data_3HOT
# 
_entry.id   3HOT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3HOT         pdb_00003hot 10.2210/pdb3hot/pdb 
NDB   NA0009       ?            ?                   
RCSB  RCSB053397   ?            ?                   
WWPDB D_1000053397 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3HOS 
_pdbx_database_related.details        'Mos1 PEC structure with Mg' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3HOT 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-03 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Richardson, J.M.' 1 ? 
'Walkinshaw, M.D.' 2 ? 
# 
_citation.id                        primary 
_citation.title                     
'Molecular architecture of the Mos1 paired-end complex: the structural basis of DNA transposition in a eukaryote' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            138 
_citation.page_first                1096 
_citation.page_last                 1108 
_citation.year                      2009 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19766564 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2009.07.012 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Richardson, J.M.' 1 ? 
primary 'Colloms, S.D.'    2 ? 
primary 'Finnegan, D.J.'   3 ? 
primary 'Walkinshaw, M.D.' 4 ? 
# 
_cell.entry_id           3HOT 
_cell.length_a           120.294 
_cell.length_b           84.989 
_cell.length_c           132.116 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.21 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HOT 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transposable element mariner, complete cds' 40865.316 2 2.7.7.- T216A ? ? 
2 polymer     syn 'Mos1 NTS inverted repeat DNA'               7879.900  3 ?       ?     ? ? 
3 polymer     syn 'Mos1 TS inverted repeat DNA'                8532.542  3 ?       ?     ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                         54.938    1 ?       ?     ? ? 
5 non-polymer syn 'SULFATE ION'                                96.063    2 ?       ?     ? ? 
6 water       nat water                                        18.015    3 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Mos1 transposase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQAL
LDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWI
FFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKR
QHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDE
FYWRGIHKLPERWEKCVASDGKYFE
;
;MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKTCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQAL
LDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWI
FFVNPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKR
QHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDE
FYWRGIHKLPERWEKCVASDGKYFE
;
A,B   ? 
2 polydeoxyribonucleotide no yes 
;(DG)(DG)(DT)(DG)(DT)(DA)(DC)(DA)(DA)(DG)(DT)(DA)(5IU)(DG)(DA)(DA)(DA)(DT)(DG)
(DT)(DC)(DG)(DT)(DT)(DT)
;
GGTGTACAAGTAUGAAATGTCGTTT C,E,G ? 
3 polydeoxyribonucleotide no no  
;(DA)(DA)(DA)(DC)(DG)(DA)(DC)(DA)(DT)(DT)(DT)(DC)(DA)(DT)(DA)(DC)(DT)(DT)(DG)(DT)
(DA)(DC)(DA)(DC)(DC)(DT)(DG)(DA)
;
AAACGACATTTCATACTTGTACACCTGA D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   PHE n 
1 5   VAL n 
1 6   PRO n 
1 7   ASN n 
1 8   LYS n 
1 9   GLU n 
1 10  GLN n 
1 11  THR n 
1 12  ARG n 
1 13  THR n 
1 14  VAL n 
1 15  LEU n 
1 16  ILE n 
1 17  PHE n 
1 18  CYS n 
1 19  PHE n 
1 20  HIS n 
1 21  LEU n 
1 22  LYS n 
1 23  LYS n 
1 24  THR n 
1 25  ALA n 
1 26  ALA n 
1 27  GLU n 
1 28  SER n 
1 29  HIS n 
1 30  ARG n 
1 31  MET n 
1 32  LEU n 
1 33  VAL n 
1 34  GLU n 
1 35  ALA n 
1 36  PHE n 
1 37  GLY n 
1 38  GLU n 
1 39  GLN n 
1 40  VAL n 
1 41  PRO n 
1 42  THR n 
1 43  VAL n 
1 44  LYS n 
1 45  THR n 
1 46  CYS n 
1 47  GLU n 
1 48  ARG n 
1 49  TRP n 
1 50  PHE n 
1 51  GLN n 
1 52  ARG n 
1 53  PHE n 
1 54  LYS n 
1 55  SER n 
1 56  GLY n 
1 57  ASP n 
1 58  PHE n 
1 59  ASP n 
1 60  VAL n 
1 61  ASP n 
1 62  ASP n 
1 63  LYS n 
1 64  GLU n 
1 65  HIS n 
1 66  GLY n 
1 67  LYS n 
1 68  PRO n 
1 69  PRO n 
1 70  LYS n 
1 71  ARG n 
1 72  TYR n 
1 73  GLU n 
1 74  ASP n 
1 75  ALA n 
1 76  GLU n 
1 77  LEU n 
1 78  GLN n 
1 79  ALA n 
1 80  LEU n 
1 81  LEU n 
1 82  ASP n 
1 83  GLU n 
1 84  ASP n 
1 85  ASP n 
1 86  ALA n 
1 87  GLN n 
1 88  THR n 
1 89  GLN n 
1 90  LYS n 
1 91  GLN n 
1 92  LEU n 
1 93  ALA n 
1 94  GLU n 
1 95  GLN n 
1 96  LEU n 
1 97  GLU n 
1 98  VAL n 
1 99  SER n 
1 100 GLN n 
1 101 GLN n 
1 102 ALA n 
1 103 VAL n 
1 104 SER n 
1 105 ASN n 
1 106 ARG n 
1 107 LEU n 
1 108 ARG n 
1 109 GLU n 
1 110 MET n 
1 111 GLY n 
1 112 LYS n 
1 113 ILE n 
1 114 GLN n 
1 115 LYS n 
1 116 VAL n 
1 117 GLY n 
1 118 ARG n 
1 119 TRP n 
1 120 VAL n 
1 121 PRO n 
1 122 HIS n 
1 123 GLU n 
1 124 LEU n 
1 125 ASN n 
1 126 GLU n 
1 127 ARG n 
1 128 GLN n 
1 129 MET n 
1 130 GLU n 
1 131 ARG n 
1 132 ARG n 
1 133 LYS n 
1 134 ASN n 
1 135 THR n 
1 136 CYS n 
1 137 GLU n 
1 138 ILE n 
1 139 LEU n 
1 140 LEU n 
1 141 SER n 
1 142 ARG n 
1 143 TYR n 
1 144 LYS n 
1 145 ARG n 
1 146 LYS n 
1 147 SER n 
1 148 PHE n 
1 149 LEU n 
1 150 HIS n 
1 151 ARG n 
1 152 ILE n 
1 153 VAL n 
1 154 THR n 
1 155 GLY n 
1 156 ASP n 
1 157 GLU n 
1 158 LYS n 
1 159 TRP n 
1 160 ILE n 
1 161 PHE n 
1 162 PHE n 
1 163 VAL n 
1 164 ASN n 
1 165 PRO n 
1 166 LYS n 
1 167 ARG n 
1 168 LYS n 
1 169 LYS n 
1 170 SER n 
1 171 TYR n 
1 172 VAL n 
1 173 ASP n 
1 174 PRO n 
1 175 GLY n 
1 176 GLN n 
1 177 PRO n 
1 178 ALA n 
1 179 THR n 
1 180 SER n 
1 181 THR n 
1 182 ALA n 
1 183 ARG n 
1 184 PRO n 
1 185 ASN n 
1 186 ARG n 
1 187 PHE n 
1 188 GLY n 
1 189 LYS n 
1 190 LYS n 
1 191 THR n 
1 192 MET n 
1 193 LEU n 
1 194 CYS n 
1 195 VAL n 
1 196 TRP n 
1 197 TRP n 
1 198 ASP n 
1 199 GLN n 
1 200 SER n 
1 201 GLY n 
1 202 VAL n 
1 203 ILE n 
1 204 TYR n 
1 205 TYR n 
1 206 GLU n 
1 207 LEU n 
1 208 LEU n 
1 209 LYS n 
1 210 PRO n 
1 211 GLY n 
1 212 GLU n 
1 213 THR n 
1 214 VAL n 
1 215 ASN n 
1 216 ALA n 
1 217 ALA n 
1 218 ARG n 
1 219 TYR n 
1 220 GLN n 
1 221 GLN n 
1 222 GLN n 
1 223 LEU n 
1 224 ILE n 
1 225 ASN n 
1 226 LEU n 
1 227 ASN n 
1 228 ARG n 
1 229 ALA n 
1 230 LEU n 
1 231 GLN n 
1 232 ARG n 
1 233 LYS n 
1 234 ARG n 
1 235 PRO n 
1 236 GLU n 
1 237 TYR n 
1 238 GLN n 
1 239 LYS n 
1 240 ARG n 
1 241 GLN n 
1 242 HIS n 
1 243 ARG n 
1 244 VAL n 
1 245 ILE n 
1 246 PHE n 
1 247 LEU n 
1 248 HIS n 
1 249 ASP n 
1 250 ASN n 
1 251 ALA n 
1 252 PRO n 
1 253 SER n 
1 254 HIS n 
1 255 THR n 
1 256 ALA n 
1 257 ARG n 
1 258 ALA n 
1 259 VAL n 
1 260 ARG n 
1 261 ASP n 
1 262 THR n 
1 263 LEU n 
1 264 GLU n 
1 265 THR n 
1 266 LEU n 
1 267 ASN n 
1 268 TRP n 
1 269 GLU n 
1 270 VAL n 
1 271 LEU n 
1 272 PRO n 
1 273 HIS n 
1 274 ALA n 
1 275 ALA n 
1 276 TYR n 
1 277 SER n 
1 278 PRO n 
1 279 ASP n 
1 280 LEU n 
1 281 ALA n 
1 282 PRO n 
1 283 SER n 
1 284 ASP n 
1 285 TYR n 
1 286 HIS n 
1 287 LEU n 
1 288 PHE n 
1 289 ALA n 
1 290 SER n 
1 291 MET n 
1 292 GLY n 
1 293 HIS n 
1 294 ALA n 
1 295 LEU n 
1 296 ALA n 
1 297 GLU n 
1 298 GLN n 
1 299 ARG n 
1 300 PHE n 
1 301 ASP n 
1 302 SER n 
1 303 TYR n 
1 304 GLU n 
1 305 SER n 
1 306 VAL n 
1 307 LYS n 
1 308 LYS n 
1 309 TRP n 
1 310 LEU n 
1 311 ASP n 
1 312 GLU n 
1 313 TRP n 
1 314 PHE n 
1 315 ALA n 
1 316 ALA n 
1 317 LYS n 
1 318 ASP n 
1 319 ASP n 
1 320 GLU n 
1 321 PHE n 
1 322 TYR n 
1 323 TRP n 
1 324 ARG n 
1 325 GLY n 
1 326 ILE n 
1 327 HIS n 
1 328 LYS n 
1 329 LEU n 
1 330 PRO n 
1 331 GLU n 
1 332 ARG n 
1 333 TRP n 
1 334 GLU n 
1 335 LYS n 
1 336 CYS n 
1 337 VAL n 
1 338 ALA n 
1 339 SER n 
1 340 ASP n 
1 341 GLY n 
1 342 LYS n 
1 343 TYR n 
1 344 PHE n 
1 345 GLU n 
2 1   DG  n 
2 2   DG  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DA  n 
2 10  DG  n 
2 11  DT  n 
2 12  DA  n 
2 13  5IU n 
2 14  DG  n 
2 15  DA  n 
2 16  DA  n 
2 17  DA  n 
2 18  DT  n 
2 19  DG  n 
2 20  DT  n 
2 21  DC  n 
2 22  DG  n 
2 23  DT  n 
2 24  DT  n 
2 25  DT  n 
3 1   DA  n 
3 2   DA  n 
3 3   DA  n 
3 4   DC  n 
3 5   DG  n 
3 6   DA  n 
3 7   DC  n 
3 8   DA  n 
3 9   DT  n 
3 10  DT  n 
3 11  DT  n 
3 12  DC  n 
3 13  DA  n 
3 14  DT  n 
3 15  DA  n 
3 16  DC  n 
3 17  DT  n 
3 18  DT  n 
3 19  DG  n 
3 20  DT  n 
3 21  DA  n 
3 22  DC  n 
3 23  DA  n 
3 24  DC  n 
3 25  DC  n 
3 26  DT  n 
3 27  DG  n 
3 28  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Fruit fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila mauritiana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7226 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q7JQ07_DROMA Q7JQ07 1 
;MSSFVPNKEQTRTVLIFCFHLKKTAAESHRMLVEAFGEQVPTVKKCERWFQRFKSGDFDVDDKEHGKPPKRYEDAELQAL
LDEDDAQTQKQLAEQLEVSQQAVSNRLREMGKIQKVGRWVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWI
FFVSPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKR
QHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDE
FYWRGIHKLPERWEKCVASDGKYLE
;
1 ? 
2 PDB 3HOT         3HOT   2 ? ? ? 
3 PDB 3HOT         3HOT   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HOT A 1 ? 345 ? Q7JQ07 1  ? 345 ? 1  345 
2 1 3HOT B 1 ? 345 ? Q7JQ07 1  ? 345 ? 1  345 
3 2 3HOT C 1 ? 25  ? 3HOT   4  ? 28  ? 4  28  
4 2 3HOT E 1 ? 25  ? 3HOT   4  ? 28  ? 4  28  
5 2 3HOT G 1 ? 25  ? 3HOT   4  ? 28  ? 4  28  
6 3 3HOT D 1 ? 28  ? 3HOT   29 ? 56  ? 29 56  
7 3 3HOT F 1 ? 28  ? 3HOT   29 ? 56  ? 29 56  
8 3 3HOT H 1 ? 28  ? 3HOT   29 ? 56  ? 29 56  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3HOT THR A 45  ? UNP Q7JQ07 LYS 45  'SEE REMARK 999'      45  1  
1 3HOT ASN A 164 ? UNP Q7JQ07 SER 164 'SEE REMARK 999'      164 2  
1 3HOT PRO A 210 ? UNP Q7JQ07 ARG 210 'SEE REMARK 999'      210 3  
1 3HOT ALA A 216 ? UNP Q7JQ07 THR 216 'engineered mutation' 216 4  
1 3HOT PHE A 344 ? UNP Q7JQ07 LEU 344 'SEE REMARK 999'      344 5  
2 3HOT THR B 45  ? UNP Q7JQ07 LYS 45  'SEE REMARK 999'      45  6  
2 3HOT ASN B 164 ? UNP Q7JQ07 SER 164 'SEE REMARK 999'      164 7  
2 3HOT PRO B 210 ? UNP Q7JQ07 ARG 210 'SEE REMARK 999'      210 8  
2 3HOT ALA B 216 ? UNP Q7JQ07 THR 216 'engineered mutation' 216 9  
2 3HOT PHE B 344 ? UNP Q7JQ07 LEU 344 'SEE REMARK 999'      344 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5IU 'DNA linking'       n "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 I N2 O8 P' 434.078 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'    149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                      ? 'Mn 2'             54.938  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                             ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3HOT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.0901 
_exptl_crystal.density_percent_sol   75.8355 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION, HANGING DROP' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2007-03-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM14' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM14 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.934 
# 
_reflns.entry_id                     3HOT 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            3.25 
_reflns.number_obs                   38972 
_reflns.number_all                   38972 
_reflns.percent_possible_obs         93.2 
_reflns.pdbx_Rmerge_I_obs            0.173 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.d_res_high             3.25 
_reflns_shell.d_res_low              3.43 
_reflns_shell.percent_possible_all   97.6 
_reflns_shell.Rmerge_I_obs           0.445 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3HOT 
_refine.ls_number_reflns_obs                     36970 
_refine.ls_number_reflns_all                     38940 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.87 
_refine.ls_d_res_high                            3.25 
_refine.ls_percent_reflns_obs                    93.17 
_refine.ls_R_factor_obs                          0.25062 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24781 
_refine.ls_R_factor_R_free                       0.30413 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1970 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               0.870 
_refine.correlation_coeff_Fo_to_Fc_free          0.814 
_refine.B_iso_mean                               50.926 
_refine.aniso_B[1][1]                            0.14 
_refine.aniso_B[2][2]                            3.95 
_refine.aniso_B[3][3]                            -5.32 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -3.87 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2F7T' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       2.175 
_refine.pdbx_overall_ESU_R_Free                  0.506 
_refine.overall_SU_ML                            0.470 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             66.747 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5643 
_refine_hist.pdbx_number_atoms_nucleic_acid   3258 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               8915 
_refine_hist.d_res_high                       3.25 
_refine_hist.d_res_low                        38.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.021  ? 9447  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.704  2.382  ? 13455 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.807  5.000  ? 672   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.392 23.365 ? 312   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       23.923 15.000 ? 1037  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.300 15.000 ? 54    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.102  0.200  ? 1426  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 6158  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.522  1.500  ? 3384  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.003  2.000  ? 5457  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.142  3.000  ? 6063  'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.995  4.500  ? 7998  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.250 
_refine_ls_shell.d_res_low                        3.334 
_refine_ls_shell.number_reflns_R_work             2790 
_refine_ls_shell.R_factor_R_work                  0.338 
_refine_ls_shell.percent_reflns_obs               97.35 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             145 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_obs                     ? 
# 
_struct.entry_id                  3HOT 
_struct.title                     'Crystal structure of the Mos1 mariner paired end complex with Mn' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HOT 
_struct_keywords.text            
'protein-DNA complex, synaptic complex, transposase, inverted repeat DNA, DNA BINDING PROTEIN-DNA COMPLEX, TRANSFERASE' 
_struct_keywords.pdbx_keywords   'TRANSFERASE, DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 7   ? LEU A 21  ? ASN A 7   LEU A 21  1 ? 15 
HELX_P HELX_P2  2  THR A 24  ? PHE A 36  ? THR A 24  PHE A 36  1 ? 13 
HELX_P HELX_P3  3  THR A 42  ? LYS A 54  ? THR A 42  LYS A 54  1 ? 13 
HELX_P HELX_P4  4  GLU A 73  ? ASP A 84  ? GLU A 73  ASP A 84  1 ? 12 
HELX_P HELX_P5  5  THR A 88  ? LEU A 96  ? THR A 88  LEU A 96  1 ? 9  
HELX_P HELX_P6  6  SER A 99  ? MET A 110 ? SER A 99  MET A 110 1 ? 12 
HELX_P HELX_P7  7  ASN A 125 ? LYS A 146 ? ASN A 125 LYS A 146 1 ? 22 
HELX_P HELX_P8  8  PHE A 148 ? HIS A 150 ? PHE A 148 HIS A 150 5 ? 3  
HELX_P HELX_P9  9  ASN A 215 ? ARG A 234 ? ASN A 215 ARG A 234 1 ? 20 
HELX_P HELX_P10 10 ALA A 256 ? LEU A 266 ? ALA A 256 LEU A 266 1 ? 11 
HELX_P HELX_P11 11 SER A 277 ? LEU A 280 ? SER A 277 LEU A 280 5 ? 4  
HELX_P HELX_P12 12 ALA A 281 ? HIS A 286 ? ALA A 281 HIS A 286 1 ? 6  
HELX_P HELX_P13 13 HIS A 286 ? ALA A 296 ? HIS A 286 ALA A 296 1 ? 11 
HELX_P HELX_P14 14 SER A 302 ? LYS A 317 ? SER A 302 LYS A 317 1 ? 16 
HELX_P HELX_P15 15 ASP A 319 ? SER A 339 ? ASP A 319 SER A 339 1 ? 21 
HELX_P HELX_P16 16 GLU B 9   ? LEU B 21  ? GLU B 9   LEU B 21  1 ? 13 
HELX_P HELX_P17 17 THR B 24  ? GLY B 37  ? THR B 24  GLY B 37  1 ? 14 
HELX_P HELX_P18 18 THR B 42  ? LYS B 54  ? THR B 42  LYS B 54  1 ? 13 
HELX_P HELX_P19 19 GLU B 73  ? ASP B 84  ? GLU B 73  ASP B 84  1 ? 12 
HELX_P HELX_P20 20 THR B 88  ? GLU B 97  ? THR B 88  GLU B 97  1 ? 10 
HELX_P HELX_P21 21 SER B 99  ? MET B 110 ? SER B 99  MET B 110 1 ? 12 
HELX_P HELX_P22 22 ASN B 125 ? LYS B 146 ? ASN B 125 LYS B 146 1 ? 22 
HELX_P HELX_P23 23 PHE B 148 ? HIS B 150 ? PHE B 148 HIS B 150 5 ? 3  
HELX_P HELX_P24 24 ASN B 215 ? ARG B 234 ? ASN B 215 ARG B 234 1 ? 20 
HELX_P HELX_P25 25 PRO B 235 ? LYS B 239 ? PRO B 235 LYS B 239 5 ? 5  
HELX_P HELX_P26 26 ALA B 256 ? THR B 265 ? ALA B 256 THR B 265 1 ? 10 
HELX_P HELX_P27 27 SER B 277 ? LEU B 280 ? SER B 277 LEU B 280 5 ? 4  
HELX_P HELX_P28 28 ALA B 281 ? LEU B 295 ? ALA B 281 LEU B 295 1 ? 15 
HELX_P HELX_P29 29 SER B 302 ? LYS B 317 ? SER B 302 LYS B 317 1 ? 16 
HELX_P HELX_P30 30 ASP B 318 ? LYS B 328 ? ASP B 318 LYS B 328 1 ? 11 
HELX_P HELX_P31 31 LYS B 328 ? ALA B 338 ? LYS B 328 ALA B 338 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1   disulf ?    ? A CYS 136 SG    ? ? ? 1_555 A CYS 336 SG    ? ? A CYS 136  A CYS 336  1_555 ? ? ? ? ? ? ?                
2.123 ? ? 
disulf2   disulf ?    ? B CYS 136 SG    ? ? ? 1_555 B CYS 336 SG    ? ? B CYS 136  B CYS 336  1_555 ? ? ? ? ? ? ?                
2.103 ? ? 
covale1   covale both ? C DA  12  "O3'" ? ? ? 1_555 C 5IU 13  P     ? ? C DA  15   C 5IU 16   1_555 ? ? ? ? ? ? ?                
1.591 ? ? 
covale2   covale both ? C 5IU 13  "O3'" ? ? ? 1_555 C DG  14  P     ? ? C 5IU 16   C DG  17   1_555 ? ? ? ? ? ? ?                
1.604 ? ? 
covale3   covale both ? E DA  12  "O3'" ? ? ? 1_555 E 5IU 13  P     ? ? E DA  15   E 5IU 16   1_555 ? ? ? ? ? ? ?                
1.594 ? ? 
covale4   covale both ? E 5IU 13  "O3'" ? ? ? 1_555 E DG  14  P     ? ? E 5IU 16   E DG  17   1_555 ? ? ? ? ? ? ?                
1.602 ? ? 
covale5   covale both ? G DA  12  "O3'" ? ? ? 1_555 G 5IU 13  P     ? ? G DA  15   G 5IU 16   1_555 ? ? ? ? ? ? ?                
1.598 ? ? 
covale6   covale both ? G 5IU 13  "O3'" ? ? ? 1_555 G DG  14  P     ? ? G 5IU 16   G DG  17   1_555 ? ? ? ? ? ? ?                
1.607 ? ? 
metalc1   metalc ?    ? A ASP 156 OD2   ? ? ? 1_555 I MN  .   MN    ? ? A ASP 156  A MN  1001 1_555 ? ? ? ? ? ? ?                
2.447 ? ? 
metalc2   metalc ?    ? A ASP 249 OD2   ? ? ? 1_555 I MN  .   MN    ? ? A ASP 249  A MN  1001 1_555 ? ? ? ? ? ? ?                
2.051 ? ? 
metalc3   metalc ?    ? I MN  .   MN    ? ? ? 2_646 G DT  25  "O3'" ? ? A MN  1001 G DT  28   1_555 ? ? ? ? ? ? ?                
2.165 ? ? 
hydrog1   hydrog ?    ? C DG  1   N2    ? ? ? 1_555 D DC  25  N3    ? ? C DG  4    D DC  53   1_555 ? ? ? ? ? ? 'DG-DC PAIR'     ? 
? ? 
hydrog2   hydrog ?    ? C DG  2   N1    ? ? ? 1_555 D DC  24  N3    ? ? C DG  5    D DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog3   hydrog ?    ? C DG  2   N2    ? ? ? 1_555 D DC  24  O2    ? ? C DG  5    D DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog4   hydrog ?    ? C DG  2   O6    ? ? ? 1_555 D DC  24  N4    ? ? C DG  5    D DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog5   hydrog ?    ? C DT  3   N3    ? ? ? 1_555 D DA  23  N1    ? ? C DT  6    D DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog6   hydrog ?    ? C DT  3   O4    ? ? ? 1_555 D DA  23  N6    ? ? C DT  6    D DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog7   hydrog ?    ? C DG  4   N1    ? ? ? 1_555 D DC  22  N3    ? ? C DG  7    D DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog8   hydrog ?    ? C DG  4   N2    ? ? ? 1_555 D DC  22  O2    ? ? C DG  7    D DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog9   hydrog ?    ? C DG  4   O6    ? ? ? 1_555 D DC  22  N4    ? ? C DG  7    D DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog10  hydrog ?    ? C DT  5   N3    ? ? ? 1_555 D DA  21  N1    ? ? C DT  8    D DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog11  hydrog ?    ? C DT  5   O4    ? ? ? 1_555 D DA  21  N6    ? ? C DT  8    D DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog12  hydrog ?    ? C DA  6   N1    ? ? ? 1_555 D DT  20  N3    ? ? C DA  9    D DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog13  hydrog ?    ? C DA  6   N6    ? ? ? 1_555 D DT  20  O4    ? ? C DA  9    D DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog14  hydrog ?    ? C DC  7   N3    ? ? ? 1_555 D DG  19  N1    ? ? C DC  10   D DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog15  hydrog ?    ? C DC  7   N4    ? ? ? 1_555 D DG  19  O6    ? ? C DC  10   D DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog16  hydrog ?    ? C DC  7   O2    ? ? ? 1_555 D DG  19  N2    ? ? C DC  10   D DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog17  hydrog ?    ? C DA  8   N1    ? ? ? 1_555 D DT  18  N3    ? ? C DA  11   D DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog18  hydrog ?    ? C DA  8   N6    ? ? ? 1_555 D DT  18  O4    ? ? C DA  11   D DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog19  hydrog ?    ? C DA  9   N1    ? ? ? 1_555 D DT  17  N3    ? ? C DA  12   D DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog20  hydrog ?    ? C DA  9   N6    ? ? ? 1_555 D DT  17  O4    ? ? C DA  12   D DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog21  hydrog ?    ? C DG  10  N1    ? ? ? 1_555 D DC  16  N3    ? ? C DG  13   D DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog22  hydrog ?    ? C DG  10  N2    ? ? ? 1_555 D DC  16  O2    ? ? C DG  13   D DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog23  hydrog ?    ? C DG  10  O6    ? ? ? 1_555 D DC  16  N4    ? ? C DG  13   D DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog24  hydrog ?    ? C DT  11  N3    ? ? ? 1_555 D DA  15  N1    ? ? C DT  14   D DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog25  hydrog ?    ? C DT  11  O4    ? ? ? 1_555 D DA  15  N6    ? ? C DT  14   D DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog26  hydrog ?    ? C DA  12  N1    ? ? ? 1_555 D DT  14  N3    ? ? C DA  15   D DT  42   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog27  hydrog ?    ? C DA  12  N6    ? ? ? 1_555 D DT  14  O4    ? ? C DA  15   D DT  42   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog28  hydrog ?    ? C 5IU 13  N3    ? ? ? 1_555 D DA  13  N1    ? ? C 5IU 16   D DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog29  hydrog ?    ? C 5IU 13  O4    ? ? ? 1_555 D DA  13  N6    ? ? C 5IU 16   D DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog30  hydrog ?    ? C DG  14  N1    ? ? ? 1_555 D DC  12  N3    ? ? C DG  17   D DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog31  hydrog ?    ? C DG  14  N2    ? ? ? 1_555 D DC  12  O2    ? ? C DG  17   D DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog32  hydrog ?    ? C DG  14  O6    ? ? ? 1_555 D DC  12  N4    ? ? C DG  17   D DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog33  hydrog ?    ? C DA  15  N1    ? ? ? 1_555 D DT  11  N3    ? ? C DA  18   D DT  39   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog34  hydrog ?    ? C DA  15  N6    ? ? ? 1_555 D DT  11  O4    ? ? C DA  18   D DT  39   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog35  hydrog ?    ? C DA  16  N1    ? ? ? 1_555 D DT  10  N3    ? ? C DA  19   D DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog36  hydrog ?    ? C DA  16  N6    ? ? ? 1_555 D DT  10  O4    ? ? C DA  19   D DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog37  hydrog ?    ? C DA  17  N1    ? ? ? 1_555 D DT  9   N3    ? ? C DA  20   D DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog38  hydrog ?    ? C DA  17  N6    ? ? ? 1_555 D DT  9   O4    ? ? C DA  20   D DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog39  hydrog ?    ? C DT  18  N3    ? ? ? 1_555 D DA  8   N1    ? ? C DT  21   D DA  36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'     ? 
? ? 
hydrog40  hydrog ?    ? C DG  19  N1    ? ? ? 1_555 D DC  7   N3    ? ? C DG  22   D DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog41  hydrog ?    ? C DG  19  N2    ? ? ? 1_555 D DC  7   O2    ? ? C DG  22   D DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog42  hydrog ?    ? C DG  19  O6    ? ? ? 1_555 D DC  7   N4    ? ? C DG  22   D DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog43  hydrog ?    ? C DT  20  N3    ? ? ? 1_555 D DA  6   N1    ? ? C DT  23   D DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog44  hydrog ?    ? C DT  20  O4    ? ? ? 1_555 D DA  6   N6    ? ? C DT  23   D DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog45  hydrog ?    ? C DC  21  N3    ? ? ? 1_555 D DG  5   N1    ? ? C DC  24   D DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog46  hydrog ?    ? C DC  21  N4    ? ? ? 1_555 D DG  5   O6    ? ? C DC  24   D DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog47  hydrog ?    ? C DC  21  O2    ? ? ? 1_555 D DG  5   N2    ? ? C DC  24   D DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog48  hydrog ?    ? C DG  22  N1    ? ? ? 1_555 D DC  4   N3    ? ? C DG  25   D DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog49  hydrog ?    ? C DG  22  N2    ? ? ? 1_555 D DC  4   O2    ? ? C DG  25   D DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog50  hydrog ?    ? C DG  22  O6    ? ? ? 1_555 D DC  4   N4    ? ? C DG  25   D DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog51  hydrog ?    ? C DT  23  N3    ? ? ? 1_555 D DA  3   N1    ? ? C DT  26   D DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog52  hydrog ?    ? C DT  23  O4    ? ? ? 1_555 D DA  3   N6    ? ? C DT  26   D DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog53  hydrog ?    ? C DT  24  N3    ? ? ? 1_555 D DA  2   N1    ? ? C DT  27   D DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog54  hydrog ?    ? C DT  24  O4    ? ? ? 1_555 D DA  2   N6    ? ? C DT  27   D DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog55  hydrog ?    ? C DT  25  N3    ? ? ? 1_555 D DA  1   N1    ? ? C DT  28   D DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog56  hydrog ?    ? C DT  25  O4    ? ? ? 1_555 D DA  1   N6    ? ? C DT  28   D DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog57  hydrog ?    ? E DG  1   N1    ? ? ? 1_555 F DC  25  N3    ? ? E DG  4    F DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog58  hydrog ?    ? E DG  1   N2    ? ? ? 1_555 F DC  25  O2    ? ? E DG  4    F DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog59  hydrog ?    ? E DG  1   O6    ? ? ? 1_555 F DC  25  N4    ? ? E DG  4    F DC  53   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog60  hydrog ?    ? E DG  2   N1    ? ? ? 1_555 F DC  24  N3    ? ? E DG  5    F DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog61  hydrog ?    ? E DG  2   N2    ? ? ? 1_555 F DC  24  O2    ? ? E DG  5    F DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog62  hydrog ?    ? E DG  2   O6    ? ? ? 1_555 F DC  24  N4    ? ? E DG  5    F DC  52   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog63  hydrog ?    ? E DT  3   N3    ? ? ? 1_555 F DA  23  N1    ? ? E DT  6    F DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog64  hydrog ?    ? E DT  3   O4    ? ? ? 1_555 F DA  23  N6    ? ? E DT  6    F DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog65  hydrog ?    ? E DG  4   N1    ? ? ? 1_555 F DC  22  N3    ? ? E DG  7    F DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog66  hydrog ?    ? E DG  4   N2    ? ? ? 1_555 F DC  22  O2    ? ? E DG  7    F DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog67  hydrog ?    ? E DG  4   O6    ? ? ? 1_555 F DC  22  N4    ? ? E DG  7    F DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog68  hydrog ?    ? E DT  5   N3    ? ? ? 1_555 F DA  21  N1    ? ? E DT  8    F DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog69  hydrog ?    ? E DT  5   O4    ? ? ? 1_555 F DA  21  N6    ? ? E DT  8    F DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog70  hydrog ?    ? E DA  6   N1    ? ? ? 1_555 F DT  20  N3    ? ? E DA  9    F DT  48   1_555 ? ? ? ? ? ? 'DA-DT PAIR'     ? 
? ? 
hydrog71  hydrog ?    ? E DC  7   N3    ? ? ? 1_555 F DG  19  N1    ? ? E DC  10   F DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog72  hydrog ?    ? E DC  7   N4    ? ? ? 1_555 F DG  19  O6    ? ? E DC  10   F DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog73  hydrog ?    ? E DC  7   O2    ? ? ? 1_555 F DG  19  N2    ? ? E DC  10   F DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog74  hydrog ?    ? E DA  8   N1    ? ? ? 1_555 F DT  18  N3    ? ? E DA  11   F DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog75  hydrog ?    ? E DA  8   N6    ? ? ? 1_555 F DT  18  O4    ? ? E DA  11   F DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog76  hydrog ?    ? E DA  9   N1    ? ? ? 1_555 F DT  17  N3    ? ? E DA  12   F DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog77  hydrog ?    ? E DA  9   N6    ? ? ? 1_555 F DT  17  O4    ? ? E DA  12   F DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog78  hydrog ?    ? E DG  10  N1    ? ? ? 1_555 F DC  16  N3    ? ? E DG  13   F DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog79  hydrog ?    ? E DG  10  N2    ? ? ? 1_555 F DC  16  O2    ? ? E DG  13   F DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog80  hydrog ?    ? E DG  10  O6    ? ? ? 1_555 F DC  16  N4    ? ? E DG  13   F DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog81  hydrog ?    ? E DT  11  N3    ? ? ? 1_555 F DA  15  N1    ? ? E DT  14   F DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog82  hydrog ?    ? E DT  11  O4    ? ? ? 1_555 F DA  15  N6    ? ? E DT  14   F DA  43   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog83  hydrog ?    ? E DA  12  N1    ? ? ? 1_555 F DT  14  N3    ? ? E DA  15   F DT  42   1_555 ? ? ? ? ? ? 'DA-DT PAIR'     ? 
? ? 
hydrog84  hydrog ?    ? E DG  14  N1    ? ? ? 1_555 F DC  12  N3    ? ? E DG  17   F DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog85  hydrog ?    ? E DG  14  N2    ? ? ? 1_555 F DC  12  O2    ? ? E DG  17   F DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog86  hydrog ?    ? E DG  14  O6    ? ? ? 1_555 F DC  12  N4    ? ? E DG  17   F DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog87  hydrog ?    ? E DA  15  N1    ? ? ? 1_555 F DT  11  N3    ? ? E DA  18   F DT  39   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog88  hydrog ?    ? E DA  15  N6    ? ? ? 1_555 F DT  11  O4    ? ? E DA  18   F DT  39   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog89  hydrog ?    ? E DA  16  N1    ? ? ? 1_555 F DT  10  N3    ? ? E DA  19   F DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog90  hydrog ?    ? E DA  16  N6    ? ? ? 1_555 F DT  10  O4    ? ? E DA  19   F DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog91  hydrog ?    ? E DA  17  N1    ? ? ? 1_555 F DT  9   N3    ? ? E DA  20   F DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog92  hydrog ?    ? E DA  17  N6    ? ? ? 1_555 F DT  9   O4    ? ? E DA  20   F DT  37   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog93  hydrog ?    ? E DT  18  N3    ? ? ? 1_555 F DA  8   N1    ? ? E DT  21   F DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog94  hydrog ?    ? E DT  18  O4    ? ? ? 1_555 F DA  8   N6    ? ? E DT  21   F DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog95  hydrog ?    ? E DG  19  N1    ? ? ? 1_555 F DC  7   N3    ? ? E DG  22   F DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog96  hydrog ?    ? E DG  19  N2    ? ? ? 1_555 F DC  7   O2    ? ? E DG  22   F DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog97  hydrog ?    ? E DG  19  O6    ? ? ? 1_555 F DC  7   N4    ? ? E DG  22   F DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog98  hydrog ?    ? E DT  20  N3    ? ? ? 1_555 F DA  6   N1    ? ? E DT  23   F DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog99  hydrog ?    ? E DT  20  O4    ? ? ? 1_555 F DA  6   N6    ? ? E DT  23   F DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog100 hydrog ?    ? E DC  21  N3    ? ? ? 1_555 F DG  5   N1    ? ? E DC  24   F DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog101 hydrog ?    ? E DC  21  N4    ? ? ? 1_555 F DG  5   O6    ? ? E DC  24   F DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog102 hydrog ?    ? E DC  21  O2    ? ? ? 1_555 F DG  5   N2    ? ? E DC  24   F DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog103 hydrog ?    ? E DG  22  N1    ? ? ? 1_555 F DC  4   N3    ? ? E DG  25   F DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog104 hydrog ?    ? E DG  22  N2    ? ? ? 1_555 F DC  4   O2    ? ? E DG  25   F DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog105 hydrog ?    ? E DG  22  O6    ? ? ? 1_555 F DC  4   N4    ? ? E DG  25   F DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog106 hydrog ?    ? E DT  23  N3    ? ? ? 1_555 F DA  3   N1    ? ? E DT  26   F DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog107 hydrog ?    ? E DT  23  O4    ? ? ? 1_555 F DA  3   N6    ? ? E DT  26   F DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog108 hydrog ?    ? E DT  24  N3    ? ? ? 1_555 F DA  2   N1    ? ? E DT  27   F DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog109 hydrog ?    ? E DT  24  O4    ? ? ? 1_555 F DA  2   N6    ? ? E DT  27   F DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog110 hydrog ?    ? E DT  25  N3    ? ? ? 1_555 F DA  1   N1    ? ? E DT  28   F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog111 hydrog ?    ? E DT  25  O4    ? ? ? 1_555 F DA  1   N6    ? ? E DT  28   F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog112 hydrog ?    ? G DG  1   N2    ? ? ? 1_555 H DC  25  O2    ? ? G DG  4    H DC  53   1_555 ? ? ? ? ? ? 'DG-DC PAIR'     ? 
? ? 
hydrog113 hydrog ?    ? G DG  2   N2    ? ? ? 1_555 H DC  24  O2    ? ? G DG  5    H DC  52   1_555 ? ? ? ? ? ? 'DG-DC PAIR'     ? 
? ? 
hydrog114 hydrog ?    ? G DT  3   N3    ? ? ? 1_555 H DA  23  N1    ? ? G DT  6    H DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog115 hydrog ?    ? G DT  3   O4    ? ? ? 1_555 H DA  23  N6    ? ? G DT  6    H DA  51   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog116 hydrog ?    ? G DG  4   N1    ? ? ? 1_555 H DC  22  N3    ? ? G DG  7    H DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog117 hydrog ?    ? G DG  4   N2    ? ? ? 1_555 H DC  22  O2    ? ? G DG  7    H DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog118 hydrog ?    ? G DG  4   O6    ? ? ? 1_555 H DC  22  N4    ? ? G DG  7    H DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog119 hydrog ?    ? G DT  5   N3    ? ? ? 1_555 H DA  21  N1    ? ? G DT  8    H DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog120 hydrog ?    ? G DT  5   O4    ? ? ? 1_555 H DA  21  N6    ? ? G DT  8    H DA  49   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog121 hydrog ?    ? G DA  6   N1    ? ? ? 1_555 H DT  20  N3    ? ? G DA  9    H DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog122 hydrog ?    ? G DA  6   N6    ? ? ? 1_555 H DT  20  O4    ? ? G DA  9    H DT  48   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog123 hydrog ?    ? G DC  7   N3    ? ? ? 1_555 H DG  19  N1    ? ? G DC  10   H DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog124 hydrog ?    ? G DC  7   N4    ? ? ? 1_555 H DG  19  O6    ? ? G DC  10   H DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog125 hydrog ?    ? G DC  7   O2    ? ? ? 1_555 H DG  19  N2    ? ? G DC  10   H DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog126 hydrog ?    ? G DA  8   N1    ? ? ? 1_555 H DT  18  N3    ? ? G DA  11   H DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog127 hydrog ?    ? G DA  8   N6    ? ? ? 1_555 H DT  18  O4    ? ? G DA  11   H DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog128 hydrog ?    ? G DA  9   N1    ? ? ? 1_555 H DT  17  N3    ? ? G DA  12   H DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog129 hydrog ?    ? G DA  9   N6    ? ? ? 1_555 H DT  17  O4    ? ? G DA  12   H DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog130 hydrog ?    ? G DG  10  N2    ? ? ? 1_555 H DC  16  O2    ? ? G DG  13   H DC  44   1_555 ? ? ? ? ? ? 'DG-DC PAIR'     ? 
? ? 
hydrog131 hydrog ?    ? G 5IU 13  N3    ? ? ? 1_555 H DT  14  O2    ? ? G 5IU 16   H DT  42   1_555 ? ? ? ? ? ? '5IU-DT MISPAIR' ? 
? ? 
hydrog132 hydrog ?    ? G DG  14  N1    ? ? ? 1_555 H DC  12  N3    ? ? G DG  17   H DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog133 hydrog ?    ? G DG  14  N2    ? ? ? 1_555 H DC  12  O2    ? ? G DG  17   H DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog134 hydrog ?    ? G DG  14  O6    ? ? ? 1_555 H DC  12  N4    ? ? G DG  17   H DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog135 hydrog ?    ? G DA  15  N1    ? ? ? 1_555 H DT  11  N3    ? ? G DA  18   H DT  39   1_555 ? ? ? ? ? ? 'DA-DT PAIR'     ? 
? ? 
hydrog136 hydrog ?    ? G DA  16  N1    ? ? ? 1_555 H DT  10  N3    ? ? G DA  19   H DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog137 hydrog ?    ? G DA  16  N6    ? ? ? 1_555 H DT  10  O4    ? ? G DA  19   H DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog138 hydrog ?    ? G DA  17  N1    ? ? ? 1_555 H DT  9   N3    ? ? G DA  20   H DT  37   1_555 ? ? ? ? ? ? 'DA-DT PAIR'     ? 
? ? 
hydrog139 hydrog ?    ? G DT  18  N3    ? ? ? 1_555 H DA  8   N1    ? ? G DT  21   H DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog140 hydrog ?    ? G DT  18  O4    ? ? ? 1_555 H DA  8   N6    ? ? G DT  21   H DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog141 hydrog ?    ? G DG  19  N1    ? ? ? 1_555 H DC  7   N3    ? ? G DG  22   H DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog142 hydrog ?    ? G DG  19  N2    ? ? ? 1_555 H DC  7   O2    ? ? G DG  22   H DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog143 hydrog ?    ? G DG  19  O6    ? ? ? 1_555 H DC  7   N4    ? ? G DG  22   H DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog144 hydrog ?    ? G DT  20  N3    ? ? ? 1_555 H DA  6   N1    ? ? G DT  23   H DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog145 hydrog ?    ? G DT  20  O4    ? ? ? 1_555 H DA  6   N6    ? ? G DT  23   H DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog146 hydrog ?    ? G DC  21  N3    ? ? ? 1_555 H DG  5   N1    ? ? G DC  24   H DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog147 hydrog ?    ? G DC  21  N4    ? ? ? 1_555 H DG  5   O6    ? ? G DC  24   H DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog148 hydrog ?    ? G DC  21  O2    ? ? ? 1_555 H DG  5   N2    ? ? G DC  24   H DG  33   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog149 hydrog ?    ? G DG  22  N1    ? ? ? 1_555 H DA  3   N1    ? ? G DG  25   H DA  31   1_555 ? ? ? ? ? ? TYPE_8_PAIR      ? 
? ? 
hydrog150 hydrog ?    ? G DG  22  O6    ? ? ? 1_555 H DA  3   N6    ? ? G DG  25   H DA  31   1_555 ? ? ? ? ? ? TYPE_8_PAIR      ? 
? ? 
hydrog151 hydrog ?    ? G DG  22  N1    ? ? ? 1_555 H DC  4   N3    ? ? G DG  25   H DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog152 hydrog ?    ? G DG  22  N2    ? ? ? 1_555 H DC  4   O2    ? ? G DG  25   H DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog153 hydrog ?    ? G DG  22  O6    ? ? ? 1_555 H DC  4   N4    ? ? G DG  25   H DC  32   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog154 hydrog ?    ? G DT  23  N3    ? ? ? 1_555 H DA  3   N1    ? ? G DT  26   H DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog155 hydrog ?    ? G DT  23  O4    ? ? ? 1_555 H DA  3   N6    ? ? G DT  26   H DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog156 hydrog ?    ? G DT  24  N3    ? ? ? 1_555 H DA  2   N1    ? ? G DT  27   H DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog157 hydrog ?    ? G DT  24  O4    ? ? ? 1_555 H DA  2   N6    ? ? G DT  27   H DA  30   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog158 hydrog ?    ? G DT  25  N3    ? ? ? 1_555 H DA  1   N1    ? ? G DT  28   H DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
hydrog159 hydrog ?    ? G DT  25  O4    ? ? ? 1_555 H DA  1   N6    ? ? G DT  28   H DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK     ? 
? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 5 ? 
D ? 2 ? 
E ? 2 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 113 ? VAL A 116 ? ILE A 113 VAL A 116 
A 2 LYS B 169 ? VAL B 172 ? LYS B 169 VAL B 172 
B 1 TRP A 119 ? VAL A 120 ? TRP A 119 VAL A 120 
B 2 THR B 181 ? ALA B 182 ? THR B 181 ALA B 182 
C 1 VAL A 202 ? LEU A 208 ? VAL A 202 LEU A 208 
C 2 LYS A 190 ? ASP A 198 ? LYS A 190 ASP A 198 
C 3 ILE A 152 ? PHE A 161 ? ILE A 152 PHE A 161 
C 4 ILE A 245 ? LEU A 247 ? ILE A 245 LEU A 247 
C 5 GLU A 269 ? VAL A 270 ? GLU A 269 VAL A 270 
D 1 LYS A 169 ? VAL A 172 ? LYS A 169 VAL A 172 
D 2 ILE B 113 ? VAL B 116 ? ILE B 113 VAL B 116 
E 1 THR A 181 ? ALA A 182 ? THR A 181 ALA A 182 
E 2 TRP B 119 ? VAL B 120 ? TRP B 119 VAL B 120 
F 1 GLY B 201 ? LEU B 208 ? GLY B 201 LEU B 208 
F 2 LYS B 190 ? ASP B 198 ? LYS B 190 ASP B 198 
F 3 ILE B 152 ? PHE B 161 ? ILE B 152 PHE B 161 
F 4 ILE B 245 ? LEU B 247 ? ILE B 245 LEU B 247 
F 5 GLU B 269 ? VAL B 270 ? GLU B 269 VAL B 270 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 113 ? N ILE A 113 O VAL B 172 ? O VAL B 172 
B 1 2 N VAL A 120 ? N VAL A 120 O THR B 181 ? O THR B 181 
C 1 2 O GLU A 206 ? O GLU A 206 N CYS A 194 ? N CYS A 194 
C 2 3 O TRP A 197 ? O TRP A 197 N THR A 154 ? N THR A 154 
C 3 4 N VAL A 153 ? N VAL A 153 O ILE A 245 ? O ILE A 245 
C 4 5 N PHE A 246 ? N PHE A 246 O GLU A 269 ? O GLU A 269 
D 1 2 N VAL A 172 ? N VAL A 172 O ILE B 113 ? O ILE B 113 
E 1 2 N THR A 181 ? N THR A 181 O VAL B 120 ? O VAL B 120 
F 1 2 O GLY B 201 ? O GLY B 201 N ASP B 198 ? N ASP B 198 
F 2 3 O THR B 191 ? O THR B 191 N ILE B 160 ? N ILE B 160 
F 3 4 N VAL B 153 ? N VAL B 153 O ILE B 245 ? O ILE B 245 
F 4 5 N PHE B 246 ? N PHE B 246 O GLU B 269 ? O GLU B 269 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  1001 ? 2 'BINDING SITE FOR RESIDUE MN A 1001' 
AC2 Software B SO4 346  ? 2 'BINDING SITE FOR RESIDUE SO4 B 346' 
AC3 Software D SO4 1    ? 2 'BINDING SITE FOR RESIDUE SO4 D 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ASP A 156 ? ASP A 156 . ? 1_555 ? 
2 AC1 2 ASP A 249 ? ASP A 249 . ? 1_555 ? 
3 AC2 2 ARG B 71  ? ARG B 71  . ? 1_555 ? 
4 AC2 2 DT  F 17  ? DT  F 45  . ? 1_555 ? 
5 AC3 2 ARG A 71  ? ARG A 71  . ? 1_555 ? 
6 AC3 2 DT  D 17  ? DT  D 45  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3HOT 
_atom_sites.fract_transf_matrix[1][1]   0.008313 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001348 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011766 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007668 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
I  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 5   ? 6.823   -19.462 -44.419 1.00 66.04  ? 5    VAL A N     1 
ATOM   2    C  CA    . VAL A 1 5   ? 6.500   -18.701 -43.182 1.00 66.00  ? 5    VAL A CA    1 
ATOM   3    C  C     . VAL A 1 5   ? 7.646   -17.686 -42.897 1.00 66.29  ? 5    VAL A C     1 
ATOM   4    O  O     . VAL A 1 5   ? 8.840   -18.065 -42.969 1.00 66.24  ? 5    VAL A O     1 
ATOM   5    C  CB    . VAL A 1 5   ? 6.210   -19.672 -42.001 1.00 65.92  ? 5    VAL A CB    1 
ATOM   6    C  CG1   . VAL A 1 5   ? 5.597   -18.926 -40.812 1.00 65.80  ? 5    VAL A CG1   1 
ATOM   7    C  CG2   . VAL A 1 5   ? 5.286   -20.820 -42.457 1.00 65.15  ? 5    VAL A CG2   1 
ATOM   8    N  N     . PRO A 1 6   ? 7.285   -16.392 -42.609 1.00 66.27  ? 6    PRO A N     1 
ATOM   9    C  CA    . PRO A 1 6   ? 8.217   -15.236 -42.582 1.00 65.87  ? 6    PRO A CA    1 
ATOM   10   C  C     . PRO A 1 6   ? 8.490   -14.629 -41.205 1.00 65.27  ? 6    PRO A C     1 
ATOM   11   O  O     . PRO A 1 6   ? 7.925   -15.080 -40.213 1.00 65.08  ? 6    PRO A O     1 
ATOM   12   C  CB    . PRO A 1 6   ? 7.455   -14.198 -43.404 1.00 65.94  ? 6    PRO A CB    1 
ATOM   13   C  CG    . PRO A 1 6   ? 5.972   -14.467 -43.007 1.00 66.30  ? 6    PRO A CG    1 
ATOM   14   C  CD    . PRO A 1 6   ? 5.888   -15.914 -42.499 1.00 66.23  ? 6    PRO A CD    1 
ATOM   15   N  N     . ASN A 1 7   ? 9.337   -13.596 -41.179 1.00 64.83  ? 7    ASN A N     1 
ATOM   16   C  CA    . ASN A 1 7   ? 9.655   -12.811 -39.970 1.00 64.51  ? 7    ASN A CA    1 
ATOM   17   C  C     . ASN A 1 7   ? 10.119  -11.383 -40.303 1.00 64.28  ? 7    ASN A C     1 
ATOM   18   O  O     . ASN A 1 7   ? 10.762  -11.168 -41.324 1.00 64.45  ? 7    ASN A O     1 
ATOM   19   C  CB    . ASN A 1 7   ? 10.676  -13.554 -39.091 1.00 64.38  ? 7    ASN A CB    1 
ATOM   20   C  CG    . ASN A 1 7   ? 11.694  -12.628 -38.434 1.00 64.34  ? 7    ASN A CG    1 
ATOM   21   O  OD1   . ASN A 1 7   ? 12.596  -12.114 -39.089 1.00 64.25  ? 7    ASN A OD1   1 
ATOM   22   N  ND2   . ASN A 1 7   ? 11.567  -12.441 -37.128 1.00 64.49  ? 7    ASN A ND2   1 
ATOM   23   N  N     . LYS A 1 8   ? 9.817   -10.425 -39.426 1.00 63.84  ? 8    LYS A N     1 
ATOM   24   C  CA    . LYS A 1 8   ? 10.002  -8.991  -39.721 1.00 63.54  ? 8    LYS A CA    1 
ATOM   25   C  C     . LYS A 1 8   ? 11.449  -8.513  -39.888 1.00 63.15  ? 8    LYS A C     1 
ATOM   26   O  O     . LYS A 1 8   ? 11.694  -7.372  -40.301 1.00 63.08  ? 8    LYS A O     1 
ATOM   27   C  CB    . LYS A 1 8   ? 9.260   -8.114  -38.696 1.00 63.77  ? 8    LYS A CB    1 
ATOM   28   C  CG    . LYS A 1 8   ? 7.716   -8.202  -38.749 1.00 64.12  ? 8    LYS A CG    1 
ATOM   29   C  CD    . LYS A 1 8   ? 7.121   -7.724  -40.087 1.00 63.68  ? 8    LYS A CD    1 
ATOM   30   C  CE    . LYS A 1 8   ? 5.713   -8.269  -40.297 1.00 63.22  ? 8    LYS A CE    1 
ATOM   31   N  NZ    . LYS A 1 8   ? 4.727   -7.613  -39.394 1.00 63.22  ? 8    LYS A NZ    1 
ATOM   32   N  N     . GLU A 1 9   ? 12.401  -9.375  -39.556 1.00 62.68  ? 9    GLU A N     1 
ATOM   33   C  CA    . GLU A 1 9   ? 13.796  -9.118  -39.890 1.00 62.23  ? 9    GLU A CA    1 
ATOM   34   C  C     . GLU A 1 9   ? 14.097  -9.786  -41.235 1.00 61.47  ? 9    GLU A C     1 
ATOM   35   O  O     . GLU A 1 9   ? 14.583  -9.142  -42.170 1.00 61.37  ? 9    GLU A O     1 
ATOM   36   C  CB    . GLU A 1 9   ? 14.722  -9.635  -38.784 1.00 62.46  ? 9    GLU A CB    1 
ATOM   37   C  CG    . GLU A 1 9   ? 16.194  -9.701  -39.186 1.00 63.47  ? 9    GLU A CG    1 
ATOM   38   C  CD    . GLU A 1 9   ? 17.110  -10.142 -38.057 1.00 64.88  ? 9    GLU A CD    1 
ATOM   39   O  OE1   . GLU A 1 9   ? 18.233  -9.604  -37.979 1.00 65.49  ? 9    GLU A OE1   1 
ATOM   40   O  OE2   . GLU A 1 9   ? 16.719  -11.020 -37.251 1.00 65.45  ? 9    GLU A OE2   1 
ATOM   41   N  N     . GLN A 1 10  ? 13.791  -11.079 -41.316 1.00 60.51  ? 10   GLN A N     1 
ATOM   42   C  CA    . GLN A 1 10  ? 13.892  -11.848 -42.548 1.00 59.58  ? 10   GLN A CA    1 
ATOM   43   C  C     . GLN A 1 10  ? 13.208  -11.121 -43.701 1.00 58.81  ? 10   GLN A C     1 
ATOM   44   O  O     . GLN A 1 10  ? 13.749  -11.047 -44.798 1.00 58.92  ? 10   GLN A O     1 
ATOM   45   C  CB    . GLN A 1 10  ? 13.254  -13.220 -42.354 1.00 59.70  ? 10   GLN A CB    1 
ATOM   46   C  CG    . GLN A 1 10  ? 14.019  -14.148 -41.422 1.00 60.14  ? 10   GLN A CG    1 
ATOM   47   C  CD    . GLN A 1 10  ? 13.104  -15.061 -40.604 1.00 60.64  ? 10   GLN A CD    1 
ATOM   48   O  OE1   . GLN A 1 10  ? 13.325  -15.253 -39.408 1.00 60.71  ? 10   GLN A OE1   1 
ATOM   49   N  NE2   . GLN A 1 10  ? 12.070  -15.616 -41.241 1.00 60.75  ? 10   GLN A NE2   1 
ATOM   50   N  N     . THR A 1 11  ? 12.019  -10.586 -43.439 1.00 57.75  ? 11   THR A N     1 
ATOM   51   C  CA    . THR A 1 11  ? 11.300  -9.753  -44.393 1.00 56.72  ? 11   THR A CA    1 
ATOM   52   C  C     . THR A 1 11  ? 12.192  -8.651  -44.929 1.00 56.01  ? 11   THR A C     1 
ATOM   53   O  O     . THR A 1 11  ? 12.391  -8.548  -46.132 1.00 55.99  ? 11   THR A O     1 
ATOM   54   C  CB    . THR A 1 11  ? 10.037  -9.155  -43.759 1.00 56.85  ? 11   THR A CB    1 
ATOM   55   O  OG1   . THR A 1 11  ? 9.037   -10.178 -43.672 1.00 57.16  ? 11   THR A OG1   1 
ATOM   56   C  CG2   . THR A 1 11  ? 9.503   -7.971  -44.571 1.00 56.50  ? 11   THR A CG2   1 
ATOM   57   N  N     . ARG A 1 12  ? 12.745  -7.840  -44.037 1.00 55.19  ? 12   ARG A N     1 
ATOM   58   C  CA    . ARG A 1 12  ? 13.669  -6.797  -44.455 1.00 54.52  ? 12   ARG A CA    1 
ATOM   59   C  C     . ARG A 1 12  ? 14.801  -7.360  -45.337 1.00 53.64  ? 12   ARG A C     1 
ATOM   60   O  O     . ARG A 1 12  ? 15.132  -6.770  -46.368 1.00 53.57  ? 12   ARG A O     1 
ATOM   61   C  CB    . ARG A 1 12  ? 14.183  -6.021  -43.235 1.00 54.78  ? 12   ARG A CB    1 
ATOM   62   C  CG    . ARG A 1 12  ? 15.408  -5.137  -43.464 1.00 55.69  ? 12   ARG A CG    1 
ATOM   63   C  CD    . ARG A 1 12  ? 16.623  -5.702  -42.735 1.00 58.08  ? 12   ARG A CD    1 
ATOM   64   N  NE    . ARG A 1 12  ? 16.348  -5.893  -41.306 1.00 60.13  ? 12   ARG A NE    1 
ATOM   65   C  CZ    . ARG A 1 12  ? 17.262  -6.164  -40.374 1.00 60.86  ? 12   ARG A CZ    1 
ATOM   66   N  NH1   . ARG A 1 12  ? 18.548  -6.280  -40.699 1.00 61.22  ? 12   ARG A NH1   1 
ATOM   67   N  NH2   . ARG A 1 12  ? 16.886  -6.312  -39.107 1.00 61.06  ? 12   ARG A NH2   1 
ATOM   68   N  N     . THR A 1 13  ? 15.354  -8.510  -44.951 1.00 52.52  ? 13   THR A N     1 
ATOM   69   C  CA    . THR A 1 13  ? 16.382  -9.189  -45.748 1.00 51.52  ? 13   THR A CA    1 
ATOM   70   C  C     . THR A 1 13  ? 15.941  -9.427  -47.198 1.00 50.88  ? 13   THR A C     1 
ATOM   71   O  O     . THR A 1 13  ? 16.586  -8.956  -48.135 1.00 50.75  ? 13   THR A O     1 
ATOM   72   C  CB    . THR A 1 13  ? 16.789  -10.527 -45.113 1.00 51.50  ? 13   THR A CB    1 
ATOM   73   O  OG1   . THR A 1 13  ? 17.409  -10.284 -43.848 1.00 51.96  ? 13   THR A OG1   1 
ATOM   74   C  CG2   . THR A 1 13  ? 17.757  -11.272 -46.003 1.00 51.21  ? 13   THR A CG2   1 
ATOM   75   N  N     . VAL A 1 14  ? 14.843  -10.157 -47.379 1.00 50.02  ? 14   VAL A N     1 
ATOM   76   C  CA    . VAL A 1 14  ? 14.303  -10.414 -48.711 1.00 49.10  ? 14   VAL A CA    1 
ATOM   77   C  C     . VAL A 1 14  ? 14.327  -9.132  -49.537 1.00 48.84  ? 14   VAL A C     1 
ATOM   78   O  O     . VAL A 1 14  ? 14.798  -9.126  -50.667 1.00 48.71  ? 14   VAL A O     1 
ATOM   79   C  CB    . VAL A 1 14  ? 12.862  -10.980 -48.647 1.00 48.96  ? 14   VAL A CB    1 
ATOM   80   C  CG1   . VAL A 1 14  ? 12.218  -10.996 -50.023 1.00 48.64  ? 14   VAL A CG1   1 
ATOM   81   C  CG2   . VAL A 1 14  ? 12.869  -12.371 -48.063 1.00 48.43  ? 14   VAL A CG2   1 
ATOM   82   N  N     . LEU A 1 15  ? 13.844  -8.042  -48.949 1.00 48.52  ? 15   LEU A N     1 
ATOM   83   C  CA    . LEU A 1 15  ? 13.734  -6.769  -49.653 1.00 48.11  ? 15   LEU A CA    1 
ATOM   84   C  C     . LEU A 1 15  ? 15.069  -6.178  -50.090 1.00 48.03  ? 15   LEU A C     1 
ATOM   85   O  O     . LEU A 1 15  ? 15.117  -5.427  -51.064 1.00 48.00  ? 15   LEU A O     1 
ATOM   86   C  CB    . LEU A 1 15  ? 12.942  -5.773  -48.822 1.00 47.90  ? 15   LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 15  ? 11.469  -5.849  -49.192 1.00 47.56  ? 15   LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 15  ? 10.622  -5.798  -47.949 1.00 48.00  ? 15   LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 15  ? 11.101  -4.737  -50.167 1.00 47.55  ? 15   LEU A CD2   1 
ATOM   90   N  N     . ILE A 1 16  ? 16.139  -6.517  -49.367 1.00 47.78  ? 16   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 16  ? 17.507  -6.140  -49.746 1.00 47.42  ? 16   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 16  ? 17.859  -6.854  -51.047 1.00 47.18  ? 16   ILE A C     1 
ATOM   93   O  O     . ILE A 1 16  ? 18.414  -6.266  -51.984 1.00 47.02  ? 16   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 16  ? 18.509  -6.512  -48.624 1.00 47.41  ? 16   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 16  ? 18.291  -5.598  -47.400 1.00 47.40  ? 16   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 16  ? 19.961  -6.502  -49.152 1.00 47.38  ? 16   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 16  ? 18.886  -6.094  -46.066 1.00 47.61  ? 16   ILE A CD1   1 
ATOM   98   N  N     . PHE A 1 17  ? 17.495  -8.130  -51.078 1.00 46.94  ? 17   PHE A N     1 
ATOM   99   C  CA    . PHE A 1 17  ? 17.616  -8.987  -52.242 1.00 46.64  ? 17   PHE A CA    1 
ATOM   100  C  C     . PHE A 1 17  ? 16.758  -8.431  -53.369 1.00 46.66  ? 17   PHE A C     1 
ATOM   101  O  O     . PHE A 1 17  ? 17.291  -7.977  -54.375 1.00 46.73  ? 17   PHE A O     1 
ATOM   102  C  CB    . PHE A 1 17  ? 17.196  -10.395 -51.829 1.00 46.52  ? 17   PHE A CB    1 
ATOM   103  C  CG    . PHE A 1 17  ? 17.144  -11.377 -52.936 1.00 45.55  ? 17   PHE A CG    1 
ATOM   104  C  CD1   . PHE A 1 17  ? 18.301  -11.868 -53.494 1.00 45.16  ? 17   PHE A CD1   1 
ATOM   105  C  CD2   . PHE A 1 17  ? 15.923  -11.860 -53.378 1.00 45.37  ? 17   PHE A CD2   1 
ATOM   106  C  CE1   . PHE A 1 17  ? 18.240  -12.804 -54.506 1.00 46.32  ? 17   PHE A CE1   1 
ATOM   107  C  CE2   . PHE A 1 17  ? 15.847  -12.791 -54.386 1.00 45.62  ? 17   PHE A CE2   1 
ATOM   108  C  CZ    . PHE A 1 17  ? 17.004  -13.266 -54.957 1.00 46.26  ? 17   PHE A CZ    1 
ATOM   109  N  N     . CYS A 1 18  ? 15.440  -8.416  -53.169 1.00 46.68  ? 18   CYS A N     1 
ATOM   110  C  CA    . CYS A 1 18  ? 14.484  -7.884  -54.146 1.00 46.69  ? 18   CYS A CA    1 
ATOM   111  C  C     . CYS A 1 18  ? 14.885  -6.517  -54.698 1.00 46.91  ? 18   CYS A C     1 
ATOM   112  O  O     . CYS A 1 18  ? 14.498  -6.141  -55.807 1.00 46.95  ? 18   CYS A O     1 
ATOM   113  C  CB    . CYS A 1 18  ? 13.085  -7.819  -53.536 1.00 46.54  ? 18   CYS A CB    1 
ATOM   114  S  SG    . CYS A 1 18  ? 12.171  -9.376  -53.616 1.00 46.09  ? 18   CYS A SG    1 
ATOM   115  N  N     . PHE A 1 19  ? 15.671  -5.788  -53.914 1.00 47.21  ? 19   PHE A N     1 
ATOM   116  C  CA    . PHE A 1 19  ? 16.203  -4.501  -54.324 1.00 47.57  ? 19   PHE A CA    1 
ATOM   117  C  C     . PHE A 1 19  ? 17.340  -4.701  -55.311 1.00 47.62  ? 19   PHE A C     1 
ATOM   118  O  O     . PHE A 1 19  ? 17.297  -4.170  -56.432 1.00 47.78  ? 19   PHE A O     1 
ATOM   119  C  CB    . PHE A 1 19  ? 16.692  -3.731  -53.098 1.00 47.83  ? 19   PHE A CB    1 
ATOM   120  C  CG    . PHE A 1 19  ? 17.268  -2.378  -53.408 1.00 48.42  ? 19   PHE A CG    1 
ATOM   121  C  CD1   . PHE A 1 19  ? 16.522  -1.427  -54.107 1.00 48.82  ? 19   PHE A CD1   1 
ATOM   122  C  CD2   . PHE A 1 19  ? 18.548  -2.045  -52.975 1.00 48.58  ? 19   PHE A CD2   1 
ATOM   123  C  CE1   . PHE A 1 19  ? 17.052  -0.172  -54.386 1.00 48.93  ? 19   PHE A CE1   1 
ATOM   124  C  CE2   . PHE A 1 19  ? 19.085  -0.796  -53.244 1.00 48.98  ? 19   PHE A CE2   1 
ATOM   125  C  CZ    . PHE A 1 19  ? 18.334  0.146   -53.953 1.00 49.11  ? 19   PHE A CZ    1 
ATOM   126  N  N     . HIS A 1 20  ? 18.337  -5.486  -54.888 1.00 47.48  ? 20   HIS A N     1 
ATOM   127  C  CA    . HIS A 1 20  ? 19.525  -5.802  -55.693 1.00 47.28  ? 20   HIS A CA    1 
ATOM   128  C  C     . HIS A 1 20  ? 19.245  -6.544  -57.001 1.00 47.51  ? 20   HIS A C     1 
ATOM   129  O  O     . HIS A 1 20  ? 20.166  -6.872  -57.752 1.00 47.52  ? 20   HIS A O     1 
ATOM   130  C  CB    . HIS A 1 20  ? 20.514  -6.585  -54.851 1.00 46.85  ? 20   HIS A CB    1 
ATOM   131  C  CG    . HIS A 1 20  ? 21.158  -5.765  -53.789 1.00 46.21  ? 20   HIS A CG    1 
ATOM   132  N  ND1   . HIS A 1 20  ? 21.897  -4.638  -54.073 1.00 45.93  ? 20   HIS A ND1   1 
ATOM   133  C  CD2   . HIS A 1 20  ? 21.173  -5.897  -52.444 1.00 45.69  ? 20   HIS A CD2   1 
ATOM   134  C  CE1   . HIS A 1 20  ? 22.344  -4.114  -52.947 1.00 45.76  ? 20   HIS A CE1   1 
ATOM   135  N  NE2   . HIS A 1 20  ? 21.922  -4.862  -51.945 1.00 45.75  ? 20   HIS A NE2   1 
ATOM   136  N  N     . LEU A 1 21  ? 17.969  -6.810  -57.256 1.00 47.72  ? 21   LEU A N     1 
ATOM   137  C  CA    . LEU A 1 21  ? 17.524  -7.377  -58.508 1.00 47.87  ? 21   LEU A CA    1 
ATOM   138  C  C     . LEU A 1 21  ? 16.885  -6.292  -59.366 1.00 48.38  ? 21   LEU A C     1 
ATOM   139  O  O     . LEU A 1 21  ? 16.212  -6.596  -60.356 1.00 48.55  ? 21   LEU A O     1 
ATOM   140  C  CB    . LEU A 1 21  ? 16.531  -8.512  -58.255 1.00 47.61  ? 21   LEU A CB    1 
ATOM   141  C  CG    . LEU A 1 21  ? 17.086  -9.927  -58.101 1.00 47.06  ? 21   LEU A CG    1 
ATOM   142  C  CD1   . LEU A 1 21  ? 17.694  -10.117 -56.756 1.00 47.26  ? 21   LEU A CD1   1 
ATOM   143  C  CD2   . LEU A 1 21  ? 15.985  -10.933 -58.274 1.00 47.03  ? 21   LEU A CD2   1 
ATOM   144  N  N     . LYS A 1 22  ? 17.107  -5.029  -58.996 1.00 48.80  ? 22   LYS A N     1 
ATOM   145  C  CA    . LYS A 1 22  ? 16.510  -3.898  -59.710 1.00 49.38  ? 22   LYS A CA    1 
ATOM   146  C  C     . LYS A 1 22  ? 14.983  -4.035  -59.830 1.00 49.35  ? 22   LYS A C     1 
ATOM   147  O  O     . LYS A 1 22  ? 14.427  -3.936  -60.940 1.00 49.44  ? 22   LYS A O     1 
ATOM   148  C  CB    . LYS A 1 22  ? 17.129  -3.747  -61.112 1.00 49.62  ? 22   LYS A CB    1 
ATOM   149  C  CG    . LYS A 1 22  ? 17.974  -2.489  -61.341 1.00 50.75  ? 22   LYS A CG    1 
ATOM   150  C  CD    . LYS A 1 22  ? 18.048  -2.159  -62.844 1.00 51.64  ? 22   LYS A CD    1 
ATOM   151  C  CE    . LYS A 1 22  ? 19.278  -1.324  -63.189 1.00 51.90  ? 22   LYS A CE    1 
ATOM   152  N  NZ    . LYS A 1 22  ? 19.841  -1.751  -64.500 1.00 51.93  ? 22   LYS A NZ    1 
ATOM   153  N  N     . LYS A 1 23  ? 14.311  -4.268  -58.701 1.00 49.11  ? 23   LYS A N     1 
ATOM   154  C  CA    . LYS A 1 23  ? 12.851  -4.417  -58.706 1.00 48.87  ? 23   LYS A CA    1 
ATOM   155  C  C     . LYS A 1 23  ? 12.142  -3.336  -57.900 1.00 48.79  ? 23   LYS A C     1 
ATOM   156  O  O     . LYS A 1 23  ? 12.625  -2.941  -56.841 1.00 49.01  ? 23   LYS A O     1 
ATOM   157  C  CB    . LYS A 1 23  ? 12.454  -5.807  -58.232 1.00 48.65  ? 23   LYS A CB    1 
ATOM   158  C  CG    . LYS A 1 23  ? 12.874  -6.882  -59.211 1.00 48.99  ? 23   LYS A CG    1 
ATOM   159  C  CD    . LYS A 1 23  ? 12.498  -8.279  -58.768 1.00 49.74  ? 23   LYS A CD    1 
ATOM   160  C  CE    . LYS A 1 23  ? 10.997  -8.500  -58.773 1.00 50.26  ? 23   LYS A CE    1 
ATOM   161  N  NZ    . LYS A 1 23  ? 10.469  -8.304  -57.387 1.00 50.65  ? 23   LYS A NZ    1 
ATOM   162  N  N     . THR A 1 24  ? 11.007  -2.863  -58.423 1.00 48.53  ? 24   THR A N     1 
ATOM   163  C  CA    . THR A 1 24  ? 10.202  -1.795  -57.809 1.00 48.28  ? 24   THR A CA    1 
ATOM   164  C  C     . THR A 1 24  ? 9.627   -2.231  -56.482 1.00 48.05  ? 24   THR A C     1 
ATOM   165  O  O     . THR A 1 24  ? 9.545   -3.427  -56.201 1.00 48.18  ? 24   THR A O     1 
ATOM   166  C  CB    . THR A 1 24  ? 8.985   -1.440  -58.672 1.00 48.33  ? 24   THR A CB    1 
ATOM   167  O  OG1   . THR A 1 24  ? 8.395   -2.645  -59.185 1.00 48.67  ? 24   THR A OG1   1 
ATOM   168  C  CG2   . THR A 1 24  ? 9.374   -0.528  -59.823 1.00 48.82  ? 24   THR A CG2   1 
ATOM   169  N  N     . ALA A 1 25  ? 9.203   -1.262  -55.677 1.00 47.58  ? 25   ALA A N     1 
ATOM   170  C  CA    . ALA A 1 25  ? 8.513   -1.572  -54.437 1.00 47.08  ? 25   ALA A CA    1 
ATOM   171  C  C     . ALA A 1 25  ? 7.322   -2.469  -54.728 1.00 46.84  ? 25   ALA A C     1 
ATOM   172  O  O     . ALA A 1 25  ? 7.213   -3.547  -54.167 1.00 46.90  ? 25   ALA A O     1 
ATOM   173  C  CB    . ALA A 1 25  ? 8.073   -0.319  -53.748 1.00 47.06  ? 25   ALA A CB    1 
ATOM   174  N  N     . ALA A 1 26  ? 6.453   -2.036  -55.632 1.00 46.64  ? 26   ALA A N     1 
ATOM   175  C  CA    . ALA A 1 26  ? 5.290   -2.820  -56.016 1.00 46.65  ? 26   ALA A CA    1 
ATOM   176  C  C     . ALA A 1 26  ? 5.663   -4.236  -56.434 1.00 46.74  ? 26   ALA A C     1 
ATOM   177  O  O     . ALA A 1 26  ? 5.327   -5.185  -55.730 1.00 46.76  ? 26   ALA A O     1 
ATOM   178  C  CB    . ALA A 1 26  ? 4.522   -2.129  -57.116 1.00 46.76  ? 26   ALA A CB    1 
ATOM   179  N  N     . GLU A 1 27  ? 6.367   -4.387  -57.557 1.00 46.97  ? 27   GLU A N     1 
ATOM   180  C  CA    . GLU A 1 27  ? 6.689   -5.729  -58.062 1.00 47.26  ? 27   GLU A CA    1 
ATOM   181  C  C     . GLU A 1 27  ? 7.507   -6.528  -57.034 1.00 47.35  ? 27   GLU A C     1 
ATOM   182  O  O     . GLU A 1 27  ? 7.589   -7.748  -57.140 1.00 47.48  ? 27   GLU A O     1 
ATOM   183  C  CB    . GLU A 1 27  ? 7.333   -5.701  -59.472 1.00 47.18  ? 27   GLU A CB    1 
ATOM   184  C  CG    . GLU A 1 27  ? 7.398   -7.078  -60.226 1.00 47.72  ? 27   GLU A CG    1 
ATOM   185  C  CD    . GLU A 1 27  ? 6.114   -7.498  -61.014 1.00 48.23  ? 27   GLU A CD    1 
ATOM   186  O  OE1   . GLU A 1 27  ? 5.613   -8.626  -60.782 1.00 47.95  ? 27   GLU A OE1   1 
ATOM   187  O  OE2   . GLU A 1 27  ? 5.617   -6.735  -61.881 1.00 47.48  ? 27   GLU A OE2   1 
ATOM   188  N  N     . SER A 1 28  ? 8.066   -5.843  -56.026 1.00 47.48  ? 28   SER A N     1 
ATOM   189  C  CA    . SER A 1 28  ? 8.705   -6.503  -54.860 1.00 47.52  ? 28   SER A CA    1 
ATOM   190  C  C     . SER A 1 28  ? 7.695   -7.016  -53.840 1.00 47.63  ? 28   SER A C     1 
ATOM   191  O  O     . SER A 1 28  ? 7.817   -8.133  -53.347 1.00 47.64  ? 28   SER A O     1 
ATOM   192  C  CB    . SER A 1 28  ? 9.685   -5.573  -54.139 1.00 47.29  ? 28   SER A CB    1 
ATOM   193  O  OG    . SER A 1 28  ? 11.017  -5.828  -54.525 1.00 46.97  ? 28   SER A OG    1 
ATOM   194  N  N     . HIS A 1 29  ? 6.713   -6.181  -53.518 1.00 47.75  ? 29   HIS A N     1 
ATOM   195  C  CA    . HIS A 1 29  ? 5.690   -6.524  -52.549 1.00 47.92  ? 29   HIS A CA    1 
ATOM   196  C  C     . HIS A 1 29  ? 4.887   -7.732  -52.995 1.00 47.77  ? 29   HIS A C     1 
ATOM   197  O  O     . HIS A 1 29  ? 4.643   -8.632  -52.204 1.00 47.70  ? 29   HIS A O     1 
ATOM   198  C  CB    . HIS A 1 29  ? 4.769   -5.329  -52.305 1.00 48.22  ? 29   HIS A CB    1 
ATOM   199  C  CG    . HIS A 1 29  ? 3.560   -5.652  -51.483 1.00 49.69  ? 29   HIS A CG    1 
ATOM   200  N  ND1   . HIS A 1 29  ? 3.599   -5.760  -50.107 1.00 50.79  ? 29   HIS A ND1   1 
ATOM   201  C  CD2   . HIS A 1 29  ? 2.273   -5.881  -51.842 1.00 50.87  ? 29   HIS A CD2   1 
ATOM   202  C  CE1   . HIS A 1 29  ? 2.392   -6.051  -49.654 1.00 50.92  ? 29   HIS A CE1   1 
ATOM   203  N  NE2   . HIS A 1 29  ? 1.570   -6.130  -50.686 1.00 51.73  ? 29   HIS A NE2   1 
ATOM   204  N  N     . ARG A 1 30  ? 4.493   -7.761  -54.264 1.00 47.81  ? 30   ARG A N     1 
ATOM   205  C  CA    . ARG A 1 30  ? 3.659   -8.855  -54.768 1.00 48.04  ? 30   ARG A CA    1 
ATOM   206  C  C     . ARG A 1 30  ? 4.419   -10.176 -54.869 1.00 47.80  ? 30   ARG A C     1 
ATOM   207  O  O     . ARG A 1 30  ? 3.807   -11.244 -54.917 1.00 47.88  ? 30   ARG A O     1 
ATOM   208  C  CB    . ARG A 1 30  ? 3.004   -8.493  -56.102 1.00 48.15  ? 30   ARG A CB    1 
ATOM   209  C  CG    . ARG A 1 30  ? 2.105   -7.269  -56.013 1.00 49.41  ? 30   ARG A CG    1 
ATOM   210  C  CD    . ARG A 1 30  ? 1.293   -7.026  -57.288 1.00 51.12  ? 30   ARG A CD    1 
ATOM   211  N  NE    . ARG A 1 30  ? 2.083   -7.095  -58.521 1.00 52.34  ? 30   ARG A NE    1 
ATOM   212  C  CZ    . ARG A 1 30  ? 2.866   -6.124  -58.996 1.00 53.19  ? 30   ARG A CZ    1 
ATOM   213  N  NH1   . ARG A 1 30  ? 3.011   -4.973  -58.346 1.00 52.86  ? 30   ARG A NH1   1 
ATOM   214  N  NH2   . ARG A 1 30  ? 3.517   -6.310  -60.139 1.00 54.23  ? 30   ARG A NH2   1 
ATOM   215  N  N     . MET A 1 31  ? 5.746   -10.092 -54.908 1.00 47.46  ? 31   MET A N     1 
ATOM   216  C  CA    . MET A 1 31  ? 6.590   -11.261 -54.775 1.00 47.34  ? 31   MET A CA    1 
ATOM   217  C  C     . MET A 1 31  ? 6.265   -11.860 -53.436 1.00 47.14  ? 31   MET A C     1 
ATOM   218  O  O     . MET A 1 31  ? 5.755   -12.968 -53.326 1.00 47.11  ? 31   MET A O     1 
ATOM   219  C  CB    . MET A 1 31  ? 8.045   -10.841 -54.717 1.00 47.46  ? 31   MET A CB    1 
ATOM   220  C  CG    . MET A 1 31  ? 8.540   -10.145 -55.919 1.00 48.25  ? 31   MET A CG    1 
ATOM   221  S  SD    . MET A 1 31  ? 9.296   -11.315 -57.039 1.00 51.06  ? 31   MET A SD    1 
ATOM   222  C  CE    . MET A 1 31  ? 10.883  -11.558 -56.248 1.00 50.46  ? 31   MET A CE    1 
ATOM   223  N  N     . LEU A 1 32  ? 6.568   -11.073 -52.414 1.00 47.06  ? 32   LEU A N     1 
ATOM   224  C  CA    . LEU A 1 32  ? 6.420   -11.449 -51.029 1.00 47.02  ? 32   LEU A CA    1 
ATOM   225  C  C     . LEU A 1 32  ? 5.091   -12.150 -50.810 1.00 47.30  ? 32   LEU A C     1 
ATOM   226  O  O     . LEU A 1 32  ? 5.050   -13.271 -50.295 1.00 47.44  ? 32   LEU A O     1 
ATOM   227  C  CB    . LEU A 1 32  ? 6.500   -10.187 -50.173 1.00 46.79  ? 32   LEU A CB    1 
ATOM   228  C  CG    . LEU A 1 32  ? 7.508   -10.098 -49.037 1.00 45.99  ? 32   LEU A CG    1 
ATOM   229  C  CD1   . LEU A 1 32  ? 8.811   -10.769 -49.399 1.00 45.51  ? 32   LEU A CD1   1 
ATOM   230  C  CD2   . LEU A 1 32  ? 7.733   -8.639  -48.719 1.00 45.24  ? 32   LEU A CD2   1 
ATOM   231  N  N     . VAL A 1 33  ? 4.015   -11.494 -51.242 1.00 47.46  ? 33   VAL A N     1 
ATOM   232  C  CA    . VAL A 1 33  ? 2.662   -11.970 -50.996 1.00 47.61  ? 33   VAL A CA    1 
ATOM   233  C  C     . VAL A 1 33  ? 2.400   -13.324 -51.660 1.00 47.67  ? 33   VAL A C     1 
ATOM   234  O  O     . VAL A 1 33  ? 1.628   -14.135 -51.142 1.00 47.57  ? 33   VAL A O     1 
ATOM   235  C  CB    . VAL A 1 33  ? 1.597   -10.903 -51.383 1.00 47.62  ? 33   VAL A CB    1 
ATOM   236  C  CG1   . VAL A 1 33  ? 1.145   -11.035 -52.855 1.00 48.01  ? 33   VAL A CG1   1 
ATOM   237  C  CG2   . VAL A 1 33  ? 0.410   -10.983 -50.442 1.00 47.74  ? 33   VAL A CG2   1 
ATOM   238  N  N     . GLU A 1 34  ? 3.062   -13.575 -52.788 1.00 47.89  ? 34   GLU A N     1 
ATOM   239  C  CA    . GLU A 1 34  ? 2.878   -14.840 -53.490 1.00 48.19  ? 34   GLU A CA    1 
ATOM   240  C  C     . GLU A 1 34  ? 3.765   -15.934 -52.906 1.00 48.13  ? 34   GLU A C     1 
ATOM   241  O  O     . GLU A 1 34  ? 3.398   -17.109 -52.913 1.00 48.40  ? 34   GLU A O     1 
ATOM   242  C  CB    . GLU A 1 34  ? 3.070   -14.699 -55.010 1.00 48.22  ? 34   GLU A CB    1 
ATOM   243  C  CG    . GLU A 1 34  ? 4.505   -14.821 -55.520 1.00 48.92  ? 34   GLU A CG    1 
ATOM   244  C  CD    . GLU A 1 34  ? 4.582   -15.373 -56.935 1.00 50.34  ? 34   GLU A CD    1 
ATOM   245  O  OE1   . GLU A 1 34  ? 5.596   -16.026 -57.273 1.00 50.10  ? 34   GLU A OE1   1 
ATOM   246  O  OE2   . GLU A 1 34  ? 3.625   -15.161 -57.714 1.00 51.91  ? 34   GLU A OE2   1 
ATOM   247  N  N     . ALA A 1 35  ? 4.924   -15.551 -52.390 1.00 47.93  ? 35   ALA A N     1 
ATOM   248  C  CA    . ALA A 1 35  ? 5.846   -16.537 -51.872 1.00 47.82  ? 35   ALA A CA    1 
ATOM   249  C  C     . ALA A 1 35  ? 5.374   -16.986 -50.515 1.00 47.92  ? 35   ALA A C     1 
ATOM   250  O  O     . ALA A 1 35  ? 5.332   -18.177 -50.233 1.00 47.99  ? 35   ALA A O     1 
ATOM   251  C  CB    . ALA A 1 35  ? 7.221   -15.970 -51.782 1.00 47.83  ? 35   ALA A CB    1 
ATOM   252  N  N     . PHE A 1 36  ? 4.990   -16.024 -49.683 1.00 48.04  ? 36   PHE A N     1 
ATOM   253  C  CA    . PHE A 1 36  ? 4.687   -16.308 -48.288 1.00 48.06  ? 36   PHE A CA    1 
ATOM   254  C  C     . PHE A 1 36  ? 3.208   -16.276 -47.932 1.00 48.20  ? 36   PHE A C     1 
ATOM   255  O  O     . PHE A 1 36  ? 2.780   -17.009 -47.040 1.00 48.23  ? 36   PHE A O     1 
ATOM   256  C  CB    . PHE A 1 36  ? 5.469   -15.367 -47.379 1.00 47.97  ? 36   PHE A CB    1 
ATOM   257  C  CG    . PHE A 1 36  ? 6.954   -15.512 -47.505 1.00 47.71  ? 36   PHE A CG    1 
ATOM   258  C  CD1   . PHE A 1 36  ? 7.558   -16.756 -47.374 1.00 47.42  ? 36   PHE A CD1   1 
ATOM   259  C  CD2   . PHE A 1 36  ? 7.750   -14.406 -47.745 1.00 47.24  ? 36   PHE A CD2   1 
ATOM   260  C  CE1   . PHE A 1 36  ? 8.927   -16.894 -47.489 1.00 46.83  ? 36   PHE A CE1   1 
ATOM   261  C  CE2   . PHE A 1 36  ? 9.119   -14.538 -47.858 1.00 46.77  ? 36   PHE A CE2   1 
ATOM   262  C  CZ    . PHE A 1 36  ? 9.707   -15.784 -47.730 1.00 46.70  ? 36   PHE A CZ    1 
ATOM   263  N  N     . GLY A 1 37  ? 2.440   -15.438 -48.628 1.00 48.29  ? 37   GLY A N     1 
ATOM   264  C  CA    . GLY A 1 37  ? 1.022   -15.249 -48.323 1.00 48.37  ? 37   GLY A CA    1 
ATOM   265  C  C     . GLY A 1 37  ? 0.692   -13.896 -47.703 1.00 48.39  ? 37   GLY A C     1 
ATOM   266  O  O     . GLY A 1 37  ? 1.588   -13.136 -47.316 1.00 48.32  ? 37   GLY A O     1 
ATOM   267  N  N     . GLU A 1 38  ? -0.610  -13.628 -47.579 1.00 48.37  ? 38   GLU A N     1 
ATOM   268  C  CA    . GLU A 1 38  ? -1.162  -12.310 -47.220 1.00 48.21  ? 38   GLU A CA    1 
ATOM   269  C  C     . GLU A 1 38  ? -0.644  -11.618 -45.939 1.00 47.68  ? 38   GLU A C     1 
ATOM   270  O  O     . GLU A 1 38  ? -0.692  -10.391 -45.850 1.00 47.67  ? 38   GLU A O     1 
ATOM   271  C  CB    . GLU A 1 38  ? -2.696  -12.381 -47.187 1.00 48.50  ? 38   GLU A CB    1 
ATOM   272  C  CG    . GLU A 1 38  ? -3.394  -11.108 -47.665 1.00 49.69  ? 38   GLU A CG    1 
ATOM   273  C  CD    . GLU A 1 38  ? -3.148  -10.825 -49.143 1.00 51.33  ? 38   GLU A CD    1 
ATOM   274  O  OE1   . GLU A 1 38  ? -2.626  -9.728  -49.446 1.00 51.91  ? 38   GLU A OE1   1 
ATOM   275  O  OE2   . GLU A 1 38  ? -3.465  -11.696 -49.995 1.00 51.52  ? 38   GLU A OE2   1 
ATOM   276  N  N     . GLN A 1 39  ? -0.178  -12.376 -44.950 1.00 46.97  ? 39   GLN A N     1 
ATOM   277  C  CA    . GLN A 1 39  ? 0.402   -11.742 -43.766 1.00 46.45  ? 39   GLN A CA    1 
ATOM   278  C  C     . GLN A 1 39  ? 1.866   -11.401 -44.040 1.00 45.56  ? 39   GLN A C     1 
ATOM   279  O  O     . GLN A 1 39  ? 2.760   -12.238 -43.885 1.00 45.66  ? 39   GLN A O     1 
ATOM   280  C  CB    . GLN A 1 39  ? 0.265   -12.596 -42.487 1.00 46.96  ? 39   GLN A CB    1 
ATOM   281  C  CG    . GLN A 1 39  ? -1.099  -13.253 -42.232 1.00 48.19  ? 39   GLN A CG    1 
ATOM   282  C  CD    . GLN A 1 39  ? -1.012  -14.779 -42.241 1.00 49.87  ? 39   GLN A CD    1 
ATOM   283  O  OE1   . GLN A 1 39  ? -0.542  -15.395 -41.275 1.00 49.60  ? 39   GLN A OE1   1 
ATOM   284  N  NE2   . GLN A 1 39  ? -1.466  -15.396 -43.336 1.00 50.64  ? 39   GLN A NE2   1 
ATOM   285  N  N     . VAL A 1 40  ? 2.093   -10.160 -44.457 1.00 44.35  ? 40   VAL A N     1 
ATOM   286  C  CA    . VAL A 1 40  ? 3.415   -9.668  -44.845 1.00 43.13  ? 40   VAL A CA    1 
ATOM   287  C  C     . VAL A 1 40  ? 3.323   -8.147  -45.064 1.00 42.29  ? 40   VAL A C     1 
ATOM   288  O  O     . VAL A 1 40  ? 2.390   -7.677  -45.718 1.00 42.57  ? 40   VAL A O     1 
ATOM   289  C  CB    . VAL A 1 40  ? 3.974   -10.439 -46.091 1.00 43.07  ? 40   VAL A CB    1 
ATOM   290  C  CG1   . VAL A 1 40  ? 3.275   -10.045 -47.397 1.00 42.84  ? 40   VAL A CG1   1 
ATOM   291  C  CG2   . VAL A 1 40  ? 5.461   -10.271 -46.200 1.00 43.31  ? 40   VAL A CG2   1 
ATOM   292  N  N     . PRO A 1 41  ? 4.270   -7.372  -44.505 1.00 41.27  ? 41   PRO A N     1 
ATOM   293  C  CA    . PRO A 1 41  ? 4.213   -5.910  -44.438 1.00 40.59  ? 41   PRO A CA    1 
ATOM   294  C  C     . PRO A 1 41  ? 3.542   -5.191  -45.614 1.00 40.07  ? 41   PRO A C     1 
ATOM   295  O  O     . PRO A 1 41  ? 3.343   -5.768  -46.686 1.00 40.02  ? 41   PRO A O     1 
ATOM   296  C  CB    . PRO A 1 41  ? 5.681   -5.526  -44.377 1.00 40.52  ? 41   PRO A CB    1 
ATOM   297  C  CG    . PRO A 1 41  ? 6.300   -6.625  -43.622 1.00 40.97  ? 41   PRO A CG    1 
ATOM   298  C  CD    . PRO A 1 41  ? 5.526   -7.876  -43.924 1.00 41.23  ? 41   PRO A CD    1 
ATOM   299  N  N     . THR A 1 42  ? 3.207   -3.925  -45.410 1.00 39.42  ? 42   THR A N     1 
ATOM   300  C  CA    . THR A 1 42  ? 2.489   -3.185  -46.424 1.00 38.89  ? 42   THR A CA    1 
ATOM   301  C  C     . THR A 1 42  ? 3.424   -2.815  -47.554 1.00 38.61  ? 42   THR A C     1 
ATOM   302  O  O     . THR A 1 42  ? 4.621   -2.657  -47.338 1.00 38.56  ? 42   THR A O     1 
ATOM   303  C  CB    . THR A 1 42  ? 1.868   -1.893  -45.866 1.00 38.96  ? 42   THR A CB    1 
ATOM   304  O  OG1   . THR A 1 42  ? 1.702   -2.007  -44.451 1.00 38.03  ? 42   THR A OG1   1 
ATOM   305  C  CG2   . THR A 1 42  ? 0.501   -1.593  -46.556 1.00 39.11  ? 42   THR A CG2   1 
ATOM   306  N  N     . VAL A 1 43  ? 2.866   -2.691  -48.756 1.00 38.24  ? 43   VAL A N     1 
ATOM   307  C  CA    . VAL A 1 43  ? 3.537   -2.024  -49.863 1.00 37.95  ? 43   VAL A CA    1 
ATOM   308  C  C     . VAL A 1 43  ? 4.189   -0.739  -49.328 1.00 37.68  ? 43   VAL A C     1 
ATOM   309  O  O     . VAL A 1 43  ? 5.378   -0.516  -49.537 1.00 37.57  ? 43   VAL A O     1 
ATOM   310  C  CB    . VAL A 1 43  ? 2.536   -1.747  -51.036 1.00 38.13  ? 43   VAL A CB    1 
ATOM   311  C  CG1   . VAL A 1 43  ? 1.341   -0.896  -50.564 1.00 38.64  ? 43   VAL A CG1   1 
ATOM   312  C  CG2   . VAL A 1 43  ? 3.230   -1.133  -52.271 1.00 37.91  ? 43   VAL A CG2   1 
ATOM   313  N  N     . LYS A 1 44  ? 3.408   0.066   -48.598 1.00 37.53  ? 44   LYS A N     1 
ATOM   314  C  CA    . LYS A 1 44  ? 3.880   1.284   -47.913 1.00 37.32  ? 44   LYS A CA    1 
ATOM   315  C  C     . LYS A 1 44  ? 5.127   1.048   -47.071 1.00 37.22  ? 44   LYS A C     1 
ATOM   316  O  O     . LYS A 1 44  ? 6.016   1.893   -47.027 1.00 37.36  ? 44   LYS A O     1 
ATOM   317  C  CB    . LYS A 1 44  ? 2.769   1.883   -47.037 1.00 37.22  ? 44   LYS A CB    1 
ATOM   318  C  CG    . LYS A 1 44  ? 3.171   3.095   -46.165 1.00 37.21  ? 44   LYS A CG    1 
ATOM   319  C  CD    . LYS A 1 44  ? 2.923   4.470   -46.837 1.00 36.70  ? 44   LYS A CD    1 
ATOM   320  C  CE    . LYS A 1 44  ? 4.211   5.152   -47.293 1.00 35.86  ? 44   LYS A CE    1 
ATOM   321  N  NZ    . LYS A 1 44  ? 4.012   6.599   -47.571 1.00 35.30  ? 44   LYS A NZ    1 
ATOM   322  N  N     . THR A 1 45  ? 5.195   -0.098  -46.406 1.00 37.10  ? 45   THR A N     1 
ATOM   323  C  CA    . THR A 1 45  ? 6.383   -0.435  -45.640 1.00 36.98  ? 45   THR A CA    1 
ATOM   324  C  C     . THR A 1 45  ? 7.554   -0.827  -46.547 1.00 37.08  ? 45   THR A C     1 
ATOM   325  O  O     . THR A 1 45  ? 8.714   -0.689  -46.162 1.00 37.28  ? 45   THR A O     1 
ATOM   326  C  CB    . THR A 1 45  ? 6.083   -1.482  -44.537 1.00 36.90  ? 45   THR A CB    1 
ATOM   327  O  OG1   . THR A 1 45  ? 5.884   -0.801  -43.289 1.00 36.44  ? 45   THR A OG1   1 
ATOM   328  C  CG2   . THR A 1 45  ? 7.230   -2.461  -44.383 1.00 36.54  ? 45   THR A CG2   1 
ATOM   329  N  N     . CYS A 1 46  ? 7.258   -1.288  -47.755 1.00 37.19  ? 46   CYS A N     1 
ATOM   330  C  CA    . CYS A 1 46  ? 8.313   -1.605  -48.701 1.00 37.47  ? 46   CYS A CA    1 
ATOM   331  C  C     . CYS A 1 46  ? 8.875   -0.334  -49.294 1.00 38.19  ? 46   CYS A C     1 
ATOM   332  O  O     . CYS A 1 46  ? 10.093  -0.145  -49.310 1.00 38.42  ? 46   CYS A O     1 
ATOM   333  C  CB    . CYS A 1 46  ? 7.793   -2.501  -49.800 1.00 37.31  ? 46   CYS A CB    1 
ATOM   334  S  SG    . CYS A 1 46  ? 7.508   -4.134  -49.237 1.00 36.33  ? 46   CYS A SG    1 
ATOM   335  N  N     . GLU A 1 47  ? 7.979   0.531   -49.772 1.00 38.80  ? 47   GLU A N     1 
ATOM   336  C  CA    . GLU A 1 47  ? 8.338   1.855   -50.277 1.00 39.52  ? 47   GLU A CA    1 
ATOM   337  C  C     . GLU A 1 47  ? 9.209   2.587   -49.264 1.00 40.40  ? 47   GLU A C     1 
ATOM   338  O  O     . GLU A 1 47  ? 10.145  3.305   -49.632 1.00 40.54  ? 47   GLU A O     1 
ATOM   339  C  CB    . GLU A 1 47  ? 7.077   2.670   -50.562 1.00 39.15  ? 47   GLU A CB    1 
ATOM   340  C  CG    . GLU A 1 47  ? 6.121   1.988   -51.518 1.00 38.93  ? 47   GLU A CG    1 
ATOM   341  C  CD    . GLU A 1 47  ? 4.760   2.639   -51.569 1.00 38.83  ? 47   GLU A CD    1 
