 2 67  ? 28.057  34.047 134.453 1.00 89.98  ? 95  ASP H N   1 
ATOM   7474 C  CA  . ASP C 2 67  ? 26.772  33.497 134.901 1.00 89.40  ? 95  ASP H CA  1 
ATOM   7475 C  C   . ASP C 2 67  ? 26.598  33.530 136.422 1.00 87.69  ? 95  ASP H C   1 
ATOM   7476 O  O   . ASP C 2 67  ? 25.470  33.526 136.918 1.00 88.40  ? 95  ASP H O   1 
ATOM   7477 C  CB  . ASP C 2 67  ? 26.576  32.063 134.383 1.00 90.51  ? 95  ASP H CB  1 
ATOM   7478 C  CG  . ASP C 2 67  ? 26.456  31.984 132.861 1.00 90.95  ? 95  ASP H CG  1 
ATOM   7479 O  OD1 . ASP C 2 67  ? 26.097  32.992 132.210 1.00 90.99  ? 95  ASP H OD1 1 
ATOM   7480 O  OD2 . ASP C 2 67  ? 26.715  30.893 132.309 1.00 91.17  ? 95  ASP H OD2 1 
ATOM   7481 N  N   . ARG C 2 68  ? 27.714  33.566 137.149 1.00 85.36  ? 96  ARG H N   1 
ATOM   7482 C  CA  . ARG C 2 68  ? 27.699  33.576 138.617 1.00 83.31  ? 96  ARG H CA  1 
ATOM   7483 C  C   . ARG C 2 68  ? 27.364  34.942 139.210 1.00 82.28  ? 96  ARG H C   1 
ATOM   7484 O  O   . ARG C 2 68  ? 26.800  35.024 140.304 1.00 82.00  ? 96  ARG H O   1 
ATOM   7485 C  CB  . ARG C 2 68  ? 29.041  33.095 139.178 1.00 82.19  ? 96  ARG H CB  1 
ATOM   7486 C  CG  . ARG C 2 68  ? 29.357  31.646 138.880 1.00 80.94  ? 96  ARG H CG  1 
ATOM   7487 C  CD  . ARG C 2 68  ? 30.726  31.265 139.406 1.00 80.56  ? 96  ARG H CD  1 
ATOM   7488 N  NE  . ARG C 2 68  ? 31.088  29.905 139.016 1.00 80.88  ? 96  ARG H NE  1 
ATOM   7489 C  CZ  . ARG C 2 68  ? 30.728  28.805 139.674 1.00 81.33  ? 96  ARG H CZ  1 
ATOM   7490 N  NH1 . ARG C 2 68  ? 29.990  28.883 140.776 1.00 82.00  ? 96  ARG H NH1 1 
ATOM   7491 N  NH2 . ARG C 2 68  ? 31.110  27.618 139.224 1.00 81.19  ? 96  ARG H NH2 1 
ATOM   7492 N  N   . LEU C 2 69  ? 27.720  36.005 138.491 1.00 81.51  ? 97  LEU H N   1 
ATOM   7493 C  CA  . LEU C 2 69  ? 27.532  37.375 138.975 1.00 80.80  ? 97  LEU H CA  1 
ATOM   7494 C  C   . LEU C 2 69  ? 26.063  37.795 138.985 1.00 80.23  ? 97  LEU H C   1 
ATOM   7495 O  O   . LEU C 2 69  ? 25.348  37.625 137.992 1.00 80.96  ? 97  LEU H O   1 
ATOM   7496 C  CB  . LEU C 2 69  ? 28.369  38.364 138.156 1.00 80.52  ? 97  LEU H CB  1 
ATOM   7497 C  CG  . LEU C 2 69  ? 29.895  38.304 138.287 1.00 80.25  ? 97  LEU H CG  1 
ATOM   7498 C  CD1 . LEU C 2 69  ? 30.556  39.044 137.134 1.00 80.36  ? 97  LEU H CD1 1 
ATOM   7499 C  CD2 . LEU C 2 69  ? 30.371  38.859 139.625 1.00 79.84  ? 97  LEU H CD2 1 
ATOM   7500 N  N   . MET C 2 70  ? 25.632  38.340 140.122 1.00 78.70  ? 98  MET H N   1 
ATOM   7501 C  CA  . MET C 2 70  ? 24.253  38.785 140.335 1.00 78.34  ? 98  MET H CA  1 
ATOM   7502 C  C   . MET C 2 70  ? 24.169  39.733 141.536 1.00 78.50  ? 98  MET H C   1 
ATOM   7503 O  O   . MET C 2 70  ? 25.114  39.828 142.326 1.00 79.23  ? 98  MET H O   1 
ATOM   7504 C  CB  . MET C 2 70  ? 23.309  37.583 140.522 1.00 78.23  ? 98  MET H CB  1 
ATOM   7505 C  CG  . MET C 2 70  ? 23.754  36.565 141.576 1.00 78.86  ? 98  MET H CG  1 
ATOM   7506 S  SD  . MET C 2 70  ? 22.769  35.046 141.613 1.00 78.90  ? 98  MET H SD  1 
ATOM   7507 C  CE  . MET C 2 70  ? 23.378  34.200 140.153 1.00 78.16  ? 98  MET H CE  1 
ATOM   7508 N  N   . THR C 2 71  ? 23.044  40.437 141.665 1.00 77.74  ? 99  THR H N   1 
ATOM   7509 C  CA  . THR C 2 71  ? 22.809  41.307 142.822 1.00 77.00  ? 99  THR H CA  1 
ATOM   7510 C  C   . THR C 2 71  ? 22.547  40.464 144.072 1.00 77.36  ? 99  THR H C   1 
ATOM   7511 O  O   . THR C 2 71  ? 22.224  39.277 143.968 1.00 77.47  ? 99  THR H O   1 
ATOM   7512 C  CB  . THR C 2 71  ? 21.635  42.304 142.595 1.00 75.69  ? 99  THR H CB  1 
ATOM   7513 O  OG1 . THR C 2 71  ? 20.415  41.586 142.377 1.00 75.50  ? 99  THR H OG1 1 
ATOM   7514 C  CG2 . THR C 2 71  ? 21.910  43.224 141.410 1.00 74.30  ? 99  THR H CG2 1 
ATOM   7515 N  N   . GLN C 2 72  ? 22.693  41.079 145.244 1.00 77.36  ? 100 GLN H N   1 
ATOM   7516 C  CA  . GLN C 2 72  ? 22.461  40.397 146.520 1.00 78.78  ? 100 GLN H CA  1 
ATOM   7517 C  C   . GLN C 2 72  ? 21.065  39.773 146.598 1.00 81.03  ? 100 GLN H C   1 
ATOM   7518 O  O   . GLN C 2 72  ? 20.904  38.676 147.139 1.00 81.92  ? 100 GLN H O   1 
ATOM   7519 C  CB  . GLN C 2 72  ? 22.695  41.357 147.698 1.00 77.49  ? 100 GLN H CB  1 
ATOM   7520 C  CG  . GLN C 2 72  ? 22.604  40.719 149.090 1.00 75.36  ? 100 GLN H CG  1 
ATOM   7521 C  CD  . GLN C 2 72  ? 23.597  39.586 149.298 1.00 74.74  ? 100 GLN H CD  1 
ATOM   7522 O  OE1 . GLN C 2 72  ? 24.773  39.700 148.951 1.00 74.96  ? 100 GLN H OE1 1 
ATOM   7523 N  NE2 . GLN C 2 72  ? 23.123  38.487 149.873 1.00 74.06  ? 100 GLN H NE2 1 
ATOM   7524 N  N   . ARG C 2 73  ? 20.071  40.470 146.046 1.00 82.81  ? 101 ARG H N   1 
ATOM   7525 C  CA  . ARG C 2 73  ? 18.686  39.991 146.032 1.00 84.12  ? 101 ARG H CA  1 
ATOM   7526 C  C   . ARG C 2 73  ? 18.526  38.730 145.179 1.00 82.73  ? 101 ARG H C   1 
ATOM   7527 O  O   . ARG C 2 73  ? 17.890  37.764 145.608 1.00 82.97  ? 101 ARG H O   1 
ATOM   7528 C  CB  . ARG C 2 73  ? 17.723  41.092 145.566 1.00 85.00  ? 101 ARG H CB  1 
ATOM   7529 C  CG  . ARG C 2 73  ? 16.249  40.713 145.690 1.00 86.15  ? 101 ARG H CG  1 
ATOM   7530 C  CD  . ARG C 2 73  ? 15.317  41.897 145.475 1.00 86.33  ? 101 ARG H CD  1 
ATOM   7531 N  NE  . ARG C 2 73  ? 13.912  41.486 145.508 1.00 87.25  ? 101 ARG H NE  1 
ATOM   7532 C  CZ  . ARG C 2 73  ? 13.164  41.420 146.608 1.00 87.00  ? 101 ARG H CZ  1 
ATOM   7533 N  NH1 . ARG C 2 73  ? 13.671  41.743 147.793 1.00 86.70  ? 101 ARG H NH1 1 
ATOM   7534 N  NH2 . ARG C 2 73  ? 11.900  41.029 146.522 1.00 87.01  ? 101 ARG H NH2 1 
ATOM   7535 N  N   . CYS C 2 74  ? 19.110  38.747 143.982 1.00 81.25  ? 102 CYS H N   1 
ATOM   7536 C  CA  . CYS C 2 74  ? 19.078  37.595 143.080 1.00 80.13  ? 102 CYS H CA  1 
ATOM   7537 C  C   . CYS C 2 74  ? 19.728  36.365 143.720 1.00 79.30  ? 102 CYS H C   1 
ATOM   7538 O  O   . CYS C 2 74  ? 19.263  35.242 143.521 1.00 78.20  ? 102 CYS H O   1 
ATOM   7539 C  CB  . CYS C 2 74  ? 19.755  37.936 141.751 1.00 80.22  ? 102 CYS H CB  1 
ATOM   7540 S  SG  . CYS C 2 74  ? 19.532  36.702 140.451 1.00 80.32  ? 102 CYS H SG  1 
ATOM   7541 N  N   . LYS C 2 75  ? 20.794  36.592 144.490 1.00 79.03  ? 103 LYS H N   1 
ATOM   7542 C  CA  . LYS C 2 75  ? 21.458  35.535 145.257 1.00 78.66  ? 103 LYS H CA  1 
ATOM   7543 C  C   . LYS C 2 75  ? 20.476  34.865 146.207 1.00 77.61  ? 103 LYS H C   1 
ATOM   7544 O  O   . LYS C 2 75  ? 20.281  33.649 146.154 1.00 76.81  ? 103 LYS H O   1 
ATOM   7545 C  CB  . LYS C 2 75  ? 22.631  36.098 146.070 1.00 78.19  ? 103 LYS H CB  1 
ATOM   7546 C  CG  . LYS C 2 75  ? 23.832  36.542 145.254 1.00 78.88  ? 103 LYS H CG  1 
ATOM   7547 C  CD  . LYS C 2 75  ? 24.972  37.012 146.148 1.00 79.41  ? 103 LYS H CD  1 
ATOM   7548 C  CE  . LYS C 2 75  ? 25.921  35.875 146.527 1.00 80.84  ? 103 LYS H CE  1 
ATOM   7549 N  NZ  . LYS C 2 75  ? 25.320  34.878 147.457 1.00 81.31  ? 103 LYS H NZ  1 
ATOM   7550 N  N   . ASP C 2 76  ? 19.856  35.679 147.060 1.00 77.77  ? 104 ASP H N   1 
ATOM   7551 C  CA  . ASP C 2 76  ? 18.964  35.203 148.119 1.00 78.25  ? 104 ASP H CA  1 
ATOM   7552 C  C   . ASP C 2 76  ? 17.827  34.337 147.580 1.00 77.90  ? 104 ASP H C   1 
ATOM   7553 O  O   . ASP C 2 76  ? 17.543  33.270 148.127 1.00 78.09  ? 104 ASP H O   1 
ATOM   7554 C  CB  . ASP C 2 76  ? 18.402  36.382 148.933 1.00 78.08  ? 104 ASP H CB  1 
ATOM   7555 C  CG  . ASP C 2 76  ? 19.486  37.178 149.658 1.00 77.15  ? 104 ASP H CG  1 
ATOM   7556 O  OD1 . ASP C 2 76  ? 20.513  36.589 150.063 1.00 76.33  ? 104 ASP H OD1 1 
ATOM   7557 O  OD2 . ASP C 2 76  ? 19.302  38.402 149.831 1.00 76.58  ? 104 ASP H OD2 1 
ATOM   7558 N  N   . LYS C 2 77  ? 17.193  34.793 146.504 1.00 77.29  ? 105 LYS H N   1 
ATOM   7559 C  CA  . LYS C 2 77  ? 16.090  34.057 145.895 1.00 77.35  ? 105 LYS H CA  1 
ATOM   7560 C  C   . LYS C 2 77  ? 16.576  32.768 145.234 1.00 78.73  ? 105 LYS H C   1 
ATOM   7561 O  O   . LYS C 2 77  ? 15.925  31.726 145.352 1.00 78.60  ? 105 LYS H O   1 
ATOM   7562 C  CB  . LYS C 2 77  ? 15.333  34.932 144.885 1.00 76.36  ? 105 LYS H CB  1 
ATOM   7563 C  CG  . LYS C 2 77  ? 14.832  36.271 145.434 1.00 75.39  ? 105 LYS H CG  1 
ATOM   7564 C  CD  . LYS C 2 77  ? 13.925  36.092 146.643 1.00 75.15  ? 105 LYS H CD  1 
ATOM   7565 C  CE  . LYS C 2 77  ? 13.572  37.424 147.273 1.00 74.90  ? 105 LYS H CE  1 
ATOM   7566 N  NZ  . LYS C 2 77  ? 12.769  37.236 148.510 1.00 75.46  ? 105 LYS H NZ  1 
ATOM   7567 N  N   . LEU C 2 78  ? 17.726  32.846 144.558 1.00 79.97  ? 106 LEU H N   1 
ATOM   7568 C  CA  . LEU C 2 78  ? 18.298  31.705 143.831 1.00 80.52  ? 106 LEU H CA  1 
ATOM   7569 C  C   . LEU C 2 78  ? 18.807  30.614 144.770 1.00 80.50  ? 106 LEU H C   1 
ATOM   7570 O  O   . LEU C 2 78  ? 18.647  29.423 144.488 1.00 81.12  ? 106 LEU H O   1 
ATOM   7571 C  CB  . LEU C 2 78  ? 19.427  32.156 142.892 1.00 80.20  ? 106 LEU H CB  1 
ATOM   7572 C  CG  . LEU C 2 78  ? 19.885  31.175 141.803 1.00 79.24  ? 106 LEU H CG  1 
ATOM   7573 C  CD1 . LEU C 2 78  ? 18.952  31.217 140.602 1.00 78.87  ? 106 LEU H CD1 1 
ATOM   7574 C  CD2 . LEU C 2 78  ? 21.311  31.465 141.372 1.00 78.69  ? 106 LEU H CD2 1 
ATOM   7575 N  N   . ASN C 2 79  ? 19.424  31.023 145.875 1.00 79.52  ? 107 ASN H N   1 
ATOM   7576 C  CA  . ASN C 2 79  ? 19.903  30.075 146.870 1.00 80.16  ? 107 ASN H CA  1 
ATOM   7577 C  C   . ASN C 2 79  ? 18.748  29.381 147.583 1.00 79.97  ? 107 ASN H C   1 
ATOM   7578 O  O   . ASN C 2 79  ? 18.847  28.203 147.926 1.00 80.26  ? 107 ASN H O   1 
ATOM   7579 C  CB  . ASN C 2 79  ? 20.838  30.757 147.870 1.00 81.68  ? 107 ASN H CB  1 
ATOM   7580 C  CG  . ASN C 2 79  ? 22.124  31.254 147.226 1.00 82.46  ? 107 ASN H CG  1 
ATOM   7581 O  OD1 . ASN C 2 79  ? 22.504  30.814 146.139 1.00 82.37  ? 107 ASN H OD1 1 
ATOM   7582 N  ND2 . ASN C 2 79  ? 22.801  32.176 147.898 1.00 83.01  ? 107 ASN H ND2 1 
ATOM   7583 N  N   . ALA C 2 80  ? 17.657  30.119 147.788 1.00 79.79  ? 108 ALA H N   1 
ATOM   7584 C  CA  . ALA C 2 80  ? 16.429  29.568 148.363 1.00 80.06  ? 108 ALA H CA  1 
ATOM   7585 C  C   . ALA C 2 80  ? 15.803  28.551 147.415 1.00 79.74  ? 108 ALA H C   1 
ATOM   7586 O  O   . ALA C 2 80  ? 15.273  27.527 147.852 1.00 81.35  ? 108 ALA H O   1 
ATOM   7587 C  CB  . ALA C 2 80  ? 15.439  30.682 148.677 1.00 80.09  ? 108 ALA H CB  1 
ATOM   7588 N  N   . LEU C 2 81  ? 15.878  28.850 146.119 1.00 77.59  ? 109 LEU H N   1 
ATOM   7589 C  CA  . LEU C 2 81  ? 15.381  27.973 145.063 1.00 75.42  ? 109 LEU H CA  1 
ATOM   7590 C  C   . LEU C 2 81  ? 16.190  26.677 144.970 1.00 75.01  ? 109 LEU H C   1 
ATOM   7591 O  O   . LEU C 2 81  ? 15.627  25.606 144.731 1.00 75.01  ? 109 LEU H O   1 
ATOM   7592 C  CB  . LEU C 2 81  ? 15.388  28.721 143.723 1.00 74.13  ? 109 LEU H CB  1 
ATOM   7593 C  CG  . LEU C 2 81  ? 14.966  28.043 142.416 1.00 73.09  ? 109 LEU H CG  1 
ATOM   7594 C  CD1 . LEU C 2 81  ? 13.620  27.346 142.522 1.00 71.45  ? 109 LEU H CD1 1 
ATOM   7595 C  CD2 . LEU C 2 81  ? 14.941  29.080 141.310 1.00 74.46  ? 109 LEU H CD2 1 
ATOM   7596 N  N   . ALA C 2 82  ? 17.504  26.783 145.168 1.00 73.98  ? 110 ALA H N   1 
ATOM   7597 C  CA  . ALA C 2 82  ? 18.396  25.624 145.155 1.00 72.00  ? 110 ALA H CA  1 
ATOM   7598 C  C   . ALA C 2 82  ? 17.929  24.557 146.140 1.00 70.58  ? 110 ALA H C   1 
ATOM   7599 O  O   . ALA C 2 82  ? 17.873  23.373 145.800 1.00 70.05  ? 110 ALA H O   1 
ATOM   7600 C  CB  . ALA C 2 82  ? 19.822  26.049 145.468 1.00 71.62  ? 110 ALA H CB  1 
ATOM   7601 N  N   . ILE C 2 83  ? 17.578  25.001 147.347 1.00 69.93  ? 111 ILE H N   1 
ATOM   7602 C  CA  . ILE C 2 83  ? 17.131  24.127 148.436 1.00 69.82  ? 111 ILE H CA  1 
ATOM   7603 C  C   . ILE C 2 83  ? 15.826  23.399 148.091 1.00 70.56  ? 111 ILE H C   1 
ATOM   7604 O  O   . ILE C 2 83  ? 15.691  22.203 148.359 1.00 71.35  ? 111 ILE H O   1 
ATOM   7605 C  CB  . ILE C 2 83  ? 16.957  24.909 149.775 1.00 68.38  ? 111 ILE H CB  1 
ATOM   7606 C  CG1 . ILE C 2 83  ? 18.155  25.830 150.035 1.00 66.76  ? 111 ILE H CG1 1 
ATOM   7607 C  CG2 . ILE C 2 83  ? 16.763  23.944 150.948 1.00 68.31  ? 111 ILE H CG2 1 
ATOM   7608 C  CD1 . ILE C 2 83  ? 17.847  27.023 150.925 1.00 65.36  ? 111 ILE H CD1 1 
ATOM   7609 N  N   . SER C 2 84  ? 14.879  24.122 147.495 1.00 70.92  ? 112 SER H N   1 
ATOM   7610 C  CA  . SER C 2 84  ? 13.578  23.551 147.138 1.00 70.73  ? 112 SER H CA  1 
ATOM   7611 C  C   . SER C 2 84  ? 13.637  22.598 145.937 1.00 70.29  ? 112 SER H C   1 
ATOM   7612 O  O   . SER C 2 84  ? 12.860  21.643 145.873 1.00 70.07  ? 112 SER H O   1 
ATOM   7613 C  CB  . SER C 2 84  ? 12.531  24.651 146.914 1.00 70.84  ? 112 SER H CB  1 
ATOM   7614 O  OG  . SER C 2 84  ? 12.884  25.503 145.838 1.00 71.04  ? 112 SER H OG  1 
ATOM   7615 N  N   . VAL C 2 85  ? 14.550  22.854 144.999 1.00 69.84  ? 113 VAL H N   1 
ATOM   7616 C  CA  . VAL C 2 85  ? 14.731  21.972 143.839 1.00 70.69  ? 113 VAL H CA  1 
ATOM   7617 C  C   . VAL C 2 85  ? 15.310  20.621 144.279 1.00 71.09  ? 113 VAL H C   1 
ATOM   7618 O  O   . VAL C 2 85  ? 14.843  19.568 143.842 1.00 71.11  ? 113 VAL H O   1 
ATOM   7619 C  CB  . VAL C 2 85  ? 15.582  22.632 142.704 1.00 70.92  ? 113 VAL H CB  1 
ATOM   7620 C  CG1 . VAL C 2 85  ? 15.902  21.631 141.589 1.00 69.88  ? 113 VAL H CG1 1 
ATOM   7621 C  CG2 . VAL C 2 85  ? 14.854  23.830 142.113 1.00 70.19  ? 113 VAL H CG2 1 
ATOM   7622 N  N   . MET C 2 86  ? 16.304  20.660 145.163 1.00 72.07  ? 114 MET H N   1 
ATOM   7623 C  CA  . MET C 2 86  ? 16.872  19.446 145.753 1.00 73.72  ? 114 MET H CA  1 
ATOM   7624 C  C   . MET C 2 86  ? 15.855  18.662 146.590 1.00 75.66  ? 114 MET H C   1 
ATOM   7625 O  O   . MET C 2 86  ? 15.980  17.445 146.751 1.00 74.99  ? 114 MET H O   1 
ATOM   7626 C  CB  . MET C 2 86  ? 18.095  19.789 146.600 1.00 73.49  ? 114 MET H CB  1 
ATOM   7627 C  CG  . MET C 2 86  ? 19.375  19.950 145.799 1.00 73.41  ? 114 MET H CG  1 
ATOM   7628 S  SD  . MET C 2 86  ? 20.757  20.546 146.791 1.00 73.29  ? 114 MET H SD  1 
ATOM   7629 C  CE  . MET C 2 86  ? 21.024  19.175 147.921 1.00 73.65  ? 114 MET H CE  1 
ATOM   7630 N  N   . ASN C 2 87  ? 14.857  19.371 147.117 1.00 78.41  ? 115 ASN H N   1 
ATOM   7631 C  CA  . ASN C 2 87  ? 13.772  18.765 147.892 1.00 80.37  ? 115 ASN H CA  1 
ATOM   7632 C  C   . ASN C 2 87  ? 12.672  18.170 147.006 1.00 80.57  ? 115 ASN H C   1 
ATOM   7633 O  O   . ASN C 2 87  ? 12.133  17.104 147.309 1.00 80.98  ? 115 ASN H O   1 
ATOM   7634 C  CB  . ASN C 2 87  ? 13.174  19.792 148.863 1.00 81.52  ? 115 ASN H CB  1 
ATOM   7635 C  CG  . ASN C 2 87  ? 12.067  19.210 149.728 1.00 82.72  ? 115 ASN H CG  1 
ATOM   7636 O  OD1 . ASN C 2 87  ? 12.319  18.397 150.620 1.00 83.35  ? 115 ASN H OD1 1 
ATOM   7637 N  ND2 . ASN C 2 87  ? 10.834  19.633 149.472 1.00 83.03  ? 115 ASN H ND2 1 
ATOM   7638 N  N   . GLN C 2 88  ? 12.346  18.867 145.919 1.00 80.29  ? 116 GLN H N   1 
ATOM   7639 C  CA  . GLN C 2 88  ? 11.332  18.415 144.967 1.00 80.47  ? 116 GLN H CA  1 
ATOM   7640 C  C   . GLN C 2 88  ? 11.796  17.167 144.218 1.00 79.40  ? 116 GLN H C   1 
ATOM   7641 O  O   . GLN C 2 88  ? 11.056  16.188 144.104 1.00 77.75  ? 116 GLN H O   1 
ATOM   7642 C  CB  . GLN C 2 88  ? 10.997  19.540 143.978 1.00 82.10  ? 116 GLN H CB  1 
ATOM   7643 C  CG  . GLN C 2 88  ? 9.791   19.276 143.075 1.00 83.10  ? 116 GLN H CG  1 
ATOM   7644 C  CD  . GLN C 2 88  ? 8.463   19.290 143.819 1.00 83.66  ? 116 GLN H CD  1 
ATOM   7645 O  OE1 . GLN C 2 88  ? 8.328   19.908 144.879 1.00 83.44  ? 116 GLN H OE1 1 
ATOM   7646 N  NE2 . GLN C 2 88  ? 7.470   18.609 143.257 1.00 84.01  ? 116 GLN H NE2 1 
ATOM   7647 N  N   . TRP C 2 89  ? 13.025  17.219 143.709 1.00 79.86  ? 117 TRP H N   1 
ATOM   7648 C  CA  . TRP C 2 89  ? 13.632  16.093 143.012 1.00 80.40  ? 117 TRP H CA  1 
ATOM   7649 C  C   . TRP C 2 89  ? 14.978  15.749 143.655 1.00 80.06  ? 117 TRP H C   1 
ATOM   7650 O  O   . TRP C 2 89  ? 15.941  16.513 143.533 1.00 80.02  ? 117 TRP H O   1 
ATOM   7651 C  CB  . TRP C 2 89  ? 13.816  16.406 141.520 1.00 81.32  ? 117 TRP H CB  1 
ATOM   7652 C  CG  . TRP C 2 89  ? 12.575  16.898 140.827 1.00 81.70  ? 117 TRP H CG  1 
ATOM   7653 C  CD1 . TRP C 2 89  ? 11.482  16.156 140.478 1.00 81.90  ? 117 TRP H CD1 1 
ATOM   7654 C  CD2 . TRP C 2 89  ? 12.308  18.237 140.385 1.00 81.85  ? 117 TRP H CD2 1 
ATOM   7655 N  NE1 . TRP C 2 89  ? 10.549  16.951 139.852 1.00 81.98  ? 117 TRP H NE1 1 
ATOM   7656 C  CE2 . TRP C 2 89  ? 11.029  18.232 139.783 1.00 81.81  ? 117 TRP H CE2 1 
ATOM   7657 C  CE3 . TRP C 2 89  ? 13.023  19.442 140.444 1.00 81.64  ? 117 TRP H CE3 1 
ATOM   7658 C  CZ2 . TRP C 2 89  ? 10.448  19.384 139.241 1.00 81.33  ? 117 TRP H CZ2 1 
ATOM   7659 C  CZ3 . TRP C 2 89  ? 12.444  20.590 139.904 1.00 81.65  ? 117 TRP H CZ3 1 
ATOM   7660 C  CH2 . TRP C 2 89  ? 11.168  20.550 139.311 1.00 81.48  ? 117 TRP H CH2 1 
ATOM   7661 N  N   . PRO C 2 90  ? 15.040  14.610 144.372 1.00 79.73  ? 118 PRO H N   1 
ATOM   7662 C  CA  . PRO C 2 90  ? 16.301  14.126 144.935 1.00 79.27  ? 118 PRO H CA  1 
ATOM   7663 C  C   . PRO C 2 90  ? 17.328  13.815 143.846 1.00 78.92  ? 118 PRO H C   1 
ATOM   7664 O  O   . PRO C 2 90  ? 16.967  13.328 142.769 1.00 78.44  ? 118 PRO H O   1 
ATOM   7665 C  CB  . PRO C 2 90  ? 15.891  12.839 145.663 1.00 79.21  ? 118 PRO H CB  1 
ATOM   7666 C  CG  . PRO C 2 90  ? 14.425  12.979 145.901 1.00 79.02  ? 118 PRO H CG  1 
ATOM   7667 C  CD  . PRO C 2 90  ? 13.913  13.722 144.714 1.00 79.58  ? 118 PRO H CD  1 
ATOM   7668 N  N   . GLY C 2 91  ? 18.594  14.112 144.129 1.00 78.51  ? 119 GLY H N   1 
ATOM   7669 C  CA  . GLY C 2 91  ? 19.682  13.883 143.181 1.00 78.25  ? 119 GLY H CA  1 
ATOM   7670 C  C   . GLY C 2 91  ? 19.691  14.862 142.022 1.00 78.34  ? 119 GLY H C   1 
ATOM   7671 O  O   . GLY C 2 91  ? 20.434  14.680 141.058 1.00 78.33  ? 119 GLY H O   1 
ATOM   7672 N  N   . VAL C 2 92  ? 18.860  15.898 142.120 1.00 78.66  ? 120 VAL H N   1 
ATOM   7673 C  CA  . VAL C 2 92  ? 18.751  16.925 141.084 1.00 79.47  ? 120 VAL H CA  1 
ATOM   7674 C  C   . VAL C 2 92  ? 18.976  18.316 141.686 1.00 79.78  ? 120 VAL H C   1 
ATOM   7675 O  O   . VAL C 2 92  ? 18.468  18.627 142.769 1.00 79.05  ? 120 VAL H O   1 
ATOM   7676 C  CB  . VAL C 2 92  ? 17.385  16.840 140.332 1.00 79.40  ? 120 VAL H CB  1 
ATOM   7677 C  CG1 . VAL C 2 92  ? 17.086  18.121 139.554 1.00 78.68  ? 120 VAL H CG1 1 
ATOM   7678 C  CG2 . VAL C 2 92  ? 17.364  15.631 139.395 1.00 79.33  ? 120 VAL H CG2 1 
ATOM   7679 N  N   . LYS C 2 93  ? 19.752  19.133 140.976 1.00 80.34  ? 121 LYS H N   1 
ATOM   7680 C  CA  . LYS C 2 93  ? 20.089  20.486 141.413 1.00 80.15  ? 121 LYS H CA  1 
ATOM   7681 C  C   . LYS C 2 93  ? 19.604  21.543 140.420 1.00 80.13  ? 121 LYS H C   1 
ATOM   7682 O  O   . LYS C 2 93  ? 19.292  21.235 139.267 1.00 79.33  ? 121 LYS H O   1 
ATOM   7683 C  CB  . LYS C 2 93  ? 21.602  20.619 141.616 1.00 79.59  ? 121 LYS H CB  1 
ATOM   7684 C  CG  . LYS C 2 93  ? 22.161  19.756 142.734 1.00 80.24  ? 121 LYS H CG  1 
ATOM   7685 C  CD  . LYS C 2 93  ? 23.679  19.833 142.799 1.00 80.38  ? 121 LYS H CD  1 
ATOM   7686 C  CE  . LYS C 2 93  ? 24.223  18.936 143.901 1.00 80.49  ? 121 LYS H CE  1 
ATOM   7687 N  NZ  . LYS C 2 93  ? 25.711  18.941 143.941 1.00 80.59  ? 121 LYS H NZ  1 
ATOM   7688 N  N   . LEU C 2 94  ? 19.541  22.787 140.888 1.00 80.31  ? 122 LEU H N   1 
ATOM   7689 C  CA  . LEU C 2 94  ? 19.213  23.932 140.048 1.00 79.64  ? 122 LEU H CA  1 
ATOM   7690 C  C   . LEU C 2 94  ? 20.412  24.300 139.174 1.00 79.66  ? 122 LEU H C   1 
ATOM   7691 O  O   . LEU C 2 94  ? 21.530  24.453 139.670 1.00 79.47  ? 122 LEU H O   1 
ATOM   7692 C  CB  . LEU C 2 94  ? 18.800  25.119 140.923 1.00 79.49  ? 122 LEU H CB  1 
ATOM   7693 C  CG  . LEU C 2 94  ? 18.500  26.476 140.281 1.00 80.12  ? 122 LEU H CG  1 
ATOM   7694 C  CD1 . LEU C 2 94  ? 17.113  26.501 139.654 1.00 79.47  ? 122 LEU H CD1 1 
ATOM   7695 C  CD2 . LEU C 2 94  ? 18.632  27.576 141.320 1.00 80.62  ? 122 LEU H CD2 1 
ATOM   7696 N  N   . ARG C 2 95  ? 20.166  24.437 137.874 1.00 79.85  ? 123 ARG H N   1 
ATOM   7697 C  CA  . ARG C 2 95  ? 21.213  24.753 136.905 1.00 79.19  ? 123 ARG H CA  1 
ATOM   7698 C  C   . ARG C 2 95  ? 21.004  26.143 136.301 1.00 78.83  ? 123 ARG H C   1 
ATOM   7699 O  O   . ARG C 2 95  ? 19.882  26.513 135.950 1.00 78.78  ? 123 ARG H O   1 
ATOM   7700 C  CB  . ARG C 2 95  ? 21.255  23.680 135.814 1.00 78.99  ? 123 ARG H CB  1 
ATOM   7701 C  CG  . ARG C 2 95  ? 22.395  23.811 134.822 1.00 80.09  ? 123 ARG H CG  1 
ATOM   7702 C  CD  . ARG C 2 95  ? 22.508  22.554 133.983 1.00 81.89  ? 123 ARG H CD  1 
ATOM   7703 N  NE  . ARG C 2 95  ? 23.238  22.778 132.737 1.00 84.70  ? 123 ARG H NE  1 
ATOM   7704 C  CZ  . ARG C 2 95  ? 22.677  23.146 131.585 1.00 87.39  ? 123 ARG H CZ  1 
ATOM   7705 N  NH1 . ARG C 2 95  ? 21.365  23.342 131.499 1.00 87.86  ? 123 ARG H NH1 1 
ATOM   7706 N  NH2 . ARG C 2 95  ? 23.431  23.318 130.510 1.00 88.23  ? 123 ARG H NH2 1 
ATOM   7707 N  N   . VAL C 2 96  ? 22.093  26.904 136.195 1.00 78.04  ? 124 VAL H N   1 
ATOM   7708 C  CA  . VAL C 2 96  ? 22.066  28.253 135.631 1.00 77.76  ? 124 VAL H CA  1 
ATOM   7709 C  C   . VAL C 2 96  ? 22.785  28.268 134.282 1.00 79.03  ? 124 VAL H C   1 
ATOM   7710 O  O   . VAL C 2 96  ? 23.911  27.781 134.169 1.00 78.83  ? 124 VAL H O   1 
ATOM   7711 C  CB  . VAL C 2 96  ? 22.698  29.288 136.604 1.00 76.17  ? 124 VAL H CB  1 
ATOM   7712 C  CG1 . VAL C 2 96  ? 22.920  30.636 135.921 1.00 75.21  ? 124 VAL H CG1 1 
ATOM   7713 C  CG2 . VAL C 2 96  ? 21.829  29.458 137.841 1.00 75.96  ? 124 VAL H CG2 1 
ATOM   7714 N  N   . THR C 2 97  ? 22.118  28.816 133.265 1.00 80.13  ? 125 THR H N   1 
ATOM   7715 C  CA  . THR C 2 97  ? 22.685  28.938 131.916 1.00 80.61  ? 125 THR H CA  1 
ATOM   7716 C  C   . THR C 2 97  ? 23.126  30.376 131.642 1.00 81.76  ? 125 THR H C   1 
ATOM   7717 O  O   . THR C 2 97  ? 24.144  30.622 130.968 1.00 85.25  ? 125 THR H O   1 
ATOM   7718 C  CB  . THR C 2 97  ? 21.681  28.484 130.831 1.00 80.28  ? 125 THR H CB  1 
ATOM   7719 O  OG1 . THR C 2 97  ? 20.397  29.069 131.083 1.00 80.86  ? 125 THR H OG1 1 
ATOM   7720 C  CG2 . THR C 2 97  ? 21.543  26.966 130.823 1.00 79.78  ? 125 THR H CG2 1 
ATOM   7721 N  N   . GLU C 2 98  ? 22.350  31.318 132.174 1.00 81.38  ? 126 GLU H N   1 
ATOM   7722 C  CA  . GLU C 2 98  ? 22.677  32.736 132.108 1.00 82.53  ? 126 GLU H CA  1 
ATOM   7723 C  C   . GLU C 2 98  ? 22.405  33.435 133.433 1.00 81.75  ? 126 GLU H C   1 
ATOM   7724 O  O   . GLU C 2 98  ? 21.457  33.097 134.146 1.00 81.08  ? 126 GLU H O   1 
ATOM   7725 C  CB  . GLU C 2 98  ? 21.893  33.430 130.988 1.00 84.83  ? 126 GLU H CB  1 
ATOM   7726 C  CG  . GLU C 2 98  ? 22.422  33.191 129.577 1.00 87.51  ? 126 GLU H CG  1 
ATOM   7727 C  CD  . GLU C 2 98  ? 23.689  33.976 129.258 1.00 89.57  ? 126 GLU H CD  1 
ATOM   7728 O  OE1 . GLU C 2 98  ? 23.607  34.934 128.457 1.00 90.02  ? 126 GLU H OE1 1 
ATOM   7729 O  OE2 . GLU C 2 98  ? 24.768  33.634 129.799 1.00 91.38  ? 126 GLU H OE2 1 
ATOM   7730 N  N   . GLY C 2 99  ? 23.257  34.405 133.753 1.00 81.38  ? 127 GLY H N   1 
ATOM   7731 C  CA  . GLY C 2 99  ? 23.044  35.314 134.874 1.00 80.97  ? 127 GLY H CA  1 
ATOM   7732 C  C   . GLY C 2 99  ? 23.248  36.727 134.369 1.00 79.72  ? 127 GLY H C   1 
ATOM   7733 O  O   . GLY C 2 99  ? 22.409  37.260 133.640 1.00 78.47  ? 127 GLY H O   1 
ATOM   7734 N  N   . TRP C 2 100 ? 24.368  37.332 134.755 1.00 78.87  ? 128 TRP H N   1 
ATOM   7735 C  CA  . TRP C 2 100 ? 24.803  38.586 134.154 1.00 76.90  ? 128 TRP H CA  1 
ATOM   7736 C  C   . TRP C 2 100 ? 25.296  38.288 132.740 1.00 77.18  ? 128 TRP H C   1 
ATOM   7737 O  O   . TRP C 2 100 ? 25.898  37.241 132.489 1.00 76.59  ? 128 TRP H O   1 
ATOM   7738 C  CB  . TRP C 2 100 ? 25.894  39.249 135.001 1.00 74.23  ? 128 TRP H CB  1 
ATOM   7739 C  CG  . TRP C 2 100 ? 26.438  40.524 134.416 1.00 73.39  ? 128 TRP H CG  1 
ATOM   7740 C  CD1 . TRP C 2 100 ? 25.811  41.737 134.357 1.00 73.04  ? 128 TRP H CD1 1 
ATOM   7741 C  CD2 . TRP C 2 100 ? 27.724  40.708 133.811 1.00 73.55  ? 128 TRP H CD2 1 
ATOM   7742 N  NE1 . TRP C 2 100 ? 26.626  42.663 133.749 1.00 72.65  ? 128 TRP H NE1 1 
ATOM   7743 C  CE2 . TRP C 2 100 ? 27.806  42.059 133.405 1.00 73.08  ? 128 TRP H CE2 1 
ATOM   7744 C  CE3 . TRP C 2 100 ? 28.816  39.861 133.571 1.00 74.15  ? 128 TRP H CE3 1 
ATOM   7745 C  CZ2 . TRP C 2 100 ? 28.939  42.584 132.770 1.00 73.58  ? 128 TRP H CZ2 1 
ATOM   7746 C  CZ3 . TRP C 2 100 ? 29.943  40.385 132.940 1.00 73.71  ? 128 TRP H CZ3 1 
ATOM   7747 C  CH2 . TRP C 2 100 ? 29.993  41.734 132.548 1.00 73.71  ? 128 TRP H CH2 1 
ATOM   7748 N  N   . ASP C 2 101 ? 25.019  39.201 131.815 1.00 78.07  ? 129 ASP H N   1 
ATOM   7749 C  CA  . ASP C 2 101 ? 25.372  39.003 130.416 1.00 79.19  ? 129 ASP H CA  1 
ATOM   7750 C  C   . ASP C 2 101 ? 26.115  40.207 129.855 1.00 79.25  ? 129 ASP H C   1 
ATOM   7751 O  O   . ASP C 2 101 ? 25.730  41.355 130.090 1.00 78.07  ? 129 ASP H O   1 
ATOM   7752 C  CB  . ASP C 2 101 ? 24.114  38.722 129.586 1.00 81.39  ? 129 ASP H CB  1 
ATOM   7753 C  CG  . ASP C 2 101 ? 24.426  38.352 128.140 1.00 82.73  ? 129 ASP H CG  1 
ATOM   7754 O  OD1 . ASP C 2 101 ? 24.990  37.261 127.907 1.00 85.90  ? 129 ASP H OD1 1 
ATOM   7755 O  OD2 . ASP C 2 101 ? 24.087  39.145 127.233 1.00 81.35  ? 129 ASP H OD2 1 
ATOM   7756 N  N   . GLU C 2 102 ? 27.184  39.928 129.117 1.00 80.88  ? 130 GLU H N   1 
ATOM   7757 C  CA  . GLU C 2 102 ? 27.937  40.959 128.405 1.00 82.86  ? 130 GLU H CA  1 
ATOM   7758 C  C   . GLU C 2 102 ? 27.955  40.694 126.899 1.00 83.15  ? 130 GLU H C   1 
ATOM   7759 O  O   . GLU C 2 102 ? 28.396  41.540 126.117 1.00 83.15  ? 130 GLU H O   1 
ATOM   7760 C  CB  . GLU C 2 102 ? 29.366  41.078 128.960 1.00 83.90  ? 130 GLU H CB  1 
ATOM   7761 C  CG  . GLU C 2 102 ? 30.171  39.772 129.001 1.00 84.01  ? 130 GLU H CG  1 
ATOM   7762 C  CD  . GLU C 2 102 ? 31.539  39.936 129.654 1.00 83.66  ? 130 GLU H CD  1 
ATOM   7763 O  OE1 . GLU C 2 102 ? 32.040  41.079 129.730 1.00 83.60  ? 130 GLU H OE1 1 
ATOM   7764 O  OE2 . GLU C 2 102 ? 32.117  38.916 130.089 1.00 83.72  ? 130 GLU H OE2 1 
ATOM   7765 N  N   . ASP C 2 103 ? 27.462  39.517 126.510 1.00 83.94  ? 131 ASP H N   1 
ATOM   7766 C  CA  . ASP C 2 103 ? 27.450  39.067 125.113 1.00 83.13  ? 131 ASP H CA  1 
ATOM   7767 C  C   . ASP C 2 103 ? 26.411  39.814 124.274 1.00 81.15  ? 131 ASP H C   1 
ATOM   7768 O  O   . ASP C 2 103 ? 26.557  39.927 123.056 1.00 79.62  ? 131 ASP H O   1 
ATOM   7769 C  CB  . ASP C 2 103 ? 27.176  37.557 125.034 1.00 85.12  ? 131 ASP H CB  1 
ATOM   7770 C  CG  . ASP C 2 103 ? 27.964  36.751 126.064 1.00 87.18  ? 131 ASP H CG  1 
ATOM   7771 O  OD1 . ASP C 2 103 ? 29.213  36.821 126.059 1.00 87.46  ? 131 ASP H OD1 1 
ATOM   7772 O  OD2 . ASP C 2 103 ? 27.326  36.037 126.874 1.00 89.59  ? 131 ASP H OD2 1 
ATOM   7773 N  N   . GLY C 2 104 ? 25.369  40.318 124.935 1.00 80.37  ? 132 GLY H N   1 
ATOM   7774 C  CA  . GLY C 2 104 ? 24.250  40.981 124.263 1.00 77.73  ? 132 GLY H CA  1 
ATOM   7775 C  C   . GLY C 2 104 ? 23.217  39.986 123.766 1.00 75.98  ? 132 GLY H C   1 
ATOM   7776 O  O   . GLY C 2 104 ? 22.492  40.261 122.812 1.00 75.89  ? 132 GLY H O   1 
ATOM   7777 N  N   . HIS C 2 105 ? 23.143  38.835 124.430 1.00 75.41  ? 133 HIS H N   1 
ATOM   7778 C  CA  . HIS C 2 105 ? 22.294  37.721 124.002 1.00 73.95  ? 133 HIS H CA  1 
ATOM   7779 C  C   . HIS C 2 105 ? 20.863  37.793 124.544 1.00 74.57  ? 133 HIS H C   1 
ATOM   7780 O  O   . HIS C 2 105 ? 20.186  36.770 124.666 1.00 74.19  ? 133 HIS H O   1 
ATOM   7781 C  CB  . HIS C 2 105 ? 22.939  36.383 124.394 1.00 71.72  ? 133 HIS H CB  1 
ATOM   7782 C  CG  . HIS C 2 105 ? 24.078  35.972 123.512 1.00 69.47  ? 133 HIS H CG  1 
ATOM   7783 N  ND1 . HIS C 2 105 ? 25.050  35.084 123.920 1.00 67.88  ? 133 HIS H ND1 1 
ATOM   7784 C  CD2 . HIS C 2 105 ? 24.402  36.329 122.246 1.00 69.03  ? 133 HIS H CD2 1 
ATOM   7785 C  CE1 . HIS C 2 105 ? 25.920  34.908 122.943 1.00 68.81  ? 133 HIS H CE1 1 
ATOM   7786 N  NE2 . HIS C 2 105 ? 25.551  35.653 121.916 1.00 69.58  ? 133 HIS H NE2 1 
ATOM   7787 N  N   . HIS C 2 106 ? 20.402  38.998 124.865 1.00 76.06  ? 134 HIS H N   1 
ATOM   7788 C  CA  . HIS C 2 106 ? 19.075  39.181 125.453 1.00 76.96  ? 134 HIS H CA  1 
ATOM   7789 C  C   . HIS C 2 106 ? 18.343  40.385 124.843 1.00 77.48  ? 134 HIS H C   1 
ATOM   7790 O  O   . HIS C 2 106 ? 18.779  40.924 123.817 1.00 77.55  ? 134 HIS H O   1 
ATOM   7791 C  CB  . HIS C 2 106 ? 19.181  39.292 126.978 1.00 76.83  ? 134 HIS H CB  1 
ATOM   7792 C  CG  . HIS C 2 106 ? 19.813  38.099 127.629 1.00 78.03  ? 134 HIS H CG  1 
ATOM   7793 N  ND1 . HIS C 2 106 ? 19.083  37.027 128.096 1.00 78.52  ? 134 HIS H ND1 1 
ATOM   7794 C  CD2 . HIS C 2 106 ? 21.110  37.806 127.885 1.00 79.10  ? 134 HIS H CD2 1 
ATOM   7795 C  CE1 . HIS C 2 106 ? 19.901  36.129 128.615 1.00 78.36  ? 134 HIS H CE1 1 
ATOM   7796 N  NE2 . HIS C 2 106 ? 21.137  36.577 128.500 1.00 79.38  ? 134 HIS H NE2 1 
ATOM   7797 N  N   . SER C 2 107 ? 17.230  40.790 125.460 1.00 76.69  ? 135 SER H N   1 
ATOM   7798 C  CA  . SER C 2 107 ? 16.411  41.901 124.951 1.00 75.62  ? 135 SER H CA  1 
ATOM   7799 C  C   . SER C 2 107 ? 17.120  43.244 125.114 1.00 75.84  ? 135 SER H C   1 
ATOM   7800 O  O   . SER C 2 107 ? 18.003  43.375 125.960 1.00 77.37  ? 135 SER H O   1 
ATOM   7801 C  CB  . SER C 2 107 ? 15.031  41.924 125.624 1.00 73.46  ? 135 SER H CB  1 
ATOM   7802 O  OG  . SER C 2 107 ? 15.129  42.095 127.023 1.00 71.75  ? 135 SER H OG  1 
ATOM   7803 N  N   . GLU C 2 108 ? 16.731  44.232 124.306 1.00 74.74  ? 136 GLU H N   1 
ATOM   7804 C  CA  . GLU C 2 108 ? 17.377  45.556 124.286 1.00 74.33  ? 136 GLU H CA  1 
ATOM   7805 C  C   . GLU C 2 108 ? 17.694  46.148 125.662 1.00 71.73  ? 136 GLU H C   1 
ATOM   7806 O  O   . GLU C 2 108 ? 18.739  46.774 125.847 1.00 71.82  ? 136 GLU H O   1 
ATOM   7807 C  CB  . GLU C 2 108 ? 16.549  46.556 123.474 1.00 76.66  ? 136 GLU H CB  1 
ATOM   7808 C  CG  . GLU C 2 108 ? 16.980  46.697 122.018 1.00 80.25  ? 136 GLU H CG  1 
ATOM   7809 C  CD  . GLU C 2 108 ? 18.111  47.695 121.828 1.00 82.46  ? 136 GLU H CD  1 
ATOM   7810 O  OE1 . GLU C 2 108 ? 19.238  47.437 122.324 1.00 83.23  ? 136 GLU H OE1 1 
ATOM   7811 O  OE2 . GLU C 2 108 ? 17.871  48.738 121.168 1.00 83.58  ? 136 GLU H OE2 1 
ATOM   7812 N  N   . GLU C 2 109 ? 16.786  45.954 126.614 1.00 68.23  ? 137 GLU H N   1 
ATOM   7813 C  CA  . GLU C 2 109 ? 16.986  46.430 127.978 1.00 65.10  ? 137 GLU H CA  1 
ATOM   7814 C  C   . GLU C 2 109 ? 16.715  45.315 128.981 1.00 63.56  ? 137 GLU H C   1 
ATOM   7815 O  O   . GLU C 2 109 ? 15.777  45.387 129.776 1.00 63.20  ? 137 GLU H O   1 
ATOM   7816 C  CB  . GLU C 2 109 ? 16.104  47.646 128.257 1.00 64.43  ? 137 GLU H CB  1 
ATOM   7817 C  CG  . GLU C 2 109 ? 16.543  48.902 127.525 1.00 64.83  ? 137 GLU H CG  1 
ATOM   7818 C  CD  . GLU C 2 109 ? 15.628  50.083 127.772 1.00 65.25  ? 137 GLU H CD  1 
ATOM   7819 O  OE1 . GLU C 2 109 ? 14.638  49.936 128.522 1.00 65.26  ? 137 GLU H OE1 1 
ATOM   7820 O  OE2 . GLU C 2 109 ? 15.900  51.165 127.212 1.00 65.94  ? 137 GLU H OE2 1 
ATOM   7821 N  N   . SER C 2 110 ? 17.554  44.285 128.934 1.00 62.09  ? 138 SER H N   1 
ATOM   7822 C  CA  . SER C 2 110 ? 17.383  43.105 129.768 1.00 61.45  ? 138 SER H CA  1 
ATOM   7823 C  C   . SER C 2 110 ? 17.913  43.313 131.179 1.00 63.80  ? 138 SER H C   1 
ATOM   7824 O  O   . SER C 2 110 ? 18.930  43.979 131.382 1.00 64.28  ? 138 SER H O   1 
ATOM   7825 C  CB  . SER C 2 110 ? 18.078  41.905 129.132 1.00 59.50  ? 138 SER H CB  1 
ATOM   7826 O  OG  . SER C 2 110 ? 17.846  40.730 129.886 1.00 58.66  ? 138 SER H OG  1 
ATOM   7827 N  N   . LEU C 2 111 ? 17.219  42.725 132.149 1.00 66.09  ? 139 LEU H N   1 
ATOM   7828 C  CA  . LEU C 2 111 ? 17.650  42.771 133.543 1.00 68.31  ? 139 LEU H CA  1 
ATOM   7829 C  C   . LEU C 2 111 ? 18.833  41.833 133.771 1.00 71.26  ? 139 LEU H C   1 
ATOM   7830 O  O   . LEU C 2 111 ? 19.397  41.778 134.871 1.00 72.61  ? 139 LEU H O   1 
ATOM   7831 C  CB  . LEU C 2 111 ? 16.491  42.437 134.494 1.00 67.94  ? 139 LEU H CB  1 
ATOM   7832 C  CG  . LEU C 2 111 ? 15.210  43.284 134.466 1.00 66.70  ? 139 LEU H CG  1 
ATOM   7833 C  CD1 . LEU C 2 111 ? 14.257  42.821 135.553 1.00 65.56  ? 139 LEU H CD1 1 
ATOM   7834 C  CD2 . LEU C 2 111 ? 15.491  44.778 134.608 1.00 65.62  ? 139 LEU H CD2 1 
ATOM   7835 N  N   . HIS C 2 112 ? 19.199  41.094 132.724 1.00 72.97  ? 140 HIS H N   1 
ATOM   7836 C  CA  . HIS C 2 112 ? 20.435  40.319 132.710 1.00 75.45  ? 140 HIS H CA  1 
ATOM   7837 C  C   . HIS C 2 112 ? 21.647  41.247 132.725 1.00 76.49  ? 140 HIS H C   1 
ATOM   7838 O  O   . HIS C 2 112 ? 22.642  40.966 133.397 1.00 76.19  ? 140 HIS H O   1 