ATOM   342  O  OE1   . GLU A 1 47  ? 4.556   3.619   -50.812 1.00 38.94  ? 47   GLU A OE1   1 
ATOM   343  O  OE2   . GLU A 1 47  ? 3.901   2.167   -52.365 1.00 38.02  ? 47   GLU A OE2   1 
ATOM   344  N  N     . ARG A 1 48  ? 8.889   2.373   -47.989 1.00 41.48  ? 48   ARG A N     1 
ATOM   345  C  CA    . ARG A 1 48  ? 9.576   2.975   -46.859 1.00 42.74  ? 48   ARG A CA    1 
ATOM   346  C  C     . ARG A 1 48  ? 11.021  2.529   -46.865 1.00 43.85  ? 48   ARG A C     1 
ATOM   347  O  O     . ARG A 1 48  ? 11.938  3.345   -46.930 1.00 43.87  ? 48   ARG A O     1 
ATOM   348  C  CB    . ARG A 1 48  ? 8.900   2.519   -45.558 1.00 42.72  ? 48   ARG A CB    1 
ATOM   349  C  CG    . ARG A 1 48  ? 8.703   3.595   -44.500 1.00 41.75  ? 48   ARG A CG    1 
ATOM   350  C  CD    . ARG A 1 48  ? 7.350   3.430   -43.797 1.00 39.42  ? 48   ARG A CD    1 
ATOM   351  N  NE    . ARG A 1 48  ? 6.615   4.696   -43.803 1.00 37.85  ? 48   ARG A NE    1 
ATOM   352  C  CZ    . ARG A 1 48  ? 5.395   4.866   -43.314 1.00 36.39  ? 48   ARG A CZ    1 
ATOM   353  N  NH1   . ARG A 1 48  ? 4.753   3.850   -42.764 1.00 35.73  ? 48   ARG A NH1   1 
ATOM   354  N  NH2   . ARG A 1 48  ? 4.822   6.058   -43.383 1.00 35.88  ? 48   ARG A NH2   1 
ATOM   355  N  N     . TRP A 1 49  ? 11.201  1.219   -46.807 1.00 45.39  ? 49   TRP A N     1 
ATOM   356  C  CA    . TRP A 1 49  ? 12.506  0.615   -46.815 1.00 47.32  ? 49   TRP A CA    1 
ATOM   357  C  C     . TRP A 1 49  ? 13.293  1.015   -48.048 1.00 48.68  ? 49   TRP A C     1 
ATOM   358  O  O     . TRP A 1 49  ? 14.498  1.255   -47.971 1.00 48.94  ? 49   TRP A O     1 
ATOM   359  C  CB    . TRP A 1 49  ? 12.363  -0.894  -46.779 1.00 47.38  ? 49   TRP A CB    1 
ATOM   360  C  CG    . TRP A 1 49  ? 12.299  -1.464  -45.420 1.00 48.05  ? 49   TRP A CG    1 
ATOM   361  C  CD1   . TRP A 1 49  ? 11.329  -2.289  -44.918 1.00 48.37  ? 49   TRP A CD1   1 
ATOM   362  C  CD2   . TRP A 1 49  ? 13.255  -1.276  -44.372 1.00 49.12  ? 49   TRP A CD2   1 
ATOM   363  N  NE1   . TRP A 1 49  ? 11.623  -2.627  -43.615 1.00 49.17  ? 49   TRP A NE1   1 
ATOM   364  C  CE2   . TRP A 1 49  ? 12.800  -2.020  -43.254 1.00 49.56  ? 49   TRP A CE2   1 
ATOM   365  C  CE3   . TRP A 1 49  ? 14.457  -0.553  -44.266 1.00 49.21  ? 49   TRP A CE3   1 
ATOM   366  C  CZ2   . TRP A 1 49  ? 13.506  -2.061  -42.041 1.00 50.02  ? 49   TRP A CZ2   1 
ATOM   367  C  CZ3   . TRP A 1 49  ? 15.158  -0.592  -43.063 1.00 49.71  ? 49   TRP A CZ3   1 
ATOM   368  C  CH2   . TRP A 1 49  ? 14.678  -1.342  -41.964 1.00 50.23  ? 49   TRP A CH2   1 
ATOM   369  N  N     . PHE A 1 50  ? 12.612  1.088   -49.187 1.00 50.50  ? 50   PHE A N     1 
ATOM   370  C  CA    . PHE A 1 50  ? 13.268  1.455   -50.436 1.00 52.37  ? 50   PHE A CA    1 
ATOM   371  C  C     . PHE A 1 50  ? 14.025  2.765   -50.323 1.00 53.85  ? 50   PHE A C     1 
ATOM   372  O  O     . PHE A 1 50  ? 15.226  2.806   -50.581 1.00 54.13  ? 50   PHE A O     1 
ATOM   373  C  CB    . PHE A 1 50  ? 12.291  1.443   -51.615 1.00 52.12  ? 50   PHE A CB    1 
ATOM   374  C  CG    . PHE A 1 50  ? 12.361  0.178   -52.434 1.00 52.21  ? 50   PHE A CG    1 
ATOM   375  C  CD1   . PHE A 1 50  ? 12.671  -1.046  -51.831 1.00 51.51  ? 50   PHE A CD1   1 
ATOM   376  C  CD2   . PHE A 1 50  ? 12.118  0.204   -53.807 1.00 52.38  ? 50   PHE A CD2   1 
ATOM   377  C  CE1   . PHE A 1 50  ? 12.746  -2.216  -52.581 1.00 51.30  ? 50   PHE A CE1   1 
ATOM   378  C  CE2   . PHE A 1 50  ? 12.189  -0.966  -54.564 1.00 51.98  ? 50   PHE A CE2   1 
ATOM   379  C  CZ    . PHE A 1 50  ? 12.501  -2.177  -53.949 1.00 51.37  ? 50   PHE A CZ    1 
ATOM   380  N  N     . GLN A 1 51  ? 13.340  3.819   -49.892 1.00 55.75  ? 51   GLN A N     1 
ATOM   381  C  CA    . GLN A 1 51  ? 13.998  5.097   -49.648 1.00 57.63  ? 51   GLN A CA    1 
ATOM   382  C  C     . GLN A 1 51  ? 15.289  4.935   -48.834 1.00 58.73  ? 51   GLN A C     1 
ATOM   383  O  O     . GLN A 1 51  ? 16.307  5.529   -49.187 1.00 59.13  ? 51   GLN A O     1 
ATOM   384  C  CB    . GLN A 1 51  ? 13.045  6.084   -48.977 1.00 57.75  ? 51   GLN A CB    1 
ATOM   385  C  CG    . GLN A 1 51  ? 11.999  6.684   -49.922 1.00 58.75  ? 51   GLN A CG    1 
ATOM   386  C  CD    . GLN A 1 51  ? 10.897  7.464   -49.197 1.00 59.71  ? 51   GLN A CD    1 
ATOM   387  O  OE1   . GLN A 1 51  ? 9.794   7.642   -49.725 1.00 60.21  ? 51   GLN A OE1   1 
ATOM   388  N  NE2   . GLN A 1 51  ? 11.193  7.931   -47.986 1.00 59.57  ? 51   GLN A NE2   1 
ATOM   389  N  N     . ARG A 1 52  ? 15.257  4.120   -47.775 1.00 59.98  ? 52   ARG A N     1 
ATOM   390  C  CA    . ARG A 1 52  ? 16.455  3.863   -46.959 1.00 61.39  ? 52   ARG A CA    1 
ATOM   391  C  C     . ARG A 1 52  ? 17.547  3.121   -47.718 1.00 61.87  ? 52   ARG A C     1 
ATOM   392  O  O     . ARG A 1 52  ? 18.733  3.296   -47.443 1.00 61.90  ? 52   ARG A O     1 
ATOM   393  C  CB    . ARG A 1 52  ? 16.117  3.110   -45.663 1.00 61.68  ? 52   ARG A CB    1 
ATOM   394  C  CG    . ARG A 1 52  ? 16.190  3.967   -44.394 1.00 63.74  ? 52   ARG A CG    1 
ATOM   395  C  CD    . ARG A 1 52  ? 15.469  3.312   -43.202 1.00 67.45  ? 52   ARG A CD    1 
ATOM   396  N  NE    . ARG A 1 52  ? 14.449  4.212   -42.642 1.00 69.93  ? 52   ARG A NE    1 
ATOM   397  C  CZ    . ARG A 1 52  ? 13.456  3.852   -41.824 1.00 70.89  ? 52   ARG A CZ    1 
ATOM   398  N  NH1   . ARG A 1 52  ? 13.317  2.588   -41.426 1.00 71.47  ? 52   ARG A NH1   1 
ATOM   399  N  NH2   . ARG A 1 52  ? 12.590  4.767   -41.402 1.00 71.14  ? 52   ARG A NH2   1 
ATOM   400  N  N     . PHE A 1 53  ? 17.153  2.292   -48.671 1.00 62.72  ? 53   PHE A N     1 
ATOM   401  C  CA    . PHE A 1 53  ? 18.138  1.569   -49.436 1.00 63.93  ? 53   PHE A CA    1 
ATOM   402  C  C     . PHE A 1 53  ? 18.900  2.477   -50.384 1.00 65.03  ? 53   PHE A C     1 
ATOM   403  O  O     . PHE A 1 53  ? 20.089  2.276   -50.598 1.00 65.32  ? 53   PHE A O     1 
ATOM   404  C  CB    . PHE A 1 53  ? 17.499  0.418   -50.190 1.00 63.77  ? 53   PHE A CB    1 
ATOM   405  C  CG    . PHE A 1 53  ? 16.982  -0.657  -49.300 1.00 63.98  ? 53   PHE A CG    1 
ATOM   406  C  CD1   . PHE A 1 53  ? 17.796  -1.217  -48.324 1.00 64.50  ? 53   PHE A CD1   1 
ATOM   407  C  CD2   . PHE A 1 53  ? 15.684  -1.121  -49.435 1.00 64.15  ? 53   PHE A CD2   1 
ATOM   408  C  CE1   . PHE A 1 53  ? 17.315  -2.218  -47.489 1.00 64.53  ? 53   PHE A CE1   1 
ATOM   409  C  CE2   . PHE A 1 53  ? 15.194  -2.124  -48.605 1.00 64.00  ? 53   PHE A CE2   1 
ATOM   410  C  CZ    . PHE A 1 53  ? 16.009  -2.674  -47.633 1.00 64.07  ? 53   PHE A CZ    1 
ATOM   411  N  N     . LYS A 1 54  ? 18.226  3.483   -50.935 1.00 66.35  ? 54   LYS A N     1 
ATOM   412  C  CA    . LYS A 1 54  ? 18.855  4.395   -51.893 1.00 67.66  ? 54   LYS A CA    1 
ATOM   413  C  C     . LYS A 1 54  ? 19.863  5.329   -51.222 1.00 68.83  ? 54   LYS A C     1 
ATOM   414  O  O     . LYS A 1 54  ? 20.638  6.000   -51.900 1.00 68.79  ? 54   LYS A O     1 
ATOM   415  C  CB    . LYS A 1 54  ? 17.799  5.178   -52.665 1.00 67.57  ? 54   LYS A CB    1 
ATOM   416  C  CG    . LYS A 1 54  ? 16.794  4.294   -53.383 1.00 67.66  ? 54   LYS A CG    1 
ATOM   417  C  CD    . LYS A 1 54  ? 15.642  5.107   -53.949 1.00 68.26  ? 54   LYS A CD    1 
ATOM   418  C  CE    . LYS A 1 54  ? 14.576  4.203   -54.554 1.00 68.51  ? 54   LYS A CE    1 
ATOM   419  N  NZ    . LYS A 1 54  ? 13.553  4.961   -55.335 1.00 68.79  ? 54   LYS A NZ    1 
ATOM   420  N  N     . SER A 1 55  ? 19.825  5.376   -49.890 1.00 70.55  ? 55   SER A N     1 
ATOM   421  C  CA    . SER A 1 55  ? 20.916  5.932   -49.083 1.00 72.26  ? 55   SER A CA    1 
ATOM   422  C  C     . SER A 1 55  ? 21.957  4.836   -48.866 1.00 73.50  ? 55   SER A C     1 
ATOM   423  O  O     . SER A 1 55  ? 23.161  5.103   -48.858 1.00 73.61  ? 55   SER A O     1 
ATOM   424  C  CB    . SER A 1 55  ? 20.415  6.418   -47.718 1.00 72.16  ? 55   SER A CB    1 
ATOM   425  O  OG    . SER A 1 55  ? 19.420  7.417   -47.844 1.00 72.42  ? 55   SER A OG    1 
ATOM   426  N  N     . GLY A 1 56  ? 21.471  3.606   -48.689 1.00 74.96  ? 56   GLY A N     1 
ATOM   427  C  CA    . GLY A 1 56  ? 22.317  2.435   -48.493 1.00 76.67  ? 56   GLY A CA    1 
ATOM   428  C  C     . GLY A 1 56  ? 22.460  2.132   -47.023 1.00 78.03  ? 56   GLY A C     1 
ATOM   429  O  O     . GLY A 1 56  ? 22.780  3.026   -46.238 1.00 78.07  ? 56   GLY A O     1 
ATOM   430  N  N     . ASP A 1 57  ? 22.195  0.878   -46.650 1.00 79.53  ? 57   ASP A N     1 
ATOM   431  C  CA    . ASP A 1 57  ? 22.441  0.389   -45.283 1.00 81.03  ? 57   ASP A CA    1 
ATOM   432  C  C     . ASP A 1 57  ? 22.032  -1.060  -45.058 1.00 81.83  ? 57   ASP A C     1 
ATOM   433  O  O     . ASP A 1 57  ? 21.273  -1.650  -45.842 1.00 81.80  ? 57   ASP A O     1 
ATOM   434  C  CB    . ASP A 1 57  ? 21.740  1.267   -44.226 1.00 81.11  ? 57   ASP A CB    1 
ATOM   435  C  CG    . ASP A 1 57  ? 20.227  1.082   -44.214 1.00 81.63  ? 57   ASP A CG    1 
ATOM   436  O  OD1   . ASP A 1 57  ? 19.754  -0.023  -43.860 1.00 81.88  ? 57   ASP A OD1   1 
ATOM   437  O  OD2   . ASP A 1 57  ? 19.509  2.051   -44.549 1.00 82.47  ? 57   ASP A OD2   1 
ATOM   438  N  N     . PHE A 1 58  ? 22.570  -1.611  -43.971 1.00 82.96  ? 58   PHE A N     1 
ATOM   439  C  CA    . PHE A 1 58  ? 22.003  -2.761  -43.284 1.00 84.08  ? 58   PHE A CA    1 
ATOM   440  C  C     . PHE A 1 58  ? 21.398  -2.152  -42.022 1.00 84.26  ? 58   PHE A C     1 
ATOM   441  O  O     . PHE A 1 58  ? 22.121  -1.852  -41.068 1.00 84.50  ? 58   PHE A O     1 
ATOM   442  C  CB    . PHE A 1 58  ? 23.080  -3.789  -42.870 1.00 84.44  ? 58   PHE A CB    1 
ATOM   443  C  CG    . PHE A 1 58  ? 24.148  -4.045  -43.917 1.00 86.07  ? 58   PHE A CG    1 
ATOM   444  C  CD1   . PHE A 1 58  ? 24.084  -5.179  -44.738 1.00 87.34  ? 58   PHE A CD1   1 
ATOM   445  C  CD2   . PHE A 1 58  ? 25.237  -3.171  -44.062 1.00 87.01  ? 58   PHE A CD2   1 
ATOM   446  C  CE1   . PHE A 1 58  ? 25.078  -5.426  -45.703 1.00 87.89  ? 58   PHE A CE1   1 
ATOM   447  C  CE2   . PHE A 1 58  ? 26.235  -3.407  -45.023 1.00 87.39  ? 58   PHE A CE2   1 
ATOM   448  C  CZ    . PHE A 1 58  ? 26.155  -4.536  -45.843 1.00 87.86  ? 58   PHE A CZ    1 
ATOM   449  N  N     . ASP A 1 59  ? 20.088  -1.941  -42.010 1.00 84.43  ? 59   ASP A N     1 
ATOM   450  C  CA    . ASP A 1 59  ? 19.428  -1.533  -40.779 1.00 84.78  ? 59   ASP A CA    1 
ATOM   451  C  C     . ASP A 1 59  ? 19.291  -2.758  -39.864 1.00 84.67  ? 59   ASP A C     1 
ATOM   452  O  O     . ASP A 1 59  ? 18.178  -3.242  -39.634 1.00 84.70  ? 59   ASP A O     1 
ATOM   453  C  CB    . ASP A 1 59  ? 18.055  -0.912  -41.071 1.00 85.22  ? 59   ASP A CB    1 
ATOM   454  C  CG    . ASP A 1 59  ? 18.001  0.601   -40.794 1.00 86.27  ? 59   ASP A CG    1 
ATOM   455  O  OD1   . ASP A 1 59  ? 18.044  1.401   -41.774 1.00 87.04  ? 59   ASP A OD1   1 
ATOM   456  O  OD2   . ASP A 1 59  ? 17.883  0.986   -39.592 1.00 87.22  ? 59   ASP A OD2   1 
ATOM   457  N  N     . VAL A 1 60  ? 20.423  -3.255  -39.347 1.00 84.57  ? 60   VAL A N     1 
ATOM   458  C  CA    . VAL A 1 60  ? 20.440  -4.445  -38.463 1.00 84.28  ? 60   VAL A CA    1 
ATOM   459  C  C     . VAL A 1 60  ? 19.419  -4.323  -37.319 1.00 84.17  ? 60   VAL A C     1 
ATOM   460  O  O     . VAL A 1 60  ? 18.689  -5.272  -37.010 1.00 84.17  ? 60   VAL A O     1 
ATOM   461  C  CB    . VAL A 1 60  ? 21.882  -4.827  -37.927 1.00 84.27  ? 60   VAL A CB    1 
ATOM   462  C  CG1   . VAL A 1 60  ? 22.822  -5.200  -39.087 1.00 84.22  ? 60   VAL A CG1   1 
ATOM   463  C  CG2   . VAL A 1 60  ? 22.494  -3.732  -37.027 1.00 83.77  ? 60   VAL A CG2   1 
ATOM   464  N  N     . ASP A 1 61  ? 19.358  -3.130  -36.729 1.00 83.91  ? 61   ASP A N     1 
ATOM   465  C  CA    . ASP A 1 61  ? 18.396  -2.816  -35.685 1.00 83.44  ? 61   ASP A CA    1 
ATOM   466  C  C     . ASP A 1 61  ? 17.562  -1.594  -36.026 1.00 82.66  ? 61   ASP A C     1 
ATOM   467  O  O     . ASP A 1 61  ? 17.926  -0.770  -36.875 1.00 82.40  ? 61   ASP A O     1 
ATOM   468  C  CB    . ASP A 1 61  ? 19.114  -2.560  -34.348 1.00 83.89  ? 61   ASP A CB    1 
ATOM   469  C  CG    . ASP A 1 61  ? 19.278  -3.824  -33.506 1.00 84.74  ? 61   ASP A CG    1 
ATOM   470  O  OD1   . ASP A 1 61  ? 20.033  -4.732  -33.935 1.00 85.74  ? 61   ASP A OD1   1 
ATOM   471  O  OD2   . ASP A 1 61  ? 18.669  -3.893  -32.405 1.00 85.04  ? 61   ASP A OD2   1 
ATOM   472  N  N     . ASP A 1 62  ? 16.432  -1.499  -35.338 1.00 81.88  ? 62   ASP A N     1 
ATOM   473  C  CA    . ASP A 1 62  ? 15.715  -0.252  -35.197 1.00 81.18  ? 62   ASP A CA    1 
ATOM   474  C  C     . ASP A 1 62  ? 16.618  0.651   -34.368 1.00 80.49  ? 62   ASP A C     1 
ATOM   475  O  O     . ASP A 1 62  ? 17.386  0.158   -33.530 1.00 80.36  ? 62   ASP A O     1 
ATOM   476  C  CB    . ASP A 1 62  ? 14.404  -0.467  -34.425 1.00 81.40  ? 62   ASP A CB    1 
ATOM   477  C  CG    . ASP A 1 62  ? 13.620  -1.704  -34.883 1.00 81.74  ? 62   ASP A CG    1 
ATOM   478  O  OD1   . ASP A 1 62  ? 13.934  -2.265  -35.954 1.00 82.78  ? 62   ASP A OD1   1 
ATOM   479  O  OD2   . ASP A 1 62  ? 12.677  -2.112  -34.162 1.00 81.54  ? 62   ASP A OD2   1 
ATOM   480  N  N     . LYS A 1 63  ? 16.539  1.962   -34.592 1.00 79.58  ? 63   LYS A N     1 
ATOM   481  C  CA    . LYS A 1 63  ? 17.152  2.905   -33.656 1.00 78.71  ? 63   LYS A CA    1 
ATOM   482  C  C     . LYS A 1 63  ? 16.354  2.881   -32.344 1.00 77.66  ? 63   LYS A C     1 
ATOM   483  O  O     . LYS A 1 63  ? 15.157  2.572   -32.336 1.00 77.55  ? 63   LYS A O     1 
ATOM   484  C  CB    . LYS A 1 63  ? 17.261  4.322   -34.243 1.00 78.95  ? 63   LYS A CB    1 
ATOM   485  C  CG    . LYS A 1 63  ? 18.143  5.270   -33.400 1.00 79.89  ? 63   LYS A CG    1 
ATOM   486  C  CD    . LYS A 1 63  ? 18.639  6.488   -34.188 1.00 81.36  ? 63   LYS A CD    1 
ATOM   487  C  CE    . LYS A 1 63  ? 19.944  6.205   -34.940 1.00 81.60  ? 63   LYS A CE    1 
ATOM   488  N  NZ    . LYS A 1 63  ? 20.604  7.463   -35.394 1.00 81.28  ? 63   LYS A NZ    1 
ATOM   489  N  N     . GLU A 1 64  ? 17.028  3.174   -31.237 1.00 76.32  ? 64   GLU A N     1 
ATOM   490  C  CA    . GLU A 1 64  ? 16.419  3.084   -29.920 1.00 75.00  ? 64   GLU A CA    1 
ATOM   491  C  C     . GLU A 1 64  ? 15.031  3.737   -29.947 1.00 73.71  ? 64   GLU A C     1 
ATOM   492  O  O     . GLU A 1 64  ? 14.886  4.883   -30.377 1.00 73.44  ? 64   GLU A O     1 
ATOM   493  C  CB    . GLU A 1 64  ? 17.334  3.751   -28.880 1.00 75.38  ? 64   GLU A CB    1 
ATOM   494  C  CG    . GLU A 1 64  ? 17.380  3.080   -27.493 1.00 75.93  ? 64   GLU A CG    1 
ATOM   495  C  CD    . GLU A 1 64  ? 18.140  3.905   -26.436 1.00 76.38  ? 64   GLU A CD    1 
ATOM   496  O  OE1   . GLU A 1 64  ? 18.741  3.293   -25.521 1.00 76.88  ? 64   GLU A OE1   1 
ATOM   497  O  OE2   . GLU A 1 64  ? 18.130  5.157   -26.512 1.00 76.06  ? 64   GLU A OE2   1 
ATOM   498  N  N     . HIS A 1 65  ? 14.018  2.983   -29.522 1.00 72.21  ? 65   HIS A N     1 
ATOM   499  C  CA    . HIS A 1 65  ? 12.642  3.476   -29.408 1.00 70.67  ? 65   HIS A CA    1 
ATOM   500  C  C     . HIS A 1 65  ? 12.519  4.618   -28.402 1.00 69.52  ? 65   HIS A C     1 
ATOM   501  O  O     . HIS A 1 65  ? 13.512  5.145   -27.902 1.00 69.32  ? 65   HIS A O     1 
ATOM   502  C  CB    . HIS A 1 65  ? 11.702  2.345   -28.972 1.00 70.76  ? 65   HIS A CB    1 
ATOM   503  C  CG    . HIS A 1 65  ? 11.433  1.328   -30.035 1.00 70.80  ? 65   HIS A CG    1 
ATOM   504  N  ND1   . HIS A 1 65  ? 11.833  0.014   -29.924 1.00 70.93  ? 65   HIS A ND1   1 
ATOM   505  C  CD2   . HIS A 1 65  ? 10.794  1.428   -31.225 1.00 70.98  ? 65   HIS A CD2   1 
ATOM   506  C  CE1   . HIS A 1 65  ? 11.457  -0.651  -31.003 1.00 71.07  ? 65   HIS A CE1   1 
ATOM   507  N  NE2   . HIS A 1 65  ? 10.823  0.184   -31.807 1.00 71.11  ? 65   HIS A NE2   1 
ATOM   508  N  N     . GLY A 1 66  ? 11.282  4.995   -28.107 1.00 68.21  ? 66   GLY A N     1 
ATOM   509  C  CA    . GLY A 1 66  ? 11.011  5.959   -27.059 1.00 66.46  ? 66   GLY A CA    1 
ATOM   510  C  C     . GLY A 1 66  ? 11.152  5.277   -25.720 1.00 65.28  ? 66   GLY A C     1 
ATOM   511  O  O     . GLY A 1 66  ? 10.977  4.058   -25.610 1.00 65.05  ? 66   GLY A O     1 
ATOM   512  N  N     . LYS A 1 67  ? 11.465  6.080   -24.705 1.00 64.15  ? 67   LYS A N     1 
ATOM   513  C  CA    . LYS A 1 67  ? 11.753  5.597   -23.359 1.00 62.72  ? 67   LYS A CA    1 
ATOM   514  C  C     . LYS A 1 67  ? 11.440  6.680   -22.328 1.00 61.77  ? 67   LYS A C     1 
ATOM   515  O  O     . LYS A 1 67  ? 11.564  7.872   -22.627 1.00 61.40  ? 67   LYS A O     1 
ATOM   516  C  CB    . LYS A 1 67  ? 13.226  5.170   -23.260 1.00 62.68  ? 67   LYS A CB    1 
ATOM   517  C  CG    . LYS A 1 67  ? 14.232  6.316   -23.293 1.00 62.39  ? 67   LYS A CG    1 
ATOM   518  C  CD    . LYS A 1 67  ? 15.570  5.902   -23.870 1.00 62.00  ? 67   LYS A CD    1 
ATOM   519  C  CE    . LYS A 1 67  ? 16.580  7.023   -23.714 1.00 62.70  ? 67   LYS A CE    1 
ATOM   520  N  NZ    . LYS A 1 67  ? 17.779  6.826   -24.577 1.00 63.53  ? 67   LYS A NZ    1 
ATOM   521  N  N     . PRO A 1 68  ? 11.025  6.267   -21.113 1.00 61.04  ? 68   PRO A N     1 
ATOM   522  C  CA    . PRO A 1 68  ? 10.826  7.188   -19.989 1.00 60.73  ? 68   PRO A CA    1 
ATOM   523  C  C     . PRO A 1 68  ? 12.041  8.083   -19.746 1.00 60.51  ? 68   PRO A C     1 
ATOM   524  O  O     . PRO A 1 68  ? 13.174  7.671   -19.994 1.00 60.82  ? 68   PRO A O     1 
ATOM   525  C  CB    . PRO A 1 68  ? 10.631  6.249   -18.805 1.00 60.50  ? 68   PRO A CB    1 
ATOM   526  C  CG    . PRO A 1 68  ? 10.042  5.037   -19.398 1.00 60.48  ? 68   PRO A CG    1 
ATOM   527  C  CD    . PRO A 1 68  ? 10.571  4.905   -20.788 1.00 60.72  ? 68   PRO A CD    1 
ATOM   528  N  N     . PRO A 1 69  ? 11.819  9.316   -19.280 1.00 60.20  ? 69   PRO A N     1 
ATOM   529  C  CA    . PRO A 1 69  ? 13.005  10.098  -18.977 1.00 59.98  ? 69   PRO A CA    1 
ATOM   530  C  C     . PRO A 1 69  ? 13.479  9.714   -17.586 1.00 59.74  ? 69   PRO A C     1 
ATOM   531  O  O     . PRO A 1 69  ? 12.656  9.414   -16.721 1.00 59.91  ? 69   PRO A O     1 
ATOM   532  C  CB    . PRO A 1 69  ? 12.500  11.547  -19.007 1.00 59.99  ? 69   PRO A CB    1 
ATOM   533  C  CG    . PRO A 1 69  ? 10.981  11.467  -19.121 1.00 60.13  ? 69   PRO A CG    1 
ATOM   534  C  CD    . PRO A 1 69  ? 10.583  10.034  -18.937 1.00 60.14  ? 69   PRO A CD    1 
ATOM   535  N  N     . LYS A 1 70  ? 14.788  9.693   -17.377 1.00 59.23  ? 70   LYS A N     1 
ATOM   536  C  CA    . LYS A 1 70  ? 15.339  9.343   -16.074 1.00 58.76  ? 70   LYS A CA    1 
ATOM   537  C  C     . LYS A 1 70  ? 14.848  10.335  -15.012 1.00 58.30  ? 70   LYS A C     1 
ATOM   538  O  O     . LYS A 1 70  ? 14.714  11.525  -15.295 1.00 58.15  ? 70   LYS A O     1 
ATOM   539  C  CB    . LYS A 1 70  ? 16.860  9.326   -16.155 1.00 58.83  ? 70   LYS A CB    1 
ATOM   540  C  CG    . LYS A 1 70  ? 17.381  8.801   -17.488 1.00 59.45  ? 70   LYS A CG    1 
ATOM   541  C  CD    . LYS A 1 70  ? 18.896  8.660   -17.500 1.00 60.72  ? 70   LYS A CD    1 
ATOM   542  C  CE    . LYS A 1 70  ? 19.332  7.308   -16.940 1.00 61.18  ? 70   LYS A CE    1 
ATOM   543  N  NZ    . LYS A 1 70  ? 20.812  7.221   -16.755 1.00 61.86  ? 70   LYS A NZ    1 
ATOM   544  N  N     . ARG A 1 71  ? 14.557  9.840   -13.810 1.00 57.79  ? 71   ARG A N     1 
ATOM   545  C  CA    . ARG A 1 71  ? 14.065  10.686  -12.718 1.00 57.51  ? 71   ARG A CA    1 
ATOM   546  C  C     . ARG A 1 71  ? 15.208  11.350  -11.972 1.00 57.38  ? 71   ARG A C     1 
ATOM   547  O  O     . ARG A 1 71  ? 15.045  12.415  -11.378 1.00 57.39  ? 71   ARG A O     1 
ATOM   548  C  CB    . ARG A 1 71  ? 13.222  9.875   -11.744 1.00 57.46  ? 71   ARG A CB    1 
ATOM   549  C  CG    . ARG A 1 71  ? 11.832  9.545   -12.252 1.00 57.95  ? 71   ARG A CG    1 
ATOM   550  C  CD    . ARG A 1 71  ? 11.415  8.150   -11.800 1.00 58.43  ? 71   ARG A CD    1 
ATOM   551  N  NE    . ARG A 1 71  ? 10.176  7.675   -12.424 1.00 58.23  ? 71   ARG A NE    1 
ATOM   552  C  CZ    . ARG A 1 71  ? 9.085   7.310   -11.753 1.00 57.91  ? 71   ARG A CZ    1 
ATOM   553  N  NH1   . ARG A 1 71  ? 9.061   7.350   -10.424 1.00 58.10  ? 71   ARG A NH1   1 
ATOM   554  N  NH2   . ARG A 1 71  ? 8.012   6.896   -12.411 1.00 57.54  ? 71   ARG A NH2   1 
ATOM   555  N  N     . TYR A 1 72  ? 16.359  10.694  -11.992 1.00 57.31  ? 72   TYR A N     1 
ATOM   556  C  CA    . TYR A 1 72  ? 17.606  11.259  -11.499 1.00 57.23  ? 72   TYR A CA    1 
ATOM   557  C  C     . TYR A 1 72  ? 18.663  10.678  -12.392 1.00 57.31  ? 72   TYR A C     1 
ATOM   558  O  O     . TYR A 1 72  ? 18.729  9.463   -12.573 1.00 57.23  ? 72   TYR A O     1 
ATOM   559  C  CB    . TYR A 1 72  ? 17.876  10.825  -10.057 1.00 57.22  ? 72   TYR A CB    1 
ATOM   560  C  CG    . TYR A 1 72  ? 18.100  9.340   -9.910  1.00 56.50  ? 72   TYR A CG    1 
ATOM   561  C  CD1   . TYR A 1 72  ? 19.373  8.803   -9.987  1.00 56.13  ? 72   TYR A CD1   1 
ATOM   562  C  CD2   . TYR A 1 72  ? 17.033  8.472   -9.719  1.00 56.51  ? 72   TYR A CD2   1 
ATOM   563  C  CE1   . TYR A 1 72  ? 19.580  7.447   -9.871  1.00 56.69  ? 72   TYR A CE1   1 
ATOM   564  C  CE2   . TYR A 1 72  ? 17.233  7.107   -9.602  1.00 56.88  ? 72   TYR A CE2   1 
ATOM   565  C  CZ    . TYR A 1 72  ? 18.510  6.602   -9.682  1.00 57.07  ? 72   TYR A CZ    1 
ATOM   566  O  OH    . TYR A 1 72  ? 18.724  5.247   -9.568  1.00 58.29  ? 72   TYR A OH    1 
ATOM   567  N  N     . GLU A 1 73  ? 19.487  11.520  -12.981 1.00 57.55  ? 73   GLU A N     1 
ATOM   568  C  CA    . GLU A 1 73  ? 20.549  10.964  -13.806 1.00 58.04  ? 73   GLU A CA    1 
ATOM   569  C  C     . GLU A 1 73  ? 21.777  10.660  -12.945 1.00 57.60  ? 73   GLU A C     1 
ATOM   570  O  O     . GLU A 1 73  ? 21.813  10.990  -11.751 1.00 57.30  ? 73   GLU A O     1 
ATOM   571  C  CB    . GLU A 1 73  ? 20.840  11.797  -15.090 1.00 58.59  ? 73   GLU A CB    1 
ATOM   572  C  CG    . GLU A 1 73  ? 20.483  13.289  -15.041 1.00 60.03  ? 73   GLU A CG    1 
ATOM   573  C  CD    . GLU A 1 73  ? 21.137  13.977  -13.854 1.00 62.48  ? 73   GLU A CD    1 
ATOM   574  O  OE1   . GLU A 1 73  ? 22.251  14.523  -14.032 1.00 63.48  ? 73   GLU A OE1   1 
ATOM   575  O  OE2   . GLU A 1 73  ? 20.555  13.931  -12.738 1.00 63.30  ? 73   GLU A OE2   1 
ATOM   576  N  N     . ASP A 1 74  ? 22.758  10.004  -13.553 1.00 57.30  ? 74   ASP A N     1 
ATOM   577  C  CA    . ASP A 1 74  ? 23.873  9.443   -12.814 1.00 57.17  ? 74   ASP A CA    1 
ATOM   578  C  C     . ASP A 1 74  ? 24.536  10.488  -11.935 1.00 56.75  ? 74   ASP A C     1 
ATOM   579  O  O     . ASP A 1 74  ? 24.424  10.429  -10.711 1.00 56.55  ? 74   ASP A O     1 
ATOM   580  C  CB    . ASP A 1 74  ? 24.874  8.771   -13.765 1.00 57.42  ? 74   ASP A CB    1 
ATOM   581  C  CG    . ASP A 1 74  ? 24.290  7.530   -14.460 1.00 58.29  ? 74   ASP A CG    1 
ATOM   582  O  OD1   . ASP A 1 74  ? 23.056  7.459   -14.681 1.00 58.97  ? 74   ASP A OD1   1 
ATOM   583  O  OD2   . ASP A 1 74  ? 25.075  6.623   -14.800 1.00 59.20  ? 74   ASP A OD2   1 
ATOM   584  N  N     . ALA A 1 75  ? 25.166  11.469  -12.573 1.00 56.43  ? 75   ALA A N     1 
ATOM   585  C  CA    . ALA A 1 75  ? 25.962  12.490  -11.891 1.00 56.00  ? 75   ALA A CA    1 
ATOM   586  C  C     . ALA A 1 75  ? 25.346  13.067  -10.611 1.00 55.67  ? 75   ALA A C     1 
ATOM   587  O  O     . ALA A 1 75  ? 26.059  13.697  -9.818  1.00 55.65  ? 75   ALA A O     1 
ATOM   588  C  CB    . ALA A 1 75  ? 26.310  13.606  -12.863 1.00 56.19  ? 75   ALA A CB    1 
ATOM   589  N  N     . GLU A 1 76  ? 24.041  12.845  -10.413 1.00 55.16  ? 76   GLU A N     1 
ATOM   590  C  CA    . GLU A 1 76  ? 23.324  13.310  -9.214  1.00 54.86  ? 76   GLU A CA    1 
ATOM   591  C  C     . GLU A 1 76  ? 23.548  12.417  -8.001  1.00 54.36  ? 76   GLU A C     1 
ATOM   592  O  O     . GLU A 1 76  ? 23.848  12.903  -6.902  1.00 54.36  ? 76   GLU A O     1 
ATOM   593  C  CB    . GLU A 1 76  ? 21.822  13.416  -9.477  1.00 55.07  ? 76   GLU A CB    1 
ATOM   594  C  CG    . GLU A 1 76  ? 21.014  13.874  -8.257  1.00 55.91  ? 76   GLU A CG    1 
ATOM   595  C  CD    . GLU A 1 76  ? 19.643  14.438  -8.619  1.00 57.45  ? 76   GLU A CD    1 
ATOM   596  O  OE1   . GLU A 1 76  ? 19.021  15.077  -7.738  1.00 57.48  ? 76   GLU A OE1   1 
ATOM   597  O  OE2   . GLU A 1 76  ? 19.189  14.250  -9.777  1.00 57.99  ? 76   GLU A OE2   1 
ATOM   598  N  N     . LEU A 1 77  ? 23.366  11.115  -8.215  1.00 53.65  ? 77   LEU A N     1 
ATOM   599  C  CA    . LEU A 1 77  ? 23.563  10.098  -7.190  1.00 52.67  ? 77   LEU A CA    1 
ATOM   600  C  C     . LEU A 1 77  ? 25.041  10.005  -6.870  1.00 52.64  ? 77   LEU A C     1 
ATOM   601  O  O     . LEU A 1 77  ? 25.416  9.839   -5.714  1.00 52.88  ? 77   LEU A O     1 
ATOM   602  C  CB    . LEU A 1 77  ? 23.015  8.764   -7.685  1.00 52.19  ? 77   LEU A CB    1 
ATOM   603  C  CG    . LEU A 1 77  ? 23.159  7.417   -6.989  1.00 50.63  ? 77   LEU A CG    1 
ATOM   604  C  CD1   . LEU A 1 77  ? 24.362  6.713   -7.525  1.00 50.31  ? 77   LEU A CD1   1 
ATOM   605  C  CD2   . LEU A 1 77  ? 23.215  7.512   -5.497  1.00 49.10  ? 77   LEU A CD2   1 
ATOM   606  N  N     . GLN A 1 78  ? 25.875  10.139  -7.898  1.00 52.40  ? 78   GLN A N     1 
ATOM   607  C  CA    . GLN A 1 78  ? 27.331  10.171  -7.719  1.00 52.16  ? 78   GLN A CA    1 
ATOM   608  C  C     . GLN A 1 78  ? 27.732  11.263  -6.725  1.00 51.70  ? 78   GLN A C     1 
ATOM   609  O  O     . GLN A 1 78  ? 28.610  11.062  -5.890  1.00 51.59  ? 78   GLN A O     1 
ATOM   610  C  CB    . GLN A 1 78  ? 28.053  10.365  -9.069  1.00 52.45  ? 78   GLN A CB    1 
ATOM   611  C  CG    . GLN A 1 78  ? 29.254  9.432   -9.306  1.00 51.92  ? 78   GLN A CG    1 
ATOM   612  C  CD    . GLN A 1 78  ? 30.247  9.483   -8.170  1.00 51.67  ? 78   GLN A CD    1 
ATOM   613  O  OE1   . GLN A 1 78  ? 30.263  8.606   -7.308  1.00 51.30  ? 78   GLN A OE1   1 
ATOM   614  N  NE2   . GLN A 1 78  ? 31.059  10.533  -8.140  1.00 51.67  ? 78   GLN A NE2   1 
ATOM   615  N  N     . ALA A 1 79  ? 27.058  12.402  -6.805  1.00 51.26  ? 79   ALA A N     1 
ATOM   616  C  CA    . ALA A 1 79  ? 27.325  13.504  -5.904  1.00 51.14  ? 79   ALA A CA    1 
ATOM   617  C  C     . ALA A 1 79  ? 26.886  13.231  -4.450  1.00 51.05  ? 79   ALA A C     1 
ATOM   618  O  O     . ALA A 1 79  ? 27.330  13.912  -3.519  1.00 51.19  ? 79   ALA A O     1 
ATOM   619  C  CB    . ALA A 1 79  ? 26.697  14.765  -6.436  1.00 51.06  ? 79   ALA A CB    1 
ATOM   620  N  N     . LEU A 1 80  ? 26.033  12.232  -4.251  1.00 50.76  ? 80   LEU A N     1 
ATOM   621  C  CA    . LEU A 1 80  ? 25.602  11.862  -2.902  1.00 50.58  ? 80   LEU A CA    1 
ATOM   622  C  C     . LEU A 1 80  ? 26.629  11.032  -2.143  1.00 50.59  ? 80   LEU A C     1 
ATOM   623  O  O     . LEU A 1 80  ? 26.796  11.181  -0.929  1.00 50.40  ? 80   LEU A O     1 
ATOM   624  C  CB    . LEU A 1 80  ? 24.285  11.114  -2.956  1.00 50.31  ? 80   LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 80  ? 23.096  11.886  -2.419  1.00 50.58  ? 80   LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 80  ? 23.036  13.328  -2.938  1.00 50.44  ? 80   LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 80  ? 21.864  11.103  -2.798  1.00 51.10  ? 80   LEU A CD2   1 
ATOM   628  N  N     . LEU A 1 81  ? 27.297  10.143  -2.872  1.00 50.66  ? 81   LEU A N     1 
ATOM   629  C  CA    . LEU A 1 81  ? 28.364  9.325   -2.324  1.00 50.61  ? 81   LEU A CA    1 
ATOM   630  C  C     . LEU A 1 81  ? 29.566  10.225  -2.048  1.00 51.11  ? 81   LEU A C     1 
ATOM   631  O  O     . LEU A 1 81  ? 30.326  10.002  -1.103  1.00 51.19  ? 81   LEU A O     1 
ATOM   632  C  CB    . LEU A 1 81  ? 28.731  8.214   -3.310  1.00 50.25  ? 81   LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 81  ? 27.618  7.318   -3.855  1.00 48.89  ? 81   LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 81  ? 27.899  6.948   -5.289  1.00 47.69  ? 81   LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 81  ? 27.455  6.079   -3.010  1.00 47.80  ? 81   LEU A CD2   1 
ATOM   636  N  N     . ASP A 1 82  ? 29.724  11.255  -2.874  1.00 51.62  ? 82   ASP A N     1 
ATOM   637  C  CA    . ASP A 1 82  ? 30.755  12.250  -2.651  1.00 52.34  ? 82   ASP A CA    1 
ATOM   638  C  C     . ASP A 1 82  ? 30.558  13.009  -1.342  1.00 52.75  ? 82   ASP A C     1 
ATOM   639  O  O     . ASP A 1 82  ? 31.536  13.372  -0.695  1.00 52.81  ? 82   ASP A O     1 
ATOM   640  C  CB    . ASP A 1 82  ? 30.827  13.206  -3.827  1.00 52.51  ? 82   ASP A CB    1 
ATOM   641  C  CG    . ASP A 1 82  ? 31.478  12.579  -5.036  1.00 53.06  ? 82   ASP A CG    1 
ATOM   642  O  OD1   . ASP A 1 82  ? 32.504  11.888  -4.858  1.00 53.77  ? 82   ASP A OD1   1 
ATOM   643  O  OD2   . ASP A 1 82  ? 30.969  12.782  -6.162  1.00 53.76  ? 82   ASP A OD2   1 
ATOM   644  N  N     . GLU A 1 83  ? 29.306  13.240  -0.950  1.00 53.29  ? 83   GLU A N     1 
ATOM   645  C  CA    . GLU A 1 83  ? 29.012  13.720  0.403   1.00 53.98  ? 83   GLU A CA    1 
ATOM   646  C  C     . GLU A 1 83  ? 29.497  12.688  1.394   1.00 53.60  ? 83   GLU A C     1 
ATOM   647  O  O     . GLU A 1 83  ? 30.517  12.867  2.042   1.00 53.58  ? 83   GLU A O     1 
ATOM   648  C  CB    . GLU A 1 83  ? 27.516  13.894  0.625   1.00 54.40  ? 83   GLU A CB    1 
ATOM   649  C  CG    . GLU A 1 83  ? 26.904  15.164  0.082   1.00 56.84  ? 83   GLU A CG    1 
ATOM   650  C  CD    . GLU A 1 83  ? 25.390  15.167  0.250   1.00 59.81  ? 83   GLU A CD    1 
ATOM   651  O  OE1   . GLU A 1 83  ? 24.832  14.161  0.760   1.00 60.33  ? 83   GLU A OE1   1 
ATOM   652  O  OE2   . GLU A 1 83  ? 24.755  16.172  -0.136  1.00 61.43  ? 83   GLU A OE2   1 
ATOM   653  N  N     . ASP A 1 84  ? 28.745  11.602  1.499   1.00 53.48  ? 84   ASP A N     1 
ATOM   654  C  CA    . ASP A 1 84  ? 29.126  10.506  2.365   1.00 53.37  ? 84   ASP A CA    1 
ATOM   655  C  C     . ASP A 1 84  ? 29.191  9.162   1.637   1.00 53.09  ? 84   ASP A C     1 
ATOM   656  O  O     . ASP A 1 84  ? 28.177  8.597   1.213   1.00 52.98  ? 84   ASP A O     1 
ATOM   657  C  CB    . ASP A 1 84  ? 28.213  10.416  3.581   1.00 53.44  ? 84   ASP A CB    1 
ATOM   658  C  CG    . ASP A 1 84  ? 28.252  9.050   4.224   1.00 53.92  ? 84   ASP A CG    1 
ATOM   659  O  OD1   . ASP A 1 84  ? 29.312  8.387   4.174   1.00 54.00  ? 84   ASP A OD1   1 
ATOM   660  O  OD2   . ASP A 1 84  ? 27.216  8.628   4.771   1.00 55.26  ? 84   ASP A OD2   1 
ATOM   661  N  N     . ASP A 1 85  ? 30.420  8.662   1.551   1.00 52.68  ? 85   ASP A N     1 
ATOM   662  C  CA    . ASP A 1 85  ? 30.779  7.404   0.916   1.00 51.93  ? 85   ASP A CA    1 
ATOM   663  C  C     . ASP A 1 85  ? 29.808  6.247   1.148   1.00 50.71  ? 85   ASP A C     1 
ATOM   664  O  O     . ASP A 1 85  ? 29.410  5.605   0.197   1.00 50.39  ? 85   ASP A O     1 
ATOM   665  C  CB    . ASP A 1 85  ? 32.204  7.014   1.354   1.00 52.54  ? 85   ASP A CB    1 
ATOM   666  C  CG    . ASP A 1 85  ? 32.864  6.016   0.405   1.00 54.67  ? 85   ASP A CG    1 
ATOM   667  O  OD1   . ASP A 1 85  ? 33.789  5.271   0.839   1.00 56.44  ? 85   ASP A OD1   1 
ATOM   668  O  OD2   . ASP A 1 85  ? 32.447  5.965   -0.777  1.00 57.21  ? 85   ASP A OD2   1 
ATOM   669  N  N     . ALA A 1 86  ? 29.431  5.983   2.397   1.00 49.68  ? 86   ALA A N     1 
ATOM   670  C  CA    . ALA A 1 86  ? 28.720  4.743   2.738   1.00 48.63  ? 86   ALA A CA    1 
ATOM   671  C  C     . ALA A 1 86  ? 27.373  4.952   3.386   1.00 47.95  ? 86   ALA A C     1 
ATOM   672  O  O     . ALA A 1 86  ? 27.251  4.916   4.608   1.00 47.61  ? 86   ALA A O     1 
ATOM   673  C  CB    . ALA A 1 86  ? 29.559  3.892   3.625   1.00 48.63  ? 86   ALA A CB    1 
ATOM   674  N  N     . GLN A 1 87  ? 26.370  5.175   2.548   1.00 47.32  ? 87   GLN A N     1 
ATOM   675  C  CA    . GLN A 1 87  ? 24.977  5.194   2.957   1.00 46.64  ? 87   GLN A CA    1 
ATOM   676  C  C     . GLN A 1 87  ? 24.394  3.938   2.365   1.00 46.67  ? 87   GLN A C     1 
ATOM   677  O  O     . GLN A 1 87  ? 25.009  3.323   1.498   1.00 46.63  ? 87   GLN A O     1 
ATOM   678  C  CB    . GLN A 1 87  ? 24.278  6.423   2.393   1.00 46.39  ? 87   GLN A CB    1 
ATOM   679  C  CG    . GLN A 1 87  ? 25.023  7.713   2.702   1.00 45.48  ? 87   GLN A CG    1 
ATOM   680  C  CD    . GLN A 1 87  ? 24.458  8.928   2.012   1.00 43.88  ? 87   GLN A CD    1 
ATOM   681  O  OE1   . GLN A 1 87  ? 23.259  9.028   1.787   1.00 43.46  ? 87   GLN A OE1   1 
ATOM   682  N  NE2   . GLN A 1 87  ? 25.326  9.872   1.684   1.00 43.64  ? 87   GLN A NE2   1 
ATOM   683  N  N     . THR A 1 88  ? 23.225  3.536   2.837   1.00 46.79  ? 88   THR A N     1 
ATOM   684  C  CA    . THR A 1 88  ? 22.617  2.295   2.362   1.00 47.14  ? 88   THR A CA    1 
ATOM   685  C  C     . THR A 1 88  ? 21.622  2.596   1.253   1.00 47.16  ? 88   THR A C     1 
ATOM   686  O  O     . THR A 1 88  ? 21.083  3.710   1.192   1.00 47.56  ? 88   THR A O     1 
ATOM   687  C  CB    . THR A 1 88  ? 21.900  1.563   3.494   1.00 47.27  ? 88   THR A CB    1 
ATOM   688  O  OG1   . THR A 1 88  ? 20.812  2.370   3.979   1.00 46.95  ? 88   THR A OG1   1 
ATOM   689  C  CG2   . THR A 1 88  ? 22.896  1.258   4.639   1.00 48.46  ? 88   THR A CG2   1 
ATOM   690  N  N     . GLN A 1 89  ? 21.365  1.623   0.378   1.00 46.65  ? 89   GLN A N     1 
ATOM   691  C  CA    . GLN A 1 89  ? 20.446  1.874   -0.728  1.00 46.05  ? 89   GLN A CA    1 
ATOM   692  C  C     . GLN A 1 89  ? 19.120  2.465   -0.240  1.00 45.94  ? 89   GLN A C     1 
ATOM   693  O  O     . GLN A 1 89  ? 18.707  3.510   -0.737  1.00 45.77  ? 89   GLN A O     1 
ATOM   694  C  CB    . GLN A 1 89  ? 20.267  0.652   -1.616  1.00 45.87  ? 89   GLN A CB    1 
ATOM   695  C  CG    . GLN A 1 89  ? 21.390  0.486   -2.621  1.00 45.50  ? 89   GLN A CG    1 
ATOM   696  C  CD    . GLN A 1 89  ? 21.402  -0.889  -3.278  1.00 46.19  ? 89   GLN A CD    1 
ATOM   697  O  OE1   . GLN A 1 89  ? 20.418  -1.622  -3.230  1.00 46.77  ? 89   GLN A OE1   1 
ATOM   698  N  NE2   . GLN A 1 89  ? 22.521  -1.240  -3.901  1.00 46.19  ? 89   GLN A NE2   1 
ATOM   699  N  N     . LYS A 1 90  ? 18.502  1.850   0.770   1.00 45.87  ? 90   LYS A N     1 
ATOM   700  C  CA    . LYS A 1 90  ? 17.237  2.369   1.335   1.00 46.12  ? 90   LYS A CA    1 
ATOM   701  C  C     . LYS A 1 90  ? 17.286  3.878   1.575   1.00 45.66  ? 90   LYS A C     1 
ATOM   702  O  O     . LYS A 1 90  ? 16.253  4.556   1.639   1.00 45.49  ? 90   LYS A O     1 
ATOM   703  C  CB    . LYS A 1 90  ? 16.852  1.663   2.662   1.00 46.50  ? 90   LYS A CB    1 
ATOM   704  C  CG    . LYS A 1 90  ? 15.342  1.837   3.070   1.00 47.10  ? 90   LYS A CG    1 
ATOM   705  C  CD    . LYS A 1 90  ? 15.135  2.508   4.449   1.00 48.16  ? 90   LYS A CD    1 
ATOM   706  C  CE    . LYS A 1 90  ? 14.858  1.504   5.589   1.00 49.79  ? 90   LYS A CE    1 
ATOM   707  N  NZ    . LYS A 1 90  ? 13.416  1.102   5.781   1.00 49.94  ? 90   LYS A NZ    1 
ATOM   708  N  N     . GLN A 1 91  ? 18.502  4.386   1.665   1.00 45.26  ? 91   GLN A N     1 
ATOM   709  C  CA    . GLN A 1 91  ? 18.768  5.641   2.317   1.00 45.29  ? 91   GLN A CA    1 
ATOM   710  C  C     . GLN A 1 91  ? 19.189  6.727   1.321   1.00 45.11  ? 91   GLN A C     1 
ATOM   711  O  O     . GLN A 1 91  ? 18.877  7.908   1.505   1.00 44.80  ? 91   GLN A O     1 
ATOM   712  C  CB    . GLN A 1 91  ? 19.839  5.365   3.358   1.00 45.32  ? 91   GLN A CB    1 
ATOM   713  C  CG    . GLN A 1 91  ? 20.196  6.475   4.274   1.00 45.88  ? 91   GLN A CG    1 
ATOM   714  C  CD    . GLN A 1 91  ? 21.565  6.252   4.847   1.00 46.55  ? 91   GLN A CD    1 
ATOM   715  O  OE1   . GLN A 1 91  ? 22.391  7.155   4.849   1.00 47.68  ? 91   GLN A OE1   1 
ATOM   716  N  NE2   . GLN A 1 91  ? 21.831  5.031   5.305   1.00 46.28  ? 91   GLN A NE2   1 
ATOM   717  N  N     . LEU A 1 92  ? 19.895  6.327   0.266   1.00 45.12  ? 92   LEU A N     1 
ATOM   718  C  CA    . LEU A 1 92  ? 20.098  7.224   -0.864  1.00 45.11  ? 92   LEU A CA    1 
ATOM   719  C  C     . LEU A 1 92  ? 18.778  7.261   -1.619  1.00 45.87  ? 92   LEU A C     1 
ATOM   720  O  O     . LEU A 1 92  ? 18.460  8.241   -2.296  1.00 46.06  ? 92   LEU A O     1 
ATOM   721  C  CB    . LEU A 1 92  ? 21.221  6.754   -1.794  1.00 44.35  ? 92   LEU A CB    1 
ATOM   722  C  CG    . LEU A 1 92  ? 22.449  6.056   -1.240  1.00 42.22  ? 92   LEU A CG    1 
ATOM   723  C  CD1   . LEU A 1 92  ? 22.360  4.654   -1.690  1.00 40.79  ? 92   LEU A CD1   1 
ATOM   724  C  CD2   . LEU A 1 92  ? 23.702  6.675   -1.779  1.00 40.00  ? 92   LEU A CD2   1 
ATOM   725  N  N     . ALA A 1 93  ? 18.013  6.181   -1.489  1.00 46.58  ? 93   ALA A N     1 
ATOM   726  C  CA    . ALA A 1 93  ? 16.683  6.105   -2.054  1.00 47.21  ? 93   ALA A CA    1 
ATOM   727  C  C     . ALA A 1 93  ? 15.862  7.294   -1.621  1.00 47.66  ? 93   ALA A C     1 
ATOM   728  O  O     . ALA A 1 93  ? 15.388  8.053   -2.461  1.00 47.66  ? 93   ALA A O     1 
ATOM   729  C  CB    . ALA A 1 93  ? 16.004  4.823   -1.636  1.00 47.42  ? 93   ALA A CB    1 
ATOM   730  N  N     . GLU A 1 94  ? 15.716  7.463   -0.310  1.00 48.54  ? 94   GLU A N     1 
ATOM   731  C  CA    . GLU A 1 94  ? 14.899  8.546   0.231   1.00 49.57  ? 94   GLU A CA    1 
ATOM   732  C  C     . GLU A 1 94  ? 15.346  9.909   -0.295  1.00 49.54  ? 94   GLU A C     1 
ATOM   733  O  O     . GLU A 1 94  ? 14.520  10.717  -0.685  1.00 49.59  ? 94   GLU A O     1 
ATOM   734  C  CB    . GLU A 1 94  ? 14.834  8.492   1.762   1.00 49.78  ? 94   GLU A CB    1 
ATOM   735  C  CG    . GLU A 1 94  ? 13.886  7.386   2.283   1.00 52.46  ? 94   GLU A CG    1 
ATOM   736  C  CD    . GLU A 1 94  ? 14.065  7.072   3.782   1.00 56.43  ? 94   GLU A CD    1 
ATOM   737  O  OE1   . GLU A 1 94  ? 13.611  7.875   4.637   1.00 57.99  ? 94   GLU A OE1   1 
ATOM   738  O  OE2   . GLU A 1 94  ? 14.648  6.008   4.113   1.00 57.96  ? 94   GLU A OE2   1 
ATOM   739  N  N     . GLN A 1 95  ? 16.651  10.138  -0.369  1.00 49.93  ? 95   GLN A N     1 
ATOM   740  C  CA    . GLN A 1 95  ? 17.176  11.395  -0.905  1.00 50.29  ? 95   GLN A CA    1 
ATOM   741  C  C     . GLN A 1 95  ? 16.950  11.594  -2.396  1.00 50.62  ? 95   GLN A C     1 
ATOM   742  O  O     . GLN A 1 95  ? 17.134  12.704  -2.897  1.00 50.92  ? 95   GLN A O     1 
ATOM   743  C  CB    . GLN A 1 95  ? 18.672  11.491  -0.675  1.00 50.25  ? 95   GLN A CB    1 
ATOM   744  C  CG    . GLN A 1 95  ? 19.106  11.964  0.672   1.00 50.21  ? 95   GLN A CG    1 
ATOM   745  C  CD    . GLN A 1 95  ? 20.539  11.584  0.899   1.00 50.74  ? 95   GLN A CD    1 
ATOM   746  O  OE1   . GLN A 1 95  ? 21.438  12.421  0.821   1.00 50.65  ? 95   GLN A OE1   1 
ATOM   747  N  NE2   . GLN A 1 95  ? 20.774  10.292  1.121   1.00 51.52  ? 95   GLN A NE2   1 
ATOM   748  N  N     . LEU A 1 96  ? 16.594  10.531  -3.111  1.00 50.93  ? 96   LEU A N     1 
ATOM   749  C  CA    . LEU A 1 96  ? 16.465  10.606  -4.573  1.00 51.30  ? 96   LEU A CA    1 
ATOM   750  C  C     . LEU A 1 96  ? 15.041  10.385  -5.090  1.00 51.59  ? 96   LEU A C     1 
ATOM   751  O  O     . LEU A 1 96  ? 14.822  10.179  -6.288  1.00 51.57  ? 96   LEU A O     1 
ATOM   752  C  CB    . LEU A 1 96  ? 17.461  9.655   -5.246  1.00 51.32  ? 96   LEU A CB    1 
ATOM   753  C  CG    . LEU A 1 96  ? 18.676  10.236  -5.983  1.00 51.22  ? 96   LEU A CG    1 
ATOM   754  C  CD1   . LEU A 1 96  ? 19.127  11.594  -5.461  1.00 51.50  ? 96   LEU A CD1   1 
ATOM   755  C  CD2   . LEU A 1 96  ? 19.821  9.243   -5.955  1.00 51.06  ? 96   LEU A CD2   1 
ATOM   756  N  N     . GLU A 1 97  ? 14.080  10.432  -4.168  1.00 51.99  ? 97   GLU A N     1 
ATOM   757  C  CA    . GLU A 1 97  ? 12.650  10.275  -4.473  1.00 52.32  ? 97   GLU A CA    1 
ATOM   758  C  C     . GLU A 1 97  ? 12.302  8.871   -4.978  1.00 52.09  ? 97   GLU A C     1 
ATOM   759  O  O     . GLU A 1 97  ? 11.128  8.509   -5.072  1.00 52.38  ? 97   GLU A O     1 
ATOM   760  C  CB    . GLU A 1 97  ? 12.169  11.345  -5.479  1.00 52.50  ? 97   GLU A CB    1 
ATOM   761  C  CG    . GLU A 1 97  ? 12.578  12.793  -5.148  1.00 53.81  ? 97   GLU A CG    1 
ATOM   762  C  CD    . GLU A 1 97  ? 11.737  13.464  -4.050  1.00 55.56  ? 97   GLU A CD    1 
ATOM   763  O  OE1   . GLU A 1 97  ? 11.537  14.695  -4.144  1.00 56.46  ? 97   GLU A OE1   1 
ATOM   764  O  OE2   . GLU A 1 97  ? 11.284  12.790  -3.094  1.00 56.31  ? 97   GLU A OE2   1 
ATOM   765  N  N     . VAL A 1 98  ? 13.322  8.079   -5.281  1.00 51.58  ? 98   VAL A N     1 
ATOM   766  C  CA    . VAL A 1 98  ? 13.124  6.846   -6.010  1.00 51.11  ? 98   VAL A CA    1 
ATOM   767  C  C     . VAL A 1 98  ? 13.130  5.656   -5.054  1.00 50.93  ? 98   VAL A C     1 
ATOM   768  O  O     . VAL A 1 98  ? 13.526  5.814   -3.907  1.00 51.24  ? 98   VAL A O     1 
ATOM   769  C  CB    . VAL A 1 98  ? 14.186  6.741   -7.095  1.00 51.02  ? 98   VAL A CB    1 
ATOM   770  C  CG1   . VAL A 1 98  ? 15.427  6.043   -6.581  1.00 50.93  ? 98   VAL A CG1   1 
ATOM   771  C  CG2   . VAL A 1 98  ? 13.617  6.077   -8.312  1.00 50.96  ? 98   VAL A CG2   1 
ATOM   772  N  N     . SER A 1 99  ? 12.671  4.486   -5.503  1.00 50.59  ? 99   SER A N     1 
ATOM   773  C  CA    . SER A 1 99  ? 12.643  3.285   -4.651  1.00 50.38  ? 99   SER A CA    1 
ATOM   774  C  C     . SER A 1 99  ? 14.049  2.718   -4.425  1.00 50.22  ? 99   SER A C     1 
ATOM   775  O  O     . SER A 1 99  ? 15.029  3.266   -4.929  1.00 49.97  ? 99   SER A O     1 
ATOM   776  C  CB    . SER A 1 99  ? 11.747  2.204   -5.258  1.00 50.39  ? 99   SER A CB    1 
ATOM   777  O  OG    . SER A 1 99  ? 12.462  1.427   -6.219  1.00 50.87  ? 99   SER A OG    1 
ATOM   778  N  N     . GLN A 1 100 ? 14.140  1.611   -3.682  1.00 50.16  ? 100  GLN A N     1 
ATOM   779  C  CA    . GLN A 1 100 ? 15.440  0.965   -3.393  1.00 49.78  ? 100  GLN A CA    1 
ATOM   780  C  C     . GLN A 1 100 ? 15.974  0.169   -4.569  1.00 49.39  ? 100  GLN A C     1 
ATOM   781  O  O     . GLN A 1 100 ? 17.098  0.403   -5.027  1.00 49.42  ? 100  GLN A O     1 
ATOM   782  C  CB    . GLN A 1 100 ? 15.377  0.061   -2.154  1.00 49.72  ? 100  GLN A CB    1 
ATOM   783  C  CG    . GLN A 1 100 ? 16.707  -0.623  -1.832  1.00 49.41  ? 100  GLN A CG    1 
ATOM   784  C  CD    . GLN A 1 100 ? 16.811  -2.045  -2.379  1.00 49.69  ? 100  GLN A CD    1 
ATOM   785  O  OE1   . GLN A 1 100 ? 17.740  -2.368  -3.114  1.00 49.13  ? 100  GLN A OE1   1 
ATOM   786  N  NE2   . GLN A 1 100 ? 15.861  -2.901  -2.006  1.00 50.12  ? 100  GLN A NE2   1 
ATOM   787  N  N     . GLN A 1 101 ? 15.176  -0.782  -5.040  1.00 48.80  ? 101  GLN A N     1 
ATOM   788  C  CA    . GLN A 1 101 ? 15.594  -1.622  -6.145  1.00 48.57  ? 101  GLN A CA    1 
ATOM   789  C  C     . GLN A 1 101 ? 16.074  -0.681  -7.237  1.00 48.21  ? 101  GLN A C     1 
ATOM   790  O  O     . GLN A 1 101 ? 17.073  -0.940  -7.928  1.00 48.09  ? 101  GLN A O     1 
ATOM   791  C  CB    . GLN A 1 101 ? 14.448  -2.517  -6.614  1.00 48.53  ? 101  GLN A CB    1 
ATOM   792  C  CG    . GLN A 1 101 ? 13.920  -3.457  -5.527  1.00 48.84  ? 101  GLN A CG    1 
ATOM   793  C  CD    . GLN A 1 101 ? 12.920  -2.801  -4.577  1.00 49.12  ? 101  GLN A CD    1 
ATOM   794  O  OE1   . GLN A 1 101 ? 12.938  -1.582  -4.374  1.00 49.08  ? 101  GLN A OE1   1 
ATOM   795  N  NE2   . GLN A 1 101 ? 12.044  -3.616  -3.988  1.00 48.35  ? 101  GLN A NE2   1 
ATOM   796  N  N     . ALA A 1 102 ? 15.376  0.447   -7.332  1.00 47.62  ? 102  ALA A N     1 
ATOM   797  C  CA    . ALA A 1 102 ? 15.718  1.484   -8.269  1.00 47.14  ? 102  ALA A CA    1 
ATOM   798  C  C     . ALA A 1 102 ? 17.163  1.938   -8.090  1.00 46.82  ? 102  ALA A C     1 
ATOM   799  O  O     . ALA A 1 102 ? 17.881  2.115   -9.071  1.00 46.76  ? 102  ALA A O     1 
ATOM   800  C  CB    . ALA A 1 102 ? 14.771  2.630   -8.114  1.00 47.25  ? 102  ALA A CB    1 
ATOM   801  N  N     . VAL A 1 103 ? 17.597  2.111   -6.845  1.00 46.56  ? 103  VAL A N     1 
ATOM   802  C  CA    . VAL A 1 103 ? 18.942  2.614   -6.610  1.00 46.46  ? 103  VAL A CA    1 
ATOM   803  C  C     . VAL A 1 103 ? 19.962  1.535   -6.877  1.00 46.70  ? 103  VAL A C     1 
ATOM   804  O  O     . VAL A 1 103 ? 20.987  1.810   -7.503  1.00 47.31  ? 103  VAL A O     1 
ATOM   805  C  CB    . VAL A 1 103 ? 19.173  3.163   -5.202  1.00 46.35  ? 103  VAL A CB    1 
ATOM   806  C  CG1   . VAL A 1 103 ? 20.386  4.053   -5.220  1.00 46.19  ? 103  VAL A CG1   1 
ATOM   807  C  CG2   . VAL A 1 103 ? 17.987  3.956   -4.719  1.00 46.15  ? 103  VAL A CG2   1 
ATOM   808  N  N     . SER A 1 104 ? 19.686  0.314   -6.414  1.00 46.53  ? 104  SER A N     1 
ATOM   809  C  CA    . SER A 1 104 ? 20.557  -0.839  -6.685  1.00 46.28  ? 104  SER A CA    1 
ATOM   810  C  C     . SER A 1 104 ? 21.026  -0.847  -8.133  1.00 46.07  ? 104  SER A C     1 
ATOM   811  O  O     . SER A 1 104 ? 22.222  -0.796  -8.410  1.00 45.78  ? 104  SER A O     1 
ATOM   812  C  CB    . SER A 1 104 ? 19.831  -2.144  -6.376  1.00 46.15  ? 104  SER A CB    1 
ATOM   813  O  OG    . SER A 1 104 ? 20.009  -3.061  -7.437  1.00 46.80  ? 104  SER A OG    1 
ATOM   814  N  N     . ASN A 1 105 ? 20.049  -0.876  -9.037  1.00 46.15  ? 105  ASN A N     1 
ATOM   815  C  CA    . ASN A 1 105 ? 20.267  -0.905  -10.478 1.00 46.14  ? 105  ASN A CA    1 
ATOM   816  C  C     . ASN A 1 105 ? 21.225  0.127   -11.012 1.00 46.05  ? 105  ASN A C     1 
ATOM   817  O  O     . ASN A 1 105 ? 22.120  -0.221  -11.777 1.00 46.09  ? 105  ASN A O     1 
ATOM   818  C  CB    . ASN A 1 105 ? 18.949  -0.745  -11.223 1.00 46.19  ? 105  ASN A CB    1 
ATOM   819  C  CG    . ASN A 1 105 ? 17.971  -1.845  -10.922 1.00 46.36  ? 105  ASN A CG    1 
ATOM   820  O  OD1   . ASN A 1 105 ? 18.353  -3.001  -10.680 1.00 46.73  ? 105  ASN A OD1   1 
ATOM   821  N  ND2   . ASN A 1 105 ? 16.686  -1.497  -10.947 1.00 45.76  ? 105  ASN A ND2   1 
ATOM   822  N  N     . ARG A 1 106 ? 21.040  1.395   -10.657 1.00 45.92  ? 106  ARG A N     1 
ATOM   823  C  CA    . ARG A 1 106 ? 21.911  2.379   -11.258 1.00 46.39  ? 106  ARG A CA    1 
ATOM   824  C  C     . ARG A 1 106 ? 23.310  2.262   -10.708 1.00 46.76  ? 106  ARG A C     1 
ATOM   825  O  O     . ARG A 1 106 ? 24.293  2.513   -11.405 1.00 46.62  ? 106  ARG A O     1 
ATOM   826  C  CB    . ARG A 1 106 ? 21.414  3.806   -11.141 1.00 46.32  ? 106  ARG A CB    1 
ATOM   827  C  CG    . ARG A 1 106 ? 22.041  4.616   -12.274 1.00 46.63  ? 106  ARG A CG    1 
ATOM   828  C  CD    . ARG A 1 106 ? 21.989  6.089   -12.073 1.00 46.97  ? 106  ARG A CD    1 
ATOM   829  N  NE    . ARG A 1 106 ? 20.675  6.677   -12.319 1.00 47.15  ? 106  ARG A NE    1 
ATOM   830  C  CZ    . ARG A 1 106 ? 19.701  6.153   -13.056 1.00 47.78  ? 106  ARG A CZ    1 
ATOM   831  N  NH1   . ARG A 1 106 ? 18.564  6.818   -13.161 1.00 48.66  ? 106  ARG A NH1   1 
ATOM   832  N  NH2   . ARG A 1 106 ? 19.846  4.992   -13.689 1.00 48.10  ? 106  ARG A NH2   1 
ATOM   833  N  N     . LEU A 1 107 ? 23.395  1.881   -9.445  1.00 47.45  ? 107  LEU A N     1 
ATOM   834  C  CA    . LEU A 1 107 ? 24.681  1.661   -8.839  1.00 48.17  ? 107  LEU A CA    1 
ATOM   835  C  C     . LEU A 1 107 ? 25.379  0.558   -9.614  1.00 49.07  ? 107  LEU A C     1 
ATOM   836  O  O     . LEU A 1 107 ? 26.544  0.706   -9.991  1.00 49.46  ? 107  LEU A O     1 
ATOM   837  C  CB    . LEU A 1 107 ? 24.535  1.335   -7.357  1.00 47.81  ? 107  LEU A CB    1 
ATOM   838  C  CG    . LEU A 1 107 ? 24.324  2.614   -6.555  1.00 46.88  ? 107  LEU A CG    1 
ATOM   839  C  CD1   . LEU A 1 107 ? 23.653  2.316   -5.248  1.00 46.68  ? 107  LEU A CD1   1 
ATOM   840  C  CD2   . LEU A 1 107 ? 25.651  3.297   -6.334  1.00 46.43  ? 107  LEU A CD2   1 
ATOM   841  N  N     . ARG A 1 108 ? 24.651  -0.524  -9.890  1.00 49.85  ? 108  ARG A N     1 
ATOM   842  C  CA    . ARG A 1 108 ? 25.161  -1.579  -10.756 1.00 50.59  ? 108  ARG A CA    1 
ATOM   843  C  C     . ARG A 1 108 ? 25.507  -1.012  -12.130 1.00 50.27  ? 108  ARG A C     1 
ATOM   844  O  O     . ARG A 1 108 ? 26.576  -1.303  -12.658 1.00 50.31  ? 108  ARG A O     1 
ATOM   845  C  CB    . ARG A 1 108 ? 24.165  -2.738  -10.878 1.00 51.15  ? 108  ARG A CB    1 
ATOM   846  C  CG    . ARG A 1 108 ? 24.364  -3.583  -12.139 1.00 54.08  ? 108  ARG A CG    1 
ATOM   847  C  CD    . ARG A 1 108 ? 23.311  -4.664  -12.310 1.00 58.98  ? 108  ARG A CD    1 
ATOM   848  N  NE    . ARG A 1 108 ? 23.667  -5.871  -11.568 1.00 62.11  ? 108  ARG A NE    1 
ATOM   849  C  CZ    . ARG A 1 108 ? 22.991  -6.351  -10.524 1.00 64.01  ? 108  ARG A CZ    1 
ATOM   850  N  NH1   . ARG A 1 108 ? 21.889  -5.742  -10.067 1.00 64.18  ? 108  ARG A NH1   1 
ATOM   851  N  NH2   . ARG A 1 108 ? 23.426  -7.459  -9.938  1.00 64.85  ? 108  ARG A NH2   1 
ATOM   852  N  N     . GLU A 1 109 ? 24.610  -0.197  -12.689 1.00 50.12  ? 109  GLU A N     1 
ATOM   853  C  CA    . GLU A 1 109 ? 24.827  0.430   -13.998 1.00 50.02  ? 109  GLU A CA    1 
ATOM   854  C  C     . GLU A 1 109 ? 26.100  1.288   -14.013 1.00 49.14  ? 109  GLU A C     1 
ATOM   855  O  O     . GLU A 1 109 ? 26.925  1.123   -14.907 1.00 49.01  ? 109  GLU A O     1 
ATOM   856  C  CB    . GLU A 1 109 ? 23.579  1.209   -14.459 1.00 50.56  ? 109  GLU A CB    1 
ATOM   857  C  CG    . GLU A 1 109 ? 23.671  1.895   -15.839 1.00 52.77  ? 109  GLU A CG    1 
ATOM   858  C  CD    . GLU A 1 109 ? 24.222  3.342   -15.766 1.00 55.37  ? 109  GLU A CD    1 
ATOM   859  O  OE1   . GLU A 1 109 ? 23.417  4.309   -15.779 1.00 56.51  ? 109  GLU A OE1   1 
ATOM   860  O  OE2   . GLU A 1 109 ? 25.461  3.515   -15.694 1.00 55.59  ? 109  GLU A OE2   1 
ATOM   861  N  N     . MET A 1 110 ? 26.261  2.188   -13.035 1.00 48.24  ? 110  MET A N     1 
ATOM   862  C  CA    . MET A 1 110 ? 27.531  2.906   -12.838 1.00 47.41  ? 110  MET A CA    1 
ATOM   863  C  C     . MET A 1 110 ? 28.610  1.891   -12.447 1.00 47.02  ? 110  MET A C     1 
ATOM   864  O  O     . MET A 1 110 ? 28.320  0.706   -12.262 1.00 47.02  ? 110  MET A O     1 
ATOM   865  C  CB    . MET A 1 110 ? 27.394  3.998   -11.777 1.00 47.15  ? 110  MET A CB    1 
ATOM   866  C  CG    . MET A 1 110 ? 26.560  5.186   -12.214 1.00 47.50  ? 110  MET A CG    1 
ATOM   867  S  SD    . MET A 1 110 ? 25.505  5.908   -10.917 1.00 48.56  ? 110  MET A SD    1 
ATOM   868  C  CE    . MET A 1 110 ? 26.652  7.024   -10.106 1.00 47.47  ? 110  MET A CE    1 
ATOM   869  N  N     . GLY A 1 111 ? 29.856  2.332   -12.317 1.00 46.46  ? 111  GLY A N     1 
ATOM   870  C  CA    . GLY A 1 111 ? 30.937  1.381   -12.025 1.00 45.69  ? 111  GLY A CA    1 
ATOM   871  C  C     . GLY A 1 111 ? 30.977  0.816   -10.611 1.00 45.08  ? 111  GLY A C     1 
ATOM   872  O  O     . GLY A 1 111 ? 31.868  0.036   -10.292 1.00 45.14  ? 111  GLY A O     1 
ATOM   873  N  N     . LYS A 1 112 ? 29.987  1.177   -9.793  1.00 44.25  ? 112  LYS A N     1 
ATOM   874  C  CA    . LYS A 1 112 ? 30.068  1.120   -8.339  1.00 43.47  ? 112  LYS A CA    1 
ATOM   875  C  C     . LYS A 1 112 ? 29.878  -0.270  -7.774  1.00 43.48  ? 112  LYS A C     1 
ATOM   876  O  O     . LYS A 1 112 ? 29.222  -1.096  -8.395  1.00 43.60  ? 112  LYS A O     1 
ATOM   877  C  CB    . LYS A 1 112 ? 29.017  2.047   -7.739  1.00 43.32  ? 112  LYS A CB    1 
ATOM   878  C  CG    . LYS A 1 112 ? 29.087  3.494   -8.204  1.00 43.00  ? 112  LYS A CG    1 
ATOM   879  C  CD    . LYS A 1 112 ? 30.261  4.227   -7.582  1.00 43.20  ? 112  LYS A CD    1 
ATOM   880  C  CE    . LYS A 1 112 ? 30.500  5.596   -8.199  1.00 42.39  ? 112  LYS A CE    1 
ATOM   881  N  NZ    . LYS A 1 112 ? 31.753  6.199   -7.635  1.00 41.89  ? 112  LYS A NZ    1 
ATOM   882  N  N     . ILE A 1 113 ? 30.460  -0.499  -6.592  1.00 43.39  ? 113  ILE A N     1 
ATOM   883  C  CA    . ILE A 1 113 ? 30.403  -1.761  -5.833  1.00 43.46  ? 113  ILE A CA    1 
ATOM   884  C  C     . ILE A 1 113 ? 30.667  -1.486  -4.362  1.00 43.60  ? 113  ILE A C     1 
ATOM   885  O  O     . ILE A 1 113 ? 31.361  -0.542  -4.035  1.00 44.02  ? 113  ILE A O     1 
ATOM   886  C  CB    . ILE A 1 113 ? 31.490  -2.779  -6.255  1.00 43.50  ? 113  ILE A CB    1 
ATOM   887  C  CG1   . ILE A 1 113 ? 32.807  -2.091  -6.629  1.00 42.85  ? 113  ILE A CG1   1 
ATOM   888  C  CG2   . ILE A 1 113 ? 30.980  -3.694  -7.359  1.00 44.24  ? 113  ILE A CG2   1 
ATOM   889  C  CD1   . ILE A 1 113 ? 33.994  -3.002  -6.549  1.00 43.06  ? 113  ILE A CD1   1 
ATOM   890  N  N     . GLN A 1 114 ? 30.152  -2.327  -3.472  1.00 43.64  ? 114  GLN A N     1 
ATOM   891  C  CA    . GLN A 1 114 ? 30.340  -2.105  -2.043  1.00 43.76  ? 114  GLN A CA    1 
ATOM   892  C  C     . GLN A 1 114 ? 31.483  -2.940  -1.516  1.00 43.80  ? 114  GLN A C     1 
ATOM   893  O  O     . GLN A 1 114 ? 31.599  -4.107  -1.855  1.00 43.88  ? 114  GLN A O     1 
ATOM   894  C  CB    . GLN A 1 114 ? 29.054  -2.405  -1.248  1.00 44.04  ? 114  GLN A CB    1 
ATOM   895  C  CG    . GLN A 1 114 ? 28.402  -3.790  -1.526  1.00 44.94  ? 114  GLN A CG    1 
ATOM   896  C  CD    . GLN A 1 114 ? 27.592  -4.372  -0.346  1.00 45.25  ? 114  GLN A CD    1 
ATOM   897  O  OE1   . GLN A 1 114 ? 26.787  -5.298  -0.539  1.00 43.71  ? 114  GLN A OE1   1 
ATOM   898  N  NE2   . GLN A 1 114 ? 27.818  -3.846  0.875   1.00 45.26  ? 114  GLN A NE2   1 
ATOM   899  N  N     . LYS A 1 115 ? 32.322  -2.350  -0.676  1.00 43.99  ? 115  LYS A N     1 
ATOM   900  C  CA    . LYS A 1 115 ? 33.388  -3.103  -0.026  1.00 44.36  ? 115  LYS A CA    1 
ATOM   901  C  C     . LYS A 1 115 ? 33.444  -2.782  1.452   1.00 44.95  ? 115  LYS A C     1 
ATOM   902  O  O     . LYS A 1 115 ? 33.226  -1.632  1.849   1.00 45.16  ? 115  LYS A O     1 
ATOM   903  C  CB    . LYS A 1 115 ? 34.727  -2.812  -0.682  1.00 44.18  ? 115  LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 115 ? 34.776  -1.483  -1.399  1.00 44.56  ? 115  LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 115 ? 36.193  -1.006  -1.589  1.00 45.73  ? 115  LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 115 ? 36.871  -1.687  -2.749  1.00 46.76  ? 115  LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 115 ? 38.350  -1.512  -2.650  1.00 47.94  ? 115  LYS A NZ    1 
ATOM   908  N  N     . VAL A 1 116 ? 33.727  -3.803  2.257   1.00 45.55  ? 116  VAL A N     1 
ATOM   909  C  CA    . VAL A 1 116 ? 33.788  -3.674  3.714   1.00 46.53  ? 116  VAL A CA    1 
ATOM   910  C  C     . VAL A 1 116 ? 35.040  -2.942  4.090   1.00 46.77  ? 116  VAL A C     1 
ATOM   911  O  O     . VAL A 1 116 ? 36.123  -3.389  3.766   1.00 46.98  ? 116  VAL A O     1 
ATOM   912  C  CB    . VAL A 1 116 ? 33.832  -5.053  4.423   1.00 46.93  ? 116  VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 116 ? 32.552  -5.322  5.250   1.00 47.80  ? 116  VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 116 ? 34.085  -6.180  3.419   1.00 47.48  ? 116  VAL A CG2   1 
ATOM   915  N  N     . GLY A 1 117 ? 34.898  -1.823  4.782   1.00 47.41  ? 117  GLY A N     1 
ATOM   916  C  CA    . GLY A 1 117 ? 36.046  -0.966  5.100   1.00 48.06  ? 117  GLY A CA    1 
ATOM   917  C  C     . GLY A 1 117 ? 37.031  -1.552  6.088   1.00 48.38  ? 117  GLY A C     1 
ATOM   918  O  O     . GLY A 1 117 ? 36.714  -2.508  6.794   1.00 48.42  ? 117  GLY A O     1 
ATOM   919  N  N     . ARG A 1 118 ? 38.226  -0.966  6.138   1.00 48.69  ? 118  ARG A N     1 
ATOM   920  C  CA    . ARG A 1 118 ? 39.320  -1.495  6.964   1.00 48.98  ? 118  ARG A CA    1 
ATOM   921  C  C     . ARG A 1 118 ? 39.196  -1.140  8.438   1.00 48.15  ? 118  ARG A C     1 
ATOM   922  O  O     . ARG A 1 118 ? 38.640  -0.107  8.781   1.00 48.12  ? 118  ARG A O     1 
ATOM   923  C  CB    . ARG A 1 118 ? 40.677  -1.014  6.440   1.00 49.55  ? 118  ARG A CB    1 
ATOM   924  C  CG    . ARG A 1 118 ? 41.077  -1.554  5.044   1.00 52.26  ? 118  ARG A CG    1 
ATOM   925  C  CD    . ARG A 1 118 ? 42.594  -1.847  4.923   1.00 56.46  ? 118  ARG A CD    1 
ATOM   926  N  NE    . ARG A 1 118 ? 43.374  -1.235  6.007   1.00 59.42  ? 118  ARG A NE    1 
ATOM   927  C  CZ    . ARG A 1 118 ? 44.004  -1.910  6.974   1.00 60.94  ? 118  ARG A CZ    1 
ATOM   928  N  NH1   . ARG A 1 118 ? 43.982  -3.245  6.987   1.00 61.52  ? 118  ARG A NH1   1 
ATOM   929  N  NH2   . ARG A 1 118 ? 44.666  -1.244  7.926   1.00 60.98  ? 118  ARG A NH2   1 
ATOM   930  N  N     . TRP A 1 119 ? 39.716  -2.007  9.299   1.00 47.45  ? 119  TRP A N     1 
ATOM   931  C  CA    . TRP A 1 119 ? 39.817  -1.704  10.720  1.00 47.05  ? 119  TRP A CA    1 
ATOM   932  C  C     . TRP A 1 119 ? 41.085  -0.895  10.952  1.00 47.26  ? 119  TRP A C     1 
ATOM   933  O  O     . TRP A 1 119 ? 42.123  -1.191  10.368  1.00 47.57  ? 119  TRP A O     1 
ATOM   934  C  CB    . TRP A 1 119 ? 39.889  -2.984  11.565  1.00 46.92  ? 119  TRP A CB    1 
ATOM   935  C  CG    . TRP A 1 119 ? 38.571  -3.585  12.059  1.00 45.07  ? 119  TRP A CG    1 
ATOM   936  C  CD1   . TRP A 1 119 ? 38.172  -4.883  11.929  1.00 44.34  ? 119  TRP A CD1   1 
ATOM   937  C  CD2   . TRP A 1 119 ? 37.530  -2.922  12.779  1.00 43.51  ? 119  TRP A CD2   1 
ATOM   938  N  NE1   . TRP A 1 119 ? 36.947  -5.068  12.508  1.00 43.86  ? 119  TRP A NE1   1 
ATOM   939  C  CE2   . TRP A 1 119 ? 36.528  -3.878  13.037  1.00 43.72  ? 119  TRP A CE2   1 
ATOM   940  C  CE3   . TRP A 1 119 ? 37.342  -1.611  13.227  1.00 43.03  ? 119  TRP A CE3   1 
ATOM   941  C  CZ2   . TRP A 1 119 ? 35.357  -3.564  13.719  1.00 44.10  ? 119  TRP A CZ2   1 
ATOM   942  C  CZ3   . TRP A 1 119 ? 36.182  -1.298  13.900  1.00 42.55  ? 119  TRP A CZ3   1 
ATOM   943  C  CH2   . TRP A 1 119 ? 35.205  -2.269  14.146  1.00 43.58  ? 119  TRP A CH2   1 
ATOM   944  N  N     . VAL A 1 120 ? 41.000  0.113   11.808  1.00 47.31  ? 120  VAL A N     1 
ATOM   945  C  CA    . VAL A 1 120 ? 42.143  0.942   12.156  1.00 47.78  ? 120  VAL A CA    1 
ATOM   946  C  C     . VAL A 1 120 ? 42.492  0.671   13.629  1.00 49.01  ? 120  VAL A C     1 
ATOM   947  O  O     . VAL A 1 120 ? 41.585  0.346   14.394  1.00 49.81  ? 120  VAL A O     1 
ATOM   948  C  CB    . VAL A 1 120 ? 41.810  2.412   11.874  1.00 47.23  ? 120  VAL A CB    1 
ATOM   949  C  CG1   . VAL A 1 120 ? 41.971  3.269   13.086  1.00 46.97  ? 120  VAL A CG1   1 
ATOM   950  C  CG2   . VAL A 1 120 ? 42.647  2.920   10.741  1.00 47.00  ? 120  VAL A CG2   1 
ATOM   951  N  N     . PRO A 1 121 ? 43.796  0.771   14.037  1.00 49.69  ? 121  PRO A N     1 
ATOM   952  C  CA    . PRO A 1 121 ? 44.234  0.423   15.409  1.00 49.87  ? 121  PRO A CA    1 
ATOM   953  C  C     . PRO A 1 121 ? 43.452  1.026   16.555  1.00 50.30  ? 121  PRO A C     1 
ATOM   954  O  O     . PRO A 1 121 ? 43.117  0.316   17.495  1.00 50.24  ? 121  PRO A O     1 
ATOM   955  C  CB    . PRO A 1 121 ? 45.664  0.941   15.449  1.00 49.47  ? 121  PRO A CB    1 
ATOM   956  C  CG    . PRO A 1 121 ? 46.134  0.695   14.096  1.00 49.40  ? 121  PRO A CG    1 
ATOM   957  C  CD    . PRO A 1 121 ? 44.973  1.061   13.194  1.00 49.67  ? 121  PRO A CD    1 
ATOM   958  N  N     . HIS A 1 122 ? 43.147  2.314   16.465  1.00 51.24  ? 122  HIS A N     1 
ATOM   959  C  CA    . HIS A 1 122 ? 42.663  3.056   17.617  1.00 52.51  ? 122  HIS A CA    1 
ATOM   960  C  C     . HIS A 1 122 ? 42.224  4.457   17.171  1.00 53.19  ? 122  HIS A C     1 
ATOM   961  O  O     . HIS A 1 122 ? 42.655  4.922   16.119  1.00 53.51  ? 122  HIS A O     1 
ATOM   962  C  CB    . HIS A 1 122 ? 43.814  3.080   18.630  1.00 52.60  ? 122  HIS A CB    1 
ATOM   963  C  CG    . HIS A 1 122 ? 43.718  4.146   19.668  1.00 53.41  ? 122  HIS A CG    1 
ATOM   964  N  ND1   . HIS A 1 122 ? 42.889  4.045   20.762  1.00 54.67  ? 122  HIS A ND1   1 
ATOM   965  C  CD2   . HIS A 1 122 ? 44.388  5.314   19.806  1.00 54.08  ? 122  HIS A CD2   1 
ATOM   966  C  CE1   . HIS A 1 122 ? 43.036  5.117   21.519  1.00 55.15  ? 122  HIS A CE1   1 
ATOM   967  N  NE2   . HIS A 1 122 ? 43.942  5.902   20.962  1.00 54.81  ? 122  HIS A NE2   1 
ATOM   968  N  N     . GLU A 1 123 ? 41.353  5.119   17.934  1.00 54.06  ? 123  GLU A N     1 
ATOM   969  C  CA    . GLU A 1 123 ? 40.946  6.505   17.610  1.00 55.00  ? 123  GLU A CA    1 
ATOM   970  C  C     . GLU A 1 123 ? 42.031  7.523   17.966  1.00 55.15  ? 123  GLU A C     1 
ATOM   971  O  O     . GLU A 1 123 ? 42.249  7.823   19.141  1.00 55.20  ? 123  GLU A O     1 
ATOM   972  C  CB    . GLU A 1 123 ? 39.619  6.882   18.287  1.00 55.23  ? 123  GLU A CB    1 
ATOM   973  C  CG    . GLU A 1 123 ? 38.378  6.813   17.376  1.00 57.05  ? 123  GLU A CG    1 
ATOM   974  C  CD    . GLU A 1 123 ? 38.102  8.116   16.598  1.00 59.36  ? 123  GLU A CD    1 
ATOM   975  O  OE1   . GLU A 1 123 ? 37.630  9.089   17.230  1.00 60.84  ? 123  GLU A OE1   1 
ATOM   976  O  OE2   . GLU A 1 123 ? 38.325  8.163   15.359  1.00 59.15  ? 123  GLU A OE2   1 
ATOM   977  N  N     . LEU A 1 124 ? 42.703  8.055   16.949  1.00 55.51  ? 124  LEU A N     1 
ATOM   978  C  CA    . LEU A 1 124 ? 43.850  8.938   17.173  1.00 55.88  ? 124  LEU A CA    1 
ATOM   979  C  C     . LEU A 1 124 ? 43.482  10.358  17.523  1.00 56.31  ? 124  LEU A C     1 
ATOM   980  O  O     . LEU A 1 124 ? 42.469  10.875  17.089  1.00 56.04  ? 124  LEU A O     1 
ATOM   981  C  CB    . LEU A 1 124 ? 44.788  8.951   15.971  1.00 55.72  ? 124  LEU A CB    1 
ATOM   982  C  CG    . LEU A 1 124 ? 45.662  7.725   15.736  1.00 55.28  ? 124  LEU A CG    1 
ATOM   983  C  CD1   . LEU A 1 124 ? 46.732  8.102   14.746  1.00 55.48  ? 124  LEU A CD1   1 
ATOM   984  C  CD2   . LEU A 1 124 ? 46.289  7.198   17.008  1.00 54.43  ? 124  LEU A CD2   1 
ATOM   985  N  N     . ASN A 1 125 ? 44.356  10.988  18.288  1.00 57.40  ? 125  ASN A N     1 
ATOM   986  C  CA    . ASN A 1 125 ? 44.130  12.320  18.806  1.00 58.63  ? 125  ASN A CA    1 
ATOM   987  C  C     . ASN A 1 125 ? 44.981  13.377  18.126  1.00 58.93  ? 125  ASN A C     1 
ATOM   988  O  O     . ASN A 1 125 ? 46.147  13.142  17.855  1.00 59.11  ? 125  ASN A O     1 
ATOM   989  C  CB    . ASN A 1 125 ? 44.432  12.328  20.288  1.00 58.89  ? 125  ASN A CB    1 
ATOM   990  C  CG    . ASN A 1 125 ? 43.897  13.535  20.966  1.00 60.75  ? 125  ASN A CG    1 
ATOM   991  O  OD1   . ASN A 1 125 ? 43.085  14.283  20.396  1.00 62.95  ? 125  ASN A OD1   1 
ATOM   992  N  ND2   . ASN A 1 125 ? 44.340  13.753  22.201  1.00 62.95  ? 125  ASN A ND2   1 
ATOM   993  N  N     . GLU A 1 126 ? 44.410  14.555  17.886  1.00 59.46  ? 126  GLU A N     1 
ATOM   994  C  CA    . GLU A 1 126 ? 45.080  15.574  17.073  1.00 60.05  ? 126  GLU A CA    1 
ATOM   995  C  C     . GLU A 1 126 ? 46.522  15.835  17.502  1.00 59.80  ? 126  GLU A C     1 
ATOM   996  O  O     . GLU A 1 126 ? 47.385  16.062  16.651  1.00 59.64  ? 126  GLU A O     1 
ATOM   997  C  CB    . GLU A 1 126 ? 44.286  16.877  17.035  1.00 60.61  ? 126  GLU A CB    1 
ATOM   998  C  CG    . GLU A 1 126 ? 44.655  17.773  15.842  1.00 62.63  ? 126  GLU A CG    1 
ATOM   999  C  CD    . GLU A 1 126 ? 45.014  19.203  16.263  1.00 65.54  ? 126  GLU A CD    1 
ATOM   1000 O  OE1   . GLU A 1 126 ? 44.309  19.777  17.133  1.00 66.70  ? 126  GLU A OE1   1 
ATOM   1001 O  OE2   . GLU A 1 126 ? 46.009  19.751  15.725  1.00 66.31  ? 126  GLU A OE2   1 
ATOM   1002 N  N     . ARG A 1 127 ? 46.777  15.806  18.810  1.00 59.73  ? 127  ARG A N     1 
ATOM   1003 C  CA    . ARG A 1 127 ? 48.151  15.778  19.302  1.00 59.80  ? 127  ARG A CA    1 
ATOM   1004 C  C     . ARG A 1 127 ? 48.788  14.473  18.825  1.00 59.19  ? 127  ARG A C     1 
ATOM   1005 O  O     . ARG A 1 127 ? 49.723  14.506  18.017  1.00 59.29  ? 127  ARG A O     1 
ATOM   1006 C  CB    . ARG A 1 127 ? 48.233  15.876  20.837  1.00 60.32  ? 127  ARG A CB    1 
ATOM   1007 C  CG    . ARG A 1 127 ? 49.647  16.254  21.372  1.00 62.17  ? 127  ARG A CG    1 
ATOM   1008 C  CD    . ARG A 1 127 ? 50.174  15.305  22.486  1.00 64.96  ? 127  ARG A CD    1 
ATOM   1009 N  NE    . ARG A 1 127 ? 51.415  15.802  23.106  1.00 66.67  ? 127  ARG A NE    1 
ATOM   1010 C  CZ    . ARG A 1 127 ? 52.468  15.049  23.442  1.00 67.06  ? 127  ARG A CZ    1 
ATOM   1011 N  NH1   . ARG A 1 127 ? 53.537  15.613  24.001  1.00 66.57  ? 127  ARG A NH1   1 
ATOM   1012 N  NH2   . ARG A 1 127 ? 52.466  13.740  23.209  1.00 67.23  ? 127  ARG A NH2   1 
ATOM   1013 N  N     . GLN A 1 128 ? 48.252  13.339  19.300  1.00 58.16  ? 128  GLN A N     1 
ATOM   1014 C  CA    . GLN A 1 128 ? 48.756  11.993  18.969  1.00 57.14  ? 128  GLN A CA    1 
ATOM   1015 C  C     . GLN A 1 128 ? 49.157  11.854  17.506  1.00 56.60  ? 128  GLN A C     1 
ATOM   1016 O  O     . GLN A 1 128 ? 49.992  11.033  17.160  1.00 56.38  ? 128  GLN A O     1 
ATOM   1017 C  CB    . GLN A 1 128 ? 47.710  10.925  19.302  1.00 57.09  ? 128  GLN A CB    1 
ATOM   1018 C  CG    . GLN A 1 128 ? 47.522  10.623  20.780  1.00 56.60  ? 128  GLN A CG    1 
ATOM   1019 C  CD    . GLN A 1 128 ? 46.476  9.545   21.028  1.00 55.67  ? 128  GLN A CD    1 
ATOM   1020 O  OE1   . GLN A 1 128 ? 45.280  9.770   20.866  1.00 55.16  ? 128  GLN A OE1   1 
ATOM   1021 N  NE2   . GLN A 1 128 ? 46.926  8.372   21.431  1.00 55.50  ? 128  GLN A NE2   1 
ATOM   1022 N  N     . MET A 1 129 ? 48.544  12.664  16.657  1.00 56.15  ? 129  MET A N     1 
ATOM   1023 C  CA    . MET A 1 129 ? 48.847  12.678  15.247  1.00 55.94  ? 129  MET A CA    1 
ATOM   1024 C  C     . MET A 1 129 ? 50.128  13.452  14.998  1.00 55.71  ? 129  MET A C     1 
ATOM   1025 O  O     . MET A 1 129 ? 51.077  12.897  14.458  1.00 55.72  ? 129  MET A O     1 
ATOM   1026 C  CB    . MET A 1 129 ? 47.672  13.252  14.456  1.00 56.15  ? 129  MET A CB    1 
ATOM   1027 C  CG    . MET A 1 129 ? 46.417  12.359  14.502  1.00 56.43  ? 129  MET A CG    1 
ATOM   1028 S  SD    . MET A 1 129 ? 44.990  12.968  13.571  1.00 56.94  ? 129  MET A SD    1 
ATOM   1029 C  CE    . MET A 1 129 ? 45.607  12.880  11.890  1.00 56.19  ? 129  MET A CE    1 
ATOM   1030 N  N     . GLU A 1 130 ? 50.170  14.719  15.413  1.00 55.46  ? 130  GLU A N     1 
ATOM   1031 C  CA    . GLU A 1 130 ? 51.404  15.525  15.334  1.00 55.40  ? 130  GLU A CA    1 
ATOM   1032 C  C     . GLU A 1 130 ? 52.603  14.751  15.882  1.00 54.70  ? 130  GLU A C     1 
ATOM   1033 O  O     . GLU A 1 130 ? 53.744  14.935  15.436  1.00 54.68  ? 130  GLU A O     1 
ATOM   1034 C  CB    . GLU A 1 130 ? 51.285  16.808  16.162  1.00 55.86  ? 130  GLU A CB    1 
ATOM   1035 C  CG    . GLU A 1 130 ? 50.192  17.800  15.775  1.00 57.39  ? 130  GLU A CG    1 
ATOM   1036 C  CD    . GLU A 1 130 ? 49.847  18.745  16.931  1.00 58.75  ? 130  GLU A CD    1 
ATOM   1037 O  OE1   . GLU A 1 130 ? 50.768  19.107  17.706  1.00 59.05  ? 130  GLU A OE1   1 
ATOM   1038 O  OE2   . GLU A 1 130 ? 48.657  19.114  17.069  1.00 59.08  ? 130  GLU A OE2   1 
ATOM   1039 N  N     . ARG A 1 131 ? 52.317  13.903  16.868  1.00 53.70  ? 131  ARG A N     1 
ATOM   1040 C  CA    . ARG A 1 131 ? 53.309  13.133  17.592  1.00 52.68  ? 131  ARG A CA    1 
ATOM   1041 C  C     . ARG A 1 131 ? 53.848  12.003  16.726  1.00 51.13  ? 131  ARG A C     1 
ATOM   1042 O  O     . ARG A 1 131 ? 55.025  11.686  16.779  1.00 51.15  ? 131  ARG A O     1 
ATOM   1043 C  CB    . ARG A 1 131 ? 52.671  12.579  18.866  1.00 53.27  ? 131  ARG A CB    1 
ATOM   1044 C  CG    . ARG A 1 131 ? 53.598  12.442  20.063  1.00 56.01  ? 131  ARG A CG    1 
ATOM   1045 C  CD    . ARG A 1 131 ? 54.267  11.054  20.095  1.00 60.88  ? 131  ARG A CD    1 
ATOM   1046 N  NE    . ARG A 1 131 ? 55.285  10.914  21.145  1.00 63.61  ? 131  ARG A NE    1 
ATOM   1047 C  CZ    . ARG A 1 131 ? 56.438  11.587  21.198  1.00 64.78  ? 131  ARG A CZ    1 
ATOM   1048 N  NH1   . ARG A 1 131 ? 56.756  12.496  20.274  1.00 64.89  ? 131  ARG A NH1   1 
ATOM   1049 N  NH2   . ARG A 1 131 ? 57.277  11.362  22.201  1.00 65.75  ? 131  ARG A NH2   1 
ATOM   1050 N  N     . ARG A 1 132 ? 52.988  11.401  15.918  1.00 49.45  ? 132  ARG A N     1 
ATOM   1051 C  CA    . ARG A 1 132 ? 53.423  10.334  15.024  1.00 47.79  ? 132  ARG A CA    1 
ATOM   1052 C  C     . ARG A 1 132 ? 54.160  10.948  13.872  1.00 47.13  ? 132  ARG A C     1 
ATOM   1053 O  O     . ARG A 1 132 ? 55.311  10.622  13.620  1.00 46.96  ? 132  ARG A O     1 
ATOM   1054 C  CB    . ARG A 1 132 ? 52.235  9.535   14.494  1.00 47.57  ? 132  ARG A CB    1 
ATOM   1055 C  CG    . ARG A 1 132 ? 51.465  8.791   15.569  1.00 45.63  ? 132  ARG A CG    1 
ATOM   1056 C  CD    . ARG A 1 132 ? 50.292  8.104   14.970  1.00 41.81  ? 132  ARG A CD    1 
ATOM   1057 N  NE    . ARG A 1 132 ? 50.685  6.858   14.340  1.00 38.82  ? 132  ARG A NE    1 
ATOM   1058 C  CZ    . ARG A 1 132 ? 50.222  6.437   13.175  1.00 37.67  ? 132  ARG A CZ    1 
ATOM   1059 N  NH1   . ARG A 1 132 ? 49.359  7.174   12.496  1.00 36.80  ? 132  ARG A NH1   1 
ATOM   1060 N  NH2   . ARG A 1 132 ? 50.629  5.279   12.689  1.00 37.34  ? 132  ARG A NH2   1 
ATOM   1061 N  N     . LYS A 1 133 ? 53.478  11.855  13.186  1.00 46.53  ? 133  LYS A N     1 
ATOM   1062 C  CA    . LYS A 1 133 ? 54.035  12.584  12.061  1.00 45.98  ? 133  LYS A CA    1 
ATOM   1063 C  C     . LYS A 1 133 ? 55.474  12.955  12.358  1.00 45.62  ? 133  LYS A C     1 
ATOM   1064 O  O     . LYS A 1 133 ? 56.347  12.725  11.538  1.00 45.55  ? 133  LYS A O     1 
ATOM   1065 C  CB    . LYS A 1 133 ? 53.211  13.845  11.782  1.00 46.01  ? 133  LYS A CB    1 
ATOM   1066 C  CG    . LYS A 1 133 ? 53.435  14.435  10.411  1.00 46.00  ? 133  LYS A CG    1 
ATOM   1067 C  CD    . LYS A 1 133 ? 53.373  15.954  10.437  1.00 46.42  ? 133  LYS A CD    1 
ATOM   1068 C  CE    . LYS A 1 133 ? 53.824  16.530  9.103   1.00 46.38  ? 133  LYS A CE    1 
ATOM   1069 N  NZ    . LYS A 1 133 ? 53.908  18.011  9.116   1.00 47.05  ? 133  LYS A NZ    1 
ATOM   1070 N  N     . ASN A 1 134 ? 55.717  13.493  13.549  1.00 45.25  ? 134  ASN A N     1 
ATOM   1071 C  CA    . ASN A 1 134 ? 57.048  13.933  13.927  1.00 44.99  ? 134  ASN A CA    1 
ATOM   1072 C  C     . ASN A 1 134 ? 58.093  12.863  13.986  1.00 44.33  ? 134  ASN A C     1 
ATOM   1073 O  O     . ASN A 1 134 ? 59.122  12.969  13.335  1.00 44.30  ? 134  ASN A O     1 
ATOM   1074 C  CB    . ASN A 1 134 ? 57.022  14.670  15.243  1.00 45.28  ? 134  ASN A CB    1 
ATOM   1075 C  CG    . ASN A 1 134 ? 57.134  16.134  15.040  1.00 47.09  ? 134  ASN A CG    1 
ATOM   1076 O  OD1   . ASN A 1 134 ? 58.208  16.645  14.674  1.00 48.34  ? 134  ASN A OD1   1 
ATOM   1077 N  ND2   . ASN A 1 134 ? 56.016  16.838  15.223  1.00 48.91  ? 134  ASN A ND2   1 
ATOM   1078 N  N     . THR A 1 135 ? 57.827  11.845  14.788  1.00 43.64  ? 135  THR A N     1 
ATOM   1079 C  CA    . THR A 1 135 ? 58.706  10.705  14.895  1.00 42.94  ? 135  THR A CA    1 
ATOM   1080 C  C     . THR A 1 135 ? 59.052  10.203  13.502  1.00 42.75  ? 135  THR A C     1 
ATOM   1081 O  O     . THR A 1 135 ? 60.235  10.103  13.162  1.00 42.63  ? 135  THR A O     1 
ATOM   1082 C  CB    . THR A 1 135 ? 58.041  9.607   15.691  1.00 42.79  ? 135  THR A CB    1 
ATOM   1083 O  OG1   . THR A 1 135 ? 57.320  10.196  16.774  1.00 42.63  ? 135  THR A OG1   1 
ATOM   1084 C  CG2   . THR A 1 135 ? 59.073  8.676   16.245  1.00 43.08  ? 135  THR A CG2   1 
ATOM   1085 N  N     . CYS A 1 136 ? 58.018  9.914   12.703  1.00 42.54  ? 136  CYS A N     1 
ATOM   1086 C  CA    . CYS A 1 136 ? 58.181  9.525   11.304  1.00 42.40  ? 136  CYS A CA    1 
ATOM   1087 C  C     . CYS A 1 136 ? 59.067  10.575  10.608  1.00 42.05  ? 136  CYS A C     1 
ATOM   1088 O  O     . CYS A 1 136 ? 60.115  10.237  10.061  1.00 42.08  ? 136  CYS A O     1 
ATOM   1089 C  CB    . CYS A 1 136 ? 56.816  9.343   10.603  1.00 42.48  ? 136  CYS A CB    1 
ATOM   1090 S  SG    . CYS A 1 136 ? 55.660  8.063   11.336  1.00 44.56  ? 136  CYS A SG    1 
ATOM   1091 N  N     . GLU A 1 137 ? 58.675  11.848  10.695  1.00 41.72  ? 137  GLU A N     1 
ATOM   1092 C  CA    . GLU A 1 137 ? 59.404  12.975  10.093  1.00 41.29  ? 137  GLU A CA    1 
ATOM   1093 C  C     . GLU A 1 137 ? 60.892  12.927  10.452  1.00 40.76  ? 137  GLU A C     1 
ATOM   1094 O  O     . GLU A 1 137 ? 61.765  12.936  9.572   1.00 40.62  ? 137  GLU A O     1 
ATOM   1095 C  CB    . GLU A 1 137 ? 58.801  14.294  10.595  1.00 41.46  ? 137  GLU A CB    1 
ATOM   1096 C  CG    . GLU A 1 137 ? 58.402  15.300  9.515   1.00 42.65  ? 137  GLU A CG    1 
ATOM   1097 C  CD    . GLU A 1 137 ? 57.429  16.391  10.015  1.00 44.27  ? 137  GLU A CD    1 
ATOM   1098 O  OE1   . GLU A 1 137 ? 56.750  16.196  11.059  1.00 44.43  ? 137  GLU A OE1   1 
ATOM   1099 O  OE2   . GLU A 1 137 ? 57.335  17.451  9.348   1.00 44.78  ? 137  GLU A OE2   1 
ATOM   1100 N  N     . ILE A 1 138 ? 61.155  12.856  11.757  1.00 40.20  ? 138  ILE A N     1 
ATOM   1101 C  CA    . ILE A 1 138 ? 62.511  12.832  12.326  1.00 39.48  ? 138  ILE A CA    1 
ATOM   1102 C  C     . ILE A 1 138 ? 63.302  11.587  11.904  1.00 38.85  ? 138  ILE A C     1 
ATOM   1103 O  O     . ILE A 1 138 ? 64.376  11.708  11.308  1.00 38.89  ? 138  ILE A O     1 
ATOM   1104 C  CB    . ILE A 1 138 ? 62.488  13.068  13.889  1.00 39.41  ? 138  ILE A CB    1 
ATOM   1105 C  CG1   . ILE A 1 138 ? 62.671  14.563  14.220  1.00 40.06  ? 138  ILE A CG1   1 
ATOM   1106 C  CG2   . ILE A 1 138 ? 63.562  12.274  14.608  1.00 38.82  ? 138  ILE A CG2   1 
ATOM   1107 C  CD1   . ILE A 1 138 ? 61.468  15.490  13.891  1.00 40.71  ? 138  ILE A CD1   1 
ATOM   1108 N  N     . LEU A 1 139 ? 62.756  10.406  12.176  1.00 37.86  ? 139  LEU A N     1 
ATOM   1109 C  CA    . LEU A 1 139 ? 63.416  9.163   11.818  1.00 37.10  ? 139  LEU A CA    1 
ATOM   1110 C  C     . LEU A 1 139 ? 63.753  9.071   10.345  1.00 37.07  ? 139  LEU A C     1 
ATOM   1111 O  O     . LEU A 1 139 ? 64.750  8.471   9.959   1.00 36.91  ? 139  LEU A O     1 
ATOM   1112 C  CB    . LEU A 1 139 ? 62.536  7.990   12.190  1.00 36.79  ? 139  LEU A CB    1 
ATOM   1113 C  CG    . LEU A 1 139 ? 62.754  7.525   13.613  1.00 36.04  ? 139  LEU A CG    1 
ATOM   1114 C  CD1   . LEU A 1 139 ? 61.471  6.979   14.144  1.00 36.21  ? 139  LEU A CD1   1 
ATOM   1115 C  CD2   . LEU A 1 139 ? 63.832  6.477   13.631  1.00 34.90  ? 139  LEU A CD2   1 
ATOM   1116 N  N     . LEU A 1 140 ? 62.908  9.668   9.524   1.00 37.20  ? 140  LEU A N     1 
ATOM   1117 C  CA    . LEU A 1 140 ? 63.043  9.562   8.087   1.00 37.52  ? 140  LEU A CA    1 
ATOM   1118 C  C     . LEU A 1 140 ? 64.195  10.420  7.595   1.00 37.81  ? 140  LEU A C     1 
ATOM   1119 O  O     . LEU A 1 140 ? 64.950  10.021  6.702   1.00 37.90  ? 140  LEU A O     1 
ATOM   1120 C  CB    . LEU A 1 140 ? 61.745  10.013  7.441   1.00 37.48  ? 140  LEU A CB    1 
ATOM   1121 C  CG    . LEU A 1 140 ? 61.388  9.536   6.044   1.00 37.72  ? 140  LEU A CG    1 
ATOM   1122 C  CD1   . LEU A 1 140 ? 61.716  8.068   5.847   1.00 37.96  ? 140  LEU A CD1   1 
ATOM   1123 C  CD2   . LEU A 1 140 ? 59.917  9.791   5.839   1.00 38.14  ? 140  LEU A CD2   1 
ATOM   1124 N  N     . SER A 1 141 ? 64.305  11.609  8.182   1.00 38.01  ? 141  SER A N     1 
ATOM   1125 C  CA    . SER A 1 141 ? 65.382  12.527  7.899   1.00 38.11  ? 141  SER A CA    1 
ATOM   1126 C  C     . SER A 1 141 ? 66.708  11.855  8.248   1.00 38.13  ? 141  SER A C     1 
ATOM   1127 O  O     . SER A 1 141 ? 67.550  11.640  7.377   1.00 37.99  ? 141  SER A O     1 
ATOM   1128 C  CB    . SER A 1 141 ? 65.163  13.801  8.707   1.00 38.13  ? 141  SER A CB    1 
ATOM   1129 O  OG    . SER A 1 141 ? 66.364  14.231  9.320   1.00 38.92  ? 141  SER A OG    1 
ATOM   1130 N  N     . ARG A 1 142 ? 66.849  11.508  9.525   1.00 38.41  ? 142  ARG A N     1 
ATOM   1131 C  CA    . ARG A 1 142 ? 67.966  10.730  10.076  1.00 38.92  ? 142  ARG A CA    1 
ATOM   1132 C  C     . ARG A 1 142 ? 68.295  9.448   9.285   1.00 38.87  ? 142  ARG A C     1 
ATOM   1133 O  O     . ARG A 1 142 ? 69.397  8.919   9.377   1.00 38.71  ? 142  ARG A O     1 