ATOM   7839 C  CB  . HIS C 2 112 ? 20.494  39.411 131.479 1.00 75.40  ? 140 HIS H CB  1 
ATOM   7840 C  CG  . HIS C 2 112 ? 19.641  38.186 131.588 1.00 75.96  ? 140 HIS H CG  1 
ATOM   7841 N  ND1 . HIS C 2 112 ? 20.011  37.087 132.334 1.00 76.49  ? 140 HIS H ND1 1 
ATOM   7842 C  CD2 . HIS C 2 112 ? 18.441  37.882 131.041 1.00 75.96  ? 140 HIS H CD2 1 
ATOM   7843 C  CE1 . HIS C 2 112 ? 19.073  36.161 132.245 1.00 76.68  ? 140 HIS H CE1 1 
ATOM   7844 N  NE2 . HIS C 2 112 ? 18.111  36.617 131.463 1.00 76.72  ? 140 HIS H NE2 1 
ATOM   7845 N  N   . TYR C 2 113 ? 21.539  42.360 131.999 1.00 78.05  ? 141 TYR H N   1 
ATOM   7846 C  CA  . TYR C 2 113 ? 22.654  43.287 131.799 1.00 80.21  ? 141 TYR H CA  1 
ATOM   7847 C  C   . TYR C 2 113 ? 23.071  44.033 133.065 1.00 80.71  ? 141 TYR H C   1 
ATOM   7848 O  O   . TYR C 2 113 ? 24.170  44.594 133.127 1.00 81.40  ? 141 TYR H O   1 
ATOM   7849 C  CB  . TYR C 2 113 ? 22.344  44.280 130.673 1.00 82.69  ? 141 TYR H CB  1 
ATOM   7850 C  CG  . TYR C 2 113 ? 22.009  43.638 129.338 1.00 84.07  ? 141 TYR H CG  1 
ATOM   7851 C  CD1 . TYR C 2 113 ? 22.677  42.488 128.899 1.00 84.82  ? 141 TYR H CD1 1 
ATOM   7852 C  CD2 . TYR C 2 113 ? 21.040  44.193 128.504 1.00 84.00  ? 141 TYR H CD2 1 
ATOM   7853 C  CE1 . TYR C 2 113 ? 22.373  41.899 127.672 1.00 85.01  ? 141 TYR H CE1 1 
ATOM   7854 C  CE2 . TYR C 2 113 ? 20.734  43.616 127.274 1.00 84.59  ? 141 TYR H CE2 1 
ATOM   7855 C  CZ  . TYR C 2 113 ? 21.401  42.469 126.865 1.00 84.47  ? 141 TYR H CZ  1 
ATOM   7856 O  OH  . TYR C 2 113 ? 21.097  41.897 125.651 1.00 83.90  ? 141 TYR H OH  1 
ATOM   7857 N  N   . GLU C 2 114 ? 22.196  44.037 134.069 1.00 80.18  ? 142 GLU H N   1 
ATOM   7858 C  CA  . GLU C 2 114 ? 22.526  44.623 135.369 1.00 78.48  ? 142 GLU H CA  1 
ATOM   7859 C  C   . GLU C 2 114 ? 22.556  43.593 136.502 1.00 78.84  ? 142 GLU H C   1 
ATOM   7860 O  O   . GLU C 2 114 ? 22.645  43.948 137.681 1.00 78.39  ? 142 GLU H O   1 
ATOM   7861 C  CB  . GLU C 2 114 ? 21.608  45.811 135.696 1.00 77.57  ? 142 GLU H CB  1 
ATOM   7862 C  CG  . GLU C 2 114 ? 20.122  45.512 135.710 1.00 76.41  ? 142 GLU H CG  1 
ATOM   7863 C  CD  . GLU C 2 114 ? 19.298  46.749 136.000 1.00 76.37  ? 142 GLU H CD  1 
ATOM   7864 O  OE1 . GLU C 2 114 ? 19.391  47.280 137.126 1.00 75.92  ? 142 GLU H OE1 1 
ATOM   7865 O  OE2 . GLU C 2 114 ? 18.548  47.188 135.104 1.00 75.63  ? 142 GLU H OE2 1 
ATOM   7866 N  N   . GLY C 2 115 ? 22.496  42.316 136.125 1.00 79.36  ? 143 GLY H N   1 
ATOM   7867 C  CA  . GLY C 2 115 ? 22.647  41.207 137.063 1.00 80.27  ? 143 GLY H CA  1 
ATOM   7868 C  C   . GLY C 2 115 ? 21.457  40.981 137.976 1.00 81.24  ? 143 GLY H C   1 
ATOM   7869 O  O   . GLY C 2 115 ? 21.617  40.565 139.125 1.00 81.01  ? 143 GLY H O   1 
ATOM   7870 N  N   . ARG C 2 116 ? 20.260  41.255 137.464 1.00 81.55  ? 144 ARG H N   1 
ATOM   7871 C  CA  . ARG C 2 116 ? 19.029  41.030 138.219 1.00 80.67  ? 144 ARG H CA  1 
ATOM   7872 C  C   . ARG C 2 116 ? 18.289  39.781 137.747 1.00 80.28  ? 144 ARG H C   1 
ATOM   7873 O  O   . ARG C 2 116 ? 17.388  39.291 138.432 1.00 80.75  ? 144 ARG H O   1 
ATOM   7874 C  CB  . ARG C 2 116 ? 18.110  42.248 138.125 1.00 80.00  ? 144 ARG H CB  1 
ATOM   7875 C  CG  . ARG C 2 116 ? 18.487  43.380 139.051 1.00 79.48  ? 144 ARG H CG  1 
ATOM   7876 C  CD  . ARG C 2 116 ? 17.322  44.329 139.220 1.00 79.73  ? 144 ARG H CD  1 
ATOM   7877 N  NE  . ARG C 2 116 ? 17.282  45.366 138.192 1.00 79.41  ? 144 ARG H NE  1 
ATOM   7878 C  CZ  . ARG C 2 116 ? 16.197  46.069 137.874 1.00 79.40  ? 144 ARG H CZ  1 
ATOM   7879 N  NH1 . ARG C 2 116 ? 15.040  45.843 138.486 1.00 79.40  ? 144 ARG H NH1 1 
ATOM   7880 N  NH2 . ARG C 2 116 ? 16.266  46.998 136.931 1.00 79.28  ? 144 ARG H NH2 1 
ATOM   7881 N  N   . ALA C 2 117 ? 18.682  39.265 136.584 1.00 79.04  ? 145 ALA H N   1 
ATOM   7882 C  CA  . ALA C 2 117 ? 17.985  38.146 135.957 1.00 77.91  ? 145 ALA H CA  1 
ATOM   7883 C  C   . ALA C 2 117 ? 18.835  36.880 135.847 1.00 77.13  ? 145 ALA H C   1 
ATOM   7884 O  O   . ALA C 2 117 ? 20.066  36.947 135.786 1.00 77.09  ? 145 ALA H O   1 
ATOM   7885 C  CB  . ALA C 2 117 ? 17.462  38.558 134.585 1.00 77.48  ? 145 ALA H CB  1 
ATOM   7886 N  N   . VAL C 2 118 ? 18.159  35.733 135.833 1.00 76.46  ? 146 VAL H N   1 
ATOM   7887 C  CA  . VAL C 2 118 ? 18.800  34.437 135.595 1.00 77.17  ? 146 VAL H CA  1 
ATOM   7888 C  C   . VAL C 2 118 ? 17.973  33.560 134.656 1.00 78.17  ? 146 VAL H C   1 
ATOM   7889 O  O   . VAL C 2 118 ? 16.741  33.615 134.665 1.00 80.48  ? 146 VAL H O   1 
ATOM   7890 C  CB  . VAL C 2 118 ? 19.058  33.652 136.903 1.00 76.80  ? 146 VAL H CB  1 
ATOM   7891 C  CG1 . VAL C 2 118 ? 20.219  34.259 137.679 1.00 77.83  ? 146 VAL H CG1 1 
ATOM   7892 C  CG2 . VAL C 2 118 ? 17.796  33.569 137.760 1.00 76.49  ? 146 VAL H CG2 1 
ATOM   7893 N  N   . ASP C 2 119 ? 18.659  32.762 133.841 1.00 76.31  ? 147 ASP H N   1 
ATOM   7894 C  CA  . ASP C 2 119 ? 18.002  31.758 133.011 1.00 74.53  ? 147 ASP H CA  1 
ATOM   7895 C  C   . ASP C 2 119 ? 18.327  30.384 133.569 1.00 74.01  ? 147 ASP H C   1 
ATOM   7896 O  O   . ASP C 2 119 ? 19.483  29.952 133.564 1.00 73.85  ? 147 ASP H O   1 
ATOM   7897 C  CB  . ASP C 2 119 ? 18.424  31.881 131.545 1.00 72.81  ? 147 ASP H CB  1 
ATOM   7898 C  CG  . ASP C 2 119 ? 17.978  33.187 130.920 1.00 71.60  ? 147 ASP H CG  1 
ATOM   7899 O  OD1 . ASP C 2 119 ? 16.944  33.751 131.350 1.00 72.68  ? 147 ASP H OD1 1 
ATOM   7900 O  OD2 . ASP C 2 119 ? 18.671  33.651 129.995 1.00 69.97  ? 147 ASP H OD2 1 
ATOM   7901 N  N   . ILE C 2 120 ? 17.296  29.710 134.064 1.00 74.40  ? 148 ILE H N   1 
ATOM   7902 C  CA  . ILE C 2 120 ? 17.478  28.511 134.876 1.00 73.53  ? 148 ILE H CA  1 
ATOM   7903 C  C   . ILE C 2 120 ? 16.924  27.249 134.225 1.00 74.72  ? 148 ILE H C   1 
ATOM   7904 O  O   . ILE C 2 120 ? 15.979  27.304 133.434 1.00 75.27  ? 148 ILE H O   1 
ATOM   7905 C  CB  . ILE C 2 120 ? 16.888  28.685 136.308 1.00 72.11  ? 148 ILE H CB  1 
ATOM   7906 C  CG1 . ILE C 2 120 ? 15.378  28.964 136.259 1.00 71.61  ? 148 ILE H CG1 1 
ATOM   7907 C  CG2 . ILE C 2 120 ? 17.618  29.805 137.047 1.00 71.99  ? 148 ILE H CG2 1 
ATOM   7908 C  CD1 . ILE C 2 120 ? 14.623  28.611 137.537 1.00 71.86  ? 148 ILE H CD1 1 
ATOM   7909 N  N   . THR C 2 121 ? 17.554  26.122 134.554 1.00 75.11  ? 149 THR H N   1 
ATOM   7910 C  CA  . THR C 2 121 ? 17.093  24.789 134.172 1.00 74.72  ? 149 THR H CA  1 
ATOM   7911 C  C   . THR C 2 121 ? 17.358  23.850 135.345 1.00 74.64  ? 149 THR H C   1 
ATOM   7912 O  O   . THR C 2 121 ? 17.906  24.271 136.366 1.00 74.71  ? 149 THR H O   1 
ATOM   7913 C  CB  . THR C 2 121 ? 17.825  24.243 132.917 1.00 74.27  ? 149 THR H CB  1 
ATOM   7914 O  OG1 . THR C 2 121 ? 19.223  24.100 133.194 1.00 74.36  ? 149 THR H OG1 1 
ATOM   7915 C  CG2 . THR C 2 121 ? 17.633  25.156 131.709 1.00 72.77  ? 149 THR H CG2 1 
ATOM   7916 N  N   . THR C 2 122 ? 16.958  22.589 135.209 1.00 74.83  ? 150 THR H N   1 
ATOM   7917 C  CA  . THR C 2 122 ? 17.362  21.556 136.160 1.00 74.12  ? 150 THR H CA  1 
ATOM   7918 C  C   . THR C 2 122 ? 18.651  20.912 135.658 1.00 74.46  ? 150 THR H C   1 
ATOM   7919 O  O   . THR C 2 122 ? 18.942  20.949 134.458 1.00 74.24  ? 150 THR H O   1 
ATOM   7920 C  CB  . THR C 2 122 ? 16.269  20.480 136.372 1.00 73.68  ? 150 THR H CB  1 
ATOM   7921 O  OG1 . THR C 2 122 ? 15.948  19.858 135.123 1.00 74.90  ? 150 THR H OG1 1 
ATOM   7922 C  CG2 . THR C 2 122 ? 15.010  21.096 136.971 1.00 73.04  ? 150 THR H CG2 1 
ATOM   7923 N  N   . SER C 2 123 ? 19.417  20.332 136.580 1.00 75.48  ? 151 SER H N   1 
ATOM   7924 C  CA  . SER C 2 123 ? 20.732  19.753 136.280 1.00 76.24  ? 151 SER H CA  1 
ATOM   7925 C  C   . SER C 2 123 ? 20.715  18.711 135.158 1.00 77.56  ? 151 SER H C   1 
ATOM   7926 O  O   . SER C 2 123 ? 21.626  18.670 134.328 1.00 77.14  ? 151 SER H O   1 
ATOM   7927 C  CB  . SER C 2 123 ? 21.352  19.152 137.549 1.00 74.93  ? 151 SER H CB  1 
ATOM   7928 O  OG  . SER C 2 123 ? 20.511  18.161 138.114 1.00 72.74  ? 151 SER H OG  1 
ATOM   7929 N  N   . ASP C 2 124 ? 19.675  17.880 135.139 1.00 80.19  ? 152 ASP H N   1 
ATOM   7930 C  CA  . ASP C 2 124 ? 19.548  16.800 134.157 1.00 82.76  ? 152 ASP H CA  1 
ATOM   7931 C  C   . ASP C 2 124 ? 19.065  17.287 132.790 1.00 84.91  ? 152 ASP H C   1 
ATOM   7932 O  O   . ASP C 2 124 ? 19.184  16.567 131.792 1.00 85.84  ? 152 ASP H O   1 
ATOM   7933 C  CB  . ASP C 2 124 ? 18.631  15.685 134.688 1.00 83.01  ? 152 ASP H CB  1 
ATOM   7934 C  CG  . ASP C 2 124 ? 17.204  16.162 134.969 1.00 82.80  ? 152 ASP H CG  1 
ATOM   7935 O  OD1 . ASP C 2 124 ? 16.971  17.385 135.096 1.00 82.58  ? 152 ASP H OD1 1 
ATOM   7936 O  OD2 . ASP C 2 124 ? 16.310  15.296 135.073 1.00 82.54  ? 152 ASP H OD2 1 
ATOM   7937 N  N   . ARG C 2 125 ? 18.527  18.507 132.760 1.00 86.08  ? 153 ARG H N   1 
ATOM   7938 C  CA  . ARG C 2 125 ? 17.993  19.130 131.541 1.00 86.81  ? 153 ARG H CA  1 
ATOM   7939 C  C   . ARG C 2 125 ? 16.756  18.393 131.023 1.00 87.33  ? 153 ARG H C   1 
ATOM   7940 O  O   . ARG C 2 125 ? 16.619  18.126 129.825 1.00 87.00  ? 153 ARG H O   1 
ATOM   7941 C  CB  . ARG C 2 125 ? 19.078  19.265 130.462 1.00 87.18  ? 153 ARG H CB  1 
ATOM   7942 C  CG  . ARG C 2 125 ? 20.279  20.083 130.914 1.00 88.13  ? 153 ARG H CG  1 
ATOM   7943 C  CD  . ARG C 2 125 ? 21.469  19.898 129.998 1.00 88.15  ? 153 ARG H CD  1 
ATOM   7944 N  NE  . ARG C 2 125 ? 21.315  20.630 128.743 1.00 87.35  ? 153 ARG H NE  1 
ATOM   7945 C  CZ  . ARG C 2 125 ? 22.279  20.781 127.840 1.00 87.72  ? 153 ARG H CZ  1 
ATOM   7946 N  NH1 . ARG C 2 125 ? 22.043  21.464 126.730 1.00 87.47  ? 153 ARG H NH1 1 
ATOM   7947 N  NH2 . ARG C 2 125 ? 23.480  20.252 128.042 1.00 88.69  ? 153 ARG H NH2 1 
ATOM   7948 N  N   . ASP C 2 126 ? 15.864  18.065 131.956 1.00 88.24  ? 154 ASP H N   1 
ATOM   7949 C  CA  . ASP C 2 126 ? 14.582  17.442 131.644 1.00 88.84  ? 154 ASP H CA  1 
ATOM   7950 C  C   . ASP C 2 126 ? 13.529  18.532 131.459 1.00 88.76  ? 154 ASP H C   1 
ATOM   7951 O  O   . ASP C 2 126 ? 13.110  19.181 132.423 1.00 88.71  ? 154 ASP H O   1 
ATOM   7952 C  CB  . ASP C 2 126 ? 14.176  16.466 132.759 1.00 88.50  ? 154 ASP H CB  1 
ATOM   7953 C  CG  . ASP C 2 126 ? 12.879  15.725 132.459 1.00 87.62  ? 154 ASP H CG  1 
ATOM   7954 O  OD1 . ASP C 2 126 ? 12.606  15.415 131.278 1.00 88.16  ? 154 ASP H OD1 1 
ATOM   7955 O  OD2 . ASP C 2 126 ? 12.132  15.442 133.418 1.00 86.39  ? 154 ASP H OD2 1 
ATOM   7956 N  N   . ARG C 2 127 ? 13.112  18.724 130.209 1.00 87.86  ? 155 ARG H N   1 
ATOM   7957 C  CA  . ARG C 2 127 ? 12.185  19.795 129.839 1.00 87.12  ? 155 ARG H CA  1 
ATOM   7958 C  C   . ARG C 2 127 ? 10.817  19.688 130.514 1.00 86.87  ? 155 ARG H C   1 
ATOM   7959 O  O   . ARG C 2 127 ? 10.131  20.696 130.707 1.00 86.96  ? 155 ARG H O   1 
ATOM   7960 C  CB  . ARG C 2 127 ? 12.018  19.846 128.320 1.00 86.32  ? 155 ARG H CB  1 
ATOM   7961 C  CG  . ARG C 2 127 ? 13.259  20.311 127.585 1.00 85.72  ? 155 ARG H CG  1 
ATOM   7962 C  CD  . ARG C 2 127 ? 12.940  20.590 126.139 1.00 85.78  ? 155 ARG H CD  1 
ATOM   7963 N  NE  . ARG C 2 127 ? 13.959  21.419 125.503 1.00 85.78  ? 155 ARG H NE  1 
ATOM   7964 C  CZ  . ARG C 2 127 ? 13.880  21.873 124.256 1.00 86.24  ? 155 ARG H CZ  1 
ATOM   7965 N  NH1 . ARG C 2 127 ? 12.827  21.581 123.502 1.00 86.40  ? 155 ARG H NH1 1 
ATOM   7966 N  NH2 . ARG C 2 127 ? 14.856  22.620 123.761 1.00 86.94  ? 155 ARG H NH2 1 
ATOM   7967 N  N   . SER C 2 128 ? 10.434  18.464 130.874 1.00 86.37  ? 156 SER H N   1 
ATOM   7968 C  CA  . SER C 2 128 ? 9.149   18.197 131.523 1.00 85.14  ? 156 SER H CA  1 
ATOM   7969 C  C   . SER C 2 128 ? 9.093   18.664 132.982 1.00 84.07  ? 156 SER H C   1 
ATOM   7970 O  O   . SER C 2 128 ? 8.019   18.686 133.587 1.00 83.45  ? 156 SER H O   1 
ATOM   7971 C  CB  . SER C 2 128 ? 8.798   16.707 131.426 1.00 83.98  ? 156 SER H CB  1 
ATOM   7972 O  OG  . SER C 2 128 ? 9.801   15.901 132.018 1.00 82.37  ? 156 SER H OG  1 
ATOM   7973 N  N   . LYS C 2 129 ? 10.244  19.042 133.535 1.00 83.53  ? 157 LYS H N   1 
ATOM   7974 C  CA  . LYS C 2 129 ? 10.332  19.502 134.921 1.00 83.88  ? 157 LYS H CA  1 
ATOM   7975 C  C   . LYS C 2 129 ? 10.296  21.024 135.072 1.00 83.88  ? 157 LYS H C   1 
ATOM   7976 O  O   . LYS C 2 129 ? 10.072  21.534 136.174 1.00 83.52  ? 157 LYS H O   1 
ATOM   7977 C  CB  . LYS C 2 129 ? 11.599  18.955 135.583 1.00 84.71  ? 157 LYS H CB  1 
ATOM   7978 C  CG  . LYS C 2 129 ? 11.508  17.499 135.998 1.00 85.96  ? 157 LYS H CG  1 
ATOM   7979 C  CD  . LYS C 2 129 ? 12.746  17.070 136.770 1.00 86.88  ? 157 LYS H CD  1 
ATOM   7980 C  CE  . LYS C 2 129 ? 12.665  15.609 137.190 1.00 87.82  ? 157 LYS H CE  1 
ATOM   7981 N  NZ  . LYS C 2 129 ? 12.696  14.677 136.024 1.00 88.68  ? 157 LYS H NZ  1 
ATOM   7982 N  N   . TYR C 2 130 ? 10.509  21.737 133.966 1.00 83.99  ? 158 TYR H N   1 
ATOM   7983 C  CA  . TYR C 2 130 ? 10.689  23.193 133.994 1.00 83.84  ? 158 TYR H CA  1 
ATOM   7984 C  C   . TYR C 2 130 ? 9.457   23.973 134.468 1.00 84.40  ? 158 TYR H C   1 
ATOM   7985 O  O   . TYR C 2 130 ? 9.595   25.022 135.101 1.00 85.40  ? 158 TYR H O   1 
ATOM   7986 C  CB  . TYR C 2 130 ? 11.151  23.724 132.632 1.00 83.57  ? 158 TYR H CB  1 
ATOM   7987 C  CG  . TYR C 2 130 ? 12.486  23.204 132.124 1.00 83.15  ? 158 TYR H CG  1 
ATOM   7988 C  CD1 . TYR C 2 130 ? 13.346  22.460 132.935 1.00 83.23  ? 158 TYR H CD1 1 
ATOM   7989 C  CD2 . TYR C 2 130 ? 12.901  23.495 130.831 1.00 83.42  ? 158 TYR H CD2 1 
ATOM   7990 C  CE1 . TYR C 2 130 ? 14.571  21.998 132.452 1.00 83.42  ? 158 TYR H CE1 1 
ATOM   7991 C  CE2 . TYR C 2 130 ? 14.122  23.043 130.343 1.00 83.60  ? 158 TYR H CE2 1 
ATOM   7992 C  CZ  . TYR C 2 130 ? 14.950  22.298 131.153 1.00 83.56  ? 158 TYR H CZ  1 
ATOM   7993 O  OH  . TYR C 2 130 ? 16.154  21.860 130.649 1.00 83.52  ? 158 TYR H OH  1 
ATOM   7994 N  N   . GLY C 2 131 ? 8.266   23.464 134.152 1.00 83.63  ? 159 GLY H N   1 
ATOM   7995 C  CA  . GLY C 2 131 ? 7.004   24.064 134.598 1.00 81.97  ? 159 GLY H CA  1 
ATOM   7996 C  C   . GLY C 2 131 ? 6.885   24.106 136.110 1.00 81.40  ? 159 GLY H C   1 
ATOM   7997 O  O   . GLY C 2 131 ? 6.508   25.131 136.684 1.00 81.37  ? 159 GLY H O   1 
ATOM   7998 N  N   . MET C 2 132 ? 7.206   22.982 136.749 1.00 80.41  ? 160 MET H N   1 
ATOM   7999 C  CA  . MET C 2 132 ? 7.263   22.891 138.208 1.00 79.70  ? 160 MET H CA  1 
ATOM   8000 C  C   . MET C 2 132 ? 8.462   23.678 138.743 1.00 77.43  ? 160 MET H C   1 
ATOM   8001 O  O   . MET C 2 132 ? 8.417   24.222 139.850 1.00 77.49  ? 160 MET H O   1 
ATOM   8002 C  CB  . MET C 2 132 ? 7.332   21.421 138.647 1.00 81.93  ? 160 MET H CB  1 
ATOM   8003 C  CG  . MET C 2 132 ? 7.417   21.187 140.162 1.00 83.51  ? 160 MET H CG  1 
ATOM   8004 S  SD  . MET C 2 132 ? 5.930   21.639 141.083 1.00 85.11  ? 160 MET H SD  1 
ATOM   8005 C  CE  . MET C 2 132 ? 4.885   20.213 140.783 1.00 85.12  ? 160 MET H CE  1 
ATOM   8006 N  N   . LEU C 2 133 ? 9.527   23.731 137.945 1.00 74.40  ? 161 LEU H N   1 
ATOM   8007 C  CA  . LEU C 2 133 ? 10.722  24.500 138.277 1.00 71.71  ? 161 LEU H CA  1 
ATOM   8008 C  C   . LEU C 2 133 ? 10.416  25.996 138.324 1.00 71.61  ? 161 LEU H C   1 
ATOM   8009 O  O   . LEU C 2 133 ? 10.992  26.730 139.129 1.00 70.10  ? 161 LEU H O   1 
ATOM   8010 C  CB  . LEU C 2 133 ? 11.835  24.199 137.269 1.00 70.64  ? 161 LEU H CB  1 
ATOM   8011 C  CG  . LEU C 2 133 ? 13.092  25.067 137.200 1.00 70.40  ? 161 LEU H CG  1 
ATOM   8012 C  CD1 . LEU C 2 133 ? 13.909  24.979 138.479 1.00 70.32  ? 161 LEU H CD1 1 
ATOM   8013 C  CD2 . LEU C 2 133 ? 13.921  24.645 136.009 1.00 70.22  ? 161 LEU H CD2 1 
ATOM   8014 N  N   . ALA C 2 134 ? 9.503   26.433 137.458 1.00 73.24  ? 162 ALA H N   1 
ATOM   8015 C  CA  . ALA C 2 134 ? 9.046   27.822 137.434 1.00 75.27  ? 162 ALA H CA  1 
ATOM   8016 C  C   . ALA C 2 134 ? 8.261   28.165 138.696 1.00 76.91  ? 162 ALA H C   1 
ATOM   8017 O  O   . ALA C 2 134 ? 8.478   29.219 139.295 1.00 78.94  ? 162 ALA H O   1 
ATOM   8018 C  CB  . ALA C 2 134 ? 8.209   28.092 136.194 1.00 74.54  ? 162 ALA H CB  1 
ATOM   8019 N  N   . ARG C 2 135 ? 7.359   27.266 139.095 1.00 76.57  ? 163 ARG H N   1 
ATOM   8020 C  CA  . ARG C 2 135 ? 6.561   27.437 140.312 1.00 75.61  ? 163 ARG H CA  1 
ATOM   8021 C  C   . ARG C 2 135 ? 7.449   27.507 141.555 1.00 74.94  ? 163 ARG H C   1 