ATOM   1134 C  CB    . ARG A 1 142 ? 67.640  10.372  11.543  1.00 39.21  ? 142  ARG A CB    1 
ATOM   1135 C  CG    . ARG A 1 142 ? 68.839  10.022  12.432  1.00 40.29  ? 142  ARG A CG    1 
ATOM   1136 C  CD    . ARG A 1 142 ? 68.505  9.988   13.952  1.00 41.18  ? 142  ARG A CD    1 
ATOM   1137 N  NE    . ARG A 1 142 ? 68.343  8.635   14.519  1.00 41.63  ? 142  ARG A NE    1 
ATOM   1138 C  CZ    . ARG A 1 142 ? 69.239  7.635   14.457  1.00 41.47  ? 142  ARG A CZ    1 
ATOM   1139 N  NH1   . ARG A 1 142 ? 70.396  7.765   13.815  1.00 41.32  ? 142  ARG A NH1   1 
ATOM   1140 N  NH2   . ARG A 1 142 ? 68.968  6.471   15.033  1.00 40.81  ? 142  ARG A NH2   1 
ATOM   1141 N  N     . TYR A 1 143 ? 67.330  8.946   8.522   1.00 39.08  ? 143  TYR A N     1 
ATOM   1142 C  CA    . TYR A 1 143 ? 67.544  7.774   7.687   1.00 39.18  ? 143  TYR A CA    1 
ATOM   1143 C  C     . TYR A 1 143 ? 68.379  8.112   6.483   1.00 39.38  ? 143  TYR A C     1 
ATOM   1144 O  O     . TYR A 1 143 ? 69.352  7.430   6.196   1.00 39.32  ? 143  TYR A O     1 
ATOM   1145 C  CB    . TYR A 1 143 ? 66.218  7.227   7.190   1.00 39.22  ? 143  TYR A CB    1 
ATOM   1146 C  CG    . TYR A 1 143 ? 66.352  6.206   6.080   1.00 39.30  ? 143  TYR A CG    1 
ATOM   1147 C  CD1   . TYR A 1 143 ? 66.529  4.859   6.376   1.00 39.43  ? 143  TYR A CD1   1 
ATOM   1148 C  CD2   . TYR A 1 143 ? 66.281  6.581   4.739   1.00 38.96  ? 143  TYR A CD2   1 
ATOM   1149 C  CE1   . TYR A 1 143 ? 66.638  3.919   5.380   1.00 39.30  ? 143  TYR A CE1   1 
ATOM   1150 C  CE2   . TYR A 1 143 ? 66.389  5.636   3.730   1.00 38.93  ? 143  TYR A CE2   1 
ATOM   1151 C  CZ    . TYR A 1 143 ? 66.568  4.309   4.066   1.00 39.45  ? 143  TYR A CZ    1 
ATOM   1152 O  OH    . TYR A 1 143 ? 66.689  3.348   3.101   1.00 40.45  ? 143  TYR A OH    1 
ATOM   1153 N  N     . LYS A 1 144 ? 67.966  9.155   5.769   1.00 39.88  ? 144  LYS A N     1 
ATOM   1154 C  CA    . LYS A 1 144 ? 68.591  9.536   4.511   1.00 40.45  ? 144  LYS A CA    1 
ATOM   1155 C  C     . LYS A 1 144 ? 70.034  10.033  4.656   1.00 40.15  ? 144  LYS A C     1 
ATOM   1156 O  O     . LYS A 1 144 ? 70.821  9.909   3.720   1.00 40.25  ? 144  LYS A O     1 
ATOM   1157 C  CB    . LYS A 1 144 ? 67.721  10.539  3.748   1.00 40.94  ? 144  LYS A CB    1 
ATOM   1158 C  CG    . LYS A 1 144 ? 68.284  10.916  2.369   1.00 43.21  ? 144  LYS A CG    1 
ATOM   1159 C  CD    . LYS A 1 144 ? 67.209  11.381  1.380   1.00 46.71  ? 144  LYS A CD    1 
ATOM   1160 C  CE    . LYS A 1 144 ? 67.853  12.022  0.134   1.00 48.07  ? 144  LYS A CE    1 
ATOM   1161 N  NZ    . LYS A 1 144 ? 66.913  12.135  -1.031  1.00 49.50  ? 144  LYS A NZ    1 
ATOM   1162 N  N     . ARG A 1 145 ? 70.379  10.588  5.817   1.00 39.86  ? 145  ARG A N     1 
ATOM   1163 C  CA    . ARG A 1 145 ? 71.763  10.973  6.104   1.00 39.54  ? 145  ARG A CA    1 
ATOM   1164 C  C     . ARG A 1 145 ? 72.672  9.748   6.009   1.00 38.79  ? 145  ARG A C     1 
ATOM   1165 O  O     . ARG A 1 145 ? 73.767  9.822   5.465   1.00 38.76  ? 145  ARG A O     1 
ATOM   1166 C  CB    . ARG A 1 145 ? 71.898  11.631  7.487   1.00 39.84  ? 145  ARG A CB    1 
ATOM   1167 C  CG    . ARG A 1 145 ? 70.707  12.496  7.900   1.00 42.14  ? 145  ARG A CG    1 
ATOM   1168 C  CD    . ARG A 1 145 ? 71.090  13.717  8.751   1.00 46.00  ? 145  ARG A CD    1 
ATOM   1169 N  NE    . ARG A 1 145 ? 71.252  14.942  7.941   1.00 49.47  ? 145  ARG A NE    1 
ATOM   1170 C  CZ    . ARG A 1 145 ? 70.298  15.858  7.704   1.00 50.47  ? 145  ARG A CZ    1 
ATOM   1171 N  NH1   . ARG A 1 145 ? 69.072  15.724  8.215   1.00 50.37  ? 145  ARG A NH1   1 
ATOM   1172 N  NH2   . ARG A 1 145 ? 70.575  16.927  6.951   1.00 50.49  ? 145  ARG A NH2   1 
ATOM   1173 N  N     . LYS A 1 146 ? 72.192  8.618   6.522   1.00 38.23  ? 146  LYS A N     1 
ATOM   1174 C  CA    . LYS A 1 146 ? 72.946  7.356   6.544   1.00 37.66  ? 146  LYS A CA    1 
ATOM   1175 C  C     . LYS A 1 146 ? 72.004  6.228   6.974   1.00 36.92  ? 146  LYS A C     1 
ATOM   1176 O  O     . LYS A 1 146 ? 71.504  6.249   8.095   1.00 36.66  ? 146  LYS A O     1 
ATOM   1177 C  CB    . LYS A 1 146 ? 74.153  7.474   7.503   1.00 37.80  ? 146  LYS A CB    1 
ATOM   1178 C  CG    . LYS A 1 146 ? 74.926  6.187   7.817   1.00 38.07  ? 146  LYS A CG    1 
ATOM   1179 C  CD    . LYS A 1 146 ? 76.089  5.943   6.858   1.00 38.55  ? 146  LYS A CD    1 
ATOM   1180 C  CE    . LYS A 1 146 ? 77.359  5.469   7.597   1.00 39.23  ? 146  LYS A CE    1 
ATOM   1181 N  NZ    . LYS A 1 146 ? 77.179  4.366   8.605   1.00 39.08  ? 146  LYS A NZ    1 
ATOM   1182 N  N     . SER A 1 147 ? 71.748  5.269   6.081   1.00 36.13  ? 147  SER A N     1 
ATOM   1183 C  CA    . SER A 1 147 ? 70.876  4.134   6.398   1.00 35.55  ? 147  SER A CA    1 
ATOM   1184 C  C     . SER A 1 147 ? 71.318  3.408   7.658   1.00 34.93  ? 147  SER A C     1 
ATOM   1185 O  O     . SER A 1 147 ? 72.504  3.205   7.874   1.00 34.98  ? 147  SER A O     1 
ATOM   1186 C  CB    . SER A 1 147 ? 70.837  3.132   5.255   1.00 35.85  ? 147  SER A CB    1 
ATOM   1187 O  OG    . SER A 1 147 ? 70.256  1.907   5.693   1.00 36.37  ? 147  SER A OG    1 
ATOM   1188 N  N     . PHE A 1 148 ? 70.360  3.004   8.479   1.00 34.15  ? 148  PHE A N     1 
ATOM   1189 C  CA    . PHE A 1 148 ? 70.692  2.368   9.738   1.00 33.62  ? 148  PHE A CA    1 
ATOM   1190 C  C     . PHE A 1 148 ? 69.853  1.139   10.045  1.00 33.81  ? 148  PHE A C     1 
ATOM   1191 O  O     . PHE A 1 148 ? 69.956  0.594   11.142  1.00 34.14  ? 148  PHE A O     1 
ATOM   1192 C  CB    . PHE A 1 148 ? 70.622  3.369   10.907  1.00 33.28  ? 148  PHE A CB    1 
ATOM   1193 C  CG    . PHE A 1 148 ? 69.278  4.020   11.086  1.00 32.10  ? 148  PHE A CG    1 
ATOM   1194 C  CD1   . PHE A 1 148 ? 68.175  3.285   11.490  1.00 31.51  ? 148  PHE A CD1   1 
ATOM   1195 C  CD2   . PHE A 1 148 ? 69.124  5.377   10.877  1.00 31.76  ? 148  PHE A CD2   1 
ATOM   1196 C  CE1   . PHE A 1 148 ? 66.939  3.884   11.652  1.00 30.70  ? 148  PHE A CE1   1 
ATOM   1197 C  CE2   . PHE A 1 148 ? 67.893  5.983   11.035  1.00 31.12  ? 148  PHE A CE2   1 
ATOM   1198 C  CZ    . PHE A 1 148 ? 66.798  5.233   11.423  1.00 30.49  ? 148  PHE A CZ    1 
ATOM   1199 N  N     . LEU A 1 149 ? 69.033  0.693   9.101   1.00 33.66  ? 149  LEU A N     1 
ATOM   1200 C  CA    . LEU A 1 149 ? 68.224  -0.501  9.325   1.00 33.84  ? 149  LEU A CA    1 
ATOM   1201 C  C     . LEU A 1 149 ? 69.144  -1.702  9.551   1.00 34.17  ? 149  LEU A C     1 
ATOM   1202 O  O     . LEU A 1 149 ? 68.896  -2.564  10.386  1.00 33.94  ? 149  LEU A O     1 
ATOM   1203 C  CB    . LEU A 1 149 ? 67.306  -0.775  8.134   1.00 33.87  ? 149  LEU A CB    1 
ATOM   1204 C  CG    . LEU A 1 149 ? 66.521  0.296   7.358   1.00 33.91  ? 149  LEU A CG    1 
ATOM   1205 C  CD1   . LEU A 1 149 ? 65.903  1.389   8.247   1.00 33.49  ? 149  LEU A CD1   1 
ATOM   1206 C  CD2   . LEU A 1 149 ? 67.387  0.894   6.246   1.00 34.72  ? 149  LEU A CD2   1 
ATOM   1207 N  N     . HIS A 1 150 ? 70.224  -1.717  8.785   1.00 34.91  ? 150  HIS A N     1 
ATOM   1208 C  CA    . HIS A 1 150 ? 71.303  -2.700  8.862   1.00 35.46  ? 150  HIS A CA    1 
ATOM   1209 C  C     . HIS A 1 150 ? 71.718  -2.985  10.314  1.00 34.87  ? 150  HIS A C     1 
ATOM   1210 O  O     . HIS A 1 150 ? 72.118  -4.099  10.633  1.00 34.96  ? 150  HIS A O     1 
ATOM   1211 C  CB    . HIS A 1 150 ? 72.456  -2.228  7.933   1.00 36.11  ? 150  HIS A CB    1 
ATOM   1212 C  CG    . HIS A 1 150 ? 71.954  -1.678  6.611   1.00 39.02  ? 150  HIS A CG    1 
ATOM   1213 N  ND1   . HIS A 1 150 ? 71.590  -2.486  5.546   1.00 41.04  ? 150  HIS A ND1   1 
ATOM   1214 C  CD2   . HIS A 1 150 ? 71.682  -0.405  6.217   1.00 39.87  ? 150  HIS A CD2   1 
ATOM   1215 C  CE1   . HIS A 1 150 ? 71.145  -1.734  4.550   1.00 40.51  ? 150  HIS A CE1   1 
ATOM   1216 N  NE2   . HIS A 1 150 ? 71.188  -0.469  4.931   1.00 39.91  ? 150  HIS A NE2   1 
ATOM   1217 N  N     . ARG A 1 151 ? 71.538  -1.992  11.189  1.00 34.31  ? 151  ARG A N     1 
ATOM   1218 C  CA    . ARG A 1 151 ? 71.829  -2.082  12.631  1.00 33.61  ? 151  ARG A CA    1 
ATOM   1219 C  C     . ARG A 1 151 ? 70.664  -2.552  13.484  1.00 33.05  ? 151  ARG A C     1 
ATOM   1220 O  O     . ARG A 1 151 ? 70.865  -3.104  14.565  1.00 33.14  ? 151  ARG A O     1 
ATOM   1221 C  CB    . ARG A 1 151 ? 72.173  -0.705  13.186  1.00 33.63  ? 151  ARG A CB    1 
ATOM   1222 C  CG    . ARG A 1 151 ? 73.569  -0.220  12.996  1.00 34.09  ? 151  ARG A CG    1 
ATOM   1223 C  CD    . ARG A 1 151 ? 73.661  1.113   13.679  1.00 35.40  ? 151  ARG A CD    1 
ATOM   1224 N  NE    . ARG A 1 151 ? 74.955  1.727   13.473  1.00 38.20  ? 151  ARG A NE    1 
ATOM   1225 C  CZ    . ARG A 1 151 ? 75.165  2.847   12.791  1.00 39.93  ? 151  ARG A CZ    1 
ATOM   1226 N  NH1   . ARG A 1 151 ? 74.147  3.514   12.250  1.00 39.45  ? 151  ARG A NH1   1 
ATOM   1227 N  NH2   . ARG A 1 151 ? 76.410  3.309   12.666  1.00 41.81  ? 151  ARG A NH2   1 
ATOM   1228 N  N     . ILE A 1 152 ? 69.450  -2.295  13.008  1.00 32.35  ? 152  ILE A N     1 
ATOM   1229 C  CA    . ILE A 1 152 ? 68.254  -2.218  13.864  1.00 31.45  ? 152  ILE A CA    1 
ATOM   1230 C  C     . ILE A 1 152 ? 67.707  -3.567  14.366  1.00 30.91  ? 152  ILE A C     1 
ATOM   1231 O  O     . ILE A 1 152 ? 67.402  -4.468  13.587  1.00 30.64  ? 152  ILE A O     1 
ATOM   1232 C  CB    . ILE A 1 152 ? 67.165  -1.257  13.210  1.00 31.44  ? 152  ILE A CB    1 
ATOM   1233 C  CG1   . ILE A 1 152 ? 66.250  -0.632  14.245  1.00 31.01  ? 152  ILE A CG1   1 
ATOM   1234 C  CG2   . ILE A 1 152 ? 66.362  -1.912  12.099  1.00 31.39  ? 152  ILE A CG2   1 
ATOM   1235 C  CD1   . ILE A 1 152 ? 65.062  -1.450  14.555  1.00 31.88  ? 152  ILE A CD1   1 
ATOM   1236 N  N     . VAL A 1 153 ? 67.638  -3.708  15.685  1.00 30.51  ? 153  VAL A N     1 
ATOM   1237 C  CA    . VAL A 1 153 ? 67.047  -4.892  16.297  1.00 30.11  ? 153  VAL A CA    1 
ATOM   1238 C  C     . VAL A 1 153 ? 65.746  -4.504  16.971  1.00 30.19  ? 153  VAL A C     1 
ATOM   1239 O  O     . VAL A 1 153 ? 65.689  -3.576  17.786  1.00 29.81  ? 153  VAL A O     1 
ATOM   1240 C  CB    . VAL A 1 153 ? 68.000  -5.625  17.281  1.00 29.85  ? 153  VAL A CB    1 
ATOM   1241 C  CG1   . VAL A 1 153 ? 68.085  -4.903  18.572  1.00 29.66  ? 153  VAL A CG1   1 
ATOM   1242 C  CG2   . VAL A 1 153 ? 67.518  -7.029  17.549  1.00 29.40  ? 153  VAL A CG2   1 
ATOM   1243 N  N     . THR A 1 154 ? 64.701  -5.226  16.601  1.00 30.54  ? 154  THR A N     1 
ATOM   1244 C  CA    . THR A 1 154 ? 63.370  -4.912  17.034  1.00 30.95  ? 154  THR A CA    1 
ATOM   1245 C  C     . THR A 1 154 ? 62.672  -6.140  17.574  1.00 31.45  ? 154  THR A C     1 
ATOM   1246 O  O     . THR A 1 154 ? 63.045  -7.271  17.269  1.00 31.05  ? 154  THR A O     1 
ATOM   1247 C  CB    . THR A 1 154 ? 62.570  -4.291  15.886  1.00 30.91  ? 154  THR A CB    1 
ATOM   1248 O  OG1   . THR A 1 154 ? 61.599  -3.388  16.424  1.00 31.45  ? 154  THR A OG1   1 
ATOM   1249 C  CG2   . THR A 1 154 ? 61.892  -5.355  15.022  1.00 30.59  ? 154  THR A CG2   1 
ATOM   1250 N  N     . GLY A 1 155 ? 61.660  -5.898  18.393  1.00 32.48  ? 155  GLY A N     1 
ATOM   1251 C  CA    . GLY A 1 155 ? 60.897  -6.968  19.002  1.00 34.12  ? 155  GLY A CA    1 
ATOM   1252 C  C     . GLY A 1 155 ? 59.589  -6.517  19.616  1.00 35.18  ? 155  GLY A C     1 
ATOM   1253 O  O     . GLY A 1 155 ? 59.413  -5.341  19.957  1.00 35.45  ? 155  GLY A O     1 
ATOM   1254 N  N     . ASP A 1 156 ? 58.664  -7.463  19.741  1.00 36.18  ? 156  ASP A N     1 
ATOM   1255 C  CA    . ASP A 1 156 ? 57.421  -7.231  20.464  1.00 37.17  ? 156  ASP A CA    1 
ATOM   1256 C  C     . ASP A 1 156 ? 56.940  -8.532  21.088  1.00 37.40  ? 156  ASP A C     1 
ATOM   1257 O  O     . ASP A 1 156 ? 57.731  -9.458  21.300  1.00 37.38  ? 156  ASP A O     1 
ATOM   1258 C  CB    . ASP A 1 156 ? 56.339  -6.605  19.557  1.00 37.59  ? 156  ASP A CB    1 
ATOM   1259 C  CG    . ASP A 1 156 ? 55.247  -5.864  20.351  1.00 38.21  ? 156  ASP A CG    1 
ATOM   1260 O  OD1   . ASP A 1 156 ? 54.238  -5.440  19.733  1.00 38.00  ? 156  ASP A OD1   1 
ATOM   1261 O  OD2   . ASP A 1 156 ? 55.396  -5.713  21.591  1.00 38.61  ? 156  ASP A OD2   1 
ATOM   1262 N  N     . GLU A 1 157 ? 55.640  -8.583  21.370  1.00 37.66  ? 157  GLU A N     1 
ATOM   1263 C  CA    . GLU A 1 157 ? 55.025  -9.654  22.127  1.00 38.07  ? 157  GLU A CA    1 
ATOM   1264 C  C     . GLU A 1 157 ? 53.576  -9.770  21.719  1.00 37.60  ? 157  GLU A C     1 
ATOM   1265 O  O     . GLU A 1 157 ? 52.858  -8.783  21.679  1.00 37.83  ? 157  GLU A O     1 
ATOM   1266 C  CB    . GLU A 1 157 ? 55.155  -9.402  23.638  1.00 38.42  ? 157  GLU A CB    1 
ATOM   1267 C  CG    . GLU A 1 157 ? 54.972  -7.936  24.067  1.00 41.09  ? 157  GLU A CG    1 
ATOM   1268 C  CD    . GLU A 1 157 ? 56.043  -7.423  25.064  1.00 44.95  ? 157  GLU A CD    1 
ATOM   1269 O  OE1   . GLU A 1 157 ? 56.951  -8.197  25.480  1.00 46.47  ? 157  GLU A OE1   1 
ATOM   1270 O  OE2   . GLU A 1 157 ? 55.972  -6.221  25.429  1.00 45.70  ? 157  GLU A OE2   1 
ATOM   1271 N  N     . LYS A 1 158 ? 53.164  -10.990 21.403  1.00 37.29  ? 158  LYS A N     1 
ATOM   1272 C  CA    . LYS A 1 158 ? 51.812  -11.282 20.937  1.00 36.82  ? 158  LYS A CA    1 
ATOM   1273 C  C     . LYS A 1 158 ? 51.349  -12.581 21.558  1.00 36.39  ? 158  LYS A C     1 
ATOM   1274 O  O     . LYS A 1 158 ? 52.153  -13.472 21.783  1.00 36.36  ? 158  LYS A O     1 
ATOM   1275 C  CB    . LYS A 1 158 ? 51.799  -11.419 19.410  1.00 36.93  ? 158  LYS A CB    1 
ATOM   1276 C  CG    . LYS A 1 158 ? 50.556  -12.112 18.845  1.00 36.53  ? 158  LYS A CG    1 
ATOM   1277 C  CD    . LYS A 1 158 ? 50.833  -12.761 17.501  1.00 35.69  ? 158  LYS A CD    1 
ATOM   1278 C  CE    . LYS A 1 158 ? 49.796  -13.809 17.164  1.00 34.70  ? 158  LYS A CE    1 
ATOM   1279 N  NZ    . LYS A 1 158 ? 48.444  -13.221 17.055  1.00 35.16  ? 158  LYS A NZ    1 
ATOM   1280 N  N     . TRP A 1 159 ? 50.051  -12.690 21.817  1.00 36.04  ? 159  TRP A N     1 
ATOM   1281 C  CA    . TRP A 1 159 ? 49.478  -13.910 22.374  1.00 35.77  ? 159  TRP A CA    1 
ATOM   1282 C  C     . TRP A 1 159 ? 49.405  -14.996 21.326  1.00 35.16  ? 159  TRP A C     1 
ATOM   1283 O  O     . TRP A 1 159 ? 49.229  -14.716 20.170  1.00 35.23  ? 159  TRP A O     1 
ATOM   1284 C  CB    . TRP A 1 159 ? 48.080  -13.622 22.913  1.00 35.99  ? 159  TRP A CB    1 
ATOM   1285 C  CG    . TRP A 1 159 ? 48.072  -12.786 24.182  1.00 37.17  ? 159  TRP A CG    1 
ATOM   1286 C  CD1   . TRP A 1 159 ? 47.728  -11.464 24.305  1.00 37.81  ? 159  TRP A CD1   1 
ATOM   1287 C  CD2   . TRP A 1 159 ? 48.424  -13.228 25.496  1.00 37.93  ? 159  TRP A CD2   1 
ATOM   1288 N  NE1   . TRP A 1 159 ? 47.837  -11.062 25.617  1.00 37.43  ? 159  TRP A NE1   1 
ATOM   1289 C  CE2   . TRP A 1 159 ? 48.266  -12.123 26.366  1.00 37.78  ? 159  TRP A CE2   1 
ATOM   1290 C  CE3   . TRP A 1 159 ? 48.853  -14.454 26.024  1.00 38.42  ? 159  TRP A CE3   1 
ATOM   1291 C  CZ2   . TRP A 1 159 ? 48.522  -12.206 27.725  1.00 38.66  ? 159  TRP A CZ2   1 
ATOM   1292 C  CZ3   . TRP A 1 159 ? 49.109  -14.542 27.373  1.00 39.30  ? 159  TRP A CZ3   1 
ATOM   1293 C  CH2   . TRP A 1 159 ? 48.946  -13.421 28.213  1.00 40.19  ? 159  TRP A CH2   1 
ATOM   1294 N  N     . ILE A 1 160 ? 49.566  -16.240 21.721  1.00 35.01  ? 160  ILE A N     1 
ATOM   1295 C  CA    . ILE A 1 160 ? 49.259  -17.320 20.816  1.00 35.35  ? 160  ILE A CA    1 
ATOM   1296 C  C     . ILE A 1 160 ? 48.157  -18.147 21.433  1.00 36.45  ? 160  ILE A C     1 
ATOM   1297 O  O     . ILE A 1 160 ? 48.391  -18.932 22.342  1.00 36.98  ? 160  ILE A O     1 
ATOM   1298 C  CB    . ILE A 1 160 ? 50.467  -18.193 20.526  1.00 34.83  ? 160  ILE A CB    1 
ATOM   1299 C  CG1   . ILE A 1 160 ? 51.388  -17.482 19.553  1.00 34.54  ? 160  ILE A CG1   1 
ATOM   1300 C  CG2   . ILE A 1 160 ? 50.033  -19.485 19.895  1.00 34.45  ? 160  ILE A CG2   1 
ATOM   1301 C  CD1   . ILE A 1 160 ? 52.518  -18.331 19.069  1.00 34.03  ? 160  ILE A CD1   1 
ATOM   1302 N  N     . PHE A 1 161 ? 46.937  -17.960 20.964  1.00 37.65  ? 161  PHE A N     1 
ATOM   1303 C  CA    . PHE A 1 161 ? 45.838  -18.754 21.466  1.00 38.79  ? 161  PHE A CA    1 
ATOM   1304 C  C     . PHE A 1 161 ? 46.093  -20.236 21.168  1.00 39.14  ? 161  PHE A C     1 
ATOM   1305 O  O     . PHE A 1 161 ? 46.779  -20.570 20.207  1.00 39.16  ? 161  PHE A O     1 
ATOM   1306 C  CB    . PHE A 1 161 ? 44.542  -18.257 20.850  1.00 39.32  ? 161  PHE A CB    1 
ATOM   1307 C  CG    . PHE A 1 161 ? 43.829  -17.243 21.691  1.00 41.13  ? 161  PHE A CG    1 
ATOM   1308 C  CD1   . PHE A 1 161 ? 42.533  -17.495 22.154  1.00 44.25  ? 161  PHE A CD1   1 
ATOM   1309 C  CD2   . PHE A 1 161 ? 44.442  -16.049 22.028  1.00 42.37  ? 161  PHE A CD2   1 
ATOM   1310 C  CE1   . PHE A 1 161 ? 41.854  -16.567 22.940  1.00 45.33  ? 161  PHE A CE1   1 
ATOM   1311 C  CE2   . PHE A 1 161 ? 43.782  -15.107 22.813  1.00 44.57  ? 161  PHE A CE2   1 
ATOM   1312 C  CZ    . PHE A 1 161 ? 42.484  -15.367 23.276  1.00 45.93  ? 161  PHE A CZ    1 
ATOM   1313 N  N     . PHE A 1 162 ? 45.580  -21.120 22.013  1.00 39.73  ? 162  PHE A N     1 
ATOM   1314 C  CA    . PHE A 1 162 ? 45.857  -22.545 21.863  1.00 40.50  ? 162  PHE A CA    1 
ATOM   1315 C  C     . PHE A 1 162 ? 44.970  -23.186 20.813  1.00 40.82  ? 162  PHE A C     1 
ATOM   1316 O  O     . PHE A 1 162 ? 45.361  -24.163 20.185  1.00 40.96  ? 162  PHE A O     1 
ATOM   1317 C  CB    . PHE A 1 162 ? 45.705  -23.270 23.198  1.00 40.79  ? 162  PHE A CB    1 
ATOM   1318 C  CG    . PHE A 1 162 ? 46.990  -23.425 23.954  1.00 42.00  ? 162  PHE A CG    1 
ATOM   1319 C  CD1   . PHE A 1 162 ? 47.713  -22.303 24.372  1.00 42.54  ? 162  PHE A CD1   1 
ATOM   1320 C  CD2   . PHE A 1 162 ? 47.478  -24.697 24.262  1.00 43.15  ? 162  PHE A CD2   1 
ATOM   1321 C  CE1   . PHE A 1 162 ? 48.902  -22.436 25.068  1.00 42.51  ? 162  PHE A CE1   1 
ATOM   1322 C  CE2   . PHE A 1 162 ? 48.673  -24.850 24.966  1.00 43.57  ? 162  PHE A CE2   1 
ATOM   1323 C  CZ    . PHE A 1 162 ? 49.388  -23.714 25.370  1.00 43.73  ? 162  PHE A CZ    1 
ATOM   1324 N  N     . VAL A 1 163 ? 43.769  -22.648 20.649  1.00 41.12  ? 163  VAL A N     1 
ATOM   1325 C  CA    . VAL A 1 163 ? 42.918  -23.011 19.528  1.00 41.67  ? 163  VAL A CA    1 
ATOM   1326 C  C     . VAL A 1 163 ? 42.511  -21.726 18.770  1.00 42.25  ? 163  VAL A C     1 
ATOM   1327 O  O     . VAL A 1 163 ? 42.146  -20.706 19.391  1.00 42.58  ? 163  VAL A O     1 
ATOM   1328 C  CB    . VAL A 1 163 ? 41.698  -23.848 19.990  1.00 41.54  ? 163  VAL A CB    1 
ATOM   1329 C  CG1   . VAL A 1 163 ? 40.935  -23.129 21.104  1.00 41.85  ? 163  VAL A CG1   1 
ATOM   1330 C  CG2   . VAL A 1 163 ? 40.769  -24.210 18.804  1.00 41.24  ? 163  VAL A CG2   1 
ATOM   1331 N  N     . ASN A 1 164 ? 42.598  -21.770 17.438  1.00 42.39  ? 164  ASN A N     1 
ATOM   1332 C  CA    . ASN A 1 164 ? 42.250  -20.616 16.603  1.00 42.55  ? 164  ASN A CA    1 
ATOM   1333 C  C     . ASN A 1 164 ? 41.169  -20.929 15.562  1.00 42.22  ? 164  ASN A C     1 
ATOM   1334 O  O     . ASN A 1 164 ? 41.484  -21.205 14.401  1.00 42.41  ? 164  ASN A O     1 
ATOM   1335 C  CB    . ASN A 1 164 ? 43.499  -20.054 15.919  1.00 42.90  ? 164  ASN A CB    1 
ATOM   1336 C  CG    . ASN A 1 164 ? 44.596  -19.706 16.907  1.00 44.34  ? 164  ASN A CG    1 
ATOM   1337 O  OD1   . ASN A 1 164 ? 45.527  -20.491 17.110  1.00 45.44  ? 164  ASN A OD1   1 
ATOM   1338 N  ND2   . ASN A 1 164 ? 44.489  -18.530 17.539  1.00 45.79  ? 164  ASN A ND2   1 
ATOM   1339 N  N     . PRO A 1 165 ? 39.885  -20.891 15.973  1.00 41.67  ? 165  PRO A N     1 
ATOM   1340 C  CA    . PRO A 1 165 ? 38.829  -21.129 15.007  1.00 41.07  ? 165  PRO A CA    1 
ATOM   1341 C  C     . PRO A 1 165 ? 38.465  -19.867 14.251  1.00 40.81  ? 165  PRO A C     1 
ATOM   1342 O  O     . PRO A 1 165 ? 38.727  -18.749 14.700  1.00 40.67  ? 165  PRO A O     1 
ATOM   1343 C  CB    . PRO A 1 165 ? 37.648  -21.588 15.863  1.00 41.01  ? 165  PRO A CB    1 
ATOM   1344 C  CG    . PRO A 1 165 ? 38.074  -21.433 17.303  1.00 41.22  ? 165  PRO A CG    1 
ATOM   1345 C  CD    . PRO A 1 165 ? 39.343  -20.654 17.320  1.00 41.55  ? 165  PRO A CD    1 
ATOM   1346 N  N     . LYS A 1 166 ? 37.869  -20.077 13.092  1.00 40.61  ? 166  LYS A N     1 
ATOM   1347 C  CA    . LYS A 1 166 ? 37.434  -19.019 12.199  1.00 40.44  ? 166  LYS A CA    1 
ATOM   1348 C  C     . LYS A 1 166 ? 36.334  -19.630 11.334  1.00 40.14  ? 166  LYS A C     1 
ATOM   1349 O  O     . LYS A 1 166 ? 36.345  -20.836 11.034  1.00 39.88  ? 166  LYS A O     1 
ATOM   1350 C  CB    . LYS A 1 166 ? 38.601  -18.432 11.373  1.00 40.65  ? 166  LYS A CB    1 
ATOM   1351 C  CG    . LYS A 1 166 ? 39.369  -19.393 10.423  1.00 41.41  ? 166  LYS A CG    1 
ATOM   1352 C  CD    . LYS A 1 166 ? 40.097  -20.555 11.143  1.00 42.23  ? 166  LYS A CD    1 
ATOM   1353 C  CE    . LYS A 1 166 ? 39.223  -21.835 11.203  1.00 41.72  ? 166  LYS A CE    1 
ATOM   1354 N  NZ    . LYS A 1 166 ? 39.499  -22.774 12.341  1.00 40.58  ? 166  LYS A NZ    1 
ATOM   1355 N  N     . ARG A 1 167 ? 35.366  -18.796 10.976  1.00 39.67  ? 167  ARG A N     1 
ATOM   1356 C  CA    . ARG A 1 167 ? 34.133  -19.266 10.395  1.00 39.10  ? 167  ARG A CA    1 
ATOM   1357 C  C     . ARG A 1 167 ? 34.425  -19.885 9.051   1.00 38.72  ? 167  ARG A C     1 
ATOM   1358 O  O     . ARG A 1 167 ? 35.185  -19.319 8.268   1.00 38.79  ? 167  ARG A O     1 
ATOM   1359 C  CB    . ARG A 1 167 ? 33.186  -18.099 10.249  1.00 39.04  ? 167  ARG A CB    1 
ATOM   1360 C  CG    . ARG A 1 167 ? 31.791  -18.487 10.553  1.00 40.10  ? 167  ARG A CG    1 
ATOM   1361 C  CD    . ARG A 1 167 ? 31.160  -17.461 11.461  1.00 41.78  ? 167  ARG A CD    1 
ATOM   1362 N  NE    . ARG A 1 167 ? 30.306  -16.528 10.734  1.00 42.73  ? 167  ARG A NE    1 
ATOM   1363 C  CZ    . ARG A 1 167 ? 30.646  -15.286 10.405  1.00 42.89  ? 167  ARG A CZ    1 
ATOM   1364 N  NH1   . ARG A 1 167 ? 31.848  -14.801 10.738  1.00 42.30  ? 167  ARG A NH1   1 
ATOM   1365 N  NH2   . ARG A 1 167 ? 29.770  -14.535 9.737   1.00 42.46  ? 167  ARG A NH2   1 
ATOM   1366 N  N     . LYS A 1 168 ? 33.856  -21.058 8.797   1.00 38.09  ? 168  LYS A N     1 
ATOM   1367 C  CA    . LYS A 1 168 ? 34.120  -21.772 7.548   1.00 37.70  ? 168  LYS A CA    1 
ATOM   1368 C  C     . LYS A 1 168 ? 33.154  -21.311 6.459   1.00 37.11  ? 168  LYS A C     1 
ATOM   1369 O  O     . LYS A 1 168 ? 31.983  -21.114 6.752   1.00 37.54  ? 168  LYS A O     1 
ATOM   1370 C  CB    . LYS A 1 168 ? 34.003  -23.283 7.775   1.00 37.89  ? 168  LYS A CB    1 
ATOM   1371 C  CG    . LYS A 1 168 ? 35.285  -23.945 8.292   1.00 39.28  ? 168  LYS A CG    1 
ATOM   1372 C  CD    . LYS A 1 168 ? 35.408  -23.881 9.819   1.00 41.91  ? 168  LYS A CD    1 
ATOM   1373 C  CE    . LYS A 1 168 ? 36.857  -24.090 10.292  1.00 43.59  ? 168  LYS A CE    1 
ATOM   1374 N  NZ    . LYS A 1 168 ? 37.038  -24.597 11.709  1.00 44.49  ? 168  LYS A NZ    1 
ATOM   1375 N  N     . LYS A 1 169 ? 33.621  -21.118 5.222   1.00 36.18  ? 169  LYS A N     1 
ATOM   1376 C  CA    . LYS A 1 169 ? 32.713  -20.724 4.128   1.00 35.55  ? 169  LYS A CA    1 
ATOM   1377 C  C     . LYS A 1 169 ? 32.420  -21.907 3.191   1.00 35.33  ? 169  LYS A C     1 
ATOM   1378 O  O     . LYS A 1 169 ? 33.357  -22.560 2.711   1.00 35.42  ? 169  LYS A O     1 
ATOM   1379 C  CB    . LYS A 1 169 ? 33.282  -19.568 3.309   1.00 35.28  ? 169  LYS A CB    1 
ATOM   1380 C  CG    . LYS A 1 169 ? 33.934  -18.477 4.069   1.00 35.22  ? 169  LYS A CG    1 
ATOM   1381 C  CD    . LYS A 1 169 ? 35.227  -18.088 3.367   1.00 37.54  ? 169  LYS A CD    1 
ATOM   1382 C  CE    . LYS A 1 169 ? 35.532  -16.578 3.452   1.00 40.25  ? 169  LYS A CE    1 
ATOM   1383 N  NZ    . LYS A 1 169 ? 34.459  -15.700 2.803   1.00 41.37  ? 169  LYS A NZ    1 
ATOM   1384 N  N     . SER A 1 170 ? 31.137  -22.161 2.910   1.00 34.66  ? 170  SER A N     1 
ATOM   1385 C  CA    . SER A 1 170 ? 30.738  -23.333 2.133   1.00 34.12  ? 170  SER A CA    1 
ATOM   1386 C  C     . SER A 1 170 ? 30.118  -22.986 0.791   1.00 34.26  ? 170  SER A C     1 
ATOM   1387 O  O     . SER A 1 170 ? 29.370  -22.011 0.693   1.00 34.42  ? 170  SER A O     1 
ATOM   1388 C  CB    . SER A 1 170 ? 29.745  -24.162 2.918   1.00 33.90  ? 170  SER A CB    1 
ATOM   1389 O  OG    . SER A 1 170 ? 30.052  -24.148 4.290   1.00 33.55  ? 170  SER A OG    1 
ATOM   1390 N  N     . TYR A 1 171 ? 30.442  -23.796 -0.228  1.00 34.20  ? 171  TYR A N     1 
ATOM   1391 C  CA    . TYR A 1 171 ? 29.849  -23.728 -1.574  1.00 33.78  ? 171  TYR A CA    1 
ATOM   1392 C  C     . TYR A 1 171 ? 28.660  -24.659 -1.642  1.00 34.64  ? 171  TYR A C     1 
ATOM   1393 O  O     . TYR A 1 171 ? 28.815  -25.883 -1.696  1.00 34.86  ? 171  TYR A O     1 
ATOM   1394 C  CB    . TYR A 1 171 ? 30.848  -24.133 -2.652  1.00 32.91  ? 171  TYR A CB    1 
ATOM   1395 C  CG    . TYR A 1 171 ? 31.813  -23.044 -3.011  1.00 31.74  ? 171  TYR A CG    1 
ATOM   1396 C  CD1   . TYR A 1 171 ? 33.014  -22.915 -2.343  1.00 31.01  ? 171  TYR A CD1   1 
ATOM   1397 C  CD2   . TYR A 1 171 ? 31.520  -22.129 -4.007  1.00 30.69  ? 171  TYR A CD2   1 
ATOM   1398 C  CE1   . TYR A 1 171 ? 33.894  -21.918 -2.652  1.00 29.73  ? 171  TYR A CE1   1 
ATOM   1399 C  CE2   . TYR A 1 171 ? 32.399  -21.126 -4.328  1.00 29.19  ? 171  TYR A CE2   1 
ATOM   1400 C  CZ    . TYR A 1 171 ? 33.584  -21.031 -3.644  1.00 29.57  ? 171  TYR A CZ    1 
ATOM   1401 O  OH    . TYR A 1 171 ? 34.483  -20.042 -3.947  1.00 31.33  ? 171  TYR A OH    1 
ATOM   1402 N  N     . VAL A 1 172 ? 27.469  -24.071 -1.655  1.00 35.47  ? 172  VAL A N     1 
ATOM   1403 C  CA    . VAL A 1 172 ? 26.225  -24.822 -1.577  1.00 36.17  ? 172  VAL A CA    1 
ATOM   1404 C  C     . VAL A 1 172 ? 25.117  -24.151 -2.408  1.00 36.35  ? 172  VAL A C     1 
ATOM   1405 O  O     . VAL A 1 172 ? 25.279  -23.016 -2.826  1.00 36.56  ? 172  VAL A O     1 
ATOM   1406 C  CB    . VAL A 1 172 ? 25.833  -24.918 -0.119  1.00 36.31  ? 172  VAL A CB    1 
ATOM   1407 C  CG1   . VAL A 1 172 ? 25.257  -23.562 0.374   1.00 36.22  ? 172  VAL A CG1   1 
ATOM   1408 C  CG2   . VAL A 1 172 ? 24.893  -26.113 0.103   1.00 37.71  ? 172  VAL A CG2   1 
ATOM   1409 N  N     . ASP A 1 173 ? 24.007  -24.833 -2.671  1.00 36.92  ? 173  ASP A N     1 
ATOM   1410 C  CA    . ASP A 1 173 ? 22.931  -24.204 -3.464  1.00 37.90  ? 173  ASP A CA    1 
ATOM   1411 C  C     . ASP A 1 173 ? 22.176  -23.221 -2.575  1.00 37.62  ? 173  ASP A C     1 
ATOM   1412 O  O     . ASP A 1 173 ? 22.140  -23.420 -1.372  1.00 37.66  ? 173  ASP A O     1 
ATOM   1413 C  CB    . ASP A 1 173 ? 21.941  -25.216 -4.054  1.00 38.49  ? 173  ASP A CB    1 
ATOM   1414 C  CG    . ASP A 1 173 ? 22.385  -26.665 -3.880  1.00 40.96  ? 173  ASP A CG    1 
ATOM   1415 O  OD1   . ASP A 1 173 ? 22.180  -27.448 -4.853  1.00 41.46  ? 173  ASP A OD1   1 
ATOM   1416 O  OD2   . ASP A 1 173 ? 22.906  -27.013 -2.771  1.00 43.40  ? 173  ASP A OD2   1 
ATOM   1417 N  N     . PRO A 1 174 ? 21.572  -22.162 -3.162  1.00 37.41  ? 174  PRO A N     1 
ATOM   1418 C  CA    . PRO A 1 174 ? 21.020  -21.081 -2.354  1.00 37.13  ? 174  PRO A CA    1 
ATOM   1419 C  C     . PRO A 1 174 ? 20.009  -21.584 -1.361  1.00 37.04  ? 174  PRO A C     1 
ATOM   1420 O  O     . PRO A 1 174 ? 19.250  -22.475 -1.679  1.00 36.77  ? 174  PRO A O     1 
ATOM   1421 C  CB    . PRO A 1 174 ? 20.357  -20.177 -3.390  1.00 37.13  ? 174  PRO A CB    1 
ATOM   1422 C  CG    . PRO A 1 174 ? 21.149  -20.390 -4.621  1.00 37.32  ? 174  PRO A CG    1 
ATOM   1423 C  CD    . PRO A 1 174 ? 21.445  -21.866 -4.602  1.00 37.61  ? 174  PRO A CD    1 
ATOM   1424 N  N     . GLY A 1 175 ? 20.028  -21.026 -0.156  1.00 37.46  ? 175  GLY A N     1 
ATOM   1425 C  CA    . GLY A 1 175 ? 19.203  -21.516 0.939   1.00 38.49  ? 175  GLY A CA    1 
ATOM   1426 C  C     . GLY A 1 175 ? 19.597  -22.912 1.396   1.00 39.27  ? 175  GLY A C     1 
ATOM   1427 O  O     . GLY A 1 175 ? 18.874  -23.881 1.187   1.00 39.25  ? 175  GLY A O     1 
ATOM   1428 N  N     . GLN A 1 176 ? 20.775  -23.017 1.986   1.00 40.09  ? 176  GLN A N     1 
ATOM   1429 C  CA    . GLN A 1 176 ? 21.197  -24.219 2.659   1.00 40.99  ? 176  GLN A CA    1 
ATOM   1430 C  C     . GLN A 1 176 ? 22.109  -23.752 3.758   1.00 41.59  ? 176  GLN A C     1 
ATOM   1431 O  O     . GLN A 1 176 ? 22.738  -22.695 3.663   1.00 41.57  ? 176  GLN A O     1 
ATOM   1432 C  CB    . GLN A 1 176 ? 21.995  -25.156 1.751   1.00 41.24  ? 176  GLN A CB    1 
ATOM   1433 C  CG    . GLN A 1 176 ? 21.257  -25.807 0.574   1.00 43.15  ? 176  GLN A CG    1 
ATOM   1434 C  CD    . GLN A 1 176 ? 20.274  -26.903 0.980   1.00 45.78  ? 176  GLN A CD    1 
ATOM   1435 O  OE1   . GLN A 1 176 ? 19.321  -27.197 0.245   1.00 47.06  ? 176  GLN A OE1   1 
ATOM   1436 N  NE2   . GLN A 1 176 ? 20.498  -27.515 2.144   1.00 45.96  ? 176  GLN A NE2   1 
ATOM   1437 N  N     . PRO A 1 177 ? 22.187  -24.541 4.817   1.00 42.31  ? 177  PRO A N     1 
ATOM   1438 C  CA    . PRO A 1 177 ? 23.174  -24.300 5.846   1.00 42.98  ? 177  PRO A CA    1 
ATOM   1439 C  C     . PRO A 1 177 ? 24.619  -24.427 5.324   1.00 43.40  ? 177  PRO A C     1 
ATOM   1440 O  O     . PRO A 1 177 ? 24.977  -25.407 4.647   1.00 43.17  ? 177  PRO A O     1 
ATOM   1441 C  CB    . PRO A 1 177 ? 22.867  -25.404 6.877   1.00 43.43  ? 177  PRO A CB    1 
ATOM   1442 C  CG    . PRO A 1 177 ? 22.044  -26.436 6.126   1.00 42.85  ? 177  PRO A CG    1 
ATOM   1443 C  CD    . PRO A 1 177 ? 21.256  -25.624 5.175   1.00 42.30  ? 177  PRO A CD    1 
ATOM   1444 N  N     . ALA A 1 178 ? 25.433  -23.428 5.631   1.00 43.91  ? 178  ALA A N     1 
ATOM   1445 C  CA    . ALA A 1 178 ? 26.854  -23.532 5.382   1.00 44.84  ? 178  ALA A CA    1 
ATOM   1446 C  C     . ALA A 1 178 ? 27.515  -23.988 6.661   1.00 45.64  ? 178  ALA A C     1 
ATOM   1447 O  O     . ALA A 1 178 ? 27.127  -23.551 7.744   1.00 45.76  ? 178  ALA A O     1 
ATOM   1448 C  CB    . ALA A 1 178 ? 27.398  -22.204 4.961   1.00 44.97  ? 178  ALA A CB    1 
ATOM   1449 N  N     . THR A 1 179 ? 28.516  -24.857 6.533   1.00 46.76  ? 179  THR A N     1 
ATOM   1450 C  CA    . THR A 1 179 ? 29.224  -25.478 7.681   1.00 47.77  ? 179  THR A CA    1 
ATOM   1451 C  C     . THR A 1 179 ? 29.536  -24.538 8.859   1.00 48.29  ? 179  THR A C     1 
ATOM   1452 O  O     . THR A 1 179 ? 30.314  -23.589 8.728   1.00 48.61  ? 179  THR A O     1 
ATOM   1453 C  CB    . THR A 1 179 ? 30.512  -26.185 7.199   1.00 47.68  ? 179  THR A CB    1 
ATOM   1454 O  OG1   . THR A 1 179 ? 30.152  -27.357 6.456   1.00 48.28  ? 179  THR A OG1   1 
ATOM   1455 C  CG2   . THR A 1 179 ? 31.397  -26.584 8.368   1.00 47.78  ? 179  THR A CG2   1 
ATOM   1456 N  N     . SER A 1 180 ? 28.933  -24.808 10.011  1.00 48.87  ? 180  SER A N     1 
ATOM   1457 C  CA    . SER A 1 180 ? 29.029  -23.876 11.134  1.00 49.57  ? 180  SER A CA    1 
ATOM   1458 C  C     . SER A 1 180 ? 30.067  -24.316 12.128  1.00 49.64  ? 180  SER A C     1 
ATOM   1459 O  O     . SER A 1 180 ? 30.301  -25.504 12.286  1.00 49.71  ? 180  SER A O     1 
ATOM   1460 C  CB    . SER A 1 180 ? 27.683  -23.748 11.837  1.00 49.80  ? 180  SER A CB    1 
ATOM   1461 O  OG    . SER A 1 180 ? 27.321  -24.970 12.452  1.00 51.06  ? 180  SER A OG    1 
ATOM   1462 N  N     . THR A 1 181 ? 30.675  -23.358 12.814  1.00 50.15  ? 181  THR A N     1 
ATOM   1463 C  CA    . THR A 1 181 ? 31.750  -23.688 13.748  1.00 50.88  ? 181  THR A CA    1 
ATOM   1464 C  C     . THR A 1 181 ? 31.663  -23.039 15.117  1.00 50.98  ? 181  THR A C     1 
ATOM   1465 O  O     . THR A 1 181 ? 31.306  -21.862 15.245  1.00 50.93  ? 181  THR A O     1 
ATOM   1466 C  CB    . THR A 1 181 ? 33.145  -23.443 13.146  1.00 51.16  ? 181  THR A CB    1 
ATOM   1467 O  OG1   . THR A 1 181 ? 33.131  -22.257 12.326  1.00 51.46  ? 181  THR A OG1   1 
ATOM   1468 C  CG2   . THR A 1 181 ? 33.589  -24.693 12.331  1.00 51.38  ? 181  THR A CG2   1 
ATOM   1469 N  N     . ALA A 1 182 ? 32.020  -23.832 16.125  1.00 51.10  ? 182  ALA A N     1 
ATOM   1470 C  CA    . ALA A 1 182 ? 31.847  -23.468 17.518  1.00 51.36  ? 182  ALA A CA    1 
ATOM   1471 C  C     . ALA A 1 182 ? 32.837  -22.423 17.990  1.00 51.71  ? 182  ALA A C     1 
ATOM   1472 O  O     . ALA A 1 182 ? 34.036  -22.532 17.754  1.00 51.57  ? 182  ALA A O     1 
ATOM   1473 C  CB    . ALA A 1 182 ? 31.915  -24.693 18.389  1.00 51.27  ? 182  ALA A CB    1 
ATOM   1474 N  N     . ARG A 1 183 ? 32.301  -21.425 18.684  1.00 52.47  ? 183  ARG A N     1 
ATOM   1475 C  CA    . ARG A 1 183 ? 33.040  -20.263 19.140  1.00 53.42  ? 183  ARG A CA    1 
ATOM   1476 C  C     . ARG A 1 183 ? 34.350  -20.546 19.854  1.00 54.57  ? 183  ARG A C     1 
ATOM   1477 O  O     . ARG A 1 183 ? 34.485  -21.533 20.585  1.00 54.32  ? 183  ARG A O     1 
ATOM   1478 C  CB    . ARG A 1 183 ? 32.171  -19.387 20.031  1.00 53.04  ? 183  ARG A CB    1 
ATOM   1479 C  CG    . ARG A 1 183 ? 31.452  -18.335 19.276  1.00 53.33  ? 183  ARG A CG    1 
ATOM   1480 C  CD    . ARG A 1 183 ? 30.040  -18.209 19.820  1.00 55.09  ? 183  ARG A CD    1 
ATOM   1481 N  NE    . ARG A 1 183 ? 29.227  -17.131 19.237  1.00 55.44  ? 183  ARG A NE    1 
ATOM   1482 C  CZ    . ARG A 1 183 ? 29.691  -15.987 18.734  1.00 55.30  ? 183  ARG A CZ    1 
ATOM   1483 N  NH1   . ARG A 1 183 ? 30.995  -15.718 18.710  1.00 55.33  ? 183  ARG A NH1   1 
ATOM   1484 N  NH2   . ARG A 1 183 ? 28.834  -15.102 18.251  1.00 55.23  ? 183  ARG A NH2   1 
ATOM   1485 N  N     . PRO A 1 184 ? 35.324  -19.648 19.642  1.00 55.79  ? 184  PRO A N     1 
ATOM   1486 C  CA    . PRO A 1 184 ? 36.540  -19.646 20.423  1.00 56.49  ? 184  PRO A CA    1 
ATOM   1487 C  C     . PRO A 1 184 ? 36.248  -19.034 21.789  1.00 57.19  ? 184  PRO A C     1 
ATOM   1488 O  O     . PRO A 1 184 ? 35.621  -17.965 21.876  1.00 57.36  ? 184  PRO A O     1 
ATOM   1489 C  CB    . PRO A 1 184 ? 37.457  -18.718 19.623  1.00 56.71  ? 184  PRO A CB    1 
ATOM   1490 C  CG    . PRO A 1 184 ? 36.544  -17.777 18.887  1.00 56.19  ? 184  PRO A CG    1 
ATOM   1491 C  CD    . PRO A 1 184 ? 35.221  -18.469 18.751  1.00 55.97  ? 184  PRO A CD    1 
ATOM   1492 N  N     . ASN A 1 185 ? 36.689  -19.706 22.844  1.00 57.75  ? 185  ASN A N     1 
ATOM   1493 C  CA    . ASN A 1 185 ? 36.593  -19.154 24.184  1.00 58.11  ? 185  ASN A CA    1 
ATOM   1494 C  C     . ASN A 1 185 ? 37.548  -17.961 24.438  1.00 58.58  ? 185  ASN A C     1 
ATOM   1495 O  O     . ASN A 1 185 ? 38.745  -18.047 24.137  1.00 58.65  ? 185  ASN A O     1 
ATOM   1496 C  CB    . ASN A 1 185 ? 36.865  -20.262 25.167  1.00 57.85  ? 185  ASN A CB    1 
ATOM   1497 C  CG    . ASN A 1 185 ? 36.670  -19.817 26.546  1.00 58.35  ? 185  ASN A CG    1 
ATOM   1498 O  OD1   . ASN A 1 185 ? 37.625  -19.691 27.302  1.00 59.15  ? 185  ASN A OD1   1 
ATOM   1499 N  ND2   . ASN A 1 185 ? 35.429  -19.510 26.891  1.00 59.02  ? 185  ASN A ND2   1 
ATOM   1500 N  N     . ARG A 1 186 ? 37.030  -16.853 24.978  1.00 59.20  ? 186  ARG A N     1 
ATOM   1501 C  CA    . ARG A 1 186 ? 37.872  -15.651 25.243  1.00 60.02  ? 186  ARG A CA    1 
ATOM   1502 C  C     . ARG A 1 186 ? 38.902  -15.862 26.380  1.00 59.55  ? 186  ARG A C     1 
ATOM   1503 O  O     . ARG A 1 186 ? 40.008  -15.291 26.365  1.00 59.66  ? 186  ARG A O     1 
ATOM   1504 C  CB    . ARG A 1 186 ? 37.009  -14.401 25.540  1.00 60.58  ? 186  ARG A CB    1 
ATOM   1505 C  CG    . ARG A 1 186 ? 37.782  -13.032 25.500  1.00 63.52  ? 186  ARG A CG    1 
ATOM   1506 C  CD    . ARG A 1 186 ? 37.039  -11.851 26.229  1.00 67.86  ? 186  ARG A CD    1 
ATOM   1507 N  NE    . ARG A 1 186 ? 37.658  -10.530 25.986  1.00 70.51  ? 186  ARG A NE    1 
ATOM   1508 C  CZ    . ARG A 1 186 ? 37.076  -9.340  26.190  1.00 71.00  ? 186  ARG A CZ    1 
ATOM   1509 N  NH1   . ARG A 1 186 ? 35.826  -9.252  26.643  1.00 70.97  ? 186  ARG A NH1   1 
ATOM   1510 N  NH2   . ARG A 1 186 ? 37.750  -8.223  25.925  1.00 70.87  ? 186  ARG A NH2   1 
ATOM   1511 N  N     . PHE A 1 187 ? 38.521  -16.685 27.354  1.00 58.72  ? 187  PHE A N     1 
ATOM   1512 C  CA    . PHE A 1 187 ? 39.326  -16.956 28.531  1.00 57.74  ? 187  PHE A CA    1 
ATOM   1513 C  C     . PHE A 1 187 ? 39.891  -18.365 28.429  1.00 56.84  ? 187  PHE A C     1 
ATOM   1514 O  O     . PHE A 1 187 ? 39.777  -19.171 29.350  1.00 56.92  ? 187  PHE A O     1 
ATOM   1515 C  CB    . PHE A 1 187 ? 38.449  -16.809 29.770  1.00 57.93  ? 187  PHE A CB    1 
ATOM   1516 C  CG    . PHE A 1 187 ? 37.395  -15.768 29.620  1.00 58.68  ? 187  PHE A CG    1 
ATOM   1517 C  CD1   . PHE A 1 187 ? 37.720  -14.419 29.703  1.00 60.16  ? 187  PHE A CD1   1 
ATOM   1518 C  CD2   . PHE A 1 187 ? 36.090  -16.125 29.348  1.00 59.68  ? 187  PHE A CD2   1 
ATOM   1519 C  CE1   . PHE A 1 187 ? 36.749  -13.435 29.544  1.00 60.92  ? 187  PHE A CE1   1 
ATOM   1520 C  CE2   . PHE A 1 187 ? 35.107  -15.153 29.184  1.00 61.02  ? 187  PHE A CE2   1 
ATOM   1521 C  CZ    . PHE A 1 187 ? 35.438  -13.804 29.288  1.00 61.66  ? 187  PHE A CZ    1 
ATOM   1522 N  N     . GLY A 1 188 ? 40.491  -18.662 27.287  1.00 55.64  ? 188  GLY A N     1 
ATOM   1523 C  CA    . GLY A 1 188 ? 41.013  -19.984 27.048  1.00 54.20  ? 188  GLY A CA    1 
ATOM   1524 C  C     . GLY A 1 188 ? 42.499  -20.027 27.280  1.00 53.26  ? 188  GLY A C     1 
ATOM   1525 O  O     . GLY A 1 188 ? 43.146  -18.986 27.467  1.00 52.98  ? 188  GLY A O     1 
ATOM   1526 N  N     . LYS A 1 189 ? 43.018  -21.252 27.267  1.00 52.41  ? 189  LYS A N     1 
ATOM   1527 C  CA    . LYS A 1 189 ? 44.442  -21.541 27.364  1.00 51.57  ? 189  LYS A CA    1 
ATOM   1528 C  C     . LYS A 1 189 ? 45.202  -20.777 26.280  1.00 50.71  ? 189  LYS A C     1 
ATOM   1529 O  O     . LYS A 1 189 ? 44.818  -20.836 25.112  1.00 50.61  ? 189  LYS A O     1 
ATOM   1530 C  CB    . LYS A 1 189 ? 44.643  -23.050 27.188  1.00 51.79  ? 189  LYS A CB    1 
ATOM   1531 C  CG    . LYS A 1 189 ? 45.933  -23.611 27.773  1.00 52.34  ? 189  LYS A CG    1 
ATOM   1532 C  CD    . LYS A 1 189 ? 46.014  -25.125 27.566  1.00 53.01  ? 189  LYS A CD    1 
ATOM   1533 C  CE    . LYS A 1 189 ? 47.041  -25.762 28.498  1.00 53.81  ? 189  LYS A CE    1 
ATOM   1534 N  NZ    . LYS A 1 189 ? 46.667  -27.165 28.869  1.00 54.16  ? 189  LYS A NZ    1 
ATOM   1535 N  N     . LYS A 1 190 ? 46.251  -20.046 26.670  1.00 49.67  ? 190  LYS A N     1 
ATOM   1536 C  CA    . LYS A 1 190 ? 47.101  -19.299 25.717  1.00 48.63  ? 190  LYS A CA    1 
ATOM   1537 C  C     . LYS A 1 190 ? 48.465  -18.984 26.294  1.00 47.92  ? 190  LYS A C     1 
ATOM   1538 O  O     . LYS A 1 190 ? 48.570  -18.602 27.465  1.00 48.05  ? 190  LYS A O     1 
ATOM   1539 C  CB    . LYS A 1 190 ? 46.434  -17.997 25.258  1.00 48.60  ? 190  LYS A CB    1 
ATOM   1540 C  CG    . LYS A 1 190 ? 46.267  -16.933 26.346  1.00 48.69  ? 190  LYS A CG    1 
ATOM   1541 C  CD    . LYS A 1 190 ? 45.108  -15.995 26.026  1.00 48.99  ? 190  LYS A CD    1 
ATOM   1542 C  CE    . LYS A 1 190 ? 45.254  -14.648 26.713  1.00 48.46  ? 190  LYS A CE    1 
ATOM   1543 N  NZ    . LYS A 1 190 ? 44.777  -14.688 28.116  1.00 48.90  ? 190  LYS A NZ    1 
ATOM   1544 N  N     . THR A 1 191 ? 49.508  -19.151 25.481  1.00 46.93  ? 191  THR A N     1 
ATOM   1545 C  CA    . THR A 1 191 ? 50.852  -18.689 25.861  1.00 46.07  ? 191  THR A CA    1 
ATOM   1546 C  C     . THR A 1 191 ? 51.086  -17.267 25.384  1.00 45.39  ? 191  THR A C     1 
ATOM   1547 O  O     . THR A 1 191 ? 50.193  -16.628 24.835  1.00 45.51  ? 191  THR A O     1 
ATOM   1548 C  CB    . THR A 1 191 ? 51.997  -19.568 25.306  1.00 45.98  ? 191  THR A CB    1 
ATOM   1549 O  OG1   . THR A 1 191 ? 51.841  -19.747 23.896  1.00 45.86  ? 191  THR A OG1   1 
ATOM   1550 C  CG2   . THR A 1 191 ? 52.036  -20.906 25.991  1.00 46.24  ? 191  THR A CG2   1 
ATOM   1551 N  N     . MET A 1 192 ? 52.301  -16.781 25.591  1.00 44.42  ? 192  MET A N     1 
ATOM   1552 C  CA    . MET A 1 192 ? 52.649  -15.426 25.223  1.00 43.35  ? 192  MET A CA    1 
ATOM   1553 C  C     . MET A 1 192 ? 54.050  -15.439 24.670  1.00 42.16  ? 192  MET A C     1 
ATOM   1554 O  O     . MET A 1 192 ? 55.017  -15.748 25.363  1.00 41.92  ? 192  MET A O     1 
ATOM   1555 C  CB    . MET A 1 192 ? 52.539  -14.503 26.434  1.00 43.85  ? 192  MET A CB    1 
ATOM   1556 C  CG    . MET A 1 192 ? 52.204  -13.068 26.113  1.00 44.49  ? 192  MET A CG    1 
ATOM   1557 S  SD    . MET A 1 192 ? 53.649  -12.030 26.301  1.00 46.96  ? 192  MET A SD    1 
ATOM   1558 C  CE    . MET A 1 192 ? 52.883  -10.535 26.946  1.00 47.21  ? 192  MET A CE    1 
ATOM   1559 N  N     . LEU A 1 193 ? 54.130  -15.126 23.391  1.00 40.93  ? 193  LEU A N     1 
ATOM   1560 C  CA    . LEU A 1 193 ? 55.370  -15.148 22.666  1.00 39.73  ? 193  LEU A CA    1 
ATOM   1561 C  C     . LEU A 1 193 ? 55.983  -13.755 22.662  1.00 39.50  ? 193  LEU A C     1 
ATOM   1562 O  O     . LEU A 1 193 ? 55.327  -12.784 22.298  1.00 39.59  ? 193  LEU A O     1 
ATOM   1563 C  CB    . LEU A 1 193 ? 55.099  -15.627 21.246  1.00 38.99  ? 193  LEU A CB    1 
ATOM   1564 C  CG    . LEU A 1 193 ? 56.189  -15.479 20.214  1.00 37.84  ? 193  LEU A CG    1 
ATOM   1565 C  CD1   . LEU A 1 193 ? 57.408  -16.186 20.690  1.00 37.61  ? 193  LEU A CD1   1 
ATOM   1566 C  CD2   . LEU A 1 193 ? 55.706  -16.090 18.935  1.00 37.72  ? 193  LEU A CD2   1 
ATOM   1567 N  N     . CYS A 1 194 ? 57.228  -13.657 23.114  1.00 38.95  ? 194  CYS A N     1 
ATOM   1568 C  CA    . CYS A 1 194 ? 58.033  -12.481 22.820  1.00 38.38  ? 194  CYS A CA    1 
ATOM   1569 C  C     . CYS A 1 194 ? 59.338  -12.843 22.129  1.00 37.65  ? 194  CYS A C     1 
ATOM   1570 O  O     . CYS A 1 194 ? 60.108  -13.713 22.559  1.00 37.26  ? 194  CYS A O     1 
ATOM   1571 C  CB    . CYS A 1 194 ? 58.247  -11.553 24.022  1.00 38.66  ? 194  CYS A CB    1 
ATOM   1572 S  SG    . CYS A 1 194 ? 57.978  -12.268 25.636  1.00 39.36  ? 194  CYS A SG    1 
ATOM   1573 N  N     . VAL A 1 195 ? 59.548  -12.133 21.035  1.00 36.80  ? 195  VAL A N     1 
ATOM   1574 C  CA    . VAL A 1 195 ? 60.585  -12.428 20.091  1.00 35.75  ? 195  VAL A CA    1 
ATOM   1575 C  C     . VAL A 1 195 ? 61.198  -11.114 19.626  1.00 35.36  ? 195  VAL A C     1 
ATOM   1576 O  O     . VAL A 1 195 ? 60.507  -10.108 19.441  1.00 35.02  ? 195  VAL A O     1 
ATOM   1577 C  CB    . VAL A 1 195 ? 60.008  -13.243 18.919  1.00 35.54  ? 195  VAL A CB    1 
ATOM   1578 C  CG1   . VAL A 1 195 ? 58.649  -12.711 18.512  1.00 34.97  ? 195  VAL A CG1   1 
ATOM   1579 C  CG2   . VAL A 1 195 ? 60.976  -13.306 17.747  1.00 35.35  ? 195  VAL A CG2   1 
ATOM   1580 N  N     . TRP A 1 196 ? 62.513  -11.143 19.492  1.00 34.82  ? 196  TRP A N     1 
ATOM   1581 C  CA    . TRP A 1 196 ? 63.274  -10.041 18.989  1.00 34.50  ? 196  TRP A CA    1 
ATOM   1582 C  C     . TRP A 1 196 ? 63.989  -10.577 17.757  1.00 34.37  ? 196  TRP A C     1 
ATOM   1583 O  O     . TRP A 1 196 ? 64.435  -11.725 17.747  1.00 34.35  ? 196  TRP A O     1 
ATOM   1584 C  CB    . TRP A 1 196 ? 64.249  -9.576  20.069  1.00 34.58  ? 196  TRP A CB    1 
ATOM   1585 C  CG    . TRP A 1 196 ? 63.551  -8.931  21.232  1.00 34.96  ? 196  TRP A CG    1 
ATOM   1586 C  CD1   . TRP A 1 196 ? 63.288  -7.598  21.400  1.00 35.23  ? 196  TRP A CD1   1 
ATOM   1587 C  CD2   . TRP A 1 196 ? 63.003  -9.589  22.373  1.00 35.77  ? 196  TRP A CD2   1 
ATOM   1588 N  NE1   . TRP A 1 196 ? 62.610  -7.385  22.575  1.00 34.83  ? 196  TRP A NE1   1 
ATOM   1589 C  CE2   . TRP A 1 196 ? 62.421  -8.592  23.194  1.00 35.72  ? 196  TRP A CE2   1 
ATOM   1590 C  CE3   . TRP A 1 196 ? 62.939  -10.928 22.784  1.00 36.55  ? 196  TRP A CE3   1 
ATOM   1591 C  CZ2   . TRP A 1 196 ? 61.776  -8.894  24.402  1.00 36.17  ? 196  TRP A CZ2   1 
ATOM   1592 C  CZ3   . TRP A 1 196 ? 62.300  -11.228 23.992  1.00 36.80  ? 196  TRP A CZ3   1 
ATOM   1593 C  CH2   . TRP A 1 196 ? 61.727  -10.212 24.785  1.00 36.25  ? 196  TRP A CH2   1 
ATOM   1594 N  N     . TRP A 1 197 ? 64.063  -9.766  16.708  1.00 34.11  ? 197  TRP A N     1 
ATOM   1595 C  CA    . TRP A 1 197 ? 64.685  -10.179 15.456  1.00 34.11  ? 197  TRP A CA    1 
ATOM   1596 C  C     . TRP A 1 197 ? 65.350  -8.994  14.811  1.00 34.38  ? 197  TRP A C     1 
ATOM   1597 O  O     . TRP A 1 197 ? 65.035  -7.864  15.143  1.00 34.55  ? 197  TRP A O     1 
ATOM   1598 C  CB    . TRP A 1 197 ? 63.645  -10.751 14.500  1.00 33.93  ? 197  TRP A CB    1 
ATOM   1599 C  CG    . TRP A 1 197 ? 62.405  -9.875  14.273  1.00 34.21  ? 197  TRP A CG    1 
ATOM   1600 C  CD1   . TRP A 1 197 ? 61.395  -9.626  15.166  1.00 34.58  ? 197  TRP A CD1   1 
ATOM   1601 C  CD2   . TRP A 1 197 ? 62.032  -9.190  13.065  1.00 33.18  ? 197  TRP A CD2   1 
ATOM   1602 N  NE1   . TRP A 1 197 ? 60.436  -8.815  14.596  1.00 33.35  ? 197  TRP A NE1   1 
ATOM   1603 C  CE2   . TRP A 1 197 ? 60.806  -8.537  13.310  1.00 32.32  ? 197  TRP A CE2   1 
ATOM   1604 C  CE3   . TRP A 1 197 ? 62.624  -9.054  11.807  1.00 32.57  ? 197  TRP A CE3   1 
ATOM   1605 C  CZ2   . TRP A 1 197 ? 60.173  -7.772  12.355  1.00 31.52  ? 197  TRP A CZ2   1 
ATOM   1606 C  CZ3   . TRP A 1 197 ? 61.986  -8.300  10.860  1.00 31.14  ? 197  TRP A CZ3   1 
ATOM   1607 C  CH2   . TRP A 1 197 ? 60.776  -7.665  11.138  1.00 31.15  ? 197  TRP A CH2   1 
ATOM   1608 N  N     . ASP A 1 198 ? 66.276  -9.241  13.898  1.00 34.80  ? 198  ASP A N     1 
ATOM   1609 C  CA    . ASP A 1 198 ? 66.874  -8.154  13.145  1.00 35.54  ? 198  ASP A CA    1 
ATOM   1610 C  C     . ASP A 1 198 ? 66.785  -8.456  11.659  1.00 35.69  ? 198  ASP A C     1 
ATOM   1611 O  O     . ASP A 1 198 ? 66.283  -9.509  11.272  1.00 35.70  ? 198  ASP A O     1 
ATOM   1612 C  CB    . ASP A 1 198 ? 68.321  -7.904  13.583  1.00 35.94  ? 198  ASP A CB    1 
ATOM   1613 C  CG    . ASP A 1 198 ? 69.321  -8.875  12.937  1.00 37.62  ? 198  ASP A CG    1 
ATOM   1614 O  OD1   . ASP A 1 198 ? 68.882  -9.781  12.180  1.00 38.54  ? 198  ASP A OD1   1 
ATOM   1615 O  OD2   . ASP A 1 198 ? 70.553  -8.720  13.191  1.00 38.98  ? 198  ASP A OD2   1 
ATOM   1616 N  N     . GLN A 1 199 ? 67.295  -7.549  10.830  1.00 35.93  ? 199  GLN A N     1 
ATOM   1617 C  CA    . GLN A 1 199 ? 67.131  -7.664  9.386   1.00 36.46  ? 199  GLN A CA    1 
ATOM   1618 C  C     . GLN A 1 199 ? 67.503  -9.051  8.790   1.00 36.89  ? 199  GLN A C     1 
ATOM   1619 O  O     . GLN A 1 199 ? 66.920  -9.471  7.781   1.00 36.79  ? 199  GLN A O     1 
ATOM   1620 C  CB    . GLN A 1 199 ? 67.840  -6.497  8.675   1.00 36.40  ? 199  GLN A CB    1 
ATOM   1621 C  CG    . GLN A 1 199 ? 69.103  -6.850  7.882   1.00 36.31  ? 199  GLN A CG    1 
ATOM   1622 C  CD    . GLN A 1 199 ? 69.740  -5.643  7.232   1.00 36.10  ? 199  GLN A CD    1 
ATOM   1623 O  OE1   . GLN A 1 199 ? 69.211  -4.533  7.289   1.00 35.68  ? 199  GLN A OE1   1 
ATOM   1624 N  NE2   . GLN A 1 199 ? 70.887  -5.853  6.608   1.00 36.79  ? 199  GLN A NE2   1 
ATOM   1625 N  N     . SER A 1 200 ? 68.447  -9.749  9.432   1.00 37.38  ? 200  SER A N     1 
ATOM   1626 C  CA    . SER A 1 200 ? 68.966  -11.036 8.945   1.00 37.81  ? 200  SER A CA    1 
ATOM   1627 C  C     . SER A 1 200 ? 68.057  -12.172 9.349   1.00 38.11  ? 200  SER A C     1 
ATOM   1628 O  O     . SER A 1 200 ? 67.542  -12.882 8.494   1.00 38.55  ? 200  SER A O     1 
ATOM   1629 C  CB    . SER A 1 200 ? 70.356  -11.324 9.494   1.00 37.71  ? 200  SER A CB    1 
ATOM   1630 O  OG    . SER A 1 200 ? 71.056  -10.127 9.781   1.00 38.69  ? 200  SER A OG    1 
ATOM   1631 N  N     . GLY A 1 201 ? 67.863  -12.355 10.652  1.00 38.39  ? 201  GLY A N     1 
ATOM   1632 C  CA    . GLY A 1 201 ? 66.944  -13.383 11.135  1.00 38.73  ? 201  GLY A CA    1 
ATOM   1633 C  C     . GLY A 1 201 ? 66.340  -13.093 12.491  1.00 38.90  ? 201  GLY A C     1 
ATOM   1634 O  O     . GLY A 1 201 ? 66.342  -11.953 12.965  1.00 38.93  ? 201  GLY A O     1 
ATOM   1635 N  N     . VAL A 1 202 ? 65.815  -14.139 13.111  1.00 39.10  ? 202  VAL A N     1 
ATOM   1636 C  CA    . VAL A 1 202 ? 65.324  -14.059 14.479  1.00 39.46  ? 202  VAL A CA    1 
ATOM   1637 C  C     . VAL A 1 202 ? 66.441  -14.328 15.501  1.00 39.55  ? 202  VAL A C     1 
ATOM   1638 O  O     . VAL A 1 202 ? 67.038  -15.400 15.521  1.00 39.39  ? 202  VAL A O     1 
ATOM   1639 C  CB    . VAL A 1 202 ? 64.112  -14.992 14.692  1.00 39.45  ? 202  VAL A CB    1 
ATOM   1640 C  CG1   . VAL A 1 202 ? 64.320  -16.315 13.969  1.00 39.71  ? 202  VAL A CG1   1 
ATOM   1641 C  CG2   . VAL A 1 202 ? 63.838  -15.201 16.175  1.00 39.48  ? 202  VAL A CG2   1 
ATOM   1642 N  N     . ILE A 1 203 ? 66.702  -13.332 16.343  1.00 39.95  ? 203  ILE A N     1 
ATOM   1643 C  CA    . ILE A 1 203 ? 67.809  -13.346 17.297  1.00 40.28  ? 203  ILE A CA    1 
ATOM   1644 C  C     . ILE A 1 203 ? 67.549  -14.282 18.477  1.00 41.01  ? 203  ILE A C     1 
ATOM   1645 O  O     . ILE A 1 203 ? 68.340  -15.186 18.744  1.00 41.03  ? 203  ILE A O     1 
ATOM   1646 C  CB    . ILE A 1 203 ? 68.081  -11.914 17.837  1.00 40.03  ? 203  ILE A CB    1 
ATOM   1647 C  CG1   . ILE A 1 203 ? 68.525  -10.965 16.722  1.00 39.32  ? 203  ILE A CG1   1 
ATOM   1648 C  CG2   . ILE A 1 203 ? 69.092  -11.932 18.956  1.00 40.07  ? 203  ILE A CG2   1 
ATOM   1649 C  CD1   . ILE A 1 203 ? 69.788  -11.365 16.008  1.00 38.39  ? 203  ILE A CD1   1 
ATOM   1650 N  N     . TYR A 1 204 ? 66.438  -14.050 19.177  1.00 41.95  ? 204  TYR A N     1 
ATOM   1651 C  CA    . TYR A 1 204 ? 66.091  -14.778 20.396  1.00 42.96  ? 204  TYR A CA    1 
ATOM   1652 C  C     . TYR A 1 204 ? 64.617  -14.570 20.736  1.00 43.84  ? 204  TYR A C     1 
ATOM   1653 O  O     . TYR A 1 204 ? 64.090  -13.470 20.545  1.00 44.38  ? 204  TYR A O     1 
ATOM   1654 C  CB    . TYR A 1 204 ? 66.967  -14.272 21.532  1.00 42.79  ? 204  TYR A CB    1 
ATOM   1655 C  CG    . TYR A 1 204 ? 66.484  -14.546 22.942  1.00 42.86  ? 204  TYR A CG    1 
ATOM   1656 C  CD1   . TYR A 1 204 ? 65.778  -13.575 23.661  1.00 42.48  ? 204  TYR A CD1   1 
ATOM   1657 C  CD2   . TYR A 1 204 ? 66.777  -15.754 23.575  1.00 42.83  ? 204  TYR A CD2   1 
ATOM   1658 C  CE1   . TYR A 1 204 ? 65.365  -13.808 24.962  1.00 42.42  ? 204  TYR A CE1   1 
ATOM   1659 C  CE2   . TYR A 1 204 ? 66.364  -15.998 24.877  1.00 42.74  ? 204  TYR A CE2   1 
ATOM   1660 C  CZ    . TYR A 1 204 ? 65.660  -15.022 25.561  1.00 42.68  ? 204  TYR A CZ    1 
ATOM   1661 O  OH    . TYR A 1 204 ? 65.257  -15.268 26.846  1.00 42.54  ? 204  TYR A OH    1 
ATOM   1662 N  N     . TYR A 1 205 ? 63.953  -15.615 21.234  1.00 44.64  ? 205  TYR A N     1 
ATOM   1663 C  CA    . TYR A 1 205 ? 62.558  -15.499 21.667  1.00 45.24  ? 205  TYR A CA    1 
ATOM   1664 C  C     . TYR A 1 205 ? 62.225  -16.338 22.896  1.00 46.27  ? 205  TYR A C     1 
ATOM   1665 O  O     . TYR A 1 205 ? 62.715  -17.461 23.067  1.00 46.32  ? 205  TYR A O     1 
ATOM   1666 C  CB    . TYR A 1 205 ? 61.617  -15.874 20.537  1.00 44.85  ? 205  TYR A CB    1 
ATOM   1667 C  CG    . TYR A 1 205 ? 61.416  -17.350 20.401  1.00 43.81  ? 205  TYR A CG    1 
ATOM   1668 C  CD1   . TYR A 1 205 ? 62.379  -18.146 19.792  1.00 43.94  ? 205  TYR A CD1   1 
ATOM   1669 C  CD2   . TYR A 1 205 ? 60.270  -17.952 20.892  1.00 42.59  ? 205  TYR A CD2   1 
ATOM   1670 C  CE1   . TYR A 1 205 ? 62.200  -19.508 19.671  1.00 44.48  ? 205  TYR A CE1   1 
ATOM   1671 C  CE2   . TYR A 1 205 ? 60.073  -19.305 20.780  1.00 43.33  ? 205  TYR A CE2   1 
ATOM   1672 C  CZ    . TYR A 1 205 ? 61.040  -20.089 20.171  1.00 44.21  ? 205  TYR A CZ    1 
ATOM   1673 O  OH    . TYR A 1 205 ? 60.852  -21.454 20.070  1.00 44.59  ? 205  TYR A OH    1 
ATOM   1674 N  N     . GLU A 1 206 ? 61.379  -15.773 23.748  1.00 47.53  ? 206  GLU A N     1 
ATOM   1675 C  CA    . GLU A 1 206 ? 60.862  -16.474 24.914  1.00 48.88  ? 206  GLU A CA    1 
ATOM   1676 C  C     . GLU A 1 206 ? 59.389  -16.782 24.681  1.00 49.65  ? 206  GLU A C     1 
ATOM   1677 O  O     . GLU A 1 206 ? 58.693  -16.015 23.998  1.00 49.83  ? 206  GLU A O     1 
ATOM   1678 C  CB    . GLU A 1 206 ? 60.990  -15.608 26.167  1.00 48.87  ? 206  GLU A CB    1 
ATOM   1679 C  CG    . GLU A 1 206 ? 62.294  -15.737 26.929  1.00 49.63  ? 206  GLU A CG    1 
ATOM   1680 C  CD    . GLU A 1 206 ? 62.378  -14.760 28.113  1.00 51.09  ? 206  GLU A CD    1 
ATOM   1681 O  OE1   . GLU A 1 206 ? 61.329  -14.484 28.745  1.00 51.33  ? 206  GLU A OE1   1 
ATOM   1682 O  OE2   . GLU A 1 206 ? 63.494  -14.269 28.420  1.00 51.54  ? 206  GLU A OE2   1 
ATOM   1683 N  N     . LEU A 1 207 ? 58.919  -17.891 25.257  1.00 50.37  ? 207  LEU A N     1 
ATOM   1684 C  CA    . LEU A 1 207 ? 57.506  -18.247 25.213  1.00 50.96  ? 207  LEU A CA    1 
ATOM   1685 C  C     . LEU A 1 207 ? 56.892  -18.379 26.614  1.00 51.84  ? 207  LEU A C     1 
ATOM   1686 O  O     . LEU A 1 207 ? 56.802  -19.474 27.166  1.00 51.95  ? 207  LEU A O     1 
ATOM   1687 C  CB    . LEU A 1 207 ? 57.317  -19.521 24.414  1.00 50.55  ? 207  LEU A CB    1 
ATOM   1688 C  CG    . LEU A 1 207 ? 55.852  -19.868 24.253  1.00 50.51  ? 207  LEU A CG    1 
ATOM   1689 C  CD1   . LEU A 1 207 ? 55.153  -18.804 23.442  1.00 51.00  ? 207  LEU A CD1   1 
ATOM   1690 C  CD2   . LEU A 1 207 ? 55.748  -21.209 23.595  1.00 51.53  ? 207  LEU A CD2   1 
ATOM   1691 N  N     . LEU A 1 208 ? 56.463  -17.246 27.167  1.00 52.95  ? 208  LEU A N     1 
ATOM   1692 C  CA    . LEU A 1 208 ? 55.952  -17.140 28.537  1.00 54.08  ? 208  LEU A CA    1 
ATOM   1693 C  C     . LEU A 1 208 ? 54.813  -18.093 28.876  1.00 55.19  ? 208  LEU A C     1 
ATOM   1694 O  O     . LEU A 1 208 ? 53.715  -17.988 28.310  1.00 55.42  ? 208  LEU A O     1 
ATOM   1695 C  CB    . LEU A 1 208 ? 55.475  -15.720 28.771  1.00 53.92  ? 208  LEU A CB    1 
ATOM   1696 C  CG    . LEU A 1 208 ? 56.453  -14.763 29.424  1.00 54.00  ? 208  LEU A CG    1 
ATOM   1697 C  CD1   . LEU A 1 208 ? 57.625  -14.461 28.513  1.00 54.11  ? 208  LEU A CD1   1 
ATOM   1698 C  CD2   . LEU A 1 208 ? 55.699  -13.504 29.776  1.00 54.48  ? 208  LEU A CD2   1 
ATOM   1699 N  N     . LYS A 1 209 ? 55.070  -18.990 29.831  1.00 56.43  ? 209  LYS A N     1 
ATOM   1700 C  CA    . LYS A 1 209 ? 54.156  -20.113 30.149  1.00 57.53  ? 209  LYS A CA    1 
ATOM   1701 C  C     . LYS A 1 209 ? 52.698  -19.694 30.477  1.00 57.95  ? 209  LYS A C     1 
ATOM   1702 O  O     . LYS A 1 209 ? 52.479  -18.588 30.984  1.00 57.85  ? 209  LYS A O     1 
ATOM   1703 C  CB    . LYS A 1 209 ? 54.751  -21.009 31.252  1.00 57.65  ? 209  LYS A CB    1 
ATOM   1704 C  CG    . LYS A 1 209 ? 56.163  -21.536 30.943  1.00 58.62  ? 209  LYS A CG    1 
ATOM   1705 C  CD    . LYS A 1 209 ? 56.462  -22.888 31.614  1.00 60.46  ? 209  LYS A CD    1 
ATOM   1706 C  CE    . LYS A 1 209 ? 56.437  -22.836 33.161  1.00 61.44  ? 209  LYS A CE    1 
ATOM   1707 N  NZ    . LYS A 1 209 ? 57.558  -22.070 33.791  1.00 60.86  ? 209  LYS A NZ    1 
ATOM   1708 N  N     . PRO A 1 210 ? 51.704  -20.569 30.162  1.00 58.39  ? 210  PRO A N     1 
ATOM   1709 C  CA    . PRO A 1 210 ? 50.282  -20.233 30.291  1.00 58.71  ? 210  PRO A CA    1 
ATOM   1710 C  C     . PRO A 1 210 ? 49.939  -19.395 31.525  1.00 59.16  ? 210  PRO A C     1 
ATOM   1711 O  O     . PRO A 1 210 ? 50.355  -19.732 32.639  1.00 59.17  ? 210  PRO A O     1 
ATOM   1712 C  CB    . PRO A 1 210 ? 49.616  -21.610 30.356  1.00 58.71  ? 210  PRO A CB    1 
ATOM   1713 C  CG    . PRO A 1 210 ? 50.450  -22.444 29.440  1.00 58.32  ? 210  PRO A CG    1 
ATOM   1714 C  CD    . PRO A 1 210 ? 51.872  -21.925 29.591  1.00 58.45  ? 210  PRO A CD    1 
ATOM   1715 N  N     . GLY A 1 211 ? 49.196  -18.307 31.302  1.00 59.65  ? 211  GLY A N     1 
ATOM   1716 C  CA    . GLY A 1 211 ? 48.803  -17.365 32.361  1.00 59.94  ? 211  GLY A CA    1 
ATOM   1717 C  C     . GLY A 1 211 ? 49.982  -16.546 32.850  1.00 60.15  ? 211  GLY A C     1 
ATOM   1718 O  O     . GLY A 1 211 ? 50.118  -16.287 34.048  1.00 59.94  ? 211  GLY A O     1 
ATOM   1719 N  N     . GLU A 1 212 ? 50.831  -16.130 31.915  1.00 60.44  ? 212  GLU A N     1 
ATOM   1720 C  CA    . GLU A 1 212 ? 52.096  -15.508 32.274  1.00 60.72  ? 212  GLU A CA    1 
ATOM   1721 C  C     . GLU A 1 212 ? 52.097  -13.992 32.121  1.00 60.69  ? 212  GLU A C     1 
ATOM   1722 O  O     . GLU A 1 212 ? 51.291  -13.425 31.384  1.00 60.57  ? 212  GLU A O     1 
ATOM   1723 C  CB    . GLU A 1 212 ? 53.239  -16.147 31.480  1.00 60.80  ? 212  GLU A CB    1 
ATOM   1724 C  CG    . GLU A 1 212 ? 54.606  -16.147 32.185  1.00 61.52  ? 212  GLU A CG    1 
ATOM   1725 C  CD    . GLU A 1 212 ? 54.580  -16.715 33.600  1.00 61.98  ? 212  GLU A CD    1 
ATOM   1726 O  OE1   . GLU A 1 212 ? 55.190  -17.793 33.813  1.00 61.82  ? 212  GLU A OE1   1 
ATOM   1727 O  OE2   . GLU A 1 212 ? 53.965  -16.078 34.492  1.00 61.53  ? 212  GLU A OE2   1 
ATOM   1728 N  N     . THR A 1 213 ? 53.019  -13.348 32.828  1.00 60.77  ? 213  THR A N     1 
ATOM   1729 C  CA    . THR A 1 213 ? 53.084  -11.894 32.877  1.00 60.93  ? 213  THR A CA    1 
ATOM   1730 C  C     . THR A 1 213 ? 54.502  -11.340 32.585  1.00 60.88  ? 213  THR A C     1 
ATOM   1731 O  O     . THR A 1 213 ? 55.520  -12.006 32.837  1.00 61.09  ? 213  THR A O     1 
ATOM   1732 C  CB    . THR A 1 213 ? 52.513  -11.374 34.248  1.00 61.10  ? 213  THR A CB    1 
ATOM   1733 O  OG1   . THR A 1 213 ? 51.843  -10.119 34.064  1.00 61.21  ? 213  THR A OG1   1 
ATOM   1734 C  CG2   . THR A 1 213 ? 53.603  -11.273 35.358  1.00 60.73  ? 213  THR A CG2   1 
ATOM   1735 N  N     . VAL A 1 214 ? 54.551  -10.122 32.049  1.00 60.46  ? 214  VAL A N     1 
ATOM   1736 C  CA    . VAL A 1 214 ? 55.807  -9.393  31.828  1.00 59.92  ? 214  VAL A CA    1 
ATOM   1737 C  C     . VAL A 1 214 ? 55.891  -8.108  32.708  1.00 59.60  ? 214  VAL A C     1 
ATOM   1738 O  O     . VAL A 1 214 ? 55.205  -7.114  32.458  1.00 59.54  ? 214  VAL A O     1 
ATOM   1739 C  CB    . VAL A 1 214 ? 56.015  -9.130  30.300  1.00 59.88  ? 214  VAL A CB    1 
ATOM   1740 C  CG1   . VAL A 1 214 ? 56.790  -7.856  30.029  1.00 59.85  ? 214  VAL A CG1   1 
ATOM   1741 C  CG2   . VAL A 1 214 ? 56.702  -10.316 29.653  1.00 59.61  ? 214  VAL A CG2   1 
ATOM   1742 N  N     . ASN A 1 215 ? 56.717  -8.150  33.751  1.00 59.19  ? 215  ASN A N     1 
ATOM   1743 C  CA    . ASN A 1 215 ? 56.874  -7.015  34.676  1.00 58.79  ? 215  ASN A CA    1 
ATOM   1744 C  C     . ASN A 1 215 ? 58.248  -6.345  34.556  1.00 58.25  ? 215  ASN A C     1 
ATOM   1745 O  O     . ASN A 1 215 ? 59.189  -6.959  34.042  1.00 58.24  ? 215  ASN A O     1 
ATOM   1746 C  CB    . ASN A 1 215 ? 56.588  -7.448  36.124  1.00 59.02  ? 215  ASN A CB    1 
ATOM   1747 C  CG    . ASN A 1 215 ? 57.291  -8.751  36.505  1.00 59.79  ? 215  ASN A CG    1 
ATOM   1748 O  OD1   . ASN A 1 215 ? 58.521  -8.802  36.603  1.00 60.68  ? 215  ASN A OD1   1 
ATOM   1749 N  ND2   . ASN A 1 215 ? 56.505  -9.809  36.731  1.00 60.21  ? 215  ASN A ND2   1 
ATOM   1750 N  N     . ALA A 1 216 ? 58.363  -5.095  35.023  1.00 57.42  ? 216  ALA A N     1 
ATOM   1751 C  CA    . ALA A 1 216 ? 59.602  -4.313  34.873  1.00 56.66  ? 216  ALA A CA    1 
ATOM   1752 C  C     . ALA A 1 216 ? 60.820  -5.206  35.016  1.00 56.36  ? 216  ALA A C     1 
ATOM   1753 O  O     . ALA A 1 216 ? 61.725  -5.166  34.188  1.00 56.34  ? 216  ALA A O     1 
ATOM   1754 C  CB    . ALA A 1 216 ? 59.657  -3.152  35.867  1.00 56.43  ? 216  ALA A CB    1 
ATOM   1755 N  N     . ALA A 1 217 ? 60.805  -6.034  36.059  1.00 56.16  ? 217  ALA A N     1 
ATOM   1756 C  CA    . ALA A 1 217 ? 61.849  -7.015  36.325  1.00 55.89  ? 217  ALA A CA    1 
ATOM   1757 C  C     . ALA A 1 217 ? 61.977  -8.017  35.181  1.00 55.66  ? 217  ALA A C     1 
ATOM   1758 O  O     . ALA A 1 217 ? 63.036  -8.123  34.565  1.00 55.67  ? 217  ALA A O     1 
ATOM   1759 C  CB    . ALA A 1 217 ? 61.566  -7.733  37.639  1.00 55.93  ? 217  ALA A CB    1 
ATOM   1760 N  N     . ARG A 1 218 ? 60.887  -8.725  34.890  1.00 55.38  ? 218  ARG A N     1 
ATOM   1761 C  CA    . ARG A 1 218 ? 60.858  -9.760  33.852  1.00 55.20  ? 218  ARG A CA    1 
ATOM   1762 C  C     . ARG A 1 218 ? 61.535  -9.342  32.545  1.00 54.89  ? 218  ARG A C     1 
ATOM   1763 O  O     . ARG A 1 218 ? 62.333  -10.097 31.986  1.00 54.80  ? 218  ARG A O     1 
ATOM   1764 C  CB    . ARG A 1 218 ? 59.411  -10.215 33.586  1.00 55.29  ? 218  ARG A CB    1 
ATOM   1765 C  CG    . ARG A 1 218 ? 59.218  -11.062 32.325  1.00 55.48  ? 218  ARG A CG    1 
ATOM   1766 C  CD    . ARG A 1 218 ? 59.848  -12.422 32.475  1.00 55.62  ? 218  ARG A CD    1 
ATOM   1767 N  NE    . ARG A 1 218 ? 58.949  -13.319 33.189  1.00 56.73  ? 218  ARG A NE    1 
ATOM   1768 C  CZ    . ARG A 1 218 ? 58.637  -14.544 32.780  1.00 57.03  ? 218  ARG A CZ    1 
ATOM   1769 N  NH1   . ARG A 1 218 ? 59.179  -15.027 31.666  1.00 57.09  ? 218  ARG A NH1   1 
ATOM   1770 N  NH2   . ARG A 1 218 ? 57.802  -15.294 33.495  1.00 56.54  ? 218  ARG A NH2   1 
ATOM   1771 N  N     . TYR A 1 219 ? 61.204  -8.142  32.075  1.00 54.58  ? 219  TYR A N     1 
ATOM   1772 C  CA    . TYR A 1 219 ? 61.718  -7.620  30.812  1.00 54.46  ? 219  TYR A CA    1 
ATOM   1773 C  C     . TYR A 1 219 ? 63.242  -7.527  30.819  1.00 54.40  ? 219  TYR A C     1 
ATOM   1774 O  O     . TYR A 1 219 ? 63.904  -7.891  29.842  1.00 54.29  ? 219  TYR A O     1 
ATOM   1775 C  CB    . TYR A 1 219 ? 61.092  -6.250  30.507  1.00 54.46  ? 219  TYR A CB    1 
ATOM   1776 C  CG    . TYR A 1 219 ? 61.190  -5.813  29.055  1.00 54.37  ? 219  TYR A CG    1 
ATOM   1777 C  CD1   . TYR A 1 219 ? 60.743  -6.640  28.028  1.00 54.47  ? 219  TYR A CD1   1 
ATOM   1778 C  CD2   . TYR A 1 219 ? 61.701  -4.563  28.714  1.00 54.69  ? 219  TYR A CD2   1 
ATOM   1779 C  CE1   . TYR A 1 219 ? 60.822  -6.247  26.698  1.00 55.20  ? 219  TYR A CE1   1 
ATOM   1780 C  CE2   . TYR A 1 219 ? 61.790  -4.154  27.382  1.00 54.94  ? 219  TYR A CE2   1 
ATOM   1781 C  CZ    . TYR A 1 219 ? 61.350  -5.004  26.376  1.00 55.46  ? 219  TYR A CZ    1 
ATOM   1782 O  OH    . TYR A 1 219 ? 61.421  -4.623  25.046  1.00 55.84  ? 219  TYR A OH    1 
ATOM   1783 N  N     . GLN A 1 220 ? 63.791  -7.044  31.931  1.00 54.29  ? 220  GLN A N     1 
ATOM   1784 C  CA    . GLN A 1 220 ? 65.229  -6.890  32.065  1.00 54.23  ? 220  GLN A CA    1 
ATOM   1785 C  C     . GLN A 1 220 ? 65.902  -8.233  31.849  1.00 54.13  ? 220  GLN A C     1 
ATOM   1786 O  O     . GLN A 1 220 ? 66.811  -8.349  31.033  1.00 54.15  ? 220  GLN A O     1 
ATOM   1787 C  CB    . GLN A 1 220 ? 65.594  -6.301  33.429  1.00 54.28  ? 220  GLN A CB    1 
ATOM   1788 C  CG    . GLN A 1 220 ? 65.246  -4.820  33.587  1.00 54.36  ? 220  GLN A CG    1 
ATOM   1789 C  CD    . GLN A 1 220 ? 65.655  -4.247  34.942  1.00 54.77  ? 220  GLN A CD    1 
ATOM   1790 O  OE1   . GLN A 1 220 ? 66.071  -4.977  35.844  1.00 55.47  ? 220  GLN A OE1   1 
ATOM   1791 N  NE2   . GLN A 1 220 ? 65.537  -2.930  35.088  1.00 54.40  ? 220  GLN A NE2   1 
ATOM   1792 N  N     . GLN A 1 221 ? 65.427  -9.250  32.559  1.00 54.19  ? 221  GLN A N     1 
ATOM   1793 C  CA    . GLN A 1 221 ? 65.913  -10.617 32.374  1.00 54.30  ? 221  GLN A CA    1 
ATOM   1794 C  C     . GLN A 1 221 ? 66.026  -10.916 30.885  1.00 53.60  ? 221  GLN A C     1 
ATOM   1795 O  O     . GLN A 1 221 ? 67.109  -11.245 30.392  1.00 53.61  ? 221  GLN A O     1 
ATOM   1796 C  CB    . GLN A 1 221 ? 64.989  -11.635 33.077  1.00 54.72  ? 221  GLN A CB    1 
ATOM   1797 C  CG    . GLN A 1 221 ? 65.520  -13.086 33.150  1.00 56.23  ? 221  GLN A CG    1 
ATOM   1798 C  CD    . GLN A 1 221 ? 66.874  -13.240 33.884  1.00 58.15  ? 221  GLN A CD    1 
ATOM   1799 O  OE1   . GLN A 1 221 ? 67.530  -12.253 34.265  1.00 58.39  ? 221  GLN A OE1   1 
ATOM   1800 N  NE2   . GLN A 1 221 ? 67.294  -14.495 34.071  1.00 58.61  ? 221  GLN A NE2   1 
ATOM   1801 N  N     . GLN A 1 222 ? 64.906  -10.756 30.183  1.00 52.74  ? 222  GLN A N     1 
ATOM   1802 C  CA    . GLN A 1 222 ? 64.833  -10.947 28.739  1.00 51.85  ? 222  GLN A CA    1 
ATOM   1803 C  C     . GLN A 1 222 ? 65.861  -10.100 27.998  1.00 51.00  ? 222  GLN A C     1 
ATOM   1804 O  O     . GLN A 1 222 ? 66.657  -10.626 27.224  1.00 50.77  ? 222  GLN A O     1 
ATOM   1805 C  CB    . GLN A 1 222 ? 63.430  -10.622 28.224  1.00 51.97  ? 222  GLN A CB    1 
ATOM   1806 C  CG    . GLN A 1 222 ? 62.307  -11.318 28.964  1.00 52.26  ? 222  GLN A CG    1 
ATOM   1807 C  CD    . GLN A 1 222 ? 60.978  -11.128 28.282  1.00 52.50  ? 222  GLN A CD    1 
ATOM   1808 O  OE1   . GLN A 1 222 ? 60.279  -10.145 28.517  1.00 52.87  ? 222  GLN A OE1   1 
ATOM   1809 N  NE2   . GLN A 1 222 ? 60.617  -12.072 27.429  1.00 52.97  ? 222  GLN A NE2   1 
ATOM   1810 N  N     . LEU A 1 223 ? 65.837  -8.793  28.236  1.00 50.09  ? 223  LEU A N     1 
ATOM   1811 C  CA    . LEU A 1 223 ? 66.796  -7.892  27.626  1.00 49.46  ? 223  LEU A CA    1 
ATOM   1812 C  C     . LEU A 1 223 ? 68.205  -8.437  27.722  1.00 49.38  ? 223  LEU A C     1 
ATOM   1813 O  O     . LEU A 1 223 ? 68.867  -8.625  26.708  1.00 49.24  ? 223  LEU A O     1 
ATOM   1814 C  CB    . LEU A 1 223 ? 66.729  -6.535  28.298  1.00 49.24  ? 223  LEU A CB    1 
ATOM   1815 C  CG    . LEU A 1 223 ? 66.183  -5.387  27.465  1.00 49.11  ? 223  LEU A CG    1 
ATOM   1816 C  CD1   . LEU A 1 223 ? 65.455  -5.848  26.202  1.00 48.80  ? 223  LEU A CD1   1 
ATOM   1817 C  CD2   . LEU A 1 223 ? 65.296  -4.536  28.342  1.00 49.02  ? 223  LEU A CD2   1 
ATOM   1818 N  N     . ILE A 1 224 ? 68.646  -8.706  28.950  1.00 49.32  ? 224  ILE A N     1 
ATOM   1819 C  CA    . ILE A 1 224 ? 69.994  -9.209  29.218  1.00 49.17  ? 224  ILE A CA    1 
ATOM   1820 C  C     . ILE A 1 224 ? 70.224  -10.535 28.492  1.00 48.91  ? 224  ILE A C     1 
ATOM   1821 O  O     . ILE A 1 224 ? 71.261  -10.730 27.851  1.00 48.75  ? 224  ILE A O     1 
ATOM   1822 C  CB    . ILE A 1 224 ? 70.282  -9.317  30.751  1.00 49.25  ? 224  ILE A CB    1 
ATOM   1823 C  CG1   . ILE A 1 224 ? 70.187  -7.931  31.417  1.00 49.32  ? 224  ILE A CG1   1 
ATOM   1824 C  CG2   . ILE A 1 224 ? 71.661  -9.924  31.006  1.00 49.70  ? 224  ILE A CG2   1 
ATOM   1825 C  CD1   . ILE A 1 224 ? 70.556  -7.885  32.916  1.00 49.29  ? 224  ILE A CD1   1 
ATOM   1826 N  N     . ASN A 1 225 ? 69.238  -11.423 28.583  1.00 48.79  ? 225  ASN A N     1 
ATOM   1827 C  CA    . ASN A 1 225 ? 69.238  -12.681 27.847  1.00 48.80  ? 225  ASN A CA    1 
ATOM   1828 C  C     . ASN A 1 225 ? 69.309  -12.505 26.338  1.00 48.85  ? 225  ASN A C     1 
ATOM   1829 O  O     . ASN A 1 225 ? 69.970  -13.291 25.661  1.00 48.91  ? 225  ASN A O     1 
ATOM   1830 C  CB    . ASN A 1 225 ? 67.991  -13.486 28.182  1.00 48.89  ? 225  ASN A CB    1 
ATOM   1831 C  CG    . ASN A 1 225 ? 68.144  -14.281 29.440  1.00 48.72  ? 225  ASN A CG    1 
ATOM   1832 O  OD1   . ASN A 1 225 ? 68.977  -15.179 29.514  1.00 49.02  ? 225  ASN A OD1   1 
ATOM   1833 N  ND2   . ASN A 1 225 ? 67.327  -13.974 30.440  1.00 48.77  ? 225  ASN A ND2   1 
ATOM   1834 N  N     . LEU A 1 226 ? 68.610  -11.495 25.818  1.00 48.81  ? 226  LEU A N     1 
ATOM   1835 C  CA    . LEU A 1 226 ? 68.682  -11.146 24.397  1.00 48.76  ? 226  LEU A CA    1 
ATOM   1836 C  C     . LEU A 1 226 ? 70.121  -10.834 24.014  1.00 49.30  ? 226  LEU A C     1 
ATOM   1837 O  O     . LEU A 1 226 ? 70.650  -11.391 23.050  1.00 49.45  ? 226  LEU A O     1 
ATOM   1838 C  CB    . LEU A 1 226 ? 67.777  -9.945  24.071  1.00 48.38  ? 226  LEU A CB    1 
ATOM   1839 C  CG    . LEU A 1 226 ? 67.951  -9.181  22.752  1.00 46.75  ? 226  LEU A CG    1 
ATOM   1840 C  CD1   . LEU A 1 226 ? 67.677  -10.079 21.583  1.00 45.50  ? 226  LEU A CD1   1 
ATOM   1841 C  CD2   . LEU A 1 226 ? 67.046  -7.963  22.704  1.00 45.47  ? 226  LEU A CD2   1 
ATOM   1842 N  N     . ASN A 1 227 ? 70.751  -9.953  24.786  1.00 49.74  ? 227  ASN A N     1 
ATOM   1843 C  CA    . ASN A 1 227 ? 72.113  -9.547  24.517  1.00 50.18  ? 227  ASN A CA    1 
ATOM   1844 C  C     . ASN A 1 227 ? 73.048  -10.739 24.591  1.00 50.60  ? 227  ASN A C     1 
ATOM   1845 O  O     . ASN A 1 227 ? 73.846  -10.948 23.684  1.00 50.48  ? 227  ASN A O     1 
ATOM   1846 C  CB    . ASN A 1 227 ? 72.545  -8.443  25.477  1.00 50.16  ? 227  ASN A CB    1 
ATOM   1847 C  CG    . ASN A 1 227 ? 73.865  -7.808  25.085  1.00 50.06  ? 227  ASN A CG    1 
ATOM   1848 O  OD1   . ASN A 1 227 ? 74.708  -7.564  25.938  1.00 49.73  ? 227  ASN A OD1   1 
ATOM   1849 N  ND2   . ASN A 1 227 ? 74.052  -7.538  23.794  1.00 50.12  ? 227  ASN A ND2   1 
ATOM   1850 N  N     . ARG A 1 228 ? 72.925  -11.530 25.658  1.00 51.33  ? 228  ARG A N     1 
ATOM   1851 C  CA    . ARG A 1 228 ? 73.674  -12.782 25.783  1.00 52.13  ? 228  ARG A CA    1 
ATOM   1852 C  C     . ARG A 1 228 ? 73.587  -13.519 24.448  1.00 52.44  ? 228  ARG A C     1 
ATOM   1853 O  O     . ARG A 1 228 ? 74.606  -13.841 23.839  1.00 52.57  ? 228  ARG A O     1 
ATOM   1854 C  CB    . ARG A 1 228 ? 73.144  -13.640 26.951  1.00 52.28  ? 228  ARG A CB    1 
ATOM   1855 C  CG    . ARG A 1 228 ? 74.090  -14.759 27.449  1.00 52.99  ? 228  ARG A CG    1 
ATOM   1856 C  CD    . ARG A 1 228 ? 74.035  -14.948 28.987  1.00 54.86  ? 228  ARG A CD    1 
ATOM   1857 N  NE    . ARG A 1 228 ? 74.493  -13.751 29.716  1.00 57.22  ? 228  ARG A NE    1 
ATOM   1858 C  CZ    . ARG A 1 228 ? 75.748  -13.509 30.125  1.00 57.97  ? 228  ARG A CZ    1 
ATOM   1859 N  NH1   . ARG A 1 228 ? 76.727  -14.384 29.909  1.00 58.13  ? 228  ARG A NH1   1 
ATOM   1860 N  NH2   . ARG A 1 228 ? 76.031  -12.376 30.766  1.00 57.73  ? 228  ARG A NH2   1 
ATOM   1861 N  N     . ALA A 1 229 ? 72.364  -13.721 23.967  1.00 52.92  ? 229  ALA A N     1 
ATOM   1862 C  CA    . ALA A 1 229 ? 72.144  -14.400 22.698  1.00 53.36  ? 229  ALA A CA    1 
ATOM   1863 C  C     . ALA A 1 229 ? 72.681  -13.599 21.532  1.00 53.58  ? 229  ALA A C     1 
ATOM   1864 O  O     . ALA A 1 229 ? 73.135  -14.166 20.549  1.00 53.53  ? 229  ALA A O     1 
ATOM   1865 C  CB    . ALA A 1 229 ? 70.675  -14.694 22.497  1.00 53.46  ? 229  ALA A CB    1 
ATOM   1866 N  N     . LEU A 1 230 ? 72.637  -12.281 21.645  1.00 54.18  ? 230  LEU A N     1 
ATOM   1867 C  CA    . LEU A 1 230 ? 73.054  -11.438 20.539  1.00 54.98  ? 230  LEU A CA    1 
ATOM   1868 C  C     . LEU A 1 230 ? 74.543  -11.584 20.247  1.00 55.77  ? 230  LEU A C     1 
ATOM   1869 O  O     . LEU A 1 230 ? 74.930  -11.741 19.087  1.00 55.95  ? 230  LEU A O     1 
ATOM   1870 C  CB    . LEU A 1 230 ? 72.685  -9.976  20.781  1.00 54.77  ? 230  LEU A CB    1 
ATOM   1871 C  CG    . LEU A 1 230 ? 72.628  -9.144  19.501  1.00 54.40  ? 230  LEU A CG    1 
ATOM   1872 C  CD1   . LEU A 1 230 ? 71.524  -8.131  19.594  1.00 54.40  ? 230  LEU A CD1   1 
ATOM   1873 C  CD2   . LEU A 1 230 ? 73.958  -8.478  19.213  1.00 54.90  ? 230  LEU A CD2   1 
ATOM   1874 N  N     . GLN A 1 231 ? 75.364  -11.540 21.298  1.00 56.67  ? 231  GLN A N     1 
ATOM   1875 C  CA    . GLN A 1 231 ? 76.824  -11.585 21.165  1.00 57.48  ? 231  GLN A CA    1 
ATOM   1876 C  C     . GLN A 1 231 ? 77.260  -12.666 20.175  1.00 57.89  ? 231  GLN A C     1 
ATOM   1877 O  O     . GLN A 1 231 ? 77.945  -12.368 19.192  1.00 57.81  ? 231  GLN A O     1 
ATOM   1878 C  CB    . GLN A 1 231 ? 77.516  -11.808 22.528  1.00 57.69  ? 231  GLN A CB    1 
ATOM   1879 C  CG    . GLN A 1 231 ? 77.090  -10.882 23.691  1.00 58.21  ? 231  GLN A CG    1 
ATOM   1880 C  CD    . GLN A 1 231 ? 77.552  -9.432  23.539  1.00 58.54  ? 231  GLN A CD    1 
ATOM   1881 O  OE1   . GLN A 1 231 ? 77.055  -8.686  22.686  1.00 58.61  ? 231  GLN A OE1   1 
ATOM   1882 N  NE2   . GLN A 1 231 ? 78.488  -9.024  24.390  1.00 58.08  ? 231  GLN A NE2   1 
ATOM   1883 N  N     . ARG A 1 232 ? 76.836  -13.906 20.425  1.00 58.47  ? 232  ARG A N     1 
ATOM   1884 C  CA    . ARG A 1 232 ? 77.228  -15.039 19.587  1.00 59.14  ? 232  ARG A CA    1 
ATOM   1885 C  C     . ARG A 1 232 ? 76.477  -15.137 18.244  1.00 59.71  ? 232  ARG A C     1 
ATOM   1886 O  O     . ARG A 1 232 ? 77.037  -15.651 17.275  1.00 59.88  ? 232  ARG A O     1 
ATOM   1887 C  CB    . ARG A 1 232 ? 77.152  -16.358 20.362  1.00 58.97  ? 232  ARG A CB    1 
ATOM   1888 C  CG    . ARG A 1 232 ? 75.787  -16.675 20.909  1.00 59.25  ? 232  ARG A CG    1 
ATOM   1889 C  CD    . ARG A 1 232 ? 75.689  -18.114 21.396  1.00 60.12  ? 232  ARG A CD    1 
ATOM   1890 N  NE    . ARG A 1 232 ? 74.290  -18.526 21.541  1.00 60.82  ? 232  ARG A NE    1 
ATOM   1891 C  CZ    . ARG A 1 232 ? 73.536  -18.993 20.544  1.00 61.45  ? 232  ARG A CZ    1 
ATOM   1892 N  NH1   . ARG A 1 232 ? 74.046  -19.119 19.321  1.00 61.89  ? 232  ARG A NH1   1 
ATOM   1893 N  NH2   . ARG A 1 232 ? 72.269  -19.335 20.761  1.00 61.43  ? 232  ARG A NH2   1 
ATOM   1894 N  N     . LYS A 1 233 ? 75.237  -14.641 18.176  1.00 60.34  ? 233  LYS A N     1 
ATOM   1895 C  CA    . LYS A 1 233 ? 74.416  -14.762 16.950  1.00 60.83  ? 233  LYS A CA    1 
ATOM   1896 C  C     . LYS A 1 233 ? 74.732  -13.721 15.868  1.00 61.30  ? 233  LYS A C     1 
ATOM   1897 O  O     . LYS A 1 233 ? 74.804  -14.056 14.685  1.00 61.18  ? 233  LYS A O     1 
ATOM   1898 C  CB    . LYS A 1 233 ? 72.917  -14.755 17.271  1.00 60.72  ? 233  LYS A CB    1 
ATOM   1899 C  CG    . LYS A 1 233 ? 72.369  -16.026 17.928  1.00 60.57  ? 233  LYS A CG    1 
ATOM   1900 C  CD    . LYS A 1 233 ? 71.616  -16.961 16.964  1.00 60.17  ? 233  LYS A CD    1 
ATOM   1901 C  CE    . LYS A 1 233 ? 70.489  -17.704 17.710  1.00 59.54  ? 233  LYS A CE    1 
ATOM   1902 N  NZ    . LYS A 1 233 ? 70.440  -19.176 17.455  1.00 59.16  ? 233  LYS A NZ    1 
ATOM   1903 N  N     . ARG A 1 234 ? 74.891  -12.463 16.273  1.00 62.11  ? 234  ARG A N     1 
ATOM   1904 C  CA    . ARG A 1 234 ? 75.395  -11.413 15.377  1.00 63.01  ? 234  ARG A CA    1 
ATOM   1905 C  C     . ARG A 1 234 ? 76.835  -11.064 15.796  1.00 64.02  ? 234  ARG A C     1 
ATOM   1906 O  O     . ARG A 1 234 ? 77.059  -10.141 16.599  1.00 64.08  ? 234  ARG A O     1 
ATOM   1907 C  CB    . ARG A 1 234 ? 74.488  -10.172 15.388  1.00 62.80  ? 234  ARG A CB    1 
ATOM   1908 C  CG    . ARG A 1 234 ? 73.072  -10.375 14.843  1.00 61.52  ? 234  ARG A CG    1 
ATOM   1909 C  CD    . ARG A 1 234 ? 73.061  -10.727 13.362  1.00 58.95  ? 234  ARG A CD    1 
ATOM   1910 N  NE    . ARG A 1 234 ? 71.757  -11.234 12.935  1.00 56.72  ? 234  ARG A NE    1 
ATOM   1911 C  CZ    . ARG A 1 234 ? 71.345  -12.491 13.086  1.00 55.11  ? 234  ARG A CZ    1 
ATOM   1912 N  NH1   . ARG A 1 234 ? 72.128  -13.384 13.668  1.00 54.88  ? 234  ARG A NH1   1 
ATOM   1913 N  NH2   . ARG A 1 234 ? 70.146  -12.858 12.659  1.00 54.10  ? 234  ARG A NH2   1 
ATOM   1914 N  N     . PRO A 1 235 ? 77.819  -11.793 15.229  1.00 64.88  ? 235  PRO A N     1 
ATOM   1915 C  CA    . PRO A 1 235 ? 79.129  -11.950 15.869  1.00 65.50  ? 235  PRO A CA    1 
ATOM   1916 C  C     . PRO A 1 235 ? 79.798  -10.652 16.329  1.00 66.25  ? 235  PRO A C     1 
ATOM   1917 O  O     . PRO A 1 235 ? 80.608  -10.677 17.256  1.00 66.50  ? 235  PRO A O     1 
ATOM   1918 C  CB    . PRO A 1 235 ? 79.974  -12.642 14.784  1.00 65.42  ? 235  PRO A CB    1 
ATOM   1919 C  CG    . PRO A 1 235 ? 78.977  -13.278 13.859  1.00 65.03  ? 235  PRO A CG    1 
ATOM   1920 C  CD    . PRO A 1 235 ? 77.814  -12.338 13.854  1.00 64.91  ? 235  PRO A CD    1 
ATOM   1921 N  N     . GLU A 1 236 ? 79.449  -9.529  15.707  1.00 67.03  ? 236  GLU A N     1 
ATOM   1922 C  CA    . GLU A 1 236 ? 80.270  -8.326  15.821  1.00 67.90  ? 236  GLU A CA    1 
ATOM   1923 C  C     . GLU A 1 236 ? 79.505  -7.005  15.731  1.00 68.32  ? 236  GLU A C     1 
ATOM   1924 O  O     . GLU A 1 236 ? 79.942  -6.058  15.058  1.00 68.40  ? 236  GLU A O     1 
ATOM   1925 C  CB    . GLU A 1 236 ? 81.418  -8.366  14.793  1.00 68.07  ? 236  GLU A CB    1 
ATOM   1926 C  CG    . GLU A 1 236 ? 81.157  -9.223  13.545  1.00 68.36  ? 236  GLU A CG    1 