ATOM   8022 O  O   . ARG C 2 135 ? 7.185   28.290 142.468 1.00 74.41  ? 163 ARG H O   1 
ATOM   8023 C  CB  . ARG C 2 135 ? 5.506   26.323 140.433 1.00 75.67  ? 163 ARG H CB  1 
ATOM   8024 C  CG  . ARG C 2 135 ? 4.685   26.302 141.736 1.00 76.41  ? 163 ARG H CG  1 
ATOM   8025 C  CD  . ARG C 2 135 ? 3.940   27.612 142.024 1.00 77.10  ? 163 ARG H CD  1 
ATOM   8026 N  NE  . ARG C 2 135 ? 2.870   27.891 141.067 1.00 77.77  ? 163 ARG H NE  1 
ATOM   8027 C  CZ  . ARG C 2 135 ? 2.074   28.959 141.110 1.00 78.03  ? 163 ARG H CZ  1 
ATOM   8028 N  NH1 . ARG C 2 135 ? 2.214   29.869 142.068 1.00 78.10  ? 163 ARG H NH1 1 
ATOM   8029 N  NH2 . ARG C 2 135 ? 1.131   29.121 140.190 1.00 77.65  ? 163 ARG H NH2 1 
ATOM   8030 N  N   . LEU C 2 136 ? 8.507   26.698 141.572 1.00 75.12  ? 164 LEU H N   1 
ATOM   8031 C  CA  . LEU C 2 136 ? 9.478   26.713 142.665 1.00 75.25  ? 164 LEU H CA  1 
ATOM   8032 C  C   . LEU C 2 136 ? 10.240  28.032 142.730 1.00 74.56  ? 164 LEU H C   1 
ATOM   8033 O  O   . LEU C 2 136 ? 10.659  28.457 143.805 1.00 75.05  ? 164 LEU H O   1 
ATOM   8034 C  CB  . LEU C 2 136 ? 10.454  25.538 142.551 1.00 75.81  ? 164 LEU H CB  1 
ATOM   8035 C  CG  . LEU C 2 136 ? 9.971   24.151 142.986 1.00 76.17  ? 164 LEU H CG  1 
ATOM   8036 C  CD1 . LEU C 2 136 ? 10.979  23.088 142.580 1.00 76.11  ? 164 LEU H CD1 1 
ATOM   8037 C  CD2 . LEU C 2 136 ? 9.709   24.093 144.490 1.00 76.52  ? 164 LEU H CD2 1 
ATOM   8038 N  N   . ALA C 2 137 ? 10.416  28.669 141.575 1.00 74.36  ? 165 ALA H N   1 
ATOM   8039 C  CA  . ALA C 2 137 ? 11.044  29.985 141.499 1.00 74.60  ? 165 ALA H CA  1 
ATOM   8040 C  C   . ALA C 2 137 ? 10.099  31.080 141.998 1.00 74.94  ? 165 ALA H C   1 
ATOM   8041 O  O   . ALA C 2 137 ? 10.547  32.084 142.559 1.00 74.29  ? 165 ALA H O   1 
ATOM   8042 C  CB  . ALA C 2 137 ? 11.500  30.273 140.077 1.00 74.51  ? 165 ALA H CB  1 
ATOM   8043 N  N   . VAL C 2 138 ? 8.798   30.873 141.789 1.00 75.44  ? 166 VAL H N   1 
ATOM   8044 C  CA  . VAL C 2 138 ? 7.754   31.793 142.258 1.00 75.85  ? 166 VAL H CA  1 
ATOM   8045 C  C   . VAL C 2 138 ? 7.686   31.813 143.788 1.00 75.18  ? 166 VAL H C   1 
ATOM   8046 O  O   . VAL C 2 138 ? 7.654   32.886 144.397 1.00 74.98  ? 166 VAL H O   1 
ATOM   8047 C  CB  . VAL C 2 138 ? 6.359   31.437 141.663 1.00 76.97  ? 166 VAL H CB  1 
ATOM   8048 C  CG1 . VAL C 2 138 ? 5.237   32.204 142.371 1.00 77.72  ? 166 VAL H CG1 1 
ATOM   8049 C  CG2 . VAL C 2 138 ? 6.323   31.706 140.165 1.00 77.11  ? 166 VAL H CG2 1 
ATOM   8050 N  N   . GLU C 2 139 ? 7.670   30.624 144.392 1.00 74.81  ? 167 GLU H N   1 
ATOM   8051 C  CA  . GLU C 2 139 ? 7.648   30.472 145.851 1.00 73.79  ? 167 GLU H CA  1 
ATOM   8052 C  C   . GLU C 2 139 ? 8.969   30.884 146.497 1.00 72.08  ? 167 GLU H C   1 
ATOM   8053 O  O   . GLU C 2 139 ? 8.984   31.334 147.644 1.00 71.85  ? 167 GLU H O   1 
ATOM   8054 C  CB  . GLU C 2 139 ? 7.301   29.033 146.250 1.00 74.93  ? 167 GLU H CB  1 
ATOM   8055 C  CG  . GLU C 2 139 ? 5.937   28.543 145.762 1.00 76.58  ? 167 GLU H CG  1 
ATOM   8056 C  CD  . GLU C 2 139 ? 4.774   29.380 146.276 1.00 76.70  ? 167 GLU H CD  1 
ATOM   8057 O  OE1 . GLU C 2 139 ? 4.664   29.570 147.510 1.00 74.51  ? 167 GLU H OE1 1 
ATOM   8058 O  OE2 . GLU C 2 139 ? 3.966   29.840 145.438 1.00 77.54  ? 167 GLU H OE2 1 
ATOM   8059 N  N   . ALA C 2 140 ? 10.067  30.730 145.755 1.00 71.23  ? 168 ALA H N   1 
ATOM   8060 C  CA  . ALA C 2 140 ? 11.396  31.159 146.201 1.00 70.75  ? 168 ALA H CA  1 
ATOM   8061 C  C   . ALA C 2 140 ? 11.452  32.662 146.479 1.00 70.63  ? 168 ALA H C   1 
ATOM   8062 O  O   . ALA C 2 140 ? 12.261  33.121 147.289 1.00 70.61  ? 168 ALA H O   1 
ATOM   8063 C  CB  . ALA C 2 140 ? 12.453  30.771 145.180 1.00 70.49  ? 168 ALA H CB  1 
ATOM   8064 N  N   . GLY C 2 141 ? 10.593  33.417 145.798 1.00 70.66  ? 169 GLY H N   1 
ATOM   8065 C  CA  . GLY C 2 141 ? 10.453  34.850 146.042 1.00 71.11  ? 169 GLY H CA  1 
ATOM   8066 C  C   . GLY C 2 141 ? 10.890  35.742 144.896 1.00 71.51  ? 169 GLY H C   1 
ATOM   8067 O  O   . GLY C 2 141 ? 11.009  36.958 145.068 1.00 71.08  ? 169 GLY H O   1 
ATOM   8068 N  N   . PHE C 2 142 ? 11.137  35.144 143.731 1.00 71.97  ? 170 PHE H N   1 
ATOM   8069 C  CA  . PHE C 2 142 ? 11.500  35.906 142.540 1.00 72.73  ? 170 PHE H CA  1 
ATOM   8070 C  C   . PHE C 2 142 ? 10.360  36.839 142.148 1.00 73.82  ? 170 PHE H C   1 
ATOM   8071 O  O   . PHE C 2 142 ? 9.202   36.422 142.068 1.00 73.93  ? 170 PHE H O   1 
ATOM   8072 C  CB  . PHE C 2 142 ? 11.865  34.980 141.376 1.00 72.89  ? 170 PHE H CB  1 
ATOM   8073 C  CG  . PHE C 2 142 ? 13.282  34.476 141.415 1.00 72.58  ? 170 PHE H CG  1 
ATOM   8074 C  CD1 . PHE C 2 142 ? 14.333  35.282 140.982 1.00 72.38  ? 170 PHE H CD1 1 
ATOM   8075 C  CD2 . PHE C 2 142 ? 13.566  33.193 141.872 1.00 72.16  ? 170 PHE H CD2 1 
ATOM   8076 C  CE1 . PHE C 2 142 ? 15.646  34.821 141.013 1.00 72.50  ? 170 PHE H CE1 1 
ATOM   8077 C  CE2 . PHE C 2 142 ? 14.877  32.722 141.906 1.00 72.12  ? 170 PHE H CE2 1 
ATOM   8078 C  CZ  . PHE C 2 142 ? 15.918  33.537 141.477 1.00 72.39  ? 170 PHE H CZ  1 
ATOM   8079 N  N   . ASP C 2 143 ? 10.702  38.103 141.913 1.00 74.75  ? 171 ASP H N   1 
ATOM   8080 C  CA  . ASP C 2 143 ? 9.716   39.157 141.658 1.00 74.90  ? 171 ASP H CA  1 
ATOM   8081 C  C   . ASP C 2 143 ? 8.998   39.031 140.310 1.00 75.38  ? 171 ASP H C   1 
ATOM   8082 O  O   . ASP C 2 143 ? 7.954   39.654 140.105 1.00 74.67  ? 171 ASP H O   1 
ATOM   8083 C  CB  . ASP C 2 143 ? 10.371  40.534 141.796 1.00 74.21  ? 171 ASP H CB  1 
ATOM   8084 C  CG  . ASP C 2 143 ? 10.843  40.818 143.210 1.00 73.33  ? 171 ASP H CG  1 
ATOM   8085 O  OD1 . ASP C 2 143 ? 10.026  40.696 144.147 1.00 73.28  ? 171 ASP H OD1 1 
ATOM   8086 O  OD2 . ASP C 2 143 ? 12.030  41.166 143.385 1.00 72.58  ? 171 ASP H OD2 1 
ATOM   8087 N  N   . TRP C 2 144 ? 9.564   38.232 139.405 1.00 76.41  ? 172 TRP H N   1 
ATOM   8088 C  CA  . TRP C 2 144 ? 8.941   37.921 138.116 1.00 77.92  ? 172 TRP H CA  1 
ATOM   8089 C  C   . TRP C 2 144 ? 9.525   36.631 137.545 1.00 78.72  ? 172 TRP H C   1 
ATOM   8090 O  O   . TRP C 2 144 ? 10.736  36.529 137.325 1.00 79.77  ? 172 TRP H O   1 
ATOM   8091 C  CB  . TRP C 2 144 ? 9.130   39.076 137.128 1.00 79.01  ? 172 TRP H CB  1 
ATOM   8092 C  CG  . TRP C 2 144 ? 8.177   39.073 135.959 1.00 79.36  ? 172 TRP H CG  1 
ATOM   8093 C  CD1 . TRP C 2 144 ? 6.833   39.327 135.993 1.00 79.44  ? 172 TRP H CD1 1 
ATOM   8094 C  CD2 . TRP C 2 144 ? 8.504   38.835 134.585 1.00 79.43  ? 172 TRP H CD2 1 
ATOM   8095 N  NE1 . TRP C 2 144 ? 6.302   39.249 134.728 1.00 78.41  ? 172 TRP H NE1 1 
ATOM   8096 C  CE2 . TRP C 2 144 ? 7.304   38.949 133.844 1.00 79.02  ? 172 TRP H CE2 1 
ATOM   8097 C  CE3 . TRP C 2 144 ? 9.691   38.525 133.907 1.00 79.78  ? 172 TRP H CE3 1 
ATOM   8098 C  CZ2 . TRP C 2 144 ? 7.259   38.770 132.458 1.00 79.30  ? 172 TRP H CZ2 1 
ATOM   8099 C  CZ3 . TRP C 2 144 ? 9.647   38.352 132.527 1.00 79.26  ? 172 TRP H CZ3 1 
ATOM   8100 C  CH2 . TRP C 2 144 ? 8.436   38.473 131.819 1.00 79.43  ? 172 TRP H CH2 1 
ATOM   8101 N  N   . VAL C 2 145 ? 8.656   35.647 137.323 1.00 77.61  ? 173 VAL H N   1 
ATOM   8102 C  CA  . VAL C 2 145 ? 9.051   34.353 136.761 1.00 75.68  ? 173 VAL H CA  1 
ATOM   8103 C  C   . VAL C 2 145 ? 8.313   34.145 135.444 1.00 75.47  ? 173 VAL H C   1 
ATOM   8104 O  O   . VAL C 2 145 ? 7.096   34.326 135.378 1.00 77.55  ? 173 VAL H O   1 
ATOM   8105 C  CB  . VAL C 2 145 ? 8.755   33.184 137.740 1.00 74.35  ? 173 VAL H CB  1 
ATOM   8106 C  CG1 . VAL C 2 145 ? 9.108   31.834 137.118 1.00 72.93  ? 173 VAL H CG1 1 
ATOM   8107 C  CG2 . VAL C 2 145 ? 9.515   33.374 139.041 1.00 73.97  ? 173 VAL H CG2 1 
ATOM   8108 N  N   . TYR C 2 146 ? 9.057   33.763 134.406 1.00 72.69  ? 174 TYR H N   1 
ATOM   8109 C  CA  . TYR C 2 146 ? 8.524   33.639 133.053 1.00 68.57  ? 174 TYR H CA  1 
ATOM   8110 C  C   . TYR C 2 146 ? 9.025   32.363 132.385 1.00 67.53  ? 174 TYR H C   1 
ATOM   8111 O  O   . TYR C 2 146 ? 10.230  32.157 132.243 1.00 67.89  ? 174 TYR H O   1 
ATOM   8112 C  CB  . TYR C 2 146 ? 8.920   34.881 132.243 1.00 67.48  ? 174 TYR H CB  1 
ATOM   8113 C  CG  . TYR C 2 146 ? 8.525   34.907 130.773 1.00 68.00  ? 174 TYR H CG  1 
ATOM   8114 C  CD1 . TYR C 2 146 ? 7.278   34.444 130.340 1.00 68.21  ? 174 TYR H CD1 1 
ATOM   8115 C  CD2 . TYR C 2 146 ? 9.390   35.447 129.819 1.00 67.86  ? 174 TYR H CD2 1 
ATOM   8116 C  CE1 . TYR C 2 146 ? 6.919   34.488 128.990 1.00 67.10  ? 174 TYR H CE1 1 
ATOM   8117 C  CE2 . TYR C 2 146 ? 9.037   35.502 128.470 1.00 68.09  ? 174 TYR H CE2 1 
ATOM   8118 C  CZ  . TYR C 2 146 ? 7.803   35.020 128.066 1.00 67.52  ? 174 TYR H CZ  1 
ATOM   8119 O  OH  . TYR C 2 146 ? 7.457   35.072 126.738 1.00 67.36  ? 174 TYR H OH  1 
ATOM   8120 N  N   . TYR C 2 147 ? 8.090   31.501 131.996 1.00 67.36  ? 175 TYR H N   1 
ATOM   8121 C  CA  . TYR C 2 147 ? 8.403   30.315 131.206 1.00 69.74  ? 175 TYR H CA  1 
ATOM   8122 C  C   . TYR C 2 147 ? 8.657   30.783 129.767 1.00 71.66  ? 175 TYR H C   1 
ATOM   8123 O  O   . TYR C 2 147 ? 7.777   30.680 128.905 1.00 70.11  ? 175 TYR H O   1 
ATOM   8124 C  CB  . TYR C 2 147 ? 7.229   29.325 131.263 1.00 70.67  ? 175 TYR H CB  1 
ATOM   8125 C  CG  . TYR C 2 147 ? 7.555   27.868 130.955 1.00 71.57  ? 175 TYR H CG  1 
ATOM   8126 C  CD1 . TYR C 2 147 ? 8.437   27.515 129.929 1.00 73.01  ? 175 TYR H CD1 1 
ATOM   8127 C  CD2 . TYR C 2 147 ? 6.943   26.838 131.670 1.00 71.53  ? 175 TYR H CD2 1 
ATOM   8128 C  CE1 . TYR C 2 147 ? 8.721   26.176 129.649 1.00 72.08  ? 175 TYR H CE1 1 
ATOM   8129 C  CE2 . TYR C 2 147 ? 7.217   25.499 131.388 1.00 71.28  ? 175 TYR H CE2 1 
ATOM   8130 C  CZ  . TYR C 2 147 ? 8.106   25.177 130.380 1.00 70.75  ? 175 TYR H CZ  1 
ATOM   8131 O  OH  . TYR C 2 147 ? 8.382   23.859 130.104 1.00 70.06  ? 175 TYR H OH  1 
ATOM   8132 N  N   . GLU C 2 148 ? 9.859   31.305 129.522 1.00 73.37  ? 176 GLU H N   1 
ATOM   8133 C  CA  . GLU C 2 148 ? 10.191  31.952 128.249 1.00 76.80  ? 176 GLU H CA  1 
ATOM   8134 C  C   . GLU C 2 148 ? 10.200  31.011 127.046 1.00 77.43  ? 176 GLU H C   1 
ATOM   8135 O  O   . GLU C 2 148 ? 9.547   31.279 126.036 1.00 76.12  ? 176 GLU H O   1 
ATOM   8136 C  CB  . GLU C 2 148 ? 11.528  32.692 128.344 1.00 79.05  ? 176 GLU H CB  1 
ATOM   8137 C  CG  . GLU C 2 148 ? 12.064  33.173 126.988 1.00 81.23  ? 176 GLU H CG  1 
ATOM   8138 C  CD  . GLU C 2 148 ? 12.579  34.592 127.037 1.00 83.73  ? 176 GLU H CD  1 
ATOM   8139 O  OE1 . GLU C 2 148 ? 12.972  35.042 128.138 1.00 88.36  ? 176 GLU H OE1 1 
ATOM   8140 O  OE2 . GLU C 2 148 ? 12.582  35.260 125.981 1.00 80.06  ? 176 GLU H OE2 1 
ATOM   8141 N  N   . SER C 2 149 ? 10.959  29.926 127.159 1.00 78.13  ? 177 SER H N   1 
ATOM   8142 C  CA  . SER C 2 149 ? 11.089  28.943 126.092 1.00 78.81  ? 177 SER H CA  1 
ATOM   8143 C  C   . SER C 2 149 ? 11.125  27.546 126.703 1.00 79.21  ? 177 SER H C   1 
ATOM   8144 O  O   . SER C 2 149 ? 11.112  27.412 127.927 1.00 77.94  ? 177 SER H O   1 
ATOM   8145 C  CB  . SER C 2 149 ? 12.352  29.218 125.266 1.00 79.19  ? 177 SER H CB  1 
ATOM   8146 O  OG  . SER C 2 149 ? 13.462  29.514 126.098 1.00 79.54  ? 177 SER H OG  1 
ATOM   8147 N  N   . LYS C 2 150 ? 11.159  26.513 125.860 1.00 80.42  ? 178 LYS H N   1 
ATOM   8148 C  CA  . LYS C 2 150 ? 11.294  25.133 126.339 1.00 81.28  ? 178 LYS H CA  1 
ATOM   8149 C  C   . LYS C 2 150 ? 12.648  24.918 126.975 1.00 81.31  ? 178 LYS H C   1 
ATOM   8150 O  O   . LYS C 2 150 ? 12.780  24.118 127.895 1.00 83.38  ? 178 LYS H O   1 
ATOM   8151 C  CB  . LYS C 2 150 ? 11.170  24.119 125.207 1.00 83.14  ? 178 LYS H CB  1 
ATOM   8152 C  CG  . LYS C 2 150 ? 10.153  24.443 124.177 1.00 86.74  ? 178 LYS H CG  1 
ATOM   8153 C  CD  . LYS C 2 150 ? 8.760   24.084 124.618 1.00 89.46  ? 178 LYS H CD  1 
ATOM   8154 C  CE  . LYS C 2 150 ? 7.784   24.699 123.644 1.00 93.15  ? 178 LYS H CE  1 
ATOM   8155 N  NZ  . LYS C 2 150 ? 8.291   24.610 122.229 1.00 94.83  ? 178 LYS H NZ  1 
ATOM   8156 N  N   . ALA C 2 151 ? 13.653  25.621 126.462 1.00 79.43  ? 179 ALA H N   1 
ATOM   8157 C  CA  . ALA C 2 151 ? 15.030  25.430 126.888 1.00 79.00  ? 179 ALA H CA  1 
ATOM   8158 C  C   . ALA C 2 151 ? 15.326  25.967 128.288 1.00 79.81  ? 179 ALA H C   1 
ATOM   8159 O  O   . ALA C 2 151 ? 16.225  25.453 128.959 1.00 81.19  ? 179 ALA H O   1 
ATOM   8160 C  CB  . ALA C 2 151 ? 15.981  26.035 125.872 1.00 79.16  ? 179 ALA H CB  1 
ATOM   8161 N  N   . HIS C 2 152 ? 14.583  26.985 128.730 1.00 79.13  ? 180 HIS H N   1 
ATOM   8162 C  CA  . HIS C 2 152 ? 14.848  27.608 130.033 1.00 79.42  ? 180 HIS H CA  1 
ATOM   8163 C  C   . HIS C 2 152 ? 13.686  28.400 130.642 1.00 78.25  ? 180 HIS H C   1 
ATOM   8164 O  O   . HIS C 2 152 ? 12.720  28.735 129.956 1.00 79.19  ? 180 HIS H O   1 
ATOM   8165 C  CB  . HIS C 2 152 ? 16.095  28.502 129.948 1.00 81.17  ? 180 HIS H CB  1 
ATOM   8166 C  CG  . HIS C 2 152 ? 15.859  29.815 129.269 1.00 81.41  ? 180 HIS H CG  1 
ATOM   8167 N  ND1 . HIS C 2 152 ? 16.018  29.990 127.911 1.00 81.43  ? 180 HIS H ND1 1 
ATOM   8168 C  CD2 . HIS C 2 152 ? 15.490  31.020 129.764 1.00 81.96  ? 180 HIS H CD2 1 
ATOM   8169 C  CE1 . HIS C 2 152 ? 15.748  31.244 127.598 1.00 82.72  ? 180 HIS H CE1 1 
ATOM   8170 N  NE2 . HIS C 2 152 ? 15.425  31.891 128.705 1.00 83.27  ? 180 HIS H NE2 1 
ATOM   8171 N  N   . ILE C 2 153 ? 13.812  28.696 131.938 1.00 76.35  ? 181 ILE H N   1 
ATOM   8172 C  CA  . ILE C 2 153 ? 12.902  29.588 132.658 1.00 74.64  ? 181 ILE H CA  1 
ATOM   8173 C  C   . ILE C 2 153 ? 13.629  30.893 132.994 1.00 74.46  ? 181 ILE H C   1 
ATOM   8174 O  O   . ILE C 2 153 ? 14.754  30.868 133.494 1.00 73.63  ? 181 ILE H O   1 
ATOM   8175 C  CB  . ILE C 2 153 ? 12.380  28.935 133.970 1.00 73.84  ? 181 ILE H CB  1 
ATOM   8176 C  CG1 . ILE C 2 153 ? 11.825  27.526 133.713 1.00 74.07  ? 181 ILE H CG1 1 
ATOM   8177 C  CG2 . ILE C 2 153 ? 11.354  29.833 134.671 1.00 73.22  ? 181 ILE H CG2 1 
ATOM   8178 C  CD1 . ILE C 2 153 ? 10.615  27.466 132.785 1.00 75.14  ? 181 ILE H CD1 1 
ATOM   8179 N  N   . HIS C 2 154 ? 12.988  32.025 132.705 1.00 74.97  ? 182 HIS H N   1 
ATOM   8180 C  CA  . HIS C 2 154 ? 13.543  33.342 133.029 1.00 75.86  ? 182 HIS H CA  1 
ATOM   8181 C  C   . HIS C 2 154 ? 13.038  33.819 134.391 1.00 77.32  ? 182 HIS H C   1 
ATOM   8182 O  O   . HIS C 2 154 ? 11.833  33.823 134.656 1.00 79.07  ? 182 HIS H O   1 
ATOM   8183 C  CB  . HIS C 2 154 ? 13.204  34.367 131.934 1.00 74.78  ? 182 HIS H CB  1 
ATOM   8184 C  CG  . HIS C 2 154 ? 13.638  35.769 132.250 1.00 73.24  ? 182 HIS H CG  1 
ATOM   8185 N  ND1 . HIS C 2 154 ? 14.855  36.280 131.852 1.00 73.52  ? 182 HIS H ND1 1 
ATOM   8186 C  CD2 . HIS C 2 154 ? 13.011  36.768 132.916 1.00 72.09  ? 182 HIS H CD2 1 
ATOM   8187 C  CE1 . HIS C 2 154 ? 14.959  37.532 132.263 1.00 72.24  ? 182 HIS H CE1 1 
ATOM   8188 N  NE2 . HIS C 2 154 ? 13.856  37.851 132.914 1.00 71.40  ? 182 HIS H NE2 1 
ATOM   8189 N  N   . CYS C 2 155 ? 13.972  34.217 135.250 1.00 76.42  ? 183 CYS H N   1 
ATOM   8190 C  CA  . CYS C 2 155 ? 13.641  34.754 136.559 1.00 75.91  ? 183 CYS H CA  1 
ATOM   8191 C  C   . CYS C 2 155 ? 14.341  36.094 136.750 1.00 74.82  ? 183 CYS H C   1 
ATOM   8192 O  O   . CYS C 2 155 ? 15.442  36.297 136.237 1.00 72.74  ? 183 CYS H O   1 
ATOM   8193 C  CB  . CYS C 2 155 ? 14.047  33.769 137.654 1.00 77.80  ? 183 CYS H CB  1 
ATOM   8194 S  SG  . CYS C 2 155 ? 13.427  32.089 137.395 1.00 80.48  ? 183 CYS H SG  1 
ATOM   8195 N  N   . SER C 2 156 ? 13.690  37.004 137.474 1.00 75.52  ? 184 SER H N   1 
ATOM   8196 C  CA  . SER C 2 156 ? 14.247  38.330 137.750 1.00 76.24  ? 184 SER H CA  1 
ATOM   8197 C  C   . SER C 2 156 ? 13.817  38.876 139.111 1.00 77.03  ? 184 SER H C   1 
ATOM   8198 O  O   . SER C 2 156 ? 12.832  38.417 139.697 1.00 78.06  ? 184 SER H O   1 
ATOM   8199 C  CB  . SER C 2 156 ? 13.868  39.317 136.645 1.00 78.09  ? 184 SER H CB  1 
ATOM   8200 O  OG  . SER C 2 156 ? 12.464  39.501 136.578 1.00 80.52  ? 184 SER H OG  1 
ATOM   8201 N  N   . VAL C 2 157 ? 14.568  39.860 139.603 1.00 76.42  ? 185 VAL H N   1 
ATOM   8202 C  CA  . VAL C 2 157 ? 14.305  40.482 140.901 1.00 75.29  ? 185 VAL H CA  1 
ATOM   8203 C  C   . VAL C 2 157 ? 14.252  42.008 140.792 1.00 75.01  ? 185 VAL H C   1 
ATOM   8204 O  O   . VAL C 2 157 ? 14.614  42.574 139.759 1.00 74.00  ? 185 VAL H O   1 
ATOM   8205 C  CB  . VAL C 2 157 ? 15.361  40.067 141.963 1.00 75.13  ? 185 VAL H CB  1 
ATOM   8206 C  CG1 . VAL C 2 157 ? 15.263  38.578 142.264 1.00 75.24  ? 185 VAL H CG1 1 
ATOM   8207 C  CG2 . VAL C 2 157 ? 16.775  40.438 141.513 1.00 74.90  ? 185 VAL H CG2 1 
ATOM   8208 N  N   . LYS C 2 158 ? 13.795  42.661 141.858 1.00 75.58  ? 186 LYS H N   1 
ATOM   8209 C  CA  . LYS C 2 158 ? 13.780  44.121 141.931 1.00 76.32  ? 186 LYS H CA  1 
ATOM   8210 C  C   . LYS C 2 158 ? 15.189  44.661 142.172 1.00 77.68  ? 186 LYS H C   1 
ATOM   8211 O  O   . LYS C 2 158 ? 16.070  43.932 142.638 1.00 77.02  ? 186 LYS H O   1 
ATOM   8212 C  CB  . LYS C 2 158 ? 12.841  44.599 143.042 1.00 76.19  ? 186 LYS H CB  1 
ATOM   8213 C  CG  . LYS C 2 158 ? 11.357  44.397 142.766 1.00 75.91  ? 186 LYS H CG  1 
ATOM   8214 C  CD  . LYS C 2 158 ? 10.523  44.799 143.980 1.00 75.84  ? 186 LYS H CD  1 
ATOM   8215 C  CE  . LYS C 2 158 ? 9.052   44.442 143.809 1.00 74.84  ? 186 LYS H CE  1 
ATOM   8216 N  NZ  . LYS C 2 158 ? 8.374   45.302 142.802 1.00 73.90  ? 186 LYS H NZ  1 
ATOM   8217 N  N   . ALA C 2 159 ? 15.390  45.939 141.856 1.00 80.37  ? 187 ALA H N   1 
ATOM   8218 C  CA  . ALA C 2 159 ? 16.670  46.615 142.079 1.00 84.11  ? 187 ALA H CA  1 
ATOM   8219 C  C   . ALA C 2 159 ? 17.032  46.693 143.569 1.00 87.63  ? 187 ALA H C   1 
ATOM   8220 O  O   . ALA C 2 159 ? 16.173  46.508 144.437 1.00 88.08  ? 187 ALA H O   1 
ATOM   8221 C  CB  . ALA C 2 159 ? 16.644  48.005 141.454 1.00 83.60  ? 187 ALA H CB  1 
ATOM   8222 N  N   . GLU C 2 160 ? 18.304  46.962 143.855 1.00 91.04  ? 188 GLU H N   1 
ATOM   8223 C  CA  . GLU C 2 160 ? 18.802  47.017 145.235 1.00 94.52  ? 188 GLU H CA  1 
ATOM   8224 C  C   . GLU C 2 160 ? 18.289  48.223 146.024 1.00 96.30  ? 188 GLU H C   1 
ATOM   8225 O  O   . GLU C 2 160 ? 18.153  48.157 147.249 1.00 95.81  ? 188 GLU H O   1 
ATOM   8226 C  CB  . GLU C 2 160 ? 20.335  46.981 145.259 1.00 95.52  ? 188 GLU H CB  1 
ATOM   8227 C  CG  . GLU C 2 160 ? 20.946  45.623 144.904 1.00 96.50  ? 188 GLU H CG  1 
ATOM   8228 C  CD  . GLU C 2 160 ? 20.651  44.543 145.938 1.00 97.01  ? 188 GLU H CD  1 
ATOM   8229 O  OE1 . GLU C 2 160 ? 20.676  44.845 147.152 1.00 96.66  ? 188 GLU H OE1 1 
ATOM   8230 O  OE2 . GLU C 2 160 ? 20.400  43.388 145.533 1.00 97.44  ? 188 GLU H OE2 1 
ATOM   8231 N  N   . ASN C 2 161 ? 18.008  49.315 145.315 1.00 98.87  ? 189 ASN H N   1 
ATOM   8232 C  CA  . ASN C 2 161 ? 17.531  50.560 145.928 1.00 100.83 ? 189 ASN H CA  1 
ATOM   8233 C  C   . ASN C 2 161 ? 16.004  50.664 146.062 1.00 101.51 ? 189 ASN H C   1 
ATOM   8234 O  O   . ASN C 2 161 ? 15.496  51.561 146.740 1.00 101.39 ? 189 ASN H O   1 
ATOM   8235 C  CB  . ASN C 2 161 ? 18.095  51.785 145.185 1.00 101.73 ? 189 ASN H CB  1 
ATOM   8236 C  CG  . ASN C 2 161 ? 17.942  51.687 143.666 1.00 102.69 ? 189 ASN H CG  1 
ATOM   8237 O  OD1 . ASN C 2 161 ? 17.047  51.010 143.153 1.00 102.61 ? 189 ASN H OD1 1 
ATOM   8238 N  ND2 . ASN C 2 161 ? 18.821  52.374 142.944 1.00 103.06 ? 189 ASN H ND2 1 
ATOM   8239 N  N   . SER C 2 162 ? 15.286  49.745 145.415 1.00 102.26 ? 190 SER H N   1 
ATOM   8240 C  CA  . SER C 2 162 ? 13.821  49.699 145.481 1.00 102.63 ? 190 SER H CA  1 
ATOM   8241 C  C   . SER C 2 162 ? 13.313  48.936 146.707 1.00 103.13 ? 190 SER H C   1 
ATOM   8242 O  O   . SER C 2 162 ? 12.138  49.045 147.069 1.00 103.05 ? 190 SER H O   1 
ATOM   8243 C  CB  . SER C 2 162 ? 13.242  49.082 144.205 1.00 102.47 ? 190 SER H CB  1 
ATOM   8244 O  OG  . SER C 2 162 ? 13.493  49.905 143.080 1.00 102.87 ? 190 SER H OG  1 
ATOM   8245 N  N   . VAL C 2 163 ? 14.203  48.169 147.335 1.00 103.58 ? 191 VAL H N   1 
ATOM   8246 C  CA  . VAL C 2 163 ? 13.866  47.378 148.522 1.00 103.30 ? 191 VAL H CA  1 
ATOM   8247 C  C   . VAL C 2 163 ? 14.553  47.918 149.774 1.00 103.12 ? 191 VAL H C   1 
ATOM   8248 O  O   . VAL C 2 163 ? 13.971  48.700 150.525 1.00 103.07 ? 191 VAL H O   1 
ATOM   8249 C  CB  . VAL C 2 163 ? 14.217  45.873 148.345 1.00 103.26 ? 191 VAL H CB  1 
ATOM   8250 C  CG1 . VAL C 2 163 ? 13.262  45.209 147.357 1.00 103.06 ? 191 VAL H CG1 1 
ATOM   8251 C  CG2 . VAL C 2 163 ? 15.676  45.688 147.913 1.00 103.16 ? 191 VAL H CG2 1 
HETATM 8252 ZN ZN  . ZN  D 3 .   ? 20.201  45.784 19.743  1.00 151.98 ? 902 ZN  A ZN  1 
HETATM 8253 ZN ZN  . ZN  E 3 .   ? 16.465  35.592 130.742 1.00 75.43  ? 400 ZN  H ZN  1 
HETATM 8254 CA CA  . CA  F 4 .   ? 26.078  31.750 130.237 1.00 90.60  ? 401 CA  H CA  1 
HETATM 8255 CA CA  . CA  G 4 .   ? 25.912  35.229 128.547 1.00 91.80  ? 402 CA  H CA  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   193 ?   ?   ?   A . n 
A 1 2   ASN 2   194 ?   ?   ?   A . n 
A 1 3   TYR 3   195 ?   ?   ?   A . n 
A 1 4   LEU 4   196 ?   ?   ?   A . n 
A 1 5   ASP 5   197 ?   ?   ?   A . n 
A 1 6   GLN 6   198 ?   ?   ?   A . n 
A 1 7   MET 7   199 ?   ?   ?   A . n 
A 1 8   GLU 8   200 ?   ?   ?   A . n 
A 1 9   GLU 9   201 ?   ?   ?   A . n 
A 1 10  TYR 10  202 ?   ?   ?   A . n 
A 1 11  ASP 11  203 ?   ?   ?   A . n 
A 1 12  LYS 12  204 ?   ?   ?   A . n 
A 1 13  VAL 13  205 ?   ?   ?   A . n 
A 1 14  GLU 14  206 ?   ?   ?   A . n 
A 1 15  GLU 15  207 ?   ?   ?   A . n 
A 1 16  ILE 16  208 ?   ?   ?   A . n 
A 1 17  SER 17  209 ?   ?   ?   A . n 
A 1 18  ARG 18  210 ?   ?   ?   A . n 
A 1 19  LYS 19  211 ?   ?   ?   A . n 
A 1 20  HIS 20  212 ?   ?   ?   A . n 
A 1 21  LYS 21  213 ?   ?   ?   A . n 
A 1 22  HIS 22  214 214 HIS HIS A . n 
A 1 23  ASN 23  215 215 ASN ASN A . n 
A 1 24  CYS 24  216 216 CYS CYS A . n 
A 1 25  PHE 25  217 217 PHE PHE A . n 
A 1 26  CYS 26  218 218 CYS CYS A . n 
A 1 27  ILE 27  219 219 ILE ILE A . n 
A 1 28  GLN 28  220 220 GLN GLN A . n 
A 1 29  GLU 29  221 221 GLU GLU A . n 
A 1 30  VAL 30  222 222 VAL VAL A . n 
A 1 31  VAL 31  223 223 VAL VAL A . n 
A 1 32  SER 32  224 224 SER SER A . n 
A 1 33  GLY 33  225 225 GLY GLY A . n 
A 1 34  LEU 34  226 226 LEU LEU A . n 
A 1 35  ARG 35  227 227 ARG ARG A . n 
A 1 36  GLN 36  228 228 GLN GLN A . n 
A 1 37  PRO 37  229 229 PRO PRO A . n 
A 1 38  VAL 38  230 230 VAL VAL A . n 
A 1 39  GLY 39  231 231 GLY GLY A . n 
A 1 40  ALA 40  232 232 ALA ALA A . n 
A 1 41  LEU 41  233 233 LEU LEU A . n 
A 1 42  HIS 42  234 234 HIS HIS A . n 
A 1 43  SER 43  235 235 SER SER A . n 
A 1 44  GLY 44  236 236 GLY GLY A . n 
A 1 45  ASP 45  237 237 ASP ASP A . n 
A 1 46  GLY 46  238 238 GLY GLY A . n 
A 1 47  SER 47  239 239 SER SER A . n 
A 1 48  GLN 48  240 240 GLN GLN A . n 
A 1 49  ARG 49  241 241 ARG ARG A . n 
A 1 50  LEU 50  242 242 LEU LEU A . n 
A 1 51  PHE 51  243 243 PHE PHE A . n 
A 1 52  ILE 52  244 244 ILE ILE A . n 
A 1 53  LEU 53  245 245 LEU LEU A . n 
A 1 54  GLU 54  246 246 GLU GLU A . n 
A 1 55  LYS 55  247 247 LYS LYS A . n 
A 1 56  GLU 56  248 248 GLU GLU A . n 
A 1 57  GLY 57  249 249 GLY GLY A . n 
A 1 58  TYR 58  250 250 TYR TYR A . n 
A 1 59  VAL 59  251 251 VAL VAL A . n 
A 1 60  LYS 60  252 252 LYS LYS A . n 
A 1 61  ILE 61  253 253 ILE ILE A . n 
A 1 62  LEU 62  254 254 LEU LEU A . n 
A 1 63  THR 63  255 255 THR THR A . n 
A 1 64  PRO 64  256 256 PRO PRO A . n 
A 1 65  GLU 65  257 257 GLU GLU A . n 
A 1 66  GLY 66  258 258 GLY GLY A . n 
A 1 67  GLU 67  259 259 GLU GLU A . n 
A 1 68  ILE 68  260 260 ILE ILE A . n 
A 1 69  PHE 69  261 261 PHE PHE A . n 
A 1 70  LYS 70  262 262 LYS LYS A . n 
A 1 71  GLU 71  263 263 GLU GLU A . n 
A 1 72  PRO 72  264 264 PRO PRO A . n 
A 1 73  TYR 73  265 265 TYR TYR A . n 
A 1 74  LEU 74  266 266 LEU LEU A . n 
A 1 75  ASP 75  267 267 ASP ASP A . n 
A 1 76  ILE 76  268 268 ILE ILE A . n 
A 1 77  HIS 77  269 269 HIS HIS A . n 
A 1 78  LYS 78  270 270 LYS LYS A . n 
A 1 79  LEU 79  271 271 LEU LEU A . n 
A 1 80  VAL 80  272 272 VAL VAL A . n 
A 1 81  GLN 81  273 273 GLN GLN A . n 
A 1 82  SER 82  274 274 SER SER A . n 
A 1 83  GLY 83  275 275 GLY GLY A . n 
A 1 84  ILE 84  276 276 ILE ILE A . n 
A 1 85  LYS 85  277 277 LYS LYS A . n 
A 1 86  GLY 86  278 278 GLY GLY A . n 
A 1 87  GLY 87  279 279 GLY GLY A . n 
A 1 88  ASP 88  280 280 ASP ASP A . n 
A 1 89  GLU 89  281 281 GLU GLU A . n 
A 1 90  ARG 90  282 282 ARG ARG A . n 
A 1 91  GLY 91  283 283 GLY GLY A . n 
A 1 92  LEU 92  284 284 LEU LEU A . n 
A 1 93  LEU 93  285 285 LEU LEU A . n 
A 1 94  SER 94  286 286 SER SER A . n 
A 1 95  LEU 95  287 287 LEU LEU A . n 
A 1 96  ALA 96  288 288 ALA ALA A . n 
A 1 97  PHE 97  289 289 PHE PHE A . n 
A 1 98  HIS 98  290 290 HIS HIS A . n 
A 1 99  PRO 99  291 291 PRO PRO A . n 
A 1 100 ASN 100 292 292 ASN ASN A . n 
A 1 101 TYR 101 293 293 TYR TYR A . n 
A 1 102 LYS 102 294 294 LYS LYS A . n 
A 1 103 LYS 103 295 295 LYS LYS A . n 
A 1 104 ASN 104 296 296 ASN ASN A . n 
A 1 105 GLY 105 297 297 GLY GLY A . n 
A 1 106 LYS 106 298 298 LYS LYS A . n 
A 1 107 LEU 107 299 299 LEU LEU A . n 
A 1 108 TYR 108 300 300 TYR TYR A . n 
A 1 109 VAL 109 301 301 VAL VAL A . n 
A 1 110 SER 110 302 302 SER SER A . n 
A 1 111 TYR 111 303 303 TYR TYR A . n 
A 1 112 THR 112 304 304 THR THR A . n 
A 1 113 THR 113 305 305 THR THR A . n 
A 1 114 ASN 114 306 306 ASN ASN A . n 
A 1 115 GLN 115 307 ?   ?   ?   A . n 
A 1 116 GLU 116 308 ?   ?   ?   A . n 
A 1 117 ARG 117 309 309 ARG ARG A . n 
A 1 118 TRP 118 310 310 TRP TRP A . n 
A 1 119 ALA 119 311 311 ALA ALA A . n 
A 1 120 ILE 120 312 312 ILE ILE A . n 
A 1 121 GLY 121 313 313 GLY GLY A . n 
A 1 122 PRO 122 314 314 PRO PRO A . n 
A 1 123 HIS 123 315 315 HIS HIS A . n 
A 1 124 ASP 124 316 316 ASP ASP A . n 
A 1 125 HIS 125 317 317 HIS HIS A . n 
A 1 126 ILE 126 318 318 ILE ILE A . n 
A 1 127 LEU 127 319 319 LEU LEU A . n 
A 1 128 ARG 128 320 320 ARG ARG A . n 
A 1 129 VAL 129 321 321 VAL VAL A . n 
A 1 130 VAL 130 322 322 VAL VAL A . n 
A 1 131 GLU 131 323 323 GLU GLU A . n 
A 1 132 TYR 132 324 324 TYR TYR A . n 
A 1 133 THR 133 325 325 THR THR A . n 
A 1 134 VAL 134 326 326 VAL VAL A . n 
A 1 135 SER 135 327 327 SER SER A . n 
A 1 136 ARG 136 328 328 ARG ARG A . n 
A 1 137 LYS 137 329 329 LYS LYS A . n 
A 1 138 ASN 138 330 330 ASN ASN A . n 
A 1 139 PRO 139 331 331 PRO PRO A . n 
A 1 140 HIS 140 332 332 HIS HIS A . n 
A 1 141 GLN 141 333 333 GLN GLN A . n 
A 1 142 VAL 142 334 334 VAL VAL A . n 
A 1 143 ASP 143 335 335 ASP ASP A . n 
A 1 144 LEU 144 336 336 LEU LEU A . n 
A 1 145 ARG 145 337 337 ARG ARG A . n 
A 1 146 THR 146 338 338 THR THR A . n 
A 1 147 ALA 147 339 339 ALA ALA A . n 
A 1 148 ARG 148 340 340 ARG ARG A . n 
A 1 149 VAL 149 341 341 VAL VAL A . n 
A 1 150 PHE 150 342 342 PHE PHE A . n 
A 1 151 LEU 151 343 343 LEU LEU A . n 
A 1 152 GLU 152 344 344 GLU GLU A . n 
A 1 153 VAL 153 345 345 VAL VAL A . n 
A 1 154 ALA 154 346 346 ALA ALA A . n 
A 1 155 GLU 155 347 347 GLU GLU A . n 
A 1 156 LEU 156 348 348 LEU LEU A . n 
A 1 157 HIS 157 349 349 HIS HIS A . n 
A 1 158 ARG 158 350 350 ARG ARG A . n 
A 1 159 LYS 159 351 351 LYS LYS A . n 
A 1 160 HIS 160 352 352 HIS HIS A . n 
A 1 161 LEU 161 353 353 LEU LEU A . n 
A 1 162 GLY 162 354 354 GLY GLY A . n 
A 1 163 GLY 163 355 355 GLY GLY A . n 
A 1 164 GLN 164 356 356 GLN GLN A . n 
A 1 165 LEU 165 357 357 LEU LEU A . n 
A 1 166 LEU 166 358 358 LEU LEU A . n 
A 1 167 PHE 167 359 359 PHE PHE A . n 
A 1 168 GLY 168 360 360 GLY GLY A . n 
A 1 169 PRO 169 361 361 PRO PRO A . n 
A 1 170 ASP 170 362 362 ASP ASP A . n 
A 1 171 GLY 171 363 363 GLY GLY A . n 
A 1 172 PHE 172 364 364 PHE PHE A . n 
A 1 173 LEU 173 365 365 LEU LEU A . n 
A 1 174 TYR 174 366 366 TYR TYR A . n 
A 1 175 ILE 175 367 367 ILE ILE A . n 
A 1 176 ILE 176 368 368 ILE ILE A . n 
A 1 177 LEU 177 369 369 LEU LEU A . n 
A 1 178 GLY 178 370 370 GLY GLY A . n 
A 1 179 ASP 179 371 371 ASP ASP A . n 
A 1 180 GLY 180 372 372 GLY GLY A . n 
A 1 181 MET 181 373 373 MET MET A . n 
A 1 182 ILE 182 374 374 ILE ILE A . n 
A 1 183 THR 183 375 375 THR THR A . n 
A 1 184 LEU 184 376 376 LEU LEU A . n 
A 1 185 ASP 185 377 377 ASP ASP A . n 
A 1 186 ASP 186 378 378 ASP ASP A . n 
A 1 187 MET 187 379 379 MET MET A . n 
A 1 188 GLU 188 380 380 GLU GLU A . n 
A 1 189 GLU 189 381 381 GLU GLU A . n 
A 1 190 MET 190 382 382 MET MET A . n 
A 1 191 ASP 191 383 383 ASP ASP A . n 
A 1 192 GLY 192 384 384 GLY GLY A . n 
A 1 193 LEU 193 385 385 LEU LEU A . n 
A 1 194 SER 194 386 386 SER SER A . n 
A 1 195 ASP 195 387 387 ASP ASP A . n 
A 1 196 PHE 196 388 388 PHE PHE A . n 
A 1 197 THR 197 389 389 THR THR A . n 
A 1 198 GLY 198 390 390 GLY GLY A . n 
A 1 199 SER 199 391 391 SER SER A . n 
A 1 200 VAL 200 392 392 VAL VAL A . n 
A 1 201 LEU 201 393 393 LEU LEU A . n 
A 1 202 ARG 202 394 394 ARG ARG A . n 
A 1 203 LEU 203 395 395 LEU LEU A . n 
A 1 204 ASP 204 396 396 ASP ASP A . n 
A 1 205 VAL 205 397 397 VAL VAL A . n 
A 1 206 ASP 206 398 398 ASP ASP A . n 
A 1 207 THR 207 399 399 THR THR A . n 
A 1 208 ASP 208 400 400 ASP ASP A . n 
A 1 209 MET 209 401 401 MET MET A . n 
A 1 210 CYS 210 402 402 CYS CYS A . n 
A 1 211 ASN 211 403 403 ASN ASN A . n 
A 1 212 VAL 212 404 404 VAL VAL A . n 
A 1 213 PRO 213 405 405 PRO PRO A . n 
A 1 214 TYR 214 406 406 TYR TYR A . n 
A 1 215 SER 215 407 407 SER SER A . n 
A 1 216 ILE 216 408 408 ILE ILE A . n 
A 1 217 PRO 217 409 409 PRO PRO A . n 
A 1 218 ARG 218 410 410 ARG ARG A . n 
A 1 219 SER 219 411 411 SER SER A . n 
A 1 220 ASN 220 412 412 ASN ASN A . n 
A 1 221 PRO 221 413 413 PRO PRO A . n 
A 1 222 HIS 222 414 414 HIS HIS A . n 
A 1 223 PHE 223 415 415 PHE PHE A . n 
A 1 224 ASN 224 416 416 ASN ASN A . n 
A 1 225 SER 225 417 417 SER SER A . n 
A 1 226 THR 226 418 418 THR THR A . n 
A 1 227 ASN 227 419 ?   ?   ?   A . n 
A 1 228 GLN 228 420 ?   ?   ?   A . n 
A 1 229 PRO 229 421 ?   ?   ?   A . n 
A 1 230 PRO 230 422 422 PRO PRO A . n 
A 1 231 GLU 231 423 423 GLU GLU A . n 
A 1 232 VAL 232 424 424 VAL VAL A . n 
A 1 233 PHE 233 425 425 PHE PHE A . n 
A 1 234 ALA 234 426 426 ALA ALA A . n 
A 1 235 HIS 235 427 427 HIS HIS A . n 
A 1 236 GLY 236 428 428 GLY GLY A . n 
A 1 237 LEU 237 429 429 LEU LEU A . n 
A 1 238 HIS 238 430 430 HIS HIS A . n 
A 1 239 ASP 239 431 431 ASP ASP A . n 
A 1 240 PRO 240 432 432 PRO PRO A . n 
A 1 241 GLY 241 433 433 GLY GLY A . n 
A 1 242 ARG 242 434 434 ARG ARG A . n 
A 1 243 CYS 243 435 435 CYS CYS A . n 
A 1 244 ALA 244 436 436 ALA ALA A . n 
A 1 245 VAL 245 437 437 VAL VAL A . n 
A 1 246 ASP 246 438 438 ASP ASP A . n 
A 1 247 ARG 247 439 439 ARG ARG A . n 
A 1 248 HIS 248 440 440 HIS HIS A . n 
A 1 249 PRO 249 441 ?   ?   ?   A . n 
A 1 250 THR 250 442 ?   ?   ?   A . n 
A 1 251 ASP 251 443 ?   ?   ?   A . n 
A 1 252 ILE 252 444 ?   ?   ?   A . n 
A 1 253 ASN 253 445 ?   ?   ?   A . n 
A 1 254 ILE 254 446 ?   ?   ?   A . n 
A 1 255 ASN 255 447 447 ASN ASN A . n 
A 1 256 LEU 256 448 448 LEU LEU A . n 
A 1 257 THR 257 449 449 THR THR A . n 
A 1 258 ILE 258 450 450 ILE ILE A . n 
A 1 259 LEU 259 451 451 LEU LEU A . n 
A 1 260 CYS 260 452 452 CYS CYS A . n 
A 1 261 SER 261 453 453 SER SER A . n 
A 1 262 ASP 262 454 454 ASP ASP A . n 
A 1 263 SER 263 455 455 SER SER A . n 
A 1 264 ASN 264 456 456 ASN ASN A . n 
A 1 265 GLY 265 457 457 GLY GLY A . n 
A 1 266 LYS 266 458 458 LYS LYS A . n 
A 1 267 ASN 267 459 459 ASN ASN A . n 
A 1 268 ARG 268 460 460 ARG ARG A . n 
A 1 269 SER 269 461 461 SER SER A . n 
A 1 270 SER 270 462 462 SER SER A . n 
A 1 271 ALA 271 463 463 ALA ALA A . n 
A 1 272 ARG 272 464 464 ARG ARG A . n 
A 1 273 ILE 273 465 465 ILE ILE A . n 
A 1 274 LEU 274 466 466 LEU LEU A . n 
A 1 275 GLN 275 467 467 GLN GLN A . n 
A 1 276 ILE 276 468 468 ILE ILE A . n 
A 1 277 ILE 277 469 469 ILE ILE A . n 
A 1 278 LYS 278 470 470 LYS LYS A . n 
A 1 279 GLY 279 471 471 GLY GLY A . n 
A 1 280 LYS 280 472 472 LYS LYS A . n 
A 1 281 ASP 281 473 473 ASP ASP A . n 
A 1 282 TYR 282 474 474 TYR TYR A . n 
A 1 283 GLU 283 475 475 GLU GLU A . n 
A 1 284 SER 284 476 476 SER SER A . n 
A 1 285 GLU 285 477 477 GLU GLU A . n 
A 1 286 PRO 286 478 478 PRO PRO A . n 
A 1 287 SER 287 479 479 SER SER A . n 
A 1 288 LEU 288 480 480 LEU LEU A . n 
A 1 289 LEU 289 481 481 LEU LEU A . n 
A 1 290 GLU 290 482 482 GLU GLU A . n 
A 1 291 PHE 291 483 483 PHE PHE A . n 
A 1 292 LYS 292 484 484 LYS LYS A . n 
A 1 293 PRO 293 485 485 PRO PRO A . n 
A 1 294 PHE 294 486 486 PHE PHE A . n 
A 1 295 SER 295 487 487 SER SER A . n 
A 1 296 ASN 296 488 488 ASN ASN A . n 
A 1 297 GLY 297 489 489 GLY GLY A . n 
A 1 298 PRO 298 490 490 PRO PRO A . n 
A 1 299 LEU 299 491 491 LEU LEU A . n 
A 1 300 VAL 300 492 492 VAL VAL A . n 