ATOM   1927 C  CD    . GLU A 1 236 ? 79.853  -8.880  12.836  1.00 69.07  ? 236  GLU A CD    1 
ATOM   1928 O  OE1   . GLU A 1 236 ? 79.939  -8.450  11.669  1.00 70.22  ? 236  GLU A OE1   1 
ATOM   1929 O  OE2   . GLU A 1 236 ? 78.754  -9.038  13.430  1.00 68.50  ? 236  GLU A OE2   1 
ATOM   1930 N  N     . TYR A 1 237 ? 78.371  -6.936  16.420  1.00 68.80  ? 237  TYR A N     1 
ATOM   1931 C  CA    . TYR A 1 237 ? 77.740  -5.644  16.670  1.00 69.31  ? 237  TYR A CA    1 
ATOM   1932 C  C     . TYR A 1 237 ? 78.550  -4.836  17.693  1.00 69.31  ? 237  TYR A C     1 
ATOM   1933 O  O     . TYR A 1 237 ? 79.263  -5.397  18.532  1.00 69.31  ? 237  TYR A O     1 
ATOM   1934 C  CB    . TYR A 1 237 ? 76.298  -5.804  17.153  1.00 69.49  ? 237  TYR A CB    1 
ATOM   1935 C  CG    . TYR A 1 237 ? 75.235  -5.734  16.069  1.00 70.19  ? 237  TYR A CG    1 
ATOM   1936 C  CD1   . TYR A 1 237 ? 75.238  -4.720  15.104  1.00 70.73  ? 237  TYR A CD1   1 
ATOM   1937 C  CD2   . TYR A 1 237 ? 74.197  -6.667  16.039  1.00 70.84  ? 237  TYR A CD2   1 
ATOM   1938 C  CE1   . TYR A 1 237 ? 74.249  -4.666  14.122  1.00 71.38  ? 237  TYR A CE1   1 
ATOM   1939 C  CE2   . TYR A 1 237 ? 73.204  -6.619  15.072  1.00 71.09  ? 237  TYR A CE2   1 
ATOM   1940 C  CZ    . TYR A 1 237 ? 73.231  -5.623  14.119  1.00 71.50  ? 237  TYR A CZ    1 
ATOM   1941 O  OH    . TYR A 1 237 ? 72.231  -5.601  13.173  1.00 71.90  ? 237  TYR A OH    1 
ATOM   1942 N  N     . GLN A 1 241 ? 81.956  -2.513  16.054  1.00 20.00  ? 241  GLN A N     1 
ATOM   1943 C  CA    . GLN A 1 241 ? 82.091  -1.596  14.929  1.00 20.00  ? 241  GLN A CA    1 
ATOM   1944 C  C     . GLN A 1 241 ? 80.841  -0.740  14.761  1.00 20.00  ? 241  GLN A C     1 
ATOM   1945 O  O     . GLN A 1 241 ? 80.941  0.518   14.597  1.00 46.64  ? 241  GLN A O     1 
ATOM   1946 C  CB    . GLN A 1 241 ? 82.377  -2.369  13.640  1.00 20.00  ? 241  GLN A CB    1 
ATOM   1947 C  CG    . GLN A 1 241 ? 83.730  -3.059  13.616  1.00 20.00  ? 241  GLN A CG    1 
ATOM   1948 C  CD    . GLN A 1 241 ? 83.948  -3.874  12.358  1.00 20.00  ? 241  GLN A CD    1 
ATOM   1949 O  OE1   . GLN A 1 241 ? 82.990  -4.311  11.720  1.00 20.00  ? 241  GLN A OE1   1 
ATOM   1950 N  NE2   . GLN A 1 241 ? 85.211  -4.079  11.995  1.00 20.00  ? 241  GLN A NE2   1 
ATOM   1951 N  N     . HIS A 1 242 ? 79.660  -1.347  14.729  1.00 46.24  ? 242  HIS A N     1 
ATOM   1952 C  CA    . HIS A 1 242 ? 78.366  -0.663  14.511  1.00 45.67  ? 242  HIS A CA    1 
ATOM   1953 C  C     . HIS A 1 242 ? 77.360  -0.817  15.692  1.00 45.04  ? 242  HIS A C     1 
ATOM   1954 O  O     . HIS A 1 242 ? 76.738  -1.896  15.858  1.00 45.12  ? 242  HIS A O     1 
ATOM   1955 C  CB    . HIS A 1 242 ? 77.712  -1.145  13.189  1.00 45.72  ? 242  HIS A CB    1 
ATOM   1956 C  CG    . HIS A 1 242 ? 78.048  -0.310  11.987  1.00 45.31  ? 242  HIS A CG    1 
ATOM   1957 N  ND1   . HIS A 1 242 ? 78.227  1.056   12.048  1.00 45.01  ? 242  HIS A ND1   1 
ATOM   1958 C  CD2   . HIS A 1 242 ? 78.197  -0.650  10.685  1.00 44.90  ? 242  HIS A CD2   1 
ATOM   1959 C  CE1   . HIS A 1 242 ? 78.488  1.517   10.838  1.00 45.21  ? 242  HIS A CE1   1 
ATOM   1960 N  NE2   . HIS A 1 242 ? 78.472  0.503   9.992   1.00 44.71  ? 242  HIS A NE2   1 
ATOM   1961 N  N     . ARG A 1 243 ? 77.182  0.263   16.473  1.00 43.68  ? 243  ARG A N     1 
ATOM   1962 C  CA    . ARG A 1 243 ? 76.258  0.273   17.634  1.00 42.31  ? 243  ARG A CA    1 
ATOM   1963 C  C     . ARG A 1 243 ? 74.755  -0.013  17.363  1.00 41.20  ? 243  ARG A C     1 
ATOM   1964 O  O     . ARG A 1 243 ? 74.125  0.577   16.481  1.00 40.97  ? 243  ARG A O     1 
ATOM   1965 C  CB    . ARG A 1 243 ? 76.414  1.559   18.445  1.00 42.34  ? 243  ARG A CB    1 
ATOM   1966 C  CG    . ARG A 1 243 ? 75.362  1.714   19.532  1.00 42.80  ? 243  ARG A CG    1 
ATOM   1967 C  CD    . ARG A 1 243 ? 75.872  2.537   20.682  1.00 44.50  ? 243  ARG A CD    1 
ATOM   1968 N  NE    . ARG A 1 243 ? 74.877  3.504   21.136  1.00 46.15  ? 243  ARG A NE    1 
ATOM   1969 C  CZ    . ARG A 1 243 ? 74.800  4.768   20.712  1.00 47.30  ? 243  ARG A CZ    1 
ATOM   1970 N  NH1   . ARG A 1 243 ? 75.670  5.247   19.815  1.00 46.89  ? 243  ARG A NH1   1 
ATOM   1971 N  NH2   . ARG A 1 243 ? 73.846  5.561   21.193  1.00 47.93  ? 243  ARG A NH2   1 
ATOM   1972 N  N     . VAL A 1 244 ? 74.204  -0.897  18.192  1.00 39.69  ? 244  VAL A N     1 
ATOM   1973 C  CA    . VAL A 1 244 ? 72.866  -1.467  18.052  1.00 38.29  ? 244  VAL A CA    1 
ATOM   1974 C  C     . VAL A 1 244 ? 71.677  -0.537  18.394  1.00 37.55  ? 244  VAL A C     1 
ATOM   1975 O  O     . VAL A 1 244 ? 71.671  0.119   19.443  1.00 37.66  ? 244  VAL A O     1 
ATOM   1976 C  CB    . VAL A 1 244 ? 72.814  -2.754  18.879  1.00 38.28  ? 244  VAL A CB    1 
ATOM   1977 C  CG1   . VAL A 1 244 ? 71.428  -3.017  19.463  1.00 37.75  ? 244  VAL A CG1   1 
ATOM   1978 C  CG2   . VAL A 1 244 ? 73.309  -3.900  18.033  1.00 38.06  ? 244  VAL A CG2   1 
ATOM   1979 N  N     . ILE A 1 245 ? 70.671  -0.523  17.506  1.00 36.25  ? 245  ILE A N     1 
ATOM   1980 C  CA    . ILE A 1 245 ? 69.531  0.410   17.556  1.00 34.84  ? 245  ILE A CA    1 
ATOM   1981 C  C     . ILE A 1 245 ? 68.255  -0.324  17.891  1.00 33.88  ? 245  ILE A C     1 
ATOM   1982 O  O     . ILE A 1 245 ? 67.821  -1.167  17.118  1.00 33.72  ? 245  ILE A O     1 
ATOM   1983 C  CB    . ILE A 1 245 ? 69.312  1.106   16.196  1.00 34.83  ? 245  ILE A CB    1 
ATOM   1984 C  CG1   . ILE A 1 245 ? 70.620  1.655   15.629  1.00 35.58  ? 245  ILE A CG1   1 
ATOM   1985 C  CG2   . ILE A 1 245 ? 68.329  2.227   16.328  1.00 34.70  ? 245  ILE A CG2   1 
ATOM   1986 C  CD1   . ILE A 1 245 ? 71.402  2.617   16.565  1.00 36.80  ? 245  ILE A CD1   1 
ATOM   1987 N  N     . PHE A 1 246 ? 67.637  0.023   19.016  1.00 32.99  ? 246  PHE A N     1 
ATOM   1988 C  CA    . PHE A 1 246 ? 66.556  -0.788  19.593  1.00 32.34  ? 246  PHE A CA    1 
ATOM   1989 C  C     . PHE A 1 246 ? 65.159  -0.196  19.457  1.00 32.80  ? 246  PHE A C     1 
ATOM   1990 O  O     . PHE A 1 246 ? 64.858  0.874   20.014  1.00 33.24  ? 246  PHE A O     1 
ATOM   1991 C  CB    . PHE A 1 246 ? 66.834  -1.071  21.067  1.00 31.65  ? 246  PHE A CB    1 
ATOM   1992 C  CG    . PHE A 1 246 ? 66.029  -2.205  21.630  1.00 29.25  ? 246  PHE A CG    1 
ATOM   1993 C  CD1   . PHE A 1 246 ? 66.391  -3.517  21.384  1.00 27.31  ? 246  PHE A CD1   1 
ATOM   1994 C  CD2   . PHE A 1 246 ? 64.918  -1.962  22.418  1.00 27.38  ? 246  PHE A CD2   1 
ATOM   1995 C  CE1   . PHE A 1 246 ? 65.665  -4.565  21.905  1.00 25.89  ? 246  PHE A CE1   1 
ATOM   1996 C  CE2   . PHE A 1 246 ? 64.188  -3.007  22.950  1.00 25.70  ? 246  PHE A CE2   1 
ATOM   1997 C  CZ    . PHE A 1 246 ? 64.565  -4.308  22.693  1.00 25.79  ? 246  PHE A CZ    1 
ATOM   1998 N  N     . LEU A 1 247 ? 64.295  -0.920  18.750  1.00 32.85  ? 247  LEU A N     1 
ATOM   1999 C  CA    . LEU A 1 247 ? 62.950  -0.444  18.467  1.00 32.96  ? 247  LEU A CA    1 
ATOM   2000 C  C     . LEU A 1 247 ? 61.901  -1.293  19.157  1.00 33.54  ? 247  LEU A C     1 
ATOM   2001 O  O     . LEU A 1 247 ? 61.750  -2.478  18.852  1.00 33.30  ? 247  LEU A O     1 
ATOM   2002 C  CB    . LEU A 1 247 ? 62.714  -0.442  16.965  1.00 32.52  ? 247  LEU A CB    1 
ATOM   2003 C  CG    . LEU A 1 247 ? 61.314  -0.140  16.473  1.00 31.77  ? 247  LEU A CG    1 
ATOM   2004 C  CD1   . LEU A 1 247 ? 60.956  1.311   16.714  1.00 32.48  ? 247  LEU A CD1   1 
ATOM   2005 C  CD2   . LEU A 1 247 ? 61.283  -0.441  15.024  1.00 30.82  ? 247  LEU A CD2   1 
ATOM   2006 N  N     . HIS A 1 248 ? 61.178  -0.675  20.087  1.00 34.43  ? 248  HIS A N     1 
ATOM   2007 C  CA    . HIS A 1 248 ? 60.151  -1.371  20.865  1.00 35.35  ? 248  HIS A CA    1 
ATOM   2008 C  C     . HIS A 1 248 ? 59.040  -0.425  21.322  1.00 36.11  ? 248  HIS A C     1 
ATOM   2009 O  O     . HIS A 1 248 ? 59.269  0.778   21.550  1.00 35.96  ? 248  HIS A O     1 
ATOM   2010 C  CB    . HIS A 1 248 ? 60.771  -2.110  22.059  1.00 35.27  ? 248  HIS A CB    1 
ATOM   2011 C  CG    . HIS A 1 248 ? 61.358  -1.206  23.105  1.00 35.50  ? 248  HIS A CG    1 
ATOM   2012 N  ND1   . HIS A 1 248 ? 61.567  -1.615  24.404  1.00 35.46  ? 248  HIS A ND1   1 
ATOM   2013 C  CD2   . HIS A 1 248 ? 61.769  0.085   23.051  1.00 35.52  ? 248  HIS A CD2   1 
ATOM   2014 C  CE1   . HIS A 1 248 ? 62.080  -0.618  25.104  1.00 35.18  ? 248  HIS A CE1   1 
ATOM   2015 N  NE2   . HIS A 1 248 ? 62.207  0.428   24.308  1.00 35.11  ? 248  HIS A NE2   1 
ATOM   2016 N  N     . ASP A 1 249 ? 57.837  -0.985  21.454  1.00 37.08  ? 249  ASP A N     1 
ATOM   2017 C  CA    . ASP A 1 249 ? 56.645  -0.202  21.774  1.00 37.73  ? 249  ASP A CA    1 
ATOM   2018 C  C     . ASP A 1 249 ? 56.682  0.326   23.196  1.00 38.26  ? 249  ASP A C     1 
ATOM   2019 O  O     . ASP A 1 249 ? 57.340  -0.241  24.062  1.00 38.11  ? 249  ASP A O     1 
ATOM   2020 C  CB    . ASP A 1 249 ? 55.346  -0.982  21.464  1.00 37.77  ? 249  ASP A CB    1 
ATOM   2021 C  CG    . ASP A 1 249 ? 55.211  -2.295  22.245  1.00 37.43  ? 249  ASP A CG    1 
ATOM   2022 O  OD1   . ASP A 1 249 ? 56.076  -2.642  23.076  1.00 37.56  ? 249  ASP A OD1   1 
ATOM   2023 O  OD2   . ASP A 1 249 ? 54.203  -2.990  22.016  1.00 36.76  ? 249  ASP A OD2   1 
ATOM   2024 N  N     . ASN A 1 250 ? 55.979  1.422   23.425  1.00 39.34  ? 250  ASN A N     1 
ATOM   2025 C  CA    . ASN A 1 250 ? 56.046  2.114   24.704  1.00 40.74  ? 250  ASN A CA    1 
ATOM   2026 C  C     . ASN A 1 250 ? 55.118  1.471   25.737  1.00 41.54  ? 250  ASN A C     1 
ATOM   2027 O  O     . ASN A 1 250 ? 54.333  2.140   26.408  1.00 41.81  ? 250  ASN A O     1 
ATOM   2028 C  CB    . ASN A 1 250 ? 55.774  3.616   24.512  1.00 40.78  ? 250  ASN A CB    1 
ATOM   2029 C  CG    . ASN A 1 250 ? 56.338  4.150   23.184  1.00 41.34  ? 250  ASN A CG    1 
ATOM   2030 O  OD1   . ASN A 1 250 ? 57.482  3.846   22.806  1.00 42.14  ? 250  ASN A OD1   1 
ATOM   2031 N  ND2   . ASN A 1 250 ? 55.528  4.934   22.467  1.00 40.40  ? 250  ASN A ND2   1 
ATOM   2032 N  N     . ALA A 1 251 ? 55.229  0.152   25.851  1.00 42.56  ? 251  ALA A N     1 
ATOM   2033 C  CA    . ALA A 1 251 ? 54.508  -0.619  26.846  1.00 43.59  ? 251  ALA A CA    1 
ATOM   2034 C  C     . ALA A 1 251 ? 54.759  -0.020  28.214  1.00 44.63  ? 251  ALA A C     1 
ATOM   2035 O  O     . ALA A 1 251 ? 55.766  0.644   28.409  1.00 44.67  ? 251  ALA A O     1 
ATOM   2036 C  CB    . ALA A 1 251 ? 54.974  -2.060  26.811  1.00 43.53  ? 251  ALA A CB    1 
ATOM   2037 N  N     . PRO A 1 252 ? 53.862  -0.276  29.182  1.00 45.89  ? 252  PRO A N     1 
ATOM   2038 C  CA    . PRO A 1 252 ? 54.061  0.296   30.511  1.00 46.56  ? 252  PRO A CA    1 
ATOM   2039 C  C     . PRO A 1 252 ? 55.368  -0.216  31.097  1.00 47.22  ? 252  PRO A C     1 
ATOM   2040 O  O     . PRO A 1 252 ? 56.026  0.488   31.873  1.00 47.50  ? 252  PRO A O     1 
ATOM   2041 C  CB    . PRO A 1 252 ? 52.893  -0.283  31.306  1.00 46.59  ? 252  PRO A CB    1 
ATOM   2042 C  CG    . PRO A 1 252 ? 52.628  -1.615  30.666  1.00 46.37  ? 252  PRO A CG    1 
ATOM   2043 C  CD    . PRO A 1 252 ? 52.824  -1.332  29.197  1.00 46.35  ? 252  PRO A CD    1 
ATOM   2044 N  N     . SER A 1 253 ? 55.724  -1.437  30.697  1.00 47.83  ? 253  SER A N     1 
ATOM   2045 C  CA    . SER A 1 253 ? 56.929  -2.103  31.141  1.00 48.38  ? 253  SER A CA    1 
ATOM   2046 C  C     . SER A 1 253 ? 58.192  -1.514  30.497  1.00 48.83  ? 253  SER A C     1 
ATOM   2047 O  O     . SER A 1 253 ? 59.104  -1.074  31.204  1.00 48.74  ? 253  SER A O     1 
ATOM   2048 C  CB    . SER A 1 253 ? 56.810  -3.593  30.852  1.00 48.25  ? 253  SER A CB    1 
ATOM   2049 O  OG    . SER A 1 253 ? 57.711  -4.319  31.660  1.00 48.29  ? 253  SER A OG    1 
ATOM   2050 N  N     . HIS A 1 254 ? 58.229  -1.484  29.164  1.00 49.50  ? 254  HIS A N     1 
ATOM   2051 C  CA    . HIS A 1 254 ? 59.393  -0.971  28.422  1.00 50.18  ? 254  HIS A CA    1 
ATOM   2052 C  C     . HIS A 1 254 ? 59.668  0.521   28.701  1.00 50.34  ? 254  HIS A C     1 
ATOM   2053 O  O     . HIS A 1 254 ? 60.778  1.010   28.482  1.00 50.32  ? 254  HIS A O     1 
ATOM   2054 C  CB    . HIS A 1 254 ? 59.252  -1.161  26.893  1.00 50.29  ? 254  HIS A CB    1 
ATOM   2055 C  CG    . HIS A 1 254 ? 58.655  -2.471  26.456  1.00 51.29  ? 254  HIS A CG    1 
ATOM   2056 N  ND1   . HIS A 1 254 ? 58.132  -2.653  25.191  1.00 51.72  ? 254  HIS A ND1   1 
ATOM   2057 C  CD2   . HIS A 1 254 ? 58.488  -3.651  27.103  1.00 52.06  ? 254  HIS A CD2   1 
ATOM   2058 C  CE1   . HIS A 1 254 ? 57.677  -3.888  25.075  1.00 51.70  ? 254  HIS A CE1   1 
ATOM   2059 N  NE2   . HIS A 1 254 ? 57.878  -4.515  26.221  1.00 52.13  ? 254  HIS A NE2   1 
ATOM   2060 N  N     . THR A 1 255 ? 58.652  1.238   29.165  1.00 50.59  ? 255  THR A N     1 
ATOM   2061 C  CA    . THR A 1 255 ? 58.737  2.684   29.290  1.00 50.96  ? 255  THR A CA    1 
ATOM   2062 C  C     . THR A 1 255 ? 59.287  3.073   30.659  1.00 51.18  ? 255  THR A C     1 
ATOM   2063 O  O     . THR A 1 255 ? 59.721  4.213   30.859  1.00 51.37  ? 255  THR A O     1 
ATOM   2064 C  CB    . THR A 1 255 ? 57.355  3.354   28.998  1.00 51.07  ? 255  THR A CB    1 
ATOM   2065 O  OG1   . THR A 1 255 ? 57.539  4.655   28.426  1.00 50.97  ? 255  THR A OG1   1 
ATOM   2066 C  CG2   . THR A 1 255 ? 56.476  3.440   30.257  1.00 51.40  ? 255  THR A CG2   1 
ATOM   2067 N  N     . ALA A 1 256 ? 59.278  2.110   31.581  1.00 51.36  ? 256  ALA A N     1 
ATOM   2068 C  CA    . ALA A 1 256 ? 59.718  2.309   32.965  1.00 51.64  ? 256  ALA A CA    1 
ATOM   2069 C  C     . ALA A 1 256 ? 61.213  2.661   33.096  1.00 51.84  ? 256  ALA A C     1 
ATOM   2070 O  O     . ALA A 1 256 ? 62.028  2.272   32.248  1.00 51.84  ? 256  ALA A O     1 
ATOM   2071 C  CB    . ALA A 1 256 ? 59.393  1.078   33.783  1.00 51.66  ? 256  ALA A CB    1 
ATOM   2072 N  N     . ARG A 1 257 ? 61.563  3.384   34.166  1.00 52.02  ? 257  ARG A N     1 
ATOM   2073 C  CA    . ARG A 1 257 ? 62.937  3.882   34.367  1.00 52.12  ? 257  ARG A CA    1 
ATOM   2074 C  C     . ARG A 1 257 ? 63.923  2.762   34.722  1.00 51.89  ? 257  ARG A C     1 
ATOM   2075 O  O     . ARG A 1 257 ? 65.094  2.810   34.333  1.00 51.84  ? 257  ARG A O     1 
ATOM   2076 C  CB    . ARG A 1 257 ? 62.980  5.038   35.386  1.00 52.19  ? 257  ARG A CB    1 
ATOM   2077 C  CG    . ARG A 1 257 ? 64.305  5.799   35.399  1.00 53.19  ? 257  ARG A CG    1 
ATOM   2078 C  CD    . ARG A 1 257 ? 64.146  7.207   35.933  1.00 55.66  ? 257  ARG A CD    1 
ATOM   2079 N  NE    . ARG A 1 257 ? 65.347  7.679   36.633  1.00 57.46  ? 257  ARG A NE    1 
ATOM   2080 C  CZ    . ARG A 1 257 ? 65.571  8.947   36.989  1.00 58.26  ? 257  ARG A CZ    1 
ATOM   2081 N  NH1   . ARG A 1 257 ? 64.689  9.901   36.700  1.00 58.34  ? 257  ARG A NH1   1 
ATOM   2082 N  NH2   . ARG A 1 257 ? 66.691  9.271   37.625  1.00 58.73  ? 257  ARG A NH2   1 
ATOM   2083 N  N     . ALA A 1 258 ? 63.436  1.754   35.442  1.00 51.71  ? 258  ALA A N     1 
ATOM   2084 C  CA    . ALA A 1 258 ? 64.205  0.539   35.702  1.00 51.60  ? 258  ALA A CA    1 
ATOM   2085 C  C     . ALA A 1 258 ? 64.898  0.048   34.423  1.00 51.55  ? 258  ALA A C     1 
ATOM   2086 O  O     . ALA A 1 258 ? 66.127  -0.074  34.374  1.00 51.28  ? 258  ALA A O     1 
ATOM   2087 C  CB    . ALA A 1 258 ? 63.290  -0.545  36.272  1.00 51.49  ? 258  ALA A CB    1 
ATOM   2088 N  N     . VAL A 1 259 ? 64.085  -0.200  33.393  1.00 51.64  ? 259  VAL A N     1 
ATOM   2089 C  CA    . VAL A 1 259 ? 64.527  -0.732  32.102  1.00 51.49  ? 259  VAL A CA    1 
ATOM   2090 C  C     . VAL A 1 259 ? 65.397  0.270   31.358  1.00 51.72  ? 259  VAL A C     1 
ATOM   2091 O  O     . VAL A 1 259 ? 66.419  -0.108  30.788  1.00 51.67  ? 259  VAL A O     1 
ATOM   2092 C  CB    . VAL A 1 259 ? 63.327  -1.147  31.217  1.00 51.31  ? 259  VAL A CB    1 
ATOM   2093 C  CG1   . VAL A 1 259 ? 63.799  -1.664  29.878  1.00 51.03  ? 259  VAL A CG1   1 
ATOM   2094 C  CG2   . VAL A 1 259 ? 62.494  -2.203  31.912  1.00 51.00  ? 259  VAL A CG2   1 
ATOM   2095 N  N     . ARG A 1 260 ? 64.988  1.539   31.374  1.00 52.06  ? 260  ARG A N     1 
ATOM   2096 C  CA    . ARG A 1 260 ? 65.784  2.633   30.808  1.00 52.58  ? 260  ARG A CA    1 
ATOM   2097 C  C     . ARG A 1 260 ? 67.258  2.503   31.183  1.00 52.34  ? 260  ARG A C     1 
ATOM   2098 O  O     . ARG A 1 260 ? 68.136  2.604   30.318  1.00 52.16  ? 260  ARG A O     1 
ATOM   2099 C  CB    . ARG A 1 260 ? 65.234  3.988   31.262  1.00 52.97  ? 260  ARG A CB    1 
ATOM   2100 C  CG    . ARG A 1 260 ? 64.424  4.727   30.194  1.00 55.12  ? 260  ARG A CG    1 
ATOM   2101 C  CD    . ARG A 1 260 ? 63.058  5.259   30.703  1.00 59.07  ? 260  ARG A CD    1 
ATOM   2102 N  NE    . ARG A 1 260 ? 63.154  6.274   31.765  1.00 62.10  ? 260  ARG A NE    1 
ATOM   2103 C  CZ    . ARG A 1 260 ? 62.112  6.902   32.319  1.00 62.95  ? 260  ARG A CZ    1 
ATOM   2104 N  NH1   . ARG A 1 260 ? 60.868  6.632   31.916  1.00 62.63  ? 260  ARG A NH1   1 
ATOM   2105 N  NH2   . ARG A 1 260 ? 62.315  7.806   33.281  1.00 63.29  ? 260  ARG A NH2   1 
ATOM   2106 N  N     . ASP A 1 261 ? 67.504  2.249   32.471  1.00 52.18  ? 261  ASP A N     1 
ATOM   2107 C  CA    . ASP A 1 261 ? 68.852  2.042   33.014  1.00 51.97  ? 261  ASP A CA    1 
ATOM   2108 C  C     . ASP A 1 261 ? 69.531  0.798   32.444  1.00 51.47  ? 261  ASP A C     1 
ATOM   2109 O  O     . ASP A 1 261 ? 70.697  0.859   32.046  1.00 51.37  ? 261  ASP A O     1 
ATOM   2110 C  CB    . ASP A 1 261 ? 68.818  1.961   34.546  1.00 52.22  ? 261  ASP A CB    1 
ATOM   2111 C  CG    . ASP A 1 261 ? 68.187  3.193   35.194  1.00 52.99  ? 261  ASP A CG    1 
ATOM   2112 O  OD1   . ASP A 1 261 ? 68.043  3.186   36.440  1.00 53.65  ? 261  ASP A OD1   1 
ATOM   2113 O  OD2   . ASP A 1 261 ? 67.834  4.160   34.471  1.00 53.35  ? 261  ASP A OD2   1 
ATOM   2114 N  N     . THR A 1 262 ? 68.793  -0.316  32.406  1.00 50.85  ? 262  THR A N     1 
ATOM   2115 C  CA    . THR A 1 262 ? 69.283  -1.587  31.854  1.00 50.17  ? 262  THR A CA    1 
ATOM   2116 C  C     . THR A 1 262 ? 69.577  -1.486  30.369  1.00 49.76  ? 262  THR A C     1 
ATOM   2117 O  O     . THR A 1 262 ? 70.393  -2.235  29.840  1.00 49.61  ? 262  THR A O     1 
ATOM   2118 C  CB    . THR A 1 262 ? 68.273  -2.713  32.058  1.00 50.12  ? 262  THR A CB    1 
ATOM   2119 O  OG1   . THR A 1 262 ? 67.936  -2.782  33.446  1.00 50.57  ? 262  THR A OG1   1 
ATOM   2120 C  CG2   . THR A 1 262 ? 68.848  -4.056  31.600  1.00 49.59  ? 262  THR A CG2   1 
ATOM   2121 N  N     . LEU A 1 263 ? 68.905  -0.560  29.702  1.00 49.24  ? 263  LEU A N     1 
ATOM   2122 C  CA    . LEU A 1 263 ? 69.163  -0.337  28.302  1.00 48.92  ? 263  LEU A CA    1 
ATOM   2123 C  C     . LEU A 1 263 ? 70.417  0.502   28.113  1.00 49.03  ? 263  LEU A C     1 
ATOM   2124 O  O     . LEU A 1 263 ? 71.332  0.090   27.407  1.00 49.23  ? 263  LEU A O     1 
ATOM   2125 C  CB    . LEU A 1 263 ? 67.952  0.290   27.612  1.00 48.83  ? 263  LEU A CB    1 
ATOM   2126 C  CG    . LEU A 1 263 ? 66.798  -0.645  27.215  1.00 47.94  ? 263  LEU A CG    1 
ATOM   2127 C  CD1   . LEU A 1 263 ? 65.547  0.153   26.892  1.00 46.98  ? 263  LEU A CD1   1 
ATOM   2128 C  CD2   . LEU A 1 263 ? 67.168  -1.556  26.051  1.00 46.54  ? 263  LEU A CD2   1 
ATOM   2129 N  N     . GLU A 1 264 ? 70.476  1.662   28.760  1.00 49.01  ? 264  GLU A N     1 
ATOM   2130 C  CA    . GLU A 1 264 ? 71.618  2.568   28.590  1.00 48.95  ? 264  GLU A CA    1 
ATOM   2131 C  C     . GLU A 1 264 ? 72.938  1.960   29.050  1.00 48.41  ? 264  GLU A C     1 
ATOM   2132 O  O     . GLU A 1 264 ? 73.995  2.369   28.589  1.00 48.26  ? 264  GLU A O     1 
ATOM   2133 C  CB    . GLU A 1 264 ? 71.377  3.899   29.303  1.00 49.25  ? 264  GLU A CB    1 
ATOM   2134 C  CG    . GLU A 1 264 ? 71.395  3.808   30.828  1.00 50.47  ? 264  GLU A CG    1 
ATOM   2135 C  CD    . GLU A 1 264 ? 70.913  5.082   31.506  1.00 52.30  ? 264  GLU A CD    1 
ATOM   2136 O  OE1   . GLU A 1 264 ? 70.195  5.882   30.857  1.00 52.78  ? 264  GLU A OE1   1 
ATOM   2137 O  OE2   . GLU A 1 264 ? 71.254  5.280   32.696  1.00 52.99  ? 264  GLU A OE2   1 
ATOM   2138 N  N     . THR A 1 265 ? 72.868  0.989   29.956  1.00 48.00  ? 265  THR A N     1 
ATOM   2139 C  CA    . THR A 1 265 ? 74.068  0.307   30.440  1.00 47.84  ? 265  THR A CA    1 
ATOM   2140 C  C     . THR A 1 265 ? 74.598  -0.743  29.457  1.00 47.45  ? 265  THR A C     1 
ATOM   2141 O  O     . THR A 1 265 ? 75.793  -1.037  29.448  1.00 47.41  ? 265  THR A O     1 
ATOM   2142 C  CB    . THR A 1 265 ? 73.865  -0.334  31.834  1.00 47.98  ? 265  THR A CB    1 
ATOM   2143 O  OG1   . THR A 1 265 ? 72.636  -1.069  31.852  1.00 48.30  ? 265  THR A OG1   1 
ATOM   2144 C  CG2   . THR A 1 265 ? 73.843  0.738   32.935  1.00 48.24  ? 265  THR A CG2   1 
ATOM   2145 N  N     . LEU A 1 266 ? 73.712  -1.309  28.638  1.00 46.96  ? 266  LEU A N     1 
ATOM   2146 C  CA    . LEU A 1 266 ? 74.126  -2.173  27.523  1.00 46.44  ? 266  LEU A CA    1 
ATOM   2147 C  C     . LEU A 1 266 ? 74.756  -1.327  26.427  1.00 46.18  ? 266  LEU A C     1 
ATOM   2148 O  O     . LEU A 1 266 ? 75.296  -1.842  25.438  1.00 46.08  ? 266  LEU A O     1 
ATOM   2149 C  CB    . LEU A 1 266 ? 72.908  -2.849  26.914  1.00 46.20  ? 266  LEU A CB    1 
ATOM   2150 C  CG    . LEU A 1 266 ? 72.130  -3.864  27.717  1.00 45.92  ? 266  LEU A CG    1 
ATOM   2151 C  CD1   . LEU A 1 266 ? 70.674  -3.711  27.388  1.00 46.27  ? 266  LEU A CD1   1 
ATOM   2152 C  CD2   . LEU A 1 266 ? 72.615  -5.243  27.356  1.00 46.35  ? 266  LEU A CD2   1 
ATOM   2153 N  N     . ASN A 1 267 ? 74.699  -0.020  26.650  1.00 45.80  ? 267  ASN A N     1 
ATOM   2154 C  CA    . ASN A 1 267 ? 74.600  0.969   25.594  1.00 45.62  ? 267  ASN A CA    1 
ATOM   2155 C  C     . ASN A 1 267 ? 73.979  0.500   24.273  1.00 45.08  ? 267  ASN A C     1 
ATOM   2156 O  O     . ASN A 1 267 ? 74.695  0.121   23.335  1.00 45.21  ? 267  ASN A O     1 
ATOM   2157 C  CB    . ASN A 1 267 ? 75.902  1.733   25.358  1.00 45.79  ? 267  ASN A CB    1 
ATOM   2158 C  CG    . ASN A 1 267 ? 75.676  2.986   24.514  1.00 47.01  ? 267  ASN A CG    1 
ATOM   2159 O  OD1   . ASN A 1 267 ? 76.471  3.306   23.629  1.00 48.71  ? 267  ASN A OD1   1 
ATOM   2160 N  ND2   . ASN A 1 267 ? 74.560  3.682   24.765  1.00 47.85  ? 267  ASN A ND2   1 
ATOM   2161 N  N     . TRP A 1 268 ? 72.645  0.511   24.233  1.00 44.24  ? 268  TRP A N     1 
ATOM   2162 C  CA    . TRP A 1 268 ? 71.896  0.442   22.987  1.00 43.38  ? 268  TRP A CA    1 
ATOM   2163 C  C     . TRP A 1 268 ? 71.218  1.760   22.781  1.00 43.04  ? 268  TRP A C     1 
ATOM   2164 O  O     . TRP A 1 268 ? 70.870  2.437   23.747  1.00 43.31  ? 268  TRP A O     1 
ATOM   2165 C  CB    . TRP A 1 268 ? 70.811  -0.612  23.043  1.00 43.19  ? 268  TRP A CB    1 
ATOM   2166 C  CG    . TRP A 1 268 ? 71.312  -1.979  23.037  1.00 43.18  ? 268  TRP A CG    1 
ATOM   2167 C  CD1   . TRP A 1 268 ? 72.564  -2.393  22.709  1.00 43.68  ? 268  TRP A CD1   1 
ATOM   2168 C  CD2   . TRP A 1 268 ? 70.568  -3.151  23.350  1.00 43.01  ? 268  TRP A CD2   1 
ATOM   2169 N  NE1   . TRP A 1 268 ? 72.656  -3.754  22.819  1.00 43.84  ? 268  TRP A NE1   1 
ATOM   2170 C  CE2   . TRP A 1 268 ? 71.440  -4.246  23.210  1.00 43.19  ? 268  TRP A CE2   1 
ATOM   2171 C  CE3   . TRP A 1 268 ? 69.251  -3.382  23.747  1.00 42.72  ? 268  TRP A CE3   1 
ATOM   2172 C  CZ2   . TRP A 1 268 ? 71.040  -5.551  23.452  1.00 43.01  ? 268  TRP A CZ2   1 
ATOM   2173 C  CZ3   . TRP A 1 268 ? 68.854  -4.673  23.983  1.00 43.06  ? 268  TRP A CZ3   1 
ATOM   2174 C  CH2   . TRP A 1 268 ? 69.746  -5.746  23.835  1.00 43.09  ? 268  TRP A CH2   1 
ATOM   2175 N  N     . GLU A 1 269 ? 71.016  2.126   21.525  1.00 42.33  ? 269  GLU A N     1 
ATOM   2176 C  CA    . GLU A 1 269 ? 70.212  3.285   21.235  1.00 41.76  ? 269  GLU A CA    1 
ATOM   2177 C  C     . GLU A 1 269 ? 68.754  2.873   21.130  1.00 41.17  ? 269  GLU A C     1 
ATOM   2178 O  O     . GLU A 1 269 ? 68.429  1.913   20.431  1.00 41.26  ? 269  GLU A O     1 
ATOM   2179 C  CB    . GLU A 1 269 ? 70.661  3.943   19.943  1.00 41.82  ? 269  GLU A CB    1 
ATOM   2180 C  CG    . GLU A 1 269 ? 69.846  5.179   19.647  1.00 42.88  ? 269  GLU A CG    1 
ATOM   2181 C  CD    . GLU A 1 269 ? 70.293  5.909   18.419  1.00 44.06  ? 269  GLU A CD    1 
ATOM   2182 O  OE1   . GLU A 1 269 ? 71.422  5.646   17.940  1.00 44.48  ? 269  GLU A OE1   1 
ATOM   2183 O  OE2   . GLU A 1 269 ? 69.501  6.755   17.946  1.00 44.75  ? 269  GLU A OE2   1 
ATOM   2184 N  N     . VAL A 1 270 ? 67.879  3.593   21.826  1.00 40.39  ? 270  VAL A N     1 
ATOM   2185 C  CA    . VAL A 1 270 ? 66.438  3.401   21.658  1.00 39.65  ? 270  VAL A CA    1 
ATOM   2186 C  C     . VAL A 1 270 ? 65.906  4.327   20.575  1.00 38.96  ? 270  VAL A C     1 
ATOM   2187 O  O     . VAL A 1 270 ? 66.055  5.558   20.666  1.00 38.88  ? 270  VAL A O     1 
ATOM   2188 C  CB    . VAL A 1 270 ? 65.657  3.622   22.963  1.00 39.72  ? 270  VAL A CB    1 
ATOM   2189 C  CG1   . VAL A 1 270 ? 65.379  2.305   23.630  1.00 39.26  ? 270  VAL A CG1   1 
ATOM   2190 C  CG2   . VAL A 1 270 ? 66.429  4.559   23.901  1.00 40.66  ? 270  VAL A CG2   1 
ATOM   2191 N  N     . LEU A 1 271 ? 65.323  3.718   19.541  1.00 38.00  ? 271  LEU A N     1 
ATOM   2192 C  CA    . LEU A 1 271 ? 64.716  4.438   18.432  1.00 37.30  ? 271  LEU A CA    1 
ATOM   2193 C  C     . LEU A 1 271 ? 63.457  5.101   18.912  1.00 37.09  ? 271  LEU A C     1 
ATOM   2194 O  O     . LEU A 1 271 ? 62.707  4.480   19.658  1.00 37.16  ? 271  LEU A O     1 
ATOM   2195 C  CB    . LEU A 1 271 ? 64.332  3.477   17.323  1.00 37.22  ? 271  LEU A CB    1 
ATOM   2196 C  CG    . LEU A 1 271 ? 65.203  3.371   16.078  1.00 37.04  ? 271  LEU A CG    1 
ATOM   2197 C  CD1   . LEU A 1 271 ? 64.470  2.588   15.014  1.00 36.59  ? 271  LEU A CD1   1 
ATOM   2198 C  CD2   . LEU A 1 271 ? 65.580  4.723   15.535  1.00 37.27  ? 271  LEU A CD2   1 
ATOM   2199 N  N     . PRO A 1 272 ? 63.203  6.356   18.483  1.00 36.83  ? 272  PRO A N     1 
ATOM   2200 C  CA    . PRO A 1 272 ? 62.062  7.080   19.040  1.00 36.58  ? 272  PRO A CA    1 
ATOM   2201 C  C     . PRO A 1 272 ? 60.820  6.392   18.579  1.00 36.26  ? 272  PRO A C     1 
ATOM   2202 O  O     . PRO A 1 272 ? 60.756  5.977   17.423  1.00 36.15  ? 272  PRO A O     1 
ATOM   2203 C  CB    . PRO A 1 272 ? 62.151  8.469   18.393  1.00 36.40  ? 272  PRO A CB    1 
ATOM   2204 C  CG    . PRO A 1 272 ? 63.492  8.538   17.772  1.00 36.72  ? 272  PRO A CG    1 
ATOM   2205 C  CD    . PRO A 1 272 ? 63.858  7.130   17.420  1.00 36.92  ? 272  PRO A CD    1 
ATOM   2206 N  N     . HIS A 1 273 ? 59.857  6.226   19.475  1.00 36.15  ? 273  HIS A N     1 
ATOM   2207 C  CA    . HIS A 1 273 ? 58.610  5.600   19.061  1.00 36.20  ? 273  HIS A CA    1 
ATOM   2208 C  C     . HIS A 1 273 ? 57.328  6.340   19.428  1.00 35.97  ? 273  HIS A C     1 
ATOM   2209 O  O     . HIS A 1 273 ? 57.249  7.016   20.462  1.00 36.49  ? 273  HIS A O     1 
ATOM   2210 C  CB    . HIS A 1 273 ? 58.523  4.146   19.493  1.00 36.26  ? 273  HIS A CB    1 
ATOM   2211 C  CG    . HIS A 1 273 ? 57.648  3.339   18.597  1.00 36.84  ? 273  HIS A CG    1 
ATOM   2212 N  ND1   . HIS A 1 273 ? 56.418  2.861   18.993  1.00 37.80  ? 273  HIS A ND1   1 
ATOM   2213 C  CD2   . HIS A 1 273 ? 57.792  2.991   17.298  1.00 37.25  ? 273  HIS A CD2   1 
ATOM   2214 C  CE1   . HIS A 1 273 ? 55.858  2.211   17.989  1.00 38.02  ? 273  HIS A CE1   1 
ATOM   2215 N  NE2   . HIS A 1 273 ? 56.673  2.274   16.950  1.00 38.70  ? 273  HIS A NE2   1 
ATOM   2216 N  N     . ALA A 1 274 ? 56.330  6.208   18.557  1.00 35.11  ? 274  ALA A N     1 
ATOM   2217 C  CA    . ALA A 1 274 ? 55.065  6.875   18.760  1.00 34.12  ? 274  ALA A CA    1 
ATOM   2218 C  C     . ALA A 1 274 ? 54.034  5.953   19.405  1.00 33.59  ? 274  ALA A C     1 
ATOM   2219 O  O     . ALA A 1 274 ? 53.962  4.751   19.123  1.00 33.60  ? 274  ALA A O     1 
ATOM   2220 C  CB    . ALA A 1 274 ? 54.560  7.435   17.454  1.00 33.97  ? 274  ALA A CB    1 
ATOM   2221 N  N     . ALA A 1 275 ? 53.249  6.540   20.295  1.00 32.95  ? 275  ALA A N     1 
ATOM   2222 C  CA    . ALA A 1 275 ? 52.096  5.883   20.886  1.00 32.22  ? 275  ALA A CA    1 
ATOM   2223 C  C     . ALA A 1 275 ? 51.118  5.387   19.814  1.00 31.61  ? 275  ALA A C     1 
ATOM   2224 O  O     . ALA A 1 275 ? 51.010  5.984   18.738  1.00 31.55  ? 275  ALA A O     1 
ATOM   2225 C  CB    . ALA A 1 275 ? 51.396  6.859   21.836  1.00 32.42  ? 275  ALA A CB    1 
ATOM   2226 N  N     . TYR A 1 276 ? 50.422  4.292   20.110  1.00 30.73  ? 276  TYR A N     1 
ATOM   2227 C  CA    . TYR A 1 276 ? 49.319  3.808   19.269  1.00 29.99  ? 276  TYR A CA    1 
ATOM   2228 C  C     . TYR A 1 276 ? 49.686  3.621   17.791  1.00 29.44  ? 276  TYR A C     1 
ATOM   2229 O  O     . TYR A 1 276 ? 48.880  3.922   16.908  1.00 29.27  ? 276  TYR A O     1 
ATOM   2230 C  CB    . TYR A 1 276 ? 48.095  4.718   19.430  1.00 29.85  ? 276  TYR A CB    1 
ATOM   2231 C  CG    . TYR A 1 276 ? 47.629  4.762   20.851  1.00 30.43  ? 276  TYR A CG    1 
ATOM   2232 C  CD1   . TYR A 1 276 ? 48.159  5.677   21.739  1.00 31.86  ? 276  TYR A CD1   1 
ATOM   2233 C  CD2   . TYR A 1 276 ? 46.694  3.851   21.327  1.00 31.72  ? 276  TYR A CD2   1 
ATOM   2234 C  CE1   . TYR A 1 276 ? 47.756  5.709   23.078  1.00 33.07  ? 276  TYR A CE1   1 
ATOM   2235 C  CE2   . TYR A 1 276 ? 46.273  3.871   22.656  1.00 32.35  ? 276  TYR A CE2   1 
ATOM   2236 C  CZ    . TYR A 1 276 ? 46.811  4.803   23.537  1.00 32.79  ? 276  TYR A CZ    1 
ATOM   2237 O  OH    . TYR A 1 276 ? 46.412  4.840   24.868  1.00 32.18  ? 276  TYR A OH    1 
ATOM   2238 N  N     . SER A 1 277 ? 50.889  3.091   17.541  1.00 28.80  ? 277  SER A N     1 
ATOM   2239 C  CA    . SER A 1 277 ? 51.463  3.023   16.193  1.00 27.93  ? 277  SER A CA    1 
ATOM   2240 C  C     . SER A 1 277 ? 52.075  1.675   15.797  1.00 27.45  ? 277  SER A C     1 
ATOM   2241 O  O     . SER A 1 277 ? 53.220  1.622   15.340  1.00 27.26  ? 277  SER A O     1 
ATOM   2242 C  CB    . SER A 1 277 ? 52.507  4.127   16.024  1.00 27.81  ? 277  SER A CB    1 
ATOM   2243 O  OG    . SER A 1 277 ? 51.883  5.379   15.831  1.00 27.24  ? 277  SER A OG    1 
ATOM   2244 N  N     . PRO A 1 278 ? 51.305  0.585   15.933  1.00 27.04  ? 278  PRO A N     1 
ATOM   2245 C  CA    . PRO A 1 278 ? 51.796  -0.756  15.595  1.00 26.86  ? 278  PRO A CA    1 
ATOM   2246 C  C     . PRO A 1 278 ? 52.039  -0.895  14.117  1.00 26.60  ? 278  PRO A C     1 
ATOM   2247 O  O     . PRO A 1 278 ? 52.875  -1.697  13.708  1.00 26.44  ? 278  PRO A O     1 
ATOM   2248 C  CB    . PRO A 1 278 ? 50.639  -1.661  15.982  1.00 27.01  ? 278  PRO A CB    1 
ATOM   2249 C  CG    . PRO A 1 278 ? 49.445  -0.791  15.919  1.00 27.22  ? 278  PRO A CG    1 
ATOM   2250 C  CD    . PRO A 1 278 ? 49.892  0.568   16.331  1.00 26.92  ? 278  PRO A CD    1 
ATOM   2251 N  N     . ASP A 1 279 ? 51.284  -0.114  13.342  1.00 26.38  ? 279  ASP A N     1 
ATOM   2252 C  CA    . ASP A 1 279 ? 51.478  0.047   11.906  1.00 26.17  ? 279  ASP A CA    1 
ATOM   2253 C  C     . ASP A 1 279 ? 52.837  0.662   11.553  1.00 25.95  ? 279  ASP A C     1 
ATOM   2254 O  O     . ASP A 1 279 ? 53.183  0.732   10.385  1.00 26.29  ? 279  ASP A O     1 
ATOM   2255 C  CB    . ASP A 1 279 ? 50.330  0.864   11.268  1.00 26.33  ? 279  ASP A CB    1 
ATOM   2256 C  CG    . ASP A 1 279 ? 50.341  2.387   11.661  1.00 26.26  ? 279  ASP A CG    1 
ATOM   2257 O  OD1   . ASP A 1 279 ? 50.676  2.756   12.815  1.00 24.82  ? 279  ASP A OD1   1 
ATOM   2258 O  OD2   . ASP A 1 279 ? 49.964  3.219   10.799  1.00 25.61  ? 279  ASP A OD2   1 
ATOM   2259 N  N     . LEU A 1 280 ? 53.596  1.120   12.544  1.00 25.42  ? 280  LEU A N     1 
ATOM   2260 C  CA    . LEU A 1 280 ? 54.978  1.511   12.293  1.00 25.05  ? 280  LEU A CA    1 
ATOM   2261 C  C     . LEU A 1 280 ? 55.969  0.517   12.896  1.00 25.21  ? 280  LEU A C     1 
ATOM   2262 O  O     . LEU A 1 280 ? 57.178  0.744   12.850  1.00 25.52  ? 280  LEU A O     1 
ATOM   2263 C  CB    . LEU A 1 280 ? 55.287  2.900   12.868  1.00 25.04  ? 280  LEU A CB    1 
ATOM   2264 C  CG    . LEU A 1 280 ? 55.024  4.240   12.190  1.00 23.64  ? 280  LEU A CG    1 
ATOM   2265 C  CD1   . LEU A 1 280 ? 54.997  4.102   10.690  1.00 23.17  ? 280  LEU A CD1   1 
ATOM   2266 C  CD2   . LEU A 1 280 ? 53.723  4.780   12.693  1.00 23.20  ? 280  LEU A CD2   1 
ATOM   2267 N  N     . ALA A 1 281 ? 55.482  -0.570  13.479  1.00 24.92  ? 281  ALA A N     1 
ATOM   2268 C  CA    . ALA A 1 281 ? 56.384  -1.464  14.181  1.00 24.60  ? 281  ALA A CA    1 
ATOM   2269 C  C     . ALA A 1 281 ? 56.503  -2.808  13.497  1.00 24.23  ? 281  ALA A C     1 
ATOM   2270 O  O     . ALA A 1 281 ? 55.560  -3.569  13.487  1.00 24.44  ? 281  ALA A O     1 
ATOM   2271 C  CB    . ALA A 1 281 ? 55.939  -1.625  15.614  1.00 25.18  ? 281  ALA A CB    1 
ATOM   2272 N  N     . PRO A 1 282 ? 57.670  -3.100  12.923  1.00 23.92  ? 282  PRO A N     1 
ATOM   2273 C  CA    . PRO A 1 282 ? 57.939  -4.239  12.075  1.00 24.14  ? 282  PRO A CA    1 
ATOM   2274 C  C     . PRO A 1 282 ? 57.383  -5.545  12.601  1.00 24.39  ? 282  PRO A C     1 
ATOM   2275 O  O     . PRO A 1 282 ? 56.751  -6.286  11.846  1.00 24.08  ? 282  PRO A O     1 
ATOM   2276 C  CB    . PRO A 1 282 ? 59.451  -4.284  12.059  1.00 24.06  ? 282  PRO A CB    1 
ATOM   2277 C  CG    . PRO A 1 282 ? 59.823  -2.920  12.151  1.00 23.78  ? 282  PRO A CG    1 
ATOM   2278 C  CD    . PRO A 1 282 ? 58.868  -2.278  13.077  1.00 23.90  ? 282  PRO A CD    1 
ATOM   2279 N  N     . SER A 1 283 ? 57.599  -5.818  13.881  1.00 24.84  ? 283  SER A N     1 
ATOM   2280 C  CA    . SER A 1 283 ? 57.117  -7.062  14.464  1.00 25.91  ? 283  SER A CA    1 
ATOM   2281 C  C     . SER A 1 283 ? 55.596  -7.242  14.256  1.00 26.79  ? 283  SER A C     1 
ATOM   2282 O  O     . SER A 1 283 ? 55.123  -8.334  13.922  1.00 27.16  ? 283  SER A O     1 
ATOM   2283 C  CB    . SER A 1 283 ? 57.486  -7.130  15.940  1.00 25.65  ? 283  SER A CB    1 
ATOM   2284 O  OG    . SER A 1 283 ? 58.697  -6.439  16.157  1.00 25.48  ? 283  SER A OG    1 
ATOM   2285 N  N     . ASP A 1 284 ? 54.846  -6.158  14.423  1.00 27.44  ? 284  ASP A N     1 
ATOM   2286 C  CA    . ASP A 1 284 ? 53.404  -6.176  14.254  1.00 27.95  ? 284  ASP A CA    1 
ATOM   2287 C  C     . ASP A 1 284 ? 52.972  -6.232  12.805  1.00 27.79  ? 284  ASP A C     1 
ATOM   2288 O  O     . ASP A 1 284 ? 52.290  -7.163  12.427  1.00 28.66  ? 284  ASP A O     1 
ATOM   2289 C  CB    . ASP A 1 284 ? 52.773  -4.962  14.922  1.00 28.52  ? 284  ASP A CB    1 
ATOM   2290 C  CG    . ASP A 1 284 ? 52.872  -5.022  16.420  1.00 30.63  ? 284  ASP A CG    1 
ATOM   2291 O  OD1   . ASP A 1 284 ? 52.550  -6.099  16.979  1.00 33.81  ? 284  ASP A OD1   1 
ATOM   2292 O  OD2   . ASP A 1 284 ? 53.270  -4.002  17.035  1.00 32.46  ? 284  ASP A OD2   1 
ATOM   2293 N  N     . TYR A 1 285 ? 53.343  -5.253  11.990  1.00 27.22  ? 285  TYR A N     1 
ATOM   2294 C  CA    . TYR A 1 285 ? 52.770  -5.177  10.661  1.00 26.77  ? 285  TYR A CA    1 
ATOM   2295 C  C     . TYR A 1 285 ? 53.418  -6.139  9.703   1.00 26.69  ? 285  TYR A C     1 
ATOM   2296 O  O     . TYR A 1 285 ? 52.850  -6.392  8.676   1.00 26.70  ? 285  TYR A O     1 
ATOM   2297 C  CB    . TYR A 1 285 ? 52.829  -3.764  10.087  1.00 26.86  ? 285  TYR A CB    1 
ATOM   2298 C  CG    . TYR A 1 285 ? 54.233  -3.336  9.749   1.00 27.05  ? 285  TYR A CG    1 
ATOM   2299 C  CD1   . TYR A 1 285 ? 54.962  -2.540  10.623  1.00 27.30  ? 285  TYR A CD1   1 
ATOM   2300 C  CD2   . TYR A 1 285 ? 54.846  -3.749  8.576   1.00 26.65  ? 285  TYR A CD2   1 
ATOM   2301 C  CE1   . TYR A 1 285 ? 56.245  -2.165  10.337  1.00 26.66  ? 285  TYR A CE1   1 
ATOM   2302 C  CE2   . TYR A 1 285 ? 56.129  -3.379  8.291   1.00 26.61  ? 285  TYR A CE2   1 
ATOM   2303 C  CZ    . TYR A 1 285 ? 56.818  -2.594  9.179   1.00 26.81  ? 285  TYR A CZ    1 
ATOM   2304 O  OH    . TYR A 1 285 ? 58.097  -2.225  8.902   1.00 29.02  ? 285  TYR A OH    1 
ATOM   2305 N  N     . HIS A 1 286 ? 54.606  -6.656  9.995   1.00 27.19  ? 286  HIS A N     1 
ATOM   2306 C  CA    . HIS A 1 286 ? 55.186  -7.672  9.087   1.00 28.02  ? 286  HIS A CA    1 
ATOM   2307 C  C     . HIS A 1 286 ? 55.397  -9.079  9.652   1.00 28.11  ? 286  HIS A C     1 
ATOM   2308 O  O     . HIS A 1 286 ? 55.023  -10.039 9.003   1.00 27.67  ? 286  HIS A O     1 
ATOM   2309 C  CB    . HIS A 1 286 ? 56.477  -7.200  8.391   1.00 28.37  ? 286  HIS A CB    1 
ATOM   2310 C  CG    . HIS A 1 286 ? 57.180  -8.288  7.616   1.00 29.41  ? 286  HIS A CG    1 
ATOM   2311 N  ND1   . HIS A 1 286 ? 57.085  -8.412  6.244   1.00 30.40  ? 286  HIS A ND1   1 
ATOM   2312 C  CD2   . HIS A 1 286 ? 57.977  -9.306  8.026   1.00 29.38  ? 286  HIS A CD2   1 
ATOM   2313 C  CE1   . HIS A 1 286 ? 57.797  -9.452  5.844   1.00 29.25  ? 286  HIS A CE1   1 
ATOM   2314 N  NE2   . HIS A 1 286 ? 58.351  -10.010 6.905   1.00 29.08  ? 286  HIS A NE2   1 
ATOM   2315 N  N     . LEU A 1 287 ? 56.030  -9.213  10.815  1.00 28.67  ? 287  LEU A N     1 
ATOM   2316 C  CA    . LEU A 1 287 ? 56.349  -10.546 11.308  1.00 29.64  ? 287  LEU A CA    1 
ATOM   2317 C  C     . LEU A 1 287 ? 55.106  -11.313 11.780  1.00 30.44  ? 287  LEU A C     1 
ATOM   2318 O  O     . LEU A 1 287 ? 54.821  -12.416 11.283  1.00 30.75  ? 287  LEU A O     1 
ATOM   2319 C  CB    . LEU A 1 287 ? 57.431  -10.525 12.392  1.00 29.68  ? 287  LEU A CB    1 
ATOM   2320 C  CG    . LEU A 1 287 ? 57.682  -11.836 13.170  1.00 29.71  ? 287  LEU A CG    1 
ATOM   2321 C  CD1   . LEU A 1 287 ? 58.149  -12.973 12.262  1.00 29.07  ? 287  LEU A CD1   1 
ATOM   2322 C  CD2   . LEU A 1 287 ? 58.667  -11.626 14.304  1.00 28.90  ? 287  LEU A CD2   1 
ATOM   2323 N  N     . PHE A 1 288 ? 54.377  -10.742 12.735  1.00 30.87  ? 288  PHE A N     1 
ATOM   2324 C  CA    . PHE A 1 288 ? 53.153  -11.363 13.216  1.00 31.22  ? 288  PHE A CA    1 
ATOM   2325 C  C     . PHE A 1 288 ? 52.140  -11.480 12.095  1.00 31.46  ? 288  PHE A C     1 
ATOM   2326 O  O     . PHE A 1 288 ? 51.470  -12.494 11.957  1.00 31.54  ? 288  PHE A O     1 
ATOM   2327 C  CB    . PHE A 1 288 ? 52.567  -10.549 14.347  1.00 31.18  ? 288  PHE A CB    1 
ATOM   2328 C  CG    . PHE A 1 288 ? 53.433  -10.498 15.558  1.00 32.17  ? 288  PHE A CG    1 
ATOM   2329 C  CD1   . PHE A 1 288 ? 54.079  -11.655 16.015  1.00 32.00  ? 288  PHE A CD1   1 
ATOM   2330 C  CD2   . PHE A 1 288 ? 53.591  -9.298  16.264  1.00 32.71  ? 288  PHE A CD2   1 
ATOM   2331 C  CE1   . PHE A 1 288 ? 54.872  -11.620 17.151  1.00 32.00  ? 288  PHE A CE1   1 
ATOM   2332 C  CE2   . PHE A 1 288 ? 54.385  -9.245  17.412  1.00 33.21  ? 288  PHE A CE2   1 
ATOM   2333 C  CZ    . PHE A 1 288 ? 55.022  -10.409 17.861  1.00 33.52  ? 288  PHE A CZ    1 
ATOM   2334 N  N     . ALA A 1 289 ? 52.046  -10.445 11.276  1.00 31.80  ? 289  ALA A N     1 
ATOM   2335 C  CA    . ALA A 1 289 ? 51.060  -10.429 10.229  1.00 32.51  ? 289  ALA A CA    1 
ATOM   2336 C  C     . ALA A 1 289 ? 51.154  -11.706 9.406   1.00 33.17  ? 289  ALA A C     1 
ATOM   2337 O  O     . ALA A 1 289 ? 50.143  -12.313 9.072   1.00 33.24  ? 289  ALA A O     1 
ATOM   2338 C  CB    . ALA A 1 289 ? 51.221  -9.207  9.380   1.00 32.47  ? 289  ALA A CB    1 
ATOM   2339 N  N     . SER A 1 290 ? 52.372  -12.133 9.113   1.00 34.23  ? 290  SER A N     1 
ATOM   2340 C  CA    . SER A 1 290 ? 52.574  -13.416 8.471   1.00 35.52  ? 290  SER A CA    1 
ATOM   2341 C  C     . SER A 1 290 ? 52.044  -14.543 9.358   1.00 36.51  ? 290  SER A C     1 
ATOM   2342 O  O     . SER A 1 290 ? 51.274  -15.388 8.897   1.00 36.84  ? 290  SER A O     1 
ATOM   2343 C  CB    . SER A 1 290 ? 54.053  -13.641 8.182   1.00 35.43  ? 290  SER A CB    1 
ATOM   2344 O  OG    . SER A 1 290 ? 54.242  -14.792 7.374   1.00 35.83  ? 290  SER A OG    1 
ATOM   2345 N  N     . MET A 1 291 ? 52.443  -14.533 10.629  1.00 37.52  ? 291  MET A N     1 
ATOM   2346 C  CA    . MET A 1 291 ? 52.105  -15.593 11.564  1.00 38.61  ? 291  MET A CA    1 
ATOM   2347 C  C     . MET A 1 291 ? 50.611  -15.820 11.680  1.00 39.54  ? 291  MET A C     1 
ATOM   2348 O  O     . MET A 1 291 ? 50.172  -16.958 11.727  1.00 39.89  ? 291  MET A O     1 
ATOM   2349 C  CB    . MET A 1 291 ? 52.682  -15.290 12.934  1.00 38.62  ? 291  MET A CB    1 
ATOM   2350 C  CG    . MET A 1 291 ? 52.977  -16.523 13.746  1.00 39.85  ? 291  MET A CG    1 
ATOM   2351 S  SD    . MET A 1 291 ? 53.933  -16.186 15.245  1.00 42.57  ? 291  MET A SD    1 
ATOM   2352 C  CE    . MET A 1 291 ? 52.651  -15.617 16.357  1.00 41.68  ? 291  MET A CE    1 
ATOM   2353 N  N     . GLY A 1 292 ? 49.834  -14.743 11.711  1.00 40.73  ? 292  GLY A N     1 
ATOM   2354 C  CA    . GLY A 1 292 ? 48.372  -14.830 11.829  1.00 42.51  ? 292  GLY A CA    1 
ATOM   2355 C  C     . GLY A 1 292 ? 47.710  -15.740 10.804  1.00 43.84  ? 292  GLY A C     1 
ATOM   2356 O  O     . GLY A 1 292 ? 46.846  -16.552 11.149  1.00 43.63  ? 292  GLY A O     1 
ATOM   2357 N  N     . HIS A 1 293 ? 48.116  -15.605 9.542   1.00 45.39  ? 293  HIS A N     1 
ATOM   2358 C  CA    . HIS A 1 293 ? 47.687  -16.537 8.494   1.00 47.33  ? 293  HIS A CA    1 
ATOM   2359 C  C     . HIS A 1 293 ? 48.105  -17.959 8.841   1.00 48.41  ? 293  HIS A C     1 
ATOM   2360 O  O     . HIS A 1 293 ? 47.320  -18.908 8.698   1.00 48.89  ? 293  HIS A O     1 
ATOM   2361 C  CB    . HIS A 1 293 ? 48.285  -16.164 7.135   1.00 47.39  ? 293  HIS A CB    1 
ATOM   2362 C  CG    . HIS A 1 293 ? 47.805  -14.849 6.604   1.00 48.09  ? 293  HIS A CG    1 
ATOM   2363 N  ND1   . HIS A 1 293 ? 46.843  -14.750 5.623   1.00 48.18  ? 293  HIS A ND1   1 
ATOM   2364 C  CD2   . HIS A 1 293 ? 48.151  -13.579 6.922   1.00 47.80  ? 293  HIS A CD2   1 
ATOM   2365 C  CE1   . HIS A 1 293 ? 46.625  -13.476 5.352   1.00 47.49  ? 293  HIS A CE1   1 
ATOM   2366 N  NE2   . HIS A 1 293 ? 47.402  -12.745 6.130   1.00 47.38  ? 293  HIS A NE2   1 
ATOM   2367 N  N     . ALA A 1 294 ? 49.343  -18.089 9.314   1.00 49.38  ? 294  ALA A N     1 
ATOM   2368 C  CA    . ALA A 1 294 ? 49.944  -19.380 9.582   1.00 50.20  ? 294  ALA A CA    1 
ATOM   2369 C  C     . ALA A 1 294 ? 49.354  -20.070 10.812  1.00 50.91  ? 294  ALA A C     1 
ATOM   2370 O  O     . ALA A 1 294 ? 49.434  -21.289 10.926  1.00 50.85  ? 294  ALA A O     1 
ATOM   2371 C  CB    . ALA A 1 294 ? 51.440  -19.224 9.705   1.00 50.00  ? 294  ALA A CB    1 
ATOM   2372 N  N     . LEU A 1 295 ? 48.744  -19.293 11.705  1.00 52.13  ? 295  LEU A N     1 
ATOM   2373 C  CA    . LEU A 1 295 ? 48.169  -19.821 12.952  1.00 53.74  ? 295  LEU A CA    1 
ATOM   2374 C  C     . LEU A 1 295 ? 46.688  -20.208 12.858  1.00 54.99  ? 295  LEU A C     1 
ATOM   2375 O  O     . LEU A 1 295 ? 46.133  -20.832 13.778  1.00 55.05  ? 295  LEU A O     1 
ATOM   2376 C  CB    . LEU A 1 295 ? 48.291  -18.802 14.089  1.00 53.53  ? 295  LEU A CB    1 
ATOM   2377 C  CG    . LEU A 1 295 ? 49.601  -18.231 14.610  1.00 53.29  ? 295  LEU A CG    1 
ATOM   2378 C  CD1   . LEU A 1 295 ? 49.232  -17.224 15.664  1.00 53.27  ? 295  LEU A CD1   1 
ATOM   2379 C  CD2   . LEU A 1 295 ? 50.523  -19.294 15.178  1.00 52.95  ? 295  LEU A CD2   1 
ATOM   2380 N  N     . ALA A 1 296 ? 46.030  -19.812 11.776  1.00 56.32  ? 296  ALA A N     1 
ATOM   2381 C  CA    . ALA A 1 296 ? 44.607  -20.052 11.684  1.00 57.77  ? 296  ALA A CA    1 
ATOM   2382 C  C     . ALA A 1 296 ? 44.286  -21.540 11.552  1.00 58.88  ? 296  ALA A C     1 
ATOM   2383 O  O     . ALA A 1 296 ? 45.087  -22.319 11.040  1.00 58.64  ? 296  ALA A O     1 
ATOM   2384 C  CB    . ALA A 1 296 ? 44.014  -19.262 10.551  1.00 57.85  ? 296  ALA A CB    1 
ATOM   2385 N  N     . GLU A 1 297 ? 43.110  -21.912 12.049  1.00 60.65  ? 297  GLU A N     1 
ATOM   2386 C  CA    . GLU A 1 297 ? 42.582  -23.285 12.017  1.00 62.41  ? 297  GLU A CA    1 
ATOM   2387 C  C     . GLU A 1 297 ? 43.464  -24.270 12.779  1.00 63.00  ? 297  GLU A C     1 
ATOM   2388 O  O     . GLU A 1 297 ? 43.189  -25.470 12.806  1.00 63.16  ? 297  GLU A O     1 
ATOM   2389 C  CB    . GLU A 1 297 ? 42.316  -23.751 10.576  1.00 62.62  ? 297  GLU A CB    1 
ATOM   2390 C  CG    . GLU A 1 297 ? 41.069  -24.643 10.416  1.00 65.09  ? 297  GLU A CG    1 
ATOM   2391 C  CD    . GLU A 1 297 ? 40.317  -24.409 9.082   1.00 69.06  ? 297  GLU A CD    1 
ATOM   2392 O  OE1   . GLU A 1 297 ? 40.497  -23.320 8.463   1.00 69.98  ? 297  GLU A OE1   1 
ATOM   2393 O  OE2   . GLU A 1 297 ? 39.543  -25.314 8.653   1.00 70.06  ? 297  GLU A OE2   1 
ATOM   2394 N  N     . GLN A 1 298 ? 44.504  -23.743 13.420  1.00 63.85  ? 298  GLN A N     1 
ATOM   2395 C  CA    . GLN A 1 298 ? 45.490  -24.560 14.113  1.00 64.67  ? 298  GLN A CA    1 
ATOM   2396 C  C     . GLN A 1 298 ? 45.160  -24.674 15.587  1.00 65.24  ? 298  GLN A C     1 
ATOM   2397 O  O     . GLN A 1 298 ? 44.621  -23.735 16.184  1.00 65.15  ? 298  GLN A O     1 
ATOM   2398 C  CB    . GLN A 1 298 ? 46.872  -23.931 13.969  1.00 64.69  ? 298  GLN A CB    1 
ATOM   2399 C  CG    . GLN A 1 298 ? 48.017  -24.909 14.088  1.00 65.05  ? 298  GLN A CG    1 
ATOM   2400 C  CD    . GLN A 1 298 ? 48.618  -25.267 12.746  1.00 65.44  ? 298  GLN A CD    1 
ATOM   2401 O  OE1   . GLN A 1 298 ? 49.803  -25.042 12.516  1.00 65.86  ? 298  GLN A OE1   1 
ATOM   2402 N  NE2   . GLN A 1 298 ? 47.806  -25.819 11.849  1.00 65.55  ? 298  GLN A NE2   1 
ATOM   2403 N  N     . ARG A 1 299 ? 45.489  -25.823 16.172  1.00 66.11  ? 299  ARG A N     1 
ATOM   2404 C  CA    . ARG A 1 299 ? 45.394  -25.975 17.627  1.00 67.11  ? 299  ARG A CA    1 
ATOM   2405 C  C     . ARG A 1 299 ? 46.394  -26.934 18.259  1.00 67.00  ? 299  ARG A C     1 
ATOM   2406 O  O     . ARG A 1 299 ? 46.188  -28.144 18.252  1.00 67.15  ? 299  ARG A O     1 
ATOM   2407 C  CB    . ARG A 1 299 ? 43.964  -26.297 18.090  1.00 67.54  ? 299  ARG A CB    1 
ATOM   2408 C  CG    . ARG A 1 299 ? 43.262  -27.448 17.382  1.00 69.65  ? 299  ARG A CG    1 
ATOM   2409 C  CD    . ARG A 1 299 ? 42.156  -27.979 18.284  1.00 72.98  ? 299  ARG A CD    1 
ATOM   2410 N  NE    . ARG A 1 299 ? 40.924  -28.310 17.567  1.00 75.15  ? 299  ARG A NE    1 
ATOM   2411 C  CZ    . ARG A 1 299 ? 39.805  -28.716 18.165  1.00 76.43  ? 299  ARG A CZ    1 
ATOM   2412 N  NH1   . ARG A 1 299 ? 39.766  -28.841 19.493  1.00 76.77  ? 299  ARG A NH1   1 
ATOM   2413 N  NH2   . ARG A 1 299 ? 38.724  -28.999 17.442  1.00 76.65  ? 299  ARG A NH2   1 
ATOM   2414 N  N     . PHE A 1 300 ? 47.471  -26.378 18.811  1.00 66.97  ? 300  PHE A N     1 
ATOM   2415 C  CA    . PHE A 1 300 ? 48.432  -27.147 19.594  1.00 66.83  ? 300  PHE A CA    1 
ATOM   2416 C  C     . PHE A 1 300 ? 47.824  -27.340 20.965  1.00 66.99  ? 300  PHE A C     1 
ATOM   2417 O  O     . PHE A 1 300 ? 47.349  -26.374 21.573  1.00 66.92  ? 300  PHE A O     1 
ATOM   2418 C  CB    . PHE A 1 300 ? 49.757  -26.396 19.755  1.00 66.79  ? 300  PHE A CB    1 
ATOM   2419 C  CG    . PHE A 1 300 ? 49.857  -25.148 18.939  1.00 65.82  ? 300  PHE A CG    1 
ATOM   2420 C  CD1   . PHE A 1 300 ? 50.547  -25.147 17.739  1.00 64.83  ? 300  PHE A CD1   1 
ATOM   2421 C  CD2   . PHE A 1 300 ? 49.259  -23.970 19.376  1.00 65.03  ? 300  PHE A CD2   1 
ATOM   2422 C  CE1   . PHE A 1 300 ? 50.643  -23.997 16.983  1.00 64.46  ? 300  PHE A CE1   1 
ATOM   2423 C  CE2   . PHE A 1 300 ? 49.345  -22.821 18.627  1.00 64.53  ? 300  PHE A CE2   1 
ATOM   2424 C  CZ    . PHE A 1 300 ? 50.041  -22.831 17.426  1.00 64.38  ? 300  PHE A CZ    1 
ATOM   2425 N  N     . ASP A 1 301 ? 47.847  -28.577 21.452  1.00 67.17  ? 301  ASP A N     1 
ATOM   2426 C  CA    . ASP A 1 301 ? 47.237  -28.910 22.737  1.00 67.42  ? 301  ASP A CA    1 
ATOM   2427 C  C     . ASP A 1 301 ? 48.247  -28.877 23.878  1.00 67.17  ? 301  ASP A C     1 
ATOM   2428 O  O     . ASP A 1 301 ? 47.862  -28.935 25.043  1.00 67.10  ? 301  ASP A O     1 
ATOM   2429 C  CB    . ASP A 1 301 ? 46.563  -30.282 22.669  1.00 67.72  ? 301  ASP A CB    1 
ATOM   2430 C  CG    . ASP A 1 301 ? 47.566  -31.423 22.531  1.00 69.03  ? 301  ASP A CG    1 
ATOM   2431 O  OD1   . ASP A 1 301 ? 47.218  -32.563 22.918  1.00 70.10  ? 301  ASP A OD1   1 
ATOM   2432 O  OD2   . ASP A 1 301 ? 48.700  -31.184 22.041  1.00 70.32  ? 301  ASP A OD2   1 
ATOM   2433 N  N     . SER A 1 302 ? 49.532  -28.793 23.532  1.00 67.11  ? 302  SER A N     1 
ATOM   2434 C  CA    . SER A 1 302 ? 50.614  -28.711 24.519  1.00 67.10  ? 302  SER A CA    1 
ATOM   2435 C  C     . SER A 1 302 ? 51.501  -27.492 24.291  1.00 66.89  ? 302  SER A C     1 
ATOM   2436 O  O     . SER A 1 302 ? 51.816  -27.160 23.149  1.00 66.84  ? 302  SER A O     1 
ATOM   2437 C  CB    . SER A 1 302 ? 51.492  -29.954 24.444  1.00 67.23  ? 302  SER A CB    1 
ATOM   2438 O  OG    . SER A 1 302 ? 52.567  -29.741 23.542  1.00 67.62  ? 302  SER A OG    1 
ATOM   2439 N  N     . TYR A 1 303 ? 51.930  -26.858 25.381  1.00 66.71  ? 303  TYR A N     1 
ATOM   2440 C  CA    . TYR A 1 303 ? 52.831  -25.699 25.320  1.00 66.71  ? 303  TYR A CA    1 
ATOM   2441 C  C     . TYR A 1 303 ? 54.050  -25.914 24.407  1.00 66.43  ? 303  TYR A C     1 
ATOM   2442 O  O     . TYR A 1 303 ? 54.479  -24.995 23.704  1.00 66.31  ? 303  TYR A O     1 
ATOM   2443 C  CB    . TYR A 1 303 ? 53.272  -25.300 26.735  1.00 66.88  ? 303  TYR A CB    1 
ATOM   2444 C  CG    . TYR A 1 303 ? 54.581  -24.530 26.829  1.00 67.77  ? 303  TYR A CG    1 
ATOM   2445 C  CD1   . TYR A 1 303 ? 54.599  -23.186 27.203  1.00 68.76  ? 303  TYR A CD1   1 
ATOM   2446 C  CD2   . TYR A 1 303 ? 55.808  -25.154 26.571  1.00 68.77  ? 303  TYR A CD2   1 
ATOM   2447 C  CE1   . TYR A 1 303 ? 55.807  -22.476 27.304  1.00 69.18  ? 303  TYR A CE1   1 
ATOM   2448 C  CE2   . TYR A 1 303 ? 57.014  -24.455 26.657  1.00 69.44  ? 303  TYR A CE2   1 
ATOM   2449 C  CZ    . TYR A 1 303 ? 57.007  -23.120 27.028  1.00 69.34  ? 303  TYR A CZ    1 
ATOM   2450 O  OH    . TYR A 1 303 ? 58.202  -22.442 27.118  1.00 69.27  ? 303  TYR A OH    1 
ATOM   2451 N  N     . GLU A 1 304 ? 54.604  -27.123 24.432  1.00 66.12  ? 304  GLU A N     1 
ATOM   2452 C  CA    . GLU A 1 304 ? 55.790  -27.449 23.639  1.00 65.90  ? 304  GLU A CA    1 
ATOM   2453 C  C     . GLU A 1 304 ? 55.454  -27.648 22.168  1.00 65.27  ? 304  GLU A C     1 
ATOM   2454 O  O     . GLU A 1 304 ? 56.304  -27.415 21.306  1.00 65.28  ? 304  GLU A O     1 
ATOM   2455 C  CB    . GLU A 1 304 ? 56.531  -28.669 24.199  1.00 66.17  ? 304  GLU A CB    1 
ATOM   2456 C  CG    . GLU A 1 304 ? 55.648  -29.655 24.964  1.00 67.78  ? 304  GLU A CG    1 
ATOM   2457 C  CD    . GLU A 1 304 ? 55.430  -29.249 26.427  1.00 69.74  ? 304  GLU A CD    1 
ATOM   2458 O  OE1   . GLU A 1 304 ? 54.254  -29.098 26.844  1.00 70.30  ? 304  GLU A OE1   1 
ATOM   2459 O  OE2   . GLU A 1 304 ? 56.437  -29.076 27.154  1.00 70.35  ? 304  GLU A OE2   1 
ATOM   2460 N  N     . SER A 1 305 ? 54.223  -28.080 21.885  1.00 64.46  ? 305  SER A N     1 
ATOM   2461 C  CA    . SER A 1 305 ? 53.735  -28.132 20.509  1.00 63.61  ? 305  SER A CA    1 
ATOM   2462 C  C     . SER A 1 305 ? 53.787  -26.743 19.897  1.00 62.99  ? 305  SER A C     1 
ATOM   2463 O  O     . SER A 1 305 ? 54.119  -26.608 18.724  1.00 63.16  ? 305  SER A O     1 
ATOM   2464 C  CB    . SER A 1 305 ? 52.320  -28.705 20.422  1.00 63.71  ? 305  SER A CB    1 
ATOM   2465 O  OG    . SER A 1 305 ? 52.329  -30.025 19.908  1.00 63.89  ? 305  SER A OG    1 
ATOM   2466 N  N     . VAL A 1 306 ? 53.480  -25.721 20.700  1.00 62.04  ? 306  VAL A N     1 
ATOM   2467 C  CA    . VAL A 1 306 ? 53.676  -24.321 20.303  1.00 61.06  ? 306  VAL A CA    1 
ATOM   2468 C  C     . VAL A 1 306 ? 55.146  -24.065 19.981  1.00 60.69  ? 306  VAL A C     1 
ATOM   2469 O  O     . VAL A 1 306 ? 55.465  -23.408 18.991  1.00 60.51  ? 306  VAL A O     1 
ATOM   2470 C  CB    . VAL A 1 306 ? 53.207  -23.324 21.392  1.00 60.89  ? 306  VAL A CB    1 
ATOM   2471 C  CG1   . VAL A 1 306 ? 53.327  -21.889 20.906  1.00 60.26  ? 306  VAL A CG1   1 
ATOM   2472 C  CG2   . VAL A 1 306 ? 51.779  -23.610 21.799  1.00 60.83  ? 306  VAL A CG2   1 
ATOM   2473 N  N     . LYS A 1 307 ? 56.038  -24.605 20.806  1.00 60.39  ? 307  LYS A N     1 
ATOM   2474 C  CA    . LYS A 1 307 ? 57.467  -24.383 20.613  1.00 60.13  ? 307  LYS A CA    1 
ATOM   2475 C  C     . LYS A 1 307 ? 57.991  -25.094 19.376  1.00 59.67  ? 307  LYS A C     1 
ATOM   2476 O  O     . LYS A 1 307 ? 58.731  -24.504 18.602  1.00 59.70  ? 307  LYS A O     1 
ATOM   2477 C  CB    . LYS A 1 307 ? 58.283  -24.750 21.859  1.00 60.31  ? 307  LYS A CB    1 
ATOM   2478 C  CG    . LYS A 1 307 ? 59.676  -24.112 21.868  1.00 61.00  ? 307  LYS A CG    1 
ATOM   2479 C  CD    . LYS A 1 307 ? 60.230  -23.930 23.272  1.00 62.36  ? 307  LYS A CD    1 
ATOM   2480 C  CE    . LYS A 1 307 ? 61.457  -23.024 23.247  1.00 62.90  ? 307  LYS A CE    1 
ATOM   2481 N  NZ    . LYS A 1 307 ? 61.846  -22.553 24.611  1.00 63.20  ? 307  LYS A NZ    1 
ATOM   2482 N  N     . LYS A 1 308 ? 57.600  -26.347 19.176  1.00 59.25  ? 308  LYS A N     1 
ATOM   2483 C  CA    . LYS A 1 308 ? 57.998  -27.053 17.966  1.00 59.00  ? 308  LYS A CA    1 
ATOM   2484 C  C     . LYS A 1 308 ? 57.485  -26.293 16.756  1.00 58.48  ? 308  LYS A C     1 
ATOM   2485 O  O     . LYS A 1 308 ? 58.164  -26.217 15.736  1.00 58.50  ? 308  LYS A O     1 
ATOM   2486 C  CB    . LYS A 1 308 ? 57.476  -28.494 17.948  1.00 59.35  ? 308  LYS A CB    1 
ATOM   2487 C  CG    . LYS A 1 308 ? 58.210  -29.413 16.957  1.00 59.92  ? 308  LYS A CG    1 
ATOM   2488 C  CD    . LYS A 1 308 ? 58.280  -30.852 17.477  1.00 61.08  ? 308  LYS A CD    1 
ATOM   2489 C  CE    . LYS A 1 308 ? 59.636  -31.494 17.170  1.00 61.26  ? 308  LYS A CE    1 
ATOM   2490 N  NZ    . LYS A 1 308 ? 60.053  -32.466 18.225  1.00 61.20  ? 308  LYS A NZ    1 
ATOM   2491 N  N     . TRP A 1 309 ? 56.297  -25.710 16.888  1.00 57.83  ? 309  TRP A N     1 
ATOM   2492 C  CA    . TRP A 1 309 ? 55.685  -24.976 15.788  1.00 57.26  ? 309  TRP A CA    1 
ATOM   2493 C  C     . TRP A 1 309 ? 56.425  -23.692 15.470  1.00 56.69  ? 309  TRP A C     1 
ATOM   2494 O  O     . TRP A 1 309 ? 56.794  -23.461 14.321  1.00 56.57  ? 309  TRP A O     1 
ATOM   2495 C  CB    . TRP A 1 309 ? 54.222  -24.670 16.074  1.00 57.34  ? 309  TRP A CB    1 
ATOM   2496 C  CG    . TRP A 1 309 ? 53.485  -24.405 14.830  1.00 57.36  ? 309  TRP A CG    1 
ATOM   2497 C  CD1   . TRP A 1 309 ? 52.836  -25.320 14.060  1.00 57.50  ? 309  TRP A CD1   1 
ATOM   2498 C  CD2   . TRP A 1 309 ? 53.342  -23.146 14.172  1.00 57.17  ? 309  TRP A CD2   1 
ATOM   2499 N  NE1   . TRP A 1 309 ? 52.283  -24.707 12.965  1.00 57.73  ? 309  TRP A NE1   1 
ATOM   2500 C  CE2   . TRP A 1 309 ? 52.578  -23.371 13.009  1.00 57.36  ? 309  TRP A CE2   1 
ATOM   2501 C  CE3   . TRP A 1 309 ? 53.778  -21.850 14.456  1.00 57.01  ? 309  TRP A CE3   1 
ATOM   2502 C  CZ2   . TRP A 1 309 ? 52.243  -22.348 12.126  1.00 56.82  ? 309  TRP A CZ2   1 
ATOM   2503 C  CZ3   . TRP A 1 309 ? 53.444  -20.836 13.583  1.00 56.61  ? 309  TRP A CZ3   1 
ATOM   2504 C  CH2   . TRP A 1 309 ? 52.684  -21.091 12.432  1.00 56.82  ? 309  TRP A CH2   1 
ATOM   2505 N  N     . LEU A 1 310 ? 56.618  -22.863 16.492  1.00 56.09  ? 310  LEU A N     1 
ATOM   2506 C  CA    . LEU A 1 310 ? 57.419  -21.653 16.380  1.00 55.64  ? 310  LEU A CA    1 
ATOM   2507 C  C     . LEU A 1 310 ? 58.800  -21.961 15.834  1.00 55.82  ? 310  LEU A C     1 
ATOM   2508 O  O     . LEU A 1 310 ? 59.214  -21.390 14.829  1.00 56.01  ? 310  LEU A O     1 
ATOM   2509 C  CB    . LEU A 1 310 ? 57.533  -20.960 17.735  1.00 55.28  ? 310  LEU A CB    1 
ATOM   2510 C  CG    . LEU A 1 310 ? 56.608  -19.784 18.052  1.00 54.33  ? 310  LEU A CG    1 
ATOM   2511 C  CD1   . LEU A 1 310 ? 55.280  -19.885 17.349  1.00 53.67  ? 310  LEU A CD1   1 
ATOM   2512 C  CD2   . LEU A 1 310 ? 56.401  -19.689 19.543  1.00 53.68  ? 310  LEU A CD2   1 
ATOM   2513 N  N     . ASP A 1 311 ? 59.502  -22.882 16.483  1.00 56.02  ? 311  ASP A N     1 
ATOM   2514 C  CA    . ASP A 1 311 ? 60.841  -23.262 16.047  1.00 56.31  ? 311  ASP A CA    1 
ATOM   2515 C  C     . ASP A 1 311 ? 60.862  -23.616 14.562  1.00 56.27  ? 311  ASP A C     1 
ATOM   2516 O  O     . ASP A 1 311 ? 61.653  -23.063 13.799  1.00 56.20  ? 311  ASP A O     1 
ATOM   2517 C  CB    . ASP A 1 311 ? 61.411  -24.392 16.920  1.00 56.40  ? 311  ASP A CB    1 
ATOM   2518 C  CG    . ASP A 1 311 ? 61.922  -23.885 18.278  1.00 56.96  ? 311  ASP A CG    1 
ATOM   2519 O  OD1   . ASP A 1 311 ? 61.799  -24.608 19.293  1.00 57.57  ? 311  ASP A OD1   1 
ATOM   2520 O  OD2   . ASP A 1 311 ? 62.451  -22.754 18.337  1.00 57.44  ? 311  ASP A OD2   1 
ATOM   2521 N  N     . GLU A 1 312 ? 59.963  -24.500 14.150  1.00 56.32  ? 312  GLU A N     1 
ATOM   2522 C  CA    . GLU A 1 312 ? 59.915  -24.913 12.753  1.00 56.61  ? 312  GLU A CA    1 
ATOM   2523 C  C     . GLU A 1 312 ? 59.469  -23.796 11.834  1.00 55.79  ? 312  GLU A C     1 
ATOM   2524 O  O     . GLU A 1 312 ? 59.874  -23.770 10.674  1.00 55.84  ? 312  GLU A O     1 
ATOM   2525 C  CB    . GLU A 1 312 ? 59.036  -26.154 12.549  1.00 57.18  ? 312  GLU A CB    1 
ATOM   2526 C  CG    . GLU A 1 312 ? 59.780  -27.477 12.829  1.00 59.81  ? 312  GLU A CG    1 
ATOM   2527 C  CD    . GLU A 1 312 ? 58.892  -28.712 12.672  1.00 62.71  ? 312  GLU A CD    1 
ATOM   2528 O  OE1   . GLU A 1 312 ? 58.640  -29.396 13.696  1.00 63.10  ? 312  GLU A OE1   1 
ATOM   2529 O  OE2   . GLU A 1 312 ? 58.444  -28.990 11.530  1.00 64.03  ? 312  GLU A OE2   1 
ATOM   2530 N  N     . TRP A 1 313 ? 58.648  -22.881 12.351  1.00 54.86  ? 313  TRP A N     1 
ATOM   2531 C  CA    . TRP A 1 313 ? 58.149  -21.761 11.544  1.00 53.82  ? 313  TRP A CA    1 
ATOM   2532 C  C     . TRP A 1 313 ? 59.279  -20.799 11.178  1.00 53.36  ? 313  TRP A C     1 
ATOM   2533 O  O     . TRP A 1 313 ? 59.500  -20.510 9.998   1.00 53.46  ? 313  TRP A O     1 
ATOM   2534 C  CB    . TRP A 1 313 ? 56.982  -21.014 12.219  1.00 53.54  ? 313  TRP A CB    1 
ATOM   2535 C  CG    . TRP A 1 313 ? 56.280  -20.065 11.278  1.00 52.25  ? 313  TRP A CG    1 
ATOM   2536 C  CD1   . TRP A 1 313 ? 55.601  -20.401 10.148  1.00 51.89  ? 313  TRP A CD1   1 
ATOM   2537 C  CD2   . TRP A 1 313 ? 56.212  -18.633 11.372  1.00 50.80  ? 313  TRP A CD2   1 
ATOM   2538 N  NE1   . TRP A 1 313 ? 55.110  -19.272 9.535   1.00 51.62  ? 313  TRP A NE1   1 
ATOM   2539 C  CE2   . TRP A 1 313 ? 55.473  -18.176 10.266  1.00 50.47  ? 313  TRP A CE2   1 
ATOM   2540 C  CE3   . TRP A 1 313 ? 56.705  -17.697 12.280  1.00 50.28  ? 313  TRP A CE3   1 
ATOM   2541 C  CZ2   . TRP A 1 313 ? 55.211  -16.834 10.047  1.00 49.79  ? 313  TRP A CZ2   1 
ATOM   2542 C  CZ3   . TRP A 1 313 ? 56.445  -16.361 12.058  1.00 49.78  ? 313  TRP A CZ3   1 
ATOM   2543 C  CH2   . TRP A 1 313 ? 55.709  -15.943 10.949  1.00 49.78  ? 313  TRP A CH2   1 
ATOM   2544 N  N     . PHE A 1 314 ? 59.996  -20.322 12.189  1.00 52.49  ? 314  PHE A N     1 
ATOM   2545 C  CA    . PHE A 1 314 ? 61.095  -19.398 11.983  1.00 51.74  ? 314  PHE A CA    1 
ATOM   2546 C  C     . PHE A 1 314 ? 62.190  -20.011 11.125  1.00 51.44  ? 314  PHE A C     1 
ATOM   2547 O  O     . PHE A 1 314 ? 62.819  -19.327 10.327  1.00 50.90  ? 314  PHE A O     1 
ATOM   2548 C  CB    . PHE A 1 314 ? 61.711  -19.038 13.322  1.00 51.84  ? 314  PHE A CB    1 
ATOM   2549 C  CG    . PHE A 1 314 ? 60.831  -18.216 14.217  1.00 51.00  ? 314  PHE A CG    1 
ATOM   2550 C  CD1   . PHE A 1 314 ? 60.284  -17.019 13.778  1.00 50.52  ? 314  PHE A CD1   1 
ATOM   2551 C  CD2   . PHE A 1 314 ? 60.621  -18.608 15.535  1.00 50.22  ? 314  PHE A CD2   1 
ATOM   2552 C  CE1   . PHE A 1 314 ? 59.503  -16.245 14.629  1.00 50.85  ? 314  PHE A CE1   1 
ATOM   2553 C  CE2   . PHE A 1 314 ? 59.848  -17.846 16.390  1.00 50.31  ? 314  PHE A CE2   1 
ATOM   2554 C  CZ    . PHE A 1 314 ? 59.286  -16.660 15.940  1.00 50.51  ? 314  PHE A CZ    1 
ATOM   2555 N  N     . ALA A 1 315 ? 62.422  -21.304 11.331  1.00 51.56  ? 315  ALA A N     1 
ATOM   2556 C  CA    . ALA A 1 315 ? 63.463  -22.055 10.632  1.00 51.64  ? 315  ALA A CA    1 
ATOM   2557 C  C     . ALA A 1 315 ? 63.107  -22.226 9.165   1.00 51.51  ? 315  ALA A C     1 
ATOM   2558 O  O     . ALA A 1 315 ? 63.962  -22.099 8.285   1.00 51.58  ? 315  ALA A O     1 
ATOM   2559 C  CB    . ALA A 1 315 ? 63.675  -23.421 11.294  1.00 51.76  ? 315  ALA A CB    1 
ATOM   2560 N  N     . ALA A 1 316 ? 61.836  -22.509 8.908   1.00 51.29  ? 316  ALA A N     1 
ATOM   2561 C  CA    . ALA A 1 316 ? 61.347  -22.623 7.546   1.00 51.16  ? 316  ALA A CA    1 
ATOM   2562 C  C     . ALA A 1 316 ? 61.049  -21.269 6.893   1.00 51.04  ? 316  ALA A C     1 
ATOM   2563 O  O     . ALA A 1 316 ? 60.746  -21.219 5.703   1.00 51.21  ? 316  ALA A O     1 
ATOM   2564 C  CB    . ALA A 1 316 ? 60.129  -23.523 7.494   1.00 51.28  ? 316  ALA A CB    1 
ATOM   2565 N  N     . LYS A 1 317 ? 61.123  -20.174 7.651   1.00 50.77  ? 317  LYS A N     1 
ATOM   2566 C  CA    . LYS A 1 317 ? 61.049  -18.852 7.028   1.00 50.40  ? 317  LYS A CA    1 
ATOM   2567 C  C     . LYS A 1 317 ? 62.270  -18.655 6.171   1.00 50.05  ? 317  LYS A C     1 
ATOM   2568 O  O     . LYS A 1 317 ? 63.320  -19.234 6.420   1.00 50.04  ? 317  LYS A O     1 
ATOM   2569 C  CB    . LYS A 1 317 ? 60.948  -17.710 8.049   1.00 50.51  ? 317  LYS A CB    1 
ATOM   2570 C  CG    . LYS A 1 317 ? 59.515  -17.239 8.359   1.00 50.74  ? 317  LYS A CG    1 
ATOM   2571 C  CD    . LYS A 1 317 ? 58.774  -16.757 7.118   1.00 51.05  ? 317  LYS A CD    1 
ATOM   2572 C  CE    . LYS A 1 317 ? 57.267  -16.837 7.320   1.00 51.68  ? 317  LYS A CE    1 
ATOM   2573 N  NZ    . LYS A 1 317 ? 56.500  -16.870 6.028   1.00 52.29  ? 317  LYS A NZ    1 
ATOM   2574 N  N     . ASP A 1 318 ? 62.111  -17.845 5.142   1.00 49.91  ? 318  ASP A N     1 
ATOM   2575 C  CA    . ASP A 1 318 ? 63.207  -17.476 4.273   1.00 49.84  ? 318  ASP A CA    1 
ATOM   2576 C  C     . ASP A 1 318 ? 64.149  -16.544 5.040   1.00 49.43  ? 318  ASP A C     1 
ATOM   2577 O  O     . ASP A 1 318 ? 63.874  -16.192 6.183   1.00 49.38  ? 318  ASP A O     1 
ATOM   2578 C  CB    . ASP A 1 318 ? 62.620  -16.784 3.049   1.00 50.17  ? 318  ASP A CB    1 
ATOM   2579 C  CG    . ASP A 1 318 ? 63.557  -16.775 1.879   1.00 51.24  ? 318  ASP A CG    1 
ATOM   2580 O  OD1   . ASP A 1 318 ? 64.793  -16.808 2.101   1.00 52.22  ? 318  ASP A OD1   1 
ATOM   2581 O  OD2   . ASP A 1 318 ? 63.044  -16.719 0.736   1.00 52.54  ? 318  ASP A OD2   1 
ATOM   2582 N  N     . ASP A 1 319 ? 65.264  -16.161 4.434   1.00 49.13  ? 319  ASP A N     1 
ATOM   2583 C  CA    . ASP A 1 319 ? 66.167  -15.208 5.069   1.00 49.14  ? 319  ASP A CA    1 
ATOM   2584 C  C     . ASP A 1 319 ? 65.741  -13.787 4.739   1.00 48.49  ? 319  ASP A C     1 
ATOM   2585 O  O     . ASP A 1 319 ? 65.604  -12.946 5.624   1.00 48.05  ? 319  ASP A O     1 
ATOM   2586 C  CB    . ASP A 1 319 ? 67.614  -15.453 4.628   1.00 49.80  ? 319  ASP A CB    1 
ATOM   2587 C  CG    . ASP A 1 319 ? 68.348  -16.465 5.523   1.00 51.36  ? 319  ASP A CG    1 
ATOM   2588 O  OD1   . ASP A 1 319 ? 68.453  -17.657 5.124   1.00 53.68  ? 319  ASP A OD1   1 
ATOM   2589 O  OD2   . ASP A 1 319 ? 68.822  -16.068 6.620   1.00 51.48  ? 319  ASP A OD2   1 
ATOM   2590 N  N     . GLU A 1 320 ? 65.514  -13.547 3.452   1.00 48.06  ? 320  GLU A N     1 
ATOM   2591 C  CA    . GLU A 1 320 ? 65.116  -12.243 2.938   1.00 47.94  ? 320  GLU A CA    1 
ATOM   2592 C  C     . GLU A 1 320 ? 63.777  -11.732 3.504   1.00 46.87  ? 320  GLU A C     1 
ATOM   2593 O  O     . GLU A 1 320 ? 63.550  -10.521 3.573   1.00 46.84  ? 320  GLU A O     1 
ATOM   2594 C  CB    . GLU A 1 320 ? 65.060  -12.281 1.407   1.00 48.45  ? 320  GLU A CB    1 
ATOM   2595 C  CG    . GLU A 1 320 ? 65.512  -10.971 0.738   1.00 51.73  ? 320  GLU A CG    1 
ATOM   2596 C  CD    . GLU A 1 320 ? 64.816  -10.682 -0.613  1.00 55.87  ? 320  GLU A CD    1 
ATOM   2597 O  OE1   . GLU A 1 320 ? 63.596  -10.982 -0.755  1.00 57.30  ? 320  GLU A OE1   1 
ATOM   2598 O  OE2   . GLU A 1 320 ? 65.495  -10.131 -1.525  1.00 56.87  ? 320  GLU A OE2   1 
ATOM   2599 N  N     . PHE A 1 321 ? 62.901  -12.656 3.901   1.00 45.65  ? 321  PHE A N     1 
ATOM   2600 C  CA    . PHE A 1 321 ? 61.584  -12.325 4.467   1.00 44.28  ? 321  PHE A CA    1 
ATOM   2601 C  C     . PHE A 1 321 ? 61.694  -11.306 5.598   1.00 43.97  ? 321  PHE A C     1 
ATOM   2602 O  O     . PHE A 1 321 ? 60.862  -10.407 5.702   1.00 43.97  ? 321  PHE A O     1 
ATOM   2603 C  CB    . PHE A 1 321 ? 60.858  -13.608 4.933   1.00 43.92  ? 321  PHE A CB    1 
ATOM   2604 C  CG    . PHE A 1 321 ? 59.724  -13.377 5.924   1.00 41.98  ? 321  PHE A CG    1 
ATOM   2605 C  CD1   . PHE A 1 321 ? 59.977  -13.165 7.267   1.00 40.39  ? 321  PHE A CD1   1 
ATOM   2606 C  CD2   . PHE A 1 321 ? 58.408  -13.423 5.517   1.00 41.16  ? 321  PHE A CD2   1 
ATOM   2607 C  CE1   . PHE A 1 321 ? 58.948  -12.968 8.166   1.00 38.97  ? 321  PHE A CE1   1 
ATOM   2608 C  CE2   . PHE A 1 321 ? 57.375  -13.230 6.425   1.00 39.77  ? 321  PHE A CE2   1 
ATOM   2609 C  CZ    . PHE A 1 321 ? 57.654  -13.001 7.746   1.00 38.59  ? 321  PHE A CZ    1 
ATOM   2610 N  N     . TYR A 1 322 ? 62.711  -11.451 6.444   1.00 43.39  ? 322  TYR A N     1 
ATOM   2611 C  CA    . TYR A 1 322 ? 62.912  -10.513 7.532   1.00 42.99  ? 322  TYR A CA    1 
ATOM   2612 C  C     . TYR A 1 322 ? 63.420  -9.206  6.967   1.00 43.28  ? 322  TYR A C     1 
ATOM   2613 O  O     . TYR A 1 322 ? 62.802  -8.170  7.189   1.00 43.66  ? 322  TYR A O     1 
ATOM   2614 C  CB    . TYR A 1 322 ? 63.865  -11.070 8.569   1.00 42.69  ? 322  TYR A CB    1 
ATOM   2615 C  CG    . TYR A 1 322 ? 63.346  -12.318 9.215   1.00 42.00  ? 322  TYR A CG    1 
ATOM   2616 C  CD1   . TYR A 1 322 ? 63.475  -13.553 8.589   1.00 42.14  ? 322  TYR A CD1   1 
ATOM   2617 C  CD2   . TYR A 1 322 ? 62.723  -12.273 10.449  1.00 41.31  ? 322  TYR A CD2   1 
ATOM   2618 C  CE1   . TYR A 1 322 ? 62.992  -14.714 9.179   1.00 41.82  ? 322  TYR A CE1   1 
ATOM   2619 C  CE2   . TYR A 1 322 ? 62.241  -13.424 11.046  1.00 41.49  ? 322  TYR A CE2   1 
ATOM   2620 C  CZ    . TYR A 1 322 ? 62.378  -14.640 10.407  1.00 41.47  ? 322  TYR A CZ    1 
ATOM   2621 O  OH    . TYR A 1 322 ? 61.905  -15.785 10.998  1.00 41.59  ? 322  TYR A OH    1 
ATOM   2622 N  N     . TRP A 1 323 ? 64.513  -9.254  6.203   1.00 43.21  ? 323  TRP A N     1 
ATOM   2623 C  CA    . TRP A 1 323 ? 65.028  -8.067  5.517   1.00 43.07  ? 323  TRP A CA    1 
ATOM   2624 C  C     . TRP A 1 323 ? 63.906  -7.199  4.954   1.00 42.82  ? 323  TRP A C     1 
ATOM   2625 O  O     . TRP A 1 323 ? 63.826  -6.010  5.268   1.00 42.68  ? 323  TRP A O     1 
ATOM   2626 C  CB    . TRP A 1 323 ? 66.007  -8.443  4.401   1.00 43.25  ? 323  TRP A CB    1 
ATOM   2627 C  CG    . TRP A 1 323 ? 66.728  -7.248  3.828   1.00 43.80  ? 323  TRP A CG    1 
ATOM   2628 C  CD1   . TRP A 1 323 ? 67.828  -6.637  4.349   1.00 44.33  ? 323  TRP A CD1   1 
ATOM   2629 C  CD2   . TRP A 1 323 ? 66.392  -6.520  2.640   1.00 43.89  ? 323  TRP A CD2   1 
ATOM   2630 N  NE1   . TRP A 1 323 ? 68.206  -5.584  3.558   1.00 44.60  ? 323  TRP A NE1   1 
ATOM   2631 C  CE2   . TRP A 1 323 ? 67.338  -5.486  2.504   1.00 44.27  ? 323  TRP A CE2   1 
ATOM   2632 C  CE3   . TRP A 1 323 ? 65.390  -6.645  1.676   1.00 44.71  ? 323  TRP A CE3   1 
ATOM   2633 C  CZ2   . TRP A 1 323 ? 67.314  -4.578  1.441   1.00 44.74  ? 323  TRP A CZ2   1 
ATOM   2634 C  CZ3   . TRP A 1 323 ? 65.364  -5.738  0.616   1.00 45.39  ? 323  TRP A CZ3   1 
ATOM   2635 C  CH2   . TRP A 1 323 ? 66.321  -4.719  0.511   1.00 45.00  ? 323  TRP A CH2   1 
ATOM   2636 N  N     . ARG A 1 324 ? 63.042  -7.806  4.139   1.00 42.61  ? 324  ARG A N     1 
ATOM   2637 C  CA    . ARG A 1 324 ? 61.907  -7.105  3.547   1.00 42.69  ? 324  ARG A CA    1 
ATOM   2638 C  C     . ARG A 1 324 ? 61.154  -6.345  4.630   1.00 41.99  ? 324  ARG A C     1 
ATOM   2639 O  O     . ARG A 1 324 ? 61.043  -5.110  4.568   1.00 42.07  ? 324  ARG A O     1 
ATOM   2640 C  CB    . ARG A 1 324 ? 60.968  -8.078  2.825   1.00 43.09  ? 324  ARG A CB    1 
ATOM   2641 C  CG    . ARG A 1 324 ? 61.502  -8.663  1.512   1.00 45.66  ? 324  ARG A CG    1 
ATOM   2642 C  CD    . ARG A 1 324 ? 61.074  -10.138 1.327   1.00 50.53  ? 324  ARG A CD    1 
ATOM   2643 N  NE    . ARG A 1 324 ? 59.664  -10.314 0.942   1.00 54.96  ? 324  ARG A NE    1 
ATOM   2644 C  CZ    . ARG A 1 324 ? 58.647  -10.567 1.782   1.00 57.37  ? 324  ARG A CZ    1 
ATOM   2645 N  NH1   . ARG A 1 324 ? 58.847  -10.672 3.093   1.00 58.82  ? 324  ARG A NH1   1 
ATOM   2646 N  NH2   . ARG A 1 324 ? 57.406  -10.711 1.313   1.00 57.68  ? 324  ARG A NH2   1 
ATOM   2647 N  N     . GLY A 1 325 ? 60.674  -7.087  5.630   1.00 41.21  ? 325  GLY A N     1 
ATOM   2648 C  CA    . GLY A 1 325 ? 59.956  -6.519  6.766   1.00 40.31  ? 325  GLY A CA    1 
ATOM   2649 C  C     . GLY A 1 325 ? 60.608  -5.235  7.242   1.00 39.90  ? 325  GLY A C     1 
ATOM   2650 O  O     . GLY A 1 325 ? 59.994  -4.165  7.183   1.00 39.87  ? 325  GLY A O     1 
ATOM   2651 N  N     . ILE A 1 326 ? 61.870  -5.348  7.670   1.00 39.26  ? 326  ILE A N     1 
ATOM   2652 C  CA    . ILE A 1 326 ? 62.623  -4.243  8.261   1.00 38.32  ? 326  ILE A CA    1 
ATOM   2653 C  C     . ILE A 1 326 ? 62.784  -3.134  7.267   1.00 38.36  ? 326  ILE A C     1 
ATOM   2654 O  O     . ILE A 1 326 ? 62.674  -1.964  7.621   1.00 38.45  ? 326  ILE A O     1 
ATOM   2655 C  CB    . ILE A 1 326 ? 64.029  -4.662  8.709   1.00 37.99  ? 326  ILE A CB    1 
ATOM   2656 C  CG1   . ILE A 1 326 ? 63.963  -5.678  9.839   1.00 37.74  ? 326  ILE A CG1   1 
ATOM   2657 C  CG2   . ILE A 1 326 ? 64.812  -3.465  9.187   1.00 37.64  ? 326  ILE A CG2   1 
ATOM   2658 C  CD1   . ILE A 1 326 ? 63.363  -5.150  11.114  1.00 37.69  ? 326  ILE A CD1   1 
ATOM   2659 N  N     . HIS A 1 327 ? 63.042  -3.498  6.016   1.00 38.27  ? 327  HIS A N     1 
ATOM   2660 C  CA    . HIS A 1 327 ? 63.349  -2.491  5.013   1.00 38.11  ? 327  HIS A CA    1 
ATOM   2661 C  C     . HIS A 1 327 ? 62.139  -1.712  4.517   1.00 37.97  ? 327  HIS A C     1 
ATOM   2662 O  O     . HIS A 1 327 ? 62.288  -0.651  3.897   1.00 38.02  ? 327  HIS A O     1 
ATOM   2663 C  CB    . HIS A 1 327 ? 64.199  -3.067  3.889   1.00 38.13  ? 327  HIS A CB    1 
ATOM   2664 C  CG    . HIS A 1 327 ? 65.657  -2.894  4.130   1.00 38.09  ? 327  HIS A CG    1 
ATOM   2665 N  ND1   . HIS A 1 327 ? 66.422  -1.994  3.424   1.00 39.00  ? 327  HIS A ND1   1 
ATOM   2666 C  CD2   . HIS A 1 327 ? 66.476  -3.448  5.053   1.00 38.40  ? 327  HIS A CD2   1 
ATOM   2667 C  CE1   . HIS A 1 327 ? 67.663  -2.028  3.877   1.00 39.75  ? 327  HIS A CE1   1 
ATOM   2668 N  NE2   . HIS A 1 327 ? 67.721  -2.899  4.868   1.00 39.56  ? 327  HIS A NE2   1 
ATOM   2669 N  N     . LYS A 1 328 ? 60.951  -2.232  4.820   1.00 37.53  ? 328  LYS A N     1 
ATOM   2670 C  CA    . LYS A 1 328 ? 59.712  -1.510  4.585   1.00 37.22  ? 328  LYS A CA    1 
ATOM   2671 C  C     . LYS A 1 328 ? 59.663  -0.157  5.304   1.00 36.76  ? 328  LYS A C     1 
ATOM   2672 O  O     . LYS A 1 328 ? 59.206  0.831   4.728   1.00 36.67  ? 328  LYS A O     1 
ATOM   2673 C  CB    . LYS A 1 328 ? 58.518  -2.385  4.956   1.00 37.23  ? 328  LYS A CB    1 
ATOM   2674 C  CG    . LYS A 1 328 ? 58.085  -3.282  3.808   1.00 38.28  ? 328  LYS A CG    1 
ATOM   2675 C  CD    . LYS A 1 328 ? 56.735  -3.963  4.065   1.00 40.06  ? 328  LYS A CD    1 
ATOM   2676 C  CE    . LYS A 1 328 ? 56.870  -5.488  4.312   1.00 40.05  ? 328  LYS A CE    1 
ATOM   2677 N  NZ    . LYS A 1 328 ? 55.535  -6.162  4.461   1.00 39.41  ? 328  LYS A NZ    1 
ATOM   2678 N  N     . LEU A 1 329 ? 60.181  -0.128  6.536   1.00 36.35  ? 329  LEU A N     1 
ATOM   2679 C  CA    . LEU A 1 329 ? 60.205  1.057   7.413   1.00 35.96  ? 329  LEU A CA    1 
ATOM   2680 C  C     . LEU A 1 329 ? 60.278  2.431   6.752   1.00 36.16  ? 329  LEU A C     1 
ATOM   2681 O  O     . LEU A 1 329 ? 59.477  3.290   7.095   1.00 36.22  ? 329  LEU A O     1 
ATOM   2682 C  CB    . LEU A 1 329 ? 61.336  0.965   8.446   1.00 35.72  ? 329  LEU A CB    1 
ATOM   2683 C  CG    . LEU A 1 329 ? 61.179  0.384   9.852   1.00 34.59  ? 329  LEU A CG    1 
ATOM   2684 C  CD1   . LEU A 1 329 ? 60.399  1.307   10.744  1.00 34.38  ? 329  LEU A CD1   1 
ATOM   2685 C  CD2   . LEU A 1 329 ? 60.535  -0.944  9.810   1.00 33.41  ? 329  LEU A CD2   1 
ATOM   2686 N  N     . PRO A 1 330 ? 61.233  2.658   5.823   1.00 36.30  ? 330  PRO A N     1 
ATOM   2687 C  CA    . PRO A 1 330 ? 61.433  4.035   5.413   1.00 36.45  ? 330  PRO A CA    1 
ATOM   2688 C  C     . PRO A 1 330 ? 60.225  4.598   4.695   1.00 36.65  ? 330  PRO A C     1 
ATOM   2689 O  O     . PRO A 1 330 ? 59.650  5.563   5.180   1.00 37.11  ? 330  PRO A O     1 
ATOM   2690 C  CB    . PRO A 1 330 ? 62.647  3.974   4.475   1.00 36.44  ? 330  PRO A CB    1 
ATOM   2691 C  CG    . PRO A 1 330 ? 63.192  2.632   4.601   1.00 36.68  ? 330  PRO A CG    1 
ATOM   2692 C  CD    . PRO A 1 330 ? 62.070  1.752   5.027   1.00 36.47  ? 330  PRO A CD    1 
ATOM   2693 N  N     . GLU A 1 331 ? 59.818  4.011   3.576   1.00 36.64  ? 331  GLU A N     1 
ATOM   2694 C  CA    . GLU A 1 331 ? 58.660  4.549   2.854   1.00 37.23  ? 331  GLU A CA    1 
ATOM   2695 C  C     . GLU A 1 331 ? 57.378  4.356   3.665   1.00 36.46  ? 331  GLU A C     1 
ATOM   2696 O  O     . GLU A 1 331 ? 56.367  5.050   3.481   1.00 36.26  ? 331  GLU A O     1 
ATOM   2697 C  CB    . GLU A 1 331 ? 58.547  3.931   1.462   1.00 38.09  ? 331  GLU A CB    1 
ATOM   2698 C  CG    . GLU A 1 331 ? 58.647  2.394   1.440   1.00 41.81  ? 331  GLU A CG    1 
ATOM   2699 C  CD    . GLU A 1 331 ? 57.287  1.693   1.370   1.00 45.72  ? 331  GLU A CD    1 
ATOM   2700 O  OE1   . GLU A 1 331 ? 56.228  2.350   1.578   1.00 46.87  ? 331  GLU A OE1   1 
ATOM   2701 O  OE2   . GLU A 1 331 ? 57.290  0.469   1.095   1.00 47.95  ? 331  GLU A OE2   1 
ATOM   2702 N  N     . ARG A 1 332 ? 57.461  3.403   4.583   1.00 35.79  ? 332  ARG A N     1 
ATOM   2703 C  CA    . ARG A 1 332 ? 56.412  3.121   5.531   1.00 34.95  ? 332  ARG A CA    1 
ATOM   2704 C  C     . ARG A 1 332 ? 56.237  4.321   6.472   1.00 34.98  ? 332  ARG A C     1 
ATOM   2705 O  O     . ARG A 1 332 ? 55.133  4.604   6.901   1.00 34.67  ? 332  ARG A O     1 
ATOM   2706 C  CB    . ARG A 1 332 ? 56.772  1.838   6.271   1.00 34.48  ? 332  ARG A CB    1 
ATOM   2707 C  CG    . ARG A 1 332 ? 55.685  0.826   6.355   1.00 32.31  ? 332  ARG A CG    1 
ATOM   2708 C  CD    . ARG A 1 332 ? 55.080  0.913   7.720   1.00 30.59  ? 332  ARG A CD    1 
ATOM   2709 N  NE    . ARG A 1 332 ? 54.124  -0.133  8.093   1.00 29.82  ? 332  ARG A NE    1 
ATOM   2710 C  CZ    . ARG A 1 332 ? 53.469  -0.947  7.272   1.00 28.80  ? 332  ARG A CZ    1 
ATOM   2711 N  NH1   . ARG A 1 332 ? 53.640  -0.894  5.960   1.00 29.97  ? 332  ARG A NH1   1 
ATOM   2712 N  NH2   . ARG A 1 332 ? 52.629  -1.826  7.780   1.00 27.20  ? 332  ARG A NH2   1 
ATOM   2713 N  N     . TRP A 1 333 ? 57.326  5.026   6.772   1.00 35.29  ? 333  TRP A N     1 
ATOM   2714 C  CA    . TRP A 1 333 ? 57.236  6.326   7.427   1.00 36.04  ? 333  TRP A CA    1 
ATOM   2715 C  C     . TRP A 1 333 ? 56.795  7.377   6.420   1.00 36.73  ? 333  TRP A C     1 
ATOM   2716 O  O     . TRP A 1 333 ? 55.844  8.096   6.673   1.00 36.73  ? 333  TRP A O     1 
ATOM   2717 C  CB    . TRP A 1 333 ? 58.561  6.783   8.056   1.00 35.98  ? 333  TRP A CB    1 
ATOM   2718 C  CG    . TRP A 1 333 ? 59.234  5.840   9.046   1.00 35.88  ? 333  TRP A CG    1 
ATOM   2719 C  CD1   . TRP A 1 333 ? 58.645  5.128   10.050  1.00 36.31  ? 333  TRP A CD1   1 