A 1 301 GLY 301 493 493 GLY GLY A . n 
A 1 302 GLY 302 494 494 GLY GLY A . n 
A 1 303 PHE 303 495 495 PHE PHE A . n 
A 1 304 VAL 304 496 496 VAL VAL A . n 
A 1 305 TYR 305 497 497 TYR TYR A . n 
A 1 306 ARG 306 498 498 ARG ARG A . n 
A 1 307 GLY 307 499 499 GLY GLY A . n 
A 1 308 CYS 308 500 500 CYS CYS A . n 
A 1 309 GLN 309 501 501 GLN GLN A . n 
A 1 310 SER 310 502 502 SER SER A . n 
A 1 311 GLU 311 503 503 GLU GLU A . n 
A 1 312 ARG 312 504 504 ARG ARG A . n 
A 1 313 LEU 313 505 505 LEU LEU A . n 
A 1 314 TYR 314 506 506 TYR TYR A . n 
A 1 315 GLY 315 507 507 GLY GLY A . n 
A 1 316 SER 316 508 508 SER SER A . n 
A 1 317 TYR 317 509 509 TYR TYR A . n 
A 1 318 VAL 318 510 510 VAL VAL A . n 
A 1 319 PHE 319 511 511 PHE PHE A . n 
A 1 320 GLY 320 512 512 GLY GLY A . n 
A 1 321 ASP 321 513 513 ASP ASP A . n 
A 1 322 ARG 322 514 514 ARG ARG A . n 
A 1 323 ASN 323 515 515 ASN ASN A . n 
A 1 324 GLY 324 516 516 GLY GLY A . n 
A 1 325 ASN 325 517 517 ASN ASN A . n 
A 1 326 PHE 326 518 518 PHE PHE A . n 
A 1 327 LEU 327 519 519 LEU LEU A . n 
A 1 328 THR 328 520 520 THR THR A . n 
A 1 329 LEU 329 521 521 LEU LEU A . n 
A 1 330 GLN 330 522 522 GLN GLN A . n 
A 1 331 GLN 331 523 523 GLN GLN A . n 
A 1 332 SER 332 524 524 SER SER A . n 
A 1 333 PRO 333 525 525 PRO PRO A . n 
A 1 334 VAL 334 526 526 VAL VAL A . n 
A 1 335 THR 335 527 527 THR THR A . n 
A 1 336 LYS 336 528 528 LYS LYS A . n 
A 1 337 GLN 337 529 529 GLN GLN A . n 
A 1 338 TRP 338 530 530 TRP TRP A . n 
A 1 339 GLN 339 531 531 GLN GLN A . n 
A 1 340 GLU 340 532 532 GLU GLU A . n 
A 1 341 LYS 341 533 533 LYS LYS A . n 
A 1 342 PRO 342 534 534 PRO PRO A . n 
A 1 343 LEU 343 535 535 LEU LEU A . n 
A 1 344 CYS 344 536 536 CYS CYS A . n 
A 1 345 LEU 345 537 537 LEU LEU A . n 
A 1 346 GLY 346 538 538 GLY GLY A . n 
A 1 347 THR 347 539 539 THR THR A . n 
A 1 348 SER 348 540 540 SER SER A . n 
A 1 349 GLY 349 541 541 GLY GLY A . n 
A 1 350 SER 350 542 542 SER SER A . n 
A 1 351 CYS 351 543 543 CYS CYS A . n 
A 1 352 ARG 352 544 544 ARG ARG A . n 
A 1 353 GLY 353 545 545 GLY GLY A . n 
A 1 354 TYR 354 546 546 TYR TYR A . n 
A 1 355 PHE 355 547 547 PHE PHE A . n 
A 1 356 SER 356 548 548 SER SER A . n 
A 1 357 GLY 357 549 549 GLY GLY A . n 
A 1 358 HIS 358 550 550 HIS HIS A . n 
A 1 359 ILE 359 551 551 ILE ILE A . n 
A 1 360 LEU 360 552 552 LEU LEU A . n 
A 1 361 GLY 361 553 553 GLY GLY A . n 
A 1 362 PHE 362 554 554 PHE PHE A . n 
A 1 363 GLY 363 555 555 GLY GLY A . n 
A 1 364 GLU 364 556 556 GLU GLU A . n 
A 1 365 ASP 365 557 557 ASP ASP A . n 
A 1 366 GLU 366 558 558 GLU GLU A . n 
A 1 367 LEU 367 559 559 LEU LEU A . n 
A 1 368 GLY 368 560 560 GLY GLY A . n 
A 1 369 GLU 369 561 561 GLU GLU A . n 
A 1 370 VAL 370 562 562 VAL VAL A . n 
A 1 371 TYR 371 563 563 TYR TYR A . n 
A 1 372 ILE 372 564 564 ILE ILE A . n 
A 1 373 LEU 373 565 565 LEU LEU A . n 
A 1 374 SER 374 566 566 SER SER A . n 
A 1 375 SER 375 567 567 SER SER A . n 
A 1 376 SER 376 568 568 SER SER A . n 
A 1 377 LYS 377 569 569 LYS LYS A . n 
A 1 378 SER 378 570 570 SER SER A . n 
A 1 379 MET 379 571 571 MET MET A . n 
A 1 380 THR 380 572 572 THR THR A . n 
A 1 381 GLN 381 573 573 GLN GLN A . n 
A 1 382 THR 382 574 574 THR THR A . n 
A 1 383 HIS 383 575 575 HIS HIS A . n 
A 1 384 ASN 384 576 576 ASN ASN A . n 
A 1 385 GLY 385 577 577 GLY GLY A . n 
A 1 386 LYS 386 578 578 LYS LYS A . n 
A 1 387 LEU 387 579 579 LEU LEU A . n 
A 1 388 TYR 388 580 580 TYR TYR A . n 
A 1 389 LYS 389 581 581 LYS LYS A . n 
A 1 390 ILE 390 582 582 ILE ILE A . n 
A 1 391 VAL 391 583 583 VAL VAL A . n 
A 1 392 ASP 392 584 584 ASP ASP A . n 
A 1 393 PRO 393 585 585 PRO PRO A . n 
A 1 394 LYS 394 586 586 LYS LYS A . n 
A 1 395 ARG 395 587 587 ARG ARG A . n 
A 1 396 PRO 396 588 588 PRO PRO A . n 
A 1 397 LEU 397 589 589 LEU LEU A . n 
A 1 398 MET 398 590 590 MET MET A . n 
A 1 399 PRO 399 591 591 PRO PRO A . n 
A 1 400 GLU 400 592 592 GLU GLU A . n 
A 1 401 GLU 401 593 593 GLU GLU A . n 
A 1 402 CYS 402 594 594 CYS CYS A . n 
A 1 403 ARG 403 595 595 ARG ARG A . n 
A 1 404 ALA 404 596 596 ALA ALA A . n 
A 1 405 THR 405 597 597 THR THR A . n 
A 1 406 VAL 406 598 598 VAL VAL A . n 
A 1 407 GLN 407 599 599 GLN GLN A . n 
A 1 408 PRO 408 600 600 PRO PRO A . n 
A 1 409 ALA 409 601 601 ALA ALA A . n 
A 1 410 GLN 410 602 602 GLN GLN A . n 
A 1 411 THR 411 603 603 THR THR A . n 
A 1 412 LEU 412 604 604 LEU LEU A . n 
A 1 413 THR 413 605 605 THR THR A . n 
A 1 414 SER 414 606 606 SER SER A . n 
A 1 415 GLU 415 607 607 GLU GLU A . n 
A 1 416 CYS 416 608 608 CYS CYS A . n 
A 1 417 SER 417 609 609 SER SER A . n 
A 1 418 ARG 418 610 610 ARG ARG A . n 
A 1 419 LEU 419 611 611 LEU LEU A . n 
A 1 420 CYS 420 612 612 CYS CYS A . n 
A 1 421 ARG 421 613 613 ARG ARG A . n 
A 1 422 ASN 422 614 614 ASN ASN A . n 
A 1 423 GLY 423 615 615 GLY GLY A . n 
A 1 424 TYR 424 616 616 TYR TYR A . n 
A 1 425 CYS 425 617 617 CYS CYS A . n 
A 1 426 THR 426 618 618 THR THR A . n 
A 1 427 PRO 427 619 619 PRO PRO A . n 
A 1 428 THR 428 620 620 THR THR A . n 
A 1 429 GLY 429 621 621 GLY GLY A . n 
A 1 430 LYS 430 622 622 LYS LYS A . n 
A 1 431 CYS 431 623 623 CYS CYS A . n 
A 1 432 CYS 432 624 624 CYS CYS A . n 
A 1 433 CYS 433 625 625 CYS CYS A . n 
A 1 434 SER 434 626 626 SER SER A . n 
A 1 435 PRO 435 627 627 PRO PRO A . n 
A 1 436 GLY 436 628 628 GLY GLY A . n 
A 1 437 TRP 437 629 629 TRP TRP A . n 
A 1 438 GLU 438 630 630 GLU GLU A . n 
A 1 439 GLY 439 631 631 GLY GLY A . n 
A 1 440 ASP 440 632 632 ASP ASP A . n 
A 1 441 PHE 441 633 633 PHE PHE A . n 
A 1 442 CYS 442 634 634 CYS CYS A . n 
A 1 443 ARG 443 635 635 ARG ARG A . n 
A 1 444 THR 444 636 636 THR THR A . n 
A 1 445 ALA 445 637 637 ALA ALA A . n 
A 1 446 LYS 446 638 638 LYS LYS A . n 
A 1 447 CYS 447 639 639 CYS CYS A . n 
A 1 448 GLU 448 640 640 GLU GLU A . n 
A 1 449 PRO 449 641 641 PRO PRO A . n 
A 1 450 ALA 450 642 642 ALA ALA A . n 
A 1 451 CYS 451 643 643 CYS CYS A . n 
A 1 452 ARG 452 644 644 ARG ARG A . n 
A 1 453 HIS 453 645 645 HIS HIS A . n 
A 1 454 GLY 454 646 646 GLY GLY A . n 
A 1 455 GLY 455 647 647 GLY GLY A . n 
A 1 456 VAL 456 648 648 VAL VAL A . n 
A 1 457 CYS 457 649 649 CYS CYS A . n 
A 1 458 VAL 458 650 650 VAL VAL A . n 
A 1 459 ARG 459 651 651 ARG ARG A . n 
A 1 460 PRO 460 652 652 PRO PRO A . n 
A 1 461 ASN 461 653 653 ASN ASN A . n 
A 1 462 LYS 462 654 654 LYS LYS A . n 
A 1 463 CYS 463 655 655 CYS CYS A . n 
A 1 464 LEU 464 656 656 LEU LEU A . n 
A 1 465 CYS 465 657 657 CYS CYS A . n 
A 1 466 LYS 466 658 658 LYS LYS A . n 
A 1 467 LYS 467 659 659 LYS LYS A . n 
A 1 468 GLY 468 660 660 GLY GLY A . n 
A 1 469 TYR 469 661 661 TYR TYR A . n 
A 1 470 LEU 470 662 662 LEU LEU A . n 
A 1 471 GLY 471 663 663 GLY GLY A . n 
A 1 472 PRO 472 664 664 PRO PRO A . n 
A 1 473 GLN 473 665 665 GLN GLN A . n 
A 1 474 CYS 474 666 666 CYS CYS A . n 
A 1 475 GLU 475 667 667 GLU GLU A . n 
A 1 476 HIS 476 668 668 HIS HIS A . n 
A 1 477 HIS 477 669 669 HIS HIS A . n 
A 1 478 HIS 478 670 670 HIS HIS A . n 
A 1 479 HIS 479 671 ?   ?   ?   A . n 
A 1 480 HIS 480 672 ?   ?   ?   A . n 
A 1 481 HIS 481 673 ?   ?   ?   A . n 
B 1 1   SER 1   193 ?   ?   ?   B . n 
B 1 2   ASN 2   194 ?   ?   ?   B . n 
B 1 3   TYR 3   195 ?   ?   ?   B . n 
B 1 4   LEU 4   196 ?   ?   ?   B . n 
B 1 5   ASP 5   197 ?   ?   ?   B . n 
B 1 6   GLN 6   198 ?   ?   ?   B . n 
B 1 7   MET 7   199 ?   ?   ?   B . n 
B 1 8   GLU 8   200 ?   ?   ?   B . n 
B 1 9   GLU 9   201 ?   ?   ?   B . n 
B 1 10  TYR 10  202 ?   ?   ?   B . n 
B 1 11  ASP 11  203 ?   ?   ?   B . n 
B 1 12  LYS 12  204 ?   ?   ?   B . n 
B 1 13  VAL 13  205 ?   ?   ?   B . n 
B 1 14  GLU 14  206 ?   ?   ?   B . n 
B 1 15  GLU 15  207 ?   ?   ?   B . n 
B 1 16  ILE 16  208 ?   ?   ?   B . n 
B 1 17  SER 17  209 ?   ?   ?   B . n 
B 1 18  ARG 18  210 ?   ?   ?   B . n 
B 1 19  LYS 19  211 ?   ?   ?   B . n 
B 1 20  HIS 20  212 ?   ?   ?   B . n 
B 1 21  LYS 21  213 ?   ?   ?   B . n 
B 1 22  HIS 22  214 214 HIS HIS B . n 
B 1 23  ASN 23  215 215 ASN ASN B . n 
B 1 24  CYS 24  216 216 CYS CYS B . n 
B 1 25  PHE 25  217 217 PHE PHE B . n 
B 1 26  CYS 26  218 218 CYS CYS B . n 
B 1 27  ILE 27  219 219 ILE ILE B . n 
B 1 28  GLN 28  220 220 GLN GLN B . n 
B 1 29  GLU 29  221 221 GLU GLU B . n 
B 1 30  VAL 30  222 222 VAL VAL B . n 
B 1 31  VAL 31  223 223 VAL VAL B . n 
B 1 32  SER 32  224 224 SER SER B . n 
B 1 33  GLY 33  225 225 GLY GLY B . n 
B 1 34  LEU 34  226 226 LEU LEU B . n 
B 1 35  ARG 35  227 227 ARG ARG B . n 
B 1 36  GLN 36  228 228 GLN GLN B . n 
B 1 37  PRO 37  229 229 PRO PRO B . n 
B 1 38  VAL 38  230 230 VAL VAL B . n 
B 1 39  GLY 39  231 231 GLY GLY B . n 
B 1 40  ALA 40  232 232 ALA ALA B . n 
B 1 41  LEU 41  233 233 LEU LEU B . n 
B 1 42  HIS 42  234 234 HIS HIS B . n 
B 1 43  SER 43  235 235 SER SER B . n 
B 1 44  GLY 44  236 236 GLY GLY B . n 
B 1 45  ASP 45  237 237 ASP ASP B . n 
B 1 46  GLY 46  238 238 GLY GLY B . n 
B 1 47  SER 47  239 239 SER SER B . n 
B 1 48  GLN 48  240 240 GLN GLN B . n 
B 1 49  ARG 49  241 241 ARG ARG B . n 
B 1 50  LEU 50  242 242 LEU LEU B . n 
B 1 51  PHE 51  243 243 PHE PHE B . n 
B 1 52  ILE 52  244 244 ILE ILE B . n 
B 1 53  LEU 53  245 245 LEU LEU B . n 
B 1 54  GLU 54  246 246 GLU GLU B . n 
B 1 55  LYS 55  247 247 LYS LYS B . n 
B 1 56  GLU 56  248 248 GLU GLU B . n 
B 1 57  GLY 57  249 249 GLY GLY B . n 
B 1 58  TYR 58  250 250 TYR TYR B . n 
B 1 59  VAL 59  251 251 VAL VAL B . n 
B 1 60  LYS 60  252 252 LYS LYS B . n 
B 1 61  ILE 61  253 253 ILE ILE B . n 
B 1 62  LEU 62  254 254 LEU LEU B . n 
B 1 63  THR 63  255 255 THR THR B . n 
B 1 64  PRO 64  256 256 PRO PRO B . n 
B 1 65  GLU 65  257 257 GLU GLU B . n 
B 1 66  GLY 66  258 258 GLY GLY B . n 
B 1 67  GLU 67  259 259 GLU GLU B . n 
B 1 68  ILE 68  260 260 ILE ILE B . n 
B 1 69  PHE 69  261 261 PHE PHE B . n 
B 1 70  LYS 70  262 262 LYS LYS B . n 
B 1 71  GLU 71  263 263 GLU GLU B . n 
B 1 72  PRO 72  264 264 PRO PRO B . n 
B 1 73  TYR 73  265 265 TYR TYR B . n 
B 1 74  LEU 74  266 266 LEU LEU B . n 
B 1 75  ASP 75  267 267 ASP ASP B . n 
B 1 76  ILE 76  268 268 ILE ILE B . n 
B 1 77  HIS 77  269 269 HIS HIS B . n 
B 1 78  LYS 78  270 270 LYS LYS B . n 
B 1 79  LEU 79  271 271 LEU LEU B . n 
B 1 80  VAL 80  272 272 VAL VAL B . n 
B 1 81  GLN 81  273 273 GLN GLN B . n 
B 1 82  SER 82  274 274 SER SER B . n 
B 1 83  GLY 83  275 275 GLY GLY B . n 
B 1 84  ILE 84  276 276 ILE ILE B . n 
B 1 85  LYS 85  277 277 LYS LYS B . n 
B 1 86  GLY 86  278 278 GLY GLY B . n 
B 1 87  GLY 87  279 279 GLY GLY B . n 
B 1 88  ASP 88  280 280 ASP ASP B . n 
B 1 89  GLU 89  281 281 GLU GLU B . n 
B 1 90  ARG 90  282 282 ARG ARG B . n 
B 1 91  GLY 91  283 283 GLY GLY B . n 
B 1 92  LEU 92  284 284 LEU LEU B . n 
B 1 93  LEU 93  285 285 LEU LEU B . n 
B 1 94  SER 94  286 286 SER SER B . n 
B 1 95  LEU 95  287 287 LEU LEU B . n 
B 1 96  ALA 96  288 288 ALA ALA B . n 
B 1 97  PHE 97  289 289 PHE PHE B . n 
B 1 98  HIS 98  290 290 HIS HIS B . n 
B 1 99  PRO 99  291 291 PRO PRO B . n 
B 1 100 ASN 100 292 292 ASN ASN B . n 
B 1 101 TYR 101 293 293 TYR TYR B . n 
B 1 102 LYS 102 294 294 LYS LYS B . n 
B 1 103 LYS 103 295 295 LYS LYS B . n 
B 1 104 ASN 104 296 296 ASN ASN B . n 
B 1 105 GLY 105 297 297 GLY GLY B . n 
B 1 106 LYS 106 298 298 LYS LYS B . n 
B 1 107 LEU 107 299 299 LEU LEU B . n 
B 1 108 TYR 108 300 300 TYR TYR B . n 
B 1 109 VAL 109 301 301 VAL VAL B . n 
B 1 110 SER 110 302 302 SER SER B . n 
B 1 111 TYR 111 303 303 TYR TYR B . n 
B 1 112 THR 112 304 304 THR THR B . n 
B 1 113 THR 113 305 305 THR THR B . n 
B 1 114 ASN 114 306 306 ASN ASN B . n 
B 1 115 GLN 115 307 307 GLN GLN B . n 
B 1 116 GLU 116 308 308 GLU GLU B . n 
B 1 117 ARG 117 309 309 ARG ARG B . n 
B 1 118 TRP 118 310 310 TRP TRP B . n 
B 1 119 ALA 119 311 311 ALA ALA B . n 
B 1 120 ILE 120 312 312 ILE ILE B . n 
B 1 121 GLY 121 313 313 GLY GLY B . n 
B 1 122 PRO 122 314 314 PRO PRO B . n 
B 1 123 HIS 123 315 315 HIS HIS B . n 
B 1 124 ASP 124 316 316 ASP ASP B . n 
B 1 125 HIS 125 317 317 HIS HIS B . n 
B 1 126 ILE 126 318 318 ILE ILE B . n 
B 1 127 LEU 127 319 319 LEU LEU B . n 
B 1 128 ARG 128 320 320 ARG ARG B . n 
B 1 129 VAL 129 321 321 VAL VAL B . n 
B 1 130 VAL 130 322 322 VAL VAL B . n 
B 1 131 GLU 131 323 323 GLU GLU B . n 
B 1 132 TYR 132 324 324 TYR TYR B . n 
B 1 133 THR 133 325 325 THR THR B . n 
B 1 134 VAL 134 326 326 VAL VAL B . n 
B 1 135 SER 135 327 327 SER SER B . n 
B 1 136 ARG 136 328 328 ARG ARG B . n 
B 1 137 LYS 137 329 329 LYS LYS B . n 
B 1 138 ASN 138 330 330 ASN ASN B . n 
B 1 139 PRO 139 331 331 PRO PRO B . n 
B 1 140 HIS 140 332 332 HIS HIS B . n 
B 1 141 GLN 141 333 333 GLN GLN B . n 
B 1 142 VAL 142 334 334 VAL VAL B . n 
B 1 143 ASP 143 335 335 ASP ASP B . n 
B 1 144 LEU 144 336 336 LEU LEU B . n 
B 1 145 ARG 145 337 337 ARG ARG B . n 
B 1 146 THR 146 338 338 THR THR B . n 
B 1 147 ALA 147 339 339 ALA ALA B . n 
B 1 148 ARG 148 340 340 ARG ARG B . n 
B 1 149 VAL 149 341 341 VAL VAL B . n 
B 1 150 PHE 150 342 342 PHE PHE B . n 
B 1 151 LEU 151 343 343 LEU LEU B . n 
B 1 152 GLU 152 344 344 GLU GLU B . n 
B 1 153 VAL 153 345 345 VAL VAL B . n 
B 1 154 ALA 154 346 346 ALA ALA B . n 
B 1 155 GLU 155 347 347 GLU GLU B . n 
B 1 156 LEU 156 348 348 LEU LEU B . n 
B 1 157 HIS 157 349 349 HIS HIS B . n 
B 1 158 ARG 158 350 350 ARG ARG B . n 
B 1 159 LYS 159 351 351 LYS LYS B . n 
B 1 160 HIS 160 352 352 HIS HIS B . n 
B 1 161 LEU 161 353 353 LEU LEU B . n 
B 1 162 GLY 162 354 354 GLY GLY B . n 
B 1 163 GLY 163 355 355 GLY GLY B . n 
B 1 164 GLN 164 356 356 GLN GLN B . n 
B 1 165 LEU 165 357 357 LEU LEU B . n 
B 1 166 LEU 166 358 358 LEU LEU B . n 
B 1 167 PHE 167 359 359 PHE PHE B . n 
B 1 168 GLY 168 360 360 GLY GLY B . n 
B 1 169 PRO 169 361 361 PRO PRO B . n 
B 1 170 ASP 170 362 362 ASP ASP B . n 
B 1 171 GLY 171 363 363 GLY GLY B . n 
B 1 172 PHE 172 364 364 PHE PHE B . n 
B 1 173 LEU 173 365 365 LEU LEU B . n 
B 1 174 TYR 174 366 366 TYR TYR B . n 
B 1 175 ILE 175 367 367 ILE ILE B . n 
B 1 176 ILE 176 368 368 ILE ILE B . n 
B 1 177 LEU 177 369 369 LEU LEU B . n 
B 1 178 GLY 178 370 370 GLY GLY B . n 
B 1 179 ASP 179 371 371 ASP ASP B . n 
B 1 180 GLY 180 372 372 GLY GLY B . n 
B 1 181 MET 181 373 373 MET MET B . n 
B 1 182 ILE 182 374 374 ILE ILE B . n 
B 1 183 THR 183 375 375 THR THR B . n 
B 1 184 LEU 184 376 376 LEU LEU B . n 
B 1 185 ASP 185 377 377 ASP ASP B . n 
B 1 186 ASP 186 378 378 ASP ASP B . n 
B 1 187 MET 187 379 379 MET MET B . n 
B 1 188 GLU 188 380 380 GLU GLU B . n 
B 1 189 GLU 189 381 381 GLU GLU B . n 
B 1 190 MET 190 382 382 MET MET B . n 
B 1 191 ASP 191 383 383 ASP ASP B . n 
B 1 192 GLY 192 384 384 GLY GLY B . n 
B 1 193 LEU 193 385 385 LEU LEU B . n 
B 1 194 SER 194 386 386 SER SER B . n 
B 1 195 ASP 195 387 387 ASP ASP B . n 
B 1 196 PHE 196 388 388 PHE PHE B . n 
B 1 197 THR 197 389 389 THR THR B . n 
B 1 198 GLY 198 390 390 GLY GLY B . n 
B 1 199 SER 199 391 391 SER SER B . n 
B 1 200 VAL 200 392 392 VAL VAL B . n 
B 1 201 LEU 201 393 393 LEU LEU B . n 
B 1 202 ARG 202 394 394 ARG ARG B . n 
B 1 203 LEU 203 395 395 LEU LEU B . n 
B 1 204 ASP 204 396 396 ASP ASP B . n 
B 1 205 VAL 205 397 397 VAL VAL B . n 
B 1 206 ASP 206 398 398 ASP ASP B . n 
B 1 207 THR 207 399 399 THR THR B . n 
B 1 208 ASP 208 400 400 ASP ASP B . n 
B 1 209 MET 209 401 401 MET MET B . n 
B 1 210 CYS 210 402 402 CYS CYS B . n 
B 1 211 ASN 211 403 403 ASN ASN B . n 
B 1 212 VAL 212 404 404 VAL VAL B . n 
B 1 213 PRO 213 405 405 PRO PRO B . n 
B 1 214 TYR 214 406 406 TYR TYR B . n 
B 1 215 SER 215 407 407 SER SER B . n 
B 1 216 ILE 216 408 408 ILE ILE B . n 
B 1 217 PRO 217 409 409 PRO PRO B . n 
B 1 218 ARG 218 410 410 ARG ARG B . n 
B 1 219 SER 219 411 411 SER SER B . n 
B 1 220 ASN 220 412 412 ASN ASN B . n 
B 1 221 PRO 221 413 413 PRO PRO B . n 
B 1 222 HIS 222 414 414 HIS HIS B . n 
B 1 223 PHE 223 415 415 PHE PHE B . n 
B 1 224 ASN 224 416 416 ASN ASN B . n 
B 1 225 SER 225 417 417 SER SER B . n 
B 1 226 THR 226 418 418 THR THR B . n 
B 1 227 ASN 227 419 419 ASN ASN B . n 
B 1 228 GLN 228 420 420 GLN GLN B . n 
B 1 229 PRO 229 421 421 PRO PRO B . n 
B 1 230 PRO 230 422 422 PRO PRO B . n 
B 1 231 GLU 231 423 423 GLU GLU B . n 
B 1 232 VAL 232 424 424 VAL VAL B . n 
B 1 233 PHE 233 425 425 PHE PHE B . n 
B 1 234 ALA 234 426 426 ALA ALA B . n 
B 1 235 HIS 235 427 427 HIS HIS B . n 
B 1 236 GLY 236 428 428 GLY GLY B . n 
B 1 237 LEU 237 429 429 LEU LEU B . n 
B 1 238 HIS 238 430 430 HIS HIS B . n 
B 1 239 ASP 239 431 431 ASP ASP B . n 
B 1 240 PRO 240 432 432 PRO PRO B . n 
B 1 241 GLY 241 433 433 GLY GLY B . n 
B 1 242 ARG 242 434 434 ARG ARG B . n 
B 1 243 CYS 243 435 435 CYS CYS B . n 
B 1 244 ALA 244 436 436 ALA ALA B . n 
B 1 245 VAL 245 437 437 VAL VAL B . n 
B 1 246 ASP 246 438 438 ASP ASP B . n 
B 1 247 ARG 247 439 439 ARG ARG B . n 
B 1 248 HIS 248 440 440 HIS HIS B . n 
B 1 249 PRO 249 441 ?   ?   ?   B . n 
B 1 250 THR 250 442 ?   ?   ?   B . n 
B 1 251 ASP 251 443 ?   ?   ?   B . n 
B 1 252 ILE 252 444 ?   ?   ?   B . n 
B 1 253 ASN 253 445 ?   ?   ?   B . n 
B 1 254 ILE 254 446 ?   ?   ?   B . n 
B 1 255 ASN 255 447 447 ASN ASN B . n 
B 1 256 LEU 256 448 448 LEU LEU B . n 
B 1 257 THR 257 449 449 THR THR B . n 
B 1 258 ILE 258 450 450 ILE ILE B . n 
B 1 259 LEU 259 451 451 LEU LEU B . n 
B 1 260 CYS 260 452 452 CYS CYS B . n 
B 1 261 SER 261 453 453 SER SER B . n 
B 1 262 ASP 262 454 454 ASP ASP B . n 
B 1 263 SER 263 455 455 SER SER B . n 
B 1 264 ASN 264 456 456 ASN ASN B . n 
B 1 265 GLY 265 457 457 GLY GLY B . n 
B 1 266 LYS 266 458 458 LYS LYS B . n 
B 1 267 ASN 267 459 459 ASN ASN B . n 
B 1 268 ARG 268 460 460 ARG ARG B . n 
B 1 269 SER 269 461 461 SER SER B . n 
B 1 270 SER 270 462 462 SER SER B . n 
B 1 271 ALA 271 463 463 ALA ALA B . n 
B 1 272 ARG 272 464 464 ARG ARG B . n 
B 1 273 ILE 273 465 465 ILE ILE B . n 
B 1 274 LEU 274 466 466 LEU LEU B . n 
B 1 275 GLN 275 467 467 GLN GLN B . n 
B 1 276 ILE 276 468 468 ILE ILE B . n 
B 1 277 ILE 277 469 469 ILE ILE B . n 
B 1 278 LYS 278 470 470 LYS LYS B . n 
B 1 279 GLY 279 471 471 GLY GLY B . n 
B 1 280 LYS 280 472 472 LYS LYS B . n 
B 1 281 ASP 281 473 473 ASP ASP B . n 
B 1 282 TYR 282 474 474 TYR TYR B . n 
B 1 283 GLU 283 475 475 GLU GLU B . n 
B 1 284 SER 284 476 476 SER SER B . n 
B 1 285 GLU 285 477 477 GLU GLU B . n 
B 1 286 PRO 286 478 478 PRO PRO B . n 
B 1 287 SER 287 479 479 SER SER B . n 
B 1 288 LEU 288 480 480 LEU LEU B . n 
B 1 289 LEU 289 481 481 LEU LEU B . n 
B 1 290 GLU 290 482 482 GLU GLU B . n 
B 1 291 PHE 291 483 483 PHE PHE B . n 
B 1 292 LYS 292 484 484 LYS LYS B . n 
B 1 293 PRO 293 485 485 PRO PRO B . n 
B 1 294 PHE 294 486 486 PHE PHE B . n 
B 1 295 SER 295 487 487 SER SER B . n 
B 1 296 ASN 296 488 488 ASN ASN B . n 
B 1 297 GLY 297 489 489 GLY GLY B . n 
B 1 298 PRO 298 490 490 PRO PRO B . n 
B 1 299 LEU 299 491 491 LEU LEU B . n 
B 1 300 VAL 300 492 492 VAL VAL B . n 
B 1 301 GLY 301 493 493 GLY GLY B . n 
B 1 302 GLY 302 494 494 GLY GLY B . n 
B 1 303 PHE 303 495 495 PHE PHE B . n 
B 1 304 VAL 304 496 496 VAL VAL B . n 
B 1 305 TYR 305 497 497 TYR TYR B . n 
B 1 306 ARG 306 498 498 ARG ARG B . n 
B 1 307 GLY 307 499 499 GLY GLY B . n 
B 1 308 CYS 308 500 500 CYS CYS B . n 
B 1 309 GLN 309 501 501 GLN GLN B . n 
B 1 310 SER 310 502 502 SER SER B . n 
B 1 311 GLU 311 503 503 GLU GLU B . n 
B 1 312 ARG 312 504 504 ARG ARG B . n 
B 1 313 LEU 313 505 505 LEU LEU B . n 
B 1 314 TYR 314 506 506 TYR TYR B . n 
B 1 315 GLY 315 507 507 GLY GLY B . n 
B 1 316 SER 316 508 508 SER SER B . n 
B 1 317 TYR 317 509 509 TYR TYR B . n 
B 1 318 VAL 318 510 510 VAL VAL B . n 
B 1 319 PHE 319 511 511 PHE PHE B . n 
B 1 320 GLY 320 512 512 GLY GLY B . n 
B 1 321 ASP 321 513 513 ASP ASP B . n 
B 1 322 ARG 322 514 514 ARG ARG B . n 
B 1 323 ASN 323 515 515 ASN ASN B . n 
B 1 324 GLY 324 516 516 GLY GLY B . n 
B 1 325 ASN 325 517 517 ASN ASN B . n 
B 1 326 PHE 326 518 518 PHE PHE B . n 
B 1 327 LEU 327 519 519 LEU LEU B . n 
B 1 328 THR 328 520 520 THR THR B . n 
B 1 329 LEU 329 521 521 LEU LEU B . n 
B 1 330 GLN 330 522 522 GLN GLN B . n 
B 1 331 GLN 331 523 523 GLN GLN B . n 
B 1 332 SER 332 524 524 SER SER B . n 
B 1 333 PRO 333 525 525 PRO PRO B . n 
B 1 334 VAL 334 526 526 VAL VAL B . n 
B 1 335 THR 335 527 527 THR THR B . n 
B 1 336 LYS 336 528 528 LYS LYS B . n 
B 1 337 GLN 337 529 529 GLN GLN B . n 
B 1 338 TRP 338 530 530 TRP TRP B . n 
B 1 339 GLN 339 531 531 GLN GLN B . n 
B 1 340 GLU 340 532 532 GLU GLU B . n 
B 1 341 LYS 341 533 533 LYS LYS B . n 
B 1 342 PRO 342 534 534 PRO PRO B . n 
B 1 343 LEU 343 535 535 LEU LEU B . n 
B 1 344 CYS 344 536 536 CYS CYS B . n 
B 1 345 LEU 345 537 537 LEU LEU B . n 
B 1 346 GLY 346 538 538 GLY GLY B . n 
B 1 347 THR 347 539 539 THR THR B . n 
B 1 348 SER 348 540 540 SER SER B . n 
B 1 349 GLY 349 541 541 GLY GLY B . n 
B 1 350 SER 350 542 542 SER SER B . n 
B 1 351 CYS 351 543 543 CYS CYS B . n 
B 1 352 ARG 352 544 544 ARG ARG B . n 
B 1 353 GLY 353 545 545 GLY GLY B . n 
B 1 354 TYR 354 546 546 TYR TYR B . n 
B 1 355 PHE 355 547 547 PHE PHE B . n 
B 1 356 SER 356 548 548 SER SER B . n 
B 1 357 GLY 357 549 549 GLY GLY B . n 
B 1 358 HIS 358 550 550 HIS HIS B . n 
B 1 359 ILE 359 551 551 ILE ILE B . n 
B 1 360 LEU 360 552 552 LEU LEU B . n 
B 1 361 GLY 361 553 553 GLY GLY B . n 
B 1 362 PHE 362 554 554 PHE PHE B . n 
B 1 363 GLY 363 555 555 GLY GLY B . n 
B 1 364 GLU 364 556 556 GLU GLU B . n 
B 1 365 ASP 365 557 557 ASP ASP B . n 
B 1 366 GLU 366 558 558 GLU GLU B . n 
B 1 367 LEU 367 559 559 LEU LEU B . n 
B 1 368 GLY 368 560 560 GLY GLY B . n 
B 1 369 GLU 369 561 561 GLU GLU B . n 
B 1 370 VAL 370 562 562 VAL VAL B . n 
B 1 371 TYR 371 563 563 TYR TYR B . n 
B 1 372 ILE 372 564 564 ILE ILE B . n 
B 1 373 LEU 373 565 565 LEU LEU B . n 
B 1 374 SER 374 566 566 SER SER B . n 
B 1 375 SER 375 567 567 SER SER B . n 
B 1 376 SER 376 568 568 SER SER B . n 
B 1 377 LYS 377 569 569 LYS LYS B . n 
B 1 378 SER 378 570 570 SER SER B . n 
B 1 379 MET 379 571 571 MET MET B . n 
B 1 380 THR 380 572 572 THR THR B . n 
B 1 381 GLN 381 573 573 GLN GLN B . n 
B 1 382 THR 382 574 574 THR THR B . n 
B 1 383 HIS 383 575 575 HIS HIS B . n 
B 1 384 ASN 384 576 576 ASN ASN B . n 
B 1 385 GLY 385 577 577 GLY GLY B . n 
B 1 386 LYS 386 578 578 LYS LYS B . n 
B 1 387 LEU 387 579 579 LEU LEU B . n 
B 1 388 TYR 388 580 580 TYR TYR B . n 
B 1 389 LYS 389 581 581 LYS LYS B . n 
B 1 390 ILE 390 582 582 ILE ILE B . n 
B 1 391 VAL 391 583 583 VAL VAL B . n 
B 1 392 ASP 392 584 584 ASP ASP B . n 
B 1 393 PRO 393 585 585 PRO PRO B . n 
B 1 394 LYS 394 586 586 LYS LYS B . n 
B 1 395 ARG 395 587 587 ARG ARG B . n 
B 1 396 PRO 396 588 588 PRO PRO B . n 
B 1 397 LEU 397 589 589 LEU LEU B . n 
B 1 398 MET 398 590 590 MET MET B . n 
B 1 399 PRO 399 591 591 PRO PRO B . n 
B 1 400 GLU 400 592 592 GLU GLU B . n 
B 1 401 GLU 401 593 593 GLU GLU B . n 
B 1 402 CYS 402 594 594 CYS CYS B . n 
B 1 403 ARG 403 595 595 ARG ARG B . n 
B 1 404 ALA 404 596 596 ALA ALA B . n 
B 1 405 THR 405 597 597 THR THR B . n 
B 1 406 VAL 406 598 598 VAL VAL B . n 
B 1 407 GLN 407 599 599 GLN GLN B . n 
B 1 408 PRO 408 600 600 PRO PRO B . n 
B 1 409 ALA 409 601 601 ALA ALA B . n 
B 1 410 GLN 410 602 602 GLN GLN B . n 
B 1 411 THR 411 603 603 THR THR B . n 
B 1 412 LEU 412 604 604 LEU LEU B . n 
B 1 413 THR 413 605 605 THR THR B . n 
B 1 414 SER 414 606 606 SER SER B . n 
B 1 415 GLU 415 607 607 GLU GLU B . n 
B 1 416 CYS 416 608 608 CYS CYS B . n 
B 1 417 SER 417 609 609 SER SER B . n 
B 1 418 ARG 418 610 610 ARG ARG B . n 
B 1 419 LEU 419 611 611 LEU LEU B . n 
B 1 420 CYS 420 612 612 CYS CYS B . n 
B 1 421 ARG 421 613 613 ARG ARG B . n 
B 1 422 ASN 422 614 614 ASN ASN B . n 
B 1 423 GLY 423 615 615 GLY GLY B . n 
B 1 424 TYR 424 616 616 TYR TYR B . n 
B 1 425 CYS 425 617 617 CYS CYS B . n 
B 1 426 THR 426 618 618 THR THR B . n 
B 1 427 PRO 427 619 619 PRO PRO B . n 
B 1 428 THR 428 620 620 THR THR B . n 
B 1 429 GLY 429 621 621 GLY GLY B . n 
B 1 430 LYS 430 622 622 LYS LYS B . n 
B 1 431 CYS 431 623 623 CYS CYS B . n 
B 1 432 CYS 432 624 624 CYS CYS B . n 
B 1 433 CYS 433 625 625 CYS CYS B . n 
B 1 434 SER 434 626 626 SER SER B . n 
B 1 435 PRO 435 627 627 PRO PRO B . n 
B 1 436 GLY 436 628 628 GLY GLY B . n 
B 1 437 TRP 437 629 629 TRP TRP B . n 
B 1 438 GLU 438 630 630 GLU GLU B . n 
B 1 439 GLY 439 631 631 GLY GLY B . n 
B 1 440 ASP 440 632 632 ASP ASP B . n 
B 1 441 PHE 441 633 633 PHE PHE B . n 
B 1 442 CYS 442 634 634 CYS CYS B . n 
B 1 443 ARG 443 635 635 ARG ARG B . n 
B 1 444 THR 444 636 636 THR THR B . n 
B 1 445 ALA 445 637 637 ALA ALA B . n 
B 1 446 LYS 446 638 638 LYS LYS B . n 
B 1 447 CYS 447 639 639 CYS CYS B . n 
B 1 448 GLU 448 640 640 GLU GLU B . n 
B 1 449 PRO 449 641 641 PRO PRO B . n 
B 1 450 ALA 450 642 642 ALA ALA B . n 
B 1 451 CYS 451 643 643 CYS CYS B . n 
B 1 452 ARG 452 644 644 ARG ARG B . n 
B 1 453 HIS 453 645 645 HIS HIS B . n 
B 1 454 GLY 454 646 646 GLY GLY B . n 
B 1 455 GLY 455 647 647 GLY GLY B . n 
B 1 456 VAL 456 648 648 VAL VAL B . n 
B 1 457 CYS 457 649 649 CYS CYS B . n 
B 1 458 VAL 458 650 650 VAL VAL B . n 
B 1 459 ARG 459 651 651 ARG ARG B . n 
B 1 460 PRO 460 652 652 PRO PRO B . n 
B 1 461 ASN 461 653 653 ASN ASN B . n 
B 1 462 LYS 462 654 654 LYS LYS B . n 
B 1 463 CYS 463 655 655 CYS CYS B . n 
B 1 464 LEU 464 656 656 LEU LEU B . n 
B 1 465 CYS 465 657 657 CYS CYS B . n 
B 1 466 LYS 466 658 658 LYS LYS B . n 
B 1 467 LYS 467 659 659 LYS LYS B . n 
B 1 468 GLY 468 660 660 GLY GLY B . n 
B 1 469 TYR 469 661 661 TYR TYR B . n 
B 1 470 LEU 470 662 662 LEU LEU B . n 
B 1 471 GLY 471 663 663 GLY GLY B . n 
B 1 472 PRO 472 664 664 PRO PRO B . n 
B 1 473 GLN 473 665 665 GLN GLN B . n 
B 1 474 CYS 474 666 666 CYS CYS B . n 
B 1 475 GLU 475 667 667 GLU GLU B . n 
B 1 476 HIS 476 668 668 HIS HIS B . n 
B 1 477 HIS 477 669 669 HIS HIS B . n 
B 1 478 HIS 478 670 670 HIS HIS B . n 
B 1 479 HIS 479 671 ?   ?   ?   B . n 
B 1 480 HIS 480 672 ?   ?   ?   B . n 
B 1 481 HIS 481 673 ?   ?   ?   B . n 
C 2 1   GLY 1   29  ?   ?   ?   H . n 
C 2 2   PHE 2   30  ?   ?   ?   H . n 
C 2 3   GLY 3   31  ?   ?   ?   H . n 
C 2 4   LYS 4   32  ?   ?   ?   H . n 
C 2 5   ARG 5   33  ?   ?   ?   H . n 
C 2 6   ARG 6   34  ?   ?   ?   H . n 
C 2 7   HIS 7   35  ?   ?   ?   H . n 
C 2 8   PRO 8   36  ?   ?   ?   H . n 
C 2 9   LYS 9   37  ?   ?   ?   H . n 
C 2 10  LYS 10  38  38  LYS LYS H . n 
C 2 11  LEU 11  39  39  LEU LEU H . n 
C 2 12  THR 12  40  40  THR THR H . n 
C 2 13  PRO 13  41  41  PRO PRO H . n 
C 2 14  LEU 14  42  42  LEU LEU H . n 
C 2 15  ALA 15  43  43  ALA ALA H . n 
C 2 16  TYR 16  44  44  TYR TYR H . n 
C 2 17  LYS 17  45  45  LYS LYS H . n 
C 2 18  GLN 18  46  46  GLN GLN H . n 
C 2 19  PHE 19  47  47  PHE PHE H . n 
C 2 20  ILE 20  48  48  ILE ILE H . n 
C 2 21  PRO 21  49  49  PRO PRO H . n 
C 2 22  ASN 22  50  50  ASN ASN H . n 
C 2 23  VAL 23  51  51  VAL VAL H . n 
C 2 24  ALA 24  52  52  ALA ALA H . n 
C 2 25  GLU 25  53  53  GLU GLU H . n 
C 2 26  LYS 26  54  54  LYS LYS H . n 
C 2 27  THR 27  55  55  THR THR H . n 
C 2 28  LEU 28  56  56  LEU LEU H . n 
C 2 29  GLY 29  57  57  GLY GLY H . n 
C 2 30  ALA 30  58  58  ALA ALA H . n 
C 2 31  SER 31  59  59  SER SER H . n 
C 2 32  GLY 32  60  60  GLY GLY H . n 
C 2 33  ARG 33  61  61  ARG ARG H . n 
C 2 34  TYR 34  62  62  TYR TYR H . n 
C 2 35  GLU 35  63  63  GLU GLU H . n 
C 2 36  GLY 36  64  64  GLY GLY H . n 
C 2 37  LYS 37  65  65  LYS LYS H . n 
C 2 38  ILE 38  66  66  ILE ILE H . n 
C 2 39  SER 39  67  67  SER SER H . n 
C 2 40  ARG 40  68  68  ARG ARG H . n 
C 2 41  ASN 41  69  69  ASN ASN H . n 
C 2 42  SER 42  70  70  SER SER H . n 
C 2 43  GLU 43  71  71  GLU GLU H . n 
C 2 44  ARG 44  72  72  ARG ARG H . n 
C 2 45  PHE 45  73  73  PHE PHE H . n 
C 2 46  LYS 46  74  74  LYS LYS H . n 
C 2 47  GLU 47  75  75  GLU GLU H . n 
C 2 48  LEU 48  76  76  LEU LEU H . n 
C 2 49  THR 49  77  77  THR THR H . n 
C 2 50  PRO 50  78  78  PRO PRO H . n 
C 2 51  ASN 51  79  79  ASN ASN H . n 
C 2 52  TYR 52  80  80  TYR TYR H . n 
C 2 53  ASN 53  81  81  ASN ASN H . n 
C 2 54  PRO 54  82  82  PRO PRO H . n 
C 2 55  ASP 55  83  83  ASP ASP H . n 
C 2 56  ILE 56  84  84  ILE ILE H . n 
C 2 57  ILE 57  85  85  ILE ILE H . n 
C 2 58  PHE 58  86  86  PHE PHE H . n 
C 2 59  LYS 59  87  87  LYS LYS H . n 
C 2 60  ASP 60  88  88  ASP ASP H . n 
C 2 61  GLU 61  89  89  GLU GLU H . n 
C 2 62  GLU 62  90  90  GLU GLU H . n 
C 2 63  ASN 63  91  91  ASN ASN H . n 
C 2 64  THR 64  92  92  THR THR H . n 
C 2 65  GLY 65  93  93  GLY GLY H . n 
C 2 66  ALA 66  94  94  ALA ALA H . n 
C 2 67  ASP 67  95  95  ASP ASP H . n 
C 2 68  ARG 68  96  96  ARG ARG H . n 
C 2 69  LEU 69  97  97  LEU LEU H . n 
C 2 70  MET 70  98  98  MET MET H . n 
C 2 71  THR 71  99  99  THR THR H . n 
C 2 72  GLN 72  100 100 GLN GLN H . n 
C 2 73  ARG 73  101 101 ARG ARG H . n 
C 2 74  CYS 74  102 102 CYS CYS H . n 
C 2 75  LYS 75  103 103 LYS LYS H . n 
C 2 76  ASP 76  104 104 ASP ASP H . n 
C 2 77  LYS 77  105 105 LYS LYS H . n 
C 2 78  LEU 78  106 106 LEU LEU H . n 
C 2 79  ASN 79  107 107 ASN ASN H . n 
C 2 80  ALA 80  108 108 ALA ALA H . n 
C 2 81  LEU 81  109 109 LEU LEU H . n 
C 2 82  ALA 82  110 110 ALA ALA H . n 
C 2 83  ILE 83  111 111 ILE ILE H . n 
C 2 84  SER 84  112 112 SER SER H . n 
C 2 85  VAL 85  113 113 VAL VAL H . n 
C 2 86  MET 86  114 114 MET MET H . n 
C 2 87  ASN 87  115 115 ASN ASN H . n 
C 2 88  GLN 88  116 116 GLN GLN H . n 
C 2 89  TRP 89  117 117 TRP TRP H . n 
C 2 90  PRO 90  118 118 PRO PRO H . n 
C 2 91  GLY 91  119 119 GLY GLY H . n 
C 2 92  VAL 92  120 120 VAL VAL H . n 
C 2 93  LYS 93  121 121 LYS LYS H . n 
C 2 94  LEU 94  122 122 LEU LEU H . n 
C 2 95  ARG 95  123 123 ARG ARG H . n 
C 2 96  VAL 96  124 124 VAL VAL H . n 
C 2 97  THR 97  125 125 THR THR H . n 
C 2 98  GLU 98  126 126 GLU GLU H . n 
C 2 99  GLY 99  127 127 GLY GLY H . n 
C 2 100 TRP 100 128 128 TRP TRP H . n 
C 2 101 ASP 101 129 129 ASP ASP H . n 
C 2 102 GLU 102 130 130 GLU GLU H . n 
C 2 103 ASP 103 131 131 ASP ASP H . n 
C 2 104 GLY 104 132 132 GLY GLY H . n 
C 2 105 HIS 105 133 133 HIS HIS H . n 
C 2 106 HIS 106 134 134 HIS HIS H . n 
C 2 107 SER 107 135 135 SER SER H . n 
C 2 108 GLU 108 136 136 GLU GLU H . n 
C 2 109 GLU 109 137 137 GLU GLU H . n 
C 2 110 SER 110 138 138 SER SER H . n 
C 2 111 LEU 111 139 139 LEU LEU H . n 
C 2 112 HIS 112 140 140 HIS HIS H . n 
C 2 113 TYR 113 141 141 TYR TYR H . n 
C 2 114 GLU 114 142 142 GLU GLU H . n 
C 2 115 GLY 115 143 143 GLY GLY H . n 
C 2 116 ARG 116 144 144 ARG ARG H . n 
C 2 117 ALA 117 145 145 ALA ALA H . n 
C 2 118 VAL 118 146 146 VAL VAL H . n 
C 2 119 ASP 119 147 147 ASP ASP H . n 
C 2 120 ILE 120 148 148 ILE ILE H . n 
C 2 121 THR 121 149 149 THR THR H . n 
C 2 122 THR 122 150 150 THR THR H . n 
C 2 123 SER 123 151 151 SER SER H . n 
C 2 124 ASP 124 152 152 ASP ASP H . n 
C 2 125 ARG 125 153 153 ARG ARG H . n 
C 2 126 ASP 126 154 154 ASP ASP H . n 
C 2 127 ARG 127 155 155 ARG ARG H . n 
C 2 128 SER 128 156 156 SER SER H . n 
C 2 129 LYS 129 157 157 LYS LYS H . n 
C 2 130 TYR 130 158 158 TYR TYR H . n 
C 2 131 GLY 131 159 159 GLY GLY H . n 
C 2 132 MET 132 160 160 MET MET H . n 
C 2 133 LEU 133 161 161 LEU LEU H . n 
C 2 134 ALA 134 162 162 ALA ALA H . n 
C 2 135 ARG 135 163 163 ARG ARG H . n 
C 2 136 LEU 136 164 164 LEU LEU H . n 
C 2 137 ALA 137 165 165 ALA ALA H . n 
C 2 138 VAL 138 166 166 VAL VAL H . n 
C 2 139 GLU 139 167 167 GLU GLU H . n 
C 2 140 ALA 140 168 168 ALA ALA H . n 
C 2 141 GLY 141 169 169 GLY GLY H . n 
C 2 142 PHE 142 170 170 PHE PHE H . n 
C 2 143 ASP 143 171 171 ASP ASP H . n 
C 2 144 TRP 144 172 172 TRP TRP H . n 
C 2 145 VAL 145 173 173 VAL VAL H . n 
C 2 146 TYR 146 174 174 TYR TYR H . n 
C 2 147 TYR 147 175 175 TYR TYR H . n 
C 2 148 GLU 148 176 176 GLU GLU H . n 
C 2 149 SER 149 177 177 SER SER H . n 
C 2 150 LYS 150 178 178 LYS LYS H . n 
C 2 151 ALA 151 179 179 ALA ALA H . n 
C 2 152 HIS 152 180 180 HIS HIS H . n 
C 2 153 ILE 153 181 181 ILE ILE H . n 
C 2 154 HIS 154 182 182 HIS HIS H . n 
C 2 155 CYS 155 183 183 CYS CYS H . n 
C 2 156 SER 156 184 184 SER SER H . n 
C 2 157 VAL 157 185 185 VAL VAL H . n 
C 2 158 LYS 158 186 186 LYS LYS H . n 
C 2 159 ALA 159 187 187 ALA ALA H . n 
C 2 160 GLU 160 188 188 GLU GLU H . n 
C 2 161 ASN 161 189 189 ASN ASN H . n 
C 2 162 SER 162 190 190 SER SER H . n 
C 2 163 VAL 163 191 191 VAL VAL H . n 
C 2 164 ALA 164 192 ?   ?   ?   H . n 
C 2 165 ALA 165 193 ?   ?   ?   H . n 
C 2 166 LYS 166 194 ?   ?   ?   H . n 
C 2 167 SER 167 195 ?   ?   ?   H . n 
C 2 168 GLY 168 196 ?   ?   ?   H . n 
C 2 169 GLY 169 197 ?   ?   ?   H . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D       
2 1 B,C,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 2010  ? 