ATOM   2720 C  CD2   . TRP A 1 333 ? 60.636  5.561   9.139   1.00 35.30  ? 333  TRP A CD2   1 
ATOM   2721 N  NE1   . TRP A 1 333 ? 59.591  4.399   10.746  1.00 34.93  ? 333  TRP A NE1   1 
ATOM   2722 C  CE2   . TRP A 1 333 ? 60.818  4.653   10.204  1.00 34.69  ? 333  TRP A CE2   1 
ATOM   2723 C  CE3   . TRP A 1 333 ? 61.753  5.981   8.416   1.00 35.50  ? 333  TRP A CE3   1 
ATOM   2724 C  CZ2   . TRP A 1 333 ? 62.060  4.161   10.556  1.00 35.00  ? 333  TRP A CZ2   1 
ATOM   2725 C  CZ3   . TRP A 1 333 ? 62.992  5.493   8.774   1.00 36.14  ? 333  TRP A CZ3   1 
ATOM   2726 C  CH2   . TRP A 1 333 ? 63.137  4.591   9.835   1.00 35.75  ? 333  TRP A CH2   1 
ATOM   2727 N  N     . GLU A 1 334 ? 57.489  7.473   5.284   1.00 37.95  ? 334  GLU A N     1 
ATOM   2728 C  CA    . GLU A 1 334 ? 57.153  8.461   4.232   1.00 39.34  ? 334  GLU A CA    1 
ATOM   2729 C  C     . GLU A 1 334 ? 55.647  8.516   4.031   1.00 39.95  ? 334  GLU A C     1 
ATOM   2730 O  O     . GLU A 1 334 ? 55.101  9.540   3.624   1.00 40.08  ? 334  GLU A O     1 
ATOM   2731 C  CB    . GLU A 1 334 ? 57.838  8.157   2.880   1.00 39.42  ? 334  GLU A CB    1 
ATOM   2732 C  CG    . GLU A 1 334 ? 59.307  8.645   2.702   1.00 40.95  ? 334  GLU A CG    1 
ATOM   2733 C  CD    . GLU A 1 334 ? 60.093  7.897   1.574   1.00 42.61  ? 334  GLU A CD    1 
ATOM   2734 O  OE1   . GLU A 1 334 ? 59.462  7.489   0.563   1.00 43.76  ? 334  GLU A OE1   1 
ATOM   2735 O  OE2   . GLU A 1 334 ? 61.340  7.722   1.691   1.00 40.87  ? 334  GLU A OE2   1 
ATOM   2736 N  N     . LYS A 1 335 ? 54.982  7.405   4.324   1.00 40.73  ? 335  LYS A N     1 
ATOM   2737 C  CA    . LYS A 1 335 ? 53.547  7.347   4.207   1.00 41.76  ? 335  LYS A CA    1 
ATOM   2738 C  C     . LYS A 1 335 ? 52.868  8.023   5.391   1.00 42.32  ? 335  LYS A C     1 
ATOM   2739 O  O     . LYS A 1 335 ? 52.002  8.874   5.198   1.00 42.52  ? 335  LYS A O     1 
ATOM   2740 C  CB    . LYS A 1 335 ? 53.093  5.905   4.091   1.00 41.96  ? 335  LYS A CB    1 
ATOM   2741 C  CG    . LYS A 1 335 ? 53.175  5.334   2.696   1.00 42.65  ? 335  LYS A CG    1 
ATOM   2742 C  CD    . LYS A 1 335 ? 52.323  4.082   2.640   1.00 43.76  ? 335  LYS A CD    1 
ATOM   2743 C  CE    . LYS A 1 335 ? 52.500  3.329   1.352   1.00 44.46  ? 335  LYS A CE    1 
ATOM   2744 N  NZ    . LYS A 1 335 ? 51.494  2.251   1.306   1.00 45.56  ? 335  LYS A NZ    1 
ATOM   2745 N  N     . CYS A 1 336 ? 53.270  7.638   6.604   1.00 43.03  ? 336  CYS A N     1 
ATOM   2746 C  CA    . CYS A 1 336 ? 52.753  8.207   7.862   1.00 43.74  ? 336  CYS A CA    1 
ATOM   2747 C  C     . CYS A 1 336 ? 52.812  9.738   7.846   1.00 44.11  ? 336  CYS A C     1 
ATOM   2748 O  O     . CYS A 1 336 ? 51.865  10.410  8.269   1.00 44.14  ? 336  CYS A O     1 
ATOM   2749 C  CB    . CYS A 1 336 ? 53.485  7.571   9.070   1.00 43.61  ? 336  CYS A CB    1 
ATOM   2750 S  SG    . CYS A 1 336 ? 53.680  8.471   10.687  1.00 45.10  ? 336  CYS A SG    1 
ATOM   2751 N  N     . VAL A 1 337 ? 53.898  10.277  7.302   1.00 44.66  ? 337  VAL A N     1 
ATOM   2752 C  CA    . VAL A 1 337 ? 54.107  11.710  7.265   1.00 45.50  ? 337  VAL A CA    1 
ATOM   2753 C  C     . VAL A 1 337 ? 53.254  12.372  6.173   1.00 46.31  ? 337  VAL A C     1 
ATOM   2754 O  O     . VAL A 1 337 ? 52.793  13.512  6.329   1.00 46.40  ? 337  VAL A O     1 
ATOM   2755 C  CB    . VAL A 1 337 ? 55.604  12.037  7.099   1.00 45.38  ? 337  VAL A CB    1 
ATOM   2756 C  CG1   . VAL A 1 337 ? 56.069  11.762  5.684   1.00 45.78  ? 337  VAL A CG1   1 
ATOM   2757 C  CG2   . VAL A 1 337 ? 55.893  13.477  7.478   1.00 45.70  ? 337  VAL A CG2   1 
ATOM   2758 N  N     . ALA A 1 338 ? 53.036  11.647  5.076   1.00 47.26  ? 338  ALA A N     1 
ATOM   2759 C  CA    . ALA A 1 338 ? 52.197  12.132  3.978   1.00 48.09  ? 338  ALA A CA    1 
ATOM   2760 C  C     . ALA A 1 338 ? 50.741  12.241  4.412   1.00 48.77  ? 338  ALA A C     1 
ATOM   2761 O  O     . ALA A 1 338 ? 49.931  12.873  3.742   1.00 48.86  ? 338  ALA A O     1 
ATOM   2762 C  CB    . ALA A 1 338 ? 52.317  11.216  2.782   1.00 47.99  ? 338  ALA A CB    1 
ATOM   2763 N  N     . SER A 1 339 ? 50.421  11.614  5.539   1.00 49.67  ? 339  SER A N     1 
ATOM   2764 C  CA    . SER A 1 339 ? 49.082  11.660  6.103   1.00 50.57  ? 339  SER A CA    1 
ATOM   2765 C  C     . SER A 1 339 ? 48.970  12.724  7.172   1.00 51.10  ? 339  SER A C     1 
ATOM   2766 O  O     . SER A 1 339 ? 47.883  13.001  7.683   1.00 51.15  ? 339  SER A O     1 
ATOM   2767 C  CB    . SER A 1 339 ? 48.736  10.305  6.687   1.00 50.41  ? 339  SER A CB    1 
ATOM   2768 O  OG    . SER A 1 339 ? 48.518  9.393   5.632   1.00 51.29  ? 339  SER A OG    1 
ATOM   2769 N  N     . ASP A 1 340 ? 50.110  13.330  7.481   1.00 51.91  ? 340  ASP A N     1 
ATOM   2770 C  CA    . ASP A 1 340 ? 50.234  14.269  8.585   1.00 52.69  ? 340  ASP A CA    1 
ATOM   2771 C  C     . ASP A 1 340 ? 49.777  13.611  9.865   1.00 53.03  ? 340  ASP A C     1 
ATOM   2772 O  O     . ASP A 1 340 ? 48.923  14.119  10.590  1.00 53.14  ? 340  ASP A O     1 
ATOM   2773 C  CB    . ASP A 1 340 ? 49.511  15.578  8.283   1.00 52.80  ? 340  ASP A CB    1 
ATOM   2774 C  CG    . ASP A 1 340 ? 50.166  16.326  7.142   1.00 53.66  ? 340  ASP A CG    1 
ATOM   2775 O  OD1   . ASP A 1 340 ? 49.690  16.184  5.995   1.00 54.87  ? 340  ASP A OD1   1 
ATOM   2776 O  OD2   . ASP A 1 340 ? 51.186  17.013  7.380   1.00 54.08  ? 340  ASP A OD2   1 
ATOM   2777 N  N     . GLY A 1 341 ? 50.359  12.438  10.093  1.00 53.53  ? 341  GLY A N     1 
ATOM   2778 C  CA    . GLY A 1 341 ? 50.205  11.695  11.321  1.00 54.03  ? 341  GLY A CA    1 
ATOM   2779 C  C     . GLY A 1 341 ? 48.899  10.965  11.381  1.00 54.39  ? 341  GLY A C     1 
ATOM   2780 O  O     . GLY A 1 341 ? 48.310  10.853  12.448  1.00 54.43  ? 341  GLY A O     1 
ATOM   2781 N  N     . LYS A 1 342 ? 48.441  10.470  10.237  1.00 54.95  ? 342  LYS A N     1 
ATOM   2782 C  CA    . LYS A 1 342 ? 47.211  9.672   10.198  1.00 55.69  ? 342  LYS A CA    1 
ATOM   2783 C  C     . LYS A 1 342 ? 47.551  8.182   10.171  1.00 55.67  ? 342  LYS A C     1 
ATOM   2784 O  O     . LYS A 1 342 ? 48.717  7.806   10.137  1.00 55.71  ? 342  LYS A O     1 
ATOM   2785 C  CB    . LYS A 1 342 ? 46.364  10.059  8.975   1.00 55.89  ? 342  LYS A CB    1 
ATOM   2786 C  CG    . LYS A 1 342 ? 44.863  10.119  9.233   1.00 56.44  ? 342  LYS A CG    1 
ATOM   2787 C  CD    . LYS A 1 342 ? 44.286  11.410  8.656   1.00 56.96  ? 342  LYS A CD    1 
ATOM   2788 C  CE    . LYS A 1 342 ? 43.157  11.937  9.532   1.00 57.10  ? 342  LYS A CE    1 
ATOM   2789 N  NZ    . LYS A 1 342 ? 43.269  13.404  9.724   1.00 56.62  ? 342  LYS A NZ    1 
ATOM   2790 N  N     . TYR A 1 343 ? 46.548  7.324   10.213  1.00 55.78  ? 343  TYR A N     1 
ATOM   2791 C  CA    . TYR A 1 343 ? 46.801  5.994   9.746   1.00 56.19  ? 343  TYR A CA    1 
ATOM   2792 C  C     . TYR A 1 343 ? 46.625  6.029   8.236   1.00 57.23  ? 343  TYR A C     1 
ATOM   2793 O  O     . TYR A 1 343 ? 45.515  6.210   7.735   1.00 57.52  ? 343  TYR A O     1 
ATOM   2794 C  CB    . TYR A 1 343 ? 45.833  4.989   10.340  1.00 55.74  ? 343  TYR A CB    1 
ATOM   2795 C  CG    . TYR A 1 343 ? 45.968  4.753   11.811  1.00 54.02  ? 343  TYR A CG    1 
ATOM   2796 C  CD1   . TYR A 1 343 ? 44.966  5.161   12.681  1.00 52.88  ? 343  TYR A CD1   1 
ATOM   2797 C  CD2   . TYR A 1 343 ? 47.073  4.099   12.338  1.00 52.58  ? 343  TYR A CD2   1 
ATOM   2798 C  CE1   . TYR A 1 343 ? 45.056  4.936   14.044  1.00 51.89  ? 343  TYR A CE1   1 
ATOM   2799 C  CE2   . TYR A 1 343 ? 47.180  3.880   13.709  1.00 52.34  ? 343  TYR A CE2   1 
ATOM   2800 C  CZ    . TYR A 1 343 ? 46.159  4.301   14.555  1.00 51.54  ? 343  TYR A CZ    1 
ATOM   2801 O  OH    . TYR A 1 343 ? 46.235  4.093   15.908  1.00 50.57  ? 343  TYR A OH    1 
ATOM   2802 N  N     . PHE A 1 344 ? 47.730  5.905   7.513   1.00 58.31  ? 344  PHE A N     1 
ATOM   2803 C  CA    . PHE A 1 344 ? 47.691  5.465   6.126   1.00 59.35  ? 344  PHE A CA    1 
ATOM   2804 C  C     . PHE A 1 344 ? 47.429  3.976   6.259   1.00 60.40  ? 344  PHE A C     1 
ATOM   2805 O  O     . PHE A 1 344 ? 47.770  3.366   7.281   1.00 60.56  ? 344  PHE A O     1 
ATOM   2806 C  CB    . PHE A 1 344 ? 49.065  5.625   5.518   1.00 59.09  ? 344  PHE A CB    1 
ATOM   2807 C  CG    . PHE A 1 344 ? 50.091  4.845   6.240   1.00 58.96  ? 344  PHE A CG    1 
ATOM   2808 C  CD1   . PHE A 1 344 ? 50.391  3.547   5.849   1.00 59.19  ? 344  PHE A CD1   1 
ATOM   2809 C  CD2   . PHE A 1 344 ? 50.696  5.369   7.371   1.00 58.79  ? 344  PHE A CD2   1 
ATOM   2810 C  CE1   . PHE A 1 344 ? 51.307  2.804   6.547   1.00 59.68  ? 344  PHE A CE1   1 
ATOM   2811 C  CE2   . PHE A 1 344 ? 51.618  4.637   8.076   1.00 59.42  ? 344  PHE A CE2   1 
ATOM   2812 C  CZ    . PHE A 1 344 ? 51.930  3.350   7.667   1.00 59.82  ? 344  PHE A CZ    1 
ATOM   2813 N  N     . GLU A 1 345 ? 46.849  3.363   5.247   1.00 61.74  ? 345  GLU A N     1 
ATOM   2814 C  CA    . GLU A 1 345 ? 46.632  1.924   5.361   1.00 63.27  ? 345  GLU A CA    1 
ATOM   2815 C  C     . GLU A 1 345 ? 47.410  1.148   4.287   1.00 63.81  ? 345  GLU A C     1 
ATOM   2816 O  O     . GLU A 1 345 ? 47.527  1.591   3.129   1.00 64.02  ? 345  GLU A O     1 
ATOM   2817 C  CB    . GLU A 1 345 ? 45.128  1.579   5.389   1.00 63.54  ? 345  GLU A CB    1 
ATOM   2818 C  CG    . GLU A 1 345 ? 44.396  1.975   6.701   1.00 64.41  ? 345  GLU A CG    1 
ATOM   2819 C  CD    . GLU A 1 345 ? 43.009  2.604   6.455   1.00 66.32  ? 345  GLU A CD    1 
ATOM   2820 O  OE1   . GLU A 1 345 ? 42.763  3.712   7.002   1.00 67.04  ? 345  GLU A OE1   1 
ATOM   2821 O  OE2   . GLU A 1 345 ? 42.176  2.013   5.711   1.00 66.39  ? 345  GLU A OE2   1 
ATOM   2822 O  OXT   . GLU A 1 345 ? 47.967  0.074   4.580   1.00 64.38  ? 345  GLU A OXT   1 
ATOM   2823 N  N     . VAL B 1 5   ? 24.620  -6.613  -48.783 1.00 68.55  ? 5    VAL B N     1 
ATOM   2824 C  CA    . VAL B 1 5   ? 25.890  -7.416  -48.834 1.00 68.81  ? 5    VAL B CA    1 
ATOM   2825 C  C     . VAL B 1 5   ? 25.877  -8.524  -47.748 1.00 68.91  ? 5    VAL B C     1 
ATOM   2826 O  O     . VAL B 1 5   ? 26.294  -8.294  -46.603 1.00 69.14  ? 5    VAL B O     1 
ATOM   2827 C  CB    . VAL B 1 5   ? 27.151  -6.509  -48.741 1.00 68.72  ? 5    VAL B CB    1 
ATOM   2828 C  CG1   . VAL B 1 5   ? 28.423  -7.346  -48.714 1.00 68.58  ? 5    VAL B CG1   1 
ATOM   2829 C  CG2   . VAL B 1 5   ? 27.186  -5.514  -49.906 1.00 68.75  ? 5    VAL B CG2   1 
ATOM   2830 N  N     . PRO B 1 6   ? 25.431  -9.744  -48.127 1.00 68.79  ? 6    PRO B N     1 
ATOM   2831 C  CA    . PRO B 1 6   ? 24.852  -10.736 -47.212 1.00 68.50  ? 6    PRO B CA    1 
ATOM   2832 C  C     . PRO B 1 6   ? 25.804  -11.393 -46.224 1.00 68.24  ? 6    PRO B C     1 
ATOM   2833 O  O     . PRO B 1 6   ? 27.002  -11.107 -46.216 1.00 68.24  ? 6    PRO B O     1 
ATOM   2834 C  CB    . PRO B 1 6   ? 24.292  -11.800 -48.166 1.00 68.41  ? 6    PRO B CB    1 
ATOM   2835 C  CG    . PRO B 1 6   ? 25.192  -11.758 -49.317 1.00 68.65  ? 6    PRO B CG    1 
ATOM   2836 C  CD    . PRO B 1 6   ? 25.642  -10.317 -49.471 1.00 68.85  ? 6    PRO B CD    1 
ATOM   2837 N  N     . ASN B 1 7   ? 25.224  -12.244 -45.379 1.00 68.00  ? 7    ASN B N     1 
ATOM   2838 C  CA    . ASN B 1 7   ? 25.948  -13.181 -44.537 1.00 67.73  ? 7    ASN B CA    1 
ATOM   2839 C  C     . ASN B 1 7   ? 25.297  -14.540 -44.757 1.00 67.36  ? 7    ASN B C     1 
ATOM   2840 O  O     . ASN B 1 7   ? 24.391  -14.645 -45.586 1.00 67.38  ? 7    ASN B O     1 
ATOM   2841 C  CB    . ASN B 1 7   ? 25.878  -12.762 -43.065 1.00 67.90  ? 7    ASN B CB    1 
ATOM   2842 C  CG    . ASN B 1 7   ? 24.720  -13.404 -42.328 1.00 68.11  ? 7    ASN B CG    1 
ATOM   2843 O  OD1   . ASN B 1 7   ? 24.921  -14.122 -41.351 1.00 68.80  ? 7    ASN B OD1   1 
ATOM   2844 N  ND2   . ASN B 1 7   ? 23.509  -13.174 -42.806 1.00 68.02  ? 7    ASN B ND2   1 
ATOM   2845 N  N     . LYS B 1 8   ? 25.728  -15.561 -44.011 1.00 66.94  ? 8    LYS B N     1 
ATOM   2846 C  CA    . LYS B 1 8   ? 25.261  -16.947 -44.223 1.00 66.48  ? 8    LYS B CA    1 
ATOM   2847 C  C     . LYS B 1 8   ? 23.842  -17.240 -43.703 1.00 66.06  ? 8    LYS B C     1 
ATOM   2848 O  O     . LYS B 1 8   ? 23.358  -18.367 -43.833 1.00 66.06  ? 8    LYS B O     1 
ATOM   2849 C  CB    . LYS B 1 8   ? 26.244  -17.991 -43.649 1.00 66.48  ? 8    LYS B CB    1 
ATOM   2850 C  CG    . LYS B 1 8   ? 27.600  -17.470 -43.198 1.00 66.56  ? 8    LYS B CG    1 
ATOM   2851 C  CD    . LYS B 1 8   ? 27.542  -16.977 -41.762 1.00 66.11  ? 8    LYS B CD    1 
ATOM   2852 C  CE    . LYS B 1 8   ? 28.562  -15.890 -41.542 1.00 66.19  ? 8    LYS B CE    1 
ATOM   2853 N  NZ    . LYS B 1 8   ? 28.186  -15.085 -40.364 1.00 66.52  ? 8    LYS B NZ    1 
ATOM   2854 N  N     . GLU B 1 9   ? 23.177  -16.239 -43.127 1.00 65.47  ? 9    GLU B N     1 
ATOM   2855 C  CA    . GLU B 1 9   ? 21.843  -16.430 -42.543 1.00 64.88  ? 9    GLU B CA    1 
ATOM   2856 C  C     . GLU B 1 9   ? 20.774  -15.700 -43.338 1.00 63.99  ? 9    GLU B C     1 
ATOM   2857 O  O     . GLU B 1 9   ? 19.709  -16.250 -43.629 1.00 63.84  ? 9    GLU B O     1 
ATOM   2858 C  CB    . GLU B 1 9   ? 21.833  -15.942 -41.106 1.00 65.13  ? 9    GLU B CB    1 
ATOM   2859 C  CG    . GLU B 1 9   ? 20.684  -16.460 -40.283 1.00 66.34  ? 9    GLU B CG    1 
ATOM   2860 C  CD    . GLU B 1 9   ? 20.745  -15.923 -38.871 1.00 68.32  ? 9    GLU B CD    1 
ATOM   2861 O  OE1   . GLU B 1 9   ? 21.614  -16.387 -38.090 1.00 68.85  ? 9    GLU B OE1   1 
ATOM   2862 O  OE2   . GLU B 1 9   ? 19.935  -15.023 -38.551 1.00 69.06  ? 9    GLU B OE2   1 
ATOM   2863 N  N     . GLN B 1 10  ? 21.071  -14.444 -43.656 1.00 63.02  ? 10   GLN B N     1 
ATOM   2864 C  CA    . GLN B 1 10  ? 20.369  -13.700 -44.684 1.00 62.02  ? 10   GLN B CA    1 
ATOM   2865 C  C     . GLN B 1 10  ? 20.387  -14.535 -45.954 1.00 61.31  ? 10   GLN B C     1 
ATOM   2866 O  O     . GLN B 1 10  ? 19.573  -14.346 -46.850 1.00 61.38  ? 10   GLN B O     1 
ATOM   2867 C  CB    . GLN B 1 10  ? 21.094  -12.386 -44.960 1.00 62.02  ? 10   GLN B CB    1 
ATOM   2868 C  CG    . GLN B 1 10  ? 20.956  -11.323 -43.891 1.00 62.06  ? 10   GLN B CG    1 
ATOM   2869 C  CD    . GLN B 1 10  ? 22.163  -10.400 -43.853 1.00 62.51  ? 10   GLN B CD    1 
ATOM   2870 O  OE1   . GLN B 1 10  ? 23.209  -10.753 -43.304 1.00 62.56  ? 10   GLN B OE1   1 
ATOM   2871 N  NE2   . GLN B 1 10  ? 22.024  -9.210  -44.438 1.00 62.98  ? 10   GLN B NE2   1 
ATOM   2872 N  N     . THR B 1 11  ? 21.336  -15.459 -46.021 1.00 60.33  ? 11   THR B N     1 
ATOM   2873 C  CA    . THR B 1 11  ? 21.466  -16.366 -47.145 1.00 59.28  ? 11   THR B CA    1 
ATOM   2874 C  C     . THR B 1 11  ? 20.407  -17.472 -47.118 1.00 58.73  ? 11   THR B C     1 
ATOM   2875 O  O     . THR B 1 11  ? 19.851  -17.808 -48.163 1.00 58.73  ? 11   THR B O     1 
ATOM   2876 C  CB    . THR B 1 11  ? 22.901  -16.903 -47.231 1.00 59.25  ? 11   THR B CB    1 
ATOM   2877 O  OG1   . THR B 1 11  ? 23.713  -15.929 -47.907 1.00 58.83  ? 11   THR B OG1   1 
ATOM   2878 C  CG2   . THR B 1 11  ? 22.966  -18.240 -47.953 1.00 58.81  ? 11   THR B CG2   1 
ATOM   2879 N  N     . ARG B 1 12  ? 20.114  -18.023 -45.939 1.00 57.94  ? 12   ARG B N     1 
ATOM   2880 C  CA    . ARG B 1 12  ? 19.010  -18.988 -45.810 1.00 57.22  ? 12   ARG B CA    1 
ATOM   2881 C  C     . ARG B 1 12  ? 17.667  -18.286 -45.957 1.00 55.94  ? 12   ARG B C     1 
ATOM   2882 O  O     . ARG B 1 12  ? 16.703  -18.870 -46.458 1.00 55.80  ? 12   ARG B O     1 
ATOM   2883 C  CB    . ARG B 1 12  ? 19.039  -19.743 -44.473 1.00 57.78  ? 12   ARG B CB    1 
ATOM   2884 C  CG    . ARG B 1 12  ? 17.938  -20.812 -44.352 1.00 59.52  ? 12   ARG B CG    1 
ATOM   2885 C  CD    . ARG B 1 12  ? 17.100  -20.607 -43.092 1.00 64.20  ? 12   ARG B CD    1 
ATOM   2886 N  NE    . ARG B 1 12  ? 15.918  -21.484 -43.023 1.00 67.80  ? 12   ARG B NE    1 
ATOM   2887 C  CZ    . ARG B 1 12  ? 15.093  -21.595 -41.968 1.00 69.40  ? 12   ARG B CZ    1 
ATOM   2888 N  NH1   . ARG B 1 12  ? 15.299  -20.887 -40.855 1.00 69.55  ? 12   ARG B NH1   1 
ATOM   2889 N  NH2   . ARG B 1 12  ? 14.051  -22.425 -42.017 1.00 69.40  ? 12   ARG B NH2   1 
ATOM   2890 N  N     . THR B 1 13  ? 17.605  -17.037 -45.505 1.00 54.39  ? 13   THR B N     1 
ATOM   2891 C  CA    . THR B 1 13  ? 16.387  -16.247 -45.645 1.00 52.90  ? 13   THR B CA    1 
ATOM   2892 C  C     . THR B 1 13  ? 16.013  -16.031 -47.125 1.00 51.72  ? 13   THR B C     1 
ATOM   2893 O  O     . THR B 1 13  ? 14.838  -16.051 -47.467 1.00 51.62  ? 13   THR B O     1 
ATOM   2894 C  CB    . THR B 1 13  ? 16.451  -14.907 -44.854 1.00 53.02  ? 13   THR B CB    1 
ATOM   2895 O  OG1   . THR B 1 13  ? 16.558  -15.180 -43.449 1.00 53.21  ? 13   THR B OG1   1 
ATOM   2896 C  CG2   . THR B 1 13  ? 15.204  -14.075 -45.093 1.00 52.48  ? 13   THR B CG2   1 
ATOM   2897 N  N     . VAL B 1 14  ? 17.000  -15.853 -47.998 1.00 50.21  ? 14   VAL B N     1 
ATOM   2898 C  CA    . VAL B 1 14  ? 16.717  -15.638 -49.417 1.00 48.72  ? 14   VAL B CA    1 
ATOM   2899 C  C     . VAL B 1 14  ? 16.355  -16.950 -50.101 1.00 48.14  ? 14   VAL B C     1 
ATOM   2900 O  O     . VAL B 1 14  ? 15.520  -16.983 -51.002 1.00 47.98  ? 14   VAL B O     1 
ATOM   2901 C  CB    . VAL B 1 14  ? 17.883  -14.946 -50.145 1.00 48.58  ? 14   VAL B CB    1 
ATOM   2902 C  CG1   . VAL B 1 14  ? 17.560  -14.765 -51.613 1.00 48.23  ? 14   VAL B CG1   1 
ATOM   2903 C  CG2   . VAL B 1 14  ? 18.154  -13.602 -49.523 1.00 47.98  ? 14   VAL B CG2   1 
ATOM   2904 N  N     . LEU B 1 15  ? 16.974  -18.034 -49.656 1.00 47.41  ? 15   LEU B N     1 
ATOM   2905 C  CA    . LEU B 1 15  ? 16.689  -19.346 -50.214 1.00 46.74  ? 15   LEU B CA    1 
ATOM   2906 C  C     . LEU B 1 15  ? 15.356  -19.915 -49.736 1.00 46.42  ? 15   LEU B C     1 
ATOM   2907 O  O     . LEU B 1 15  ? 14.755  -20.732 -50.435 1.00 46.36  ? 15   LEU B O     1 
ATOM   2908 C  CB    . LEU B 1 15  ? 17.841  -20.311 -49.944 1.00 46.64  ? 15   LEU B CB    1 
ATOM   2909 C  CG    . LEU B 1 15  ? 18.836  -20.429 -51.104 1.00 46.70  ? 15   LEU B CG    1 
ATOM   2910 C  CD1   . LEU B 1 15  ? 19.433  -19.086 -51.507 1.00 46.71  ? 15   LEU B CD1   1 
ATOM   2911 C  CD2   . LEU B 1 15  ? 19.943  -21.420 -50.774 1.00 46.83  ? 15   LEU B CD2   1 
ATOM   2912 N  N     . ILE B 1 16  ? 14.899  -19.489 -48.553 1.00 45.96  ? 16   ILE B N     1 
ATOM   2913 C  CA    . ILE B 1 16  ? 13.544  -19.815 -48.083 1.00 45.42  ? 16   ILE B CA    1 
ATOM   2914 C  C     . ILE B 1 16  ? 12.531  -19.090 -48.983 1.00 45.02  ? 16   ILE B C     1 
ATOM   2915 O  O     . ILE B 1 16  ? 11.509  -19.656 -49.364 1.00 45.08  ? 16   ILE B O     1 
ATOM   2916 C  CB    . ILE B 1 16  ? 13.332  -19.503 -46.551 1.00 45.36  ? 16   ILE B CB    1 
ATOM   2917 C  CG1   . ILE B 1 16  ? 12.041  -20.153 -46.009 1.00 45.87  ? 16   ILE B CG1   1 
ATOM   2918 C  CG2   . ILE B 1 16  ? 13.332  -18.022 -46.282 1.00 45.30  ? 16   ILE B CG2   1 
ATOM   2919 C  CD1   . ILE B 1 16  ? 11.552  -19.645 -44.593 1.00 45.52  ? 16   ILE B CD1   1 
ATOM   2920 N  N     . PHE B 1 17  ? 12.855  -17.851 -49.348 1.00 44.42  ? 17   PHE B N     1 
ATOM   2921 C  CA    . PHE B 1 17  ? 12.044  -17.058 -50.250 1.00 43.75  ? 17   PHE B CA    1 
ATOM   2922 C  C     . PHE B 1 17  ? 12.037  -17.714 -51.620 1.00 43.86  ? 17   PHE B C     1 
ATOM   2923 O  O     . PHE B 1 17  ? 11.001  -18.189 -52.076 1.00 43.90  ? 17   PHE B O     1 
ATOM   2924 C  CB    . PHE B 1 17  ? 12.578  -15.626 -50.307 1.00 43.39  ? 17   PHE B CB    1 
ATOM   2925 C  CG    . PHE B 1 17  ? 11.822  -14.723 -51.229 1.00 42.46  ? 17   PHE B CG    1 
ATOM   2926 C  CD1   . PHE B 1 17  ? 10.462  -14.537 -51.085 1.00 41.96  ? 17   PHE B CD1   1 
ATOM   2927 C  CD2   . PHE B 1 17  ? 12.483  -14.031 -52.229 1.00 42.36  ? 17   PHE B CD2   1 
ATOM   2928 C  CE1   . PHE B 1 17  ? 9.767   -13.694 -51.941 1.00 42.02  ? 17   PHE B CE1   1 
ATOM   2929 C  CE2   . PHE B 1 17  ? 11.797  -13.180 -53.086 1.00 41.97  ? 17   PHE B CE2   1 
ATOM   2930 C  CZ    . PHE B 1 17  ? 10.436  -13.016 -52.942 1.00 42.01  ? 17   PHE B CZ    1 
ATOM   2931 N  N     . CYS B 1 18  ? 13.205  -17.793 -52.248 1.00 44.03  ? 18   CYS B N     1 
ATOM   2932 C  CA    . CYS B 1 18  ? 13.325  -18.351 -53.597 1.00 44.28  ? 18   CYS B CA    1 
ATOM   2933 C  C     . CYS B 1 18  ? 12.726  -19.747 -53.721 1.00 44.51  ? 18   CYS B C     1 
ATOM   2934 O  O     . CYS B 1 18  ? 12.371  -20.192 -54.816 1.00 44.30  ? 18   CYS B O     1 
ATOM   2935 C  CB    . CYS B 1 18  ? 14.785  -18.355 -54.044 1.00 44.22  ? 18   CYS B CB    1 
ATOM   2936 S  SG    . CYS B 1 18  ? 15.459  -16.710 -54.372 1.00 44.03  ? 18   CYS B SG    1 
ATOM   2937 N  N     . PHE B 1 19  ? 12.614  -20.426 -52.586 1.00 45.06  ? 19   PHE B N     1 
ATOM   2938 C  CA    . PHE B 1 19  ? 11.992  -21.733 -52.540 1.00 45.68  ? 19   PHE B CA    1 
ATOM   2939 C  C     . PHE B 1 19  ? 10.522  -21.570 -52.874 1.00 45.71  ? 19   PHE B C     1 
ATOM   2940 O  O     . PHE B 1 19  ? 10.033  -22.158 -53.842 1.00 45.91  ? 19   PHE B O     1 
ATOM   2941 C  CB    . PHE B 1 19  ? 12.173  -22.389 -51.161 1.00 45.98  ? 19   PHE B CB    1 
ATOM   2942 C  CG    . PHE B 1 19  ? 11.681  -23.814 -51.094 1.00 47.00  ? 19   PHE B CG    1 
ATOM   2943 C  CD1   . PHE B 1 19  ? 12.489  -24.866 -51.518 1.00 47.90  ? 19   PHE B CD1   1 
ATOM   2944 C  CD2   . PHE B 1 19  ? 10.407  -24.105 -50.609 1.00 47.79  ? 19   PHE B CD2   1 
ATOM   2945 C  CE1   . PHE B 1 19  ? 12.034  -26.187 -51.465 1.00 48.39  ? 19   PHE B CE1   1 
ATOM   2946 C  CE2   . PHE B 1 19  ? 9.945   -25.420 -50.551 1.00 48.26  ? 19   PHE B CE2   1 
ATOM   2947 C  CZ    . PHE B 1 19  ? 10.761  -26.463 -50.979 1.00 48.52  ? 19   PHE B CZ    1 
ATOM   2948 N  N     . HIS B 1 20  ? 9.835   -20.745 -52.090 1.00 45.65  ? 20   HIS B N     1 
ATOM   2949 C  CA    . HIS B 1 20  ? 8.401   -20.552 -52.250 1.00 45.77  ? 20   HIS B CA    1 
ATOM   2950 C  C     . HIS B 1 20  ? 8.013   -19.997 -53.616 1.00 45.74  ? 20   HIS B C     1 
ATOM   2951 O  O     . HIS B 1 20  ? 6.905   -20.246 -54.090 1.00 45.87  ? 20   HIS B O     1 
ATOM   2952 C  CB    . HIS B 1 20  ? 7.858   -19.680 -51.132 1.00 45.84  ? 20   HIS B CB    1 
ATOM   2953 C  CG    . HIS B 1 20  ? 7.881   -20.347 -49.793 1.00 46.62  ? 20   HIS B CG    1 
ATOM   2954 N  ND1   . HIS B 1 20  ? 6.843   -21.129 -49.333 1.00 47.45  ? 20   HIS B ND1   1 
ATOM   2955 C  CD2   . HIS B 1 20  ? 8.820   -20.358 -48.818 1.00 47.11  ? 20   HIS B CD2   1 
ATOM   2956 C  CE1   . HIS B 1 20  ? 7.139   -21.587 -48.130 1.00 47.79  ? 20   HIS B CE1   1 
ATOM   2957 N  NE2   . HIS B 1 20  ? 8.334   -21.133 -47.794 1.00 47.49  ? 20   HIS B NE2   1 
ATOM   2958 N  N     . LEU B 1 21  ? 8.937   -19.275 -54.252 1.00 45.65  ? 21   LEU B N     1 
ATOM   2959 C  CA    . LEU B 1 21  ? 8.747   -18.789 -55.619 1.00 45.40  ? 21   LEU B CA    1 
ATOM   2960 C  C     . LEU B 1 21  ? 8.969   -19.888 -56.660 1.00 45.64  ? 21   LEU B C     1 
ATOM   2961 O  O     . LEU B 1 21  ? 9.114   -19.606 -57.852 1.00 45.62  ? 21   LEU B O     1 
ATOM   2962 C  CB    . LEU B 1 21  ? 9.675   -17.614 -55.910 1.00 45.10  ? 21   LEU B CB    1 
ATOM   2963 C  CG    . LEU B 1 21  ? 9.566   -16.320 -55.112 1.00 44.46  ? 21   LEU B CG    1 
ATOM   2964 C  CD1   . LEU B 1 21  ? 10.559  -15.350 -55.685 1.00 44.34  ? 21   LEU B CD1   1 
ATOM   2965 C  CD2   . LEU B 1 21  ? 8.185   -15.732 -55.183 1.00 44.14  ? 21   LEU B CD2   1 
ATOM   2966 N  N     . LYS B 1 22  ? 9.005   -21.137 -56.199 1.00 45.99  ? 22   LYS B N     1 
ATOM   2967 C  CA    . LYS B 1 22  ? 9.089   -22.311 -57.075 1.00 46.47  ? 22   LYS B CA    1 
ATOM   2968 C  C     . LYS B 1 22  ? 10.339  -22.339 -57.953 1.00 46.45  ? 22   LYS B C     1 
ATOM   2969 O  O     . LYS B 1 22  ? 10.373  -23.044 -58.970 1.00 46.51  ? 22   LYS B O     1 
ATOM   2970 C  CB    . LYS B 1 22  ? 7.823   -22.446 -57.942 1.00 46.71  ? 22   LYS B CB    1 
ATOM   2971 C  CG    . LYS B 1 22  ? 6.541   -22.719 -57.162 1.00 47.63  ? 22   LYS B CG    1 
ATOM   2972 C  CD    . LYS B 1 22  ? 6.569   -24.107 -56.532 1.00 49.33  ? 22   LYS B CD    1 
ATOM   2973 C  CE    . LYS B 1 22  ? 5.402   -24.311 -55.583 1.00 50.03  ? 22   LYS B CE    1 
ATOM   2974 N  NZ    . LYS B 1 22  ? 5.429   -25.681 -55.012 1.00 50.61  ? 22   LYS B NZ    1 
ATOM   2975 N  N     . LYS B 1 23  ? 11.351  -21.560 -57.568 1.00 46.35  ? 23   LYS B N     1 
ATOM   2976 C  CA    . LYS B 1 23  ? 12.643  -21.600 -58.242 1.00 46.23  ? 23   LYS B CA    1 
ATOM   2977 C  C     . LYS B 1 23  ? 13.371  -22.854 -57.774 1.00 46.02  ? 23   LYS B C     1 
ATOM   2978 O  O     . LYS B 1 23  ? 13.202  -23.276 -56.629 1.00 45.93  ? 23   LYS B O     1 
ATOM   2979 C  CB    . LYS B 1 23  ? 13.477  -20.346 -57.944 1.00 46.24  ? 23   LYS B CB    1 
ATOM   2980 C  CG    . LYS B 1 23  ? 12.910  -19.010 -58.467 1.00 46.69  ? 23   LYS B CG    1 
ATOM   2981 C  CD    . LYS B 1 23  ? 12.787  -18.959 -60.001 1.00 47.91  ? 23   LYS B CD    1 
ATOM   2982 C  CE    . LYS B 1 23  ? 13.169  -17.583 -60.579 1.00 48.29  ? 23   LYS B CE    1 
ATOM   2983 N  NZ    . LYS B 1 23  ? 12.192  -16.481 -60.299 1.00 48.41  ? 23   LYS B NZ    1 
ATOM   2984 N  N     . THR B 1 24  ? 14.153  -23.463 -58.665 1.00 45.82  ? 24   THR B N     1 
ATOM   2985 C  CA    . THR B 1 24  ? 14.937  -24.646 -58.307 1.00 45.59  ? 24   THR B CA    1 
ATOM   2986 C  C     . THR B 1 24  ? 16.166  -24.179 -57.542 1.00 45.51  ? 24   THR B C     1 
ATOM   2987 O  O     . THR B 1 24  ? 16.399  -22.974 -57.415 1.00 45.71  ? 24   THR B O     1 
ATOM   2988 C  CB    . THR B 1 24  ? 15.378  -25.478 -59.541 1.00 45.53  ? 24   THR B CB    1 
ATOM   2989 O  OG1   . THR B 1 24  ? 16.570  -24.919 -60.102 1.00 45.68  ? 24   THR B OG1   1 
ATOM   2990 C  CG2   . THR B 1 24  ? 14.288  -25.532 -60.604 1.00 45.46  ? 24   THR B CG2   1 
ATOM   2991 N  N     . ALA B 1 25  ? 16.950  -25.124 -57.030 1.00 45.18  ? 25   ALA B N     1 
ATOM   2992 C  CA    . ALA B 1 25  ? 18.181  -24.782 -56.325 1.00 44.69  ? 25   ALA B CA    1 
ATOM   2993 C  C     . ALA B 1 25  ? 19.126  -23.976 -57.225 1.00 44.37  ? 25   ALA B C     1 
ATOM   2994 O  O     . ALA B 1 25  ? 19.339  -22.781 -57.000 1.00 44.11  ? 25   ALA B O     1 
ATOM   2995 C  CB    . ALA B 1 25  ? 18.858  -26.040 -55.796 1.00 44.74  ? 25   ALA B CB    1 
ATOM   2996 N  N     . ALA B 1 26  ? 19.653  -24.621 -58.264 1.00 44.02  ? 26   ALA B N     1 
ATOM   2997 C  CA    . ALA B 1 26  ? 20.615  -23.986 -59.152 1.00 43.85  ? 26   ALA B CA    1 
ATOM   2998 C  C     . ALA B 1 26  ? 20.048  -22.717 -59.790 1.00 43.78  ? 26   ALA B C     1 
ATOM   2999 O  O     . ALA B 1 26  ? 20.792  -21.888 -60.316 1.00 43.76  ? 26   ALA B O     1 
ATOM   3000 C  CB    . ALA B 1 26  ? 21.085  -24.969 -60.209 1.00 43.83  ? 26   ALA B CB    1 
ATOM   3001 N  N     . GLU B 1 27  ? 18.729  -22.573 -59.717 1.00 43.80  ? 27   GLU B N     1 
ATOM   3002 C  CA    . GLU B 1 27  ? 18.021  -21.425 -60.271 1.00 43.98  ? 27   GLU B CA    1 
ATOM   3003 C  C     . GLU B 1 27  ? 18.224  -20.198 -59.395 1.00 43.85  ? 27   GLU B C     1 
ATOM   3004 O  O     . GLU B 1 27  ? 18.412  -19.088 -59.888 1.00 43.69  ? 27   GLU B O     1 
ATOM   3005 C  CB    . GLU B 1 27  ? 16.535  -21.743 -60.355 1.00 43.98  ? 27   GLU B CB    1 
ATOM   3006 C  CG    . GLU B 1 27  ? 15.865  -21.275 -61.618 1.00 45.33  ? 27   GLU B CG    1 
ATOM   3007 C  CD    . GLU B 1 27  ? 14.969  -22.351 -62.219 1.00 47.09  ? 27   GLU B CD    1 
ATOM   3008 O  OE1   . GLU B 1 27  ? 13.731  -22.158 -62.259 1.00 47.74  ? 27   GLU B OE1   1 
ATOM   3009 O  OE2   . GLU B 1 27  ? 15.509  -23.399 -62.642 1.00 47.72  ? 27   GLU B OE2   1 
ATOM   3010 N  N     . SER B 1 28  ? 18.187  -20.415 -58.087 1.00 43.90  ? 28   SER B N     1 
ATOM   3011 C  CA    . SER B 1 28  ? 18.276  -19.328 -57.127 1.00 43.87  ? 28   SER B CA    1 
ATOM   3012 C  C     . SER B 1 28  ? 19.713  -18.858 -56.979 1.00 43.91  ? 28   SER B C     1 
ATOM   3013 O  O     . SER B 1 28  ? 19.956  -17.733 -56.554 1.00 43.98  ? 28   SER B O     1 
ATOM   3014 C  CB    . SER B 1 28  ? 17.712  -19.757 -55.767 1.00 43.94  ? 28   SER B CB    1 
ATOM   3015 O  OG    . SER B 1 28  ? 16.313  -19.996 -55.823 1.00 43.54  ? 28   SER B OG    1 
ATOM   3016 N  N     . HIS B 1 29  ? 20.667  -19.716 -57.319 1.00 43.89  ? 29   HIS B N     1 
ATOM   3017 C  CA    . HIS B 1 29  ? 22.050  -19.302 -57.260 1.00 43.98  ? 29   HIS B CA    1 
ATOM   3018 C  C     . HIS B 1 29  ? 22.318  -18.260 -58.323 1.00 44.03  ? 29   HIS B C     1 
ATOM   3019 O  O     . HIS B 1 29  ? 23.025  -17.293 -58.066 1.00 43.93  ? 29   HIS B O     1 
ATOM   3020 C  CB    . HIS B 1 29  ? 23.007  -20.467 -57.429 1.00 44.07  ? 29   HIS B CB    1 
ATOM   3021 C  CG    . HIS B 1 29  ? 24.434  -20.089 -57.200 1.00 44.77  ? 29   HIS B CG    1 
ATOM   3022 N  ND1   . HIS B 1 29  ? 25.125  -20.445 -56.063 1.00 46.08  ? 29   HIS B ND1   1 
ATOM   3023 C  CD2   . HIS B 1 29  ? 25.289  -19.349 -57.945 1.00 45.43  ? 29   HIS B CD2   1 
ATOM   3024 C  CE1   . HIS B 1 29  ? 26.352  -19.955 -56.124 1.00 46.44  ? 29   HIS B CE1   1 
ATOM   3025 N  NE2   . HIS B 1 29  ? 26.475  -19.281 -57.253 1.00 46.21  ? 29   HIS B NE2   1 
ATOM   3026 N  N     . ARG B 1 30  ? 21.751  -18.455 -59.512 1.00 44.39  ? 30   ARG B N     1 
ATOM   3027 C  CA    . ARG B 1 30  ? 21.908  -17.486 -60.603 1.00 44.81  ? 30   ARG B CA    1 
ATOM   3028 C  C     . ARG B 1 30  ? 21.489  -16.088 -60.109 1.00 45.02  ? 30   ARG B C     1 
ATOM   3029 O  O     . ARG B 1 30  ? 22.219  -15.115 -60.322 1.00 45.10  ? 30   ARG B O     1 
ATOM   3030 C  CB    . ARG B 1 30  ? 21.136  -17.902 -61.886 1.00 44.83  ? 30   ARG B CB    1 
ATOM   3031 C  CG    . ARG B 1 30  ? 21.561  -19.250 -62.536 1.00 44.78  ? 30   ARG B CG    1 
ATOM   3032 C  CD    . ARG B 1 30  ? 20.762  -19.594 -63.817 1.00 44.81  ? 30   ARG B CD    1 
ATOM   3033 N  NE    . ARG B 1 30  ? 19.315  -19.714 -63.585 1.00 46.00  ? 30   ARG B NE    1 
ATOM   3034 C  CZ    . ARG B 1 30  ? 18.360  -19.485 -64.497 1.00 46.46  ? 30   ARG B CZ    1 
ATOM   3035 N  NH1   . ARG B 1 30  ? 18.671  -19.114 -65.734 1.00 46.45  ? 30   ARG B NH1   1 
ATOM   3036 N  NH2   . ARG B 1 30  ? 17.076  -19.615 -64.172 1.00 45.90  ? 30   ARG B NH2   1 
ATOM   3037 N  N     . MET B 1 31  ? 20.340  -16.016 -59.423 1.00 45.22  ? 31   MET B N     1 
ATOM   3038 C  CA    . MET B 1 31  ? 19.778  -14.766 -58.869 1.00 45.29  ? 31   MET B CA    1 
ATOM   3039 C  C     . MET B 1 31  ? 20.669  -14.227 -57.764 1.00 45.48  ? 31   MET B C     1 
ATOM   3040 O  O     . MET B 1 31  ? 20.943  -13.027 -57.688 1.00 45.37  ? 31   MET B O     1 
ATOM   3041 C  CB    . MET B 1 31  ? 18.382  -15.006 -58.272 1.00 45.21  ? 31   MET B CB    1 
ATOM   3042 C  CG    . MET B 1 31  ? 17.351  -15.654 -59.196 1.00 45.40  ? 31   MET B CG    1 
ATOM   3043 S  SD    . MET B 1 31  ? 15.950  -16.400 -58.318 1.00 45.17  ? 31   MET B SD    1 
ATOM   3044 C  CE    . MET B 1 31  ? 15.029  -14.951 -57.814 1.00 45.02  ? 31   MET B CE    1 
ATOM   3045 N  N     . LEU B 1 32  ? 21.102  -15.146 -56.906 1.00 45.86  ? 32   LEU B N     1 
ATOM   3046 C  CA    . LEU B 1 32  ? 21.955  -14.857 -55.767 1.00 46.24  ? 32   LEU B CA    1 
ATOM   3047 C  C     . LEU B 1 32  ? 23.276  -14.244 -56.211 1.00 46.71  ? 32   LEU B C     1 
ATOM   3048 O  O     . LEU B 1 32  ? 23.828  -13.396 -55.522 1.00 46.80  ? 32   LEU B O     1 
ATOM   3049 C  CB    . LEU B 1 32  ? 22.194  -16.148 -54.989 1.00 46.05  ? 32   LEU B CB    1 
ATOM   3050 C  CG    . LEU B 1 32  ? 22.571  -16.160 -53.508 1.00 45.95  ? 32   LEU B CG    1 
ATOM   3051 C  CD1   . LEU B 1 32  ? 21.828  -15.119 -52.687 1.00 45.95  ? 32   LEU B CD1   1 
ATOM   3052 C  CD2   . LEU B 1 32  ? 22.306  -17.545 -52.952 1.00 45.62  ? 32   LEU B CD2   1 
ATOM   3053 N  N     . VAL B 1 33  ? 23.770  -14.674 -57.369 1.00 47.38  ? 33   VAL B N     1 
ATOM   3054 C  CA    . VAL B 1 33  ? 24.972  -14.098 -57.956 1.00 48.11  ? 33   VAL B CA    1 
ATOM   3055 C  C     . VAL B 1 33  ? 24.718  -12.667 -58.434 1.00 48.71  ? 33   VAL B C     1 
ATOM   3056 O  O     . VAL B 1 33  ? 25.476  -11.768 -58.090 1.00 48.72  ? 33   VAL B O     1 
ATOM   3057 C  CB    . VAL B 1 33  ? 25.561  -15.004 -59.083 1.00 48.13  ? 33   VAL B CB    1 
ATOM   3058 C  CG1   . VAL B 1 33  ? 26.347  -14.197 -60.131 1.00 48.26  ? 33   VAL B CG1   1 
ATOM   3059 C  CG2   . VAL B 1 33  ? 26.442  -16.083 -58.477 1.00 47.99  ? 33   VAL B CG2   1 
ATOM   3060 N  N     . GLU B 1 34  ? 23.647  -12.453 -59.198 1.00 49.60  ? 34   GLU B N     1 
ATOM   3061 C  CA    . GLU B 1 34  ? 23.379  -11.127 -59.781 1.00 50.47  ? 34   GLU B CA    1 
ATOM   3062 C  C     . GLU B 1 34  ? 22.923  -10.080 -58.749 1.00 51.02  ? 34   GLU B C     1 
ATOM   3063 O  O     . GLU B 1 34  ? 23.112  -8.874  -58.942 1.00 51.05  ? 34   GLU B O     1 
ATOM   3064 C  CB    . GLU B 1 34  ? 22.404  -11.206 -60.973 1.00 50.42  ? 34   GLU B CB    1 
ATOM   3065 C  CG    . GLU B 1 34  ? 20.922  -11.405 -60.614 1.00 50.48  ? 34   GLU B CG    1 
ATOM   3066 C  CD    . GLU B 1 34  ? 19.969  -10.896 -61.695 1.00 50.34  ? 34   GLU B CD    1 
ATOM   3067 O  OE1   . GLU B 1 34  ? 20.180  -9.775  -62.203 1.00 49.85  ? 34   GLU B OE1   1 
ATOM   3068 O  OE2   . GLU B 1 34  ? 18.996  -11.609 -62.027 1.00 50.73  ? 34   GLU B OE2   1 
ATOM   3069 N  N     . ALA B 1 35  ? 22.330  -10.535 -57.655 1.00 51.68  ? 35   ALA B N     1 
ATOM   3070 C  CA    . ALA B 1 35  ? 21.962  -9.615  -56.602 1.00 52.52  ? 35   ALA B CA    1 
ATOM   3071 C  C     . ALA B 1 35  ? 23.193  -9.206  -55.805 1.00 53.14  ? 35   ALA B C     1 
ATOM   3072 O  O     . ALA B 1 35  ? 23.460  -8.021  -55.628 1.00 53.34  ? 35   ALA B O     1 
ATOM   3073 C  CB    . ALA B 1 35  ? 20.937  -10.235 -55.702 1.00 52.56  ? 35   ALA B CB    1 
ATOM   3074 N  N     . PHE B 1 36  ? 23.954  -10.192 -55.346 1.00 53.91  ? 36   PHE B N     1 
ATOM   3075 C  CA    . PHE B 1 36  ? 25.022  -9.946  -54.384 1.00 54.70  ? 36   PHE B CA    1 
ATOM   3076 C  C     . PHE B 1 36  ? 26.424  -10.302 -54.899 1.00 55.46  ? 36   PHE B C     1 
ATOM   3077 O  O     . PHE B 1 36  ? 27.280  -10.764 -54.132 1.00 55.44  ? 36   PHE B O     1 
ATOM   3078 C  CB    . PHE B 1 36  ? 24.730  -10.700 -53.081 1.00 54.53  ? 36   PHE B CB    1 
ATOM   3079 C  CG    . PHE B 1 36  ? 23.326  -10.517 -52.562 1.00 54.41  ? 36   PHE B CG    1 
ATOM   3080 C  CD1   . PHE B 1 36  ? 22.652  -9.306  -52.699 1.00 54.34  ? 36   PHE B CD1   1 
ATOM   3081 C  CD2   . PHE B 1 36  ? 22.689  -11.551 -51.895 1.00 54.19  ? 36   PHE B CD2   1 
ATOM   3082 C  CE1   . PHE B 1 36  ? 21.359  -9.149  -52.209 1.00 53.98  ? 36   PHE B CE1   1 
ATOM   3083 C  CE2   . PHE B 1 36  ? 21.399  -11.390 -51.398 1.00 53.70  ? 36   PHE B CE2   1 
ATOM   3084 C  CZ    . PHE B 1 36  ? 20.739  -10.192 -51.555 1.00 53.20  ? 36   PHE B CZ    1 
ATOM   3085 N  N     . GLY B 1 37  ? 26.657  -10.081 -56.192 1.00 56.34  ? 37   GLY B N     1 
ATOM   3086 C  CA    . GLY B 1 37  ? 27.932  -10.437 -56.824 1.00 57.48  ? 37   GLY B CA    1 
ATOM   3087 C  C     . GLY B 1 37  ? 28.319  -11.900 -56.648 1.00 58.22  ? 37   GLY B C     1 
ATOM   3088 O  O     . GLY B 1 37  ? 27.561  -12.697 -56.080 1.00 58.27  ? 37   GLY B O     1 
ATOM   3089 N  N     . GLU B 1 38  ? 29.501  -12.258 -57.145 1.00 58.90  ? 38   GLU B N     1 
ATOM   3090 C  CA    . GLU B 1 38  ? 30.031  -13.604 -56.953 1.00 59.49  ? 38   GLU B CA    1 
ATOM   3091 C  C     . GLU B 1 38  ? 30.780  -13.644 -55.622 1.00 59.49  ? 38   GLU B C     1 
ATOM   3092 O  O     . GLU B 1 38  ? 32.005  -13.525 -55.577 1.00 59.82  ? 38   GLU B O     1 
ATOM   3093 C  CB    . GLU B 1 38  ? 30.935  -13.988 -58.119 1.00 59.62  ? 38   GLU B CB    1 
ATOM   3094 C  CG    . GLU B 1 38  ? 31.157  -15.480 -58.243 1.00 61.11  ? 38   GLU B CG    1 
ATOM   3095 C  CD    . GLU B 1 38  ? 31.259  -15.926 -59.688 1.00 63.05  ? 38   GLU B CD    1 
ATOM   3096 O  OE1   . GLU B 1 38  ? 31.775  -15.138 -60.511 1.00 63.94  ? 38   GLU B OE1   1 
ATOM   3097 O  OE2   . GLU B 1 38  ? 30.822  -17.060 -60.002 1.00 63.62  ? 38   GLU B OE2   1 
ATOM   3098 N  N     . GLN B 1 39  ? 30.025  -13.809 -54.540 1.00 59.36  ? 39   GLN B N     1 
ATOM   3099 C  CA    . GLN B 1 39  ? 30.513  -13.529 -53.193 1.00 59.12  ? 39   GLN B CA    1 
ATOM   3100 C  C     . GLN B 1 39  ? 29.768  -14.373 -52.177 1.00 58.58  ? 39   GLN B C     1 
ATOM   3101 O  O     . GLN B 1 39  ? 29.926  -14.205 -50.970 1.00 58.42  ? 39   GLN B O     1 
ATOM   3102 C  CB    . GLN B 1 39  ? 30.285  -12.042 -52.872 1.00 59.45  ? 39   GLN B CB    1 
ATOM   3103 C  CG    . GLN B 1 39  ? 31.409  -11.099 -53.301 1.00 60.27  ? 39   GLN B CG    1 
ATOM   3104 C  CD    . GLN B 1 39  ? 32.554  -11.064 -52.289 1.00 61.72  ? 39   GLN B CD    1 
ATOM   3105 O  OE1   . GLN B 1 39  ? 32.728  -10.078 -51.569 1.00 61.71  ? 39   GLN B OE1   1 
ATOM   3106 N  NE2   . GLN B 1 39  ? 33.330  -12.150 -52.222 1.00 62.37  ? 39   GLN B NE2   1 
ATOM   3107 N  N     . VAL B 1 40  ? 28.944  -15.276 -52.684 1.00 58.11  ? 40   VAL B N     1 
ATOM   3108 C  CA    . VAL B 1 40  ? 27.967  -15.977 -51.867 1.00 57.75  ? 40   VAL B CA    1 
ATOM   3109 C  C     . VAL B 1 40  ? 28.337  -17.455 -51.746 1.00 57.55  ? 40   VAL B C     1 
ATOM   3110 O  O     . VAL B 1 40  ? 29.347  -17.881 -52.314 1.00 57.81  ? 40   VAL B O     1 
ATOM   3111 C  CB    . VAL B 1 40  ? 26.562  -15.824 -52.473 1.00 57.64  ? 40   VAL B CB    1 
ATOM   3112 C  CG1   . VAL B 1 40  ? 26.215  -14.357 -52.619 1.00 57.82  ? 40   VAL B CG1   1 
ATOM   3113 C  CG2   . VAL B 1 40  ? 26.477  -16.525 -53.820 1.00 57.79  ? 40   VAL B CG2   1 
ATOM   3114 N  N     . PRO B 1 41  ? 27.531  -18.244 -51.007 1.00 57.15  ? 41   PRO B N     1 
ATOM   3115 C  CA    . PRO B 1 41  ? 27.787  -19.680 -50.910 1.00 56.96  ? 41   PRO B CA    1 
ATOM   3116 C  C     . PRO B 1 41  ? 27.599  -20.421 -52.240 1.00 56.80  ? 41   PRO B C     1 
ATOM   3117 O  O     . PRO B 1 41  ? 26.945  -19.911 -53.155 1.00 56.65  ? 41   PRO B O     1 
ATOM   3118 C  CB    . PRO B 1 41  ? 26.753  -20.146 -49.884 1.00 56.89  ? 41   PRO B CB    1 
ATOM   3119 C  CG    . PRO B 1 41  ? 25.692  -19.126 -49.940 1.00 56.78  ? 41   PRO B CG    1 
ATOM   3120 C  CD    . PRO B 1 41  ? 26.408  -17.846 -50.146 1.00 57.01  ? 41   PRO B CD    1 
ATOM   3121 N  N     . THR B 1 42  ? 28.181  -21.614 -52.330 1.00 56.61  ? 42   THR B N     1 
ATOM   3122 C  CA    . THR B 1 42  ? 28.183  -22.382 -53.568 1.00 56.41  ? 42   THR B CA    1 
ATOM   3123 C  C     . THR B 1 42  ? 26.849  -23.051 -53.812 1.00 56.27  ? 42   THR B C     1 
ATOM   3124 O  O     . THR B 1 42  ? 26.044  -23.215 -52.892 1.00 56.20  ? 42   THR B O     1 
ATOM   3125 C  CB    . THR B 1 42  ? 29.249  -23.484 -53.559 1.00 56.46  ? 42   THR B CB    1 
ATOM   3126 O  OG1   . THR B 1 42  ? 29.017  -24.354 -52.442 1.00 56.04  ? 42   THR B OG1   1 
ATOM   3127 C  CG2   . THR B 1 42  ? 30.660  -22.881 -53.504 1.00 56.41  ? 42   THR B CG2   1 
ATOM   3128 N  N     . VAL B 1 43  ? 26.645  -23.454 -55.063 1.00 56.05  ? 43   VAL B N     1 
ATOM   3129 C  CA    . VAL B 1 43  ? 25.445  -24.164 -55.484 1.00 55.72  ? 43   VAL B CA    1 
ATOM   3130 C  C     . VAL B 1 43  ? 25.143  -25.307 -54.511 1.00 55.30  ? 43   VAL B C     1 
ATOM   3131 O  O     . VAL B 1 43  ? 24.002  -25.482 -54.086 1.00 55.00  ? 43   VAL B O     1 
ATOM   3132 C  CB    . VAL B 1 43  ? 25.565  -24.650 -56.985 1.00 55.92  ? 43   VAL B CB    1 
ATOM   3133 C  CG1   . VAL B 1 43  ? 26.277  -26.018 -57.111 1.00 56.18  ? 43   VAL B CG1   1 
ATOM   3134 C  CG2   . VAL B 1 43  ? 24.203  -24.669 -57.684 1.00 55.73  ? 43   VAL B CG2   1 
ATOM   3135 N  N     . LYS B 1 44  ? 26.183  -26.038 -54.118 1.00 54.98  ? 44   LYS B N     1 
ATOM   3136 C  CA    . LYS B 1 44  ? 26.001  -27.263 -53.357 1.00 54.92  ? 44   LYS B CA    1 
ATOM   3137 C  C     . LYS B 1 44  ? 25.210  -27.023 -52.088 1.00 54.73  ? 44   LYS B C     1 
ATOM   3138 O  O     . LYS B 1 44  ? 24.340  -27.818 -51.738 1.00 54.86  ? 44   LYS B O     1 
ATOM   3139 C  CB    . LYS B 1 44  ? 27.343  -27.940 -53.053 1.00 55.03  ? 44   LYS B CB    1 
ATOM   3140 C  CG    . LYS B 1 44  ? 27.255  -29.300 -52.307 1.00 55.46  ? 44   LYS B CG    1 
ATOM   3141 C  CD    . LYS B 1 44  ? 26.446  -30.393 -53.043 1.00 55.85  ? 44   LYS B CD    1 
ATOM   3142 C  CE    . LYS B 1 44  ? 26.327  -31.673 -52.194 1.00 55.79  ? 44   LYS B CE    1 
ATOM   3143 N  NZ    . LYS B 1 44  ? 25.281  -32.619 -52.686 1.00 55.27  ? 44   LYS B NZ    1 
ATOM   3144 N  N     . THR B 1 45  ? 25.489  -25.913 -51.414 1.00 54.50  ? 45   THR B N     1 
ATOM   3145 C  CA    . THR B 1 45  ? 24.801  -25.611 -50.167 1.00 54.11  ? 45   THR B CA    1 
ATOM   3146 C  C     . THR B 1 45  ? 23.333  -25.320 -50.430 1.00 54.04  ? 45   THR B C     1 
ATOM   3147 O  O     . THR B 1 45  ? 22.480  -25.636 -49.603 1.00 54.06  ? 45   THR B O     1 
ATOM   3148 C  CB    . THR B 1 45  ? 25.429  -24.435 -49.411 1.00 53.96  ? 45   THR B CB    1 
ATOM   3149 O  OG1   . THR B 1 45  ? 26.743  -24.165 -49.918 1.00 53.96  ? 45   THR B OG1   1 
ATOM   3150 C  CG2   . THR B 1 45  ? 25.516  -24.772 -47.945 1.00 53.92  ? 45   THR B CG2   1 
ATOM   3151 N  N     . CYS B 1 46  ? 23.045  -24.733 -51.591 1.00 53.96  ? 46   CYS B N     1 
ATOM   3152 C  CA    . CYS B 1 46  ? 21.675  -24.437 -51.982 1.00 53.91  ? 46   CYS B CA    1 
ATOM   3153 C  C     . CYS B 1 46  ? 20.901  -25.731 -52.132 1.00 53.96  ? 46   CYS B C     1 
ATOM   3154 O  O     . CYS B 1 46  ? 19.805  -25.872 -51.584 1.00 53.99  ? 46   CYS B O     1 
ATOM   3155 C  CB    . CYS B 1 46  ? 21.643  -23.651 -53.282 1.00 53.80  ? 46   CYS B CB    1 
ATOM   3156 S  SG    . CYS B 1 46  ? 22.554  -22.121 -53.199 1.00 54.15  ? 46   CYS B SG    1 
ATOM   3157 N  N     . GLU B 1 47  ? 21.487  -26.675 -52.865 1.00 54.02  ? 47   GLU B N     1 
ATOM   3158 C  CA    . GLU B 1 47  ? 20.926  -28.017 -53.002 1.00 54.05  ? 47   GLU B CA    1 
ATOM   3159 C  C     . GLU B 1 47  ? 20.650  -28.615 -51.614 1.00 54.11  ? 47   GLU B C     1 
ATOM   3160 O  O     . GLU B 1 47  ? 19.526  -29.042 -51.329 1.00 54.23  ? 47   GLU B O     1 
ATOM   3161 C  CB    . GLU B 1 47  ? 21.859  -28.911 -53.836 1.00 54.00  ? 47   GLU B CB    1 
ATOM   3162 C  CG    . GLU B 1 47  ? 21.992  -28.472 -55.301 1.00 53.87  ? 47   GLU B CG    1 
ATOM   3163 C  CD    . GLU B 1 47  ? 23.156  -29.124 -56.045 1.00 53.99  ? 47   GLU B CD    1 
ATOM   3164 O  OE1   . GLU B 1 47  ? 23.889  -29.942 -55.445 1.00 54.05  ? 47   GLU B OE1   1 
ATOM   3165 O  OE2   . GLU B 1 47  ? 23.337  -28.809 -57.243 1.00 53.88  ? 47   GLU B OE2   1 
ATOM   3166 N  N     . ARG B 1 48  ? 21.670  -28.599 -50.752 1.00 54.02  ? 48   ARG B N     1 
ATOM   3167 C  CA    . ARG B 1 48  ? 21.578  -29.119 -49.387 1.00 53.97  ? 48   ARG B CA    1 
ATOM   3168 C  C     . ARG B 1 48  ? 20.437  -28.474 -48.635 1.00 54.35  ? 48   ARG B C     1 
ATOM   3169 O  O     . ARG B 1 48  ? 19.559  -29.155 -48.113 1.00 54.31  ? 48   ARG B O     1 
ATOM   3170 C  CB    . ARG B 1 48  ? 22.883  -28.866 -48.632 1.00 53.74  ? 48   ARG B CB    1 
ATOM   3171 C  CG    . ARG B 1 48  ? 23.941  -29.925 -48.838 1.00 52.83  ? 48   ARG B CG    1 
ATOM   3172 C  CD    . ARG B 1 48  ? 25.325  -29.413 -48.494 1.00 50.86  ? 48   ARG B CD    1 
ATOM   3173 N  NE    . ARG B 1 48  ? 26.346  -30.411 -48.799 1.00 49.67  ? 48   ARG B NE    1 
ATOM   3174 C  CZ    . ARG B 1 48  ? 27.644  -30.149 -48.908 1.00 48.99  ? 48   ARG B CZ    1 
ATOM   3175 N  NH1   . ARG B 1 48  ? 28.100  -28.911 -48.750 1.00 48.44  ? 48   ARG B NH1   1 
ATOM   3176 N  NH2   . ARG B 1 48  ? 28.485  -31.130 -49.190 1.00 48.91  ? 48   ARG B NH2   1 
ATOM   3177 N  N     . TRP B 1 49  ? 20.465  -27.150 -48.585 1.00 54.95  ? 49   TRP B N     1 
ATOM   3178 C  CA    . TRP B 1 49  ? 19.407  -26.382 -47.982 1.00 55.69  ? 49   TRP B CA    1 
ATOM   3179 C  C     . TRP B 1 49  ? 18.057  -26.887 -48.464 1.00 56.44  ? 49   TRP B C     1 
ATOM   3180 O  O     . TRP B 1 49  ? 17.177  -27.173 -47.662 1.00 56.39  ? 49   TRP B O     1 
ATOM   3181 C  CB    . TRP B 1 49  ? 19.567  -24.907 -48.344 1.00 55.64  ? 49   TRP B CB    1 
ATOM   3182 C  CG    . TRP B 1 49  ? 20.308  -24.060 -47.338 1.00 55.77  ? 49   TRP B CG    1 
ATOM   3183 C  CD1   . TRP B 1 49  ? 21.303  -23.150 -47.598 1.00 55.54  ? 49   TRP B CD1   1 
ATOM   3184 C  CD2   . TRP B 1 49  ? 20.092  -24.022 -45.917 1.00 56.10  ? 49   TRP B CD2   1 
ATOM   3185 N  NE1   . TRP B 1 49  ? 21.718  -22.556 -46.427 1.00 55.89  ? 49   TRP B NE1   1 
ATOM   3186 C  CE2   . TRP B 1 49  ? 20.993  -23.076 -45.383 1.00 56.04  ? 49   TRP B CE2   1 
ATOM   3187 C  CE3   . TRP B 1 49  ? 19.223  -24.702 -45.040 1.00 55.79  ? 49   TRP B CE3   1 
ATOM   3188 C  CZ2   . TRP B 1 49  ? 21.052  -22.796 -44.017 1.00 55.85  ? 49   TRP B CZ2   1 
ATOM   3189 C  CZ3   . TRP B 1 49  ? 19.282  -24.425 -43.685 1.00 54.81  ? 49   TRP B CZ3   1 
ATOM   3190 C  CH2   . TRP B 1 49  ? 20.189  -23.482 -43.187 1.00 55.69  ? 49   TRP B CH2   1 
ATOM   3191 N  N     . PHE B 1 50  ? 17.915  -27.023 -49.780 1.00 57.59  ? 50   PHE B N     1 
ATOM   3192 C  CA    . PHE B 1 50  ? 16.631  -27.347 -50.401 1.00 58.73  ? 50   PHE B CA    1 
ATOM   3193 C  C     . PHE B 1 50  ? 15.969  -28.647 -49.938 1.00 59.83  ? 50   PHE B C     1 
ATOM   3194 O  O     . PHE B 1 50  ? 14.742  -28.719 -49.881 1.00 60.03  ? 50   PHE B O     1 
ATOM   3195 C  CB    . PHE B 1 50  ? 16.729  -27.272 -51.928 1.00 58.45  ? 50   PHE B CB    1 
ATOM   3196 C  CG    . PHE B 1 50  ? 16.285  -25.947 -52.499 1.00 58.27  ? 50   PHE B CG    1 
ATOM   3197 C  CD1   . PHE B 1 50  ? 16.483  -24.759 -51.793 1.00 57.79  ? 50   PHE B CD1   1 
ATOM   3198 C  CD2   . PHE B 1 50  ? 15.672  -25.881 -53.747 1.00 58.10  ? 50   PHE B CD2   1 
ATOM   3199 C  CE1   . PHE B 1 50  ? 16.069  -23.529 -52.315 1.00 57.31  ? 50   PHE B CE1   1 
ATOM   3200 C  CE2   . PHE B 1 50  ? 15.258  -24.655 -54.277 1.00 57.88  ? 50   PHE B CE2   1 
ATOM   3201 C  CZ    . PHE B 1 50  ? 15.463  -23.477 -53.559 1.00 57.39  ? 50   PHE B CZ    1 
ATOM   3202 N  N     . GLN B 1 51  ? 16.766  -29.660 -49.597 1.00 61.16  ? 51   GLN B N     1 
ATOM   3203 C  CA    . GLN B 1 51  ? 16.220  -30.912 -49.051 1.00 62.35  ? 51   GLN B CA    1 
ATOM   3204 C  C     . GLN B 1 51  ? 15.612  -30.684 -47.665 1.00 63.21  ? 51   GLN B C     1 
ATOM   3205 O  O     . GLN B 1 51  ? 14.519  -31.183 -47.383 1.00 63.30  ? 51   GLN B O     1 
ATOM   3206 C  CB    . GLN B 1 51  ? 17.281  -32.006 -48.977 1.00 62.31  ? 51   GLN B CB    1 
ATOM   3207 C  CG    . GLN B 1 51  ? 18.018  -32.281 -50.266 1.00 62.64  ? 51   GLN B CG    1 
ATOM   3208 C  CD    . GLN B 1 51  ? 19.413  -32.839 -50.016 1.00 63.54  ? 51   GLN B CD    1 
ATOM   3209 O  OE1   . GLN B 1 51  ? 19.956  -32.737 -48.908 1.00 63.00  ? 51   GLN B OE1   1 
ATOM   3210 N  NE2   . GLN B 1 51  ? 20.006  -33.428 -51.052 1.00 64.07  ? 51   GLN B NE2   1 
ATOM   3211 N  N     . ARG B 1 52  ? 16.330  -29.945 -46.809 1.00 64.35  ? 52   ARG B N     1 
ATOM   3212 C  CA    . ARG B 1 52  ? 15.783  -29.442 -45.538 1.00 65.51  ? 52   ARG B CA    1 
ATOM   3213 C  C     . ARG B 1 52  ? 14.481  -28.678 -45.822 1.00 65.99  ? 52   ARG B C     1 
ATOM   3214 O  O     . ARG B 1 52  ? 13.438  -28.939 -45.209 1.00 65.96  ? 52   ARG B O     1 
ATOM   3215 C  CB    . ARG B 1 52  ? 16.797  -28.531 -44.809 1.00 65.69  ? 52   ARG B CB    1 
ATOM   3216 C  CG    . ARG B 1 52  ? 17.512  -29.135 -43.589 1.00 66.63  ? 52   ARG B CG    1 
ATOM   3217 C  CD    . ARG B 1 52  ? 18.608  -28.190 -43.016 1.00 68.68  ? 52   ARG B CD    1 
ATOM   3218 N  NE    . ARG B 1 52  ? 19.934  -28.387 -43.638 1.00 70.05  ? 52   ARG B NE    1 
ATOM   3219 C  CZ    . ARG B 1 52  ? 21.088  -27.863 -43.200 1.00 70.19  ? 52   ARG B CZ    1 
ATOM   3220 N  NH1   . ARG B 1 52  ? 21.112  -27.089 -42.119 1.00 70.77  ? 52   ARG B NH1   1 
ATOM   3221 N  NH2   . ARG B 1 52  ? 22.232  -28.113 -43.843 1.00 69.18  ? 52   ARG B NH2   1 
ATOM   3222 N  N     . PHE B 1 53  ? 14.550  -27.764 -46.786 1.00 66.58  ? 53   PHE B N     1 
ATOM   3223 C  CA    . PHE B 1 53  ? 13.413  -26.962 -47.181 1.00 67.39  ? 53   PHE B CA    1 
ATOM   3224 C  C     . PHE B 1 53  ? 12.191  -27.756 -47.625 1.00 68.33  ? 53   PHE B C     1 
ATOM   3225 O  O     . PHE B 1 53  ? 11.071  -27.259 -47.530 1.00 68.54  ? 53   PHE B O     1 
ATOM   3226 C  CB    . PHE B 1 53  ? 13.816  -26.002 -48.287 1.00 67.19  ? 53   PHE B CB    1 
ATOM   3227 C  CG    . PHE B 1 53  ? 14.570  -24.814 -47.802 1.00 67.04  ? 53   PHE B CG    1 
ATOM   3228 C  CD1   . PHE B 1 53  ? 14.021  -23.974 -46.844 1.00 67.06  ? 53   PHE B CD1   1 
ATOM   3229 C  CD2   . PHE B 1 53  ? 15.818  -24.514 -48.318 1.00 66.85  ? 53   PHE B CD2   1 
ATOM   3230 C  CE1   . PHE B 1 53  ? 14.712  -22.868 -46.386 1.00 67.17  ? 53   PHE B CE1   1 
ATOM   3231 C  CE2   . PHE B 1 53  ? 16.519  -23.407 -47.875 1.00 66.99  ? 53   PHE B CE2   1 
ATOM   3232 C  CZ    . PHE B 1 53  ? 15.965  -22.581 -46.903 1.00 67.49  ? 53   PHE B CZ    1 
ATOM   3233 N  N     . LYS B 1 54  ? 12.391  -28.977 -48.113 1.00 69.50  ? 54   LYS B N     1 
ATOM   3234 C  CA    . LYS B 1 54  ? 11.270  -29.764 -48.633 1.00 70.54  ? 54   LYS B CA    1 
ATOM   3235 C  C     . LYS B 1 54  ? 10.398  -30.409 -47.551 1.00 71.53  ? 54   LYS B C     1 
ATOM   3236 O  O     . LYS B 1 54  ? 9.288   -30.850 -47.848 1.00 71.79  ? 54   LYS B O     1 
ATOM   3237 C  CB    . LYS B 1 54  ? 11.736  -30.786 -49.675 1.00 70.21  ? 54   LYS B CB    1 
ATOM   3238 C  CG    . LYS B 1 54  ? 12.060  -30.142 -51.007 1.00 70.03  ? 54   LYS B CG    1 
ATOM   3239 C  CD    . LYS B 1 54  ? 12.726  -31.099 -51.982 1.00 70.21  ? 54   LYS B CD    1 
ATOM   3240 C  CE    . LYS B 1 54  ? 11.720  -31.715 -52.946 1.00 70.10  ? 54   LYS B CE    1 
ATOM   3241 N  NZ    . LYS B 1 54  ? 12.385  -32.290 -54.142 1.00 69.40  ? 54   LYS B NZ    1 
ATOM   3242 N  N     . SER B 1 55  ? 10.880  -30.450 -46.305 1.00 72.67  ? 55   SER B N     1 
ATOM   3243 C  CA    . SER B 1 55  ? 10.110  -31.057 -45.210 1.00 73.82  ? 55   SER B CA    1 
ATOM   3244 C  C     . SER B 1 55  ? 10.379  -30.449 -43.822 1.00 74.74  ? 55   SER B C     1 
ATOM   3245 O  O     . SER B 1 55  ? 10.915  -31.123 -42.933 1.00 74.88  ? 55   SER B O     1 
ATOM   3246 C  CB    . SER B 1 55  ? 10.320  -32.581 -45.179 1.00 73.80  ? 55   SER B CB    1 
ATOM   3247 O  OG    . SER B 1 55  ? 9.563   -33.240 -46.181 1.00 73.57  ? 55   SER B OG    1 
ATOM   3248 N  N     . GLY B 1 56  ? 9.982   -29.189 -43.636 1.00 75.70  ? 56   GLY B N     1 
ATOM   3249 C  CA    . GLY B 1 56  ? 10.167  -28.484 -42.363 1.00 76.86  ? 56   GLY B CA    1 
ATOM   3250 C  C     . GLY B 1 56  ? 11.570  -27.918 -42.225 1.00 77.77  ? 56   GLY B C     1 
ATOM   3251 O  O     . GLY B 1 56  ? 12.384  -28.410 -41.435 1.00 77.73  ? 56   GLY B O     1 
ATOM   3252 N  N     . ASP B 1 57  ? 11.844  -26.875 -43.005 1.00 78.73  ? 57   ASP B N     1 
ATOM   3253 C  CA    . ASP B 1 57  ? 13.166  -26.228 -43.062 1.00 79.61  ? 57   ASP B CA    1 
ATOM   3254 C  C     . ASP B 1 57  ? 13.687  -25.729 -41.707 1.00 80.41  ? 57   ASP B C     1 
ATOM   3255 O  O     . ASP B 1 57  ? 14.832  -26.019 -41.332 1.00 80.26  ? 57   ASP B O     1 
ATOM   3256 C  CB    . ASP B 1 57  ? 13.145  -25.085 -44.092 1.00 79.41  ? 57   ASP B CB    1 
ATOM   3257 C  CG    . ASP B 1 57  ? 11.871  -24.234 -44.026 1.00 78.37  ? 57   ASP B CG    1 
ATOM   3258 O  OD1   . ASP B 1 57  ? 11.750  -23.411 -43.097 1.00 77.42  ? 57   ASP B OD1   1 
ATOM   3259 O  OD2   . ASP B 1 57  ? 11.005  -24.374 -44.916 1.00 76.52  ? 57   ASP B OD2   1 
ATOM   3260 N  N     . PHE B 1 58  ? 12.818  -24.976 -41.019 1.00 81.54  ? 58   PHE B N     1 
ATOM   3261 C  CA    . PHE B 1 58  ? 12.987  -24.426 -39.659 1.00 82.73  ? 58   PHE B CA    1 
ATOM   3262 C  C     . PHE B 1 58  ? 14.408  -24.419 -39.085 1.00 83.12  ? 58   PHE B C     1 
ATOM   3263 O  O     . PHE B 1 58  ? 14.645  -24.991 -38.012 1.00 83.37  ? 58   PHE B O     1 
ATOM   3264 C  CB    . PHE B 1 58  ? 12.025  -25.116 -38.654 1.00 83.06  ? 58   PHE B CB    1 
ATOM   3265 C  CG    . PHE B 1 58  ? 10.601  -24.562 -38.646 1.00 84.45  ? 58   PHE B CG    1 
ATOM   3266 C  CD1   . PHE B 1 58  ? 9.596   -25.153 -39.432 1.00 85.35  ? 58   PHE B CD1   1 
ATOM   3267 C  CD2   . PHE B 1 58  ? 10.255  -23.477 -37.820 1.00 85.33  ? 58   PHE B CD2   1 
ATOM   3268 C  CE1   . PHE B 1 58  ? 8.274   -24.655 -39.418 1.00 85.58  ? 58   PHE B CE1   1 
ATOM   3269 C  CE2   . PHE B 1 58  ? 8.934   -22.970 -37.796 1.00 85.43  ? 58   PHE B CE2   1 
ATOM   3270 C  CZ    . PHE B 1 58  ? 7.945   -23.562 -38.596 1.00 85.65  ? 58   PHE B CZ    1 
ATOM   3271 N  N     . ASP B 1 59  ? 15.346  -23.781 -39.788 1.00 83.47  ? 59   ASP B N     1 
ATOM   3272 C  CA    . ASP B 1 59  ? 16.672  -23.505 -39.220 1.00 84.00  ? 59   ASP B CA    1 
ATOM   3273 C  C     . ASP B 1 59  ? 16.520  -22.531 -38.027 1.00 84.31  ? 59   ASP B C     1 
ATOM   3274 O  O     . ASP B 1 59  ? 16.537  -21.301 -38.191 1.00 84.56  ? 59   ASP B O     1 
ATOM   3275 C  CB    . ASP B 1 59  ? 17.659  -23.018 -40.311 1.00 83.93  ? 59   ASP B CB    1 
ATOM   3276 C  CG    . ASP B 1 59  ? 18.761  -22.077 -39.777 1.00 84.33  ? 59   ASP B CG    1 
ATOM   3277 O  OD1   . ASP B 1 59  ? 19.448  -22.414 -38.782 1.00 84.75  ? 59   ASP B OD1   1 
ATOM   3278 O  OD2   . ASP B 1 59  ? 18.952  -20.991 -40.376 1.00 84.37  ? 59   ASP B OD2   1 
ATOM   3279 N  N     . VAL B 1 60  ? 16.331  -23.111 -36.835 1.00 84.45  ? 60   VAL B N     1 
ATOM   3280 C  CA    . VAL B 1 60  ? 16.207  -22.366 -35.568 1.00 84.37  ? 60   VAL B CA    1 
ATOM   3281 C  C     . VAL B 1 60  ? 17.599  -21.891 -35.147 1.00 84.26  ? 60   VAL B C     1 
ATOM   3282 O  O     . VAL B 1 60  ? 17.740  -20.915 -34.392 1.00 84.19  ? 60   VAL B O     1 
ATOM   3283 C  CB    . VAL B 1 60  ? 15.558  -23.252 -34.435 1.00 84.45  ? 60   VAL B CB    1 
ATOM   3284 C  CG1   . VAL B 1 60  ? 15.532  -22.530 -33.077 1.00 84.35  ? 60   VAL B CG1   1 
ATOM   3285 C  CG2   . VAL B 1 60  ? 14.142  -23.711 -34.831 1.00 84.47  ? 60   VAL B CG2   1 
ATOM   3286 N  N     . ASP B 1 61  ? 18.610  -22.582 -35.690 1.00 84.09  ? 61   ASP B N     1 
ATOM   3287 C  CA    . ASP B 1 61  ? 20.014  -22.497 -35.268 1.00 83.64  ? 61   ASP B CA    1 
ATOM   3288 C  C     . ASP B 1 61  ? 20.858  -23.457 -36.134 1.00 82.88  ? 61   ASP B C     1 
ATOM   3289 O  O     . ASP B 1 61  ? 20.317  -24.388 -36.749 1.00 82.50  ? 61   ASP B O     1 
ATOM   3290 C  CB    . ASP B 1 61  ? 20.120  -22.920 -33.780 1.00 83.88  ? 61   ASP B CB    1 
ATOM   3291 C  CG    . ASP B 1 61  ? 21.018  -21.999 -32.939 1.00 84.24  ? 61   ASP B CG    1 
ATOM   3292 O  OD1   . ASP B 1 61  ? 21.124  -20.780 -33.222 1.00 84.67  ? 61   ASP B OD1   1 
ATOM   3293 O  OD2   . ASP B 1 61  ? 21.602  -22.510 -31.959 1.00 84.78  ? 61   ASP B OD2   1 
ATOM   3294 N  N     . ASP B 1 62  ? 22.172  -23.216 -36.191 1.00 82.14  ? 62   ASP B N     1 
ATOM   3295 C  CA    . ASP B 1 62  ? 23.139  -24.274 -36.497 1.00 81.46  ? 62   ASP B CA    1 
ATOM   3296 C  C     . ASP B 1 62  ? 22.927  -25.337 -35.416 1.00 80.90  ? 62   ASP B C     1 
ATOM   3297 O  O     . ASP B 1 62  ? 22.951  -25.006 -34.219 1.00 81.02  ? 62   ASP B O     1 
ATOM   3298 C  CB    . ASP B 1 62  ? 24.590  -23.762 -36.379 1.00 81.55  ? 62   ASP B CB    1 
ATOM   3299 C  CG    . ASP B 1 62  ? 25.033  -22.901 -37.557 1.00 81.40  ? 62   ASP B CG    1 
ATOM   3300 O  OD1   . ASP B 1 62  ? 24.211  -22.135 -38.103 1.00 81.39  ? 62   ASP B OD1   1 
ATOM   3301 O  OD2   . ASP B 1 62  ? 26.231  -22.974 -37.916 1.00 81.00  ? 62   ASP B OD2   1 
ATOM   3302 N  N     . LYS B 1 63  ? 22.703  -26.594 -35.805 1.00 79.83  ? 63   LYS B N     1 
ATOM   3303 C  CA    . LYS B 1 63  ? 22.569  -27.657 -34.807 1.00 78.79  ? 63   LYS B CA    1 
ATOM   3304 C  C     . LYS B 1 63  ? 23.951  -27.870 -34.170 1.00 77.87  ? 63   LYS B C     1 
ATOM   3305 O  O     . LYS B 1 63  ? 24.940  -27.953 -34.905 1.00 77.96  ? 63   LYS B O     1 
ATOM   3306 C  CB    . LYS B 1 63  ? 22.028  -28.943 -35.433 1.00 78.91  ? 63   LYS B CB    1 
ATOM   3307 C  CG    . LYS B 1 63  ? 20.884  -29.539 -34.626 1.00 79.57  ? 63   LYS B CG    1 
ATOM   3308 C  CD    . LYS B 1 63  ? 21.102  -31.020 -34.310 1.00 80.30  ? 63   LYS B CD    1 
ATOM   3309 C  CE    . LYS B 1 63  ? 20.477  -31.402 -32.955 1.00 80.21  ? 63   LYS B CE    1 
ATOM   3310 N  NZ    . LYS B 1 63  ? 21.094  -30.685 -31.792 1.00 79.54  ? 63   LYS B NZ    1 
ATOM   3311 N  N     . GLU B 1 64  ? 24.018  -27.938 -32.829 1.00 76.40  ? 64   GLU B N     1 
ATOM   3312 C  CA    . GLU B 1 64  ? 25.294  -27.821 -32.073 1.00 74.98  ? 64   GLU B CA    1 
ATOM   3313 C  C     . GLU B 1 64  ? 26.486  -28.627 -32.605 1.00 73.70  ? 64   GLU B C     1 
ATOM   3314 O  O     . GLU B 1 64  ? 26.430  -29.859 -32.664 1.00 73.56  ? 64   GLU B O     1 
ATOM   3315 C  CB    . GLU B 1 64  ? 25.116  -28.127 -30.577 1.00 75.21  ? 64   GLU B CB    1 
ATOM   3316 C  CG    . GLU B 1 64  ? 26.444  -27.976 -29.792 1.00 76.11  ? 64   GLU B CG    1 
ATOM   3317 C  CD    . GLU B 1 64  ? 26.336  -28.218 -28.288 1.00 77.07  ? 64   GLU B CD    1 
ATOM   3318 O  OE1   . GLU B 1 64  ? 26.130  -29.390 -27.879 1.00 77.20  ? 64   GLU B OE1   1 
ATOM   3319 O  OE2   . GLU B 1 64  ? 26.498  -27.234 -27.520 1.00 76.89  ? 64   GLU B OE2   1 
ATOM   3320 N  N     . HIS B 1 65  ? 27.566  -27.925 -32.962 1.00 72.04  ? 65   HIS B N     1 
ATOM   3321 C  CA    . HIS B 1 65  ? 28.783  -28.589 -33.461 1.00 70.39  ? 65   HIS B CA    1 
ATOM   3322 C  C     . HIS B 1 65  ? 29.747  -29.063 -32.364 1.00 69.01  ? 65   HIS B C     1 
ATOM   3323 O  O     . HIS B 1 65  ? 29.433  -28.974 -31.176 1.00 68.65  ? 65   HIS B O     1 
ATOM   3324 C  CB    . HIS B 1 65  ? 29.495  -27.846 -34.636 1.00 70.53  ? 65   HIS B CB    1 
ATOM   3325 C  CG    . HIS B 1 65  ? 29.429  -26.343 -34.599 1.00 70.71  ? 65   HIS B CG    1 
ATOM   3326 N  ND1   . HIS B 1 65  ? 30.028  -25.564 -35.568 1.00 70.50  ? 65   HIS B ND1   1 
ATOM   3327 C  CD2   . HIS B 1 65  ? 28.854  -25.478 -33.729 1.00 71.16  ? 65   HIS B CD2   1 
ATOM   3328 C  CE1   . HIS B 1 65  ? 29.817  -24.289 -35.302 1.00 70.57  ? 65   HIS B CE1   1 
ATOM   3329 N  NE2   . HIS B 1 65  ? 29.109  -24.208 -34.190 1.00 71.09  ? 65   HIS B NE2   1 
ATOM   3330 N  N     . GLY B 1 66  ? 30.894  -29.598 -32.785 1.00 67.44  ? 66   GLY B N     1 
ATOM   3331 C  CA    . GLY B 1 66  ? 31.845  -30.246 -31.889 1.00 65.41  ? 66   GLY B CA    1 
ATOM   3332 C  C     . GLY B 1 66  ? 32.337  -29.369 -30.762 1.00 64.06  ? 66   GLY B C     1 
ATOM   3333 O  O     . GLY B 1 66  ? 32.162  -28.148 -30.787 1.00 64.13  ? 66   GLY B O     1 
ATOM   3334 N  N     . LYS B 1 67  ? 32.953  -30.005 -29.771 1.00 62.52  ? 67   LYS B N     1 
ATOM   3335 C  CA    . LYS B 1 67  ? 33.488  -29.325 -28.597 1.00 60.94  ? 67   LYS B CA    1 
ATOM   3336 C  C     . LYS B 1 67  ? 34.444  -30.277 -27.893 1.00 59.79  ? 67   LYS B C     1 
ATOM   3337 O  O     . LYS B 1 67  ? 34.299  -31.493 -28.032 1.00 59.76  ? 67   LYS B O     1 
ATOM   3338 C  CB    . LYS B 1 67  ? 32.353  -28.927 -27.646 1.00 60.95  ? 67   LYS B CB    1 
ATOM   3339 C  CG    . LYS B 1 67  ? 31.386  -30.059 -27.303 1.00 61.12  ? 67   LYS B CG    1 
ATOM   3340 C  CD    . LYS B 1 67  ? 30.197  -29.548 -26.497 1.00 61.77  ? 67   LYS B CD    1 
ATOM   3341 C  CE    . LYS B 1 67  ? 28.970  -30.457 -26.610 1.00 62.48  ? 67   LYS B CE    1 
ATOM   3342 N  NZ    . LYS B 1 67  ? 29.181  -31.836 -26.085 1.00 62.80  ? 67   LYS B NZ    1 
ATOM   3343 N  N     . PRO B 1 68  ? 35.417  -29.734 -27.127 1.00 58.51  ? 68   PRO B N     1 
ATOM   3344 C  CA    . PRO B 1 68  ? 36.281  -30.557 -26.284 1.00 57.40  ? 68   PRO B CA    1 
ATOM   3345 C  C     . PRO B 1 68  ? 35.436  -31.367 -25.333 1.00 56.44  ? 68   PRO B C     1 
ATOM   3346 O  O     . PRO B 1 68  ? 34.363  -30.924 -24.945 1.00 56.28  ? 68   PRO B O     1 
ATOM   3347 C  CB    . PRO B 1 68  ? 37.065  -29.537 -25.466 1.00 57.32  ? 68   PRO B CB    1 
ATOM   3348 C  CG    . PRO B 1 68  ? 36.980  -28.288 -26.200 1.00 57.83  ? 68   PRO B CG    1 
ATOM   3349 C  CD    . PRO B 1 68  ? 35.722  -28.302 -26.993 1.00 58.33  ? 68   PRO B CD    1 
ATOM   3350 N  N     . PRO B 1 69  ? 35.906  -32.554 -24.952 1.00 55.88  ? 69   PRO B N     1 
ATOM   3351 C  CA    . PRO B 1 69  ? 35.121  -33.278 -23.952 1.00 55.54  ? 69   PRO B CA    1 
ATOM   3352 C  C     . PRO B 1 69  ? 35.283  -32.647 -22.556 1.00 55.12  ? 69   PRO B C     1 
ATOM   3353 O  O     . PRO B 1 69  ? 36.286  -31.951 -22.292 1.00 55.23  ? 69   PRO B O     1 
ATOM   3354 C  CB    . PRO B 1 69  ? 35.720  -34.684 -23.992 1.00 55.59  ? 69   PRO B CB    1 
ATOM   3355 C  CG    . PRO B 1 69  ? 37.153  -34.479 -24.468 1.00 55.60  ? 69   PRO B CG    1 
ATOM   3356 C  CD    . PRO B 1 69  ? 37.161  -33.243 -25.316 1.00 55.80  ? 69   PRO B CD    1 
ATOM   3357 N  N     . LYS B 1 70  ? 34.307  -32.867 -21.678 1.00 54.16  ? 70   LYS B N     1 
ATOM   3358 C  CA    . LYS B 1 70  ? 34.444  -32.426 -20.293 1.00 53.23  ? 70   LYS B CA    1 
ATOM   3359 C  C     . LYS B 1 70  ? 35.514  -33.277 -19.608 1.00 52.77  ? 70   LYS B C     1 
ATOM   3360 O  O     . LYS B 1 70  ? 35.764  -34.411 -20.023 1.00 52.69  ? 70   LYS B O     1 
ATOM   3361 C  CB    . LYS B 1 70  ? 33.111  -32.523 -19.549 1.00 53.14  ? 70   LYS B CB    1 
ATOM   3362 C  CG    . LYS B 1 70  ? 32.090  -31.477 -19.946 1.00 52.65  ? 70   LYS B CG    1 
ATOM   3363 C  CD    . LYS B 1 70  ? 30.823  -31.614 -19.119 1.00 53.06  ? 70   LYS B CD    1 
ATOM   3364 C  CE    . LYS B 1 70  ? 29.863  -30.457 -19.376 1.00 53.44  ? 70   LYS B CE    1 
ATOM   3365 N  NZ    . LYS B 1 70  ? 28.946  -30.196 -18.220 1.00 53.75  ? 70   LYS B NZ    1 
ATOM   3366 N  N     . ARG B 1 71  ? 36.157  -32.730 -18.578 1.00 52.13  ? 71   ARG B N     1 
ATOM   3367 C  CA    . ARG B 1 71  ? 37.170  -33.480 -17.846 1.00 51.59  ? 71   ARG B CA    1 
ATOM   3368 C  C     . ARG B 1 71  ? 36.580  -34.137 -16.604 1.00 51.74  ? 71   ARG B C     1 
ATOM   3369 O  O     . ARG B 1 71  ? 36.789  -35.328 -16.374 1.00 52.13  ? 71   ARG B O     1 
ATOM   3370 C  CB    . ARG B 1 71  ? 38.367  -32.606 -17.522 1.00 51.15  ? 71   ARG B CB    1 
ATOM   3371 C  CG    . ARG B 1 71  ? 38.636  -31.648 -18.625 1.00 50.55  ? 71   ARG B CG    1 
ATOM   3372 C  CD    . ARG B 1 71  ? 40.089  -31.492 -18.935 1.00 50.64  ? 71   ARG B CD    1 
ATOM   3373 N  NE    . ARG B 1 71  ? 40.218  -30.580 -20.069 1.00 51.76  ? 71   ARG B NE    1 
ATOM   3374 C  CZ    . ARG B 1 71  ? 41.349  -30.007 -20.479 1.00 52.18  ? 71   ARG B CZ    1 
ATOM   3375 N  NH1   . ARG B 1 71  ? 42.499  -30.242 -19.852 1.00 52.33  ? 71   ARG B NH1   1 
ATOM   3376 N  NH2   . ARG B 1 71  ? 41.323  -29.183 -21.525 1.00 51.78  ? 71   ARG B NH2   1 
ATOM   3377 N  N     . TYR B 1 72  ? 35.819  -33.380 -15.824 1.00 51.64  ? 72   TYR B N     1 
ATOM   3378 C  CA    . TYR B 1 72  ? 35.099  -33.944 -14.682 1.00 51.47  ? 72   TYR B CA    1 
ATOM   3379 C  C     . TYR B 1 72  ? 33.608  -33.789 -14.865 1.00 51.77  ? 72   TYR B C     1 
ATOM   3380 O  O     . TYR B 1 72  ? 33.140  -32.729 -15.267 1.00 51.77  ? 72   TYR B O     1 
ATOM   3381 C  CB    . TYR B 1 72  ? 35.532  -33.277 -13.377 1.00 51.19  ? 72   TYR B CB    1 
ATOM   3382 C  CG    . TYR B 1 72  ? 35.450  -31.766 -13.373 1.00 50.17  ? 72   TYR B CG    1 
ATOM   3383 C  CD1   . TYR B 1 72  ? 34.444  -31.104 -12.681 1.00 49.11  ? 72   TYR B CD1   1 
ATOM   3384 C  CD2   . TYR B 1 72  ? 36.387  -31.003 -14.053 1.00 49.74  ? 72   TYR B CD2   1 
ATOM   3385 C  CE1   . TYR B 1 72  ? 34.373  -29.715 -12.668 1.00 48.78  ? 72   TYR B CE1   1 
ATOM   3386 C  CE2   . TYR B 1 72  ? 36.320  -29.627 -14.057 1.00 49.74  ? 72   TYR B CE2   1 
ATOM   3387 C  CZ    . TYR B 1 72  ? 35.315  -28.988 -13.363 1.00 49.39  ? 72   TYR B CZ    1 
ATOM   3388 O  OH    . TYR B 1 72  ? 35.279  -27.617 -13.379 1.00 49.76  ? 72   TYR B OH    1 
ATOM   3389 N  N     . GLU B 1 73  ? 32.856  -34.842 -14.575 1.00 52.31  ? 73   GLU B N     1 
ATOM   3390 C  CA    . GLU B 1 73  ? 31.397  -34.749 -14.627 1.00 53.20  ? 73   GLU B CA    1 
ATOM   3391 C  C     . GLU B 1 73  ? 30.957  -33.684 -13.647 1.00 52.81  ? 73   GLU B C     1 
ATOM   3392 O  O     . GLU B 1 73  ? 31.537  -33.558 -12.565 1.00 52.62  ? 73   GLU B O     1 
ATOM   3393 C  CB    . GLU B 1 73  ? 30.723  -36.064 -14.210 1.00 53.84  ? 73   GLU B CB    1 
ATOM   3394 C  CG    . GLU B 1 73  ? 30.795  -37.227 -15.207 1.00 56.09  ? 73   GLU B CG    1 
ATOM   3395 C  CD    . GLU B 1 73  ? 30.818  -38.604 -14.505 1.00 58.92  ? 73   GLU B CD    1 
ATOM   3396 O  OE1   . GLU B 1 73  ? 31.305  -38.707 -13.344 1.00 59.53  ? 73   GLU B OE1   1 
ATOM   3397 O  OE2   . GLU B 1 73  ? 30.360  -39.590 -15.125 1.00 60.09  ? 73   GLU B OE2   1 
ATOM   3398 N  N     . ASP B 1 74  ? 29.932  -32.924 -14.012 1.00 52.44  ? 74   ASP B N     1 
ATOM   3399 C  CA    . ASP B 1 74  ? 29.328  -32.039 -13.046 1.00 52.14  ? 74   ASP B CA    1 
ATOM   3400 C  C     . ASP B 1 74  ? 29.149  -32.809 -11.746 1.00 51.74  ? 74   ASP B C     1 
ATOM   3401 O  O     . ASP B 1 74  ? 29.756  -32.480 -10.734 1.00 51.54  ? 74   ASP B O     1 
ATOM   3402 C  CB    . ASP B 1 74  ? 28.000  -31.508 -13.569 1.00 52.37  ? 74   ASP B CB    1 
ATOM   3403 C  CG    . ASP B 1 74  ? 28.115  -30.098 -14.126 1.00 53.02  ? 74   ASP B CG    1 
ATOM   3404 O  OD1   . ASP B 1 74  ? 29.245  -29.665 -14.452 1.00 53.70  ? 74   ASP B OD1   1 
ATOM   3405 O  OD2   . ASP B 1 74  ? 27.071  -29.416 -14.227 1.00 53.05  ? 74   ASP B OD2   1 
ATOM   3406 N  N     . ALA B 1 75  ? 28.376  -33.886 -11.814 1.00 51.62  ? 75   ALA B N     1 
ATOM   3407 C  CA    . ALA B 1 75  ? 28.033  -34.727 -10.653 1.00 51.32  ? 75   ALA B CA    1 
ATOM   3408 C  C     . ALA B 1 75  ? 29.221  -35.341 -9.878  1.00 50.74  ? 75   ALA B C     1 
ATOM   3409 O  O     . ALA B 1 75  ? 29.031  -35.972 -8.830  1.00 50.40  ? 75   ALA B O     1 
ATOM   3410 C  CB    . ALA B 1 75  ? 27.037  -35.835 -11.085 1.00 51.66  ? 75   ALA B CB    1 
ATOM   3411 N  N     . GLU B 1 76  ? 30.431  -35.144 -10.393 1.00 50.05  ? 76   GLU B N     1 
ATOM   3412 C  CA    . GLU B 1 76  ? 31.643  -35.676 -9.773  1.00 49.53  ? 76   GLU B CA    1 
ATOM   3413 C  C     . GLU B 1 76  ? 32.342  -34.619 -8.906  1.00 48.64  ? 76   GLU B C     1 
ATOM   3414 O  O     . GLU B 1 76  ? 33.036  -34.954 -7.934  1.00 48.52  ? 76   GLU B O     1 
ATOM   3415 C  CB    . GLU B 1 76  ? 32.564  -36.226 -10.865 1.00 49.84  ? 76   GLU B CB    1 
ATOM   3416 C  CG    . GLU B 1 76  ? 34.047  -36.347 -10.516 1.00 51.51  ? 76   GLU B CG    1 
ATOM   3417 C  CD    . GLU B 1 76  ? 34.909  -36.762 -11.722 1.00 54.06  ? 76   GLU B CD    1 
ATOM   3418 O  OE1   . GLU B 1 76  ? 36.109  -37.083 -11.508 1.00 54.71  ? 76   GLU B OE1   1 
ATOM   3419 O  OE2   . GLU B 1 76  ? 34.391  -36.768 -12.877 1.00 54.30  ? 76   GLU B OE2   1 
ATOM   3420 N  N     . LEU B 1 77  ? 32.153  -33.348 -9.274  1.00 47.48  ? 77   LEU B N     1 
ATOM   3421 C  CA    . LEU B 1 77  ? 32.604  -32.215 -8.477  1.00 46.14  ? 77   LEU B CA    1 
ATOM   3422 C  C     . LEU B 1 77  ? 31.607  -32.088 -7.372  1.00 45.95  ? 77   LEU B C     1 
ATOM   3423 O  O     . LEU B 1 77  ? 31.919  -31.565 -6.314  1.00 45.92  ? 77   LEU B O     1 
ATOM   3424 C  CB    . LEU B 1 77  ? 32.658  -30.937 -9.326  1.00 45.92  ? 77   LEU B CB    1 
ATOM   3425 C  CG    . LEU B 1 77  ? 32.735  -29.440 -8.945  1.00 44.23  ? 77   LEU B CG    1 
ATOM   3426 C  CD1   . LEU B 1 77  ? 31.376  -28.876 -8.817  1.00 44.19  ? 77   LEU B CD1   1 
ATOM   3427 C  CD2   . LEU B 1 77  ? 33.522  -29.087 -7.720  1.00 42.78  ? 77   LEU B CD2   1 
ATOM   3428 N  N     . GLN B 1 78  ? 30.402  -32.593 -7.612  1.00 45.71  ? 78   GLN B N     1 
ATOM   3429 C  CA    . GLN B 1 78  ? 29.386  -32.568 -6.585  1.00 45.70  ? 78   GLN B CA    1 
ATOM   3430 C  C     . GLN B 1 78  ? 29.799  -33.470 -5.444  1.00 45.58  ? 78   GLN B C     1 
ATOM   3431 O  O     . GLN B 1 78  ? 29.850  -33.008 -4.306  1.00 45.71  ? 78   GLN B O     1 
ATOM   3432 C  CB    . GLN B 1 78  ? 28.015  -32.970 -7.112  1.00 45.82  ? 78   GLN B CB    1 
ATOM   3433 C  CG    . GLN B 1 78  ? 26.893  -31.990 -6.729  1.00 46.74  ? 78   GLN B CG    1 
ATOM   3434 C  CD    . GLN B 1 78  ? 26.576  -31.919 -5.230  1.00 48.12  ? 78   GLN B CD    1 
ATOM   3435 O  OE1   . GLN B 1 78  ? 25.690  -31.172 -4.820  1.00 49.36  ? 78   GLN B OE1   1 
ATOM   3436 N  NE2   . GLN B 1 78  ? 27.281  -32.693 -4.418  1.00 48.09  ? 78   GLN B NE2   1 
ATOM   3437 N  N     . ALA B 1 79  ? 30.122  -34.732 -5.750  1.00 45.38  ? 79   ALA B N     1 
ATOM   3438 C  CA    . ALA B 1 79  ? 30.491  -35.730 -4.721  1.00 45.25  ? 79   ALA B CA    1 
ATOM   3439 C  C     . ALA B 1 79  ? 31.610  -35.270 -3.796  1.00 45.13  ? 79   ALA B C     1 
ATOM   3440 O  O     . ALA B 1 79  ? 31.717  -35.759 -2.658  1.00 45.22  ? 79   ALA B O     1 
ATOM   3441 C  CB    . ALA B 1 79  ? 30.859  -37.077 -5.343  1.00 45.40  ? 79   ALA B CB    1 
ATOM   3442 N  N     . LEU B 1 80  ? 32.434  -34.342 -4.295  1.00 44.64  ? 80   LEU B N     1 
ATOM   3443 C  CA    . LEU B 1 80  ? 33.465  -33.689 -3.497  1.00 43.98  ? 80   LEU B CA    1 
ATOM   3444 C  C     . LEU B 1 80  ? 32.881  -32.808 -2.410  1.00 43.99  ? 80   LEU B C     1 
ATOM   3445 O  O     . LEU B 1 80  ? 33.408  -32.772 -1.301  1.00 43.98  ? 80   LEU B O     1 
ATOM   3446 C  CB    . LEU B 1 80  ? 34.386  -32.863 -4.381  1.00 43.65  ? 80   LEU B CB    1 
ATOM   3447 C  CG    . LEU B 1 80  ? 35.745  -33.473 -4.696  1.00 42.88  ? 80   LEU B CG    1 
ATOM   3448 C  CD1   . LEU B 1 80  ? 35.612  -34.714 -5.571  1.00 42.04  ? 80   LEU B CD1   1 
ATOM   3449 C  CD2   . LEU B 1 80  ? 36.617  -32.407 -5.347  1.00 41.47  ? 80   LEU B CD2   1 
ATOM   3450 N  N     . LEU B 1 81  ? 31.791  -32.111 -2.729  1.00 44.12  ? 81   LEU B N     1 
ATOM   3451 C  CA    . LEU B 1 81  ? 31.146  -31.193 -1.789  1.00 44.39  ? 81   LEU B CA    1 
ATOM   3452 C  C     . LEU B 1 81  ? 30.344  -31.913 -0.718  1.00 45.08  ? 81   LEU B C     1 
ATOM   3453 O  O     . LEU B 1 81  ? 30.289  -31.475 0.431   1.00 45.04  ? 81   LEU B O     1 
ATOM   3454 C  CB    . LEU B 1 81  ? 30.252  -30.213 -2.531  1.00 44.03  ? 81   LEU B CB    1 
ATOM   3455 C  CG    . LEU B 1 81  ? 30.896  -29.280 -3.552  1.00 43.07  ? 81   LEU B CG    1 
ATOM   3456 C  CD1   . LEU B 1 81  ? 29.946  -28.162 -3.791  1.00 42.71  ? 81   LEU B CD1   1 
ATOM   3457 C  CD2   . LEU B 1 81  ? 32.201  -28.720 -3.067  1.00 42.08  ? 81   LEU B CD2   1 
ATOM   3458 N  N     . ASP B 1 82  ? 29.720  -33.022 -1.105  1.00 46.07  ? 82   ASP B N     1 
ATOM   3459 C  CA    . ASP B 1 82  ? 29.068  -33.916 -0.156  1.00 47.00  ? 82   ASP B CA    1 
ATOM   3460 C  C     . ASP B 1 82  ? 30.044  -34.367 0.916   1.00 47.31  ? 82   ASP B C     1 
ATOM   3461 O  O     . ASP B 1 82  ? 29.629  -34.612 2.044   1.00 47.63  ? 82   ASP B O     1 
ATOM   3462 C  CB    . ASP B 1 82  ? 28.490  -35.140 -0.866  1.00 47.29  ? 82   ASP B CB    1 
ATOM   3463 C  CG    . ASP B 1 82  ? 27.419  -34.781 -1.907  1.00 48.69  ? 82   ASP B CG    1 
ATOM   3464 O  OD1   . ASP B 1 82  ? 27.029  -33.584 -2.018  1.00 48.61  ? 82   ASP B OD1   1 
ATOM   3465 O  OD2   . ASP B 1 82  ? 26.967  -35.720 -2.616  1.00 50.22  ? 82   ASP B OD2   1 
ATOM   3466 N  N     . GLU B 1 83  ? 31.327  -34.482 0.561   1.00 47.62  ? 83   GLU B N     1 
ATOM   3467 C  CA    . GLU B 1 83  ? 32.386  -34.766 1.532   1.00 48.13  ? 83   GLU B CA    1 
ATOM   3468 C  C     . GLU B 1 83  ? 32.745  -33.519 2.334   1.00 48.19  ? 83   GLU B C     1 
ATOM   3469 O  O     . GLU B 1 83  ? 32.646  -33.505 3.558   1.00 48.12  ? 83   GLU B O     1 
ATOM   3470 C  CB    . GLU B 1 83  ? 33.653  -35.258 0.846   1.00 48.41  ? 83   GLU B CB    1 
ATOM   3471 C  CG    . GLU B 1 83  ? 33.508  -36.412 -0.128  1.00 50.00  ? 83   GLU B CG    1 
ATOM   3472 C  CD    . GLU B 1 83  ? 34.875  -36.944 -0.582  1.00 51.82  ? 83   GLU B CD    1 
ATOM   3473 O  OE1   . GLU B 1 83  ? 35.070  -37.209 -1.800  1.00 51.67  ? 83   GLU B OE1   1 
ATOM   3474 O  OE2   . GLU B 1 83  ? 35.760  -37.083 0.298   1.00 52.62  ? 83   GLU B OE2   1 
ATOM   3475 N  N     . ASP B 1 84  ? 33.201  -32.481 1.646   1.00 48.52  ? 84   ASP B N     1 
ATOM   3476 C  CA    . ASP B 1 84  ? 33.442  -31.211 2.315   1.00 48.93  ? 84   ASP B CA    1 
ATOM   3477 C  C     . ASP B 1 84  ? 32.785  -30.017 1.637   1.00 48.76  ? 84   ASP B C     1 
ATOM   3478 O  O     . ASP B 1 84  ? 33.280  -29.449 0.662   1.00 48.41  ? 84   ASP B O     1 
ATOM   3479 C  CB    . ASP B 1 84  ? 34.922  -30.961 2.592   1.00 49.32  ? 84   ASP B CB    1 
ATOM   3480 C  CG    . ASP B 1 84  ? 35.143  -29.891 3.666   1.00 50.64  ? 84   ASP B CG    1 
ATOM   3481 O  OD1   . ASP B 1 84  ? 34.357  -28.909 3.740   1.00 51.28  ? 84   ASP B OD1   1 
ATOM   3482 O  OD2   . ASP B 1 84  ? 36.113  -30.040 4.446   1.00 51.88  ? 84   ASP B OD2   1 
ATOM   3483 N  N     . ASP B 1 85  ? 31.636  -29.688 2.211   1.00 48.85  ? 85   ASP B N     1 
ATOM   3484 C  CA    . ASP B 1 85  ? 30.835  -28.492 1.988   1.00 48.73  ? 85   ASP B CA    1 
ATOM   3485 C  C     . ASP B 1 85  ? 31.637  -27.212 1.750   1.00 47.80  ? 85   ASP B C     1 
ATOM   3486 O  O     . ASP B 1 85  ? 31.282  -26.381 0.917   1.00 47.30  ? 85   ASP B O     1 
ATOM   3487 C  CB    . ASP B 1 85  ? 29.998  -28.319 3.261   1.00 49.35  ? 85   ASP B CB    1 
ATOM   3488 C  CG    . ASP B 1 85  ? 28.695  -27.601 3.026   1.00 51.79  ? 85   ASP B CG    1 
ATOM   3489 O  OD1   . ASP B 1 85  ? 28.095  -27.776 1.930   1.00 54.74  ? 85   ASP B OD1   1 
ATOM   3490 O  OD2   . ASP B 1 85  ? 28.258  -26.879 3.966   1.00 54.02  ? 85   ASP B OD2   1 
ATOM   3491 N  N     . ALA B 1 86  ? 32.722  -27.074 2.501   1.00 47.08  ? 86   ALA B N     1 
ATOM   3492 C  CA    . ALA B 1 86  ? 33.442  -25.825 2.605   1.00 46.30  ? 86   ALA B CA    1 
ATOM   3493 C  C     . ALA B 1 86  ? 34.905  -26.005 2.245   1.00 45.87  ? 86   ALA B C     1 
ATOM   3494 O  O     . ALA B 1 86  ? 35.779  -25.957 3.115   1.00 45.93  ? 86   ALA B O     1 
ATOM   3495 C  CB    . ALA B 1 86  ? 33.307  -25.279 4.008   1.00 46.21  ? 86   ALA B CB    1 
ATOM   3496 N  N     . GLN B 1 87  ? 35.168  -26.227 0.962   1.00 45.15  ? 87   GLN B N     1 
ATOM   3497 C  CA    . GLN B 1 87  ? 36.534  -26.239 0.462   1.00 44.49  ? 87   GLN B CA    1 
ATOM   3498 C  C     . GLN B 1 87  ? 36.748  -24.996 -0.362  1.00 44.42  ? 87   GLN B C     1 
ATOM   3499 O  O     . GLN B 1 87  ? 35.809  -24.246 -0.618  1.00 44.63  ? 87   GLN B O     1 
ATOM   3500 C  CB    . GLN B 1 87  ? 36.804  -27.485 -0.365  1.00 44.22  ? 87   GLN B CB    1 
ATOM   3501 C  CG    . GLN B 1 87  ? 36.752  -28.736 0.466   1.00 43.64  ? 87   GLN B CG    1 
ATOM   3502 C  CD    . GLN B 1 87  ? 36.966  -29.980 -0.342  1.00 42.79  ? 87   GLN B CD    1 
ATOM   3503 O  OE1   . GLN B 1 87  ? 38.066  -30.237 -0.823  1.00 42.77  ? 87   GLN B OE1   1 
ATOM   3504 N  NE2   . GLN B 1 87  ? 35.919  -30.776 -0.484  1.00 42.44  ? 87   GLN B NE2   1 
ATOM   3505 N  N     . THR B 1 88  ? 37.988  -24.766 -0.757  1.00 44.01  ? 88   THR B N     1 
ATOM   3506 C  CA    . THR B 1 88  ? 38.319  -23.630 -1.591  1.00 43.81  ? 88   THR B CA    1 
ATOM   3507 C  C     . THR B 1 88  ? 38.532  -24.123 -2.997  1.00 43.63  ? 88   THR B C     1 
ATOM   3508 O  O     . THR B 1 88  ? 38.946  -25.260 -3.191  1.00 43.92  ? 88   THR B O     1 
ATOM   3509 C  CB    . THR B 1 88  ? 39.596  -23.051 -1.130  1.00 43.92  ? 88   THR B CB    1 
ATOM   3510 O  OG1   . THR B 1 88  ? 40.527  -24.126 -0.901  1.00 43.97  ? 88   THR B OG1   1 
ATOM   3511 C  CG2   . THR B 1 88  ? 39.347  -22.302 0.163   1.00 45.13  ? 88   THR B CG2   1 
ATOM   3512 N  N     . GLN B 1 89  ? 38.267  -23.287 -3.988  1.00 43.19  ? 89   GLN B N     1 
ATOM   3513 C  CA    . GLN B 1 89  ? 38.326  -23.775 -5.351  1.00 42.84  ? 89   GLN B CA    1 