2 MORE         -58   ? 
2 'SSA (A^2)'  28520 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? B ASP 191 ? B ASP 383 ? 1_555 ZN ? E ZN . ? H ZN 400 ? 1_555 NE2 ? C HIS 112 ? H HIS 140 ? 1_555 103.2 ? 
2  OD2 ? B ASP 191 ? B ASP 383 ? 1_555 ZN ? E ZN . ? H ZN 400 ? 1_555 OD1 ? C ASP 119 ? H ASP 147 ? 1_555 138.4 ? 
3  NE2 ? C HIS 112 ? H HIS 140 ? 1_555 ZN ? E ZN . ? H ZN 400 ? 1_555 OD1 ? C ASP 119 ? H ASP 147 ? 1_555 99.2  ? 
4  OD2 ? B ASP 191 ? B ASP 383 ? 1_555 ZN ? E ZN . ? H ZN 400 ? 1_555 ND1 ? C HIS 154 ? H HIS 182 ? 1_555 98.0  ? 
5  NE2 ? C HIS 112 ? H HIS 140 ? 1_555 ZN ? E ZN . ? H ZN 400 ? 1_555 ND1 ? C HIS 154 ? H HIS 182 ? 1_555 105.5 ? 
6  OD1 ? C ASP 119 ? H ASP 147 ? 1_555 ZN ? E ZN . ? H ZN 400 ? 1_555 ND1 ? C HIS 154 ? H HIS 182 ? 1_555 109.2 ? 
7  OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 61  ? H GLU 89  ? 1_555 55.8  ? 
8  OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 72.7  ? 
9  OE2 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 83.1  ? 
10 OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 119.3 ? 
11 OE2 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 86.4  ? 
12 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 55.5  ? 
13 OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 140.3 ? 
14 OE2 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 159.5 ? 
15 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 90.7  ? 
16 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 74.1  ? 
17 OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 85.1  ? 
18 OE2 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 140.4 ? 
19 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 79.3  ? 
20 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 111.2 ? 
21 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 56.0  ? 
22 OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 O   ? C THR 97  ? H THR 125 ? 1_555 88.4  ? 
23 OE2 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 O   ? C THR 97  ? H THR 125 ? 1_555 104.9 ? 
24 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 O   ? C THR 97  ? H THR 125 ? 1_555 150.7 ? 
25 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 O   ? C THR 97  ? H THR 125 ? 1_555 151.1 ? 
26 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 O   ? C THR 97  ? H THR 125 ? 1_555 90.0  ? 
27 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 O   ? C THR 97  ? H THR 125 ? 1_555 76.8  ? 
28 OE1 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 145.0 ? 
29 OE2 ? C GLU 61  ? H GLU 89  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 91.4  ? 
30 OE1 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 119.3 ? 
31 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 63.8  ? 
32 OD1 ? C ASP 67  ? H ASP 95  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 74.6  ? 
33 OD2 ? C ASP 67  ? H ASP 95  ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 128.1 ? 
34 O   ? C THR 97  ? H THR 125 ? 1_555 CA ? F CA . ? H CA 401 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 89.1  ? 
35 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OE1 ? C GLU 98  ? H GLU 126 ? 1_555 120.1 ? 
36 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 64.1  ? 
37 OE1 ? C GLU 98  ? H GLU 126 ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 56.4  ? 
38 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD1 ? C ASP 101 ? H ASP 129 ? 1_555 158.5 ? 
39 OE1 ? C GLU 98  ? H GLU 126 ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD1 ? C ASP 101 ? H ASP 129 ? 1_555 72.9  ? 
40 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD1 ? C ASP 101 ? H ASP 129 ? 1_555 123.6 ? 
41 OE2 ? C GLU 62  ? H GLU 90  ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD2 ? C ASP 103 ? H ASP 131 ? 1_555 104.2 ? 
42 OE1 ? C GLU 98  ? H GLU 126 ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD2 ? C ASP 103 ? H ASP 131 ? 1_555 128.1 ? 
43 OE2 ? C GLU 98  ? H GLU 126 ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD2 ? C ASP 103 ? H ASP 131 ? 1_555 156.9 ? 
44 OD1 ? C ASP 101 ? H ASP 129 ? 1_555 CA ? G CA . ? H CA 402 ? 1_555 OD2 ? C ASP 103 ? H ASP 131 ? 1_555 74.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-23 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 13.5418  28.7701 48.7252  -0.5773 0.0072  -0.5072 -0.2034 -0.0647 -0.1130 4.2304  2.2035  5.6920  
-0.8665 -1.0870  0.0995  0.0035  0.0482  -0.0516 1.4707  0.1007  -0.0093 -0.4375 -0.0521 0.0539  
'X-RAY DIFFRACTION' 2 ? refined 41.0485  17.6891 39.6322  -0.0738 0.9407  -0.0092 0.0831  0.0702  -0.4029 19.0273 0.6190  11.6971 
3.4319  -14.9186 -2.6908 -0.5742 -0.8648 1.4389  0.9847  -0.5733 -0.3755 -0.5663 0.7574  0.4312  
'X-RAY DIFFRACTION' 3 ? refined 63.2572  24.0824 30.9176  -0.3984 -0.5158 -0.2734 0.0479  0.1202  -0.0557 19.5851 10.8279 25.7191 
-3.5468 11.0969  2.6616  0.5733  -0.5694 -0.0039 -0.0285 1.8190  -0.1920 0.1869  -2.4019 -0.8979 
'X-RAY DIFFRACTION' 4 ? refined 7.0523   25.9662 98.6709  -0.3603 -0.4969 -0.3930 0.0667  0.0250  0.1228  3.1991  1.9124  6.3512  
-0.5354 -0.4551  0.8778  -0.2454 0.1954  0.0500  -0.6976 -0.3102 0.0436  0.5887  0.7498  0.2605  
'X-RAY DIFFRACTION' 5 ? refined -15.5961 44.2787 108.6657 -0.4438 0.1957  -0.3473 0.2062  0.1719  -0.1343 1.8966  7.9702  8.3801  
-0.2110 -0.1629  6.3729  -0.3586 -0.1590 0.5176  -0.7337 -0.1109 0.4796  0.4230  -0.5194 -0.9657 
'X-RAY DIFFRACTION' 6 ? refined -19.9242 64.3175 122.8157 -0.7689 -0.4586 -0.6479 -0.1707 0.0987  -0.0418 24.2735 31.4133 14.1006 
-5.1463 1.1620   0.6334  -0.9788 1.3659  -0.3871 -0.5984 1.0498  -1.0860 1.2449  -0.0503 2.3235  
'X-RAY DIFFRACTION' 7 ? refined 17.4700  34.0870 136.9189 0.7295  1.2638  -0.1123 0.2086  -0.2030 0.0130  7.4315  6.0294  5.6755  
1.3144  0.4240   -0.5407 -0.0538 0.0638  -0.0100 -1.1717 0.1966  -0.3688 0.8086  -0.1383 0.3085  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 214 A 603 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 604 A 637 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 638 A 669 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 B 214 B 603 ? . . . . ? 
'X-RAY DIFFRACTION' 5 5 B 604 B 637 ? . . . . ? 
'X-RAY DIFFRACTION' 6 6 B 638 B 669 ? . . . . ? 
'X-RAY DIFFRACTION' 7 7 H 38  H 191 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice  'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3HO5 
_pdbx_entry_details.compound_details     
;THE SECOND MOLECULE OF SONIC HEDGEHOG PROTEIN WAS CRYSTALLIZED BUT APPEARED TO BE LARGELY DISORDERED AND WAS NOT INCLUDED IN THE FINAL MODEL. THE SEQUENCE IS:
GFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV 
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    527 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   GLN 
_pdbx_validate_close_contact.auth_seq_id_2    529 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CA A ARG 460 ? ? CB A ARG 460 ? ? 1.325 1.535 -0.210 0.022 N 
2 1 CB B CYS 218 ? ? SG B CYS 218 ? ? 1.710 1.812 -0.102 0.016 N 
3 1 CA B ARG 410 ? ? CB B ARG 410 ? ? 1.393 1.535 -0.142 0.022 N 
4 1 CA B LYS 458 ? ? CB B LYS 458 ? ? 1.388 1.535 -0.147 0.022 N 
5 1 CA B ARG 460 ? ? CB B ARG 460 ? ? 1.304 1.535 -0.231 0.022 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A LYS 458 ? ? CA A LYS 458 ? ? C  A LYS 458 ? ? 95.98  110.40 -14.42 2.00 N 
2 1 N  A ARG 460 ? ? CA A ARG 460 ? ? CB A ARG 460 ? ? 122.80 110.60 12.20  1.80 N 
3 1 CA B LEU 299 ? ? CB B LEU 299 ? ? CG B LEU 299 ? ? 133.50 115.30 18.20  2.30 N 
4 1 N  B ARG 460 ? ? CA B ARG 460 ? ? CB B ARG 460 ? ? 91.33  110.60 -19.27 1.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 228 ? ? 21.52   82.50   
2  1 GLN A 240 ? ? -82.23  45.01   
3  1 ILE A 276 ? ? -11.68  -102.20 
4  1 LYS A 277 ? ? 8.33    -74.13  
5  1 ALA A 311 ? ? -145.07 32.88   
6  1 ASP A 362 ? ? 70.25   -8.80   
7  1 HIS A 430 ? ? -107.82 -90.73  
8  1 ASP A 431 ? ? -117.05 77.41   
9  1 LYS A 458 ? ? -112.43 53.27   
10 1 ARG A 460 ? ? 56.18   -162.63 
11 1 ILE A 469 ? ? 63.49   -161.12 
12 1 SER A 487 ? ? -138.94 -32.59  
13 1 ASN A 488 ? ? -85.99  32.99   
14 1 CYS A 500 ? ? -131.23 -37.22  
15 1 THR A 527 ? ? -106.63 50.22   
16 1 LYS A 528 ? ? -12.29  22.76   
17 1 SER A 542 ? ? -62.94  2.44    
18 1 CYS A 612 ? ? -58.26  103.95  
19 1 ARG A 613 ? ? -43.80  -94.85  
20 1 SER B 224 ? ? -129.03 -156.81 
21 1 GLN B 228 ? ? 38.52   72.95   
22 1 GLN B 240 ? ? -71.90  49.69   
23 1 ILE B 276 ? ? -133.52 -55.35  
24 1 ASN B 292 ? ? -106.72 42.81   
25 1 LYS B 295 ? ? -103.62 -62.20  
26 1 GLN B 307 ? ? 63.08   -52.49  
27 1 GLU B 308 ? ? 27.33   51.85   
28 1 ASP B 377 ? ? -57.87  -71.15  
29 1 HIS B 430 ? ? -116.46 -80.05  
30 1 LYS B 458 ? ? -69.49  66.41   
31 1 ARG B 460 ? ? -61.21  -97.86  
32 1 SER B 461 ? ? -167.07 108.18  
33 1 ILE B 469 ? ? 59.95   -171.20 
34 1 LEU B 480 ? ? -110.37 65.34   
35 1 PRO B 485 ? ? -97.53  30.26   
36 1 ASN B 576 ? ? -142.75 45.39   
37 1 PRO B 627 ? ? -30.18  115.02  
38 1 HIS B 669 ? ? -127.34 -71.90  
39 1 ALA H 58  ? ? -103.94 -103.89 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    275 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ILE 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    276 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.82 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A ARG 410 ? CB  ? A ARG 218 CB  
2  1 Y 0 A ARG 410 ? CG  ? A ARG 218 CG  
3  1 Y 0 A ARG 410 ? CD  ? A ARG 218 CD  
4  1 Y 0 A ARG 410 ? NE  ? A ARG 218 NE  
5  1 Y 0 A ARG 410 ? CZ  ? A ARG 218 CZ  
6  1 Y 0 A ARG 410 ? NH1 ? A ARG 218 NH1 
7  1 Y 0 A ARG 410 ? NH2 ? A ARG 218 NH2 
8  1 Y 0 A LYS 458 ? CB  ? A LYS 266 CB  
9  1 Y 0 A LYS 458 ? CG  ? A LYS 266 CG  
10 1 Y 0 A LYS 458 ? CD  ? A LYS 266 CD  
11 1 Y 0 A LYS 458 ? CE  ? A LYS 266 CE  
12 1 Y 0 A LYS 458 ? NZ  ? A LYS 266 NZ  
13 1 Y 0 A ARG 460 ? CB  ? A ARG 268 CB  
14 1 Y 0 A ARG 460 ? CG  ? A ARG 268 CG  
15 1 Y 0 A ARG 460 ? CD  ? A ARG 268 CD  
16 1 Y 0 A ARG 460 ? NE  ? A ARG 268 NE  
17 1 Y 0 A ARG 460 ? CZ  ? A ARG 268 CZ  
18 1 Y 0 A ARG 460 ? NH1 ? A ARG 268 NH1 
19 1 Y 0 A ARG 460 ? NH2 ? A ARG 268 NH2 
20 1 Y 0 B ARG 410 ? CB  ? B ARG 218 CB  
21 1 Y 0 B ARG 410 ? CG  ? B ARG 218 CG  
22 1 Y 0 B ARG 410 ? CD  ? B ARG 218 CD  
23 1 Y 0 B ARG 410 ? NE  ? B ARG 218 NE  
24 1 Y 0 B ARG 410 ? CZ  ? B ARG 218 CZ  
25 1 Y 0 B ARG 410 ? NH1 ? B ARG 218 NH1 
26 1 Y 0 B ARG 410 ? NH2 ? B ARG 218 NH2 
27 1 Y 0 B LYS 458 ? CB  ? B LYS 266 CB  
28 1 Y 0 B LYS 458 ? CG  ? B LYS 266 CG  
29 1 Y 0 B LYS 458 ? CD  ? B LYS 266 CD  
30 1 Y 0 B LYS 458 ? CE  ? B LYS 266 CE  
31 1 Y 0 B LYS 458 ? NZ  ? B LYS 266 NZ  
32 1 Y 0 B ARG 460 ? CB  ? B ARG 268 CB  
33 1 Y 0 B ARG 460 ? CG  ? B ARG 268 CG  
34 1 Y 0 B ARG 460 ? CD  ? B ARG 268 CD  
35 1 Y 0 B ARG 460 ? NE  ? B ARG 268 NE  
36 1 Y 0 B ARG 460 ? CZ  ? B ARG 268 CZ  
37 1 Y 0 B ARG 460 ? NH1 ? B ARG 268 NH1 
38 1 Y 0 B ARG 460 ? NH2 ? B ARG 268 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 193 ? A SER 1   
2  1 Y 1 A ASN 194 ? A ASN 2   
3  1 Y 1 A TYR 195 ? A TYR 3   
4  1 Y 1 A LEU 196 ? A LEU 4   
5  1 Y 1 A ASP 197 ? A ASP 5   
6  1 Y 1 A GLN 198 ? A GLN 6   
7  1 Y 1 A MET 199 ? A MET 7   
8  1 Y 1 A GLU 200 ? A GLU 8   
9  1 Y 1 A GLU 201 ? A GLU 9   
10 1 Y 1 A TYR 202 ? A TYR 10  
11 1 Y 1 A ASP 203 ? A ASP 11  
12 1 Y 1 A LYS 204 ? A LYS 12  
13 1 Y 1 A VAL 205 ? A VAL 13  
14 1 Y 1 A GLU 206 ? A GLU 14  
15 1 Y 1 A GLU 207 ? A GLU 15  
16 1 Y 1 A ILE 208 ? A ILE 16  
17 1 Y 1 A SER 209 ? A SER 17  
18 1 Y 1 A ARG 210 ? A ARG 18  
19 1 Y 1 A LYS 211 ? A LYS 19  
20 1 Y 1 A HIS 212 ? A HIS 20  
21 1 Y 1 A LYS 213 ? A LYS 21  
22 1 Y 1 A GLN 307 ? A GLN 115 
23 1 Y 1 A GLU 308 ? A GLU 116 
24 1 Y 1 A ASN 419 ? A ASN 227 
25 1 Y 1 A GLN 420 ? A GLN 228 
26 1 Y 1 A PRO 421 ? A PRO 229 
27 1 Y 1 A PRO 441 ? A PRO 249 
28 1 Y 1 A THR 442 ? A THR 250 
29 1 Y 1 A ASP 443 ? A ASP 251 
30 1 Y 1 A ILE 444 ? A ILE 252 
31 1 Y 1 A ASN 445 ? A ASN 253 
32 1 Y 1 A ILE 446 ? A ILE 254 
33 1 Y 1 A HIS 671 ? A HIS 479 
34 1 Y 1 A HIS 672 ? A HIS 480 
35 1 Y 1 A HIS 673 ? A HIS 481 
36 1 Y 1 B SER 193 ? B SER 1   
37 1 Y 1 B ASN 194 ? B ASN 2   
38 1 Y 1 B TYR 195 ? B TYR 3   
39 1 Y 1 B LEU 196 ? B LEU 4   
40 1 Y 1 B ASP 197 ? B ASP 5   
41 1 Y 1 B GLN 198 ? B GLN 6   
42 1 Y 1 B MET 199 ? B MET 7   
43 1 Y 1 B GLU 200 ? B GLU 8   
44 1 Y 1 B GLU 201 ? B GLU 9   
45 1 Y 1 B TYR 202 ? B TYR 10  
46 1 Y 1 B ASP 203 ? B ASP 11  
47 1 Y 1 B LYS 204 ? B LYS 12  
48 1 Y 1 B VAL 205 ? B VAL 13  
49 1 Y 1 B GLU 206 ? B GLU 14  
50 1 Y 1 B GLU 207 ? B GLU 15  
51 1 Y 1 B ILE 208 ? B ILE 16  
52 1 Y 1 B SER 209 ? B SER 17  
53 1 Y 1 B ARG 210 ? B ARG 18  
54 1 Y 1 B LYS 211 ? B LYS 19  
55 1 Y 1 B HIS 212 ? B HIS 20  
56 1 Y 1 B LYS 213 ? B LYS 21  
57 1 Y 1 B PRO 441 ? B PRO 249 
58 1 Y 1 B THR 442 ? B THR 250 
59 1 Y 1 B ASP 443 ? B ASP 251 
60 1 Y 1 B ILE 444 ? B ILE 252 
61 1 Y 1 B ASN 445 ? B ASN 253 
62 1 Y 1 B ILE 446 ? B ILE 254 
63 1 Y 1 B HIS 671 ? B HIS 479 
64 1 Y 1 B HIS 672 ? B HIS 480 
65 1 Y 1 B HIS 673 ? B HIS 481 
66 1 Y 1 H GLY 29  ? C GLY 1   
67 1 Y 1 H PHE 30  ? C PHE 2   
68 1 Y 1 H GLY 31  ? C GLY 3   
69 1 Y 1 H LYS 32  ? C LYS 4   
70 1 Y 1 H ARG 33  ? C ARG 5   
71 1 Y 1 H ARG 34  ? C ARG 6   
72 1 Y 1 H HIS 35  ? C HIS 7   
73 1 Y 1 H PRO 36  ? C PRO 8   
74 1 Y 1 H LYS 37  ? C LYS 9   
75 1 Y 1 H ALA 192 ? C ALA 164 
76 1 Y 1 H ALA 193 ? C ALA 165 
77 1 Y 1 H LYS 194 ? C LYS 166 
78 1 Y 1 H SER 195 ? C SER 167 
79 1 Y 1 H GLY 196 ? C GLY 168 
80 1 Y 1 H GLY 197 ? C GLY 169 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION'    ZN 
4 'CALCIUM ION' CA 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 ZN 1 902 902 ZN ZN A . 
E 3 ZN 1 400 400 ZN ZN H . 
F 4 CA 1 401 401 CA CA H . 
G 4 CA 1 402 402 CA CA H . 
#