ATOM   3514 C  C     . GLN B 1 89  ? 39.682  -24.402 -5.634  1.00 43.06  ? 89   GLN B C     1 
ATOM   3515 O  O     . GLN B 1 89  ? 39.756  -25.521 -6.147  1.00 43.24  ? 89   GLN B O     1 
ATOM   3516 C  CB    . GLN B 1 89  ? 38.007  -22.675 -6.341  1.00 42.60  ? 89   GLN B CB    1 
ATOM   3517 C  CG    . GLN B 1 89  ? 36.548  -22.324 -6.376  1.00 41.68  ? 89   GLN B CG    1 
ATOM   3518 C  CD    . GLN B 1 89  ? 36.301  -20.992 -7.031  1.00 41.16  ? 89   GLN B CD    1 
ATOM   3519 O  OE1   . GLN B 1 89  ? 37.113  -20.522 -7.818  1.00 41.23  ? 89   GLN B OE1   1 
ATOM   3520 N  NE2   . GLN B 1 89  ? 35.178  -20.369 -6.708  1.00 40.86  ? 89   GLN B NE2   1 
ATOM   3521 N  N     . LYS B 1 90  ? 40.748  -23.701 -5.253  1.00 43.05  ? 90   LYS B N     1 
ATOM   3522 C  CA    . LYS B 1 90  ? 42.118  -24.191 -5.459  1.00 43.19  ? 90   LYS B CA    1 
ATOM   3523 C  C     . LYS B 1 90  ? 42.207  -25.658 -5.037  1.00 42.64  ? 90   LYS B C     1 
ATOM   3524 O  O     . LYS B 1 90  ? 42.838  -26.478 -5.685  1.00 42.34  ? 90   LYS B O     1 
ATOM   3525 C  CB    . LYS B 1 90  ? 43.122  -23.319 -4.657  1.00 43.75  ? 90   LYS B CB    1 
ATOM   3526 C  CG    . LYS B 1 90  ? 44.466  -22.899 -5.367  1.00 44.35  ? 90   LYS B CG    1 
ATOM   3527 C  CD    . LYS B 1 90  ? 45.568  -23.995 -5.351  1.00 45.66  ? 90   LYS B CD    1 
ATOM   3528 C  CE    . LYS B 1 90  ? 46.020  -24.414 -3.929  1.00 45.93  ? 90   LYS B CE    1 
ATOM   3529 N  NZ    . LYS B 1 90  ? 47.049  -23.520 -3.307  1.00 45.95  ? 90   LYS B NZ    1 
ATOM   3530 N  N     . GLN B 1 91  ? 41.511  -25.969 -3.960  1.00 42.55  ? 91   GLN B N     1 
ATOM   3531 C  CA    . GLN B 1 91  ? 41.623  -27.236 -3.270  1.00 42.76  ? 91   GLN B CA    1 
ATOM   3532 C  C     . GLN B 1 91  ? 40.865  -28.346 -3.973  1.00 42.61  ? 91   GLN B C     1 
ATOM   3533 O  O     . GLN B 1 91  ? 41.283  -29.498 -3.949  1.00 42.59  ? 91   GLN B O     1 
ATOM   3534 C  CB    . GLN B 1 91  ? 41.056  -27.046 -1.873  1.00 42.99  ? 91   GLN B CB    1 
ATOM   3535 C  CG    . GLN B 1 91  ? 41.449  -28.067 -0.856  1.00 43.58  ? 91   GLN B CG    1 
ATOM   3536 C  CD    . GLN B 1 91  ? 40.999  -27.644 0.513   1.00 43.87  ? 91   GLN B CD    1 
ATOM   3537 O  OE1   . GLN B 1 91  ? 41.409  -26.595 1.020   1.00 43.68  ? 91   GLN B OE1   1 
ATOM   3538 N  NE2   . GLN B 1 91  ? 40.136  -28.449 1.119   1.00 44.43  ? 91   GLN B NE2   1 
ATOM   3539 N  N     . LEU B 1 92  ? 39.731  -27.988 -4.568  1.00 42.71  ? 92   LEU B N     1 
ATOM   3540 C  CA    . LEU B 1 92  ? 38.906  -28.919 -5.336  1.00 42.65  ? 92   LEU B CA    1 
ATOM   3541 C  C     . LEU B 1 92  ? 39.633  -29.170 -6.631  1.00 42.66  ? 92   LEU B C     1 
ATOM   3542 O  O     . LEU B 1 92  ? 39.986  -30.311 -6.958  1.00 42.82  ? 92   LEU B O     1 
ATOM   3543 C  CB    . LEU B 1 92  ? 37.542  -28.298 -5.644  1.00 42.50  ? 92   LEU B CB    1 
ATOM   3544 C  CG    . LEU B 1 92  ? 36.713  -27.828 -4.457  1.00 42.07  ? 92   LEU B CG    1 
ATOM   3545 C  CD1   . LEU B 1 92  ? 35.944  -26.615 -4.871  1.00 41.56  ? 92   LEU B CD1   1 
ATOM   3546 C  CD2   . LEU B 1 92  ? 35.797  -28.931 -3.938  1.00 41.43  ? 92   LEU B CD2   1 
ATOM   3547 N  N     . ALA B 1 93  ? 39.858  -28.079 -7.355  1.00 42.44  ? 93   ALA B N     1 
ATOM   3548 C  CA    . ALA B 1 93  ? 40.688  -28.083 -8.541  1.00 42.40  ? 93   ALA B CA    1 
ATOM   3549 C  C     . ALA B 1 93  ? 41.763  -29.184 -8.498  1.00 42.24  ? 93   ALA B C     1 
ATOM   3550 O  O     . ALA B 1 93  ? 41.876  -29.999 -9.419  1.00 42.19  ? 93   ALA B O     1 
ATOM   3551 C  CB    . ALA B 1 93  ? 41.316  -26.718 -8.710  1.00 42.40  ? 93   ALA B CB    1 
ATOM   3552 N  N     . GLU B 1 94  ? 42.523  -29.213 -7.409  1.00 41.93  ? 94   GLU B N     1 
ATOM   3553 C  CA    . GLU B 1 94  ? 43.602  -30.160 -7.253  1.00 41.86  ? 94   GLU B CA    1 
ATOM   3554 C  C     . GLU B 1 94  ? 43.137  -31.605 -7.391  1.00 41.57  ? 94   GLU B C     1 
ATOM   3555 O  O     . GLU B 1 94  ? 43.686  -32.353 -8.209  1.00 41.67  ? 94   GLU B O     1 
ATOM   3556 C  CB    . GLU B 1 94  ? 44.327  -29.921 -5.931  1.00 42.10  ? 94   GLU B CB    1 
ATOM   3557 C  CG    . GLU B 1 94  ? 45.207  -28.675 -5.979  1.00 43.62  ? 94   GLU B CG    1 
ATOM   3558 C  CD    . GLU B 1 94  ? 46.217  -28.578 -4.839  1.00 46.18  ? 94   GLU B CD    1 
ATOM   3559 O  OE1   . GLU B 1 94  ? 46.385  -29.557 -4.054  1.00 46.17  ? 94   GLU B OE1   1 
ATOM   3560 O  OE2   . GLU B 1 94  ? 46.852  -27.498 -4.744  1.00 47.42  ? 94   GLU B OE2   1 
ATOM   3561 N  N     . GLN B 1 95  ? 42.120  -31.989 -6.621  1.00 40.98  ? 95   GLN B N     1 
ATOM   3562 C  CA    . GLN B 1 95  ? 41.581  -33.348 -6.690  1.00 40.57  ? 95   GLN B CA    1 
ATOM   3563 C  C     . GLN B 1 95  ? 40.880  -33.615 -8.021  1.00 40.21  ? 95   GLN B C     1 
ATOM   3564 O  O     . GLN B 1 95  ? 40.817  -34.750 -8.501  1.00 40.01  ? 95   GLN B O     1 
ATOM   3565 C  CB    . GLN B 1 95  ? 40.594  -33.598 -5.562  1.00 40.65  ? 95   GLN B CB    1 
ATOM   3566 C  CG    . GLN B 1 95  ? 40.886  -32.886 -4.268  1.00 40.76  ? 95   GLN B CG    1 
ATOM   3567 C  CD    . GLN B 1 95  ? 39.666  -32.864 -3.357  1.00 41.52  ? 95   GLN B CD    1 
ATOM   3568 O  OE1   . GLN B 1 95  ? 39.044  -33.903 -3.100  1.00 41.45  ? 95   GLN B OE1   1 
ATOM   3569 N  NE2   . GLN B 1 95  ? 39.311  -31.674 -2.873  1.00 41.74  ? 95   GLN B NE2   1 
ATOM   3570 N  N     . LEU B 1 96  ? 40.337  -32.555 -8.604  1.00 39.96  ? 96   LEU B N     1 
ATOM   3571 C  CA    . LEU B 1 96  ? 39.699  -32.640 -9.907  1.00 39.73  ? 96   LEU B CA    1 
ATOM   3572 C  C     . LEU B 1 96  ? 40.707  -32.726 -11.058 1.00 39.94  ? 96   LEU B C     1 
ATOM   3573 O  O     . LEU B 1 96  ? 40.360  -33.115 -12.174 1.00 39.81  ? 96   LEU B O     1 
ATOM   3574 C  CB    . LEU B 1 96  ? 38.743  -31.471 -10.089 1.00 39.18  ? 96   LEU B CB    1 
ATOM   3575 C  CG    . LEU B 1 96  ? 37.266  -31.862 -10.080 1.00 38.43  ? 96   LEU B CG    1 
ATOM   3576 C  CD1   . LEU B 1 96  ? 36.888  -32.820 -8.974  1.00 37.82  ? 96   LEU B CD1   1 
ATOM   3577 C  CD2   . LEU B 1 96  ? 36.444  -30.635 -9.984  1.00 38.53  ? 96   LEU B CD2   1 
ATOM   3578 N  N     . GLU B 1 97  ? 41.958  -32.377 -10.758 1.00 40.22  ? 97   GLU B N     1 
ATOM   3579 C  CA    . GLU B 1 97  ? 43.061  -32.393 -11.721 1.00 40.18  ? 97   GLU B CA    1 
ATOM   3580 C  C     . GLU B 1 97  ? 42.781  -31.362 -12.789 1.00 39.66  ? 97   GLU B C     1 
ATOM   3581 O  O     . GLU B 1 97  ? 42.612  -31.695 -13.962 1.00 39.81  ? 97   GLU B O     1 
ATOM   3582 C  CB    . GLU B 1 97  ? 43.244  -33.787 -12.338 1.00 40.57  ? 97   GLU B CB    1 
ATOM   3583 C  CG    . GLU B 1 97  ? 43.645  -34.883 -11.341 1.00 41.93  ? 97   GLU B CG    1 
ATOM   3584 C  CD    . GLU B 1 97  ? 44.609  -35.885 -11.949 1.00 42.98  ? 97   GLU B CD    1 
ATOM   3585 O  OE1   . GLU B 1 97  ? 44.388  -36.247 -13.128 1.00 44.32  ? 97   GLU B OE1   1 
ATOM   3586 O  OE2   . GLU B 1 97  ? 45.580  -36.297 -11.260 1.00 42.37  ? 97   GLU B OE2   1 
ATOM   3587 N  N     . VAL B 1 98  ? 42.720  -30.104 -12.365 1.00 39.09  ? 98   VAL B N     1 
ATOM   3588 C  CA    . VAL B 1 98  ? 42.160  -29.047 -13.193 1.00 38.33  ? 98   VAL B CA    1 
ATOM   3589 C  C     . VAL B 1 98  ? 42.290  -27.696 -12.488 1.00 38.03  ? 98   VAL B C     1 
ATOM   3590 O  O     . VAL B 1 98  ? 42.509  -27.632 -11.287 1.00 37.87  ? 98   VAL B O     1 
ATOM   3591 C  CB    . VAL B 1 98  ? 40.690  -29.372 -13.554 1.00 38.19  ? 98   VAL B CB    1 
ATOM   3592 C  CG1   . VAL B 1 98  ? 39.769  -29.011 -12.425 1.00 38.15  ? 98   VAL B CG1   1 
ATOM   3593 C  CG2   . VAL B 1 98  ? 40.282  -28.698 -14.839 1.00 37.91  ? 98   VAL B CG2   1 
ATOM   3594 N  N     . SER B 1 99  ? 42.163  -26.618 -13.247 1.00 37.83  ? 99   SER B N     1 
ATOM   3595 C  CA    . SER B 1 99  ? 42.478  -25.290 -12.748 1.00 37.51  ? 99   SER B CA    1 
ATOM   3596 C  C     . SER B 1 99  ? 41.442  -24.729 -11.809 1.00 36.91  ? 99   SER B C     1 
ATOM   3597 O  O     . SER B 1 99  ? 40.260  -24.994 -11.949 1.00 36.85  ? 99   SER B O     1 
ATOM   3598 C  CB    . SER B 1 99  ? 42.615  -24.328 -13.909 1.00 37.69  ? 99   SER B CB    1 
ATOM   3599 O  OG    . SER B 1 99  ? 43.398  -23.230 -13.501 1.00 39.41  ? 99   SER B OG    1 
ATOM   3600 N  N     . GLN B 1 100 ? 41.897  -23.924 -10.861 1.00 36.54  ? 100  GLN B N     1 
ATOM   3601 C  CA    . GLN B 1 100 ? 40.998  -23.220 -9.967  1.00 35.83  ? 100  GLN B CA    1 
ATOM   3602 C  C     . GLN B 1 100 ? 40.007  -22.496 -10.823 1.00 35.76  ? 100  GLN B C     1 
ATOM   3603 O  O     . GLN B 1 100 ? 38.825  -22.816 -10.783 1.00 36.18  ? 100  GLN B O     1 
ATOM   3604 C  CB    . GLN B 1 100 ? 41.747  -22.231 -9.084  1.00 35.69  ? 100  GLN B CB    1 
ATOM   3605 C  CG    . GLN B 1 100 ? 40.837  -21.335 -8.249  1.00 35.05  ? 100  GLN B CG    1 
ATOM   3606 C  CD    . GLN B 1 100 ? 40.523  -19.999 -8.905  1.00 33.64  ? 100  GLN B CD    1 
ATOM   3607 O  OE1   . GLN B 1 100 ? 39.373  -19.586 -8.959  1.00 32.48  ? 100  GLN B OE1   1 
ATOM   3608 N  NE2   . GLN B 1 100 ? 41.547  -19.320 -9.401  1.00 33.72  ? 100  GLN B NE2   1 
ATOM   3609 N  N     . GLN B 1 101 ? 40.487  -21.543 -11.618 1.00 35.42  ? 101  GLN B N     1 
ATOM   3610 C  CA    . GLN B 1 101 ? 39.605  -20.773 -12.488 1.00 35.36  ? 101  GLN B CA    1 
ATOM   3611 C  C     . GLN B 1 101 ? 38.622  -21.681 -13.235 1.00 35.32  ? 101  GLN B C     1 
ATOM   3612 O  O     . GLN B 1 101 ? 37.458  -21.313 -13.432 1.00 35.31  ? 101  GLN B O     1 
ATOM   3613 C  CB    . GLN B 1 101 ? 40.391  -19.887 -13.450 1.00 35.29  ? 101  GLN B CB    1 
ATOM   3614 C  CG    . GLN B 1 101 ? 41.804  -20.332 -13.706 1.00 35.90  ? 101  GLN B CG    1 
ATOM   3615 C  CD    . GLN B 1 101 ? 42.811  -19.634 -12.811 1.00 37.34  ? 101  GLN B CD    1 
ATOM   3616 O  OE1   . GLN B 1 101 ? 43.037  -18.431 -12.932 1.00 38.51  ? 101  GLN B OE1   1 
ATOM   3617 N  NE2   . GLN B 1 101 ? 43.431  -20.389 -11.915 1.00 37.67  ? 101  GLN B NE2   1 
ATOM   3618 N  N     . ALA B 1 102 ? 39.085  -22.875 -13.612 1.00 35.17  ? 102  ALA B N     1 
ATOM   3619 C  CA    . ALA B 1 102 ? 38.213  -23.890 -14.191 1.00 35.00  ? 102  ALA B CA    1 
ATOM   3620 C  C     . ALA B 1 102 ? 37.030  -24.186 -13.263 1.00 35.04  ? 102  ALA B C     1 
ATOM   3621 O  O     . ALA B 1 102 ? 35.879  -23.891 -13.598 1.00 35.17  ? 102  ALA B O     1 
ATOM   3622 C  CB    . ALA B 1 102 ? 38.999  -25.140 -14.475 1.00 34.93  ? 102  ALA B CB    1 
ATOM   3623 N  N     . VAL B 1 103 ? 37.330  -24.733 -12.084 1.00 34.99  ? 103  VAL B N     1 
ATOM   3624 C  CA    . VAL B 1 103 ? 36.323  -25.023 -11.068 1.00 34.65  ? 103  VAL B CA    1 
ATOM   3625 C  C     . VAL B 1 103 ? 35.443  -23.834 -10.788 1.00 34.96  ? 103  VAL B C     1 
ATOM   3626 O  O     . VAL B 1 103 ? 34.254  -24.010 -10.563 1.00 35.08  ? 103  VAL B O     1 
ATOM   3627 C  CB    . VAL B 1 103 ? 36.941  -25.458 -9.737  1.00 34.50  ? 103  VAL B CB    1 
ATOM   3628 C  CG1   . VAL B 1 103 ? 35.948  -25.247 -8.607  1.00 34.04  ? 103  VAL B CG1   1 
ATOM   3629 C  CG2   . VAL B 1 103 ? 37.382  -26.903 -9.796  1.00 33.71  ? 103  VAL B CG2   1 
ATOM   3630 N  N     . SER B 1 104 ? 36.024  -22.632 -10.802 1.00 35.49  ? 104  SER B N     1 
ATOM   3631 C  CA    . SER B 1 104 ? 35.274  -21.402 -10.515 1.00 36.01  ? 104  SER B CA    1 
ATOM   3632 C  C     . SER B 1 104 ? 33.998  -21.339 -11.321 1.00 36.65  ? 104  SER B C     1 
ATOM   3633 O  O     . SER B 1 104 ? 32.950  -20.957 -10.801 1.00 36.62  ? 104  SER B O     1 
ATOM   3634 C  CB    . SER B 1 104 ? 36.093  -20.162 -10.818 1.00 35.76  ? 104  SER B CB    1 
ATOM   3635 O  OG    . SER B 1 104 ? 35.263  -19.015 -10.791 1.00 35.52  ? 104  SER B OG    1 
ATOM   3636 N  N     . ASN B 1 105 ? 34.095  -21.750 -12.581 1.00 37.40  ? 105  ASN B N     1 
ATOM   3637 C  CA    . ASN B 1 105 ? 32.985  -21.654 -13.496 1.00 38.25  ? 105  ASN B CA    1 
ATOM   3638 C  C     . ASN B 1 105 ? 32.015  -22.798 -13.415 1.00 38.58  ? 105  ASN B C     1 
ATOM   3639 O  O     . ASN B 1 105 ? 30.838  -22.587 -13.640 1.00 39.00  ? 105  ASN B O     1 
ATOM   3640 C  CB    . ASN B 1 105 ? 33.483  -21.450 -14.912 1.00 38.51  ? 105  ASN B CB    1 
ATOM   3641 C  CG    . ASN B 1 105 ? 34.476  -20.319 -14.998 1.00 40.19  ? 105  ASN B CG    1 
ATOM   3642 O  OD1   . ASN B 1 105 ? 34.615  -19.541 -14.049 1.00 42.38  ? 105  ASN B OD1   1 
ATOM   3643 N  ND2   . ASN B 1 105 ? 35.192  -20.228 -16.117 1.00 41.22  ? 105  ASN B ND2   1 
ATOM   3644 N  N     . ARG B 1 106 ? 32.463  -24.002 -13.074 1.00 39.09  ? 106  ARG B N     1 
ATOM   3645 C  CA    . ARG B 1 106 ? 31.485  -25.091 -12.904 1.00 39.84  ? 106  ARG B CA    1 
ATOM   3646 C  C     . ARG B 1 106 ? 30.652  -24.866 -11.668 1.00 40.10  ? 106  ARG B C     1 
ATOM   3647 O  O     . ARG B 1 106 ? 29.703  -25.592 -11.386 1.00 39.68  ? 106  ARG B O     1 
ATOM   3648 C  CB    . ARG B 1 106 ? 32.137  -26.464 -12.855 1.00 39.90  ? 106  ARG B CB    1 
ATOM   3649 C  CG    . ARG B 1 106 ? 32.617  -26.917 -14.194 1.00 40.76  ? 106  ARG B CG    1 
ATOM   3650 C  CD    . ARG B 1 106 ? 31.523  -27.387 -15.117 1.00 41.74  ? 106  ARG B CD    1 
ATOM   3651 N  NE    . ARG B 1 106 ? 32.155  -28.298 -16.051 1.00 44.48  ? 106  ARG B NE    1 
ATOM   3652 C  CZ    . ARG B 1 106 ? 32.320  -29.600 -15.825 1.00 46.01  ? 106  ARG B CZ    1 
ATOM   3653 N  NH1   . ARG B 1 106 ? 32.943  -30.358 -16.722 1.00 46.87  ? 106  ARG B NH1   1 
ATOM   3654 N  NH2   . ARG B 1 106 ? 31.848  -30.153 -14.713 1.00 46.53  ? 106  ARG B NH2   1 
ATOM   3655 N  N     . LEU B 1 107 ? 31.022  -23.834 -10.934 1.00 40.83  ? 107  LEU B N     1 
ATOM   3656 C  CA    . LEU B 1 107 ? 30.305  -23.524 -9.744  1.00 41.73  ? 107  LEU B CA    1 
ATOM   3657 C  C     . LEU B 1 107 ? 29.140  -22.616 -10.072 1.00 42.64  ? 107  LEU B C     1 
ATOM   3658 O  O     . LEU B 1 107 ? 28.037  -22.817 -9.548  1.00 42.97  ? 107  LEU B O     1 
ATOM   3659 C  CB    . LEU B 1 107 ? 31.238  -23.013 -8.642  1.00 41.52  ? 107  LEU B CB    1 
ATOM   3660 C  CG    . LEU B 1 107 ? 32.023  -24.195 -8.026  1.00 40.80  ? 107  LEU B CG    1 
ATOM   3661 C  CD1   . LEU B 1 107 ? 32.581  -23.905 -6.650  1.00 40.11  ? 107  LEU B CD1   1 
ATOM   3662 C  CD2   . LEU B 1 107 ? 31.160  -25.437 -7.932  1.00 39.89  ? 107  LEU B CD2   1 
ATOM   3663 N  N     . ARG B 1 108 ? 29.343  -21.649 -10.961 1.00 43.54  ? 108  ARG B N     1 
ATOM   3664 C  CA    . ARG B 1 108 ? 28.182  -20.897 -11.430 1.00 44.78  ? 108  ARG B CA    1 
ATOM   3665 C  C     . ARG B 1 108 ? 27.421  -21.696 -12.482 1.00 44.97  ? 108  ARG B C     1 
ATOM   3666 O  O     . ARG B 1 108 ? 26.222  -21.500 -12.633 1.00 45.32  ? 108  ARG B O     1 
ATOM   3667 C  CB    . ARG B 1 108 ? 28.484  -19.450 -11.862 1.00 44.86  ? 108  ARG B CB    1 
ATOM   3668 C  CG    . ARG B 1 108 ? 29.916  -19.155 -12.295 1.00 48.18  ? 108  ARG B CG    1 
ATOM   3669 C  CD    . ARG B 1 108 ? 30.003  -18.043 -13.364 1.00 53.90  ? 108  ARG B CD    1 
ATOM   3670 N  NE    . ARG B 1 108 ? 29.349  -16.790 -12.948 1.00 58.65  ? 108  ARG B NE    1 
ATOM   3671 C  CZ    . ARG B 1 108 ? 28.155  -16.360 -13.382 1.00 60.93  ? 108  ARG B CZ    1 
ATOM   3672 N  NH1   . ARG B 1 108 ? 27.453  -17.076 -14.268 1.00 61.76  ? 108  ARG B NH1   1 
ATOM   3673 N  NH2   . ARG B 1 108 ? 27.652  -15.204 -12.927 1.00 61.46  ? 108  ARG B NH2   1 
ATOM   3674 N  N     . GLU B 1 109 ? 28.099  -22.620 -13.170 1.00 45.41  ? 109  GLU B N     1 
ATOM   3675 C  CA    . GLU B 1 109 ? 27.437  -23.500 -14.154 1.00 45.77  ? 109  GLU B CA    1 
ATOM   3676 C  C     . GLU B 1 109 ? 26.451  -24.402 -13.430 1.00 45.32  ? 109  GLU B C     1 
ATOM   3677 O  O     . GLU B 1 109 ? 25.320  -24.570 -13.872 1.00 45.43  ? 109  GLU B O     1 
ATOM   3678 C  CB    . GLU B 1 109 ? 28.445  -24.336 -14.969 1.00 46.18  ? 109  GLU B CB    1 
ATOM   3679 C  CG    . GLU B 1 109 ? 27.868  -25.076 -16.227 1.00 48.08  ? 109  GLU B CG    1 
ATOM   3680 C  CD    . GLU B 1 109 ? 27.453  -26.561 -15.988 1.00 49.90  ? 109  GLU B CD    1 
ATOM   3681 O  OE1   . GLU B 1 109 ? 28.083  -27.472 -16.602 1.00 50.31  ? 109  GLU B OE1   1 
ATOM   3682 O  OE2   . GLU B 1 109 ? 26.497  -26.814 -15.209 1.00 49.46  ? 109  GLU B OE2   1 
ATOM   3683 N  N     . MET B 1 110 ? 26.887  -24.977 -12.318 1.00 44.84  ? 110  MET B N     1 
ATOM   3684 C  CA    . MET B 1 110 ? 25.973  -25.621 -11.400 1.00 44.47  ? 110  MET B CA    1 
ATOM   3685 C  C     . MET B 1 110 ? 25.338  -24.515 -10.559 1.00 44.39  ? 110  MET B C     1 
ATOM   3686 O  O     . MET B 1 110 ? 25.607  -23.323 -10.767 1.00 44.29  ? 110  MET B O     1 
ATOM   3687 C  CB    . MET B 1 110 ? 26.724  -26.612 -10.526 1.00 44.39  ? 110  MET B CB    1 
ATOM   3688 C  CG    . MET B 1 110 ? 27.768  -27.392 -11.288 1.00 44.62  ? 110  MET B CG    1 
ATOM   3689 S  SD    . MET B 1 110 ? 28.474  -28.756 -10.363 1.00 44.70  ? 110  MET B SD    1 
ATOM   3690 C  CE    . MET B 1 110 ? 27.213  -30.008 -10.590 1.00 45.85  ? 110  MET B CE    1 
ATOM   3691 N  N     . GLY B 1 111 ? 24.501  -24.899 -9.602  1.00 44.20  ? 111  GLY B N     1 
ATOM   3692 C  CA    . GLY B 1 111 ? 23.755  -23.918 -8.813  1.00 43.89  ? 111  GLY B CA    1 
ATOM   3693 C  C     . GLY B 1 111 ? 24.593  -23.025 -7.922  1.00 43.46  ? 111  GLY B C     1 
ATOM   3694 O  O     . GLY B 1 111 ? 24.300  -21.842 -7.767  1.00 43.75  ? 111  GLY B O     1 
ATOM   3695 N  N     . LYS B 1 112 ? 25.687  -23.590 -7.425  1.00 42.91  ? 112  LYS B N     1 
ATOM   3696 C  CA    . LYS B 1 112 ? 26.253  -23.283 -6.106  1.00 42.01  ? 112  LYS B CA    1 
ATOM   3697 C  C     . LYS B 1 112 ? 26.816  -21.907 -5.878  1.00 41.25  ? 112  LYS B C     1 
ATOM   3698 O  O     . LYS B 1 112 ? 27.497  -21.361 -6.726  1.00 41.19  ? 112  LYS B O     1 
ATOM   3699 C  CB    . LYS B 1 112 ? 27.321  -24.320 -5.779  1.00 42.13  ? 112  LYS B CB    1 
ATOM   3700 C  CG    . LYS B 1 112 ? 27.260  -25.552 -6.681  1.00 42.39  ? 112  LYS B CG    1 
ATOM   3701 C  CD    . LYS B 1 112 ? 27.209  -26.854 -5.888  1.00 43.62  ? 112  LYS B CD    1 
ATOM   3702 C  CE    . LYS B 1 112 ? 25.792  -27.233 -5.472  1.00 43.93  ? 112  LYS B CE    1 
ATOM   3703 N  NZ    . LYS B 1 112 ? 25.606  -28.706 -5.599  1.00 44.49  ? 112  LYS B NZ    1 
ATOM   3704 N  N     . ILE B 1 113 ? 26.521  -21.368 -4.703  1.00 40.55  ? 113  ILE B N     1 
ATOM   3705 C  CA    . ILE B 1 113 ? 27.061  -20.097 -4.242  1.00 40.42  ? 113  ILE B CA    1 
ATOM   3706 C  C     . ILE B 1 113 ? 27.785  -20.334 -2.928  1.00 40.65  ? 113  ILE B C     1 
ATOM   3707 O  O     . ILE B 1 113 ? 27.756  -21.444 -2.416  1.00 40.94  ? 113  ILE B O     1 
ATOM   3708 C  CB    . ILE B 1 113 ? 25.950  -19.091 -4.010  1.00 40.22  ? 113  ILE B CB    1 
ATOM   3709 C  CG1   . ILE B 1 113 ? 24.811  -19.726 -3.204  1.00 39.66  ? 113  ILE B CG1   1 
ATOM   3710 C  CG2   . ILE B 1 113 ? 25.458  -18.567 -5.336  1.00 40.44  ? 113  ILE B CG2   1 
ATOM   3711 C  CD1   . ILE B 1 113 ? 23.857  -18.726 -2.588  1.00 40.16  ? 113  ILE B CD1   1 
ATOM   3712 N  N     . GLN B 1 114 ? 28.440  -19.324 -2.366  1.00 40.78  ? 114  GLN B N     1 
ATOM   3713 C  CA    . GLN B 1 114 ? 29.113  -19.551 -1.082  1.00 40.88  ? 114  GLN B CA    1 
ATOM   3714 C  C     . GLN B 1 114 ? 28.619  -18.662 0.018   1.00 40.84  ? 114  GLN B C     1 
ATOM   3715 O  O     . GLN B 1 114 ? 28.521  -17.453 -0.151  1.00 41.03  ? 114  GLN B O     1 
ATOM   3716 C  CB    . GLN B 1 114 ? 30.644  -19.482 -1.191  1.00 41.14  ? 114  GLN B CB    1 
ATOM   3717 C  CG    . GLN B 1 114 ? 31.280  -18.082 -1.266  1.00 41.63  ? 114  GLN B CG    1 
ATOM   3718 C  CD    . GLN B 1 114 ? 32.772  -18.103 -0.924  1.00 41.94  ? 114  GLN B CD    1 
ATOM   3719 O  OE1   . GLN B 1 114 ? 33.615  -17.792 -1.757  1.00 42.27  ? 114  GLN B OE1   1 
ATOM   3720 N  NE2   . GLN B 1 114 ? 33.095  -18.493 0.301   1.00 42.24  ? 114  GLN B NE2   1 
ATOM   3721 N  N     . LYS B 1 115 ? 28.314  -19.262 1.155   1.00 40.95  ? 115  LYS B N     1 
ATOM   3722 C  CA    . LYS B 1 115 ? 27.867  -18.490 2.310   1.00 41.19  ? 115  LYS B CA    1 
ATOM   3723 C  C     . LYS B 1 115 ? 28.674  -18.829 3.566   1.00 41.08  ? 115  LYS B C     1 
ATOM   3724 O  O     . LYS B 1 115 ? 29.161  -19.960 3.702   1.00 41.20  ? 115  LYS B O     1 
ATOM   3725 C  CB    . LYS B 1 115 ? 26.351  -18.633 2.523   1.00 41.20  ? 115  LYS B CB    1 
ATOM   3726 C  CG    . LYS B 1 115 ? 25.685  -19.781 1.758   1.00 42.14  ? 115  LYS B CG    1 
ATOM   3727 C  CD    . LYS B 1 115 ? 24.167  -19.632 1.694   1.00 42.79  ? 115  LYS B CD    1 
ATOM   3728 C  CE    . LYS B 1 115 ? 23.511  -19.991 3.011   1.00 43.31  ? 115  LYS B CE    1 
ATOM   3729 N  NZ    . LYS B 1 115 ? 22.388  -19.065 3.315   1.00 44.05  ? 115  LYS B NZ    1 
ATOM   3730 N  N     . VAL B 1 116 ? 28.853  -17.844 4.449   1.00 40.76  ? 116  VAL B N     1 
ATOM   3731 C  CA    . VAL B 1 116 ? 29.573  -18.064 5.711   1.00 40.61  ? 116  VAL B CA    1 
ATOM   3732 C  C     . VAL B 1 116 ? 28.764  -18.887 6.689   1.00 40.19  ? 116  VAL B C     1 
ATOM   3733 O  O     . VAL B 1 116 ? 27.542  -18.828 6.707   1.00 39.94  ? 116  VAL B O     1 
ATOM   3734 C  CB    . VAL B 1 116 ? 29.981  -16.760 6.427   1.00 40.73  ? 116  VAL B CB    1 
ATOM   3735 C  CG1   . VAL B 1 116 ? 31.269  -16.192 5.832   1.00 41.06  ? 116  VAL B CG1   1 
ATOM   3736 C  CG2   . VAL B 1 116 ? 28.847  -15.746 6.395   1.00 41.22  ? 116  VAL B CG2   1 
ATOM   3737 N  N     . GLY B 1 117 ? 29.467  -19.651 7.508   1.00 40.13  ? 117  GLY B N     1 
ATOM   3738 C  CA    . GLY B 1 117 ? 28.828  -20.541 8.457   1.00 40.21  ? 117  GLY B CA    1 
ATOM   3739 C  C     . GLY B 1 117 ? 28.353  -19.769 9.658   1.00 40.20  ? 117  GLY B C     1 
ATOM   3740 O  O     . GLY B 1 117 ? 28.747  -18.627 9.865   1.00 40.34  ? 117  GLY B O     1 
ATOM   3741 N  N     . ARG B 1 118 ? 27.480  -20.386 10.439  1.00 40.03  ? 118  ARG B N     1 
ATOM   3742 C  CA    . ARG B 1 118 ? 27.081  -19.817 11.698  1.00 40.10  ? 118  ARG B CA    1 
ATOM   3743 C  C     . ARG B 1 118 ? 28.264  -19.881 12.678  1.00 39.62  ? 118  ARG B C     1 
ATOM   3744 O  O     . ARG B 1 118 ? 29.175  -20.690 12.508  1.00 39.76  ? 118  ARG B O     1 
ATOM   3745 C  CB    . ARG B 1 118 ? 25.877  -20.586 12.239  1.00 40.46  ? 118  ARG B CB    1 
ATOM   3746 C  CG    . ARG B 1 118 ? 24.573  -20.360 11.473  1.00 43.07  ? 118  ARG B CG    1 
ATOM   3747 C  CD    . ARG B 1 118 ? 23.297  -20.750 12.289  1.00 48.25  ? 118  ARG B CD    1 
ATOM   3748 N  NE    . ARG B 1 118 ? 23.286  -20.255 13.679  1.00 52.09  ? 118  ARG B NE    1 
ATOM   3749 C  CZ    . ARG B 1 118 ? 22.870  -19.042 14.076  1.00 54.10  ? 118  ARG B CZ    1 
ATOM   3750 N  NH1   . ARG B 1 118 ? 22.400  -18.139 13.204  1.00 54.25  ? 118  ARG B NH1   1 
ATOM   3751 N  NH2   . ARG B 1 118 ? 22.931  -18.722 15.369  1.00 54.50  ? 118  ARG B NH2   1 
ATOM   3752 N  N     . TRP B 1 119 ? 28.272  -18.992 13.667  1.00 39.08  ? 119  TRP B N     1 
ATOM   3753 C  CA    . TRP B 1 119 ? 29.086  -19.174 14.861  1.00 38.49  ? 119  TRP B CA    1 
ATOM   3754 C  C     . TRP B 1 119 ? 28.183  -19.865 15.863  1.00 38.34  ? 119  TRP B C     1 
ATOM   3755 O  O     . TRP B 1 119 ? 26.998  -19.548 15.964  1.00 38.36  ? 119  TRP B O     1 
ATOM   3756 C  CB    . TRP B 1 119 ? 29.507  -17.826 15.443  1.00 38.58  ? 119  TRP B CB    1 
ATOM   3757 C  CG    . TRP B 1 119 ? 30.878  -17.329 15.066  1.00 38.09  ? 119  TRP B CG    1 
ATOM   3758 C  CD1   . TRP B 1 119 ? 31.193  -16.108 14.528  1.00 38.25  ? 119  TRP B CD1   1 
ATOM   3759 C  CD2   . TRP B 1 119 ? 32.114  -18.019 15.228  1.00 37.42  ? 119  TRP B CD2   1 
ATOM   3760 N  NE1   . TRP B 1 119 ? 32.546  -16.008 14.327  1.00 37.65  ? 119  TRP B NE1   1 
ATOM   3761 C  CE2   . TRP B 1 119 ? 33.134  -17.169 14.752  1.00 37.22  ? 119  TRP B CE2   1 
ATOM   3762 C  CE3   . TRP B 1 119 ? 32.458  -19.280 15.712  1.00 37.63  ? 119  TRP B CE3   1 
ATOM   3763 C  CZ2   . TRP B 1 119 ? 34.468  -17.540 14.756  1.00 37.14  ? 119  TRP B CZ2   1 
ATOM   3764 C  CZ3   . TRP B 1 119 ? 33.779  -19.649 15.707  1.00 37.31  ? 119  TRP B CZ3   1 
ATOM   3765 C  CH2   . TRP B 1 119 ? 34.771  -18.784 15.236  1.00 36.95  ? 119  TRP B CH2   1 
ATOM   3766 N  N     . VAL B 1 120 ? 28.715  -20.797 16.625  1.00 38.18  ? 120  VAL B N     1 
ATOM   3767 C  CA    . VAL B 1 120 ? 27.848  -21.530 17.532  1.00 38.47  ? 120  VAL B CA    1 
ATOM   3768 C  C     . VAL B 1 120 ? 28.413  -21.591 18.962  1.00 39.05  ? 120  VAL B C     1 
ATOM   3769 O  O     . VAL B 1 120 ? 29.562  -21.967 19.157  1.00 39.55  ? 120  VAL B O     1 
ATOM   3770 C  CB    . VAL B 1 120 ? 27.490  -22.905 16.931  1.00 38.12  ? 120  VAL B CB    1 
ATOM   3771 C  CG1   . VAL B 1 120 ? 27.429  -23.971 17.983  1.00 38.16  ? 120  VAL B CG1   1 
ATOM   3772 C  CG2   . VAL B 1 120 ? 26.177  -22.807 16.189  1.00 37.91  ? 120  VAL B CG2   1 
ATOM   3773 N  N     . PRO B 1 121 ? 27.601  -21.214 19.966  1.00 39.30  ? 121  PRO B N     1 
ATOM   3774 C  CA    . PRO B 1 121 ? 28.003  -20.918 21.333  1.00 39.49  ? 121  PRO B CA    1 
ATOM   3775 C  C     . PRO B 1 121 ? 29.071  -21.789 21.969  1.00 40.10  ? 121  PRO B C     1 
ATOM   3776 O  O     . PRO B 1 121 ? 29.751  -21.315 22.878  1.00 40.33  ? 121  PRO B O     1 
ATOM   3777 C  CB    . PRO B 1 121 ? 26.711  -21.103 22.103  1.00 39.32  ? 121  PRO B CB    1 
ATOM   3778 C  CG    . PRO B 1 121 ? 25.703  -20.674 21.184  1.00 39.33  ? 121  PRO B CG    1 
ATOM   3779 C  CD    . PRO B 1 121 ? 26.143  -21.107 19.824  1.00 39.39  ? 121  PRO B CD    1 
ATOM   3780 N  N     . HIS B 1 122 ? 29.218  -23.036 21.522  1.00 40.92  ? 122  HIS B N     1 
ATOM   3781 C  CA    . HIS B 1 122 ? 30.023  -24.014 22.256  1.00 41.97  ? 122  HIS B CA    1 
ATOM   3782 C  C     . HIS B 1 122 ? 30.237  -25.320 21.515  1.00 42.89  ? 122  HIS B C     1 
ATOM   3783 O  O     . HIS B 1 122 ? 29.348  -25.798 20.810  1.00 43.23  ? 122  HIS B O     1 
ATOM   3784 C  CB    . HIS B 1 122 ? 29.305  -24.343 23.557  1.00 41.83  ? 122  HIS B CB    1 
ATOM   3785 C  CG    . HIS B 1 122 ? 30.172  -24.965 24.595  1.00 42.41  ? 122  HIS B CG    1 
ATOM   3786 N  ND1   . HIS B 1 122 ? 31.472  -24.564 24.819  1.00 43.38  ? 122  HIS B ND1   1 
ATOM   3787 C  CD2   . HIS B 1 122 ? 29.911  -25.931 25.506  1.00 43.00  ? 122  HIS B CD2   1 
ATOM   3788 C  CE1   . HIS B 1 122 ? 31.982  -25.272 25.811  1.00 44.04  ? 122  HIS B CE1   1 
ATOM   3789 N  NE2   . HIS B 1 122 ? 31.055  -26.108 26.246  1.00 44.23  ? 122  HIS B NE2   1 
ATOM   3790 N  N     . GLU B 1 123 ? 31.410  -25.918 21.692  1.00 44.05  ? 123  GLU B N     1 
ATOM   3791 C  CA    . GLU B 1 123 ? 31.598  -27.305 21.278  1.00 45.18  ? 123  GLU B CA    1 
ATOM   3792 C  C     . GLU B 1 123 ? 30.863  -28.217 22.267  1.00 45.49  ? 123  GLU B C     1 
ATOM   3793 O  O     . GLU B 1 123 ? 31.286  -28.368 23.412  1.00 45.39  ? 123  GLU B O     1 
ATOM   3794 C  CB    . GLU B 1 123 ? 33.090  -27.660 21.172  1.00 45.45  ? 123  GLU B CB    1 
ATOM   3795 C  CG    . GLU B 1 123 ? 33.693  -27.529 19.750  1.00 47.02  ? 123  GLU B CG    1 
ATOM   3796 C  CD    . GLU B 1 123 ? 32.997  -28.413 18.675  1.00 49.21  ? 123  GLU B CD    1 
ATOM   3797 O  OE1   . GLU B 1 123 ? 33.055  -28.056 17.474  1.00 50.56  ? 123  GLU B OE1   1 
ATOM   3798 O  OE2   . GLU B 1 123 ? 32.394  -29.461 19.010  1.00 49.30  ? 123  GLU B OE2   1 
ATOM   3799 N  N     . LEU B 1 124 ? 29.751  -28.803 21.834  1.00 46.10  ? 124  LEU B N     1 
ATOM   3800 C  CA    . LEU B 1 124 ? 28.874  -29.497 22.764  1.00 47.02  ? 124  LEU B CA    1 
ATOM   3801 C  C     . LEU B 1 124 ? 29.228  -30.954 22.980  1.00 48.23  ? 124  LEU B C     1 
ATOM   3802 O  O     . LEU B 1 124 ? 29.443  -31.693 22.026  1.00 48.31  ? 124  LEU B O     1 
ATOM   3803 C  CB    . LEU B 1 124 ? 27.412  -29.366 22.345  1.00 46.69  ? 124  LEU B CB    1 
ATOM   3804 C  CG    . LEU B 1 124 ? 26.639  -28.100 22.723  1.00 45.68  ? 124  LEU B CG    1 
ATOM   3805 C  CD1   . LEU B 1 124 ? 25.203  -28.274 22.329  1.00 45.02  ? 124  LEU B CD1   1 
ATOM   3806 C  CD2   . LEU B 1 124 ? 26.706  -27.782 24.201  1.00 45.03  ? 124  LEU B CD2   1 
ATOM   3807 N  N     . ASN B 1 125 ? 29.269  -31.352 24.252  1.00 49.85  ? 125  ASN B N     1 
ATOM   3808 C  CA    . ASN B 1 125 ? 29.573  -32.720 24.657  1.00 51.46  ? 125  ASN B CA    1 
ATOM   3809 C  C     . ASN B 1 125 ? 28.437  -33.637 24.361  1.00 52.26  ? 125  ASN B C     1 
ATOM   3810 O  O     . ASN B 1 125 ? 27.278  -33.267 24.502  1.00 52.41  ? 125  ASN B O     1 
ATOM   3811 C  CB    . ASN B 1 125 ? 29.829  -32.799 26.156  1.00 51.70  ? 125  ASN B CB    1 
ATOM   3812 C  CG    . ASN B 1 125 ? 30.994  -31.925 26.601  1.00 53.77  ? 125  ASN B CG    1 
ATOM   3813 O  OD1   . ASN B 1 125 ? 31.435  -31.023 25.879  1.00 55.35  ? 125  ASN B OD1   1 
ATOM   3814 N  ND2   . ASN B 1 125 ? 31.498  -32.187 27.808  1.00 56.14  ? 125  ASN B ND2   1 
ATOM   3815 N  N     . GLU B 1 126 ? 28.783  -34.854 23.977  1.00 53.60  ? 126  GLU B N     1 
ATOM   3816 C  CA    . GLU B 1 126 ? 27.814  -35.933 23.791  1.00 54.78  ? 126  GLU B CA    1 
ATOM   3817 C  C     . GLU B 1 126 ? 26.718  -35.891 24.868  1.00 54.64  ? 126  GLU B C     1 
ATOM   3818 O  O     . GLU B 1 126 ? 25.537  -36.035 24.550  1.00 54.45  ? 126  GLU B O     1 
ATOM   3819 C  CB    . GLU B 1 126 ? 28.533  -37.304 23.772  1.00 55.41  ? 126  GLU B CB    1 
ATOM   3820 C  CG    . GLU B 1 126 ? 29.456  -37.578 22.518  1.00 58.11  ? 126  GLU B CG    1 
ATOM   3821 C  CD    . GLU B 1 126 ? 30.975  -37.196 22.671  1.00 61.02  ? 126  GLU B CD    1 
ATOM   3822 O  OE1   . GLU B 1 126 ? 31.498  -36.941 23.782  1.00 61.77  ? 126  GLU B OE1   1 
ATOM   3823 O  OE2   . GLU B 1 126 ? 31.677  -37.181 21.530  1.00 60.87  ? 126  GLU B OE2   1 
ATOM   3824 N  N     . ARG B 1 127 ? 27.109  -35.666 26.126  1.00 54.80  ? 127  ARG B N     1 
ATOM   3825 C  CA    . ARG B 1 127 ? 26.130  -35.576 27.211  1.00 55.02  ? 127  ARG B CA    1 
ATOM   3826 C  C     . ARG B 1 127 ? 25.363  -34.269 27.170  1.00 54.74  ? 127  ARG B C     1 
ATOM   3827 O  O     . ARG B 1 127 ? 24.135  -34.287 27.093  1.00 55.05  ? 127  ARG B O     1 
ATOM   3828 C  CB    . ARG B 1 127 ? 26.746  -35.778 28.599  1.00 55.32  ? 127  ARG B CB    1 
ATOM   3829 C  CG    . ARG B 1 127 ? 25.746  -35.473 29.725  1.00 56.85  ? 127  ARG B CG    1 
ATOM   3830 C  CD    . ARG B 1 127 ? 26.177  -35.974 31.108  1.00 60.13  ? 127  ARG B CD    1 
ATOM   3831 N  NE    . ARG B 1 127 ? 25.529  -35.213 32.185  1.00 62.53  ? 127  ARG B NE    1 
ATOM   3832 C  CZ    . ARG B 1 127 ? 24.259  -35.355 32.583  1.00 63.75  ? 127  ARG B CZ    1 
ATOM   3833 N  NH1   . ARG B 1 127 ? 23.790  -34.593 33.565  1.00 64.38  ? 127  ARG B NH1   1 
ATOM   3834 N  NH2   . ARG B 1 127 ? 23.447  -36.242 32.010  1.00 64.00  ? 127  ARG B NH2   1 
ATOM   3835 N  N     . GLN B 1 128 ? 26.084  -33.145 27.221  1.00 54.21  ? 128  GLN B N     1 
ATOM   3836 C  CA    . GLN B 1 128 ? 25.464  -31.811 27.215  1.00 53.55  ? 128  GLN B CA    1 
ATOM   3837 C  C     . GLN B 1 128 ? 24.406  -31.672 26.126  1.00 53.19  ? 128  GLN B C     1 
ATOM   3838 O  O     . GLN B 1 128 ? 23.463  -30.897 26.265  1.00 53.16  ? 128  GLN B O     1 
ATOM   3839 C  CB    . GLN B 1 128 ? 26.510  -30.728 27.013  1.00 53.48  ? 128  GLN B CB    1 
ATOM   3840 C  CG    . GLN B 1 128 ? 27.554  -30.649 28.090  1.00 53.55  ? 128  GLN B CG    1 
ATOM   3841 C  CD    . GLN B 1 128 ? 28.705  -29.747 27.698  1.00 53.67  ? 128  GLN B CD    1 
ATOM   3842 O  OE1   . GLN B 1 128 ? 28.981  -29.551 26.515  1.00 53.64  ? 128  GLN B OE1   1 
ATOM   3843 N  NE2   . GLN B 1 128 ? 29.389  -29.194 28.692  1.00 54.18  ? 128  GLN B NE2   1 
ATOM   3844 N  N     . MET B 1 129 ? 24.581  -32.424 25.044  1.00 52.66  ? 129  MET B N     1 
ATOM   3845 C  CA    . MET B 1 129 ? 23.625  -32.462 23.957  1.00 52.27  ? 129  MET B CA    1 
ATOM   3846 C  C     . MET B 1 129 ? 22.303  -33.074 24.380  1.00 51.79  ? 129  MET B C     1 
ATOM   3847 O  O     . MET B 1 129 ? 21.253  -32.588 23.978  1.00 52.10  ? 129  MET B O     1 
ATOM   3848 C  CB    . MET B 1 129 ? 24.187  -33.250 22.782  1.00 52.65  ? 129  MET B CB    1 
ATOM   3849 C  CG    . MET B 1 129 ? 24.673  -32.410 21.609  1.00 53.31  ? 129  MET B CG    1 
ATOM   3850 S  SD    . MET B 1 129 ? 25.585  -33.377 20.373  1.00 55.24  ? 129  MET B SD    1 
ATOM   3851 C  CE    . MET B 1 129 ? 24.541  -34.832 20.143  1.00 54.67  ? 129  MET B CE    1 
ATOM   3852 N  N     . GLU B 1 130 ? 22.336  -34.142 25.168  1.00 50.91  ? 130  GLU B N     1 
ATOM   3853 C  CA    . GLU B 1 130 ? 21.085  -34.747 25.603  1.00 50.19  ? 130  GLU B CA    1 
ATOM   3854 C  C     . GLU B 1 130 ? 20.513  -34.094 26.847  1.00 49.30  ? 130  GLU B C     1 
ATOM   3855 O  O     . GLU B 1 130 ? 19.305  -34.091 27.031  1.00 49.12  ? 130  GLU B O     1 
ATOM   3856 C  CB    . GLU B 1 130 ? 21.200  -36.256 25.762  1.00 50.48  ? 130  GLU B CB    1 
ATOM   3857 C  CG    . GLU B 1 130 ? 22.596  -36.754 26.024  1.00 52.01  ? 130  GLU B CG    1 
ATOM   3858 C  CD    . GLU B 1 130 ? 22.604  -38.103 26.719  1.00 54.16  ? 130  GLU B CD    1 
ATOM   3859 O  OE1   . GLU B 1 130 ? 21.880  -39.019 26.258  1.00 54.51  ? 130  GLU B OE1   1 
ATOM   3860 O  OE2   . GLU B 1 130 ? 23.335  -38.241 27.730  1.00 55.03  ? 130  GLU B OE2   1 
ATOM   3861 N  N     . ARG B 1 131 ? 21.370  -33.520 27.684  1.00 48.53  ? 131  ARG B N     1 
ATOM   3862 C  CA    . ARG B 1 131 ? 20.905  -32.643 28.761  1.00 48.26  ? 131  ARG B CA    1 
ATOM   3863 C  C     . ARG B 1 131 ? 19.918  -31.630 28.206  1.00 47.05  ? 131  ARG B C     1 
ATOM   3864 O  O     . ARG B 1 131 ? 18.900  -31.333 28.818  1.00 47.07  ? 131  ARG B O     1 
ATOM   3865 C  CB    . ARG B 1 131 ? 22.066  -31.893 29.445  1.00 48.97  ? 131  ARG B CB    1 
ATOM   3866 C  CG    . ARG B 1 131 ? 22.423  -32.334 30.899  1.00 52.00  ? 131  ARG B CG    1 
ATOM   3867 C  CD    . ARG B 1 131 ? 21.277  -32.106 31.938  1.00 57.27  ? 131  ARG B CD    1 
ATOM   3868 N  NE    . ARG B 1 131 ? 20.962  -30.683 32.184  1.00 61.10  ? 131  ARG B NE    1 
ATOM   3869 C  CZ    . ARG B 1 131 ? 19.882  -30.234 32.839  1.00 62.36  ? 131  ARG B CZ    1 
ATOM   3870 N  NH1   . ARG B 1 131 ? 18.978  -31.090 33.324  1.00 62.73  ? 131  ARG B NH1   1 
ATOM   3871 N  NH2   . ARG B 1 131 ? 19.697  -28.922 33.007  1.00 62.28  ? 131  ARG B NH2   1 
ATOM   3872 N  N     . ARG B 1 132 ? 20.232  -31.106 27.033  1.00 45.79  ? 132  ARG B N     1 
ATOM   3873 C  CA    . ARG B 1 132 ? 19.363  -30.170 26.362  1.00 44.49  ? 132  ARG B CA    1 
ATOM   3874 C  C     . ARG B 1 132 ? 18.135  -30.879 25.855  1.00 44.08  ? 132  ARG B C     1 
ATOM   3875 O  O     . ARG B 1 132 ? 17.027  -30.516 26.218  1.00 43.99  ? 132  ARG B O     1 
ATOM   3876 C  CB    . ARG B 1 132 ? 20.087  -29.543 25.187  1.00 44.44  ? 132  ARG B CB    1 
ATOM   3877 C  CG    . ARG B 1 132 ? 21.293  -28.718 25.556  1.00 42.99  ? 132  ARG B CG    1 
ATOM   3878 C  CD    . ARG B 1 132 ? 21.840  -28.031 24.330  1.00 39.79  ? 132  ARG B CD    1 
ATOM   3879 N  NE    . ARG B 1 132 ? 20.849  -27.142 23.749  1.00 37.17  ? 132  ARG B NE    1 
ATOM   3880 C  CZ    . ARG B 1 132 ? 21.111  -26.255 22.808  1.00 36.61  ? 132  ARG B CZ    1 
ATOM   3881 N  NH1   . ARG B 1 132 ? 22.338  -26.139 22.347  1.00 36.89  ? 132  ARG B NH1   1 
ATOM   3882 N  NH2   . ARG B 1 132 ? 20.147  -25.485 22.330  1.00 37.24  ? 132  ARG B NH2   1 
ATOM   3883 N  N     . LYS B 1 133 ? 18.342  -31.899 25.024  1.00 43.65  ? 133  LYS B N     1 
ATOM   3884 C  CA    . LYS B 1 133 ? 17.250  -32.597 24.361  1.00 43.56  ? 133  LYS B CA    1 
ATOM   3885 C  C     . LYS B 1 133 ? 16.133  -32.803 25.342  1.00 43.15  ? 133  LYS B C     1 
ATOM   3886 O  O     . LYS B 1 133 ? 14.988  -32.442 25.088  1.00 42.80  ? 133  LYS B O     1 
ATOM   3887 C  CB    . LYS B 1 133 ? 17.705  -33.958 23.834  1.00 43.95  ? 133  LYS B CB    1 
ATOM   3888 C  CG    . LYS B 1 133 ? 16.708  -34.601 22.856  1.00 45.34  ? 133  LYS B CG    1 
ATOM   3889 C  CD    . LYS B 1 133 ? 17.069  -36.051 22.500  1.00 47.32  ? 133  LYS B CD    1 
ATOM   3890 C  CE    . LYS B 1 133 ? 16.223  -36.559 21.324  1.00 48.02  ? 133  LYS B CE    1 
ATOM   3891 N  NZ    . LYS B 1 133 ? 16.313  -38.042 21.128  1.00 48.70  ? 133  LYS B NZ    1 
ATOM   3892 N  N     . ASN B 1 134 ? 16.499  -33.374 26.481  1.00 43.04  ? 134  ASN B N     1 
ATOM   3893 C  CA    . ASN B 1 134 ? 15.562  -33.670 27.542  1.00 42.84  ? 134  ASN B CA    1 
ATOM   3894 C  C     . ASN B 1 134 ? 14.811  -32.461 28.002  1.00 42.39  ? 134  ASN B C     1 
ATOM   3895 O  O     . ASN B 1 134 ? 13.622  -32.343 27.743  1.00 42.54  ? 134  ASN B O     1 
ATOM   3896 C  CB    . ASN B 1 134 ? 16.280  -34.320 28.705  1.00 42.90  ? 134  ASN B CB    1 
ATOM   3897 C  CG    . ASN B 1 134 ? 16.485  -35.768 28.474  1.00 43.66  ? 134  ASN B CG    1 
ATOM   3898 O  OD1   . ASN B 1 134 ? 17.544  -36.191 28.006  1.00 44.75  ? 134  ASN B OD1   1 
ATOM   3899 N  ND2   . ASN B 1 134 ? 15.446  -36.552 28.736  1.00 44.70  ? 134  ASN B ND2   1 
ATOM   3900 N  N     . THR B 1 135 ? 15.509  -31.556 28.670  1.00 41.62  ? 135  THR B N     1 
ATOM   3901 C  CA    . THR B 1 135 ? 14.896  -30.334 29.147  1.00 41.06  ? 135  THR B CA    1 
ATOM   3902 C  C     . THR B 1 135 ? 13.889  -29.750 28.129  1.00 41.02  ? 135  THR B C     1 
ATOM   3903 O  O     . THR B 1 135 ? 12.765  -29.412 28.515  1.00 41.03  ? 135  THR B O     1 
ATOM   3904 C  CB    . THR B 1 135 ? 15.962  -29.326 29.544  1.00 40.95  ? 135  THR B CB    1 
ATOM   3905 O  OG1   . THR B 1 135 ? 16.969  -30.002 30.301  1.00 40.50  ? 135  THR B OG1   1 
ATOM   3906 C  CG2   . THR B 1 135 ? 15.364  -28.233 30.386  1.00 40.91  ? 135  THR B CG2   1 
ATOM   3907 N  N     . CYS B 1 136 ? 14.272  -29.661 26.848  1.00 40.56  ? 136  CYS B N     1 
ATOM   3908 C  CA    . CYS B 1 136 ? 13.327  -29.282 25.803  1.00 40.21  ? 136  CYS B CA    1 
ATOM   3909 C  C     . CYS B 1 136 ? 12.195  -30.302 25.848  1.00 39.89  ? 136  CYS B C     1 
ATOM   3910 O  O     . CYS B 1 136 ? 11.082  -29.976 26.266  1.00 40.15  ? 136  CYS B O     1 
ATOM   3911 C  CB    . CYS B 1 136 ? 13.991  -29.236 24.426  1.00 40.35  ? 136  CYS B CB    1 
ATOM   3912 S  SG    . CYS B 1 136 ? 15.479  -28.201 24.368  1.00 41.91  ? 136  CYS B SG    1 
ATOM   3913 N  N     . GLU B 1 137 ? 12.497  -31.547 25.484  1.00 39.28  ? 137  GLU B N     1 
ATOM   3914 C  CA    . GLU B 1 137 ? 11.547  -32.662 25.557  1.00 38.78  ? 137  GLU B CA    1 
ATOM   3915 C  C     . GLU B 1 137 ? 10.567  -32.463 26.702  1.00 38.27  ? 137  GLU B C     1 
ATOM   3916 O  O     . GLU B 1 137 ? 9.357   -32.474 26.510  1.00 37.93  ? 137  GLU B O     1 
ATOM   3917 C  CB    . GLU B 1 137 ? 12.328  -33.944 25.812  1.00 38.98  ? 137  GLU B CB    1 
ATOM   3918 C  CG    . GLU B 1 137 ? 12.022  -35.125 24.918  1.00 39.72  ? 137  GLU B CG    1 
ATOM   3919 C  CD    . GLU B 1 137 ? 13.202  -36.102 24.857  1.00 40.86  ? 137  GLU B CD    1 
ATOM   3920 O  OE1   . GLU B 1 137 ? 14.033  -36.130 25.804  1.00 40.20  ? 137  GLU B OE1   1 
ATOM   3921 O  OE2   . GLU B 1 137 ? 13.303  -36.834 23.848  1.00 41.91  ? 137  GLU B OE2   1 
ATOM   3922 N  N     . ILE B 1 138 ? 11.130  -32.266 27.892  1.00 38.10  ? 138  ILE B N     1 
ATOM   3923 C  CA    . ILE B 1 138 ? 10.396  -32.125 29.148  1.00 38.01  ? 138  ILE B CA    1 
ATOM   3924 C  C     . ILE B 1 138 ? 9.452   -30.929 29.171  1.00 37.79  ? 138  ILE B C     1 
ATOM   3925 O  O     . ILE B 1 138 ? 8.264   -31.086 29.446  1.00 37.96  ? 138  ILE B O     1 
ATOM   3926 C  CB    . ILE B 1 138 ? 11.369  -32.069 30.367  1.00 37.96  ? 138  ILE B CB    1 
ATOM   3927 C  CG1   . ILE B 1 138 ? 11.714  -33.481 30.840  1.00 38.44  ? 138  ILE B CG1   1 
ATOM   3928 C  CG2   . ILE B 1 138 ? 10.764  -31.321 31.538  1.00 37.81  ? 138  ILE B CG2   1 
ATOM   3929 C  CD1   . ILE B 1 138 ? 13.022  -34.027 30.320  1.00 38.93  ? 138  ILE B CD1   1 
ATOM   3930 N  N     . LEU B 1 139 ? 9.977   -29.740 28.896  1.00 37.40  ? 139  LEU B N     1 
ATOM   3931 C  CA    . LEU B 1 139 ? 9.158   -28.546 28.940  1.00 37.17  ? 139  LEU B CA    1 
ATOM   3932 C  C     . LEU B 1 139 ? 8.098   -28.655 27.874  1.00 37.33  ? 139  LEU B C     1 
ATOM   3933 O  O     . LEU B 1 139 ? 6.907   -28.516 28.160  1.00 37.72  ? 139  LEU B O     1 
ATOM   3934 C  CB    . LEU B 1 139 ? 9.994   -27.301 28.692  1.00 37.01  ? 139  LEU B CB    1 
ATOM   3935 C  CG    . LEU B 1 139 ? 11.213  -27.136 29.579  1.00 36.45  ? 139  LEU B CG    1 
ATOM   3936 C  CD1   . LEU B 1 139 ? 12.192  -26.249 28.860  1.00 36.41  ? 139  LEU B CD1   1 
ATOM   3937 C  CD2   . LEU B 1 139 ? 10.854  -26.585 30.949  1.00 35.27  ? 139  LEU B CD2   1 
ATOM   3938 N  N     . LEU B 1 140 ? 8.543   -28.929 26.650  1.00 37.14  ? 140  LEU B N     1 
ATOM   3939 C  CA    . LEU B 1 140 ? 7.661   -29.050 25.506  1.00 37.09  ? 140  LEU B CA    1 
ATOM   3940 C  C     . LEU B 1 140 ? 6.485   -29.973 25.810  1.00 37.46  ? 140  LEU B C     1 
ATOM   3941 O  O     . LEU B 1 140 ? 5.380   -29.742 25.326  1.00 37.86  ? 140  LEU B O     1 
ATOM   3942 C  CB    . LEU B 1 140 ? 8.443   -29.569 24.308  1.00 36.87  ? 140  LEU B CB    1 
ATOM   3943 C  CG    . LEU B 1 140 ? 7.864   -29.389 22.908  1.00 36.79  ? 140  LEU B CG    1 
ATOM   3944 C  CD1   . LEU B 1 140 ? 7.669   -27.917 22.568  1.00 36.89  ? 140  LEU B CD1   1 
ATOM   3945 C  CD2   . LEU B 1 140 ? 8.777   -30.049 21.897  1.00 36.73  ? 140  LEU B CD2   1 
ATOM   3946 N  N     . SER B 1 141 ? 6.724   -30.999 26.627  1.00 37.61  ? 141  SER B N     1 
ATOM   3947 C  CA    . SER B 1 141 ? 5.691   -31.958 27.017  1.00 37.63  ? 141  SER B CA    1 
ATOM   3948 C  C     . SER B 1 141 ? 4.577   -31.353 27.869  1.00 37.61  ? 141  SER B C     1 
ATOM   3949 O  O     . SER B 1 141 ? 3.405   -31.599 27.599  1.00 37.92  ? 141  SER B O     1 
ATOM   3950 C  CB    . SER B 1 141 ? 6.310   -33.156 27.738  1.00 37.79  ? 141  SER B CB    1 
ATOM   3951 O  OG    . SER B 1 141 ? 5.319   -33.894 28.431  1.00 38.00  ? 141  SER B OG    1 
ATOM   3952 N  N     . ARG B 1 142 ? 4.930   -30.581 28.896  1.00 37.49  ? 142  ARG B N     1 
ATOM   3953 C  CA    . ARG B 1 142 ? 3.914   -29.929 29.726  1.00 37.53  ? 142  ARG B CA    1 
ATOM   3954 C  C     . ARG B 1 142 ? 3.215   -28.808 28.956  1.00 37.69  ? 142  ARG B C     1 
ATOM   3955 O  O     . ARG B 1 142 ? 2.042   -28.536 29.182  1.00 37.32  ? 142  ARG B O     1 
ATOM   3956 C  CB    . ARG B 1 142 ? 4.490   -29.435 31.067  1.00 37.64  ? 142  ARG B CB    1 
ATOM   3957 C  CG    . ARG B 1 142 ? 4.864   -27.948 31.125  1.00 37.61  ? 142  ARG B CG    1 
ATOM   3958 C  CD    . ARG B 1 142 ? 4.637   -27.327 32.509  1.00 37.68  ? 142  ARG B CD    1 
ATOM   3959 N  NE    . ARG B 1 142 ? 5.837   -27.349 33.348  1.00 37.96  ? 142  ARG B NE    1 
ATOM   3960 C  CZ    . ARG B 1 142 ? 5.893   -26.951 34.624  1.00 38.22  ? 142  ARG B CZ    1 
ATOM   3961 N  NH1   . ARG B 1 142 ? 4.807   -26.495 35.251  1.00 37.66  ? 142  ARG B NH1   1 
ATOM   3962 N  NH2   . ARG B 1 142 ? 7.048   -27.019 35.284  1.00 37.91  ? 142  ARG B NH2   1 
ATOM   3963 N  N     . TYR B 1 143 ? 3.935   -28.173 28.036  1.00 38.27  ? 143  TYR B N     1 
ATOM   3964 C  CA    . TYR B 1 143 ? 3.334   -27.175 27.165  1.00 39.10  ? 143  TYR B CA    1 
ATOM   3965 C  C     . TYR B 1 143 ? 2.195   -27.762 26.335  1.00 40.04  ? 143  TYR B C     1 
ATOM   3966 O  O     . TYR B 1 143 ? 1.119   -27.179 26.236  1.00 40.16  ? 143  TYR B O     1 
ATOM   3967 C  CB    . TYR B 1 143 ? 4.365   -26.560 26.240  1.00 38.58  ? 143  TYR B CB    1 
ATOM   3968 C  CG    . TYR B 1 143 ? 3.744   -25.553 25.315  1.00 38.79  ? 143  TYR B CG    1 
ATOM   3969 C  CD1   . TYR B 1 143 ? 3.187   -24.386 25.811  1.00 39.12  ? 143  TYR B CD1   1 
ATOM   3970 C  CD2   . TYR B 1 143 ? 3.692   -25.770 23.949  1.00 39.69  ? 143  TYR B CD2   1 
ATOM   3971 C  CE1   . TYR B 1 143 ? 2.601   -23.448 24.969  1.00 40.07  ? 143  TYR B CE1   1 
ATOM   3972 C  CE2   . TYR B 1 143 ? 3.109   -24.831 23.087  1.00 40.46  ? 143  TYR B CE2   1 
ATOM   3973 C  CZ    . TYR B 1 143 ? 2.568   -23.668 23.610  1.00 40.64  ? 143  TYR B CZ    1 
ATOM   3974 O  OH    . TYR B 1 143 ? 1.990   -22.724 22.783  1.00 41.23  ? 143  TYR B OH    1 
ATOM   3975 N  N     . LYS B 1 144 ? 2.466   -28.912 25.726  1.00 41.29  ? 144  LYS B N     1 
ATOM   3976 C  CA    . LYS B 1 144 ? 1.477   -29.741 25.044  1.00 42.33  ? 144  LYS B CA    1 
ATOM   3977 C  C     . LYS B 1 144 ? 0.202   -29.878 25.889  1.00 42.61  ? 144  LYS B C     1 
ATOM   3978 O  O     . LYS B 1 144 ? -0.898  -29.663 25.383  1.00 42.64  ? 144  LYS B O     1 
ATOM   3979 C  CB    . LYS B 1 144 ? 2.090   -31.124 24.799  1.00 42.60  ? 144  LYS B CB    1 
ATOM   3980 C  CG    . LYS B 1 144 ? 1.669   -31.857 23.522  1.00 44.51  ? 144  LYS B CG    1 
ATOM   3981 C  CD    . LYS B 1 144 ? 1.785   -33.404 23.727  1.00 47.05  ? 144  LYS B CD    1 
ATOM   3982 C  CE    . LYS B 1 144 ? 2.263   -34.179 22.480  1.00 47.18  ? 144  LYS B CE    1 
ATOM   3983 N  NZ    . LYS B 1 144 ? 1.382   -33.999 21.291  1.00 48.02  ? 144  LYS B NZ    1 
ATOM   3984 N  N     . ARG B 1 145 ? 0.365   -30.220 27.171  1.00 43.03  ? 145  ARG B N     1 
ATOM   3985 C  CA    . ARG B 1 145 ? -0.748  -30.386 28.119  1.00 43.51  ? 145  ARG B CA    1 
ATOM   3986 C  C     . ARG B 1 145 ? -1.541  -29.097 28.391  1.00 43.87  ? 145  ARG B C     1 
ATOM   3987 O  O     . ARG B 1 145 ? -2.774  -29.080 28.252  1.00 43.74  ? 145  ARG B O     1 
ATOM   3988 C  CB    . ARG B 1 145 ? -0.228  -30.940 29.440  1.00 43.56  ? 145  ARG B CB    1 
ATOM   3989 C  CG    . ARG B 1 145 ? -0.393  -32.421 29.616  1.00 44.07  ? 145  ARG B CG    1 
ATOM   3990 C  CD    . ARG B 1 145 ? -0.265  -32.790 31.094  1.00 45.40  ? 145  ARG B CD    1 
ATOM   3991 N  NE    . ARG B 1 145 ? 1.125   -33.039 31.482  1.00 46.61  ? 145  ARG B NE    1 
ATOM   3992 C  CZ    . ARG B 1 145 ? 1.853   -32.269 32.290  1.00 47.29  ? 145  ARG B CZ    1 
ATOM   3993 N  NH1   . ARG B 1 145 ? 1.340   -31.168 32.828  1.00 47.81  ? 145  ARG B NH1   1 
ATOM   3994 N  NH2   . ARG B 1 145 ? 3.108   -32.607 32.563  1.00 47.52  ? 145  ARG B NH2   1 
ATOM   3995 N  N     . LYS B 1 146 ? -0.832  -28.049 28.835  1.00 44.30  ? 146  LYS B N     1 
ATOM   3996 C  CA    . LYS B 1 146 ? -1.339  -26.653 28.816  1.00 44.36  ? 146  LYS B CA    1 
ATOM   3997 C  C     . LYS B 1 146 ? -0.243  -25.575 28.873  1.00 43.97  ? 146  LYS B C     1 
ATOM   3998 O  O     . LYS B 1 146 ? 0.683   -25.672 29.679  1.00 43.78  ? 146  LYS B O     1 
ATOM   3999 C  CB    . LYS B 1 146 ? -2.413  -26.375 29.891  1.00 44.47  ? 146  LYS B CB    1 
ATOM   4000 C  CG    . LYS B 1 146 ? -3.226  -25.073 29.600  1.00 44.74  ? 146  LYS B CG    1 
ATOM   4001 C  CD    . LYS B 1 146 ? -4.106  -25.190 28.321  1.00 43.88  ? 146  LYS B CD    1 
ATOM   4002 C  CE    . LYS B 1 146 ? -4.073  -23.930 27.450  1.00 42.69  ? 146  LYS B CE    1 
ATOM   4003 N  NZ    . LYS B 1 146 ? -3.262  -24.136 26.217  1.00 41.46  ? 146  LYS B NZ    1 
ATOM   4004 N  N     . SER B 1 147 ? -0.387  -24.560 28.009  1.00 43.72  ? 147  SER B N     1 
ATOM   4005 C  CA    . SER B 1 147 ? 0.472   -23.365 27.967  1.00 43.39  ? 147  SER B CA    1 
ATOM   4006 C  C     . SER B 1 147 ? 0.657   -22.825 29.369  1.00 43.34  ? 147  SER B C     1 
ATOM   4007 O  O     . SER B 1 147 ? -0.278  -22.844 30.176  1.00 43.62  ? 147  SER B O     1 
ATOM   4008 C  CB    . SER B 1 147 ? -0.145  -22.280 27.066  1.00 43.44  ? 147  SER B CB    1 
ATOM   4009 O  OG    . SER B 1 147 ? 0.687   -21.134 26.946  1.00 42.79  ? 147  SER B OG    1 
ATOM   4010 N  N     . PHE B 1 148 ? 1.867   -22.366 29.663  1.00 42.92  ? 148  PHE B N     1 
ATOM   4011 C  CA    . PHE B 1 148 ? 2.207   -21.901 30.997  1.00 42.53  ? 148  PHE B CA    1 
ATOM   4012 C  C     . PHE B 1 148 ? 3.181   -20.757 30.866  1.00 42.42  ? 148  PHE B C     1 
ATOM   4013 O  O     . PHE B 1 148 ? 3.719   -20.267 31.861  1.00 42.26  ? 148  PHE B O     1 
ATOM   4014 C  CB    . PHE B 1 148 ? 2.824   -23.032 31.820  1.00 42.49  ? 148  PHE B CB    1 
ATOM   4015 C  CG    . PHE B 1 148 ? 4.089   -23.562 31.247  1.00 42.44  ? 148  PHE B CG    1 
ATOM   4016 C  CD1   . PHE B 1 148 ? 5.306   -23.053 31.639  1.00 42.85  ? 148  PHE B CD1   1 
ATOM   4017 C  CD2   . PHE B 1 148 ? 4.066   -24.559 30.295  1.00 43.49  ? 148  PHE B CD2   1 
ATOM   4018 C  CE1   . PHE B 1 148 ? 6.488   -23.535 31.092  1.00 43.49  ? 148  PHE B CE1   1 
ATOM   4019 C  CE2   . PHE B 1 148 ? 5.247   -25.047 29.739  1.00 43.99  ? 148  PHE B CE2   1 
ATOM   4020 C  CZ    . PHE B 1 148 ? 6.457   -24.537 30.143  1.00 43.58  ? 148  PHE B CZ    1 
ATOM   4021 N  N     . LEU B 1 149 ? 3.403   -20.343 29.621  1.00 42.52  ? 149  LEU B N     1 
ATOM   4022 C  CA    . LEU B 1 149 ? 4.273   -19.212 29.311  1.00 42.58  ? 149  LEU B CA    1 
ATOM   4023 C  C     . LEU B 1 149 ? 3.650   -17.893 29.767  1.00 43.03  ? 149  LEU B C     1 
ATOM   4024 O  O     . LEU B 1 149 ? 4.335   -16.884 29.979  1.00 43.06  ? 149  LEU B O     1 
ATOM   4025 C  CB    . LEU B 1 149 ? 4.586   -19.154 27.817  1.00 42.22  ? 149  LEU B CB    1 
ATOM   4026 C  CG    . LEU B 1 149 ? 5.253   -20.320 27.097  1.00 40.98  ? 149  LEU B CG    1 
ATOM   4027 C  CD1   . LEU B 1 149 ? 5.744   -21.394 28.055  1.00 40.18  ? 149  LEU B CD1   1 
ATOM   4028 C  CD2   . LEU B 1 149 ? 4.272   -20.881 26.127  1.00 40.40  ? 149  LEU B CD2   1 
ATOM   4029 N  N     . HIS B 1 150 ? 2.335   -17.922 29.919  1.00 43.56  ? 150  HIS B N     1 
ATOM   4030 C  CA    . HIS B 1 150 ? 1.597   -16.809 30.473  1.00 44.08  ? 150  HIS B CA    1 
ATOM   4031 C  C     . HIS B 1 150 ? 2.161   -16.398 31.847  1.00 43.58  ? 150  HIS B C     1 
ATOM   4032 O  O     . HIS B 1 150 ? 2.164   -15.217 32.183  1.00 43.70  ? 150  HIS B O     1 
ATOM   4033 C  CB    . HIS B 1 150 ? 0.085   -17.127 30.456  1.00 44.58  ? 150  HIS B CB    1 
ATOM   4034 C  CG    . HIS B 1 150 ? -0.447  -17.385 29.066  1.00 47.13  ? 150  HIS B CG    1 
ATOM   4035 N  ND1   . HIS B 1 150 ? -1.110  -18.546 28.715  1.00 48.81  ? 150  HIS B ND1   1 
ATOM   4036 C  CD2   . HIS B 1 150 ? -0.367  -16.644 27.927  1.00 48.33  ? 150  HIS B CD2   1 
ATOM   4037 C  CE1   . HIS B 1 150 ? -1.436  -18.497 27.433  1.00 48.84  ? 150  HIS B CE1   1 
ATOM   4038 N  NE2   . HIS B 1 150 ? -0.997  -17.353 26.932  1.00 48.60  ? 150  HIS B NE2   1 
ATOM   4039 N  N     . ARG B 1 151 ? 2.709   -17.353 32.599  1.00 43.05  ? 151  ARG B N     1 
ATOM   4040 C  CA    . ARG B 1 151 ? 3.312   -17.043 33.904  1.00 42.49  ? 151  ARG B CA    1 
ATOM   4041 C  C     . ARG B 1 151 ? 4.830   -17.317 34.019  1.00 41.80  ? 151  ARG B C     1 
ATOM   4042 O  O     . ARG B 1 151 ? 5.394   -17.369 35.123  1.00 41.79  ? 151  ARG B O     1 
ATOM   4043 C  CB    . ARG B 1 151 ? 2.525   -17.709 35.044  1.00 42.66  ? 151  ARG B CB    1 
ATOM   4044 C  CG    . ARG B 1 151 ? 2.740   -19.193 35.178  1.00 43.01  ? 151  ARG B CG    1 
ATOM   4045 C  CD    . ARG B 1 151 ? 1.799   -19.772 36.198  1.00 44.88  ? 151  ARG B CD    1 
ATOM   4046 N  NE    . ARG B 1 151 ? 1.532   -21.174 35.903  1.00 46.89  ? 151  ARG B NE    1 
ATOM   4047 C  CZ    . ARG B 1 151 ? 1.921   -22.210 36.645  1.00 48.16  ? 151  ARG B CZ    1 
ATOM   4048 N  NH1   . ARG B 1 151 ? 2.594   -22.034 37.789  1.00 48.14  ? 151  ARG B NH1   1 
ATOM   4049 N  NH2   . ARG B 1 151 ? 1.611   -23.438 36.237  1.00 48.76  ? 151  ARG B NH2   1 
ATOM   4050 N  N     . ILE B 1 152 ? 5.495   -17.472 32.886  1.00 40.76  ? 152  ILE B N     1 
ATOM   4051 C  CA    . ILE B 1 152 ? 6.932   -17.620 32.912  1.00 39.92  ? 152  ILE B CA    1 
ATOM   4052 C  C     . ILE B 1 152 ? 7.590   -16.231 32.889  1.00 39.62  ? 152  ILE B C     1 
ATOM   4053 O  O     . ILE B 1 152 ? 7.315   -15.410 32.014  1.00 39.31  ? 152  ILE B O     1 
ATOM   4054 C  CB    . ILE B 1 152 ? 7.432   -18.630 31.816  1.00 39.78  ? 152  ILE B CB    1 
ATOM   4055 C  CG1   . ILE B 1 152 ? 8.910   -18.963 31.972  1.00 39.92  ? 152  ILE B CG1   1 
ATOM   4056 C  CG2   . ILE B 1 152 ? 7.183   -18.139 30.421  1.00 39.87  ? 152  ILE B CG2   1 
ATOM   4057 C  CD1   . ILE B 1 152 ? 9.850   -17.945 31.335  1.00 40.42  ? 152  ILE B CD1   1 
ATOM   4058 N  N     . VAL B 1 153 ? 8.411   -15.968 33.905  1.00 39.56  ? 153  VAL B N     1 
ATOM   4059 C  CA    . VAL B 1 153 ? 9.236   -14.757 33.982  1.00 39.48  ? 153  VAL B CA    1 
ATOM   4060 C  C     . VAL B 1 153 ? 10.728  -15.114 33.977  1.00 39.84  ? 153  VAL B C     1 
ATOM   4061 O  O     . VAL B 1 153 ? 11.180  -16.015 34.702  1.00 39.51  ? 153  VAL B O     1 
ATOM   4062 C  CB    . VAL B 1 153 ? 8.906   -13.889 35.216  1.00 39.24  ? 153  VAL B CB    1 
ATOM   4063 C  CG1   . VAL B 1 153 ? 9.504   -14.489 36.448  1.00 38.99  ? 153  VAL B CG1   1 
ATOM   4064 C  CG2   . VAL B 1 153 ? 9.435   -12.477 35.040  1.00 38.73  ? 153  VAL B CG2   1 
ATOM   4065 N  N     . THR B 1 154 ? 11.479  -14.373 33.167  1.00 40.33  ? 154  THR B N     1 
ATOM   4066 C  CA    . THR B 1 154 ? 12.853  -14.719 32.855  1.00 40.80  ? 154  THR B CA    1 
ATOM   4067 C  C     . THR B 1 154 ? 13.765  -13.508 32.820  1.00 41.28  ? 154  THR B C     1 
ATOM   4068 O  O     . THR B 1 154 ? 13.314  -12.386 32.620  1.00 41.35  ? 154  THR B O     1 
ATOM   4069 C  CB    . THR B 1 154 ? 12.936  -15.434 31.499  1.00 40.75  ? 154  THR B CB    1 
ATOM   4070 O  OG1   . THR B 1 154 ? 14.219  -16.056 31.366  1.00 40.81  ? 154  THR B OG1   1 
ATOM   4071 C  CG2   . THR B 1 154 ? 12.706  -14.453 30.345  1.00 40.48  ? 154  THR B CG2   1 
ATOM   4072 N  N     . GLY B 1 155 ? 15.055  -13.761 33.001  1.00 41.89  ? 155  GLY B N     1 
ATOM   4073 C  CA    . GLY B 1 155 ? 16.070  -12.724 32.955  1.00 42.85  ? 155  GLY B CA    1 
ATOM   4074 C  C     . GLY B 1 155 ? 17.488  -13.255 32.797  1.00 43.68  ? 155  GLY B C     1 
ATOM   4075 O  O     . GLY B 1 155 ? 17.760  -14.451 32.980  1.00 43.85  ? 155  GLY B O     1 
ATOM   4076 N  N     . ASP B 1 156 ? 18.399  -12.351 32.455  1.00 44.27  ? 156  ASP B N     1 
ATOM   4077 C  CA    . ASP B 1 156 ? 19.802  -12.679 32.291  1.00 44.81  ? 156  ASP B CA    1 
ATOM   4078 C  C     . ASP B 1 156 ? 20.513  -11.365 32.172  1.00 44.73  ? 156  ASP B C     1 
ATOM   4079 O  O     . ASP B 1 156 ? 19.940  -10.392 31.707  1.00 44.46  ? 156  ASP B O     1 
ATOM   4080 C  CB    . ASP B 1 156 ? 20.030  -13.519 31.024  1.00 45.23  ? 156  ASP B CB    1 
ATOM   4081 C  CG    . ASP B 1 156 ? 21.428  -14.163 30.963  1.00 46.34  ? 156  ASP B CG    1 
ATOM   4082 O  OD1   . ASP B 1 156 ? 21.833  -14.548 29.842  1.00 46.63  ? 156  ASP B OD1   1 
ATOM   4083 O  OD2   . ASP B 1 156 ? 22.119  -14.291 32.007  1.00 47.49  ? 156  ASP B OD2   1 
ATOM   4084 N  N     . GLU B 1 157 ? 21.756  -11.348 32.623  1.00 45.20  ? 157  GLU B N     1 
ATOM   4085 C  CA    . GLU B 1 157 ? 22.622  -10.188 32.523  1.00 45.80  ? 157  GLU B CA    1 
ATOM   4086 C  C     . GLU B 1 157 ? 23.352  -10.183 31.182  1.00 45.85  ? 157  GLU B C     1 
ATOM   4087 O  O     . GLU B 1 157 ? 23.555  -11.235 30.574  1.00 46.20  ? 157  GLU B O     1 
ATOM   4088 C  CB    . GLU B 1 157 ? 23.626  -10.153 33.684  1.00 45.93  ? 157  GLU B CB    1 
ATOM   4089 C  CG    . GLU B 1 157 ? 24.237  -11.502 34.091  1.00 47.40  ? 157  GLU B CG    1 
ATOM   4090 C  CD    . GLU B 1 157 ? 23.377  -12.249 35.108  1.00 50.34  ? 157  GLU B CD    1 
ATOM   4091 O  OE1   . GLU B 1 157 ? 22.368  -12.868 34.691  1.00 52.07  ? 157  GLU B OE1   1 
ATOM   4092 O  OE2   . GLU B 1 157 ? 23.705  -12.222 36.322  1.00 50.86  ? 157  GLU B OE2   1 
ATOM   4093 N  N     . LYS B 1 158 ? 23.728  -8.997  30.716  1.00 45.73  ? 158  LYS B N     1 
ATOM   4094 C  CA    . LYS B 1 158 ? 24.468  -8.859  29.469  1.00 45.56  ? 158  LYS B CA    1 
ATOM   4095 C  C     . LYS B 1 158 ? 25.176  -7.515  29.478  1.00 45.97  ? 158  LYS B C     1 
ATOM   4096 O  O     . LYS B 1 158 ? 24.698  -6.562  30.111  1.00 46.37  ? 158  LYS B O     1 
ATOM   4097 C  CB    . LYS B 1 158 ? 23.538  -8.969  28.250  1.00 45.24  ? 158  LYS B CB    1 
ATOM   4098 C  CG    . LYS B 1 158 ? 23.294  -7.672  27.492  1.00 43.99  ? 158  LYS B CG    1 
ATOM   4099 C  CD    . LYS B 1 158 ? 23.486  -7.881  25.994  1.00 42.40  ? 158  LYS B CD    1 
ATOM   4100 C  CE    . LYS B 1 158 ? 23.925  -6.606  25.296  1.00 41.39  ? 158  LYS B CE    1 
ATOM   4101 N  NZ    . LYS B 1 158 ? 24.387  -6.808  23.910  1.00 40.39  ? 158  LYS B NZ    1 
ATOM   4102 N  N     . TRP B 1 159 ? 26.299  -7.438  28.765  1.00 45.93  ? 159  TRP B N     1 
ATOM   4103 C  CA    . TRP B 1 159 ? 27.141  -6.245  28.761  1.00 45.72  ? 159  TRP B CA    1 
ATOM   4104 C  C     . TRP B 1 159 ? 26.642  -5.153  27.838  1.00 45.47  ? 159  TRP B C     1 
ATOM   4105 O  O     . TRP B 1 159 ? 26.077  -5.434  26.799  1.00 45.42  ? 159  TRP B O     1 
ATOM   4106 C  CB    . TRP B 1 159 ? 28.561  -6.625  28.361  1.00 45.86  ? 159  TRP B CB    1 
ATOM   4107 C  CG    . TRP B 1 159 ? 29.350  -7.302  29.451  1.00 46.28  ? 159  TRP B CG    1 
ATOM   4108 C  CD1   . TRP B 1 159 ? 29.783  -8.594  29.468  1.00 46.47  ? 159  TRP B CD1   1 
ATOM   4109 C  CD2   . TRP B 1 159 ? 29.813  -6.708  30.668  1.00 46.71  ? 159  TRP B CD2   1 
ATOM   4110 N  NE1   . TRP B 1 159 ? 30.489  -8.842  30.623  1.00 46.53  ? 159  TRP B NE1   1 
ATOM   4111 C  CE2   . TRP B 1 159 ? 30.516  -7.702  31.377  1.00 46.43  ? 159  TRP B CE2   1 
ATOM   4112 C  CE3   . TRP B 1 159 ? 29.696  -5.428  31.229  1.00 47.49  ? 159  TRP B CE3   1 
ATOM   4113 C  CZ2   . TRP B 1 159 ? 31.094  -7.465  32.609  1.00 47.61  ? 159  TRP B CZ2   1 
ATOM   4114 C  CZ3   . TRP B 1 159 ? 30.275  -5.189  32.450  1.00 48.26  ? 159  TRP B CZ3   1 
ATOM   4115 C  CH2   . TRP B 1 159 ? 30.967  -6.203  33.133  1.00 48.92  ? 159  TRP B CH2   1 
ATOM   4116 N  N     . ILE B 1 160 ? 26.857  -3.905  28.223  1.00 45.58  ? 160  ILE B N     1 
ATOM   4117 C  CA    . ILE B 1 160 ? 26.634  -2.782  27.322  1.00 46.09  ? 160  ILE B CA    1 
ATOM   4118 C  C     . ILE B 1 160 ? 27.913  -1.961  27.203  1.00 46.96  ? 160  ILE B C     1 
ATOM   4119 O  O     . ILE B 1 160 ? 28.143  -1.053  27.994  1.00 47.33  ? 160  ILE B O     1 
ATOM   4120 C  CB    . ILE B 1 160 ? 25.470  -1.881  27.789  1.00 45.72  ? 160  ILE B CB    1 
ATOM   4121 C  CG1   . ILE B 1 160 ? 24.197  -2.704  27.919  1.00 45.67  ? 160  ILE B CG1   1 
ATOM   4122 C  CG2   . ILE B 1 160 ? 25.254  -0.703  26.832  1.00 44.92  ? 160  ILE B CG2   1 
ATOM   4123 C  CD1   . ILE B 1 160 ? 22.984  -1.895  28.303  1.00 46.25  ? 160  ILE B CD1   1 
ATOM   4124 N  N     . PHE B 1 161 ? 28.757  -2.297  26.233  1.00 47.84  ? 161  PHE B N     1 
ATOM   4125 C  CA    . PHE B 1 161 ? 29.930  -1.496  25.927  1.00 48.85  ? 161  PHE B CA    1 
ATOM   4126 C  C     . PHE B 1 161 ? 29.491  -0.046  25.669  1.00 48.89  ? 161  PHE B C     1 
ATOM   4127 O  O     . PHE B 1 161 ? 28.401  0.193   25.155  1.00 48.52  ? 161  PHE B O     1 
ATOM   4128 C  CB    . PHE B 1 161 ? 30.624  -2.064  24.691  1.00 49.59  ? 161  PHE B CB    1 
ATOM   4129 C  CG    . PHE B 1 161 ? 31.743  -3.051  24.984  1.00 52.07  ? 161  PHE B CG    1 
ATOM   4130 C  CD1   . PHE B 1 161 ? 31.489  -4.259  25.638  1.00 52.88  ? 161  PHE B CD1   1 
ATOM   4131 C  CD2   . PHE B 1 161 ? 33.061  -2.783  24.538  1.00 54.87  ? 161  PHE B CD2   1 
ATOM   4132 C  CE1   . PHE B 1 161 ? 32.537  -5.170  25.885  1.00 54.53  ? 161  PHE B CE1   1 
ATOM   4133 C  CE2   . PHE B 1 161 ? 34.119  -3.690  24.772  1.00 55.24  ? 161  PHE B CE2   1 
ATOM   4134 C  CZ    . PHE B 1 161 ? 33.858  -4.884  25.450  1.00 55.17  ? 161  PHE B CZ    1 
ATOM   4135 N  N     . PHE B 1 162 ? 30.335  0.911   26.048  1.00 49.40  ? 162  PHE B N     1 
ATOM   4136 C  CA    . PHE B 1 162 ? 30.037  2.347   25.903  1.00 49.89  ? 162  PHE B CA    1 
ATOM   4137 C  C     . PHE B 1 162 ? 30.277  2.821   24.482  1.00 50.17  ? 162  PHE B C     1 
ATOM   4138 O  O     . PHE B 1 162 ? 29.617  3.735   23.990  1.00 50.07  ? 162  PHE B O     1 
ATOM   4139 C  CB    . PHE B 1 162 ? 30.900  3.173   26.857  1.00 49.87  ? 162  PHE B CB    1 
ATOM   4140 C  CG    . PHE B 1 162 ? 30.268  3.424   28.189  1.00 50.10  ? 162  PHE B CG    1 
ATOM   4141 C  CD1   . PHE B 1 162 ? 29.597  2.414   28.863  1.00 49.92  ? 162  PHE B CD1   1 
ATOM   4142 C  CD2   . PHE B 1 162 ? 30.364  4.674   28.786  1.00 51.01  ? 162  PHE B CD2   1 
ATOM   4143 C  CE1   . PHE B 1 162 ? 29.013  2.654   30.101  1.00 50.27  ? 162  PHE B CE1   1 
ATOM   4144 C  CE2   . PHE B 1 162 ? 29.782  4.926   30.034  1.00 50.81  ? 162  PHE B CE2   1 
ATOM   4145 C  CZ    . PHE B 1 162 ? 29.106  3.914   30.689  1.00 50.40  ? 162  PHE B CZ    1 
ATOM   4146 N  N     . VAL B 1 163 ? 31.263  2.214   23.841  1.00 50.67  ? 163  VAL B N     1 
ATOM   4147 C  CA    . VAL B 1 163 ? 31.447  2.397   22.421  1.00 51.29  ? 163  VAL B CA    1 
ATOM   4148 C  C     . VAL B 1 163 ? 31.442  1.029   21.740  1.00 51.60  ? 163  VAL B C     1 
ATOM   4149 O  O     . VAL B 1 163 ? 32.111  0.067   22.180  1.00 51.58  ? 163  VAL B O     1 
ATOM   4150 C  CB    . VAL B 1 163 ? 32.709  3.233   22.080  1.00 51.33  ? 163  VAL B CB    1 
ATOM   4151 C  CG1   . VAL B 1 163 ? 33.998  2.392   22.205  1.00 51.77  ? 163  VAL B CG1   1 
ATOM   4152 C  CG2   . VAL B 1 163 ? 32.580  3.855   20.684  1.00 51.54  ? 163  VAL B CG2   1 
ATOM   4153 N  N     . ASN B 1 164 ? 30.648  0.965   20.678  1.00 51.78  ? 164  ASN B N     1 
ATOM   4154 C  CA    . ASN B 1 164 ? 30.430  -0.250  19.919  1.00 51.91  ? 164  ASN B CA    1 
ATOM   4155 C  C     . ASN B 1 164 ? 30.469  0.147   18.443  1.00 51.91  ? 164  ASN B C     1 
ATOM   4156 O  O     . ASN B 1 164 ? 29.473  0.622   17.873  1.00 52.32  ? 164  ASN B O     1 
ATOM   4157 C  CB    . ASN B 1 164 ? 29.082  -0.886  20.293  1.00 51.95  ? 164  ASN B CB    1 
ATOM   4158 C  CG    . ASN B 1 164 ? 28.406  -0.188  21.473  1.00 51.60  ? 164  ASN B CG    1 
ATOM   4159 O  OD1   . ASN B 1 164 ? 28.185  1.028   21.454  1.00 51.02  ? 164  ASN B OD1   1 
ATOM   4160 N  ND2   . ASN B 1 164 ? 28.070  -0.959  22.498  1.00 51.49  ? 164  ASN B ND2   1 
ATOM   4161 N  N     . PRO B 1 165 ? 31.635  0.012   17.818  1.00 51.58  ? 165  PRO B N     1 
ATOM   4162 C  CA    . PRO B 1 165 ? 31.548  0.456   16.457  1.00 51.26  ? 165  PRO B CA    1 
ATOM   4163 C  C     . PRO B 1 165 ? 31.474  -0.734  15.541  1.00 51.04  ? 165  PRO B C     1 
ATOM   4164 O  O     . PRO B 1 165 ? 32.111  -1.761  15.780  1.00 50.61  ? 165  PRO B O     1 
ATOM   4165 C  CB    . PRO B 1 165 ? 32.846  1.245   16.258  1.00 51.37  ? 165  PRO B CB    1 
ATOM   4166 C  CG    . PRO B 1 165 ? 33.621  1.110   17.572  1.00 51.69  ? 165  PRO B CG    1 
ATOM   4167 C  CD    . PRO B 1 165 ? 33.023  -0.050  18.284  1.00 51.45  ? 165  PRO B CD    1 
ATOM   4168 N  N     . LYS B 1 166 ? 30.638  -0.576  14.527  1.00 51.14  ? 166  LYS B N     1 
ATOM   4169 C  CA    . LYS B 1 166 ? 30.477  -1.504  13.412  1.00 51.15  ? 166  LYS B CA    1 
ATOM   4170 C  C     . LYS B 1 166 ? 31.449  -1.102  12.296  1.00 50.18  ? 166  LYS B C     1 
ATOM   4171 O  O     . LYS B 1 166 ? 31.776  0.086   12.105  1.00 49.98  ? 166  LYS B O     1 
ATOM   4172 C  CB    . LYS B 1 166 ? 29.029  -1.427  12.880  1.00 51.81  ? 166  LYS B CB    1 
ATOM   4173 C  CG    . LYS B 1 166 ? 28.657  -0.056  12.135  1.00 54.64  ? 166  LYS B CG    1 
ATOM   4174 C  CD    . LYS B 1 166 ? 28.727  1.226   13.056  1.00 57.15  ? 166  LYS B CD    1 
ATOM   4175 C  CE    . LYS B 1 166 ? 29.388  2.457   12.375  1.00 58.09  ? 166  LYS B CE    1 
ATOM   4176 N  NZ    . LYS B 1 166 ? 29.834  3.527   13.349  1.00 58.12  ? 166  LYS B NZ    1 
ATOM   4177 N  N     . ARG B 1 167 ? 31.899  -2.097  11.549  1.00 49.00  ? 167  ARG B N     1 
ATOM   4178 C  CA    . ARG B 1 167 ? 32.764  -1.835  10.428  1.00 47.82  ? 167  ARG B CA    1 
ATOM   4179 C  C     . ARG B 1 167 ? 31.925  -1.331  9.274   1.00 47.24  ? 167  ARG B C     1 
ATOM   4180 O  O     . ARG B 1 167 ? 31.007  -2.022  8.833   1.00 47.12  ? 167  ARG B O     1 
ATOM   4181 C  CB    . ARG B 1 167 ? 33.477  -3.108  10.047  1.00 47.76  ? 167  ARG B CB    1 
ATOM   4182 C  CG    . ARG B 1 167 ? 34.708  -2.869  9.257   1.00 47.11  ? 167  ARG B CG    1 
ATOM   4183 C  CD    . ARG B 1 167 ? 35.760  -3.833  9.715   1.00 45.42  ? 167  ARG B CD    1 
ATOM   4184 N  NE    . ARG B 1 167 ? 36.220  -4.639  8.602   1.00 42.95  ? 167  ARG B NE    1 
ATOM   4185 C  CZ    . ARG B 1 167 ? 35.872  -5.896  8.408   1.00 40.69  ? 167  ARG B CZ    1 
ATOM   4186 N  NH1   . ARG B 1 167 ? 35.071  -6.511  9.273   1.00 39.18  ? 167  ARG B NH1   1 
ATOM   4187 N  NH2   . ARG B 1 167 ? 36.341  -6.526  7.346   1.00 40.69  ? 167  ARG B NH2   1 
ATOM   4188 N  N     . LYS B 1 168 ? 32.241  -0.129  8.797   1.00 46.47  ? 168  LYS B N     1 
ATOM   4189 C  CA    . LYS B 1 168 ? 31.435  0.543   7.775   1.00 45.90  ? 168  LYS B CA    1 
ATOM   4190 C  C     . LYS B 1 168 ? 31.714  0.049   6.372   1.00 45.10  ? 168  LYS B C     1 
ATOM   4191 O  O     . LYS B 1 168 ? 32.867  -0.077  5.995   1.00 45.09  ? 168  LYS B O     1 
ATOM   4192 C  CB    . LYS B 1 168 ? 31.661  2.040   7.840   1.00 46.05  ? 168  LYS B CB    1 
ATOM   4193 C  CG    . LYS B 1 168 ? 30.714  2.746   8.803   1.00 47.75  ? 168  LYS B CG    1 
ATOM   4194 C  CD    . LYS B 1 168 ? 31.167  4.175   9.094   1.00 49.31  ? 168  LYS B CD    1 
ATOM   4195 C  CE    . LYS B 1 168 ? 32.063  4.229   10.327  1.00 49.81  ? 168  LYS B CE    1 
ATOM   4196 N  NZ    . LYS B 1 168 ? 33.012  5.368   10.236  1.00 50.45  ? 168  LYS B NZ    1 
ATOM   4197 N  N     . LYS B 1 169 ? 30.660  -0.229  5.604   1.00 44.32  ? 169  LYS B N     1 
ATOM   4198 C  CA    . LYS B 1 169 ? 30.823  -0.709  4.224   1.00 44.01  ? 169  LYS B CA    1 
ATOM   4199 C  C     . LYS B 1 169 ? 30.309  0.288   3.166   1.00 43.11  ? 169  LYS B C     1 
ATOM   4200 O  O     . LYS B 1 169 ? 29.270  0.938   3.359   1.00 42.74  ? 169  LYS B O     1 
ATOM   4201 C  CB    . LYS B 1 169 ? 30.243  -2.122  4.022   1.00 44.50  ? 169  LYS B CB    1 
ATOM   4202 C  CG    . LYS B 1 169 ? 28.755  -2.282  4.310   1.00 46.33  ? 169  LYS B CG    1 
ATOM   4203 C  CD    . LYS B 1 169 ? 28.488  -2.853  5.710   1.00 49.41  ? 169  LYS B CD    1 
ATOM   4204 C  CE    . LYS B 1 169 ? 28.538  -4.400  5.720   1.00 51.42  ? 169  LYS B CE    1 
ATOM   4205 N  NZ    . LYS B 1 169 ? 27.691  -5.000  6.821   1.00 51.84  ? 169  LYS B NZ    1 
ATOM   4206 N  N     . SER B 1 170 ? 31.038  0.386   2.049   1.00 42.09  ? 170  SER B N     1 
ATOM   4207 C  CA    . SER B 1 170 ? 30.925  1.562   1.181   1.00 41.29  ? 170  SER B CA    1 
ATOM   4208 C  C     . SER B 1 170 ? 30.897  1.322   -0.336  1.00 40.67  ? 170  SER B C     1 
ATOM   4209 O  O     . SER B 1 170 ? 31.566  0.415   -0.834  1.00 40.70  ? 170  SER B O     1 
ATOM   4210 C  CB    . SER B 1 170 ? 32.051  2.527   1.519   1.00 41.25  ? 170  SER B CB    1 
ATOM   4211 O  OG    . SER B 1 170 ? 31.564  3.834   1.390   1.00 40.98  ? 170  SER B OG    1 
ATOM   4212 N  N     . TYR B 1 171 ? 30.128  2.151   -1.052  1.00 39.69  ? 171  TYR B N     1 
ATOM   4213 C  CA    . TYR B 1 171 ? 29.968  2.035   -2.509  1.00 38.90  ? 171  TYR B CA    1 
ATOM   4214 C  C     . TYR B 1 171 ? 30.995  2.865   -3.231  1.00 39.26  ? 171  TYR B C     1 
ATOM   4215 O  O     . TYR B 1 171 ? 30.906  4.083   -3.289  1.00 39.35  ? 171  TYR B O     1 
ATOM   4216 C  CB    . TYR B 1 171 ? 28.560  2.437   -2.985  1.00 38.21  ? 171  TYR B CB    1 
ATOM   4217 C  CG    . TYR B 1 171 ? 27.521  1.400   -2.696  1.00 36.24  ? 171  TYR B CG    1 
ATOM   4218 C  CD1   . TYR B 1 171 ? 26.606  1.582   -1.684  1.00 35.32  ? 171  TYR B CD1   1 
ATOM   4219 C  CD2   . TYR B 1 171 ? 27.472  0.214   -3.413  1.00 34.69  ? 171  TYR B CD2   1 
ATOM   4220 C  CE1   . TYR B 1 171 ? 25.659  0.603   -1.391  1.00 34.25  ? 171  TYR B CE1   1 
ATOM   4221 C  CE2   . TYR B 1 171 ? 26.520  -0.766  -3.128  1.00 32.99  ? 171  TYR B CE2   1 
ATOM   4222 C  CZ    . TYR B 1 171 ? 25.625  -0.562  -2.116  1.00 32.01  ? 171  TYR B CZ    1 
ATOM   4223 O  OH    . TYR B 1 171 ? 24.686  -1.507  -1.815  1.00 30.35  ? 171  TYR B OH    1 
ATOM   4224 N  N     . VAL B 1 172 ? 31.970  2.205   -3.811  1.00 39.79  ? 172  VAL B N     1 
ATOM   4225 C  CA    . VAL B 1 172 ? 32.982  2.923   -4.530  1.00 40.56  ? 172  VAL B CA    1 
ATOM   4226 C  C     . VAL B 1 172 ? 33.454  2.130   -5.743  1.00 41.28  ? 172  VAL B C     1 
ATOM   4227 O  O     . VAL B 1 172 ? 33.358  0.909   -5.761  1.00 41.45  ? 172  VAL B O     1 
ATOM   4228 C  CB    . VAL B 1 172 ? 34.135  3.262   -3.592  1.00 40.46  ? 172  VAL B CB    1 
ATOM   4229 C  CG1   . VAL B 1 172 ? 34.632  2.010   -2.889  1.00 39.78  ? 172  VAL B CG1   1 
ATOM   4230 C  CG2   . VAL B 1 172 ? 35.236  3.972   -4.354  1.00 40.99  ? 172  VAL B CG2   1 
ATOM   4231 N  N     . ASP B 1 173 ? 33.953  2.831   -6.755  1.00 42.13  ? 173  ASP B N     1 
ATOM   4232 C  CA    . ASP B 1 173 ? 34.512  2.191   -7.943  1.00 43.15  ? 173  ASP B CA    1 
ATOM   4233 C  C     . ASP B 1 173 ? 35.504  1.074   -7.595  1.00 43.19  ? 173  ASP B C     1 
ATOM   4234 O  O     . ASP B 1 173 ? 36.089  1.098   -6.519  1.00 43.39  ? 173  ASP B O     1 
ATOM   4235 C  CB    . ASP B 1 173 ? 35.198  3.252   -8.793  1.00 43.61  ? 173  ASP B CB    1 
ATOM   4236 C  CG    . ASP B 1 173 ? 34.243  4.335   -9.239  1.00 45.55  ? 173  ASP B CG    1 
ATOM   4237 O  OD1   . ASP B 1 173 ? 33.058  4.021   -9.510  1.00 46.92  ? 173  ASP B OD1   1 
ATOM   4238 O  OD2   . ASP B 1 173 ? 34.678  5.504   -9.323  1.00 48.58  ? 173  ASP B OD2   1 
ATOM   4239 N  N     . PRO B 1 174 ? 35.708  0.099   -8.500  1.00 43.26  ? 174  PRO B N     1 
ATOM   4240 C  CA    . PRO B 1 174 ? 36.679  -0.928  -8.182  1.00 43.55  ? 174  PRO B CA    1 
ATOM   4241 C  C     . PRO B 1 174 ? 38.019  -0.306  -7.857  1.00 43.88  ? 174  PRO B C     1 
ATOM   4242 O  O     . PRO B 1 174 ? 38.362  0.721   -8.427  1.00 44.15  ? 174  PRO B O     1 
ATOM   4243 C  CB    . PRO B 1 174 ? 36.798  -1.721  -9.483  1.00 43.53  ? 174  PRO B CB    1 
ATOM   4244 C  CG    . PRO B 1 174 ? 35.557  -1.483  -10.187 1.00 43.86  ? 174  PRO B CG    1 
ATOM   4245 C  CD    . PRO B 1 174 ? 35.166  -0.079  -9.854  1.00 43.60  ? 174  PRO B CD    1 
ATOM   4246 N  N     . GLY B 1 175 ? 38.748  -0.909  -6.922  1.00 44.23  ? 175  GLY B N     1 
ATOM   4247 C  CA    . GLY B 1 175 ? 40.115  -0.507  -6.618  1.00 44.68  ? 175  GLY B CA    1 
ATOM   4248 C  C     . GLY B 1 175 ? 40.244  0.798   -5.870  1.00 44.99  ? 175  GLY B C     1 
ATOM   4249 O  O     . GLY B 1 175 ? 41.351  1.255   -5.598  1.00 45.13  ? 175  GLY B O     1 
ATOM   4250 N  N     . GLN B 1 176 ? 39.113  1.402   -5.539  1.00 45.28  ? 176  GLN B N     1 
ATOM   4251 C  CA    . GLN B 1 176 ? 39.116  2.618   -4.755  1.00 45.95  ? 176  GLN B CA    1 
ATOM   4252 C  C     . GLN B 1 176 ? 38.931  2.229   -3.295  1.00 45.60  ? 176  GLN B C     1 
ATOM   4253 O  O     . GLN B 1 176 ? 38.490  1.120   -3.013  1.00 45.59  ? 176  GLN B O     1 
ATOM   4254 C  CB    . GLN B 1 176 ? 38.029  3.567   -5.266  1.00 46.42  ? 176  GLN B CB    1 
ATOM   4255 C  CG    . GLN B 1 176 ? 38.551  4.963   -5.672  1.00 49.09  ? 176  GLN B CG    1 
ATOM   4256 C  CD    . GLN B 1 176 ? 39.994  4.930   -6.233  1.00 52.08  ? 176  GLN B CD    1 
ATOM   4257 O  OE1   . GLN B 1 176 ? 40.907  5.529   -5.655  1.00 53.01  ? 176  GLN B OE1   1 
ATOM   4258 N  NE2   . GLN B 1 176 ? 40.197  4.210   -7.346  1.00 52.32  ? 176  GLN B NE2   1 
ATOM   4259 N  N     . PRO B 1 177 ? 39.291  3.116   -2.356  1.00 45.52  ? 177  PRO B N     1 
ATOM   4260 C  CA    . PRO B 1 177 ? 39.323  2.651   -0.961  1.00 45.68  ? 177  PRO B CA    1 
ATOM   4261 C  C     . PRO B 1 177 ? 37.978  2.734   -0.231  1.00 45.66  ? 177  PRO B C     1 
ATOM   4262 O  O     . PRO B 1 177 ? 37.153  3.595   -0.537  1.00 45.85  ? 177  PRO B O     1 
ATOM   4263 C  CB    . PRO B 1 177 ? 40.349  3.581   -0.318  1.00 45.74  ? 177  PRO B CB    1 
ATOM   4264 C  CG    . PRO B 1 177 ? 40.263  4.847   -1.127  1.00 45.62  ? 177  PRO B CG    1 
ATOM   4265 C  CD    . PRO B 1 177 ? 39.705  4.522   -2.482  1.00 45.24  ? 177  PRO B CD    1 
ATOM   4266 N  N     . ALA B 1 178 ? 37.762  1.853   0.735   1.00 45.57  ? 178  ALA B N     1 
ATOM   4267 C  CA    . ALA B 1 178 ? 36.488  1.820   1.450   1.00 45.98  ? 178  ALA B CA    1 
ATOM   4268 C  C     . ALA B 1 178 ? 36.410  2.962   2.473   1.00 46.26  ? 178  ALA B C     1 
ATOM   4269 O  O     . ALA B 1 178 ? 37.135  3.942   2.352   1.00 46.50  ? 178  ALA B O     1 
ATOM   4270 C  CB    . ALA B 1 178 ? 36.321  0.468   2.119   1.00 45.95  ? 178  ALA B CB    1 
ATOM   4271 N  N     . THR B 1 179 ? 35.533  2.852   3.471   1.00 46.46  ? 179  THR B N     1 
ATOM   4272 C  CA    . THR B 1 179 ? 35.625  3.706   4.666   1.00 46.41  ? 179  THR B CA    1 
ATOM   4273 C  C     . THR B 1 179 ? 36.220  2.917   5.826   1.00 46.64  ? 179  THR B C     1 
ATOM   4274 O  O     . THR B 1 179 ? 35.912  1.745   5.998   1.00 46.52  ? 179  THR B O     1 
ATOM   4275 C  CB    . THR B 1 179 ? 34.263  4.335   5.043   1.00 46.39  ? 179  THR B CB    1 
ATOM   4276 O  OG1   . THR B 1 179 ? 34.271  5.726   4.692   1.00 46.45  ? 179  THR B OG1   1 
ATOM   4277 C  CG2   . THR B 1 179 ? 33.976  4.211   6.525   1.00 45.86  ? 179  THR B CG2   1 
ATOM   4278 N  N     . SER B 1 180 ? 37.078  3.564   6.611   1.00 47.23  ? 180  SER B N     1 
ATOM   4279 C  CA    . SER B 1 180 ? 37.794  2.900   7.715   1.00 47.53  ? 180  SER B CA    1 
ATOM   4280 C  C     . SER B 1 180 ? 37.235  3.285   9.073   1.00 47.72  ? 180  SER B C     1 
ATOM   4281 O  O     . SER B 1 180 ? 36.818  4.416   9.272   1.00 47.97  ? 180  SER B O     1 
ATOM   4282 C  CB    . SER B 1 180 ? 39.274  3.250   7.668   1.00 47.54  ? 180  SER B CB    1 
ATOM   4283 O  OG    . SER B 1 180 ? 39.460  4.656   7.745   1.00 47.46  ? 180  SER B OG    1 
ATOM   4284 N  N     . THR B 1 181 ? 37.251  2.350   10.013  1.00 48.03  ? 181  THR B N     1 
ATOM   4285 C  CA    . THR B 1 181 ? 36.602  2.553   11.302  1.00 48.60  ? 181  THR B CA    1 
ATOM   4286 C  C     . THR B 1 181 ? 37.533  2.189   12.446  1.00 48.82  ? 181  THR B C     1 
ATOM   4287 O  O     . THR B 1 181 ? 38.146  1.127   12.438  1.00 48.76  ? 181  THR B O     1 
ATOM   4288 C  CB    . THR B 1 181 ? 35.347  1.694   11.403  1.00 48.66  ? 181  THR B CB    1 
ATOM   4289 O  OG1   . THR B 1 181 ? 34.855  1.409   10.085  1.00 49.41  ? 181  THR B OG1   1 
ATOM   4290 C  CG2   . THR B 1 181 ? 34.280  2.414   12.198  1.00 49.36  ? 181  THR B CG2   1 
ATOM   4291 N  N     . ALA B 1 182 ? 37.645  3.066   13.435  1.00 49.43  ? 182  ALA B N     1 
ATOM   4292 C  CA    . ALA B 1 182 ? 38.620  2.847   14.504  1.00 50.11  ? 182  ALA B CA    1 
ATOM   4293 C  C     . ALA B 1 182 ? 38.189  1.741   15.445  1.00 50.61  ? 182  ALA B C     1 
ATOM   4294 O  O     . ALA B 1 182 ? 37.106  1.792   16.009  1.00 50.68  ? 182  ALA B O     1 
ATOM   4295 C  CB    . ALA B 1 182 ? 38.886  4.124   15.265  1.00 49.96  ? 182  ALA B CB    1 
ATOM   4296 N  N     . ARG B 1 183 ? 39.060  0.755   15.615  1.00 51.52  ? 183  ARG B N     1 
ATOM   4297 C  CA    . ARG B 1 183 ? 38.778  -0.439  16.396  1.00 52.75  ? 183  ARG B CA    1 
ATOM   4298 C  C     . ARG B 1 183 ? 38.200  -0.116  17.775  1.00 53.85  ? 183  ARG B C     1 
ATOM   4299 O  O     . ARG B 1 183 ? 38.503  0.937   18.344  1.00 54.09  ? 183  ARG B O     1 
ATOM   4300 C  CB    . ARG B 1 183 ? 40.053  -1.270  16.536  1.00 52.66  ? 183  ARG B CB    1 
ATOM   4301 C  CG    . ARG B 1 183 ? 39.869  -2.745  16.257  1.00 53.32  ? 183  ARG B CG    1 
ATOM   4302 C  CD    . ARG B 1 183 ? 41.130  -3.346  15.683  1.00 55.31  ? 183  ARG B CD    1 
ATOM   4303 N  NE    . ARG B 1 183 ? 40.817  -4.519  14.871  1.00 58.47  ? 183  ARG B NE    1 
ATOM   4304 C  CZ    . ARG B 1 183 ? 41.691  -5.466  14.519  1.00 60.46  ? 183  ARG B CZ    1 
ATOM   4305 N  NH1   . ARG B 1 183 ? 42.956  -5.401  14.917  1.00 61.47  ? 183  ARG B NH1   1 
ATOM   4306 N  NH2   . ARG B 1 183 ? 41.297  -6.497  13.772  1.00 60.94  ? 183  ARG B NH2   1 
ATOM   4307 N  N     . PRO B 1 184 ? 37.348  -1.013  18.314  1.00 54.94  ? 184  PRO B N     1 
ATOM   4308 C  CA    . PRO B 1 184 ? 36.847  -0.812  19.677  1.00 55.56  ? 184  PRO B CA    1 
ATOM   4309 C  C     . PRO B 1 184 ? 37.926  -1.154  20.697  1.00 56.14  ? 184  PRO B C     1 
ATOM   4310 O  O     . PRO B 1 184 ? 38.686  -2.111  20.484  1.00 56.17  ? 184  PRO B O     1 
ATOM   4311 C  CB    . PRO B 1 184 ? 35.720  -1.843  19.780  1.00 55.81  ? 184  PRO B CB    1 
ATOM   4312 C  CG    . PRO B 1 184 ? 36.132  -2.955  18.833  1.00 55.57  ? 184  PRO B CG    1 
ATOM   4313 C  CD    . PRO B 1 184 ? 36.804  -2.245  17.695  1.00 55.10  ? 184  PRO B CD    1 
ATOM   4314 N  N     . ASN B 1 185 ? 38.009  -0.404  21.794  1.00 56.71  ? 185  ASN B N     1 
ATOM   4315 C  CA    . ASN B 1 185 ? 38.899  -0.839  22.868  1.00 57.29  ? 185  ASN B CA    1 
ATOM   4316 C  C     . ASN B 1 185 ? 38.407  -2.131  23.553  1.00 57.54  ? 185  ASN B C     1 
ATOM   4317 O  O     . ASN B 1 185 ? 37.316  -2.153  24.149  1.00 57.66  ? 185  ASN B O     1 
ATOM   4318 C  CB    . ASN B 1 185 ? 39.151  0.259   23.891  1.00 57.19  ? 185  ASN B CB    1 
ATOM   4319 C  CG    . ASN B 1 185 ? 40.242  -0.125  24.875  1.00 58.21  ? 185  ASN B CG    1 
ATOM   4320 O  OD1   . ASN B 1 185 ? 40.304  -1.272  25.344  1.00 58.47  ? 185  ASN B OD1   1 
ATOM   4321 N  ND2   . ASN B 1 185 ? 41.123  0.826   25.185  1.00 59.40  ? 185  ASN B ND2   1 
ATOM   4322 N  N     . ARG B 1 186 ? 39.219  -3.195  23.465  1.00 57.78  ? 186  ARG B N     1 
ATOM   4323 C  CA    . ARG B 1 186 ? 38.842  -4.537  23.966  1.00 57.89  ? 186  ARG B CA    1 
ATOM   4324 C  C     . ARG B 1 186 ? 38.119  -4.396  25.302  1.00 57.36  ? 186  ARG B C     1 
ATOM   4325 O  O     . ARG B 1 186 ? 37.114  -5.084  25.569  1.00 57.58  ? 186  ARG B O     1 
ATOM   4326 C  CB    . ARG B 1 186 ? 40.059  -5.480  24.151  1.00 58.26  ? 186  ARG B CB    1 
ATOM   4327 C  CG    . ARG B 1 186 ? 41.206  -5.399  23.113  1.00 59.86  ? 186  ARG B CG    1 
ATOM   4328 C  CD    . ARG B 1 186 ? 42.348  -6.414  23.425  1.00 62.06  ? 186  ARG B CD    1 
ATOM   4329 N  NE    . ARG B 1 186 ? 43.684  -5.811  23.281  1.00 63.30  ? 186  ARG B NE    1 
ATOM   4330 C  CZ    . ARG B 1 186 ? 44.848  -6.450  23.433  1.00 63.41  ? 186  ARG B CZ    1 
ATOM   4331 N  NH1   . ARG B 1 186 ? 44.880  -7.750  23.724  1.00 63.35  ? 186  ARG B NH1   1 
ATOM   4332 N  NH2   . ARG B 1 186 ? 45.989  -5.780  23.276  1.00 63.03  ? 186  ARG B NH2   1 
ATOM   4333 N  N     . PHE B 1 187 ? 38.636  -3.475  26.117  1.00 56.32  ? 187  PHE B N     1 
ATOM   4334 C  CA    . PHE B 1 187 ? 38.136  -3.248  27.455  1.00 55.37  ? 187  PHE B CA    1 
ATOM   4335 C  C     . PHE B 1 187 ? 37.999  -1.769  27.801  1.00 54.61  ? 187  PHE B C     1 
ATOM   4336 O  O     . PHE B 1 187 ? 38.787  -1.219  28.571  1.00 54.35  ? 187  PHE B O     1 
ATOM   4337 C  CB    . PHE B 1 187 ? 39.022  -3.971  28.469  1.00 55.52  ? 187  PHE B CB    1 
ATOM   4338 C  CG    . PHE B 1 187 ? 40.477  -4.066  28.066  1.00 55.26  ? 187  PHE B CG    1 
ATOM   4339 C  CD1   . PHE B 1 187 ? 41.012  -5.281  27.630  1.00 54.97  ? 187  PHE B CD1   1 
ATOM   4340 C  CD2   . PHE B 1 187 ? 41.316  -2.964  28.153  1.00 54.89  ? 187  PHE B CD2   1 
ATOM   4341 C  CE1   . PHE B 1 187 ? 42.349  -5.400  27.276  1.00 53.71  ? 187  PHE B CE1   1 
ATOM   4342 C  CE2   . PHE B 1 187 ? 42.647  -3.073  27.798  1.00 54.95  ? 187  PHE B CE2   1 
ATOM   4343 C  CZ    . PHE B 1 187 ? 43.164  -4.304  27.358  1.00 54.40  ? 187  PHE B CZ    1 
ATOM   4344 N  N     . GLY B 1 188 ? 36.983  -1.129  27.233  1.00 53.84  ? 188  GLY B N     1 
ATOM   4345 C  CA    . GLY B 1 188 ? 36.710  0.272   27.533  1.00 52.90  ? 188  GLY B CA    1 
ATOM   4346 C  C     . GLY B 1 188 ? 35.877  0.365   28.791  1.00 52.19  ? 188  GLY B C     1 
ATOM   4347 O  O     . GLY B 1 188 ? 35.965  -0.501  29.665  1.00 52.11  ? 188  GLY B O     1 
ATOM   4348 N  N     . LYS B 1 189 ? 35.084  1.430   28.887  1.00 51.40  ? 189  LYS B N     1 
ATOM   4349 C  CA    . LYS B 1 189 ? 34.006  1.502   29.864  1.00 50.36  ? 189  LYS B CA    1 
ATOM   4350 C  C     . LYS B 1 189 ? 32.874  0.605   29.393  1.00 49.42  ? 189  LYS B C     1 
ATOM   4351 O  O     . LYS B 1 189 ? 32.571  0.557   28.201  1.00 49.41  ? 189  LYS B O     1 
ATOM   4352 C  CB    . LYS B 1 189 ? 33.497  2.931   30.012  1.00 50.54  ? 189  LYS B CB    1 
ATOM   4353 C  CG    . LYS B 1 189 ? 34.367  3.810   30.887  1.00 51.77  ? 189  LYS B CG    1 
ATOM   4354 C  CD    . LYS B 1 189 ? 33.523  4.840   31.645  1.00 53.79  ? 189  LYS B CD    1 
ATOM   4355 C  CE    . LYS B 1 189 ? 34.171  5.222   32.985  1.00 54.58  ? 189  LYS B CE    1 
ATOM   4356 N  NZ    . LYS B 1 189 ? 33.169  5.491   34.074  1.00 55.02  ? 189  LYS B NZ    1 
ATOM   4357 N  N     . LYS B 1 190 ? 32.275  -0.123  30.331  1.00 48.41  ? 190  LYS B N     1 
ATOM   4358 C  CA    . LYS B 1 190 ? 31.080  -0.937  30.074  1.00 47.31  ? 190  LYS B CA    1 
ATOM   4359 C  C     . LYS B 1 190 ? 30.204  -1.044  31.314  1.00 46.45  ? 190  LYS B C     1 
ATOM   4360 O  O     . LYS B 1 190 ? 30.703  -1.205  32.423  1.00 46.39  ? 190  LYS B O     1 
ATOM   4361 C  CB    . LYS B 1 190 ? 31.442  -2.334  29.551  1.00 47.37  ? 190  LYS B CB    1 
ATOM   4362 C  CG    . LYS B 1 190 ? 32.439  -3.113  30.395  1.00 47.64  ? 190  LYS B CG    1 
ATOM   4363 C  CD    . LYS B 1 190 ? 32.569  -4.545  29.905  1.00 48.52  ? 190  LYS B CD    1 
ATOM   4364 C  CE    . LYS B 1 190 ? 33.872  -5.174  30.337  1.00 49.43  ? 190  LYS B CE    1 
ATOM   4365 N  NZ    . LYS B 1 190 ? 35.009  -4.537  29.596  1.00 51.44  ? 190  LYS B NZ    1 
ATOM   4366 N  N     . THR B 1 191 ? 28.898  -0.927  31.122  1.00 45.51  ? 191  THR B N     1 
ATOM   4367 C  CA    . THR B 1 191 ? 27.947  -1.178  32.192  1.00 44.77  ? 191  THR B CA    1 
ATOM   4368 C  C     . THR B 1 191 ? 27.339  -2.536  31.978  1.00 44.54  ? 191  THR B C     1 
ATOM   4369 O  O     . THR B 1 191 ? 27.307  -3.026  30.861  1.00 44.76  ? 191  THR B O     1 
ATOM   4370 C  CB    . THR B 1 191 ? 26.840  -0.153  32.206  1.00 44.58  ? 191  THR B CB    1 
ATOM   4371 O  OG1   . THR B 1 191 ? 26.422  0.110   30.864  1.00 43.43  ? 191  THR B OG1   1 
ATOM   4372 C  CG2   . THR B 1 191 ? 27.348  1.116   32.824  1.00 44.89  ? 191  THR B CG2   1 
ATOM   4373 N  N     . MET B 1 192 ? 26.849  -3.149  33.040  1.00 44.22  ? 192  MET B N     1 
ATOM   4374 C  CA    . MET B 1 192 ? 26.383  -4.512  32.929  1.00 44.18  ? 192  MET B CA    1 
ATOM   4375 C  C     . MET B 1 192 ? 24.920  -4.602  33.272  1.00 43.87  ? 192  MET B C     1 
ATOM   4376 O  O     . MET B 1 192 ? 24.536  -4.465  34.422  1.00 44.04  ? 192  MET B O     1 
ATOM   4377 C  CB    . MET B 1 192 ? 27.207  -5.409  33.829  1.00 44.41  ? 192  MET B CB    1 
ATOM   4378 C  CG    . MET B 1 192 ? 27.244  -6.830  33.382  1.00 45.50  ? 192  MET B CG    1 
ATOM   4379 S  SD    . MET B 1 192 ? 26.400  -7.888  34.548  1.00 48.69  ? 192  MET B SD    1 
ATOM   4380 C  CE    . MET B 1 192 ? 27.181  -9.460  34.127  1.00 49.12  ? 192  MET B CE    1 
ATOM   4381 N  N     . LEU B 1 193 ? 24.107  -4.843  32.258  1.00 43.70  ? 193  LEU B N     1 
ATOM   4382 C  CA    . LEU B 1 193 ? 22.663  -4.770  32.399  1.00 43.48  ? 193  LEU B CA    1 
ATOM   4383 C  C     . LEU B 1 193 ? 22.052  -6.079  32.888  1.00 43.35  ? 193  LEU B C     1 
ATOM   4384 O  O     . LEU B 1 193 ? 22.186  -7.117  32.226  1.00 43.32  ? 193  LEU B O     1 
ATOM   4385 C  CB    . LEU B 1 193 ? 22.033  -4.363  31.066  1.00 43.49  ? 193  LEU B CB    1 
ATOM   4386 C  CG    . LEU B 1 193 ? 20.524  -4.144  31.039  1.00 43.46  ? 193  LEU B CG    1 
ATOM   4387 C  CD1   . LEU B 1 193 ? 20.142  -3.136  32.090  1.00 43.93  ? 193  LEU B CD1   1 
ATOM   4388 C  CD2   . LEU B 1 193 ? 20.074  -3.680  29.666  1.00 43.58  ? 193  LEU B CD2   1 
ATOM   4389 N  N     . CYS B 1 194 ? 21.390  -6.013  34.049  1.00 42.90  ? 194  CYS B N     1 
ATOM   4390 C  CA    . CYS B 1 194 ? 20.579  -7.118  34.571  1.00 42.44  ? 194  CYS B CA    1 
ATOM   4391 C  C     . CYS B 1 194 ? 19.111  -6.770  34.403  1.00 41.90  ? 194  CYS B C     1 
ATOM   4392 O  O     . CYS B 1 194 ? 18.647  -5.770  34.949  1.00 42.04  ? 194  CYS B O     1 
ATOM   4393 C  CB    . CYS B 1 194 ? 20.865  -7.355  36.045  1.00 42.43  ? 194  CYS B CB    1 
ATOM   4394 S  SG    . CYS B 1 194 ? 22.569  -7.724  36.394  1.00 43.72  ? 194  CYS B SG    1 
ATOM   4395 N  N     . VAL B 1 195 ? 18.385  -7.592  33.652  1.00 41.11  ? 195  VAL B N     1 
ATOM   4396 C  CA    . VAL B 1 195 ? 16.991  -7.308  33.338  1.00 40.14  ? 195  VAL B CA    1 
ATOM   4397 C  C     . VAL B 1 195 ? 16.109  -8.556  33.477  1.00 40.09  ? 195  VAL B C     1 
ATOM   4398 O  O     . VAL B 1 195 ? 16.561  -9.687  33.271  1.00 40.00  ? 195  VAL B O     1 
ATOM   4399 C  CB    . VAL B 1 195 ? 16.871  -6.688  31.946  1.00 39.70  ? 195  VAL B CB    1 
ATOM   4400 C  CG1   . VAL B 1 195 ? 17.430  -7.622  30.914  1.00 39.52  ? 195  VAL B CG1   1 
ATOM   4401 C  CG2   . VAL B 1 195 ? 15.440  -6.328  31.634  1.00 39.36  ? 195  VAL B CG2   1 
ATOM   4402 N  N     . TRP B 1 196 ? 14.861  -8.329  33.875  1.00 39.76  ? 196  TRP B N     1 
ATOM   4403 C  CA    . TRP B 1 196 ? 13.870  -9.372  33.990  1.00 39.47  ? 196  TRP B CA    1 
ATOM   4404 C  C     . TRP B 1 196 ? 12.584  -8.887  33.341  1.00 39.66  ? 196  TRP B C     1 
ATOM   4405 O  O     . TRP B 1 196 ? 12.283  -7.695  33.359  1.00 39.58  ? 196  TRP B O     1 
ATOM   4406 C  CB    . TRP B 1 196 ? 13.636  -9.713  35.450  1.00 39.38  ? 196  TRP B CB    1 
ATOM   4407 C  CG    . TRP B 1 196 ? 14.808  -10.341 36.076  1.00 39.25  ? 196  TRP B CG    1 
ATOM   4408 C  CD1   . TRP B 1 196 ? 15.076  -11.677 36.164  1.00 39.82  ? 196  TRP B CD1   1 
ATOM   4409 C  CD2   . TRP B 1 196 ? 15.899  -9.669  36.701  1.00 39.14  ? 196  TRP B CD2   1 
ATOM   4410 N  NE1   . TRP B 1 196 ? 16.272  -11.883 36.815  1.00 39.78  ? 196  TRP B NE1   1 
ATOM   4411 C  CE2   . TRP B 1 196 ? 16.802  -10.663 37.147  1.00 39.49  ? 196  TRP B CE2   1 
ATOM   4412 C  CE3   . TRP B 1 196 ? 16.207  -8.323  36.928  1.00 38.65  ? 196  TRP B CE3   1 
ATOM   4413 C  CZ2   . TRP B 1 196 ? 17.997  -10.349 37.800  1.00 39.04  ? 196  TRP B CZ2   1 
ATOM   4414 C  CZ3   . TRP B 1 196 ? 17.395  -8.014  37.581  1.00 38.72  ? 196  TRP B CZ3   1 
ATOM   4415 C  CH2   . TRP B 1 196 ? 18.273  -9.023  38.011  1.00 38.69  ? 196  TRP B CH2   1 
ATOM   4416 N  N     . TRP B 1 197 ? 11.833  -9.822  32.768  1.00 40.03  ? 197  TRP B N     1 
ATOM   4417 C  CA    . TRP B 1 197 ? 10.655  -9.514  31.961  1.00 40.27  ? 197  TRP B CA    1 
ATOM   4418 C  C     . TRP B 1 197 ? 9.765   -10.740 31.823  1.00 40.88  ? 197  TRP B C     1 
ATOM   4419 O  O     . TRP B 1 197 ? 10.205  -11.863 32.091  1.00 40.83  ? 197  TRP B O     1 
ATOM   4420 C  CB    . TRP B 1 197 ? 11.076  -9.044  30.572  1.00 39.85  ? 197  TRP B CB    1 
ATOM   4421 C  CG    . TRP B 1 197 ? 11.928  -10.047 29.788  1.00 39.29  ? 197  TRP B CG    1 
ATOM   4422 C  CD1   . TRP B 1 197 ? 13.190  -10.495 30.100  1.00 38.35  ? 197  TRP B CD1   1 
ATOM   4423 C  CD2   . TRP B 1 197 ? 11.581  -10.682 28.552  1.00 38.32  ? 197  TRP B CD2   1 
ATOM   4424 N  NE1   . TRP B 1 197 ? 13.634  -11.373 29.145  1.00 37.21  ? 197  TRP B NE1   1 
ATOM   4425 C  CE2   . TRP B 1 197 ? 12.667  -11.503 28.183  1.00 37.63  ? 197  TRP B CE2   1 
ATOM   4426 C  CE3   . TRP B 1 197 ? 10.453  -10.641 27.721  1.00 37.59  ? 197  TRP B CE3   1 
ATOM   4427 C  CZ2   . TRP B 1 197 ? 12.651  -12.272 27.029  1.00 37.13  ? 197  TRP B CZ2   1 
ATOM   4428 C  CZ3   . TRP B 1 197 ? 10.444  -11.407 26.572  1.00 36.20  ? 197  TRP B CZ3   1 
ATOM   4429 C  CH2   . TRP B 1 197 ? 11.531  -12.208 26.238  1.00 36.42  ? 197  TRP B CH2   1 
ATOM   4430 N  N     . ASP B 1 198 ? 8.516   -10.501 31.417  1.00 41.68  ? 198  ASP B N     1 
ATOM   4431 C  CA    . ASP B 1 198 ? 7.552   -11.546 31.053  1.00 42.47  ? 198  ASP B CA    1 
ATOM   4432 C  C     . ASP B 1 198 ? 6.786   -11.089 29.817  1.00 42.91  ? 198  ASP B C     1 
ATOM   4433 O  O     . ASP B 1 198 ? 7.034   -9.989  29.325  1.00 43.10  ? 198  ASP B O     1 
ATOM   4434 C  CB    . ASP B 1 198 ? 6.596   -11.853 32.210  1.00 42.65  ? 198  ASP B CB    1 
ATOM   4435 C  CG    . ASP B 1 198 ? 5.598   -10.725 32.482  1.00 43.01  ? 198  ASP B CG    1 
ATOM   4436 O  OD1   . ASP B 1 198 ? 5.643   -9.673  31.787  1.00 42.32  ? 198  ASP B OD1   1 
ATOM   4437 O  OD2   . ASP B 1 198 ? 4.761   -10.912 33.407  1.00 43.13  ? 198  ASP B OD2   1 
ATOM   4438 N  N     . GLN B 1 199 ? 5.853   -11.904 29.327  1.00 43.51  ? 199  GLN B N     1 
ATOM   4439 C  CA    . GLN B 1 199 ? 5.213   -11.640 28.025  1.00 44.30  ? 199  GLN B CA    1 
ATOM   4440 C  C     . GLN B 1 199 ? 4.571   -10.250 27.878  1.00 44.84  ? 199  GLN B C     1 
ATOM   4441 O  O     . GLN B 1 199 ? 4.184   -9.844  26.776  1.00 44.82  ? 199  GLN B O     1 
ATOM   4442 C  CB    . GLN B 1 199 ? 4.211   -12.740 27.669  1.00 44.28  ? 199  GLN B CB    1 
ATOM   4443 C  CG    . GLN B 1 199 ? 3.324   -13.176 28.806  1.00 44.48  ? 199  GLN B CG    1 
ATOM   4444 C  CD    . GLN B 1 199 ? 2.008   -13.749 28.324  1.00 44.98  ? 199  GLN B CD    1 
ATOM   4445 O  OE1   . GLN B 1 199 ? 1.949   -14.498 27.342  1.00 44.82  ? 199  GLN B OE1   1 
ATOM   4446 N  NE2   . GLN B 1 199 ? 0.937   -13.400 29.021  1.00 45.32  ? 199  GLN B NE2   1 
ATOM   4447 N  N     . SER B 1 200 ? 4.492   -9.527  28.995  1.00 45.54  ? 200  SER B N     1 
ATOM   4448 C  CA    . SER B 1 200 ? 3.864   -8.203  29.052  1.00 46.06  ? 200  SER B CA    1 
ATOM   4449 C  C     . SER B 1 200 ? 4.877   -7.053  29.040  1.00 46.03  ? 200  SER B C     1 
ATOM   4450 O  O     . SER B 1 200 ? 4.506   -5.886  28.891  1.00 45.92  ? 200  SER B O     1 
ATOM   4451 C  CB    . SER B 1 200 ? 2.964   -8.108  30.291  1.00 46.22  ? 200  SER B CB    1 
ATOM   4452 O  OG    . SER B 1 200 ? 2.048   -9.198  30.351  1.00 46.80  ? 200  SER B OG    1 
ATOM   4453 N  N     . GLY B 1 201 ? 6.150   -7.397  29.199  1.00 46.18  ? 201  GLY B N     1 
ATOM   4454 C  CA    . GLY B 1 201 ? 7.231   -6.425  29.159  1.00 46.38  ? 201  GLY B CA    1 
ATOM   4455 C  C     . GLY B 1 201 ? 8.183   -6.519  30.335  1.00 46.55  ? 201  GLY B C     1 
ATOM   4456 O  O     . GLY B 1 201 ? 8.024   -7.359  31.221  1.00 46.57  ? 201  GLY B O     1 
ATOM   4457 N  N     . VAL B 1 202 ? 9.178   -5.643  30.328  1.00 46.72  ? 202  VAL B N     1 
ATOM   4458 C  CA    . VAL B 1 202 ? 10.154  -5.539  31.405  1.00 47.00  ? 202  VAL B CA    1 
ATOM   4459 C  C     . VAL B 1 202 ? 9.516   -5.341  32.791  1.00 47.19  ? 202  VAL B C     1 
ATOM   4460 O  O     . VAL B 1 202 ? 8.804   -4.368  33.037  1.00 47.11  ? 202  VAL B O     1 
ATOM   4461 C  CB    . VAL B 1 202 ? 11.172  -4.410  31.113  1.00 46.99  ? 202  VAL B CB    1 
ATOM   4462 C  CG1   . VAL B 1 202 ? 10.456  -3.150  30.593  1.00 47.22  ? 202  VAL B CG1   1 
ATOM   4463 C  CG2   . VAL B 1 202 ? 12.029  -4.109  32.351  1.00 46.79  ? 202  VAL B CG2   1 
ATOM   4464 N  N     . ILE B 1 203 ? 9.787   -6.288  33.680  1.00 47.50  ? 203  ILE B N     1 
ATOM   4465 C  CA    . ILE B 1 203 ? 9.335   -6.240  35.070  1.00 47.70  ? 203  ILE B CA    1 
ATOM   4466 C  C     . ILE B 1 203 ? 10.230  -5.307  35.887  1.00 48.18  ? 203  ILE B C     1 
ATOM   4467 O  O     . ILE B 1 203 ? 9.755   -4.415  36.588  1.00 47.93  ? 203  ILE B O     1 
ATOM   4468 C  CB    . ILE B 1 203 ? 9.361   -7.668  35.695  1.00 47.45  ? 203  ILE B CB    1 
ATOM   4469 C  CG1   . ILE B 1 203 ? 8.351   -8.596  35.005  1.00 46.70  ? 203  ILE B CG1   1 
ATOM   4470 C  CG2   . ILE B 1 203 ? 9.145   -7.626  37.196  1.00 47.29  ? 203  ILE B CG2   1 
ATOM   4471 C  CD1   . ILE B 1 203 ? 6.910   -8.183  35.134  1.00 44.90  ? 203  ILE B CD1   1 
ATOM   4472 N  N     . TYR B 1 204 ? 11.533  -5.542  35.774  1.00 49.09  ? 204  TYR B N     1 
ATOM   4473 C  CA    . TYR B 1 204 ? 12.557  -4.829  36.519  1.00 49.93  ? 204  TYR B CA    1 
ATOM   4474 C  C     . TYR B 1 204 ? 13.904  -4.951  35.814  1.00 50.54  ? 204  TYR B C     1 
ATOM   4475 O  O     . TYR B 1 204 ? 14.145  -5.906  35.058  1.00 50.66  ? 204  TYR B O     1 
ATOM   4476 C  CB    . TYR B 1 204 ? 12.684  -5.429  37.901  1.00 49.69  ? 204  TYR B CB    1 
ATOM   4477 C  CG    . TYR B 1 204 ? 13.520  -4.624  38.847  1.00 50.59  ? 204  TYR B CG    1 
ATOM   4478 C  CD1   . TYR B 1 204 ? 14.512  -5.231  39.614  1.00 51.61  ? 204  TYR B CD1   1 
ATOM   4479 C  CD2   . TYR B 1 204 ? 13.313  -3.252  38.996  1.00 51.75  ? 204  TYR B CD2   1 
ATOM   4480 C  CE1   . TYR B 1 204 ? 15.284  -4.493  40.521  1.00 52.67  ? 204  TYR B CE1   1 
ATOM   4481 C  CE2   . TYR B 1 204 ? 14.077  -2.498  39.898  1.00 52.87  ? 204  TYR B CE2   1 
ATOM   4482 C  CZ    . TYR B 1 204 ? 15.062  -3.124  40.656  1.00 53.08  ? 204  TYR B CZ    1 
ATOM   4483 O  OH    . TYR B 1 204 ? 15.819  -2.386  41.542  1.00 53.28  ? 204  TYR B OH    1 
ATOM   4484 N  N     . TYR B 1 205 ? 14.774  -3.973  36.058  1.00 51.12  ? 205  TYR B N     1 
ATOM   4485 C  CA    . TYR B 1 205 ? 16.145  -4.014  35.565  1.00 51.52  ? 205  TYR B CA    1 
ATOM   4486 C  C     . TYR B 1 205 ? 17.004  -3.066  36.362  1.00 52.13  ? 205  TYR B C     1 
ATOM   4487 O  O     . TYR B 1 205 ? 16.530  -2.035  36.836  1.00 52.51  ? 205  TYR B O     1 
ATOM   4488 C  CB    . TYR B 1 205 ? 16.227  -3.643  34.086  1.00 51.32  ? 205  TYR B CB    1 
ATOM   4489 C  CG    . TYR B 1 205 ? 16.280  -2.166  33.827  1.00 50.56  ? 205  TYR B CG    1 
ATOM   4490 C  CD1   . TYR B 1 205 ? 15.119  -1.446  33.594  1.00 50.77  ? 205  TYR B CD1   1 
ATOM   4491 C  CD2   . TYR B 1 205 ? 17.490  -1.491  33.822  1.00 50.28  ? 205  TYR B CD2   1 
ATOM   4492 C  CE1   . TYR B 1 205 ? 15.157  -0.086  33.352  1.00 51.90  ? 205  TYR B CE1   1 
ATOM   4493 C  CE2   . TYR B 1 205 ? 17.547  -0.134  33.592  1.00 51.70  ? 205  TYR B CE2   1 
ATOM   4494 C  CZ    . TYR B 1 205 ? 16.376  0.572   33.351  1.00 52.31  ? 205  TYR B CZ    1 
ATOM   4495 O  OH    . TYR B 1 205 ? 16.425  1.936   33.122  1.00 52.57  ? 205  TYR B OH    1 
ATOM   4496 N  N     . GLU B 1 206 ? 18.273  -3.422  36.496  1.00 52.76  ? 206  GLU B N     1 
ATOM   4497 C  CA    . GLU B 1 206 ? 19.244  -2.570  37.149  1.00 53.41  ? 206  GLU B CA    1 
ATOM   4498 C  C     . GLU B 1 206 ? 20.411  -2.381  36.200  1.00 53.72  ? 206  GLU B C     1 
ATOM   4499 O  O     . GLU B 1 206 ? 20.715  -3.271  35.392  1.00 53.64  ? 206  GLU B O     1 
ATOM   4500 C  CB    . GLU B 1 206 ? 19.734  -3.201  38.449  1.00 53.35  ? 206  GLU B CB    1 
ATOM   4501 C  CG    . GLU B 1 206 ? 18.710  -3.278  39.557  1.00 54.28  ? 206  GLU B CG    1 
ATOM   4502 C  CD    . GLU B 1 206 ? 19.183  -4.152  40.717  1.00 56.65  ? 206  GLU B CD    1 
ATOM   4503 O  OE1   . GLU B 1 206 ? 20.387  -4.508  40.755  1.00 57.20  ? 206  GLU B OE1   1 
ATOM   4504 O  OE2   . GLU B 1 206 ? 18.354  -4.484  41.601  1.00 57.73  ? 206  GLU B OE2   1 
ATOM   4505 N  N     . LEU B 1 207 ? 21.059  -1.223  36.307  1.00 54.17  ? 207  LEU B N     1 
ATOM   4506 C  CA    . LEU B 1 207 ? 22.254  -0.931  35.531  1.00 54.54  ? 207  LEU B CA    1 
ATOM   4507 C  C     . LEU B 1 207 ? 23.478  -0.736  36.421  1.00 55.14  ? 207  LEU B C     1 
ATOM   4508 O  O     . LEU B 1 207 ? 23.659  0.313   37.024  1.00 55.13  ? 207  LEU B O     1 
ATOM   4509 C  CB    . LEU B 1 207 ? 22.021  0.289   34.657  1.00 54.27  ? 207  LEU B CB    1 
ATOM   4510 C  CG    . LEU B 1 207 ? 22.985  0.393   33.494  1.00 53.75  ? 207  LEU B CG    1 
ATOM   4511 C  CD1   . LEU B 1 207 ? 23.258  -0.989  32.897  1.00 53.08  ? 207  LEU B CD1   1 
ATOM   4512 C  CD2   . LEU B 1 207 ? 22.382  1.335   32.484  1.00 53.35  ? 207  LEU B CD2   1 
ATOM   4513 N  N     . LEU B 1 208 ? 24.315  -1.764  36.481  1.00 56.14  ? 208  LEU B N     1 
ATOM   4514 C  CA    . LEU B 1 208 ? 25.480  -1.792  37.357  1.00 57.27  ? 208  LEU B CA    1 
ATOM   4515 C  C     . LEU B 1 208 ? 26.524  -0.751  36.984  1.00 58.27  ? 208  LEU B C     1 
ATOM   4516 O  O     . LEU B 1 208 ? 26.918  -0.647  35.814  1.00 58.53  ? 208  LEU B O     1 
ATOM   4517 C  CB    . LEU B 1 208 ? 26.130  -3.173  37.318  1.00 57.09  ? 208  LEU B CB    1 
ATOM   4518 C  CG    . LEU B 1 208 ? 25.659  -4.229  38.313  1.00 57.35  ? 208  LEU B CG    1 
ATOM   4519 C  CD1   . LEU B 1 208 ? 24.201  -4.594  38.121  1.00 57.53  ? 208  LEU B CD1   1 
ATOM   4520 C  CD2   . LEU B 1 208 ? 26.524  -5.468  38.189  1.00 58.01  ? 208  LEU B CD2   1 
ATOM   4521 N  N     . LYS B 1 209 ? 26.972  0.005   37.990  1.00 59.32  ? 209  LYS B N     1 
ATOM   4522 C  CA    . LYS B 1 209 ? 28.064  0.973   37.836  1.00 60.05  ? 209  LYS B CA    1 
ATOM   4523 C  C     . LYS B 1 209 ? 29.274  0.272   37.185  1.00 60.39  ? 209  LYS B C     1 
ATOM   4524 O  O     . LYS B 1 209 ? 29.612  -0.860  37.559  1.00 60.32  ? 209  LYS B O     1 
ATOM   4525 C  CB    . LYS B 1 209 ? 28.466  1.591   39.189  1.00 60.13  ? 209  LYS B CB    1 
ATOM   4526 C  CG    . LYS B 1 209 ? 27.378  1.634   40.281  1.00 60.92  ? 209  LYS B CG    1 
ATOM   4527 C  CD    . LYS B 1 209 ? 27.971  2.147   41.615  1.00 62.33  ? 209  LYS B CD    1 
ATOM   4528 C  CE    . LYS B 1 209 ? 27.495  1.369   42.862  1.00 62.05  ? 209  LYS B CE    1 
ATOM   4529 N  NZ    . LYS B 1 209 ? 26.118  1.699   43.325  1.00 61.83  ? 209  LYS B NZ    1 
ATOM   4530 N  N     . PRO B 1 210 ? 29.913  0.930   36.193  1.00 60.72  ? 210  PRO B N     1 
ATOM   4531 C  CA    . PRO B 1 210 ? 31.030  0.308   35.470  1.00 60.96  ? 210  PRO B CA    1 
ATOM   4532 C  C     . PRO B 1 210 ? 31.970  -0.517  36.372  1.00 61.21  ? 210  PRO B C     1 
ATOM   4533 O  O     . PRO B 1 210 ? 32.310  -0.088  37.482  1.00 60.99  ? 210  PRO B O     1 
ATOM   4534 C  CB    . PRO B 1 210 ? 31.753  1.510   34.859  1.00 60.97  ? 210  PRO B CB    1 
ATOM   4535 C  CG    . PRO B 1 210 ? 30.657  2.512   34.623  1.00 60.75  ? 210  PRO B CG    1 
ATOM   4536 C  CD    . PRO B 1 210 ? 29.604  2.281   35.676  1.00 60.64  ? 210  PRO B CD    1 
ATOM   4537 N  N     . GLY B 1 211 ? 32.362  -1.698  35.892  1.00 61.54  ? 211  GLY B N     1 
ATOM   4538 C  CA    . GLY B 1 211 ? 33.183  -2.621  36.666  1.00 61.85  ? 211  GLY B CA    1 
ATOM   4539 C  C     . GLY B 1 211 ? 32.466  -3.022  37.940  1.00 62.16  ? 211  GLY B C     1 
ATOM   4540 O  O     . GLY B 1 211 ? 32.976  -2.813  39.040  1.00 62.20  ? 211  GLY B O     1 
ATOM   4541 N  N     . GLU B 1 212 ? 31.268  -3.583  37.788  1.00 62.45  ? 212  GLU B N     1 
ATOM   4542 C  CA    . GLU B 1 212 ? 30.483  -4.048  38.938  1.00 62.54  ? 212  GLU B CA    1 
ATOM   4543 C  C     . GLU B 1 212 ? 30.102  -5.541  38.867  1.00 62.35  ? 212  GLU B C     1 
ATOM   4544 O  O     . GLU B 1 212 ? 29.556  -6.032  37.863  1.00 62.25  ? 212  GLU B O     1 
ATOM   4545 C  CB    . GLU B 1 212 ? 29.234  -3.190  39.106  1.00 62.74  ? 212  GLU B CB    1 
ATOM   4546 C  CG    . GLU B 1 212 ? 28.573  -3.310  40.467  1.00 63.12  ? 212  GLU B CG    1 
ATOM   4547 C  CD    . GLU B 1 212 ? 28.629  -2.027  41.262  1.00 63.22  ? 212  GLU B CD    1 
ATOM   4548 O  OE1   . GLU B 1 212 ? 27.571  -1.371  41.375  1.00 62.33  ? 212  GLU B OE1   1 
ATOM   4549 O  OE2   . GLU B 1 212 ? 29.722  -1.680  41.765  1.00 63.81  ? 212  GLU B OE2   1 
ATOM   4550 N  N     . THR B 1 213 ? 30.384  -6.247  39.958  1.00 61.90  ? 213  THR B N     1 
ATOM   4551 C  CA    . THR B 1 213 ? 30.231  -7.696  40.008  1.00 61.34  ? 213  THR B CA    1 
ATOM   4552 C  C     . THR B 1 213 ? 28.844  -8.091  40.529  1.00 60.94  ? 213  THR B C     1 
ATOM   4553 O  O     . THR B 1 213 ? 28.154  -7.272  41.147  1.00 61.13  ? 213  THR B O     1 
ATOM   4554 C  CB    . THR B 1 213 ? 31.367  -8.323  40.870  1.00 61.43  ? 213  THR B CB    1 
ATOM   4555 O  OG1   . THR B 1 213 ? 31.560  -9.699  40.515  1.00 60.97  ? 213  THR B OG1   1 
ATOM   4556 C  CG2   . THR B 1 213 ? 31.087  -8.167  42.388  1.00 61.27  ? 213  THR B CG2   1 
ATOM   4557 N  N     . VAL B 1 214 ? 28.442  -9.338  40.275  1.00 60.17  ? 214  VAL B N     1 
ATOM   4558 C  CA    . VAL B 1 214 ? 27.175  -9.878  40.788  1.00 59.28  ? 214  VAL B CA    1 
ATOM   4559 C  C     . VAL B 1 214 ? 27.388  -11.221 41.517  1.00 58.75  ? 214  VAL B C     1 
ATOM   4560 O  O     . VAL B 1 214 ? 27.487  -12.282 40.899  1.00 58.57  ? 214  VAL B O     1 
ATOM   4561 C  CB    . VAL B 1 214 ? 26.094  -9.941  39.670  1.00 59.21  ? 214  VAL B CB    1 
ATOM   4562 C  CG1   . VAL B 1 214 ? 26.190  -11.226 38.846  1.00 59.50  ? 214  VAL B CG1   1 
ATOM   4563 C  CG2   . VAL B 1 214 ? 24.721  -9.786  40.248  1.00 59.05  ? 214  VAL B CG2   1 
ATOM   4564 N  N     . ASN B 1 215 ? 27.478  -11.153 42.841  1.00 58.26  ? 215  ASN B N     1 
ATOM   4565 C  CA    . ASN B 1 215 ? 27.853  -12.311 43.664  1.00 57.90  ? 215  ASN B CA    1 
ATOM   4566 C  C     . ASN B 1 215 ? 26.676  -12.872 44.459  1.00 57.43  ? 215  ASN B C     1 
ATOM   4567 O  O     . ASN B 1 215 ? 25.706  -12.151 44.714  1.00 57.23  ? 215  ASN B O     1 
ATOM   4568 C  CB    . ASN B 1 215 ? 29.008  -11.941 44.597  1.00 58.04  ? 215  ASN B CB    1 
ATOM   4569 C  CG    . ASN B 1 215 ? 28.739  -10.662 45.378  1.00 58.72  ? 215  ASN B CG    1 
ATOM   4570 O  OD1   . ASN B 1 215 ? 27.952  -10.660 46.327  1.00 59.38  ? 215  ASN B OD1   1 
ATOM   4571 N  ND2   . ASN B 1 215 ? 29.394  -9.566  44.978  1.00 59.14  ? 215  ASN B ND2   1 
ATOM   4572 N  N     . ALA B 1 216 ? 26.769  -14.147 44.853  1.00 56.79  ? 216  ALA B N     1 
ATOM   4573 C  CA    . ALA B 1 216 ? 25.631  -14.869 45.416  1.00 56.33  ? 216  ALA B CA    1 
ATOM   4574 C  C     . ALA B 1 216 ? 24.792  -13.894 46.209  1.00 56.33  ? 216  ALA B C     1 
ATOM   4575 O  O     . ALA B 1 216 ? 23.595  -13.768 45.975  1.00 56.34  ? 216  ALA B O     1 
ATOM   4576 C  CB    . ALA B 1 216 ? 26.078  -16.052 46.274  1.00 55.99  ? 216  ALA B CB    1 
ATOM   4577 N  N     . ALA B 1 217 ? 25.451  -13.155 47.097  1.00 56.48  ? 217  ALA B N     1 
ATOM   4578 C  CA    . ALA B 1 217 ? 24.786  -12.211 47.991  1.00 56.53  ? 217  ALA B CA    1 
ATOM   4579 C  C     . ALA B 1 217 ? 24.100  -11.038 47.265  1.00 56.49  ? 217  ALA B C     1 
ATOM   4580 O  O     . ALA B 1 217 ? 22.959  -10.686 47.585  1.00 56.49  ? 217  ALA B O     1 
ATOM   4581 C  CB    . ALA B 1 217 ? 25.775  -11.711 49.052  1.00 56.52  ? 217  ALA B CB    1 
ATOM   4582 N  N     . ARG B 1 218 ? 24.795  -10.446 46.294  1.00 56.40  ? 218  ARG B N     1 
ATOM   4583 C  CA    . ARG B 1 218 ? 24.271  -9.313  45.537  1.00 56.39  ? 218  ARG B CA    1 
ATOM   4584 C  C     . ARG B 1 218 ? 23.086  -9.719  44.685  1.00 56.26  ? 218  ARG B C     1 
ATOM   4585 O  O     . ARG B 1 218 ? 22.167  -8.923  44.476  1.00 56.34  ? 218  ARG B O     1 
ATOM   4586 C  CB    . ARG B 1 218 ? 25.357  -8.720  44.640  1.00 56.57  ? 218  ARG B CB    1 
ATOM   4587 C  CG    . ARG B 1 218 ? 24.849  -8.214  43.284  1.00 57.02  ? 218  ARG B CG    1 
ATOM   4588 C  CD    . ARG B 1 218 ? 24.475  -6.738  43.275  1.00 57.65  ? 218  ARG B CD    1 
ATOM   4589 N  NE    . ARG B 1 218 ? 25.678  -5.901  43.304  1.00 58.35  ? 218  ARG B NE    1 
ATOM   4590 C  CZ    . ARG B 1 218 ? 25.731  -4.627  42.925  1.00 58.09  ? 218  ARG B CZ    1 
ATOM   4591 N  NH1   . ARG B 1 218 ? 24.647  -4.009  42.466  1.00 58.24  ? 218  ARG B NH1   1 
ATOM   4592 N  NH2   . ARG B 1 218 ? 26.879  -3.973  43.007  1.00 57.68  ? 218  ARG B NH2   1 
ATOM   4593 N  N     . TYR B 1 219 ? 23.125  -10.952 44.180  1.00 56.11  ? 219  TYR B N     1 
ATOM   4594 C  CA    . TYR B 1 219 ? 22.057  -11.481 43.330  1.00 55.93  ? 219  TYR B CA    1 
ATOM   4595 C  C     . TYR B 1 219 ? 20.730  -11.544 44.087  1.00 55.99  ? 219  TYR B C     1 
ATOM   4596 O  O     . TYR B 1 219 ? 19.721  -11.012 43.622  1.00 56.01  ? 219  TYR B O     1 
ATOM   4597 C  CB    . TYR B 1 219 ? 22.435  -12.862 42.774  1.00 55.73  ? 219  TYR B CB    1 
ATOM   4598 C  CG    . TYR B 1 219 ? 21.489  -13.394 41.715  1.00 55.27  ? 219  TYR B CG    1 
ATOM   4599 C  CD1   . TYR B 1 219 ? 21.013  -12.565 40.706  1.00 54.75  ? 219  TYR B CD1   1 
ATOM   4600 C  CD2   . TYR B 1 219 ? 21.087  -14.734 41.711  1.00 55.11  ? 219  TYR B CD2   1 
ATOM   4601 C  CE1   . TYR B 1 219 ? 20.155  -13.048 39.726  1.00 55.00  ? 219  TYR B CE1   1 
ATOM   4602 C  CE2   . TYR B 1 219 ? 20.219  -15.227 40.730  1.00 54.62  ? 219  TYR B CE2   1 
ATOM   4603 C  CZ    . TYR B 1 219 ? 19.760  -14.374 39.739  1.00 54.67  ? 219  TYR B CZ    1 
ATOM   4604 O  OH    . TYR B 1 219 ? 18.910  -14.820 38.746  1.00 55.02  ? 219  TYR B OH    1 
ATOM   4605 N  N     . GLN B 1 220 ? 20.752  -12.185 45.258  1.00 55.90  ? 220  GLN B N     1 
ATOM   4606 C  CA    . GLN B 1 220 ? 19.586  -12.299 46.128  1.00 55.70  ? 220  GLN B CA    1 
ATOM   4607 C  C     . GLN B 1 220 ? 18.918  -10.948 46.278  1.00 55.76  ? 220  GLN B C     1 
ATOM   4608 O  O     . GLN B 1 220 ? 17.730  -10.800 45.996  1.00 55.70  ? 220  GLN B O     1 
ATOM   4609 C  CB    . GLN B 1 220 ? 19.998  -12.829 47.497  1.00 55.55  ? 220  GLN B CB    1 
ATOM   4610 C  CG    . GLN B 1 220 ? 20.432  -14.278 47.486  1.00 55.68  ? 220  GLN B CG    1 
ATOM   4611 C  CD    . GLN B 1 220 ? 21.097  -14.712 48.781  1.00 55.96  ? 220  GLN B CD    1 
ATOM   4612 O  OE1   . GLN B 1 220 ? 21.850  -13.955 49.396  1.00 55.82  ? 220  GLN B OE1   1 
ATOM   4613 N  NE2   . GLN B 1 220 ? 20.830  -15.945 49.195  1.00 56.01  ? 220  GLN B NE2   1 
ATOM   4614 N  N     . GLN B 1 221 ? 19.710  -9.966  46.699  1.00 55.94  ? 221  GLN B N     1 
ATOM   4615 C  CA    . GLN B 1 221 ? 19.261  -8.589  46.859  1.00 56.15  ? 221  GLN B CA    1 
ATOM   4616 C  C     . GLN B 1 221 ? 18.465  -8.106  45.649  1.00 55.82  ? 221  GLN B C     1 
ATOM   4617 O  O     . GLN B 1 221 ? 17.446  -7.442  45.809  1.00 55.85  ? 221  GLN B O     1 
ATOM   4618 C  CB    . GLN B 1 221 ? 20.463  -7.670  47.133  1.00 56.47  ? 221  GLN B CB    1 
ATOM   4619 C  CG    . GLN B 1 221 ? 20.138  -6.171  47.292  1.00 57.62  ? 221  GLN B CG    1 
ATOM   4620 C  CD    . GLN B 1 221 ? 19.455  -5.825  48.612  1.00 59.02  ? 221  GLN B CD    1 
ATOM   4621 O  OE1   . GLN B 1 221 ? 18.604  -6.577  49.112  1.00 59.99  ? 221  GLN B OE1   1 
ATOM   4622 N  NE2   . GLN B 1 221 ? 19.821  -4.671  49.180  1.00 58.70  ? 221  GLN B NE2   1 
ATOM   4623 N  N     . GLN B 1 222 ? 18.925  -8.460  44.452  1.00 55.46  ? 222  GLN B N     1 
ATOM   4624 C  CA    . GLN B 1 222 ? 18.228  -8.117  43.212  1.00 55.31  ? 222  GLN B CA    1 
ATOM   4625 C  C     . GLN B 1 222 ? 16.917  -8.886  43.061  1.00 55.08  ? 222  GLN B C     1 
ATOM   4626 O  O     . GLN B 1 222 ? 15.867  -8.301  42.771  1.00 54.77  ? 222  GLN B O     1 
ATOM   4627 C  CB    . GLN B 1 222 ? 19.092  -8.467  42.007  1.00 55.43  ? 222  GLN B CB    1 
ATOM   4628 C  CG    . GLN B 1 222 ? 20.405  -7.747  41.868  1.00 55.52  ? 222  GLN B CG    1 
ATOM   4629 C  CD    . GLN B 1 222 ? 21.085  -8.168  40.592  1.00 55.53  ? 222  GLN B CD    1 
ATOM   4630 O  OE1   . GLN B 1 222 ? 21.478  -9.325  40.442  1.00 55.67  ? 222  GLN B OE1   1 
ATOM   4631 N  NE2   . GLN B 1 222 ? 21.193  -7.245  39.646  1.00 55.44  ? 222  GLN B NE2   1 
ATOM   4632 N  N     . LEU B 1 223 ? 17.012  -10.207 43.219  1.00 54.96  ? 223  LEU B N     1 
ATOM   4633 C  CA    . LEU B 1 223 ? 15.874  -11.103 43.148  1.00 54.80  ? 223  LEU B CA    1 
ATOM   4634 C  C     . LEU B 1 223 ? 14.746  -10.554 43.983  1.00 55.22  ? 223  LEU B C     1 
ATOM   4635 O  O     . LEU B 1 223 ? 13.660  -10.309 43.465  1.00 55.30  ? 223  LEU B O     1 
ATOM   4636 C  CB    . LEU B 1 223 ? 16.264  -12.484 43.653  1.00 54.45  ? 223  LEU B CB    1 
ATOM   4637 C  CG    . LEU B 1 223 ? 16.427  -13.531 42.565  1.00 53.83  ? 223  LEU B CG    1 
ATOM   4638 C  CD1   . LEU B 1 223 ? 17.428  -14.581 42.974  1.00 53.42  ? 223  LEU B CD1   1 
ATOM   4639 C  CD2   . LEU B 1 223 ? 15.086  -14.158 42.280  1.00 53.48  ? 223  LEU B CD2   1 
ATOM   4640 N  N     . ILE B 1 224 ? 15.021  -10.348 45.272  1.00 55.59  ? 224  ILE B N     1 
ATOM   4641 C  CA    . ILE B 1 224 ? 14.071  -9.735  46.202  1.00 55.97  ? 224  ILE B CA    1 
ATOM   4642 C  C     . ILE B 1 224 ? 13.465  -8.447  45.623  1.00 56.32  ? 224  ILE B C     1 
ATOM   4643 O  O     . ILE B 1 224 ? 12.245  -8.332  45.506  1.00 56.41  ? 224  ILE B O     1 
ATOM   4644 C  CB    . ILE B 1 224 ? 14.709  -9.500  47.607  1.00 55.88  ? 224  ILE B CB    1 
ATOM   4645 C  CG1   . ILE B 1 224 ? 14.797  -10.832 48.371  1.00 55.99  ? 224  ILE B CG1   1 
ATOM   4646 C  CG2   . ILE B 1 224 ? 13.908  -8.480  48.406  1.00 55.88  ? 224  ILE B CG2   1 
ATOM   4647 C  CD1   . ILE B 1 224 ? 15.474  -10.775 49.751  1.00 55.85  ? 224  ILE B CD1   1 
ATOM   4648 N  N     . ASN B 1 225 ? 14.320  -7.505  45.231  1.00 56.72  ? 225  ASN B N     1 
ATOM   4649 C  CA    . ASN B 1 225 ? 13.875  -6.224  44.687  1.00 57.10  ? 225  ASN B CA    1 
ATOM   4650 C  C     . ASN B 1 225 ? 13.013  -6.401  43.447  1.00 57.36  ? 225  ASN B C     1 
ATOM   4651 O  O     . ASN B 1 225 ? 12.090  -5.618  43.199  1.00 57.28  ? 225  ASN B O     1 
ATOM   4652 C  CB    . ASN B 1 225 ? 15.079  -5.336  44.390  1.00 57.15  ? 225  ASN B CB    1 
ATOM   4653 C  CG    . ASN B 1 225 ? 15.794  -4.879  45.654  1.00 57.81  ? 225  ASN B CG    1 
ATOM   4654 O  OD1   . ASN B 1 225 ? 16.170  -3.717  45.767  1.00 59.30  ? 225  ASN B OD1   1 
ATOM   4655 N  ND2   . ASN B 1 225 ? 15.978  -5.789  46.612  1.00 57.81  ? 225  ASN B ND2   1 
ATOM   4656 N  N     . LEU B 1 226 ? 13.331  -7.446  42.683  1.00 57.81  ? 226  LEU B N     1 
ATOM   4657 C  CA    . LEU B 1 226 ? 12.535  -7.881  41.541  1.00 58.18  ? 226  LEU B CA    1 
ATOM   4658 C  C     . LEU B 1 226 ? 11.122  -8.227  42.011  1.00 58.67  ? 226  LEU B C     1 
ATOM   4659 O  O     . LEU B 1 226 ? 10.141  -7.631  41.563  1.00 58.59  ? 226  LEU B O     1 
ATOM   4660 C  CB    . LEU B 1 226 ? 13.221  -9.082  40.860  1.00 57.94  ? 226  LEU B CB    1 
ATOM   4661 C  CG    . LEU B 1 226 ? 12.770  -9.769  39.556  1.00 57.42  ? 226  LEU B CG    1 
ATOM   4662 C  CD1   . LEU B 1 226 ? 12.225  -11.156 39.802  1.00 56.70  ? 226  LEU B CD1   1 
ATOM   4663 C  CD2   . LEU B 1 226 ? 11.793  -8.941  38.733  1.00 57.02  ? 226  LEU B CD2   1 
ATOM   4664 N  N     . ASN B 1 227 ? 11.041  -9.167  42.947  1.00 59.34  ? 227  ASN B N     1 
ATOM   4665 C  CA    . ASN B 1 227 ? 9.777   -9.621  43.511  1.00 60.02  ? 227  ASN B CA    1 
ATOM   4666 C  C     . ASN B 1 227 ? 8.961   -8.489  44.127  1.00 60.56  ? 227  ASN B C     1 
ATOM   4667 O  O     . ASN B 1 227 ? 7.736   -8.446  43.997  1.00 60.25  ? 227  ASN B O     1 
ATOM   4668 C  CB    . ASN B 1 227 ? 10.062  -10.687 44.560  1.00 59.96  ? 227  ASN B CB    1 
ATOM   4669 C  CG    . ASN B 1 227 ? 8.814   -11.308 45.117  1.00 60.03  ? 227  ASN B CG    1 
ATOM   4670 O  OD1   . ASN B 1 227 ? 8.833   -11.843 46.218  1.00 60.38  ? 227  ASN B OD1   1 
ATOM   4671 N  ND2   . ASN B 1 227 ? 7.720   -11.249 44.363  1.00 60.15  ? 227  ASN B ND2   1 
ATOM   4672 N  N     . ARG B 1 228 ? 9.665   -7.585  44.803  1.00 61.60  ? 228  ARG B N     1 
ATOM   4673 C  CA    . ARG B 1 228 ? 9.079   -6.389  45.404  1.00 62.60  ? 228  ARG B CA    1 
ATOM   4674 C  C     . ARG B 1 228 ? 8.344   -5.603  44.319  1.00 62.90  ? 228  ARG B C     1 
ATOM   4675 O  O     . ARG B 1 228 ? 7.189   -5.203  44.494  1.00 63.11  ? 228  ARG B O     1 
ATOM   4676 C  CB    . ARG B 1 228 ? 10.184  -5.534  46.059  1.00 62.78  ? 228  ARG B CB    1 
ATOM   4677 C  CG    . ARG B 1 228 ? 9.758   -4.659  47.241  1.00 63.41  ? 228  ARG B CG    1 
ATOM   4678 C  CD    . ARG B 1 228 ? 9.199   -3.306  46.791  1.00 65.15  ? 228  ARG B CD    1 
ATOM   4679 N  NE    . ARG B 1 228 ? 8.831   -2.452  47.923  1.00 66.99  ? 228  ARG B NE    1 
ATOM   4680 C  CZ    . ARG B 1 228 ? 7.766   -2.642  48.707  1.00 67.94  ? 228  ARG B CZ    1 
ATOM   4681 N  NH1   . ARG B 1 228 ? 6.950   -3.668  48.496  1.00 68.32  ? 228  ARG B NH1   1 
ATOM   4682 N  NH2   . ARG B 1 228 ? 7.515   -1.809  49.715  1.00 68.25  ? 228  ARG B NH2   1 
ATOM   4683 N  N     . ALA B 1 229 ? 9.009   -5.415  43.187  1.00 63.15  ? 229  ALA B N     1 
ATOM   4684 C  CA    . ALA B 1 229 ? 8.411   -4.702  42.081  1.00 63.45  ? 229  ALA B CA    1 
ATOM   4685 C  C     . ALA B 1 229 ? 7.432   -5.579  41.279  1.00 63.76  ? 229  ALA B C     1 
ATOM   4686 O  O     . ALA B 1 229 ? 6.664   -5.068  40.460  1.00 63.71  ? 229  ALA B O     1 
ATOM   4687 C  CB    . ALA B 1 229 ? 9.495   -4.121  41.196  1.00 63.35  ? 229  ALA B CB    1 
ATOM   4688 N  N     . LEU B 1 230 ? 7.446   -6.890  41.528  1.00 64.21  ? 230  LEU B N     1 
ATOM   4689 C  CA    . LEU B 1 230 ? 6.567   -7.813  40.800  1.00 64.68  ? 230  LEU B CA    1 
ATOM   4690 C  C     . LEU B 1 230 ? 5.133   -7.748  41.303  1.00 65.18  ? 230  LEU B C     1 
ATOM   4691 O  O     . LEU B 1 230 ? 4.195   -7.829  40.522  1.00 65.17  ? 230  LEU B O     1 
ATOM   4692 C  CB    . LEU B 1 230 ? 7.093   -9.254  40.857  1.00 64.60  ? 230  LEU B CB    1 
ATOM   4693 C  CG    . LEU B 1 230 ? 6.272   -10.380 40.206  1.00 64.30  ? 230  LEU B CG    1 
ATOM   4694 C  CD1   . LEU B 1 230 ? 6.343   -10.338 38.682  1.00 63.74  ? 230  LEU B CD1   1 
ATOM   4695 C  CD2   . LEU B 1 230 ? 6.716   -11.740 40.720  1.00 63.82  ? 230  LEU B CD2   1 
ATOM   4696 N  N     . GLN B 1 231 ? 4.969   -7.604  42.612  1.00 65.98  ? 231  GLN B N     1 
ATOM   4697 C  CA    . GLN B 1 231 ? 3.641   -7.534  43.215  1.00 66.76  ? 231  GLN B CA    1 
ATOM   4698 C  C     . GLN B 1 231 ? 2.967   -6.211  42.860  1.00 67.07  ? 231  GLN B C     1 
ATOM   4699 O  O     . GLN B 1 231 ? 1.739   -6.103  42.856  1.00 66.95  ? 231  GLN B O     1 
ATOM   4700 C  CB    . GLN B 1 231 ? 3.730   -7.723  44.739  1.00 66.93  ? 231  GLN B CB    1 
ATOM   4701 C  CG    . GLN B 1 231 ? 4.621   -8.904  45.212  1.00 67.56  ? 231  GLN B CG    1 
ATOM   4702 C  CD    . GLN B 1 231 ? 4.110   -10.294 44.788  1.00 68.24  ? 231  GLN B CD    1 
ATOM   4703 O  OE1   . GLN B 1 231 ? 3.530   -11.020 45.597  1.00 68.13  ? 231  GLN B OE1   1 
ATOM   4704 N  NE2   . GLN B 1 231 ? 4.339   -10.668 43.523  1.00 68.20  ? 231  GLN B NE2   1 
ATOM   4705 N  N     . ARG B 1 232 ? 3.794   -5.218  42.545  1.00 67.68  ? 232  ARG B N     1 
ATOM   4706 C  CA    . ARG B 1 232 ? 3.333   -3.901  42.140  1.00 68.33  ? 232  ARG B CA    1 
ATOM   4707 C  C     . ARG B 1 232 ? 2.979   -3.879  40.654  1.00 68.81  ? 232  ARG B C     1 
ATOM   4708 O  O     . ARG B 1 232 ? 1.835   -3.593  40.302  1.00 68.78  ? 232  ARG B O     1 
ATOM   4709 C  CB    . ARG B 1 232 ? 4.392   -2.842  42.484  1.00 68.35  ? 232  ARG B CB    1 
ATOM   4710 C  CG    . ARG B 1 232 ? 3.968   -1.390  42.236  1.00 68.73  ? 232  ARG B CG    1 
ATOM   4711 C  CD    . ARG B 1 232 ? 4.935   -0.366  42.866  1.00 68.93  ? 232  ARG B CD    1 
ATOM   4712 N  NE    . ARG B 1 232 ? 6.314   -0.490  42.384  1.00 68.73  ? 232  ARG B NE    1 
ATOM   4713 C  CZ    . ARG B 1 232 ? 6.747   -0.074  41.193  1.00 69.02  ? 232  ARG B CZ    1 
ATOM   4714 N  NH1   . ARG B 1 232 ? 5.914   0.498   40.325  1.00 68.86  ? 232  ARG B NH1   1 
ATOM   4715 N  NH2   . ARG B 1 232 ? 8.023   -0.239  40.863  1.00 69.34  ? 232  ARG B NH2   1 
ATOM   4716 N  N     . LYS B 1 233 ? 3.952   -4.196  39.795  1.00 69.64  ? 233  LYS B N     1 
ATOM   4717 C  CA    . LYS B 1 233 ? 3.763   -4.171  38.330  1.00 70.44  ? 233  LYS B CA    1 
ATOM   4718 C  C     . LYS B 1 233 ? 2.826   -5.289  37.829  1.00 71.20  ? 233  LYS B C     1 
ATOM   4719 O  O     . LYS B 1 233 ? 2.097   -5.098  36.857  1.00 71.27  ? 233  LYS B O     1 
ATOM   4720 C  CB    . LYS B 1 233 ? 5.112   -4.224  37.581  1.00 70.23  ? 233  LYS B CB    1 
ATOM   4721 C  CG    . LYS B 1 233 ? 6.099   -3.073  37.844  1.00 69.80  ? 233  LYS B CG    1 
ATOM   4722 C  CD    . LYS B 1 233 ? 6.145   -2.028  36.713  1.00 69.54  ? 233  LYS B CD    1 
ATOM   4723 C  CE    . LYS B 1 233 ? 7.255   -0.978  36.961  1.00 68.88  ? 233  LYS B CE    1 
ATOM   4724 N  NZ    . LYS B 1 233 ? 7.115   0.264   36.142  1.00 67.68  ? 233  LYS B NZ    1 
ATOM   4725 N  N     . ARG B 1 234 ? 2.861   -6.450  38.486  1.00 72.23  ? 234  ARG B N     1 
ATOM   4726 C  CA    . ARG B 1 234 ? 1.964   -7.571  38.166  1.00 73.23  ? 234  ARG B CA    1 
ATOM   4727 C  C     . ARG B 1 234 ? 1.164   -7.988  39.408  1.00 74.18  ? 234  ARG B C     1 
ATOM   4728 O  O     . ARG B 1 234 ? 1.545   -8.936  40.110  1.00 74.14  ? 234  ARG B O     1 
ATOM   4729 C  CB    . ARG B 1 234 ? 2.741   -8.781  37.620  1.00 73.09  ? 234  ARG B CB    1 
ATOM   4730 C  CG    . ARG B 1 234 ? 3.664   -8.512  36.440  1.00 72.97  ? 234  ARG B CG    1 
ATOM   4731 C  CD    . ARG B 1 234 ? 2.913   -8.297  35.139  1.00 73.09  ? 234  ARG B CD    1 
ATOM   4732 N  NE    . ARG B 1 234 ? 3.824   -8.085  34.015  1.00 73.55  ? 234  ARG B NE    1 
ATOM   4733 C  CZ    . ARG B 1 234 ? 4.166   -6.894  33.522  1.00 73.79  ? 234  ARG B CZ    1 
ATOM   4734 N  NH1   . ARG B 1 234 ? 3.670   -5.780  34.052  1.00 74.10  ? 234  ARG B NH1   1 
ATOM   4735 N  NH2   . ARG B 1 234 ? 5.008   -6.816  32.494  1.00 73.46  ? 234  ARG B NH2   1 
ATOM   4736 N  N     . PRO B 1 235 ? 0.049   -7.281  39.689  1.00 75.20  ? 235  PRO B N     1 
ATOM   4737 C  CA    . PRO B 1 235 ? -0.751  -7.619  40.875  1.00 75.90  ? 235  PRO B CA    1 
ATOM   4738 C  C     . PRO B 1 235 ? -1.454  -8.959  40.684  1.00 76.61  ? 235  PRO B C     1 
ATOM   4739 O  O     . PRO B 1 235 ? -2.050  -9.490  41.619  1.00 76.70  ? 235  PRO B O     1 
ATOM   4740 C  CB    . PRO B 1 235 ? -1.769  -6.475  40.954  1.00 75.86  ? 235  PRO B CB    1 
ATOM   4741 C  CG    . PRO B 1 235 ? -1.914  -6.001  39.540  1.00 75.73  ? 235  PRO B CG    1 
ATOM   4742 C  CD    . PRO B 1 235 ? -0.569  -6.202  38.887  1.00 75.30  ? 235  PRO B CD    1 
ATOM   4743 N  N     . GLU B 1 236 ? -1.361  -9.486  39.465  1.00 77.45  ? 236  GLU B N     1 
ATOM   4744 C  CA    . GLU B 1 236 ? -1.927  -10.769 39.076  1.00 78.37  ? 236  GLU B CA    1 
ATOM   4745 C  C     . GLU B 1 236 ? -1.541  -11.896 40.034  1.00 78.95  ? 236  GLU B C     1 
ATOM   4746 O  O     . GLU B 1 236 ? -2.364  -12.760 40.346  1.00 79.10  ? 236  GLU B O     1 
ATOM   4747 C  CB    . GLU B 1 236 ? -1.466  -11.106 37.656  1.00 78.35  ? 236  GLU B CB    1 
ATOM   4748 C  CG    . GLU B 1 236 ? -2.032  -10.171 36.579  1.00 79.25  ? 236  GLU B CG    1 
ATOM   4749 C  CD    . GLU B 1 236 ? -0.992  -9.716  35.547  1.00 79.96  ? 236  GLU B CD    1 
ATOM   4750 O  OE1   . GLU B 1 236 ? -1.164  -10.002 34.338  1.00 79.70  ? 236  GLU B OE1   1 
ATOM   4751 O  OE2   . GLU B 1 236 ? -0.008  -9.057  35.946  1.00 80.20  ? 236  GLU B OE2   1 
ATOM   4752 N  N     . TYR B 1 237 ? -0.300  -11.861 40.523  1.00 79.72  ? 237  TYR B N     1 
ATOM   4753 C  CA    . TYR B 1 237 ? 0.268   -12.963 41.311  1.00 80.39  ? 237  TYR B CA    1 
ATOM   4754 C  C     . TYR B 1 237 ? -0.111  -12.984 42.798  1.00 80.72  ? 237  TYR B C     1 
ATOM   4755 O  O     . TYR B 1 237 ? 0.365   -13.839 43.547  1.00 80.74  ? 237  TYR B O     1 
ATOM   4756 C  CB    . TYR B 1 237 ? 1.794   -13.034 41.128  1.00 80.47  ? 237  TYR B CB    1 
ATOM   4757 C  CG    . TYR B 1 237 ? 2.232   -13.274 39.689  1.00 80.95  ? 237  TYR B CG    1 
ATOM   4758 C  CD1   . TYR B 1 237 ? 2.167   -14.549 39.114  1.00 81.12  ? 237  TYR B CD1   1 
ATOM   4759 C  CD2   . TYR B 1 237 ? 2.709   -12.223 38.902  1.00 81.35  ? 237  TYR B CD2   1 
ATOM   4760 C  CE1   . TYR B 1 237 ? 2.566   -14.766 37.788  1.00 81.05  ? 237  TYR B CE1   1 
ATOM   4761 C  CE2   . TYR B 1 237 ? 3.112   -12.432 37.580  1.00 81.21  ? 237  TYR B CE2   1 
ATOM   4762 C  CZ    . TYR B 1 237 ? 3.039   -13.702 37.032  1.00 81.09  ? 237  TYR B CZ    1 
ATOM   4763 O  OH    . TYR B 1 237 ? 3.439   -13.896 35.727  1.00 81.11  ? 237  TYR B OH    1 
ATOM   4764 N  N     . GLN B 1 238 ? -0.969  -12.054 43.218  1.00 81.22  ? 238  GLN B N     1 
ATOM   4765 C  CA    . GLN B 1 238 ? -1.524  -12.080 44.576  1.00 81.71  ? 238  GLN B CA    1 
ATOM   4766 C  C     . GLN B 1 238 ? -2.564  -13.191 44.681  1.00 81.92  ? 238  GLN B C     1 
ATOM   4767 O  O     . GLN B 1 238 ? -2.754  -13.772 45.752  1.00 82.02  ? 238  GLN B O     1 
ATOM   4768 C  CB    . GLN B 1 238 ? -2.172  -10.740 44.967  1.00 81.77  ? 238  GLN B CB    1 
ATOM   4769 C  CG    . GLN B 1 238 ? -1.460  -9.475  44.486  1.00 82.17  ? 238  GLN B CG    1 
ATOM   4770 C  CD    . GLN B 1 238 ? 0.016   -9.437  44.836  1.00 82.59  ? 238  GLN B CD    1 
ATOM   4771 O  OE1   . GLN B 1 238 ? 0.390   -9.221  45.993  1.00 82.64  ? 238  GLN B OE1   1 
ATOM   4772 N  NE2   . GLN B 1 238 ? 0.866   -9.631  43.828  1.00 82.48  ? 238  GLN B NE2   1 
ATOM   4773 N  N     . LYS B 1 239 ? -3.229  -13.473 43.560  1.00 82.18  ? 239  LYS B N     1 
ATOM   4774 C  CA    . LYS B 1 239 ? -4.315  -14.450 43.513  1.00 82.44  ? 239  LYS B CA    1 
ATOM   4775 C  C     . LYS B 1 239 ? -3.789  -15.875 43.331  1.00 82.58  ? 239  LYS B C     1 
ATOM   4776 O  O     . LYS B 1 239 ? -3.941  -16.725 44.216  1.00 82.67  ? 239  LYS B O     1 
ATOM   4777 C  CB    . LYS B 1 239 ? -5.314  -14.095 42.399  1.00 82.45  ? 239  LYS B CB    1 
ATOM   4778 C  CG    . LYS B 1 239 ? -6.770  -14.487 42.700  1.00 82.39  ? 239  LYS B CG    1 
ATOM   4779 C  CD    . LYS B 1 239 ? -7.414  -13.539 43.714  1.00 81.85  ? 239  LYS B CD    1 
ATOM   4780 C  CE    . LYS B 1 239 ? -8.858  -13.904 43.978  1.00 81.35  ? 239  LYS B CE    1 
ATOM   4781 N  NZ    . LYS B 1 239 ? -9.546  -12.828 44.731  1.00 80.89  ? 239  LYS B NZ    1 
ATOM   4782 N  N     . ARG B 1 243 ? 1.833   -19.011 41.030  1.00 47.73  ? 243  ARG B N     1 
ATOM   4783 C  CA    . ARG B 1 243 ? 3.192   -19.555 40.928  1.00 47.84  ? 243  ARG B CA    1 
ATOM   4784 C  C     . ARG B 1 243 ? 3.958   -18.955 39.745  1.00 47.23  ? 243  ARG B C     1 
ATOM   4785 O  O     . ARG B 1 243 ? 3.658   -19.231 38.578  1.00 47.14  ? 243  ARG B O     1 
ATOM   4786 C  CB    . ARG B 1 243 ? 3.179   -21.091 40.830  1.00 48.18  ? 243  ARG B CB    1 
ATOM   4787 C  CG    . ARG B 1 243 ? 2.743   -21.817 42.104  1.00 49.86  ? 243  ARG B CG    1 
ATOM   4788 C  CD    . ARG B 1 243 ? 3.894   -22.021 43.085  1.00 52.57  ? 243  ARG B CD    1 
ATOM   4789 N  NE    . ARG B 1 243 ? 4.860   -23.010 42.603  1.00 55.27  ? 243  ARG B NE    1 
ATOM   4790 C  CZ    . ARG B 1 243 ? 5.988   -23.352 43.232  1.00 56.66  ? 243  ARG B CZ    1 
ATOM   4791 N  NH1   . ARG B 1 243 ? 6.315   -22.791 44.394  1.00 56.66  ? 243  ARG B NH1   1 
ATOM   4792 N  NH2   . ARG B 1 243 ? 6.800   -24.263 42.696  1.00 57.33  ? 243  ARG B NH2   1 
ATOM   4793 N  N     . VAL B 1 244 ? 4.943   -18.126 40.068  1.00 46.47  ? 244  VAL B N     1 
ATOM   4794 C  CA    . VAL B 1 244 ? 5.810   -17.508 39.075  1.00 45.63  ? 244  VAL B CA    1 
ATOM   4795 C  C     . VAL B 1 244 ? 6.865   -18.515 38.631  1.00 45.17  ? 244  VAL B C     1 
ATOM   4796 O  O     . VAL B 1 244 ? 7.618   -19.055 39.445  1.00 44.95  ? 244  VAL B O     1 
ATOM   4797 C  CB    . VAL B 1 244 ? 6.459   -16.215 39.636  1.00 45.51  ? 244  VAL B CB    1 
ATOM   4798 C  CG1   . VAL B 1 244 ? 7.843   -16.023 39.101  1.00 45.57  ? 244  VAL B CG1   1 
ATOM   4799 C  CG2   . VAL B 1 244 ? 5.610   -15.008 39.328  1.00 45.02  ? 244  VAL B CG2   1 
ATOM   4800 N  N     . ILE B 1 245 ? 6.895   -18.788 37.334  1.00 44.78  ? 245  ILE B N     1 
ATOM   4801 C  CA    . ILE B 1 245 ? 7.894   -19.694 36.807  1.00 44.54  ? 245  ILE B CA    1 
ATOM   4802 C  C     . ILE B 1 245 ? 9.099   -18.860 36.453  1.00 44.22  ? 245  ILE B C     1 
ATOM   4803 O  O     . ILE B 1 245 ? 9.025   -17.968 35.612  1.00 44.27  ? 245  ILE B O     1 
ATOM   4804 C  CB    . ILE B 1 245 ? 7.430   -20.479 35.553  1.00 44.66  ? 245  ILE B CB    1 
ATOM   4805 C  CG1   . ILE B 1 245 ? 5.960   -20.934 35.653  1.00 45.02  ? 245  ILE B CG1   1 
ATOM   4806 C  CG2   . ILE B 1 245 ? 8.356   -21.658 35.318  1.00 44.46  ? 245  ILE B CG2   1 
ATOM   4807 C  CD1   . ILE B 1 245 ? 5.708   -22.220 36.462  1.00 44.86  ? 245  ILE B CD1   1 
ATOM   4808 N  N     . PHE B 1 246 ? 10.208  -19.143 37.115  1.00 43.90  ? 246  PHE B N     1 
ATOM   4809 C  CA    . PHE B 1 246 ? 11.420  -18.385 36.899  1.00 43.51  ? 246  PHE B CA    1 
ATOM   4810 C  C     . PHE B 1 246 ? 12.318  -19.149 35.944  1.00 43.38  ? 246  PHE B C     1 
ATOM   4811 O  O     . PHE B 1 246 ? 12.657  -20.313 36.192  1.00 43.21  ? 246  PHE B O     1 
ATOM   4812 C  CB    . PHE B 1 246 ? 12.125  -18.134 38.233  1.00 43.54  ? 246  PHE B CB    1 
ATOM   4813 C  CG    . PHE B 1 246 ? 13.046  -16.952 38.224  1.00 42.99  ? 246  PHE B CG    1 
ATOM   4814 C  CD1   . PHE B 1 246 ? 12.552  -15.672 38.038  1.00 42.59  ? 246  PHE B CD1   1 
ATOM   4815 C  CD2   . PHE B 1 246 ? 14.410  -17.121 38.428  1.00 42.95  ? 246  PHE B CD2   1 
ATOM   4816 C  CE1   . PHE B 1 246 ? 13.406  -14.577 38.040  1.00 43.11  ? 246  PHE B CE1   1 
ATOM   4817 C  CE2   . PHE B 1 246 ? 15.277  -16.036 38.425  1.00 42.87  ? 246  PHE B CE2   1 
ATOM   4818 C  CZ    . PHE B 1 246 ? 14.777  -14.758 38.230  1.00 43.04  ? 246  PHE B CZ    1 
ATOM   4819 N  N     . LEU B 1 247 ? 12.676  -18.493 34.842  1.00 43.15  ? 247  LEU B N     1 
ATOM   4820 C  CA    . LEU B 1 247 ? 13.637  -19.042 33.894  1.00 42.85  ? 247  LEU B CA    1 
ATOM   4821 C  C     . LEU B 1 247 ? 14.919  -18.213 33.872  1.00 42.84  ? 247  LEU B C     1 
ATOM   4822 O  O     . LEU B 1 247 ? 14.901  -17.029 33.539  1.00 42.43  ? 247  LEU B O     1 
ATOM   4823 C  CB    . LEU B 1 247 ? 13.022  -19.142 32.502  1.00 42.67  ? 247  LEU B CB    1 
ATOM   4824 C  CG    . LEU B 1 247 ? 13.929  -19.444 31.308  1.00 42.57  ? 247  LEU B CG    1 
ATOM   4825 C  CD1   . LEU B 1 247 ? 14.819  -20.655 31.551  1.00 43.13  ? 247  LEU B CD1   1 
ATOM   4826 C  CD2   . LEU B 1 247 ? 13.093  -19.637 30.059  1.00 41.69  ? 247  LEU B CD2   1 
ATOM   4827 N  N     . HIS B 1 248 ? 16.024  -18.857 34.243  1.00 43.02  ? 248  HIS B N     1 
ATOM   4828 C  CA    . HIS B 1 248 ? 17.326  -18.203 34.324  1.00 43.28  ? 248  HIS B CA    1 
ATOM   4829 C  C     . HIS B 1 248 ? 18.458  -19.219 34.210  1.00 43.56  ? 248  HIS B C     1 
ATOM   4830 O  O     . HIS B 1 248 ? 18.262  -20.409 34.440  1.00 43.36  ? 248  HIS B O     1 
ATOM   4831 C  CB    . HIS B 1 248 ? 17.434  -17.340 35.595  1.00 43.21  ? 248  HIS B CB    1 
ATOM   4832 C  CG    . HIS B 1 248 ? 17.669  -18.115 36.857  1.00 43.03  ? 248  HIS B CG    1 
ATOM   4833 N  ND1   . HIS B 1 248 ? 17.066  -19.326 37.121  1.00 43.31  ? 248  HIS B ND1   1 
ATOM   4834 C  CD2   . HIS B 1 248 ? 18.425  -17.830 37.944  1.00 42.76  ? 248  HIS B CD2   1 
ATOM   4835 C  CE1   . HIS B 1 248 ? 17.458  -19.764 38.305  1.00 42.85  ? 248  HIS B CE1   1 
ATOM   4836 N  NE2   . HIS B 1 248 ? 18.285  -18.875 38.824  1.00 42.38  ? 248  HIS B NE2   1 
ATOM   4837 N  N     . ASP B 1 249 ? 19.637  -18.735 33.846  1.00 44.21  ? 249  ASP B N     1 
ATOM   4838 C  CA    . ASP B 1 249 ? 20.728  -19.609 33.428  1.00 45.05  ? 249  ASP B CA    1 
ATOM   4839 C  C     . ASP B 1 249 ? 21.556  -20.131 34.596  1.00 44.88  ? 249  ASP B C     1 
ATOM   4840 O  O     . ASP B 1 249 ? 21.752  -19.426 35.583  1.00 44.39  ? 249  ASP B O     1 
ATOM   4841 C  CB    . ASP B 1 249 ? 21.615  -18.910 32.368  1.00 45.62  ? 249  ASP B CB    1 
ATOM   4842 C  CG    . ASP B 1 249 ? 22.178  -17.550 32.843  1.00 47.55  ? 249  ASP B CG    1 
ATOM   4843 O  OD1   . ASP B 1 249 ? 21.886  -17.134 33.995  1.00 49.47  ? 249  ASP B OD1   1 
ATOM   4844 O  OD2   . ASP B 1 249 ? 22.925  -16.901 32.060  1.00 48.31  ? 249  ASP B OD2   1 
ATOM   4845 N  N     . ASN B 1 250 ? 22.042  -21.367 34.454  1.00 45.28  ? 250  ASN B N     1 
ATOM   4846 C  CA    . ASN B 1 250 ? 22.876  -22.044 35.461  1.00 45.71  ? 250  ASN B CA    1 
ATOM   4847 C  C     . ASN B 1 250 ? 24.142  -21.277 35.831  1.00 46.37  ? 250  ASN B C     1 
ATOM   4848 O  O     . ASN B 1 250 ? 25.171  -21.895 36.137  1.00 46.40  ? 250  ASN B O     1 
ATOM   4849 C  CB    . ASN B 1 250 ? 23.320  -23.438 34.986  1.00 45.43  ? 250  ASN B CB    1 
ATOM   4850 C  CG    . ASN B 1 250 ? 22.171  -24.352 34.645  1.00 44.86  ? 250  ASN B CG    1 
ATOM   4851 O  OD1   . ASN B 1 250 ? 21.177  -24.435 35.362  1.00 44.37  ? 250  ASN B OD1   1 
ATOM   4852 N  ND2   . ASN B 1 250 ? 22.320  -25.076 33.549  1.00 44.14  ? 250  ASN B ND2   1 
ATOM   4853 N  N     . ALA B 1 251 ? 24.080  -19.945 35.788  1.00 47.21  ? 251  ALA B N     1 
ATOM   4854 C  CA    . ALA B 1 251 ? 25.206  -19.105 36.191  1.00 48.20  ? 251  ALA B CA    1 
ATOM   4855 C  C     . ALA B 1 251 ? 25.698  -19.561 37.575  1.00 49.02  ? 251  ALA B C     1 
ATOM   4856 O  O     . ALA B 1 251 ? 24.891  -20.030 38.385  1.00 49.41  ? 251  ALA B O     1 
ATOM   4857 C  CB    . ALA B 1 251 ? 24.786  -17.638 36.208  1.00 47.98  ? 251  ALA B CB    1 
ATOM   4858 N  N     . PRO B 1 252 ? 27.016  -19.445 37.859  1.00 49.65  ? 252  PRO B N     1 
ATOM   4859 C  CA    . PRO B 1 252 ? 27.468  -19.921 39.178  1.00 49.79  ? 252  PRO B CA    1 
ATOM   4860 C  C     . PRO B 1 252 ? 26.857  -19.075 40.317  1.00 49.92  ? 252  PRO B C     1 
ATOM   4861 O  O     . PRO B 1 252 ? 26.566  -19.602 41.395  1.00 49.75  ? 252  PRO B O     1 
ATOM   4862 C  CB    . PRO B 1 252 ? 28.987  -19.753 39.104  1.00 49.83  ? 252  PRO B CB    1 
ATOM   4863 C  CG    . PRO B 1 252 ? 29.184  -18.585 38.183  1.00 49.69  ? 252  PRO B CG    1 
ATOM   4864 C  CD    . PRO B 1 252 ? 28.084  -18.713 37.145  1.00 49.77  ? 252  PRO B CD    1 
ATOM   4865 N  N     . SER B 1 253 ? 26.652  -17.783 40.041  1.00 50.00  ? 253  SER B N     1 
ATOM   4866 C  CA    . SER B 1 253 ? 25.931  -16.864 40.918  1.00 50.05  ? 253  SER B CA    1 
ATOM   4867 C  C     . SER B 1 253 ? 24.456  -17.261 41.112  1.00 50.28  ? 253  SER B C     1 
ATOM   4868 O  O     . SER B 1 253 ? 23.971  -17.306 42.237  1.00 50.09  ? 253  SER B O     1 
ATOM   4869 C  CB    . SER B 1 253 ? 26.038  -15.438 40.365  1.00 50.04  ? 253  SER B CB    1 
ATOM   4870 O  OG    . SER B 1 253 ? 25.399  -14.503 41.216  1.00 49.54  ? 253  SER B OG    1 
ATOM   4871 N  N     . HIS B 1 254 ? 23.752  -17.551 40.017  1.00 50.73  ? 254  HIS B N     1 
ATOM   4872 C  CA    . HIS B 1 254 ? 22.351  -17.977 40.081  1.00 51.18  ? 254  HIS B CA    1 
ATOM   4873 C  C     . HIS B 1 254 ? 22.204  -19.399 40.619  1.00 51.30  ? 254  HIS B C     1 
ATOM   4874 O  O     . HIS B 1 254 ? 21.090  -19.879 40.809  1.00 51.46  ? 254  HIS B O     1 
ATOM   4875 C  CB    . HIS B 1 254 ? 21.686  -17.944 38.703  1.00 51.22  ? 254  HIS B CB    1 
ATOM   4876 C  CG    . HIS B 1 254 ? 21.848  -16.657 37.956  1.00 52.77  ? 254  HIS B CG    1 
ATOM   4877 N  ND1   . HIS B 1 254 ? 21.356  -16.483 36.678  1.00 54.63  ? 254  HIS B ND1   1 
ATOM   4878 C  CD2   . HIS B 1 254 ? 22.465  -15.496 38.280  1.00 53.98  ? 254  HIS B CD2   1 
ATOM   4879 C  CE1   . HIS B 1 254 ? 21.636  -15.261 36.260  1.00 54.68  ? 254  HIS B CE1   1 
ATOM   4880 N  NE2   . HIS B 1 254 ? 22.315  -14.643 37.211  1.00 54.65  ? 254  HIS B NE2   1 
ATOM   4881 N  N     . THR B 1 255 ? 23.320  -20.078 40.850  1.00 51.38  ? 255  THR B N     1 
ATOM   4882 C  CA    . THR B 1 255 ? 23.277  -21.503 41.112  1.00 51.56  ? 255  THR B CA    1 
ATOM   4883 C  C     . THR B 1 255 ? 23.606  -21.851 42.577  1.00 52.14  ? 255  THR B C     1 
ATOM   4884 O  O     . THR B 1 255 ? 23.521  -23.018 42.997  1.00 52.20  ? 255  THR B O     1 
ATOM   4885 C  CB    . THR B 1 255 ? 24.164  -22.242 40.088  1.00 51.32  ? 255  THR B CB    1 
ATOM   4886 O  OG1   . THR B 1 255 ? 23.583  -23.507 39.768  1.00 51.17  ? 255  THR B OG1   1 
ATOM   4887 C  CG2   . THR B 1 255 ? 25.597  -22.414 40.578  1.00 51.41  ? 255  THR B CG2   1 
ATOM   4888 N  N     . ALA B 1 256 ? 23.934  -20.810 43.347  1.00 52.70  ? 256  ALA B N     1 
ATOM   4889 C  CA    . ALA B 1 256 ? 24.418  -20.922 44.734  1.00 53.02  ? 256  ALA B CA    1 
ATOM   4890 C  C     . ALA B 1 256 ? 23.416  -21.503 45.719  1.00 53.30  ? 256  ALA B C     1 
ATOM   4891 O  O     . ALA B 1 256 ? 22.210  -21.258 45.627  1.00 53.36  ? 256  ALA B O     1 
ATOM   4892 C  CB    . ALA B 1 256 ? 24.913  -19.558 45.243  1.00 52.96  ? 256  ALA B CB    1 
ATOM   4893 N  N     . ARG B 1 257 ? 23.950  -22.265 46.670  1.00 53.68  ? 257  ARG B N     1 
ATOM   4894 C  CA    . ARG B 1 257 ? 23.201  -22.812 47.794  1.00 54.08  ? 257  ARG B CA    1 
ATOM   4895 C  C     . ARG B 1 257 ? 22.281  -21.747 48.410  1.00 53.92  ? 257  ARG B C     1 
ATOM   4896 O  O     . ARG B 1 257 ? 21.097  -21.995 48.652  1.00 53.93  ? 257  ARG B O     1 
ATOM   4897 C  CB    . ARG B 1 257 ? 24.191  -23.350 48.840  1.00 54.34  ? 257  ARG B CB    1 
ATOM   4898 C  CG    . ARG B 1 257 ? 23.695  -24.515 49.700  1.00 55.90  ? 257  ARG B CG    1 
ATOM   4899 C  CD    . ARG B 1 257 ? 23.708  -25.853 48.941  1.00 58.18  ? 257  ARG B CD    1 
ATOM   4900 N  NE    . ARG B 1 257 ? 23.537  -27.002 49.838  1.00 59.59  ? 257  ARG B NE    1 
ATOM   4901 C  CZ    . ARG B 1 257 ? 22.376  -27.580 50.151  1.00 59.78  ? 257  ARG B CZ    1 
ATOM   4902 N  NH1   . ARG B 1 257 ? 21.227  -27.138 49.647  1.00 59.54  ? 257  ARG B NH1   1 
ATOM   4903 N  NH2   . ARG B 1 257 ? 22.373  -28.617 50.981  1.00 60.10  ? 257  ARG B NH2   1 
ATOM   4904 N  N     . ALA B 1 258 ? 22.834  -20.557 48.627  1.00 53.81  ? 258  ALA B N     1 
ATOM   4905 C  CA    . ALA B 1 258 ? 22.116  -19.448 49.242  1.00 53.72  ? 258  ALA B CA    1 
ATOM   4906 C  C     . ALA B 1 258 ? 20.929  -18.965 48.408  1.00 53.69  ? 258  ALA B C     1 
ATOM   4907 O  O     . ALA B 1 258 ? 19.856  -18.692 48.948  1.00 53.79  ? 258  ALA B O     1 
ATOM   4908 C  CB    . ALA B 1 258 ? 23.074  -18.309 49.513  1.00 53.65  ? 258  ALA B CB    1 
ATOM   4909 N  N     . VAL B 1 259 ? 21.130  -18.868 47.097  1.00 53.60  ? 259  VAL B N     1 
ATOM   4910 C  CA    . VAL B 1 259 ? 20.106  -18.385 46.175  1.00 53.67  ? 259  VAL B CA    1 
ATOM   4911 C  C     . VAL B 1 259 ? 18.979  -19.406 46.027  1.00 53.78  ? 259  VAL B C     1 
ATOM   4912 O  O     . VAL B 1 259 ? 17.799  -19.061 46.107  1.00 53.59  ? 259  VAL B O     1 
ATOM   4913 C  CB    . VAL B 1 259 ? 20.711  -18.084 44.782  1.00 53.73  ? 259  VAL B CB    1 
ATOM   4914 C  CG1   . VAL B 1 259 ? 19.676  -17.465 43.853  1.00 53.72  ? 259  VAL B CG1   1 
ATOM   4915 C  CG2   . VAL B 1 259 ? 21.917  -17.170 44.906  1.00 53.84  ? 259  VAL B CG2   1 
ATOM   4916 N  N     . ARG B 1 260 ? 19.361  -20.663 45.811  1.00 54.08  ? 260  ARG B N     1 
ATOM   4917 C  CA    . ARG B 1 260 ? 18.416  -21.767 45.678  1.00 54.43  ? 260  ARG B CA    1 
ATOM   4918 C  C     . ARG B 1 260 ? 17.487  -21.806 46.879  1.00 54.47  ? 260  ARG B C     1 
ATOM   4919 O  O     . ARG B 1 260 ? 16.299  -22.120 46.754  1.00 54.48  ? 260  ARG B O     1 
ATOM   4920 C  CB    . ARG B 1 260 ? 19.164  -23.093 45.598  1.00 54.50  ? 260  ARG B CB    1 
ATOM   4921 C  CG    . ARG B 1 260 ? 19.909  -23.368 44.302  1.00 55.45  ? 260  ARG B CG    1 
ATOM   4922 C  CD    . ARG B 1 260 ? 20.756  -24.641 44.425  1.00 57.78  ? 260  ARG B CD    1 
ATOM   4923 N  NE    . ARG B 1 260 ? 20.064  -25.711 45.163  1.00 60.17  ? 260  ARG B NE    1 
ATOM   4924 C  CZ    . ARG B 1 260 ? 20.308  -26.053 46.435  1.00 60.71  ? 260  ARG B CZ    1 
ATOM   4925 N  NH1   . ARG B 1 260 ? 21.240  -25.417 47.132  1.00 60.66  ? 260  ARG B NH1   1 
ATOM   4926 N  NH2   . ARG B 1 260 ? 19.618  -27.033 47.016  1.00 60.49  ? 260  ARG B NH2   1 
ATOM   4927 N  N     . ASP B 1 261 ? 18.054  -21.490 48.042  1.00 54.55  ? 261  ASP B N     1 
ATOM   4928 C  CA    . ASP B 1 261 ? 17.320  -21.471 49.294  1.00 54.63  ? 261  ASP B CA    1 
ATOM   4929 C  C     . ASP B 1 261 ? 16.569  -20.157 49.502  1.00 54.47  ? 261  ASP B C     1 
ATOM   4930 O  O     . ASP B 1 261 ? 15.581  -20.124 50.236  1.00 54.55  ? 261  ASP B O     1 
ATOM   4931 C  CB    . ASP B 1 261 ? 18.254  -21.784 50.469  1.00 54.86  ? 261  ASP B CB    1 
ATOM   4932 C  CG    . ASP B 1 261 ? 18.424  -23.294 50.704  1.00 55.60  ? 261  ASP B CG    1 
ATOM   4933 O  OD1   . ASP B 1 261 ? 19.535  -23.824 50.482  1.00 56.28  ? 261  ASP B OD1   1 
ATOM   4934 O  OD2   . ASP B 1 261 ? 17.444  -23.958 51.115  1.00 56.19  ? 261  ASP B OD2   1 
ATOM   4935 N  N     . THR B 1 262 ? 17.029  -19.086 48.850  1.00 54.26  ? 262  THR B N     1 
ATOM   4936 C  CA    . THR B 1 262 ? 16.319  -17.800 48.858  1.00 53.91  ? 262  THR B CA    1 
ATOM   4937 C  C     . THR B 1 262 ? 15.072  -17.919 48.013  1.00 53.86  ? 262  THR B C     1 
ATOM   4938 O  O     . THR B 1 262 ? 13.964  -17.707 48.495  1.00 53.71  ? 262  THR B O     1 
ATOM   4939 C  CB    . THR B 1 262 ? 17.170  -16.657 48.289  1.00 53.79  ? 262  THR B CB    1 
ATOM   4940 O  OG1   . THR B 1 262 ? 18.394  -16.568 49.018  1.00 53.54  ? 262  THR B OG1   1 
ATOM   4941 C  CG2   . THR B 1 262 ? 16.423  -15.332 48.388  1.00 53.46  ? 262  THR B CG2   1 
ATOM   4942 N  N     . LEU B 1 263 ? 15.276  -18.260 46.745  1.00 54.01  ? 263  LEU B N     1 
ATOM   4943 C  CA    . LEU B 1 263 ? 14.195  -18.543 45.814  1.00 54.29  ? 263  LEU B CA    1 
ATOM   4944 C  C     . LEU B 1 263 ? 13.120  -19.405 46.461  1.00 54.74  ? 263  LEU B C     1 
ATOM   4945 O  O     . LEU B 1 263 ? 11.933  -19.097 46.377  1.00 54.90  ? 263  LEU B O     1 
ATOM   4946 C  CB    . LEU B 1 263 ? 14.740  -19.284 44.595  1.00 54.08  ? 263  LEU B CB    1 
ATOM   4947 C  CG    . LEU B 1 263 ? 15.384  -18.538 43.436  1.00 53.27  ? 263  LEU B CG    1 
ATOM   4948 C  CD1   . LEU B 1 263 ? 16.427  -19.446 42.821  1.00 52.54  ? 263  LEU B CD1   1 
ATOM   4949 C  CD2   . LEU B 1 263 ? 14.338  -18.123 42.408  1.00 52.37  ? 263  LEU B CD2   1 
ATOM   4950 N  N     . GLU B 1 264 ? 13.550  -20.484 47.109  1.00 55.15  ? 264  GLU B N     1 
ATOM   4951 C  CA    . GLU B 1 264 ? 12.645  -21.446 47.724  1.00 55.53  ? 264  GLU B CA    1 
ATOM   4952 C  C     . GLU B 1 264 ? 11.557  -20.761 48.566  1.00 55.34  ? 264  GLU B C     1 
ATOM   4953 O  O     . GLU B 1 264 ? 10.362  -21.039 48.398  1.00 55.32  ? 264  GLU B O     1 
ATOM   4954 C  CB    . GLU B 1 264 ? 13.449  -22.443 48.566  1.00 55.80  ? 264  GLU B CB    1 
ATOM   4955 C  CG    . GLU B 1 264 ? 12.799  -23.819 48.736  1.00 56.99  ? 264  GLU B CG    1 
ATOM   4956 C  CD    . GLU B 1 264 ? 13.754  -24.848 49.336  1.00 58.36  ? 264  GLU B CD    1 
ATOM   4957 O  OE1   . GLU B 1 264 ? 14.527  -24.490 50.257  1.00 58.69  ? 264  GLU B OE1   1 
ATOM   4958 O  OE2   . GLU B 1 264 ? 13.729  -26.017 48.885  1.00 58.98  ? 264  GLU B OE2   1 
ATOM   4959 N  N     . THR B 1 265 ? 11.974  -19.854 49.450  1.00 55.12  ? 265  THR B N     1 
ATOM   4960 C  CA    . THR B 1 265 ? 11.037  -19.147 50.333  1.00 54.88  ? 265  THR B CA    1 
ATOM   4961 C  C     . THR B 1 265 ? 10.513  -17.836 49.723  1.00 54.44  ? 265  THR B C     1 
ATOM   4962 O  O     . THR B 1 265 ? 10.060  -16.943 50.437  1.00 54.36  ? 265  THR B O     1 
ATOM   4963 C  CB    . THR B 1 265 ? 11.583  -18.975 51.810  1.00 55.07  ? 265  THR B CB    1 
ATOM   4964 O  OG1   . THR B 1 265 ? 13.011  -19.123 51.838  1.00 55.35  ? 265  THR B OG1   1 
ATOM   4965 C  CG2   . THR B 1 265 ? 10.963  -20.023 52.758  1.00 54.89  ? 265  THR B CG2   1 
ATOM   4966 N  N     . LEU B 1 266 ? 10.598  -17.731 48.397  1.00 54.03  ? 266  LEU B N     1 
ATOM   4967 C  CA    . LEU B 1 266 ? 9.815   -16.760 47.627  1.00 53.62  ? 266  LEU B CA    1 
ATOM   4968 C  C     . LEU B 1 266 ? 8.674   -17.520 47.009  1.00 53.44  ? 266  LEU B C     1 
ATOM   4969 O  O     . LEU B 1 266 ? 7.699   -16.931 46.539  1.00 53.41  ? 266  LEU B O     1 
ATOM   4970 C  CB    . LEU B 1 266 ? 10.618  -16.155 46.482  1.00 53.46  ? 266  LEU B CB    1 
ATOM   4971 C  CG    . LEU B 1 266 ? 11.361  -14.844 46.667  1.00 53.28  ? 266  LEU B CG    1 
ATOM   4972 C  CD1   . LEU B 1 266 ? 12.852  -15.115 46.793  1.00 53.96  ? 266  LEU B CD1   1 
ATOM   4973 C  CD2   . LEU B 1 266 ? 11.095  -13.972 45.475  1.00 52.49  ? 266  LEU B CD2   1 
ATOM   4974 N  N     . ASN B 1 267 ? 8.839   -18.841 46.999  1.00 53.26  ? 267  ASN B N     1 
ATOM   4975 C  CA    . ASN B 1 267 ? 7.927   -19.793 46.366  1.00 53.01  ? 267  ASN B CA    1 
ATOM   4976 C  C     . ASN B 1 267 ? 7.741   -19.617 44.850  1.00 52.57  ? 267  ASN B C     1 
ATOM   4977 O  O     . ASN B 1 267 ? 6.612   -19.536 44.357  1.00 52.57  ? 267  ASN B O     1 
ATOM   4978 C  CB    . ASN B 1 267 ? 6.580   -19.844 47.097  1.00 53.15  ? 267  ASN B CB    1 
ATOM   4979 C  CG    . ASN B 1 267 ? 6.006   -21.238 47.138  1.00 53.51  ? 267  ASN B CG    1 
ATOM   4980 O  OD1   . ASN B 1 267 ? 5.152   -21.595 46.326  1.00 53.78  ? 267  ASN B OD1   1 
ATOM   4981 N  ND2   . ASN B 1 267 ? 6.492   -22.049 48.072  1.00 53.97  ? 267  ASN B ND2   1 
ATOM   4982 N  N     . TRP B 1 268 ? 8.856   -19.561 44.125  1.00 51.97  ? 268  TRP B N     1 
ATOM   4983 C  CA    . TRP B 1 268 ? 8.838   -19.528 42.665  1.00 51.56  ? 268  TRP B CA    1 
ATOM   4984 C  C     . TRP B 1 268 ? 9.313   -20.855 42.105  1.00 51.26  ? 268  TRP B C     1 
ATOM   4985 O  O     . TRP B 1 268 ? 10.254  -21.446 42.640  1.00 51.54  ? 268  TRP B O     1 
ATOM   4986 C  CB    . TRP B 1 268 ? 9.745   -18.421 42.136  1.00 51.51  ? 268  TRP B CB    1 
ATOM   4987 C  CG    . TRP B 1 268 ? 9.203   -17.054 42.333  1.00 51.98  ? 268  TRP B CG    1 
ATOM   4988 C  CD1   . TRP B 1 268 ? 7.929   -16.724 42.681  1.00 52.49  ? 268  TRP B CD1   1 
ATOM   4989 C  CD2   . TRP B 1 268 ? 9.903   -15.815 42.160  1.00 52.69  ? 268  TRP B CD2   1 
ATOM   4990 N  NE1   . TRP B 1 268 ? 7.790   -15.360 42.751  1.00 52.90  ? 268  TRP B NE1   1 
ATOM   4991 C  CE2   . TRP B 1 268 ? 8.986   -14.775 42.435  1.00 52.87  ? 268  TRP B CE2   1 
ATOM   4992 C  CE3   . TRP B 1 268 ? 11.218  -15.482 41.808  1.00 53.14  ? 268  TRP B CE3   1 
ATOM   4993 C  CZ2   . TRP B 1 268 ? 9.339   -13.423 42.368  1.00 52.89  ? 268  TRP B CZ2   1 
ATOM   4994 C  CZ3   . TRP B 1 268 ? 11.567  -14.133 41.741  1.00 53.28  ? 268  TRP B CZ3   1 
ATOM   4995 C  CH2   . TRP B 1 268 ? 10.628  -13.123 42.023  1.00 53.07  ? 268  TRP B CH2   1 
ATOM   4996 N  N     . GLU B 1 269 ? 8.676   -21.329 41.034  1.00 50.62  ? 269  GLU B N     1 
ATOM   4997 C  CA    . GLU B 1 269 ? 9.172   -22.520 40.355  1.00 49.84  ? 269  GLU B CA    1 
ATOM   4998 C  C     . GLU B 1 269 ? 10.277  -22.111 39.400  1.00 49.21  ? 269  GLU B C     1 
ATOM   4999 O  O     . GLU B 1 269 ? 10.084  -21.232 38.556  1.00 49.00  ? 269  GLU B O     1 
ATOM   5000 C  CB    . GLU B 1 269 ? 8.069   -23.249 39.588  1.00 49.95  ? 269  GLU B CB    1 
ATOM   5001 C  CG    . GLU B 1 269 ? 8.384   -24.735 39.353  1.00 50.37  ? 269  GLU B CG    1 
ATOM   5002 C  CD    . GLU B 1 269 ? 7.975   -25.244 37.969  1.00 50.66  ? 269  GLU B CD    1 
ATOM   5003 O  OE1   . GLU B 1 269 ? 7.068   -24.648 37.346  1.00 50.57  ? 269  GLU B OE1   1 
ATOM   5004 O  OE2   . GLU B 1 269 ? 8.569   -26.250 37.506  1.00 50.46  ? 269  GLU B OE2   1 
ATOM   5005 N  N     . VAL B 1 270 ? 11.437  -22.744 39.551  1.00 48.48  ? 270  VAL B N     1 
ATOM   5006 C  CA    . VAL B 1 270 ? 12.554  -22.547 38.629  1.00 47.83  ? 270  VAL B CA    1 
ATOM   5007 C  C     . VAL B 1 270 ? 12.535  -23.572 37.486  1.00 47.45  ? 270  VAL B C     1 
ATOM   5008 O  O     . VAL B 1 270 ? 12.802  -24.759 37.709  1.00 47.39  ? 270  VAL B O     1 
ATOM   5009 C  CB    . VAL B 1 270 ? 13.919  -22.597 39.357  1.00 47.81  ? 270  VAL B CB    1 
ATOM   5010 C  CG1   . VAL B 1 270 ? 14.234  -21.248 39.991  1.00 47.69  ? 270  VAL B CG1   1 
ATOM   5011 C  CG2   . VAL B 1 270 ? 13.957  -23.726 40.389  1.00 47.40  ? 270  VAL B CG2   1 
ATOM   5012 N  N     . LEU B 1 271 ? 12.210  -23.114 36.274  1.00 46.81  ? 271  LEU B N     1 
ATOM   5013 C  CA    . LEU B 1 271 ? 12.221  -23.979 35.096  1.00 46.24  ? 271  LEU B CA    1 
ATOM   5014 C  C     . LEU B 1 271 ? 13.588  -24.586 34.928  1.00 46.16  ? 271  LEU B C     1 
ATOM   5015 O  O     . LEU B 1 271 ? 14.593  -23.875 35.078  1.00 46.13  ? 271  LEU B O     1 
ATOM   5016 C  CB    . LEU B 1 271 ? 11.900  -23.203 33.823  1.00 46.15  ? 271  LEU B CB    1 
ATOM   5017 C  CG    . LEU B 1 271 ? 10.465  -23.166 33.307  1.00 45.95  ? 271  LEU B CG    1 
ATOM   5018 C  CD1   . LEU B 1 271 ? 10.427  -22.673 31.872  1.00 44.98  ? 271  LEU B CD1   1 
ATOM   5019 C  CD2   . LEU B 1 271 ? 9.805   -24.519 33.415  1.00 46.01  ? 271  LEU B CD2   1 
ATOM   5020 N  N     . PRO B 1 272 ? 13.643  -25.899 34.613  1.00 46.02  ? 272  PRO B N     1 
ATOM   5021 C  CA    . PRO B 1 272 ? 14.948  -26.499 34.355  1.00 45.94  ? 272  PRO B CA    1 
ATOM   5022 C  C     . PRO B 1 272 ? 15.527  -25.810 33.130  1.00 45.97  ? 272  PRO B C     1 
ATOM   5023 O  O     . PRO B 1 272 ? 14.773  -25.456 32.212  1.00 46.12  ? 272  PRO B O     1 
ATOM   5024 C  CB    . PRO B 1 272 ? 14.619  -27.967 34.063  1.00 45.78  ? 272  PRO B CB    1 
ATOM   5025 C  CG    . PRO B 1 272 ? 13.203  -27.969 33.639  1.00 45.79  ? 272  PRO B CG    1 
ATOM   5026 C  CD    . PRO B 1 272 ? 12.539  -26.845 34.368  1.00 45.97  ? 272  PRO B CD    1 
ATOM   5027 N  N     . HIS B 1 273 ? 16.835  -25.566 33.132  1.00 45.76  ? 273  HIS B N     1 
ATOM   5028 C  CA    . HIS B 1 273 ? 17.456  -24.874 32.006  1.00 45.44  ? 273  HIS B CA    1 
ATOM   5029 C  C     . HIS B 1 273 ? 18.835  -25.426 31.715  1.00 44.71  ? 273  HIS B C     1 
ATOM   5030 O  O     . HIS B 1 273 ? 19.802  -25.132 32.422  1.00 44.92  ? 273  HIS B O     1 
ATOM   5031 C  CB    . HIS B 1 273 ? 17.504  -23.365 32.248  1.00 45.86  ? 273  HIS B CB    1 
ATOM   5032 C  CG    . HIS B 1 273 ? 17.973  -22.579 31.066  1.00 46.88  ? 273  HIS B CG    1 
ATOM   5033 N  ND1   . HIS B 1 273 ? 19.176  -21.904 31.051  1.00 48.34  ? 273  HIS B ND1   1 
ATOM   5034 C  CD2   . HIS B 1 273 ? 17.404  -22.361 29.857  1.00 47.64  ? 273  HIS B CD2   1 
ATOM   5035 C  CE1   . HIS B 1 273 ? 19.329  -21.302 29.885  1.00 48.26  ? 273  HIS B CE1   1 
ATOM   5036 N  NE2   . HIS B 1 273 ? 18.267  -21.562 29.143  1.00 48.23  ? 273  HIS B NE2   1 
ATOM   5037 N  N     . ALA B 1 274 ? 18.896  -26.224 30.657  1.00 43.69  ? 274  ALA B N     1 
ATOM   5038 C  CA    . ALA B 1 274 ? 20.115  -26.872 30.190  1.00 42.76  ? 274  ALA B CA    1 
ATOM   5039 C  C     . ALA B 1 274 ? 21.330  -25.945 30.056  1.00 41.85  ? 274  ALA B C     1 
ATOM   5040 O  O     . ALA B 1 274 ? 21.231  -24.827 29.534  1.00 41.59  ? 274  ALA B O     1 
ATOM   5041 C  CB    . ALA B 1 274 ? 19.837  -27.563 28.861  1.00 43.21  ? 274  ALA B CB    1 
ATOM   5042 N  N     . ALA B 1 275 ? 22.476  -26.441 30.517  1.00 40.72  ? 275  ALA B N     1 
ATOM   5043 C  CA    . ALA B 1 275 ? 23.727  -25.685 30.491  1.00 39.60  ? 275  ALA B CA    1 
ATOM   5044 C  C     . ALA B 1 275 ? 24.202  -25.395 29.067  1.00 38.56  ? 275  ALA B C     1 
ATOM   5045 O  O     . ALA B 1 275 ? 24.037  -26.235 28.175  1.00 38.70  ? 275  ALA B O     1 
ATOM   5046 C  CB    . ALA B 1 275 ? 24.794  -26.432 31.269  1.00 39.93  ? 275  ALA B CB    1 
ATOM   5047 N  N     . TYR B 1 276 ? 24.799  -24.215 28.874  1.00 36.95  ? 276  TYR B N     1 
ATOM   5048 C  CA    . TYR B 1 276 ? 25.221  -23.733 27.550  1.00 35.47  ? 276  TYR B CA    1 
ATOM   5049 C  C     . TYR B 1 276 ? 24.084  -23.712 26.527  1.00 34.34  ? 276  TYR B C     1 
ATOM   5050 O  O     . TYR B 1 276 ? 24.231  -24.243 25.427  1.00 33.75  ? 276  TYR B O     1 
ATOM   5051 C  CB    . TYR B 1 276 ? 26.362  -24.574 26.974  1.00 35.41  ? 276  TYR B CB    1 
ATOM   5052 C  CG    . TYR B 1 276 ? 27.562  -24.689 27.845  1.00 35.25  ? 276  TYR B CG    1 
ATOM   5053 C  CD1   . TYR B 1 276 ? 27.681  -25.733 28.746  1.00 35.98  ? 276  TYR B CD1   1 
ATOM   5054 C  CD2   . TYR B 1 276 ? 28.592  -23.771 27.760  1.00 35.71  ? 276  TYR B CD2   1 
ATOM   5055 C  CE1   . TYR B 1 276 ? 28.798  -25.862 29.562  1.00 36.60  ? 276  TYR B CE1   1 
ATOM   5056 C  CE2   . TYR B 1 276 ? 29.725  -23.889 28.570  1.00 36.66  ? 276  TYR B CE2   1 
ATOM   5057 C  CZ    . TYR B 1 276 ? 29.818  -24.940 29.471  1.00 36.62  ? 276  TYR B CZ    1 
ATOM   5058 O  OH    . TYR B 1 276 ? 30.924  -25.078 30.280  1.00 36.87  ? 276  TYR B OH    1 
ATOM   5059 N  N     . SER B 1 277 ? 22.961  -23.096 26.877  1.00 33.11  ? 277  SER B N     1 
ATOM   5060 C  CA    . SER B 1 277 ? 21.843  -23.070 25.958  1.00 32.16  ? 277  SER B CA    1 
ATOM   5061 C  C     . SER B 1 277 ? 21.250  -21.685 25.757  1.00 31.31  ? 277  SER B C     1 
ATOM   5062 O  O     . SER B 1 277 ? 20.059  -21.506 25.965  1.00 31.67  ? 277  SER B O     1 
ATOM   5063 C  CB    . SER B 1 277 ? 20.759  -24.034 26.435  1.00 32.31  ? 277  SER B CB    1 
ATOM   5064 O  OG    . SER B 1 277 ? 21.214  -25.374 26.384  1.00 32.85  ? 277  SER B OG    1 
ATOM   5065 N  N     . PRO B 1 278 ? 22.059  -20.706 25.313  1.00 30.17  ? 278  PRO B N     1 
ATOM   5066 C  CA    . PRO B 1 278 ? 21.567  -19.327 25.274  1.00 29.28  ? 278  PRO B CA    1 
ATOM   5067 C  C     . PRO B 1 278 ? 20.524  -19.106 24.195  1.00 28.65  ? 278  PRO B C     1 
ATOM   5068 O  O     . PRO B 1 278 ? 19.698  -18.213 24.332  1.00 29.07  ? 278  PRO B O     1 
ATOM   5069 C  CB    . PRO B 1 278 ? 22.811  -18.529 24.954  1.00 29.03  ? 278  PRO B CB    1 
ATOM   5070 C  CG    . PRO B 1 278 ? 23.615  -19.448 24.155  1.00 29.64  ? 278  PRO B CG    1 
ATOM   5071 C  CD    . PRO B 1 278 ? 23.361  -20.834 24.648  1.00 29.90  ? 278  PRO B CD    1 
ATOM   5072 N  N     . ASP B 1 279 ? 20.577  -19.915 23.139  1.00 27.68  ? 279  ASP B N     1 
ATOM   5073 C  CA    . ASP B 1 279 ? 19.558  -19.967 22.093  1.00 26.68  ? 279  ASP B CA    1 
ATOM   5074 C  C     . ASP B 1 279 ? 18.245  -20.529 22.638  1.00 26.29  ? 279  ASP B C     1 
ATOM   5075 O  O     . ASP B 1 279 ? 17.221  -20.545 21.962  1.00 26.37  ? 279  ASP B O     1 
ATOM   5076 C  CB    . ASP B 1 279 ? 20.033  -20.904 20.987  1.00 26.64  ? 279  ASP B CB    1 
ATOM   5077 C  CG    . ASP B 1 279 ? 20.187  -22.356 21.471  1.00 26.10  ? 279  ASP B CG    1 
ATOM   5078 O  OD1   . ASP B 1 279 ? 20.345  -22.580 22.695  1.00 24.69  ? 279  ASP B OD1   1 
ATOM   5079 O  OD2   . ASP B 1 279 ? 20.150  -23.274 20.622  1.00 25.81  ? 279  ASP B OD2   1 
ATOM   5080 N  N     . LEU B 1 280 ? 18.282  -21.022 23.860  1.00 25.63  ? 280  LEU B N     1 
ATOM   5081 C  CA    . LEU B 1 280 ? 17.113  -21.627 24.450  1.00 25.09  ? 280  LEU B CA    1 
ATOM   5082 C  C     . LEU B 1 280 ? 16.455  -20.694 25.466  1.00 25.30  ? 280  LEU B C     1 
ATOM   5083 O  O     . LEU B 1 280 ? 15.341  -20.958 25.931  1.00 25.07  ? 280  LEU B O     1 
ATOM   5084 C  CB    . LEU B 1 280 ? 17.534  -22.944 25.105  1.00 24.79  ? 280  LEU B CB    1 
ATOM   5085 C  CG    . LEU B 1 280 ? 17.125  -24.299 24.556  1.00 22.39  ? 280  LEU B CG    1 
ATOM   5086 C  CD1   . LEU B 1 280 ? 16.143  -24.844 25.532  1.00 21.84  ? 280  LEU B CD1   1 
ATOM   5087 C  CD2   . LEU B 1 280 ? 16.537  -24.228 23.164  1.00 19.96  ? 280  LEU B CD2   1 
ATOM   5088 N  N     . ALA B 1 281 ? 17.158  -19.613 25.803  1.00 25.67  ? 281  ALA B N     1 
ATOM   5089 C  CA    . ALA B 1 281 ? 16.703  -18.657 26.813  1.00 26.33  ? 281  ALA B CA    1 
ATOM   5090 C  C     . ALA B 1 281 ? 16.348  -17.309 26.207  1.00 26.66  ? 281  ALA B C     1 
ATOM   5091 O  O     . ALA B 1 281 ? 17.218  -16.617 25.677  1.00 26.74  ? 281  ALA B O     1 
ATOM   5092 C  CB    . ALA B 1 281 ? 17.741  -18.489 27.923  1.00 26.42  ? 281  ALA B CB    1 
ATOM   5093 N  N     . PRO B 1 282 ? 15.067  -16.919 26.327  1.00 27.05  ? 282  PRO B N     1 
ATOM   5094 C  CA    . PRO B 1 282 ? 14.452  -15.839 25.577  1.00 27.38  ? 282  PRO B CA    1 
ATOM   5095 C  C     . PRO B 1 282 ? 15.212  -14.551 25.742  1.00 27.66  ? 282  PRO B C     1 
ATOM   5096 O  O     . PRO B 1 282 ? 15.478  -13.876 24.754  1.00 27.53  ? 282  PRO B O     1 
ATOM   5097 C  CB    . PRO B 1 282 ? 13.056  -15.735 26.192  1.00 27.45  ? 282  PRO B CB    1 
ATOM   5098 C  CG    . PRO B 1 282 ? 12.861  -16.997 26.950  1.00 27.14  ? 282  PRO B CG    1 
ATOM   5099 C  CD    . PRO B 1 282 ? 14.201  -17.351 27.433  1.00 27.20  ? 282  PRO B CD    1 
ATOM   5100 N  N     . SER B 1 283 ? 15.582  -14.241 26.976  1.00 28.28  ? 283  SER B N     1 
ATOM   5101 C  CA    . SER B 1 283 ? 16.383  -13.074 27.267  1.00 29.59  ? 283  SER B CA    1 
ATOM   5102 C  C     . SER B 1 283 ? 17.431  -12.882 26.181  1.00 30.38  ? 283  SER B C     1 
ATOM   5103 O  O     . SER B 1 283 ? 17.522  -11.809 25.575  1.00 30.50  ? 283  SER B O     1 
ATOM   5104 C  CB    . SER B 1 283 ? 17.085  -13.239 28.614  1.00 29.70  ? 283  SER B CB    1 
ATOM   5105 O  OG    . SER B 1 283 ? 16.205  -13.716 29.616  1.00 30.49  ? 283  SER B OG    1 
ATOM   5106 N  N     . ASP B 1 284 ? 18.198  -13.941 25.928  1.00 31.32  ? 284  ASP B N     1 
ATOM   5107 C  CA    . ASP B 1 284 ? 19.311  -13.892 25.001  1.00 32.39  ? 284  ASP B CA    1 
ATOM   5108 C  C     . ASP B 1 284 ? 18.866  -13.725 23.570  1.00 32.66  ? 284  ASP B C     1 
ATOM   5109 O  O     . ASP B 1 284 ? 18.935  -12.620 23.032  1.00 33.08  ? 284  ASP B O     1 
ATOM   5110 C  CB    . ASP B 1 284 ? 20.180  -15.129 25.136  1.00 32.83  ? 284  ASP B CB    1 
ATOM   5111 C  CG    . ASP B 1 284 ? 21.135  -15.040 26.314  1.00 35.61  ? 284  ASP B CG    1 
ATOM   5112 O  OD1   . ASP B 1 284 ? 21.566  -13.909 26.676  1.00 37.73  ? 284  ASP B OD1   1 
ATOM   5113 O  OD2   . ASP B 1 284 ? 21.460  -16.114 26.877  1.00 38.30  ? 284  ASP B OD2   1 
ATOM   5114 N  N     . TYR B 1 285 ? 18.397  -14.814 22.962  1.00 32.97  ? 285  TYR B N     1 
ATOM   5115 C  CA    . TYR B 1 285 ? 18.041  -14.827 21.533  1.00 33.14  ? 285  TYR B CA    1 
ATOM   5116 C  C     . TYR B 1 285 ? 16.990  -13.799 21.106  1.00 33.00  ? 285  TYR B C     1 
ATOM   5117 O  O     . TYR B 1 285 ? 16.874  -13.509 19.920  1.00 32.90  ? 285  TYR B O     1 
ATOM   5118 C  CB    . TYR B 1 285 ? 17.584  -16.218 21.092  1.00 33.05  ? 285  TYR B CB    1 
ATOM   5119 C  CG    . TYR B 1 285 ? 16.258  -16.637 21.672  1.00 33.61  ? 285  TYR B CG    1 
ATOM   5120 C  CD1   . TYR B 1 285 ? 16.206  -17.446 22.798  1.00 34.37  ? 285  TYR B CD1   1 
ATOM   5121 C  CD2   . TYR B 1 285 ? 15.053  -16.230 21.095  1.00 34.16  ? 285  TYR B CD2   1 
ATOM   5122 C  CE1   . TYR B 1 285 ? 14.993  -17.856 23.336  1.00 35.06  ? 285  TYR B CE1   1 
ATOM   5123 C  CE2   . TYR B 1 285 ? 13.830  -16.629 21.629  1.00 34.88  ? 285  TYR B CE2   1 
ATOM   5124 C  CZ    . TYR B 1 285 ? 13.810  -17.443 22.754  1.00 35.32  ? 285  TYR B CZ    1 
ATOM   5125 O  OH    . TYR B 1 285 ? 12.620  -17.851 23.310  1.00 35.41  ? 285  TYR B OH    1 
ATOM   5126 N  N     . HIS B 1 286 ? 16.216  -13.271 22.049  1.00 32.93  ? 286  HIS B N     1 
ATOM   5127 C  CA    . HIS B 1 286 ? 15.179  -12.321 21.679  1.00 33.01  ? 286  HIS B CA    1 
ATOM   5128 C  C     . HIS B 1 286 ? 15.372  -10.880 22.156  1.00 33.26  ? 286  HIS B C     1 
ATOM   5129 O  O     . HIS B 1 286 ? 15.322  -9.954  21.342  1.00 32.91  ? 286  HIS B O     1 
ATOM   5130 C  CB    . HIS B 1 286 ? 13.821  -12.836 22.097  1.00 32.85  ? 286  HIS B CB    1 
ATOM   5131 C  CG    . HIS B 1 286 ? 12.695  -11.945 21.688  1.00 32.63  ? 286  HIS B CG    1 
ATOM   5132 N  ND1   . HIS B 1 286 ? 12.186  -11.934 20.409  1.00 32.27  ? 286  HIS B ND1   1 
ATOM   5133 C  CD2   . HIS B 1 286 ? 11.965  -11.050 22.395  1.00 32.38  ? 286  HIS B CD2   1 
ATOM   5134 C  CE1   . HIS B 1 286 ? 11.193  -11.067 20.344  1.00 33.02  ? 286  HIS B CE1   1 
ATOM   5135 N  NE2   . HIS B 1 286 ? 11.036  -10.518 21.536  1.00 32.75  ? 286  HIS B NE2   1 
ATOM   5136 N  N     . LEU B 1 287 ? 15.573  -10.686 23.459  1.00 33.76  ? 287  LEU B N     1 
ATOM   5137 C  CA    . LEU B 1 287 ? 15.637  -9.329  24.001  1.00 34.48  ? 287  LEU B CA    1 
ATOM   5138 C  C     . LEU B 1 287 ? 16.937  -8.620  23.638  1.00 35.10  ? 287  LEU B C     1 
ATOM   5139 O  O     . LEU B 1 287 ? 16.923  -7.540  23.027  1.00 35.54  ? 287  LEU B O     1 
ATOM   5140 C  CB    . LEU B 1 287 ? 15.402  -9.289  25.516  1.00 34.41  ? 287  LEU B CB    1 
ATOM   5141 C  CG    . LEU B 1 287 ? 15.228  -7.862  26.076  1.00 34.48  ? 287  LEU B CG    1 
ATOM   5142 C  CD1   . LEU B 1 287 ? 14.074  -7.154  25.390  1.00 34.36  ? 287  LEU B CD1   1 
ATOM   5143 C  CD2   . LEU B 1 287 ? 15.025  -7.837  27.585  1.00 34.24  ? 287  LEU B CD2   1 
ATOM   5144 N  N     . PHE B 1 288 ? 18.056  -9.232  24.014  1.00 35.38  ? 288  PHE B N     1 
ATOM   5145 C  CA    . PHE B 1 288 ? 19.366  -8.674  23.730  1.00 35.51  ? 288  PHE B CA    1 
ATOM   5146 C  C     . PHE B 1 288 ? 19.618  -8.637  22.236  1.00 35.75  ? 288  PHE B C     1 
ATOM   5147 O  O     . PHE B 1 288 ? 20.226  -7.713  21.712  1.00 35.39  ? 288  PHE B O     1 
ATOM   5148 C  CB    . PHE B 1 288 ? 20.424  -9.525  24.399  1.00 35.56  ? 288  PHE B CB    1 
ATOM   5149 C  CG    . PHE B 1 288 ? 20.227  -9.681  25.864  1.00 35.87  ? 288  PHE B CG    1 
ATOM   5150 C  CD1   . PHE B 1 288 ? 19.985  -8.565  26.668  1.00 35.63  ? 288  PHE B CD1   1 
ATOM   5151 C  CD2   . PHE B 1 288 ? 20.307  -10.940 26.448  1.00 36.57  ? 288  PHE B CD2   1 
ATOM   5152 C  CE1   . PHE B 1 288 ? 19.809  -8.696  28.022  1.00 36.33  ? 288  PHE B CE1   1 
ATOM   5153 C  CE2   . PHE B 1 288 ? 20.135  -11.098 27.817  1.00 37.63  ? 288  PHE B CE2   1 
ATOM   5154 C  CZ    . PHE B 1 288 ? 19.884  -9.972  28.609  1.00 38.02  ? 288  PHE B CZ    1 
ATOM   5155 N  N     . ALA B 1 289 ? 19.146  -9.668  21.551  1.00 36.28  ? 289  ALA B N     1 
ATOM   5156 C  CA    . ALA B 1 289 ? 19.280  -9.731  20.119  1.00 36.64  ? 289  ALA B CA    1 
ATOM   5157 C  C     . ALA B 1 289 ? 18.595  -8.532  19.479  1.00 36.78  ? 289  ALA B C     1 
ATOM   5158 O  O     . ALA B 1 289 ? 19.107  -7.981  18.512  1.00 36.75  ? 289  ALA B O     1 
ATOM   5159 C  CB    . ALA B 1 289 ? 18.730  -11.037 19.591  1.00 36.67  ? 289  ALA B CB    1 
ATOM   5160 N  N     . SER B 1 290 ? 17.461  -8.107  20.022  1.00 37.09  ? 290  SER B N     1 
ATOM   5161 C  CA    . SER B 1 290 ? 16.831  -6.923  19.480  1.00 37.93  ? 290  SER B CA    1 
ATOM   5162 C  C     . SER B 1 290 ? 17.732  -5.755  19.752  1.00 38.49  ? 290  SER B C     1 
ATOM   5163 O  O     . SER B 1 290 ? 17.886  -4.858  18.917  1.00 38.60  ? 290  SER B O     1 
ATOM   5164 C  CB    . SER B 1 290 ? 15.478  -6.656  20.109  1.00 38.02  ? 290  SER B CB    1 
ATOM   5165 O  OG    . SER B 1 290 ? 14.824  -5.598  19.412  1.00 38.56  ? 290  SER B OG    1 
ATOM   5166 N  N     . MET B 1 291 ? 18.332  -5.789  20.932  1.00 39.36  ? 291  MET B N     1 
ATOM   5167 C  CA    . MET B 1 291 ? 19.213  -4.737  21.394  1.00 40.31  ? 291  MET B CA    1 
ATOM   5168 C  C     . MET B 1 291 ? 20.489  -4.684  20.547  1.00 41.44  ? 291  MET B C     1 
ATOM   5169 O  O     . MET B 1 291 ? 20.881  -3.613  20.059  1.00 41.21  ? 291  MET B O     1 
ATOM   5170 C  CB    . MET B 1 291 ? 19.526  -4.977  22.867  1.00 39.93  ? 291  MET B CB    1 
ATOM   5171 C  CG    . MET B 1 291 ? 20.158  -3.815  23.570  1.00 39.01  ? 291  MET B CG    1 
ATOM   5172 S  SD    . MET B 1 291 ? 19.718  -3.855  25.303  1.00 36.68  ? 291  MET B SD    1 
ATOM   5173 C  CE    . MET B 1 291 ? 20.859  -5.063  25.932  1.00 37.16  ? 291  MET B CE    1 
ATOM   5174 N  N     . GLY B 1 292 ? 21.107  -5.856  20.358  1.00 42.97  ? 292  GLY B N     1 
ATOM   5175 C  CA    . GLY B 1 292 ? 22.322  -6.016  19.551  1.00 44.69  ? 292  GLY B CA    1 
ATOM   5176 C  C     . GLY B 1 292 ? 22.330  -5.079  18.363  1.00 46.00  ? 292  GLY B C     1 
ATOM   5177 O  O     . GLY B 1 292 ? 23.291  -4.354  18.154  1.00 45.93  ? 292  GLY B O     1 
ATOM   5178 N  N     . HIS B 1 293 ? 21.239  -5.068  17.605  1.00 47.49  ? 293  HIS B N     1 
ATOM   5179 C  CA    . HIS B 1 293 ? 21.112  -4.143  16.494  1.00 49.29  ? 293  HIS B CA    1 
ATOM   5180 C  C     . HIS B 1 293 ? 21.085  -2.693  16.954  1.00 50.39  ? 293  HIS B C     1 
ATOM   5181 O  O     . HIS B 1 293 ? 22.027  -1.954  16.692  1.00 51.02  ? 293  HIS B O     1 
ATOM   5182 C  CB    . HIS B 1 293 ? 19.896  -4.465  15.634  1.00 49.29  ? 293  HIS B CB    1 
ATOM   5183 C  CG    . HIS B 1 293 ? 20.001  -5.772  14.920  1.00 49.67  ? 293  HIS B CG    1 
ATOM   5184 N  ND1   . HIS B 1 293 ? 20.526  -5.884  13.650  1.00 50.19  ? 293  HIS B ND1   1 
ATOM   5185 C  CD2   . HIS B 1 293 ? 19.654  -7.025  15.299  1.00 49.74  ? 293  HIS B CD2   1 
ATOM   5186 C  CE1   . HIS B 1 293 ? 20.487  -7.151  13.274  1.00 50.80  ? 293  HIS B CE1   1 
ATOM   5187 N  NE2   . HIS B 1 293 ? 19.958  -7.863  14.255  1.00 50.48  ? 293  HIS B NE2   1 
ATOM   5188 N  N     . ALA B 1 294 ? 20.039  -2.281  17.657  1.00 51.50  ? 294  ALA B N     1 
ATOM   5189 C  CA    . ALA B 1 294 ? 19.879  -0.858  17.955  1.00 52.72  ? 294  ALA B CA    1 
ATOM   5190 C  C     . ALA B 1 294 ? 20.984  -0.257  18.838  1.00 53.61  ? 294  ALA B C     1 
ATOM   5191 O  O     . ALA B 1 294 ? 20.859  0.875   19.299  1.00 53.69  ? 294  ALA B O     1 
ATOM   5192 C  CB    . ALA B 1 294 ? 18.495  -0.579  18.542  1.00 52.89  ? 294  ALA B CB    1 
ATOM   5193 N  N     . LEU B 1 295 ? 22.059  -1.008  19.068  1.00 54.72  ? 295  LEU B N     1 
ATOM   5194 C  CA    . LEU B 1 295 ? 23.210  -0.473  19.788  1.00 56.09  ? 295  LEU B CA    1 
ATOM   5195 C  C     . LEU B 1 295 ? 24.319  0.015   18.840  1.00 57.29  ? 295  LEU B C     1 
ATOM   5196 O  O     . LEU B 1 295 ? 25.173  0.828   19.216  1.00 57.30  ? 295  LEU B O     1 
ATOM   5197 C  CB    . LEU B 1 295 ? 23.767  -1.503  20.782  1.00 55.95  ? 295  LEU B CB    1 
ATOM   5198 C  CG    . LEU B 1 295 ? 23.007  -1.978  22.032  1.00 55.54  ? 295  LEU B CG    1 
ATOM   5199 C  CD1   . LEU B 1 295 ? 23.874  -2.958  22.803  1.00 55.38  ? 295  LEU B CD1   1 
ATOM   5200 C  CD2   . LEU B 1 295 ? 22.593  -0.855  22.955  1.00 54.90  ? 295  LEU B CD2   1 
ATOM   5201 N  N     . ALA B 1 296 ? 24.298  -0.477  17.607  1.00 58.88  ? 296  ALA B N     1 
ATOM   5202 C  CA    . ALA B 1 296 ? 25.344  -0.166  16.633  1.00 60.54  ? 296  ALA B CA    1 
ATOM   5203 C  C     . ALA B 1 296 ? 25.609  1.334   16.512  1.00 61.74  ? 296  ALA B C     1 
ATOM   5204 O  O     . ALA B 1 296 ? 24.690  2.145   16.666  1.00 61.67  ? 296  ALA B O     1 
ATOM   5205 C  CB    . ALA B 1 296 ? 24.997  -0.766  15.264  1.00 60.23  ? 296  ALA B CB    1 
ATOM   5206 N  N     . GLU B 1 297 ? 26.875  1.683   16.264  1.00 63.49  ? 297  GLU B N     1 
ATOM   5207 C  CA    . GLU B 1 297 ? 27.285  3.051   15.930  1.00 65.23  ? 297  GLU B CA    1 
ATOM   5208 C  C     . GLU B 1 297 ? 26.998  4.008   17.086  1.00 66.00  ? 297  GLU B C     1 
ATOM   5209 O  O     . GLU B 1 297 ? 27.439  5.158   17.076  1.00 66.12  ? 297  GLU B O     1 
ATOM   5210 C  CB    . GLU B 1 297 ? 26.576  3.500   14.636  1.00 65.49  ? 297  GLU B CB    1 
ATOM   5211 C  CG    . GLU B 1 297 ? 26.959  4.870   14.053  1.00 66.77  ? 297  GLU B CG    1 
ATOM   5212 C  CD    . GLU B 1 297 ? 25.945  5.361   13.007  1.00 68.32  ? 297  GLU B CD    1 
ATOM   5213 O  OE1   . GLU B 1 297 ? 25.803  4.704   11.947  1.00 68.94  ? 297  GLU B OE1   1 
ATOM   5214 O  OE2   . GLU B 1 297 ? 25.285  6.400   13.249  1.00 68.35  ? 297  GLU B OE2   1 
ATOM   5215 N  N     . GLN B 1 298 ? 26.266  3.518   18.084  1.00 67.10  ? 298  GLN B N     1 
ATOM   5216 C  CA    . GLN B 1 298 ? 25.871  4.334   19.219  1.00 68.29  ? 298  GLN B CA    1 
ATOM   5217 C  C     . GLN B 1 298 ? 27.062  4.587   20.115  1.00 69.31  ? 298  GLN B C     1 
ATOM   5218 O  O     . GLN B 1 298 ? 27.956  3.739   20.235  1.00 69.53  ? 298  GLN B O     1 
ATOM   5219 C  CB    . GLN B 1 298 ? 24.785  3.644   20.032  1.00 68.10  ? 298  GLN B CB    1 
ATOM   5220 C  CG    . GLN B 1 298 ? 23.922  4.592   20.830  1.00 67.84  ? 298  GLN B CG    1 
ATOM   5221 C  CD    . GLN B 1 298 ? 22.695  5.062   20.067  1.00 67.89  ? 298  GLN B CD    1 
ATOM   5222 O  OE1   . GLN B 1 298 ? 22.523  4.767   18.882  1.00 67.90  ? 298  GLN B OE1   1 
ATOM   5223 N  NE2   . GLN B 1 298 ? 21.829  5.798   20.752  1.00 68.12  ? 298  GLN B NE2   1 
ATOM   5224 N  N     . ARG B 1 299 ? 27.062  5.764   20.733  1.00 70.47  ? 299  ARG B N     1 
ATOM   5225 C  CA    . ARG B 1 299 ? 28.084  6.146   21.703  1.00 71.63  ? 299  ARG B CA    1 
ATOM   5226 C  C     . ARG B 1 299 ? 27.427  6.541   23.029  1.00 71.98  ? 299  ARG B C     1 
ATOM   5227 O  O     . ARG B 1 299 ? 26.315  7.082   23.058  1.00 72.08  ? 299  ARG B O     1 
ATOM   5228 C  CB    . ARG B 1 299 ? 28.951  7.291   21.158  1.00 71.85  ? 299  ARG B CB    1 
ATOM   5229 C  CG    . ARG B 1 299 ? 29.813  6.930   19.927  1.00 73.56  ? 299  ARG B CG    1 
ATOM   5230 C  CD    . ARG B 1 299 ? 30.266  8.185   19.154  1.00 76.43  ? 299  ARG B CD    1 
ATOM   5231 N  NE    . ARG B 1 299 ? 29.201  8.752   18.310  1.00 77.81  ? 299  ARG B NE    1 
ATOM   5232 C  CZ    . ARG B 1 299 ? 28.930  10.055  18.184  1.00 78.10  ? 299  ARG B CZ    1 
ATOM   5233 N  NH1   . ARG B 1 299 ? 29.626  10.972  18.861  1.00 77.95  ? 299  ARG B NH1   1 
ATOM   5234 N  NH2   . ARG B 1 299 ? 27.939  10.444  17.390  1.00 77.88  ? 299  ARG B NH2   1 
ATOM   5235 N  N     . PHE B 1 300 ? 28.108  6.252   24.130  1.00 72.49  ? 300  PHE B N     1 
ATOM   5236 C  CA    . PHE B 1 300 ? 27.601  6.629   25.441  1.00 72.91  ? 300  PHE B CA    1 
ATOM   5237 C  C     . PHE B 1 300 ? 28.649  7.403   26.214  1.00 73.07  ? 300  PHE B C     1 
ATOM   5238 O  O     . PHE B 1 300 ? 29.641  6.834   26.671  1.00 72.98  ? 300  PHE B O     1 
ATOM   5239 C  CB    . PHE B 1 300 ? 27.141  5.399   26.221  1.00 73.07  ? 300  PHE B CB    1 
ATOM   5240 C  CG    . PHE B 1 300 ? 25.931  4.738   25.637  1.00 73.31  ? 300  PHE B CG    1 
ATOM   5241 C  CD1   . PHE B 1 300 ? 24.673  5.311   25.785  1.00 73.58  ? 300  PHE B CD1   1 
ATOM   5242 C  CD2   . PHE B 1 300 ? 26.047  3.547   24.935  1.00 73.67  ? 300  PHE B CD2   1 
ATOM   5243 C  CE1   . PHE B 1 300 ? 23.548  4.706   25.246  1.00 73.84  ? 300  PHE B CE1   1 
ATOM   5244 C  CE2   . PHE B 1 300 ? 24.927  2.933   24.391  1.00 74.01  ? 300  PHE B CE2   1 
ATOM   5245 C  CZ    . PHE B 1 300 ? 23.672  3.514   24.548  1.00 74.04  ? 300  PHE B CZ    1 
ATOM   5246 N  N     . ASP B 1 301 ? 28.417  8.708   26.337  1.00 73.32  ? 301  ASP B N     1 
ATOM   5247 C  CA    . ASP B 1 301 ? 29.360  9.620   26.979  1.00 73.55  ? 301  ASP B CA    1 
ATOM   5248 C  C     . ASP B 1 301 ? 29.363  9.449   28.490  1.00 73.38  ? 301  ASP B C     1 
ATOM   5249 O  O     . ASP B 1 301 ? 30.408  9.613   29.122  1.00 73.33  ? 301  ASP B O     1 
ATOM   5250 C  CB    . ASP B 1 301 ? 29.064  11.077  26.603  1.00 73.82  ? 301  ASP B CB    1 
ATOM   5251 C  CG    . ASP B 1 301 ? 27.584  11.431  26.733  1.00 74.89  ? 301  ASP B CG    1 
ATOM   5252 O  OD1   . ASP B 1 301 ? 27.205  12.071  27.749  1.00 75.85  ? 301  ASP B OD1   1 
ATOM   5253 O  OD2   . ASP B 1 301 ? 26.801  11.063  25.821  1.00 75.67  ? 301  ASP B OD2   1 
ATOM   5254 N  N     . SER B 1 302 ? 28.199  9.121   29.059  1.00 73.27  ? 302  SER B N     1 
ATOM   5255 C  CA    . SER B 1 302 ? 28.086  8.841   30.501  1.00 73.22  ? 302  SER B CA    1 
ATOM   5256 C  C     . SER B 1 302 ? 27.020  7.798   30.858  1.00 72.88  ? 302  SER B C     1 
ATOM   5257 O  O     . SER B 1 302 ? 26.104  7.527   30.078  1.00 72.74  ? 302  SER B O     1 
ATOM   5258 C  CB    . SER B 1 302 ? 27.893  10.136  31.323  1.00 73.32  ? 302  SER B CB    1 
ATOM   5259 O  OG    . SER B 1 302 ? 26.543  10.575  31.325  1.00 73.64  ? 302  SER B OG    1 
ATOM   5260 N  N     . TYR B 1 303 ? 27.171  7.230   32.054  1.00 72.57  ? 303  TYR B N     1 
ATOM   5261 C  CA    . TYR B 1 303 ? 26.311  6.176   32.592  1.00 72.29  ? 303  TYR B CA    1 
ATOM   5262 C  C     . TYR B 1 303 ? 24.841  6.588   32.694  1.00 72.09  ? 303  TYR B C     1 
ATOM   5263 O  O     . TYR B 1 303 ? 23.952  5.740   32.714  1.00 71.84  ? 303  TYR B O     1 
ATOM   5264 C  CB    . TYR B 1 303 ? 26.872  5.728   33.948  1.00 72.32  ? 303  TYR B CB    1 
ATOM   5265 C  CG    . TYR B 1 303 ? 25.918  4.985   34.852  1.00 72.65  ? 303  TYR B CG    1 
ATOM   5266 C  CD1   . TYR B 1 303 ? 25.775  3.604   34.761  1.00 72.98  ? 303  TYR B CD1   1 
ATOM   5267 C  CD2   . TYR B 1 303 ? 25.177  5.664   35.823  1.00 73.34  ? 303  TYR B CD2   1 
ATOM   5268 C  CE1   . TYR B 1 303 ? 24.901  2.912   35.603  1.00 73.31  ? 303  TYR B CE1   1 
ATOM   5269 C  CE2   . TYR B 1 303 ? 24.303  4.985   36.672  1.00 73.46  ? 303  TYR B CE2   1 
ATOM   5270 C  CZ    . TYR B 1 303 ? 24.171  3.611   36.554  1.00 73.51  ? 303  TYR B CZ    1 
ATOM   5271 O  OH    . TYR B 1 303 ? 23.308  2.940   37.384  1.00 73.56  ? 303  TYR B OH    1 
ATOM   5272 N  N     . GLU B 1 304 ? 24.596  7.894   32.745  1.00 72.10  ? 304  GLU B N     1 
ATOM   5273 C  CA    . GLU B 1 304 ? 23.236  8.428   32.819  1.00 72.16  ? 304  GLU B CA    1 
ATOM   5274 C  C     . GLU B 1 304 ? 22.534  8.374   31.476  1.00 71.77  ? 304  GLU B C     1 
ATOM   5275 O  O     . GLU B 1 304 ? 21.301  8.334   31.415  1.00 71.85  ? 304  GLU B O     1 
ATOM   5276 C  CB    . GLU B 1 304 ? 23.229  9.863   33.360  1.00 72.43  ? 304  GLU B CB    1 
ATOM   5277 C  CG    . GLU B 1 304 ? 23.772  10.012  34.789  1.00 73.68  ? 304  GLU B CG    1 
ATOM   5278 C  CD    . GLU B 1 304 ? 23.077  9.105   35.821  1.00 75.20  ? 304  GLU B CD    1 
ATOM   5279 O  OE1   . GLU B 1 304 ? 23.131  9.445   37.024  1.00 75.73  ? 304  GLU B OE1   1 
ATOM   5280 O  OE2   . GLU B 1 304 ? 22.490  8.058   35.447  1.00 75.26  ? 304  GLU B OE2   1 
ATOM   5281 N  N     . SER B 1 305 ? 23.326  8.382   30.407  1.00 71.20  ? 305  SER B N     1 
ATOM   5282 C  CA    . SER B 1 305 ? 22.807  8.224   29.054  1.00 70.62  ? 305  SER B CA    1 
ATOM   5283 C  C     . SER B 1 305 ? 22.280  6.804   28.854  1.00 70.08  ? 305  SER B C     1 
ATOM   5284 O  O     . SER B 1 305 ? 21.236  6.605   28.226  1.00 69.86  ? 305  SER B O     1 
ATOM   5285 C  CB    . SER B 1 305 ? 23.890  8.534   28.016  1.00 70.68  ? 305  SER B CB    1 
ATOM   5286 O  OG    . SER B 1 305 ? 24.605  9.707   28.351  1.00 70.84  ? 305  SER B OG    1 
ATOM   5287 N  N     . VAL B 1 306 ? 23.003  5.825   29.398  1.00 69.38  ? 306  VAL B N     1 
ATOM   5288 C  CA    . VAL B 1 306 ? 22.629  4.425   29.243  1.00 68.80  ? 306  VAL B CA    1 
ATOM   5289 C  C     . VAL B 1 306 ? 21.312  4.151   29.973  1.00 68.77  ? 306  VAL B C     1 
ATOM   5290 O  O     . VAL B 1 306 ? 20.464  3.427   29.449  1.00 68.92  ? 306  VAL B O     1 
ATOM   5291 C  CB    . VAL B 1 306 ? 23.764  3.455   29.649  1.00 68.58  ? 306  VAL B CB    1 
ATOM   5292 C  CG1   . VAL B 1 306 ? 23.493  2.065   29.128  1.00 67.98  ? 306  VAL B CG1   1 
ATOM   5293 C  CG2   . VAL B 1 306 ? 25.075  3.925   29.074  1.00 68.31  ? 306  VAL B CG2   1 
ATOM   5294 N  N     . LYS B 1 307 ? 21.119  4.753   31.149  1.00 68.52  ? 307  LYS B N     1 
ATOM   5295 C  CA    . LYS B 1 307 ? 19.796  4.747   31.790  1.00 68.31  ? 307  LYS B CA    1 
ATOM   5296 C  C     . LYS B 1 307 ? 18.802  5.377   30.833  1.00 68.04  ? 307  LYS B C     1 
ATOM   5297 O  O     . LYS B 1 307 ? 17.803  4.752   30.468  1.00 67.96  ? 307  LYS B O     1 
ATOM   5298 C  CB    . LYS B 1 307 ? 19.790  5.522   33.110  1.00 68.40  ? 307  LYS B CB    1 
ATOM   5299 C  CG    . LYS B 1 307 ? 20.314  4.753   34.328  1.00 68.99  ? 307  LYS B CG    1 
ATOM   5300 C  CD    . LYS B 1 307 ? 19.210  4.272   35.279  1.00 68.93  ? 307  LYS B CD    1 
ATOM   5301 C  CE    . LYS B 1 307 ? 19.757  4.098   36.701  1.00 68.05  ? 307  LYS B CE    1 
ATOM   5302 N  NZ    . LYS B 1 307 ? 18.926  3.180   37.519  1.00 67.87  ? 307  LYS B NZ    1 
ATOM   5303 N  N     . LYS B 1 308 ? 19.110  6.605   30.409  1.00 67.78  ? 308  LYS B N     1 
ATOM   5304 C  CA    . LYS B 1 308 ? 18.260  7.376   29.498  1.00 67.59  ? 308  LYS B CA    1 
ATOM   5305 C  C     . LYS B 1 308 ? 17.846  6.535   28.302  1.00 67.33  ? 308  LYS B C     1 
ATOM   5306 O  O     . LYS B 1 308 ? 16.657  6.427   27.986  1.00 67.22  ? 308  LYS B O     1 
ATOM   5307 C  CB    . LYS B 1 308 ? 18.980  8.651   29.021  1.00 67.65  ? 308  LYS B CB    1 
ATOM   5308 C  CG    . LYS B 1 308 ? 18.049  9.791   28.613  1.00 67.60  ? 308  LYS B CG    1 
ATOM   5309 C  CD    . LYS B 1 308 ? 17.529  10.524  29.848  1.00 68.10  ? 308  LYS B CD    1 
ATOM   5310 C  CE    . LYS B 1 308 ? 16.036  10.813  29.751  1.00 68.00  ? 308  LYS B CE    1 
ATOM   5311 N  NZ    . LYS B 1 308 ? 15.519  11.382  31.024  1.00 67.47  ? 308  LYS B NZ    1 
ATOM   5312 N  N     . TRP B 1 309 ? 18.843  5.925   27.667  1.00 67.02  ? 309  TRP B N     1 
ATOM   5313 C  CA    . TRP B 1 309 ? 18.646  5.133   26.466  1.00 66.85  ? 309  TRP B CA    1 
ATOM   5314 C  C     . TRP B 1 309 ? 17.870  3.851   26.710  1.00 66.97  ? 309  TRP B C     1 
ATOM   5315 O  O     . TRP B 1 309 ? 17.075  3.446   25.865  1.00 66.93  ? 309  TRP B O     1 
ATOM   5316 C  CB    . TRP B 1 309 ? 19.989  4.806   25.823  1.00 66.74  ? 309  TRP B CB    1 
ATOM   5317 C  CG    . TRP B 1 309 ? 19.879  4.171   24.472  1.00 65.65  ? 309  TRP B CG    1 
ATOM   5318 C  CD1   . TRP B 1 309 ? 19.897  4.804   23.266  1.00 65.19  ? 309  TRP B CD1   1 
ATOM   5319 C  CD2   . TRP B 1 309 ? 19.735  2.781   24.192  1.00 64.18  ? 309  TRP B CD2   1 
ATOM   5320 N  NE1   . TRP B 1 309 ? 19.775  3.894   22.251  1.00 64.51  ? 309  TRP B NE1   1 
ATOM   5321 C  CE2   . TRP B 1 309 ? 19.675  2.642   22.794  1.00 64.16  ? 309  TRP B CE2   1 
ATOM   5322 C  CE3   . TRP B 1 309 ? 19.650  1.638   24.988  1.00 63.88  ? 309  TRP B CE3   1 
ATOM   5323 C  CZ2   . TRP B 1 309 ? 19.538  1.405   22.174  1.00 64.03  ? 309  TRP B CZ2   1 
ATOM   5324 C  CZ3   . TRP B 1 309 ? 19.513  0.410   24.371  1.00 63.62  ? 309  TRP B CZ3   1 
ATOM   5325 C  CH2   . TRP B 1 309 ? 19.456  0.303   22.979  1.00 63.65  ? 309  TRP B CH2   1 
ATOM   5326 N  N     . LEU B 1 310 ? 18.106  3.200   27.843  1.00 67.20  ? 310  LEU B N     1 
ATOM   5327 C  CA    . LEU B 1 310 ? 17.393  1.963   28.129  1.00 67.64  ? 310  LEU B CA    1 
ATOM   5328 C  C     . LEU B 1 310 ? 15.868  2.153   28.168  1.00 68.46  ? 310  LEU B C     1 
ATOM   5329 O  O     . LEU B 1 310 ? 15.136  1.380   27.536  1.00 68.70  ? 310  LEU B O     1 
ATOM   5330 C  CB    . LEU B 1 310 ? 17.909  1.270   29.398  1.00 67.26  ? 310  LEU B CB    1 
ATOM   5331 C  CG    . LEU B 1 310 ? 18.799  0.016   29.281  1.00 66.10  ? 310  LEU B CG    1 
ATOM   5332 C  CD1   . LEU B 1 310 ? 18.602  -0.710  27.967  1.00 65.29  ? 310  LEU B CD1   1 
ATOM   5333 C  CD2   . LEU B 1 310 ? 20.261  0.320   29.463  1.00 64.71  ? 310  LEU B CD2   1 
ATOM   5334 N  N     . ASP B 1 311 ? 15.402  3.192   28.870  1.00 69.22  ? 311  ASP B N     1 
ATOM   5335 C  CA    . ASP B 1 311 ? 13.951  3.449   29.053  1.00 69.84  ? 311  ASP B CA    1 
ATOM   5336 C  C     . ASP B 1 311 ? 13.199  3.774   27.761  1.00 69.86  ? 311  ASP B C     1 
ATOM   5337 O  O     . ASP B 1 311 ? 12.154  3.172   27.467  1.00 69.86  ? 311  ASP B O     1 
ATOM   5338 C  CB    . ASP B 1 311 ? 13.706  4.580   30.056  1.00 70.01  ? 311  ASP B CB    1 
ATOM   5339 C  CG    . ASP B 1 311 ? 14.505  4.415   31.322  1.00 70.81  ? 311  ASP B CG    1 
ATOM   5340 O  OD1   . ASP B 1 311 ? 15.087  5.429   31.762  1.00 72.53  ? 311  ASP B OD1   1 
ATOM   5341 O  OD2   . ASP B 1 311 ? 14.557  3.286   31.867  1.00 71.00  ? 311  ASP B OD2   1 
ATOM   5342 N  N     . GLU B 1 312 ? 13.723  4.743   27.012  1.00 69.76  ? 312  GLU B N     1 
ATOM   5343 C  CA    . GLU B 1 312 ? 13.158  5.100   25.724  1.00 69.71  ? 312  GLU B CA    1 
ATOM   5344 C  C     . GLU B 1 312 ? 12.883  3.827   24.928  1.00 69.02  ? 312  GLU B C     1 
ATOM   5345 O  O     . GLU B 1 312 ? 11.814  3.681   24.338  1.00 69.12  ? 312  GLU B O     1 
ATOM   5346 C  CB    . GLU B 1 312 ? 14.098  6.039   24.961  1.00 70.16  ? 312  GLU B CB    1 
ATOM   5347 C  CG    . GLU B 1 312 ? 14.142  7.478   25.520  1.00 71.93  ? 312  GLU B CG    1 
ATOM   5348 C  CD    . GLU B 1 312 ? 15.306  8.323   24.965  1.00 74.23  ? 312  GLU B CD    1 
ATOM   5349 O  OE1   . GLU B 1 312 ? 15.803  8.033   23.845  1.00 74.92  ? 312  GLU B OE1   1 
ATOM   5350 O  OE2   . GLU B 1 312 ? 15.724  9.285   25.657  1.00 74.90  ? 312  GLU B OE2   1 
ATOM   5351 N  N     . TRP B 1 313 ? 13.835  2.895   24.967  1.00 68.11  ? 313  TRP B N     1 
ATOM   5352 C  CA    . TRP B 1 313 ? 13.732  1.621   24.255  1.00 67.11  ? 313  TRP B CA    1 
ATOM   5353 C  C     . TRP B 1 313 ? 12.705  0.681   24.882  1.00 66.80  ? 313  TRP B C     1 
ATOM   5354 O  O     . TRP B 1 313 ? 11.710  0.328   24.244  1.00 66.87  ? 313  TRP B O     1 
ATOM   5355 C  CB    . TRP B 1 313 ? 15.097  0.941   24.197  1.00 66.78  ? 313  TRP B CB    1 
ATOM   5356 C  CG    . TRP B 1 313 ? 15.231  -0.063  23.109  1.00 65.21  ? 313  TRP B CG    1 
ATOM   5357 C  CD1   . TRP B 1 313 ? 15.267  0.180   21.767  1.00 64.82  ? 313  TRP B CD1   1 
ATOM   5358 C  CD2   . TRP B 1 313 ? 15.377  -1.469  23.264  1.00 63.34  ? 313  TRP B CD2   1 
ATOM   5359 N  NE1   . TRP B 1 313 ? 15.421  -0.996  21.073  1.00 63.97  ? 313  TRP B NE1   1 
ATOM   5360 C  CE2   . TRP B 1 313 ? 15.491  -2.024  21.973  1.00 63.09  ? 313  TRP B CE2   1 
ATOM   5361 C  CE3   . TRP B 1 313 ? 15.416  -2.317  24.366  1.00 62.53  ? 313  TRP B CE3   1 
ATOM   5362 C  CZ2   . TRP B 1 313 ? 15.639  -3.383  21.758  1.00 62.51  ? 313  TRP B CZ2   1 
ATOM   5363 C  CZ3   . TRP B 1 313 ? 15.564  -3.666  24.150  1.00 62.63  ? 313  TRP B CZ3   1 
ATOM   5364 C  CH2   . TRP B 1 313 ? 15.674  -4.188  22.855  1.00 62.40  ? 313  TRP B CH2   1 
ATOM   5365 N  N     . PHE B 1 314 ? 12.944  0.285   26.128  1.00 66.18  ? 314  PHE B N     1 
ATOM   5366 C  CA    . PHE B 1 314 ? 12.046  -0.632  26.823  1.00 65.77  ? 314  PHE B CA    1 
ATOM   5367 C  C     . PHE B 1 314 ? 10.575  -0.236  26.725  1.00 65.67  ? 314  PHE B C     1 
ATOM   5368 O  O     . PHE B 1 314 ? 9.725   -1.070  26.402  1.00 65.61  ? 314  PHE B O     1 
ATOM   5369 C  CB    . PHE B 1 314 ? 12.457  -0.786  28.286  1.00 65.67  ? 314  PHE B CB    1 
ATOM   5370 C  CG    . PHE B 1 314 ? 13.572  -1.760  28.495  1.00 64.97  ? 314  PHE B CG    1 
ATOM   5371 C  CD1   . PHE B 1 314 ? 13.505  -3.041  27.952  1.00 64.59  ? 314  PHE B CD1   1 
ATOM   5372 C  CD2   . PHE B 1 314 ? 14.682  -1.409  29.243  1.00 64.37  ? 314  PHE B CD2   1 
ATOM   5373 C  CE1   . PHE B 1 314 ? 14.536  -3.953  28.141  1.00 64.17  ? 314  PHE B CE1   1 
ATOM   5374 C  CE2   . PHE B 1 314 ? 15.715  -2.314  29.440  1.00 64.32  ? 314  PHE B CE2   1 
ATOM   5375 C  CZ    . PHE B 1 314 ? 15.642  -3.591  28.885  1.00 63.94  ? 314  PHE B CZ    1 
ATOM   5376 N  N     . ALA B 1 315 ? 10.291  1.038   26.995  1.00 65.46  ? 315  ALA B N     1 
ATOM   5377 C  CA    . ALA B 1 315 ? 8.933   1.576   26.908  1.00 65.17  ? 315  ALA B CA    1 
ATOM   5378 C  C     . ALA B 1 315 ? 8.444   1.701   25.462  1.00 64.89  ? 315  ALA B C     1 
ATOM   5379 O  O     . ALA B 1 315 ? 7.237   1.683   25.209  1.00 64.86  ? 315  ALA B O     1 
ATOM   5380 C  CB    . ALA B 1 315 ? 8.836   2.924   27.630  1.00 65.19  ? 315  ALA B CB    1 
ATOM   5381 N  N     . ALA B 1 316 ? 9.377   1.815   24.521  1.00 64.44  ? 316  ALA B N     1 
ATOM   5382 C  CA    . ALA B 1 316 ? 9.019   2.025   23.124  1.00 64.10  ? 316  ALA B CA    1 
ATOM   5383 C  C     . ALA B 1 316 ? 8.518   0.766   22.407  1.00 63.99  ? 316  ALA B C     1 
ATOM   5384 O  O     . ALA B 1 316 ? 7.885   0.874   21.350  1.00 64.16  ? 316  ALA B O     1 
ATOM   5385 C  CB    . ALA B 1 316 ? 10.173  2.646   22.364  1.00 64.01  ? 316  ALA B CB    1 
ATOM   5386 N  N     . LYS B 1 317 ? 8.792   -0.415  22.968  1.00 63.58  ? 317  LYS B N     1 
ATOM   5387 C  CA    . LYS B 1 317 ? 8.403   -1.682  22.329  1.00 63.15  ? 317  LYS B CA    1 
ATOM   5388 C  C     . LYS B 1 317 ? 6.982   -2.080  22.739  1.00 62.87  ? 317  LYS B C     1 
ATOM   5389 O  O     . LYS B 1 317 ? 6.678   -2.073  23.929  1.00 62.77  ? 317  LYS B O     1 
ATOM   5390 C  CB    . LYS B 1 317 ? 9.404   -2.792  22.700  1.00 63.03  ? 317  LYS B CB    1 
ATOM   5391 C  CG    . LYS B 1 317 ? 10.836  -2.580  22.196  1.00 63.21  ? 317  LYS B CG    1 
ATOM   5392 C  CD    . LYS B 1 317 ? 11.057  -3.088  20.757  1.00 64.25  ? 317  LYS B CD    1 
ATOM   5393 C  CE    . LYS B 1 317 ? 12.256  -2.384  20.082  1.00 65.09  ? 317  LYS B CE    1 
ATOM   5394 N  NZ    . LYS B 1 317 ? 12.774  -3.045  18.831  1.00 64.93  ? 317  LYS B NZ    1 
ATOM   5395 N  N     . ASP B 1 318 ? 6.105   -2.415  21.788  1.00 62.62  ? 318  ASP B N     1 
ATOM   5396 C  CA    . ASP B 1 318 ? 4.771   -2.886  22.200  1.00 62.71  ? 318  ASP B CA    1 
ATOM   5397 C  C     . ASP B 1 318 ? 4.779   -4.316  22.732  1.00 62.30  ? 318  ASP B C     1 
ATOM   5398 O  O     . ASP B 1 318 ? 5.537   -5.170  22.260  1.00 62.18  ? 318  ASP B O     1 
ATOM   5399 C  CB    . ASP B 1 318 ? 3.680   -2.734  21.118  1.00 63.07  ? 318  ASP B CB    1 
ATOM   5400 C  CG    . ASP B 1 318 ? 2.234   -3.027  21.673  1.00 64.21  ? 318  ASP B CG    1 
ATOM   5401 O  OD1   . ASP B 1 318 ? 1.611   -4.038  21.261  1.00 64.82  ? 318  ASP B OD1   1 
ATOM   5402 O  OD2   . ASP B 1 318 ? 1.723   -2.263  22.538  1.00 64.67  ? 318  ASP B OD2   1 
ATOM   5403 N  N     . ASP B 1 319 ? 3.911   -4.546  23.715  1.00 61.87  ? 319  ASP B N     1 
ATOM   5404 C  CA    . ASP B 1 319 ? 3.622   -5.870  24.280  1.00 61.62  ? 319  ASP B CA    1 
ATOM   5405 C  C     . ASP B 1 319 ? 3.686   -7.022  23.263  1.00 61.18  ? 319  ASP B C     1 
ATOM   5406 O  O     . ASP B 1 319 ? 4.103   -8.138  23.604  1.00 61.29  ? 319  ASP B O     1 
ATOM   5407 C  CB    . ASP B 1 319 ? 2.254   -5.857  24.983  1.00 61.68  ? 319  ASP B CB    1 
ATOM   5408 C  CG    . ASP B 1 319 ? 2.163   -4.798  26.079  1.00 62.04  ? 319  ASP B CG    1 
ATOM   5409 O  OD1   . ASP B 1 319 ? 1.299   -4.939  26.967  1.00 62.43  ? 319  ASP B OD1   1 
ATOM   5410 O  OD2   . ASP B 1 319 ? 2.949   -3.824  26.059  1.00 62.47  ? 319  ASP B OD2   1 
ATOM   5411 N  N     . GLU B 1 320 ? 3.271   -6.753  22.026  1.00 60.34  ? 320  GLU B N     1 
ATOM   5412 C  CA    . GLU B 1 320 ? 3.411   -7.726  20.956  1.00 59.59  ? 320  GLU B CA    1 
ATOM   5413 C  C     . GLU B 1 320 ? 4.848   -8.260  20.953  1.00 58.29  ? 320  GLU B C     1 
ATOM   5414 O  O     . GLU B 1 320 ? 5.049   -9.474  21.072  1.00 58.33  ? 320  GLU B O     1 
ATOM   5415 C  CB    . GLU B 1 320 ? 3.008   -7.117  19.598  1.00 60.18  ? 320  GLU B CB    1 
ATOM   5416 C  CG    . GLU B 1 320 ? 3.143   -8.049  18.359  1.00 62.58  ? 320  GLU B CG    1 
ATOM   5417 C  CD    . GLU B 1 320 ? 2.147   -9.231  18.346  1.00 65.78  ? 320  GLU B CD    1 
ATOM   5418 O  OE1   . GLU B 1 320 ? 1.171   -9.227  19.147  1.00 66.49  ? 320  GLU B OE1   1 
ATOM   5419 O  OE2   . GLU B 1 320 ? 2.348   -10.168 17.524  1.00 66.34  ? 320  GLU B OE2   1 
ATOM   5420 N  N     . PHE B 1 321 ? 5.831   -7.356  20.877  1.00 56.49  ? 321  PHE B N     1 
ATOM   5421 C  CA    . PHE B 1 321 ? 7.247   -7.742  20.787  1.00 54.68  ? 321  PHE B CA    1 
ATOM   5422 C  C     . PHE B 1 321 ? 7.677   -8.710  21.871  1.00 53.75  ? 321  PHE B C     1 
ATOM   5423 O  O     . PHE B 1 321 ? 8.393   -9.681  21.603  1.00 53.35  ? 321  PHE B O     1 
ATOM   5424 C  CB    . PHE B 1 321 ? 8.172   -6.524  20.819  1.00 54.55  ? 321  PHE B CB    1 
ATOM   5425 C  CG    . PHE B 1 321 ? 9.635   -6.878  20.979  1.00 53.35  ? 321  PHE B CG    1 
ATOM   5426 C  CD1   . PHE B 1 321 ? 10.366  -7.371  19.921  1.00 52.16  ? 321  PHE B CD1   1 
ATOM   5427 C  CD2   . PHE B 1 321 ? 10.274  -6.722  22.196  1.00 52.85  ? 321  PHE B CD2   1 
ATOM   5428 C  CE1   . PHE B 1 321 ? 11.700  -7.694  20.076  1.00 51.31  ? 321  PHE B CE1   1 
ATOM   5429 C  CE2   . PHE B 1 321 ? 11.614  -7.049  22.346  1.00 51.18  ? 321  PHE B CE2   1 
ATOM   5430 C  CZ    . PHE B 1 321 ? 12.318  -7.533  21.290  1.00 50.34  ? 321  PHE B CZ    1 
ATOM   5431 N  N     . TYR B 1 322 ? 7.256   -8.423  23.098  1.00 52.60  ? 322  TYR B N     1 
ATOM   5432 C  CA    . TYR B 1 322 ? 7.588   -9.278  24.223  1.00 51.49  ? 322  TYR B CA    1 
ATOM   5433 C  C     . TYR B 1 322 ? 6.832   -10.593 24.150  1.00 51.28  ? 322  TYR B C     1 
ATOM   5434 O  O     . TYR B 1 322 ? 7.444   -11.656 24.078  1.00 51.47  ? 322  TYR B O     1 
ATOM   5435 C  CB    . TYR B 1 322 ? 7.332   -8.565  25.543  1.00 51.04  ? 322  TYR B CB    1 
ATOM   5436 C  CG    . TYR B 1 322 ? 8.224   -7.382  25.747  1.00 48.72  ? 322  TYR B CG    1 
ATOM   5437 C  CD1   . TYR B 1 322 ? 7.744   -6.106  25.587  1.00 47.68  ? 322  TYR B CD1   1 
ATOM   5438 C  CD2   . TYR B 1 322 ? 9.551   -7.543  26.086  1.00 47.15  ? 322  TYR B CD2   1 
ATOM   5439 C  CE1   . TYR B 1 322 ? 8.552   -5.014  25.780  1.00 47.52  ? 322  TYR B CE1   1 
ATOM   5440 C  CE2   . TYR B 1 322 ? 10.373  -6.460  26.276  1.00 46.89  ? 322  TYR B CE2   1 
ATOM   5441 C  CZ    . TYR B 1 322 ? 9.866   -5.192  26.126  1.00 47.12  ? 322  TYR B CZ    1 
ATOM   5442 O  OH    . TYR B 1 322 ? 10.669  -4.091  26.317  1.00 47.43  ? 322  TYR B OH    1 
ATOM   5443 N  N     . TRP B 1 323 ? 5.507   -10.528 24.139  1.00 50.70  ? 323  TRP B N     1 
ATOM   5444 C  CA    . TRP B 1 323 ? 4.718   -11.736 24.015  1.00 50.25  ? 323  TRP B CA    1 
ATOM   5445 C  C     . TRP B 1 323 ? 5.341   -12.655 22.975  1.00 49.61  ? 323  TRP B C     1 
ATOM   5446 O  O     . TRP B 1 323 ? 5.570   -13.829 23.243  1.00 49.53  ? 323  TRP B O     1 
ATOM   5447 C  CB    . TRP B 1 323 ? 3.285   -11.399 23.641  1.00 50.52  ? 323  TRP B CB    1 
ATOM   5448 C  CG    . TRP B 1 323 ? 2.395   -12.594 23.539  1.00 51.41  ? 323  TRP B CG    1 
ATOM   5449 C  CD1   . TRP B 1 323 ? 1.663   -13.162 24.543  1.00 52.20  ? 323  TRP B CD1   1 
ATOM   5450 C  CD2   . TRP B 1 323 ? 2.130   -13.362 22.364  1.00 52.29  ? 323  TRP B CD2   1 
ATOM   5451 N  NE1   . TRP B 1 323 ? 0.952   -14.235 24.062  1.00 52.67  ? 323  TRP B NE1   1 
ATOM   5452 C  CE2   . TRP B 1 323 ? 1.224   -14.381 22.727  1.00 52.76  ? 323  TRP B CE2   1 
ATOM   5453 C  CE3   . TRP B 1 323 ? 2.568   -13.286 21.035  1.00 52.96  ? 323  TRP B CE3   1 
ATOM   5454 C  CZ2   . TRP B 1 323 ? 0.751   -15.322 21.809  1.00 53.68  ? 323  TRP B CZ2   1 
ATOM   5455 C  CZ3   . TRP B 1 323 ? 2.100   -14.219 20.123  1.00 53.59  ? 323  TRP B CZ3   1 
ATOM   5456 C  CH2   . TRP B 1 323 ? 1.201   -15.226 20.515  1.00 54.18  ? 323  TRP B CH2   1 
ATOM   5457 N  N     . ARG B 1 324 ? 5.640   -12.111 21.801  1.00 49.00  ? 324  ARG B N     1 
ATOM   5458 C  CA    . ARG B 1 324 ? 6.239   -12.905 20.742  1.00 48.59  ? 324  ARG B CA    1 
ATOM   5459 C  C     . ARG B 1 324 ? 7.497   -13.605 21.215  1.00 48.08  ? 324  ARG B C     1 
ATOM   5460 O  O     . ARG B 1 324 ? 7.632   -14.821 21.060  1.00 48.41  ? 324  ARG B O     1 
ATOM   5461 C  CB    . ARG B 1 324 ? 6.512   -12.065 19.505  1.00 48.55  ? 324  ARG B CB    1 
ATOM   5462 C  CG    . ARG B 1 324 ? 5.410   -12.177 18.469  1.00 49.83  ? 324  ARG B CG    1 
ATOM   5463 C  CD    . ARG B 1 324 ? 5.562   -11.177 17.331  1.00 51.95  ? 324  ARG B CD    1 
ATOM   5464 N  NE    . ARG B 1 324 ? 6.965   -10.908 17.001  1.00 53.23  ? 324  ARG B NE    1 
ATOM   5465 C  CZ    . ARG B 1 324 ? 7.534   -9.706  17.085  1.00 53.36  ? 324  ARG B CZ    1 
ATOM   5466 N  NH1   . ARG B 1 324 ? 6.804   -8.652  17.476  1.00 53.20  ? 324  ARG B NH1   1 
ATOM   5467 N  NH2   . ARG B 1 324 ? 8.823   -9.557  16.768  1.00 51.66  ? 324  ARG B NH2   1 
ATOM   5468 N  N     . GLY B 1 325 ? 8.394   -12.842 21.828  1.00 47.39  ? 325  GLY B N     1 
ATOM   5469 C  CA    . GLY B 1 325 ? 9.664   -13.375 22.305  1.00 46.42  ? 325  GLY B CA    1 
ATOM   5470 C  C     . GLY B 1 325 ? 9.551   -14.614 23.159  1.00 45.68  ? 325  GLY B C     1 
ATOM   5471 O  O     . GLY B 1 325 ? 10.278  -15.580 22.957  1.00 45.39  ? 325  GLY B O     1 
ATOM   5472 N  N     . ILE B 1 326 ? 8.632   -14.579 24.114  1.00 45.35  ? 326  ILE B N     1 
ATOM   5473 C  CA    . ILE B 1 326 ? 8.412   -15.711 25.000  1.00 45.08  ? 326  ILE B CA    1 
ATOM   5474 C  C     . ILE B 1 326 ? 7.703   -16.826 24.260  1.00 45.19  ? 326  ILE B C     1 
ATOM   5475 O  O     . ILE B 1 326 ? 7.971   -18.006 24.490  1.00 45.33  ? 326  ILE B O     1 
ATOM   5476 C  CB    . ILE B 1 326 ? 7.606   -15.318 26.241  1.00 44.89  ? 326  ILE B CB    1 
ATOM   5477 C  CG1   . ILE B 1 326 ? 8.493   -14.514 27.184  1.00 44.95  ? 326  ILE B CG1   1 
ATOM   5478 C  CG2   . ILE B 1 326 ? 7.050   -16.553 26.943  1.00 44.00  ? 326  ILE B CG2   1 
ATOM   5479 C  CD1   . ILE B 1 326 ? 7.861   -14.262 28.526  1.00 46.91  ? 326  ILE B CD1   1 
ATOM   5480 N  N     . HIS B 1 327 ? 6.811   -16.458 23.354  1.00 45.05  ? 327  HIS B N     1 
ATOM   5481 C  CA    . HIS B 1 327 ? 6.024   -17.471 22.699  1.00 44.87  ? 327  HIS B CA    1 
ATOM   5482 C  C     . HIS B 1 327 ? 6.780   -18.245 21.630  1.00 44.96  ? 327  HIS B C     1 
ATOM   5483 O  O     . HIS B 1 327 ? 6.271   -19.240 21.110  1.00 45.40  ? 327  HIS B O     1 
ATOM   5484 C  CB    . HIS B 1 327 ? 4.688   -16.914 22.242  1.00 44.69  ? 327  HIS B CB    1 
ATOM   5485 C  CG    . HIS B 1 327 ? 3.691   -16.865 23.345  1.00 44.56  ? 327  HIS B CG    1 
ATOM   5486 N  ND1   . HIS B 1 327 ? 2.666   -17.776 23.458  1.00 45.63  ? 327  HIS B ND1   1 
ATOM   5487 C  CD2   . HIS B 1 327 ? 3.608   -16.068 24.434  1.00 44.93  ? 327  HIS B CD2   1 
ATOM   5488 C  CE1   . HIS B 1 327 ? 1.965   -17.516 24.547  1.00 46.00  ? 327  HIS B CE1   1 
ATOM   5489 N  NE2   . HIS B 1 327 ? 2.517   -16.483 25.158  1.00 45.82  ? 327  HIS B NE2   1 
ATOM   5490 N  N     . LYS B 1 328 ? 8.011   -17.821 21.346  1.00 44.67  ? 328  LYS B N     1 
ATOM   5491 C  CA    . LYS B 1 328 ? 8.882   -18.579 20.452  1.00 44.54  ? 328  LYS B CA    1 
ATOM   5492 C  C     . LYS B 1 328 ? 9.432   -19.869 21.089  1.00 44.28  ? 328  LYS B C     1 
ATOM   5493 O  O     . LYS B 1 328 ? 9.837   -20.794 20.377  1.00 44.20  ? 328  LYS B O     1 
ATOM   5494 C  CB    . LYS B 1 328 ? 9.990   -17.689 19.893  1.00 44.49  ? 328  LYS B CB    1 
ATOM   5495 C  CG    . LYS B 1 328 ? 9.478   -16.749 18.784  1.00 45.51  ? 328  LYS B CG    1 
ATOM   5496 C  CD    . LYS B 1 328 ? 10.568  -16.311 17.787  1.00 46.41  ? 328  LYS B CD    1 
ATOM   5497 C  CE    . LYS B 1 328 ? 11.362  -15.096 18.286  1.00 46.77  ? 328  LYS B CE    1 
ATOM   5498 N  NZ    . LYS B 1 328 ? 12.646  -14.912 17.535  1.00 47.01  ? 328  LYS B NZ    1 
ATOM   5499 N  N     . LEU B 1 329 ? 9.388   -19.934 22.422  1.00 43.96  ? 329  LEU B N     1 
ATOM   5500 C  CA    . LEU B 1 329 ? 9.964   -21.039 23.209  1.00 43.61  ? 329  LEU B CA    1 
ATOM   5501 C  C     . LEU B 1 329 ? 9.611   -22.444 22.731  1.00 43.68  ? 329  LEU B C     1 
ATOM   5502 O  O     . LEU B 1 329 ? 10.498  -23.281 22.572  1.00 43.46  ? 329  LEU B O     1 
ATOM   5503 C  CB    . LEU B 1 329 ? 9.626   -20.898 24.707  1.00 43.43  ? 329  LEU B CB    1 
ATOM   5504 C  CG    . LEU B 1 329 ? 10.535  -20.137 25.690  1.00 42.32  ? 329  LEU B CG    1 
ATOM   5505 C  CD1   . LEU B 1 329 ? 11.641  -21.009 26.266  1.00 41.23  ? 329  LEU B CD1   1 
ATOM   5506 C  CD2   . LEU B 1 329 ? 11.123  -18.908 25.063  1.00 40.98  ? 329  LEU B CD2   1 
ATOM   5507 N  N     . PRO B 1 330 ? 8.322   -22.716 22.515  1.00 43.98  ? 330  PRO B N     1 
ATOM   5508 C  CA    . PRO B 1 330 ? 7.963   -24.062 22.100  1.00 44.43  ? 330  PRO B CA    1 
ATOM   5509 C  C     . PRO B 1 330 ? 8.563   -24.460 20.756  1.00 44.84  ? 330  PRO B C     1 
ATOM   5510 O  O     . PRO B 1 330 ? 9.146   -25.547 20.661  1.00 45.07  ? 330  PRO B O     1 
ATOM   5511 C  CB    . PRO B 1 330 ? 6.443   -24.009 22.030  1.00 44.38  ? 330  PRO B CB    1 
ATOM   5512 C  CG    . PRO B 1 330 ? 6.103   -22.998 23.040  1.00 44.60  ? 330  PRO B CG    1 
ATOM   5513 C  CD    . PRO B 1 330 ? 7.129   -21.932 22.853  1.00 44.05  ? 330  PRO B CD    1 
ATOM   5514 N  N     . GLU B 1 331 ? 8.462   -23.599 19.742  1.00 44.94  ? 331  GLU B N     1 
ATOM   5515 C  CA    . GLU B 1 331 ? 9.064   -23.935 18.448  1.00 45.31  ? 331  GLU B CA    1 
ATOM   5516 C  C     . GLU B 1 331 ? 10.589  -24.073 18.530  1.00 44.68  ? 331  GLU B C     1 
ATOM   5517 O  O     . GLU B 1 331 ? 11.208  -24.717 17.679  1.00 44.74  ? 331  GLU B O     1 
ATOM   5518 C  CB    . GLU B 1 331 ? 8.645   -22.970 17.333  1.00 45.92  ? 331  GLU B CB    1 
ATOM   5519 C  CG    . GLU B 1 331 ? 9.367   -21.622 17.300  1.00 48.80  ? 331  GLU B CG    1 
ATOM   5520 C  CD    . GLU B 1 331 ? 9.214   -20.902 15.952  1.00 52.62  ? 331  GLU B CD    1 
ATOM   5521 O  OE1   . GLU B 1 331 ? 8.097   -20.916 15.364  1.00 53.71  ? 331  GLU B OE1   1 
ATOM   5522 O  OE2   . GLU B 1 331 ? 10.223  -20.318 15.482  1.00 54.28  ? 331  GLU B OE2   1 
ATOM   5523 N  N     . ARG B 1 332 ? 11.188  -23.481 19.559  1.00 43.89  ? 332  ARG B N     1 
ATOM   5524 C  CA    . ARG B 1 332 ? 12.600  -23.684 19.797  1.00 43.03  ? 332  ARG B CA    1 
ATOM   5525 C  C     . ARG B 1 332 ? 12.830  -25.074 20.317  1.00 42.70  ? 332  ARG B C     1 
ATOM   5526 O  O     . ARG B 1 332 ? 13.573  -25.827 19.710  1.00 42.34  ? 332  ARG B O     1 
ATOM   5527 C  CB    . ARG B 1 332 ? 13.168  -22.638 20.736  1.00 42.93  ? 332  ARG B CB    1 
ATOM   5528 C  CG    . ARG B 1 332 ? 13.166  -21.269 20.124  1.00 42.48  ? 332  ARG B CG    1 
ATOM   5529 C  CD    . ARG B 1 332 ? 14.467  -20.575 20.339  1.00 41.67  ? 332  ARG B CD    1 
ATOM   5530 N  NE    . ARG B 1 332 ? 14.590  -19.485 19.385  1.00 43.57  ? 332  ARG B NE    1 
ATOM   5531 C  CZ    . ARG B 1 332 ? 15.720  -18.839 19.106  1.00 45.06  ? 332  ARG B CZ    1 
ATOM   5532 N  NH1   . ARG B 1 332 ? 16.851  -19.168 19.712  1.00 45.48  ? 332  ARG B NH1   1 
ATOM   5533 N  NH2   . ARG B 1 332 ? 15.723  -17.855 18.210  1.00 46.21  ? 332  ARG B NH2   1 
ATOM   5534 N  N     . TRP B 1 333 ? 12.161  -25.422 21.412  1.00 42.75  ? 333  TRP B N     1 
ATOM   5535 C  CA    . TRP B 1 333 ? 12.262  -26.764 21.974  1.00 43.18  ? 333  TRP B CA    1 
ATOM   5536 C  C     . TRP B 1 333 ? 11.930  -27.841 20.958  1.00 43.77  ? 333  TRP B C     1 
ATOM   5537 O  O     . TRP B 1 333 ? 12.642  -28.844 20.857  1.00 43.85  ? 333  TRP B O     1 
ATOM   5538 C  CB    . TRP B 1 333 ? 11.328  -26.938 23.147  1.00 42.97  ? 333  TRP B CB    1 
ATOM   5539 C  CG    . TRP B 1 333 ? 11.541  -26.008 24.250  1.00 42.48  ? 333  TRP B CG    1 
ATOM   5540 C  CD1   . TRP B 1 333 ? 12.723  -25.538 24.706  1.00 42.39  ? 333  TRP B CD1   1 
ATOM   5541 C  CD2   . TRP B 1 333 ? 10.531  -25.457 25.094  1.00 42.27  ? 333  TRP B CD2   1 
ATOM   5542 N  NE1   . TRP B 1 333 ? 12.516  -24.698 25.778  1.00 42.40  ? 333  TRP B NE1   1 
ATOM   5543 C  CE2   . TRP B 1 333 ? 11.175  -24.638 26.035  1.00 42.00  ? 333  TRP B CE2   1 
ATOM   5544 C  CE3   . TRP B 1 333 ? 9.140   -25.575 25.143  1.00 42.59  ? 333  TRP B CE3   1 
ATOM   5545 C  CZ2   . TRP B 1 333 ? 10.479  -23.938 27.008  1.00 42.21  ? 333  TRP B CZ2   1 
ATOM   5546 C  CZ3   . TRP B 1 333 ? 8.450   -24.879 26.113  1.00 42.70  ? 333  TRP B CZ3   1 
ATOM   5547 C  CH2   . TRP B 1 333 ? 9.119   -24.070 27.032  1.00 42.44  ? 333  TRP B CH2   1 
ATOM   5548 N  N     . GLU B 1 334 ? 10.838  -27.639 20.224  1.00 44.37  ? 334  GLU B N     1 
ATOM   5549 C  CA    . GLU B 1 334 ? 10.487  -28.511 19.109  1.00 45.20  ? 334  GLU B CA    1 
ATOM   5550 C  C     . GLU B 1 334 ? 11.732  -28.775 18.270  1.00 45.05  ? 334  GLU B C     1 
ATOM   5551 O  O     . GLU B 1 334 ? 12.046  -29.929 17.974  1.00 45.09  ? 334  GLU B O     1 
ATOM   5552 C  CB    . GLU B 1 334 ? 9.390   -27.875 18.241  1.00 45.71  ? 334  GLU B CB    1 
ATOM   5553 C  CG    . GLU B 1 334 ? 8.425   -28.874 17.582  1.00 48.27  ? 334  GLU B CG    1 
ATOM   5554 C  CD    . GLU B 1 334 ? 7.337   -29.373 18.553  1.00 51.85  ? 334  GLU B CD    1 
ATOM   5555 O  OE1   . GLU B 1 334 ? 6.347   -28.613 18.779  1.00 52.54  ? 334  GLU B OE1   1 
ATOM   5556 O  OE2   . GLU B 1 334 ? 7.478   -30.519 19.083  1.00 52.07  ? 334  GLU B OE2   1 
ATOM   5557 N  N     . LYS B 1 335 ? 12.444  -27.704 17.913  1.00 45.00  ? 335  LYS B N     1 
ATOM   5558 C  CA    . LYS B 1 335 ? 13.661  -27.812 17.119  1.00 44.97  ? 335  LYS B CA    1 
ATOM   5559 C  C     . LYS B 1 335 ? 14.764  -28.554 17.881  1.00 44.95  ? 335  LYS B C     1 
ATOM   5560 O  O     . LYS B 1 335 ? 15.154  -29.657 17.487  1.00 44.97  ? 335  LYS B O     1 
ATOM   5561 C  CB    . LYS B 1 335 ? 14.112  -26.435 16.650  1.00 44.80  ? 335  LYS B CB    1 
ATOM   5562 C  CG    . LYS B 1 335 ? 13.554  -26.029 15.279  1.00 45.42  ? 335  LYS B CG    1 
ATOM   5563 C  CD    . LYS B 1 335 ? 13.245  -24.521 15.239  1.00 46.31  ? 335  LYS B CD    1 
ATOM   5564 C  CE    . LYS B 1 335 ? 13.610  -23.831 13.924  1.00 45.21  ? 335  LYS B CE    1 
ATOM   5565 N  NZ    . LYS B 1 335 ? 13.630  -22.356 14.156  1.00 43.66  ? 335  LYS B NZ    1 
ATOM   5566 N  N     . CYS B 1 336 ? 15.230  -27.960 18.979  1.00 44.84  ? 336  CYS B N     1 
ATOM   5567 C  CA    . CYS B 1 336 ? 16.200  -28.580 19.894  1.00 44.66  ? 336  CYS B CA    1 
ATOM   5568 C  C     . CYS B 1 336 ? 16.013  -30.077 20.027  1.00 44.72  ? 336  CYS B C     1 
ATOM   5569 O  O     . CYS B 1 336 ? 16.992  -30.797 20.151  1.00 44.77  ? 336  CYS B O     1 
ATOM   5570 C  CB    . CYS B 1 336 ? 16.138  -27.903 21.277  1.00 44.63  ? 336  CYS B CB    1 
ATOM   5571 S  SG    . CYS B 1 336 ? 16.682  -28.848 22.769  1.00 44.46  ? 336  CYS B SG    1 
ATOM   5572 N  N     . VAL B 1 337 ? 14.768  -30.545 19.981  1.00 44.92  ? 337  VAL B N     1 
ATOM   5573 C  CA    . VAL B 1 337 ? 14.495  -31.969 20.185  1.00 45.47  ? 337  VAL B CA    1 
ATOM   5574 C  C     . VAL B 1 337 ? 14.893  -32.835 18.984  1.00 45.82  ? 337  VAL B C     1 
ATOM   5575 O  O     . VAL B 1 337 ? 15.624  -33.812 19.142  1.00 46.04  ? 337  VAL B O     1 
ATOM   5576 C  CB    . VAL B 1 337 ? 13.029  -32.239 20.624  1.00 45.40  ? 337  VAL B CB    1 
ATOM   5577 C  CG1   . VAL B 1 337 ? 12.223  -32.956 19.526  1.00 45.64  ? 337  VAL B CG1   1 
ATOM   5578 C  CG2   . VAL B 1 337 ? 13.013  -33.061 21.883  1.00 45.26  ? 337  VAL B CG2   1 
ATOM   5579 N  N     . ALA B 1 338 ? 14.425  -32.475 17.793  1.00 46.25  ? 338  ALA B N     1 
ATOM   5580 C  CA    . ALA B 1 338 ? 14.712  -33.262 16.596  1.00 46.73  ? 338  ALA B CA    1 
ATOM   5581 C  C     . ALA B 1 338 ? 15.995  -32.759 15.920  1.00 47.08  ? 338  ALA B C     1 
ATOM   5582 O  O     . ALA B 1 338 ? 16.216  -32.943 14.718  1.00 47.19  ? 338  ALA B O     1 
ATOM   5583 C  CB    . ALA B 1 338 ? 13.499  -33.270 15.633  1.00 46.74  ? 338  ALA B CB    1 
ATOM   5584 N  N     . SER B 1 339 ? 16.829  -32.105 16.720  1.00 47.39  ? 339  SER B N     1 
ATOM   5585 C  CA    . SER B 1 339 ? 18.190  -31.778 16.343  1.00 47.72  ? 339  SER B CA    1 
ATOM   5586 C  C     . SER B 1 339 ? 19.058  -32.635 17.216  1.00 47.80  ? 339  SER B C     1 
ATOM   5587 O  O     . SER B 1 339 ? 20.236  -32.830 16.940  1.00 47.77  ? 339  SER B O     1 
ATOM   5588 C  CB    . SER B 1 339 ? 18.486  -30.311 16.629  1.00 47.77  ? 339  SER B CB    1 
ATOM   5589 O  OG    . SER B 1 339 ? 17.589  -29.476 15.928  1.00 48.72  ? 339  SER B OG    1 
ATOM   5590 N  N     . ASP B 1 340 ? 18.441  -33.142 18.278  1.00 48.24  ? 340  ASP B N     1 
ATOM   5591 C  CA    . ASP B 1 340 ? 19.093  -33.966 19.282  1.00 48.80  ? 340  ASP B CA    1 
ATOM   5592 C  C     . ASP B 1 340 ? 19.922  -33.142 20.235  1.00 48.94  ? 340  ASP B C     1 
ATOM   5593 O  O     . ASP B 1 340 ? 20.756  -33.668 20.973  1.00 49.04  ? 340  ASP B O     1 
ATOM   5594 C  CB    . ASP B 1 340 ? 19.940  -35.045 18.633  1.00 49.09  ? 340  ASP B CB    1 
ATOM   5595 C  CG    . ASP B 1 340 ? 19.153  -36.279 18.345  1.00 50.40  ? 340  ASP B CG    1 
ATOM   5596 O  OD1   . ASP B 1 340 ? 18.170  -36.218 17.559  1.00 51.79  ? 340  ASP B OD1   1 
ATOM   5597 O  OD2   . ASP B 1 340 ? 19.522  -37.318 18.928  1.00 52.45  ? 340  ASP B OD2   1 
ATOM   5598 N  N     . GLY B 1 341 ? 19.683  -31.841 20.221  1.00 49.14  ? 341  GLY B N     1 
ATOM   5599 C  CA    . GLY B 1 341 ? 20.269  -30.962 21.211  1.00 49.55  ? 341  GLY B CA    1 
ATOM   5600 C  C     . GLY B 1 341 ? 21.369  -30.100 20.656  1.00 49.76  ? 341  GLY B C     1 
ATOM   5601 O  O     . GLY B 1 341 ? 21.835  -29.181 21.332  1.00 49.67  ? 341  GLY B O     1 
ATOM   5602 N  N     . LYS B 1 342 ? 21.790  -30.404 19.432  1.00 50.11  ? 342  LYS B N     1 
ATOM   5603 C  CA    . LYS B 1 342 ? 22.747  -29.559 18.736  1.00 50.75  ? 342  LYS B CA    1 
ATOM   5604 C  C     . LYS B 1 342 ? 22.103  -28.212 18.527  1.00 50.71  ? 342  LYS B C     1 
ATOM   5605 O  O     . LYS B 1 342 ? 20.922  -28.123 18.201  1.00 50.71  ? 342  LYS B O     1 
ATOM   5606 C  CB    . LYS B 1 342 ? 23.158  -30.157 17.392  1.00 50.95  ? 342  LYS B CB    1 
ATOM   5607 C  CG    . LYS B 1 342 ? 23.189  -31.659 17.400  1.00 52.49  ? 342  LYS B CG    1 
ATOM   5608 C  CD    . LYS B 1 342 ? 24.477  -32.188 16.821  1.00 55.72  ? 342  LYS B CD    1 
ATOM   5609 C  CE    . LYS B 1 342 ? 24.497  -33.719 16.881  1.00 56.98  ? 342  LYS B CE    1 
ATOM   5610 N  NZ    . LYS B 1 342 ? 25.851  -34.299 16.628  1.00 57.69  ? 342  LYS B NZ    1 
ATOM   5611 N  N     . TYR B 1 343 ? 22.872  -27.161 18.751  1.00 50.93  ? 343  TYR B N     1 
ATOM   5612 C  CA    . TYR B 1 343 ? 22.396  -25.846 18.465  1.00 51.38  ? 343  TYR B CA    1 
ATOM   5613 C  C     . TYR B 1 343 ? 21.744  -26.004 17.125  1.00 52.45  ? 343  TYR B C     1 
ATOM   5614 O  O     . TYR B 1 343 ? 22.359  -26.498 16.196  1.00 52.71  ? 343  TYR B O     1 
ATOM   5615 C  CB    . TYR B 1 343 ? 23.571  -24.893 18.382  1.00 50.97  ? 343  TYR B CB    1 
ATOM   5616 C  CG    . TYR B 1 343 ? 24.314  -24.782 19.682  1.00 49.96  ? 343  TYR B CG    1 
ATOM   5617 C  CD1   . TYR B 1 343 ? 25.436  -25.562 19.940  1.00 49.04  ? 343  TYR B CD1   1 
ATOM   5618 C  CD2   . TYR B 1 343 ? 23.882  -23.906 20.668  1.00 49.08  ? 343  TYR B CD2   1 
ATOM   5619 C  CE1   . TYR B 1 343 ? 26.108  -25.451 21.135  1.00 48.07  ? 343  TYR B CE1   1 
ATOM   5620 C  CE2   . TYR B 1 343 ? 24.543  -23.801 21.866  1.00 48.02  ? 343  TYR B CE2   1 
ATOM   5621 C  CZ    . TYR B 1 343 ? 25.646  -24.573 22.091  1.00 47.58  ? 343  TYR B CZ    1 
ATOM   5622 O  OH    . TYR B 1 343 ? 26.276  -24.456 23.290  1.00 47.77  ? 343  TYR B OH    1 
ATOM   5623 N  N     . PHE B 1 344 ? 20.474  -25.660 17.029  1.00 53.89  ? 344  PHE B N     1 
ATOM   5624 C  CA    . PHE B 1 344 ? 19.764  -25.823 15.767  1.00 55.36  ? 344  PHE B CA    1 
ATOM   5625 C  C     . PHE B 1 344 ? 20.077  -24.683 14.819  1.00 56.53  ? 344  PHE B C     1 
ATOM   5626 O  O     . PHE B 1 344 ? 20.533  -23.615 15.248  1.00 56.90  ? 344  PHE B O     1 
ATOM   5627 C  CB    . PHE B 1 344 ? 18.268  -25.877 16.008  1.00 55.33  ? 344  PHE B CB    1 
ATOM   5628 C  CG    . PHE B 1 344 ? 17.831  -25.082 17.186  1.00 54.97  ? 344  PHE B CG    1 
ATOM   5629 C  CD1   . PHE B 1 344 ? 17.825  -23.701 17.140  1.00 54.42  ? 344  PHE B CD1   1 
ATOM   5630 C  CD2   . PHE B 1 344 ? 17.436  -25.719 18.345  1.00 55.10  ? 344  PHE B CD2   1 
ATOM   5631 C  CE1   . PHE B 1 344 ? 17.425  -22.972 18.216  1.00 54.45  ? 344  PHE B CE1   1 
ATOM   5632 C  CE2   . PHE B 1 344 ? 17.034  -24.997 19.427  1.00 55.32  ? 344  PHE B CE2   1 
ATOM   5633 C  CZ    . PHE B 1 344 ? 17.025  -23.618 19.364  1.00 55.31  ? 344  PHE B CZ    1 
ATOM   5634 N  N     . GLU B 1 345 ? 19.834  -24.907 13.529  1.00 57.88  ? 345  GLU B N     1 
ATOM   5635 C  CA    . GLU B 1 345 ? 20.087  -23.860 12.541  1.00 59.14  ? 345  GLU B CA    1 
ATOM   5636 C  C     . GLU B 1 345 ? 18.872  -22.907 12.491  1.00 59.27  ? 345  GLU B C     1 
ATOM   5637 O  O     . GLU B 1 345 ? 17.695  -23.298 12.420  1.00 59.35  ? 345  GLU B O     1 
ATOM   5638 C  CB    . GLU B 1 345 ? 20.528  -24.435 11.159  1.00 59.45  ? 345  GLU B CB    1 
ATOM   5639 C  CG    . GLU B 1 345 ? 21.763  -23.687 10.469  1.00 61.39  ? 345  GLU B CG    1 
ATOM   5640 C  CD    . GLU B 1 345 ? 23.211  -24.063 11.010  1.00 63.71  ? 345  GLU B CD    1 
ATOM   5641 O  OE1   . GLU B 1 345 ? 24.087  -24.346 10.154  1.00 63.49  ? 345  GLU B OE1   1 
ATOM   5642 O  OE2   . GLU B 1 345 ? 23.492  -24.053 12.256  1.00 63.29  ? 345  GLU B OE2   1 
ATOM   5643 O  OXT   . GLU B 1 345 ? 19.055  -21.691 12.587  1.00 59.57  ? 345  GLU B OXT   1 
ATOM   5644 O  OP3   . DG  C 2 1   ? 10.832  -11.384 13.534  1.00 89.53  ? 4    DG  C OP3   1 
ATOM   5645 P  P     . DG  C 2 1   ? 10.571  -12.365 14.632  1.00 89.52  ? 4    DG  C P     1 
ATOM   5646 O  OP1   . DG  C 2 1   ? 11.166  -13.724 14.534  1.00 90.25  ? 4    DG  C OP1   1 
ATOM   5647 O  OP2   . DG  C 2 1   ? 9.097   -12.562 14.774  1.00 89.53  ? 4    DG  C OP2   1 
ATOM   5648 O  "O5'" . DG  C 2 1   ? 11.077  -11.670 15.997  1.00 85.71  ? 4    DG  C "O5'" 1 
ATOM   5649 C  "C5'" . DG  C 2 1   ? 12.482  -11.557 16.322  1.00 78.90  ? 4    DG  C "C5'" 1 
ATOM   5650 C  "C4'" . DG  C 2 1   ? 12.945  -10.107 16.483  1.00 73.26  ? 4    DG  C "C4'" 1 
ATOM   5651 O  "O4'" . DG  C 2 1   ? 14.224  -10.022 17.157  1.00 71.28  ? 4    DG  C "O4'" 1 
ATOM   5652 C  "C3'" . DG  C 2 1   ? 13.172  -9.334  15.190  1.00 69.66  ? 4    DG  C "C3'" 1 
ATOM   5653 O  "O3'" . DG  C 2 1   ? 12.745  -7.975  15.326  1.00 64.65  ? 4    DG  C "O3'" 1 
ATOM   5654 C  "C2'" . DG  C 2 1   ? 14.665  -9.469  14.902  1.00 69.97  ? 4    DG  C "C2'" 1 
ATOM   5655 C  "C1'" . DG  C 2 1   ? 15.255  -10.004 16.197  1.00 70.56  ? 4    DG  C "C1'" 1 
ATOM   5656 N  N9    . DG  C 2 1   ? 15.725  -11.371 16.102  1.00 71.10  ? 4    DG  C N9    1 
ATOM   5657 C  C8    . DG  C 2 1   ? 15.537  -12.336 17.062  1.00 71.20  ? 4    DG  C C8    1 
ATOM   5658 N  N7    . DG  C 2 1   ? 16.045  -13.487 16.748  1.00 71.94  ? 4    DG  C N7    1 
ATOM   5659 C  C5    . DG  C 2 1   ? 16.613  -13.274 15.497  1.00 72.32  ? 4    DG  C C5    1 
ATOM   5660 C  C6    . DG  C 2 1   ? 17.317  -14.190 14.669  1.00 72.75  ? 4    DG  C C6    1 
ATOM   5661 O  O6    . DG  C 2 1   ? 17.583  -15.392 14.902  1.00 71.87  ? 4    DG  C O6    1 
ATOM   5662 N  N1    . DG  C 2 1   ? 17.721  -13.562 13.478  1.00 72.92  ? 4    DG  C N1    1 
ATOM   5663 C  C2    . DG  C 2 1   ? 17.479  -12.240 13.152  1.00 72.18  ? 4    DG  C C2    1 
ATOM   5664 N  N2    . DG  C 2 1   ? 17.960  -11.847 11.978  1.00 72.40  ? 4    DG  C N2    1 
ATOM   5665 N  N3    . DG  C 2 1   ? 16.828  -11.374 13.918  1.00 71.34  ? 4    DG  C N3    1 
ATOM   5666 C  C4    . DG  C 2 1   ? 16.423  -11.964 15.075  1.00 71.68  ? 4    DG  C C4    1 
ATOM   5667 P  P     . DG  C 2 2   ? 13.342  -6.891  16.345  1.00 61.17  ? 5    DG  C P     1 
ATOM   5668 O  OP1   . DG  C 2 2   ? 14.284  -7.520  17.285  1.00 60.58  ? 5    DG  C OP1   1 
ATOM   5669 O  OP2   . DG  C 2 2   ? 12.184  -6.116  16.849  1.00 61.74  ? 5    DG  C OP2   1 
ATOM   5670 O  "O5'" . DG  C 2 2   ? 14.185  -5.917  15.404  1.00 59.17  ? 5    DG  C "O5'" 1 
ATOM   5671 C  "C5'" . DG  C 2 2   ? 15.604  -5.887  15.439  1.00 55.53  ? 5    DG  C "C5'" 1 
ATOM   5672 C  "C4'" . DG  C 2 2   ? 16.210  -5.908  14.039  1.00 52.68  ? 5    DG  C "C4'" 1 
ATOM   5673 O  "O4'" . DG  C 2 2   ? 16.383  -7.238  13.474  1.00 51.31  ? 5    DG  C "O4'" 1 
ATOM   5674 C  "C3'" . DG  C 2 2   ? 15.462  -5.096  12.988  1.00 51.47  ? 5    DG  C "C3'" 1 
ATOM   5675 O  "O3'" . DG  C 2 2   ? 16.393  -4.079  12.638  1.00 51.88  ? 5    DG  C "O3'" 1 
ATOM   5676 C  "C2'" . DG  C 2 2   ? 15.174  -6.109  11.878  1.00 49.66  ? 5    DG  C "C2'" 1 
ATOM   5677 C  "C1'" . DG  C 2 2   ? 16.342  -7.068  12.080  1.00 49.09  ? 5    DG  C "C1'" 1 
ATOM   5678 N  N9    . DG  C 2 2   ? 16.225  -8.348  11.386  1.00 47.62  ? 5    DG  C N9    1 
ATOM   5679 C  C8    . DG  C 2 2   ? 15.129  -9.177  11.317  1.00 47.08  ? 5    DG  C C8    1 
ATOM   5680 N  N7    . DG  C 2 2   ? 15.322  -10.257 10.610  1.00 46.34  ? 5    DG  C N7    1 
ATOM   5681 C  C5    . DG  C 2 2   ? 16.628  -10.134 10.168  1.00 46.30  ? 5    DG  C C5    1 
ATOM   5682 C  C6    . DG  C 2 2   ? 17.394  -11.001 9.352   1.00 45.76  ? 5    DG  C C6    1 
ATOM   5683 O  O6    . DG  C 2 2   ? 17.053  -12.068 8.856   1.00 45.20  ? 5    DG  C O6    1 
ATOM   5684 N  N1    . DG  C 2 2   ? 18.683  -10.534 9.137   1.00 46.07  ? 5    DG  C N1    1 
ATOM   5685 C  C2    . DG  C 2 2   ? 19.158  -9.350  9.662   1.00 46.77  ? 5    DG  C C2    1 
ATOM   5686 N  N2    . DG  C 2 2   ? 20.426  -9.052  9.356   1.00 47.57  ? 5    DG  C N2    1 
ATOM   5687 N  N3    . DG  C 2 2   ? 18.456  -8.515  10.429  1.00 46.39  ? 5    DG  C N3    1 
ATOM   5688 C  C4    . DG  C 2 2   ? 17.200  -8.970  10.643  1.00 46.75  ? 5    DG  C C4    1 
ATOM   5689 P  P     . DT  C 2 3   ? 16.044  -2.803  11.746  1.00 52.33  ? 6    DT  C P     1 
ATOM   5690 O  OP1   . DT  C 2 3   ? 16.501  -1.601  12.489  1.00 52.32  ? 6    DT  C OP1   1 
ATOM   5691 O  OP2   . DT  C 2 3   ? 14.649  -2.925  11.242  1.00 52.19  ? 6    DT  C OP2   1 
ATOM   5692 O  "O5'" . DT  C 2 3   ? 17.014  -3.020  10.505  1.00 51.06  ? 6    DT  C "O5'" 1 
ATOM   5693 C  "C5'" . DT  C 2 3   ? 18.332  -3.506  10.722  1.00 50.19  ? 6    DT  C "C5'" 1 
ATOM   5694 C  "C4'" . DT  C 2 3   ? 18.980  -3.737  9.377   1.00 48.87  ? 6    DT  C "C4'" 1 
ATOM   5695 O  "O4'" . DT  C 2 3   ? 18.902  -5.133  9.025   1.00 47.47  ? 6    DT  C "O4'" 1 
ATOM   5696 C  "C3'" . DT  C 2 3   ? 18.237  -2.970  8.300   1.00 48.40  ? 6    DT  C "C3'" 1 
ATOM   5697 O  "O3'" . DT  C 2 3   ? 18.932  -1.724  8.125   1.00 48.49  ? 6    DT  C "O3'" 1 
ATOM   5698 C  "C2'" . DT  C 2 3   ? 18.162  -3.929  7.110   1.00 47.67  ? 6    DT  C "C2'" 1 
ATOM   5699 C  "C1'" . DT  C 2 3   ? 18.733  -5.245  7.637   1.00 46.42  ? 6    DT  C "C1'" 1 
ATOM   5700 N  N1    . DT  C 2 3   ? 17.862  -6.415  7.454   1.00 44.96  ? 6    DT  C N1    1 
ATOM   5701 C  C2    . DT  C 2 3   ? 18.357  -7.534  6.808   1.00 45.35  ? 6    DT  C C2    1 
ATOM   5702 O  O2    . DT  C 2 3   ? 19.496  -7.607  6.361   1.00 46.47  ? 6    DT  C O2    1 
ATOM   5703 N  N3    . DT  C 2 3   ? 17.467  -8.576  6.691   1.00 44.22  ? 6    DT  C N3    1 
ATOM   5704 C  C4    . DT  C 2 3   ? 16.168  -8.585  7.154   1.00 43.78  ? 6    DT  C C4    1 
ATOM   5705 O  O4    . DT  C 2 3   ? 15.422  -9.546  7.027   1.00 43.46  ? 6    DT  C O4    1 
ATOM   5706 C  C5    . DT  C 2 3   ? 15.730  -7.386  7.814   1.00 44.24  ? 6    DT  C C5    1 
ATOM   5707 C  C7    . DT  C 2 3   ? 14.329  -7.308  8.342   1.00 45.60  ? 6    DT  C C7    1 
ATOM   5708 C  C6    . DT  C 2 3   ? 16.581  -6.366  7.941   1.00 44.06  ? 6    DT  C C6    1 
ATOM   5709 P  P     . DG  C 2 4   ? 19.984  -1.381  6.963   1.00 48.94  ? 7    DG  C P     1 
ATOM   5710 O  OP1   . DG  C 2 4   ? 21.061  -0.504  7.495   1.00 48.55  ? 7    DG  C OP1   1 
ATOM   5711 O  OP2   . DG  C 2 4   ? 19.118  -0.957  5.832   1.00 48.21  ? 7    DG  C OP2   1 
ATOM   5712 O  "O5'" . DG  C 2 4   ? 20.725  -2.767  6.628   1.00 48.06  ? 7    DG  C "O5'" 1 
ATOM   5713 C  "C5'" . DG  C 2 4   ? 21.863  -2.798  5.743   1.00 44.53  ? 7    DG  C "C5'" 1 
ATOM   5714 C  "C4'" . DG  C 2 4   ? 21.656  -3.619  4.459   1.00 40.56  ? 7    DG  C "C4'" 1 
ATOM   5715 O  "O4'" . DG  C 2 4   ? 20.635  -4.656  4.576   1.00 38.64  ? 7    DG  C "O4'" 1 
ATOM   5716 C  "C3'" . DG  C 2 4   ? 21.312  -2.816  3.206   1.00 37.51  ? 7    DG  C "C3'" 1 
ATOM   5717 O  "O3'" . DG  C 2 4   ? 22.308  -3.081  2.237   1.00 35.59  ? 7    DG  C "O3'" 1 
ATOM   5718 C  "C2'" . DG  C 2 4   ? 19.957  -3.382  2.805   1.00 37.22  ? 7    DG  C "C2'" 1 
ATOM   5719 C  "C1'" . DG  C 2 4   ? 20.112  -4.821  3.283   1.00 36.83  ? 7    DG  C "C1'" 1 
ATOM   5720 N  N9    . DG  C 2 4   ? 18.898  -5.592  3.467   1.00 34.92  ? 7    DG  C N9    1 
ATOM   5721 C  C8    . DG  C 2 4   ? 17.759  -5.149  4.072   1.00 34.98  ? 7    DG  C C8    1 
ATOM   5722 N  N7    . DG  C 2 4   ? 16.817  -6.045  4.121   1.00 34.97  ? 7    DG  C N7    1 
ATOM   5723 C  C5    . DG  C 2 4   ? 17.371  -7.161  3.524   1.00 33.87  ? 7    DG  C C5    1 
ATOM   5724 C  C6    . DG  C 2 4   ? 16.808  -8.444  3.309   1.00 33.24  ? 7    DG  C C6    1 
ATOM   5725 O  O6    . DG  C 2 4   ? 15.679  -8.838  3.613   1.00 31.67  ? 7    DG  C O6    1 
ATOM   5726 N  N1    . DG  C 2 4   ? 17.695  -9.305  2.671   1.00 33.02  ? 7    DG  C N1    1 
ATOM   5727 C  C2    . DG  C 2 4   ? 18.966  -8.946  2.287   1.00 33.03  ? 7    DG  C C2    1 
ATOM   5728 N  N2    . DG  C 2 4   ? 19.680  -9.900  1.682   1.00 32.32  ? 7    DG  C N2    1 
ATOM   5729 N  N3    . DG  C 2 4   ? 19.503  -7.743  2.488   1.00 33.69  ? 7    DG  C N3    1 
ATOM   5730 C  C4    . DG  C 2 4   ? 18.655  -6.897  3.113   1.00 33.86  ? 7    DG  C C4    1 
ATOM   5731 P  P     . DT  C 2 5   ? 22.563  -2.115  0.983   1.00 35.85  ? 8    DT  C P     1 
ATOM   5732 O  OP1   . DT  C 2 5   ? 23.980  -1.700  0.894   1.00 36.48  ? 8    DT  C OP1   1 
ATOM   5733 O  OP2   . DT  C 2 5   ? 21.532  -1.056  1.027   1.00 37.10  ? 8    DT  C OP2   1 
ATOM   5734 O  "O5'" . DT  C 2 5   ? 22.313  -3.110  -0.236  1.00 34.86  ? 8    DT  C "O5'" 1 
ATOM   5735 C  "C5'" . DT  C 2 5   ? 22.957  -4.374  -0.146  1.00 34.18  ? 8    DT  C "C5'" 1 
ATOM   5736 C  "C4'" . DT  C 2 5   ? 22.508  -5.407  -1.165  1.00 32.97  ? 8    DT  C "C4'" 1 
ATOM   5737 O  "O4'" . DT  C 2 5   ? 21.454  -6.232  -0.627  1.00 32.24  ? 8    DT  C "O4'" 1 
ATOM   5738 C  "C3'" . DT  C 2 5   ? 22.061  -4.820  -2.478  1.00 32.48  ? 8    DT  C "C3'" 1 
ATOM   5739 O  "O3'" . DT  C 2 5   ? 23.187  -4.973  -3.349  1.00 34.00  ? 8    DT  C "O3'" 1 
ATOM   5740 C  "C2'" . DT  C 2 5   ? 20.820  -5.621  -2.810  1.00 33.29  ? 8    DT  C "C2'" 1 
ATOM   5741 C  "C1'" . DT  C 2 5   ? 20.540  -6.527  -1.626  1.00 33.45  ? 8    DT  C "C1'" 1 
ATOM   5742 N  N1    . DT  C 2 5   ? 19.179  -6.432  -1.005  1.00 36.56  ? 8    DT  C N1    1 
ATOM   5743 C  C2    . DT  C 2 5   ? 18.424  -7.585  -1.043  1.00 38.75  ? 8    DT  C C2    1 
ATOM   5744 O  O2    . DT  C 2 5   ? 18.838  -8.612  -1.560  1.00 40.62  ? 8    DT  C O2    1 
ATOM   5745 N  N3    . DT  C 2 5   ? 17.175  -7.502  -0.463  1.00 38.90  ? 8    DT  C N3    1 
ATOM   5746 C  C4    . DT  C 2 5   ? 16.628  -6.393  0.152   1.00 38.66  ? 8    DT  C C4    1 
ATOM   5747 O  O4    . DT  C 2 5   ? 15.513  -6.416  0.653   1.00 39.49  ? 8    DT  C O4    1 
ATOM   5748 C  C5    . DT  C 2 5   ? 17.453  -5.213  0.163   1.00 37.92  ? 8    DT  C C5    1 
ATOM   5749 C  C7    . DT  C 2 5   ? 16.910  -3.976  0.809   1.00 37.71  ? 8    DT  C C7    1 
ATOM   5750 C  C6    . DT  C 2 5   ? 18.679  -5.279  -0.404  1.00 37.42  ? 8    DT  C C6    1 
ATOM   5751 P  P     . DA  C 2 6   ? 23.217  -5.454  -4.875  1.00 35.27  ? 9    DA  C P     1 
ATOM   5752 O  OP1   . DA  C 2 6   ? 24.625  -5.705  -5.240  1.00 35.44  ? 9    DA  C OP1   1 
ATOM   5753 O  OP2   . DA  C 2 6   ? 22.458  -4.494  -5.700  1.00 35.31  ? 9    DA  C OP2   1 
ATOM   5754 O  "O5'" . DA  C 2 6   ? 22.412  -6.825  -4.746  1.00 35.62  ? 9    DA  C "O5'" 1 
ATOM   5755 C  "C5'" . DA  C 2 6   ? 22.727  -7.989  -5.447  1.00 37.26  ? 9    DA  C "C5'" 1 
ATOM   5756 C  "C4'" . DA  C 2 6   ? 21.444  -8.638  -5.948  1.00 38.88  ? 9    DA  C "C4'" 1 
ATOM   5757 O  "O4'" . DA  C 2 6   ? 20.274  -8.405  -5.119  1.00 38.22  ? 9    DA  C "O4'" 1 
ATOM   5758 C  "C3'" . DA  C 2 6   ? 21.014  -8.231  -7.343  1.00 40.71  ? 9    DA  C "C3'" 1 
ATOM   5759 O  "O3'" . DA  C 2 6   ? 20.576  -9.437  -7.891  1.00 44.10  ? 9    DA  C "O3'" 1 
ATOM   5760 C  "C2'" . DA  C 2 6   ? 19.855  -7.278  -7.112  1.00 39.10  ? 9    DA  C "C2'" 1 
ATOM   5761 C  "C1'" . DA  C 2 6   ? 19.210  -7.988  -5.936  1.00 37.85  ? 9    DA  C "C1'" 1 
ATOM   5762 N  N9    . DA  C 2 6   ? 18.364  -7.110  -5.162  1.00 37.27  ? 9    DA  C N9    1 
ATOM   5763 C  C8    . DA  C 2 6   ? 18.582  -5.791  -4.899  1.00 37.08  ? 9    DA  C C8    1 
ATOM   5764 N  N7    . DA  C 2 6   ? 17.648  -5.244  -4.164  1.00 37.95  ? 9    DA  C N7    1 
ATOM   5765 C  C5    . DA  C 2 6   ? 16.748  -6.281  -3.947  1.00 38.16  ? 9    DA  C C5    1 
ATOM   5766 C  C6    . DA  C 2 6   ? 15.518  -6.356  -3.256  1.00 37.92  ? 9    DA  C C6    1 
ATOM   5767 N  N6    . DA  C 2 6   ? 14.986  -5.313  -2.624  1.00 38.56  ? 9    DA  C N6    1 
ATOM   5768 N  N1    . DA  C 2 6   ? 14.854  -7.529  -3.239  1.00 36.93  ? 9    DA  C N1    1 
ATOM   5769 C  C2    . DA  C 2 6   ? 15.399  -8.566  -3.876  1.00 37.20  ? 9    DA  C C2    1 
ATOM   5770 N  N3    . DA  C 2 6   ? 16.545  -8.621  -4.561  1.00 37.51  ? 9    DA  C N3    1 
ATOM   5771 C  C4    . DA  C 2 6   ? 17.177  -7.438  -4.560  1.00 37.58  ? 9    DA  C C4    1 
ATOM   5772 P  P     . DC  C 2 7   ? 20.581  -9.713  -9.454  1.00 46.86  ? 10   DC  C P     1 
ATOM   5773 O  OP1   . DC  C 2 7   ? 21.930  -9.548  -10.054 1.00 45.24  ? 10   DC  C OP1   1 
ATOM   5774 O  OP2   . DC  C 2 7   ? 19.421  -8.975  -10.019 1.00 46.01  ? 10   DC  C OP2   1 
ATOM   5775 O  "O5'" . DC  C 2 7   ? 20.293  -11.282 -9.332  1.00 48.28  ? 10   DC  C "O5'" 1 
ATOM   5776 C  "C5'" . DC  C 2 7   ? 19.331  -11.894 -10.147 1.00 51.03  ? 10   DC  C "C5'" 1 
ATOM   5777 C  "C4'" . DC  C 2 7   ? 18.020  -12.142 -9.431  1.00 52.88  ? 10   DC  C "C4'" 1 
ATOM   5778 O  "O4'" . DC  C 2 7   ? 17.644  -11.065 -8.544  1.00 51.92  ? 10   DC  C "O4'" 1 
ATOM   5779 C  "C3'" . DC  C 2 7   ? 16.898  -12.228 -10.448 1.00 55.50  ? 10   DC  C "C3'" 1 
ATOM   5780 O  "O3'" . DC  C 2 7   ? 16.188  -13.440 -10.289 1.00 59.54  ? 10   DC  C "O3'" 1 
ATOM   5781 C  "C2'" . DC  C 2 7   ? 16.014  -11.022 -10.160 1.00 54.54  ? 10   DC  C "C2'" 1 
ATOM   5782 C  "C1'" . DC  C 2 7   ? 16.247  -10.901 -8.673  1.00 52.88  ? 10   DC  C "C1'" 1 
ATOM   5783 N  N1    . DC  C 2 7   ? 15.794  -9.594  -8.115  1.00 53.13  ? 10   DC  C N1    1 
ATOM   5784 C  C2    . DC  C 2 7   ? 14.615  -9.561  -7.355  1.00 53.05  ? 10   DC  C C2    1 
ATOM   5785 O  O2    . DC  C 2 7   ? 13.977  -10.612 -7.168  1.00 52.18  ? 10   DC  C O2    1 
ATOM   5786 N  N3    . DC  C 2 7   ? 14.220  -8.360  -6.839  1.00 53.25  ? 10   DC  C N3    1 
ATOM   5787 C  C4    . DC  C 2 7   ? 14.933  -7.249  -7.060  1.00 53.18  ? 10   DC  C C4    1 
ATOM   5788 N  N4    . DC  C 2 7   ? 14.488  -6.114  -6.525  1.00 53.26  ? 10   DC  C N4    1 
ATOM   5789 C  C5    . DC  C 2 7   ? 16.129  -7.252  -7.840  1.00 53.24  ? 10   DC  C C5    1 
ATOM   5790 C  C6    . DC  C 2 7   ? 16.512  -8.439  -8.336  1.00 53.52  ? 10   DC  C C6    1 
ATOM   5791 P  P     . DA  C 2 8   ? 15.344  -13.952 -11.547 1.00 62.71  ? 11   DA  C P     1 
ATOM   5792 O  OP1   . DA  C 2 8   ? 15.990  -15.219 -11.999 1.00 62.28  ? 11   DA  C OP1   1 
ATOM   5793 O  OP2   . DA  C 2 8   ? 15.134  -12.801 -12.481 1.00 61.91  ? 11   DA  C OP2   1 
ATOM   5794 O  "O5'" . DA  C 2 8   ? 13.925  -14.317 -10.892 1.00 63.30  ? 11   DA  C "O5'" 1 
ATOM   5795 C  "C5'" . DA  C 2 8   ? 13.262  -13.405 -10.024 1.00 64.27  ? 11   DA  C "C5'" 1 
ATOM   5796 C  "C4'" . DA  C 2 8   ? 11.757  -13.354 -10.260 1.00 64.63  ? 11   DA  C "C4'" 1 
ATOM   5797 O  "O4'" . DA  C 2 8   ? 11.202  -12.145 -9.670  1.00 64.10  ? 11   DA  C "O4'" 1 
ATOM   5798 C  "C3'" . DA  C 2 8   ? 11.311  -13.330 -11.716 1.00 65.28  ? 11   DA  C "C3'" 1 
ATOM   5799 O  "O3'" . DA  C 2 8   ? 10.013  -13.944 -11.857 1.00 66.50  ? 11   DA  C "O3'" 1 
ATOM   5800 C  "C2'" . DA  C 2 8   ? 11.288  -11.836 -12.022 1.00 64.57  ? 11   DA  C "C2'" 1 
ATOM   5801 C  "C1'" . DA  C 2 8   ? 10.910  -11.202 -10.679 1.00 63.07  ? 11   DA  C "C1'" 1 
ATOM   5802 N  N9    . DA  C 2 8   ? 11.641  -9.961  -10.448 1.00 61.08  ? 11   DA  C N9    1 
ATOM   5803 C  C8    . DA  C 2 8   ? 12.892  -9.675  -10.922 1.00 60.74  ? 11   DA  C C8    1 
ATOM   5804 N  N7    . DA  C 2 8   ? 13.321  -8.486  -10.588 1.00 60.63  ? 11   DA  C N7    1 
ATOM   5805 C  C5    . DA  C 2 8   ? 12.272  -7.958  -9.854  1.00 59.80  ? 11   DA  C C5    1 
ATOM   5806 C  C6    . DA  C 2 8   ? 12.111  -6.716  -9.220  1.00 59.18  ? 11   DA  C C6    1 
ATOM   5807 N  N6    . DA  C 2 8   ? 13.071  -5.783  -9.261  1.00 59.71  ? 11   DA  C N6    1 
ATOM   5808 N  N1    . DA  C 2 8   ? 10.953  -6.486  -8.561  1.00 57.89  ? 11   DA  C N1    1 
ATOM   5809 C  C2    . DA  C 2 8   ? 10.023  -7.441  -8.550  1.00 57.58  ? 11   DA  C C2    1 
ATOM   5810 N  N3    . DA  C 2 8   ? 10.066  -8.644  -9.112  1.00 58.52  ? 11   DA  C N3    1 
ATOM   5811 C  C4    . DA  C 2 8   ? 11.225  -8.846  -9.756  1.00 59.61  ? 11   DA  C C4    1 
ATOM   5812 P  P     . DA  C 2 9   ? 9.357   -14.195 -13.302 1.00 66.66  ? 12   DA  C P     1 
ATOM   5813 O  OP1   . DA  C 2 9   ? 8.759   -15.548 -13.244 1.00 66.21  ? 12   DA  C OP1   1 
ATOM   5814 O  OP2   . DA  C 2 9   ? 10.318  -13.820 -14.372 1.00 65.56  ? 12   DA  C OP2   1 
ATOM   5815 O  "O5'" . DA  C 2 9   ? 8.196   -13.099 -13.358 1.00 67.10  ? 12   DA  C "O5'" 1 
ATOM   5816 C  "C5'" . DA  C 2 9   ? 7.185   -13.063 -12.361 1.00 67.72  ? 12   DA  C "C5'" 1 
ATOM   5817 C  "C4'" . DA  C 2 9   ? 6.712   -11.637 -12.174 1.00 67.76  ? 12   DA  C "C4'" 1 
ATOM   5818 O  "O4'" . DA  C 2 9   ? 7.845   -10.767 -12.022 1.00 67.05  ? 12   DA  C "O4'" 1 
ATOM   5819 C  "C3'" . DA  C 2 9   ? 6.023   -11.021 -13.376 1.00 68.24  ? 12   DA  C "C3'" 1 
ATOM   5820 O  "O3'" . DA  C 2 9   ? 4.649   -11.380 -13.374 1.00 69.56  ? 12   DA  C "O3'" 1 
ATOM   5821 C  "C2'" . DA  C 2 9   ? 6.218   -9.529  -13.130 1.00 67.66  ? 12   DA  C "C2'" 1 
ATOM   5822 C  "C1'" . DA  C 2 9   ? 7.315   -9.469  -12.086 1.00 66.75  ? 12   DA  C "C1'" 1 
ATOM   5823 N  N9    . DA  C 2 9   ? 8.360   -8.501  -12.407 1.00 66.22  ? 12   DA  C N9    1 
ATOM   5824 C  C8    . DA  C 2 9   ? 9.381   -8.594  -13.310 1.00 65.65  ? 12   DA  C C8    1 
ATOM   5825 N  N7    . DA  C 2 9   ? 10.145  -7.527  -13.342 1.00 65.26  ? 12   DA  C N7    1 
ATOM   5826 C  C5    . DA  C 2 9   ? 9.585   -6.680  -12.405 1.00 65.32  ? 12   DA  C C5    1 
ATOM   5827 C  C6    . DA  C 2 9   ? 9.906   -5.386  -11.944 1.00 65.62  ? 12   DA  C C6    1 
ATOM   5828 N  N6    . DA  C 2 9   ? 10.928  -4.655  -12.374 1.00 65.59  ? 12   DA  C N6    1 
ATOM   5829 N  N1    . DA  C 2 9   ? 9.125   -4.843  -10.993 1.00 66.46  ? 12   DA  C N1    1 
ATOM   5830 C  C2    . DA  C 2 9   ? 8.080   -5.536  -10.523 1.00 66.58  ? 12   DA  C C2    1 
ATOM   5831 N  N3    . DA  C 2 9   ? 7.681   -6.755  -10.876 1.00 66.18  ? 12   DA  C N3    1 
ATOM   5832 C  C4    . DA  C 2 9   ? 8.484   -7.270  -11.823 1.00 65.78  ? 12   DA  C C4    1 
ATOM   5833 P  P     . DG  C 2 10  ? 3.582   -10.647 -14.326 1.00 70.46  ? 13   DG  C P     1 
ATOM   5834 O  OP1   . DG  C 2 10  ? 2.600   -11.675 -14.747 1.00 70.55  ? 13   DG  C OP1   1 
ATOM   5835 O  OP2   . DG  C 2 10  ? 4.304   -9.886  -15.386 1.00 70.05  ? 13   DG  C OP2   1 
ATOM   5836 O  "O5'" . DG  C 2 10  ? 2.865   -9.655  -13.277 1.00 68.73  ? 13   DG  C "O5'" 1 
ATOM   5837 C  "C5'" . DG  C 2 10  ? 2.134   -8.512  -13.707 1.00 66.85  ? 13   DG  C "C5'" 1 
ATOM   5838 C  "C4'" . DG  C 2 10  ? 2.791   -7.266  -13.151 1.00 65.58  ? 13   DG  C "C4'" 1 
ATOM   5839 O  "O4'" . DG  C 2 10  ? 4.168   -7.242  -13.567 1.00 64.68  ? 13   DG  C "O4'" 1 
ATOM   5840 C  "C3'" . DG  C 2 10  ? 2.371   -5.908  -13.698 1.00 65.48  ? 13   DG  C "C3'" 1 
ATOM   5841 O  "O3'" . DG  C 2 10  ? 1.103   -5.439  -13.266 1.00 65.33  ? 13   DG  C "O3'" 1 
ATOM   5842 C  "C2'" . DG  C 2 10  ? 3.460   -5.029  -13.110 1.00 64.76  ? 13   DG  C "C2'" 1 
ATOM   5843 C  "C1'" . DG  C 2 10  ? 4.637   -6.005  -13.071 1.00 64.39  ? 13   DG  C "C1'" 1 
ATOM   5844 N  N9    . DG  C 2 10  ? 5.850   -5.526  -13.747 1.00 63.41  ? 13   DG  C N9    1 
ATOM   5845 C  C8    . DG  C 2 10  ? 6.740   -6.211  -14.544 1.00 62.82  ? 13   DG  C C8    1 
ATOM   5846 N  N7    . DG  C 2 10  ? 7.737   -5.475  -14.952 1.00 62.35  ? 13   DG  C N7    1 
ATOM   5847 C  C5    . DG  C 2 10  ? 7.492   -4.230  -14.383 1.00 62.11  ? 13   DG  C C5    1 
ATOM   5848 C  C6    . DG  C 2 10  ? 8.211   -3.019  -14.451 1.00 61.60  ? 13   DG  C C6    1 
ATOM   5849 O  O6    . DG  C 2 10  ? 9.249   -2.816  -15.071 1.00 62.08  ? 13   DG  C O6    1 
ATOM   5850 N  N1    . DG  C 2 10  ? 7.627   -1.985  -13.720 1.00 61.25  ? 13   DG  C N1    1 
ATOM   5851 C  C2    . DG  C 2 10  ? 6.461   -2.113  -13.000 1.00 61.77  ? 13   DG  C C2    1 
ATOM   5852 N  N2    . DG  C 2 10  ? 5.983   -1.046  -12.338 1.00 61.94  ? 13   DG  C N2    1 
ATOM   5853 N  N3    . DG  C 2 10  ? 5.781   -3.241  -12.931 1.00 62.28  ? 13   DG  C N3    1 
ATOM   5854 C  C4    . DG  C 2 10  ? 6.346   -4.250  -13.640 1.00 62.52  ? 13   DG  C C4    1 
ATOM   5855 P  P     . DT  C 2 11  ? 0.165   -4.741  -14.357 1.00 65.18  ? 14   DT  C P     1 
ATOM   5856 O  OP1   . DT  C 2 11  ? -1.087  -5.515  -14.405 1.00 65.10  ? 14   DT  C OP1   1 
ATOM   5857 O  OP2   . DT  C 2 11  ? 0.918   -4.581  -15.625 1.00 64.30  ? 14   DT  C OP2   1 
ATOM   5858 O  "O5'" . DT  C 2 11  ? -0.154  -3.318  -13.675 1.00 66.16  ? 14   DT  C "O5'" 1 
ATOM   5859 C  "C5'" . DT  C 2 11  ? 0.804   -2.599  -12.861 1.00 66.74  ? 14   DT  C "C5'" 1 
ATOM   5860 C  "C4'" . DT  C 2 11  ? 1.317   -1.309  -13.510 1.00 66.61  ? 14   DT  C "C4'" 1 
ATOM   5861 O  "O4'" . DT  C 2 11  ? 2.720   -1.419  -13.902 1.00 65.68  ? 14   DT  C "O4'" 1 
ATOM   5862 C  "C3'" . DT  C 2 11  ? 0.585   -0.823  -14.765 1.00 66.62  ? 14   DT  C "C3'" 1 
ATOM   5863 O  "O3'" . DT  C 2 11  ? 0.402   0.609   -14.678 1.00 68.65  ? 14   DT  C "O3'" 1 
ATOM   5864 C  "C2'" . DT  C 2 11  ? 1.538   -1.232  -15.890 1.00 65.05  ? 14   DT  C "C2'" 1 
ATOM   5865 C  "C1'" . DT  C 2 11  ? 2.852   -0.895  -15.212 1.00 63.70  ? 14   DT  C "C1'" 1 
ATOM   5866 N  N1    . DT  C 2 11  ? 4.081   -1.415  -15.875 1.00 62.07  ? 14   DT  C N1    1 
ATOM   5867 C  C2    . DT  C 2 11  ? 5.116   -0.526  -16.089 1.00 61.63  ? 14   DT  C C2    1 
ATOM   5868 O  O2    . DT  C 2 11  ? 5.053   0.651   -15.762 1.00 61.24  ? 14   DT  C O2    1 
ATOM   5869 N  N3    . DT  C 2 11  ? 6.236   -1.061  -16.699 1.00 61.30  ? 14   DT  C N3    1 
ATOM   5870 C  C4    . DT  C 2 11  ? 6.427   -2.373  -17.110 1.00 60.75  ? 14   DT  C C4    1 
ATOM   5871 O  O4    . DT  C 2 11  ? 7.471   -2.747  -17.650 1.00 58.74  ? 14   DT  C O4    1 
ATOM   5872 C  C5    . DT  C 2 11  ? 5.302   -3.249  -16.844 1.00 61.20  ? 14   DT  C C5    1 
ATOM   5873 C  C7    . DT  C 2 11  ? 5.367   -4.695  -17.236 1.00 61.39  ? 14   DT  C C7    1 
ATOM   5874 C  C6    . DT  C 2 11  ? 4.201   -2.741  -16.250 1.00 61.53  ? 14   DT  C C6    1 
ATOM   5875 P  P     . DA  C 2 12  ? -0.336  1.476   -15.824 1.00 69.70  ? 15   DA  C P     1 
ATOM   5876 O  OP1   . DA  C 2 12  ? -0.807  2.741   -15.200 1.00 69.43  ? 15   DA  C OP1   1 
ATOM   5877 O  OP2   . DA  C 2 12  ? -1.307  0.593   -16.525 1.00 69.96  ? 15   DA  C OP2   1 
ATOM   5878 O  "O5'" . DA  C 2 12  ? 0.846   1.777   -16.856 1.00 67.29  ? 15   DA  C "O5'" 1 
ATOM   5879 C  "C5'" . DA  C 2 12  ? 0.766   2.935   -17.629 1.00 65.03  ? 15   DA  C "C5'" 1 
ATOM   5880 C  "C4'" . DA  C 2 12  ? 1.764   3.931   -17.088 1.00 63.48  ? 15   DA  C "C4'" 1 
ATOM   5881 O  "O4'" . DA  C 2 12  ? 2.977   3.240   -16.720 1.00 62.62  ? 15   DA  C "O4'" 1 
ATOM   5882 C  "C3'" . DA  C 2 12  ? 2.177   4.956   -18.123 1.00 62.97  ? 15   DA  C "C3'" 1 
ATOM   5883 O  "O3'" . DA  C 2 12  ? 2.474   6.175   -17.519 1.00 63.23  ? 15   DA  C "O3'" 1 
ATOM   5884 C  "C2'" . DA  C 2 12  ? 3.437   4.394   -18.755 1.00 62.25  ? 15   DA  C "C2'" 1 
ATOM   5885 C  "C1'" . DA  C 2 12  ? 3.954   3.408   -17.731 1.00 62.23  ? 15   DA  C "C1'" 1 
ATOM   5886 N  N9    . DA  C 2 12  ? 4.246   2.118   -18.358 1.00 62.29  ? 15   DA  C N9    1 
ATOM   5887 C  C8    . DA  C 2 12  ? 3.409   1.037   -18.552 1.00 61.84  ? 15   DA  C C8    1 
ATOM   5888 N  N7    . DA  C 2 12  ? 3.982   0.014   -19.147 1.00 60.67  ? 15   DA  C N7    1 
ATOM   5889 C  C5    . DA  C 2 12  ? 5.272   0.467   -19.359 1.00 60.44  ? 15   DA  C C5    1 
ATOM   5890 C  C6    . DA  C 2 12  ? 6.382   -0.137  -19.936 1.00 60.01  ? 15   DA  C C6    1 
ATOM   5891 N  N6    . DA  C 2 12  ? 6.325   -1.371  -20.420 1.00 60.82  ? 15   DA  C N6    1 
ATOM   5892 N  N1    . DA  C 2 12  ? 7.532   0.562   -19.990 1.00 59.76  ? 15   DA  C N1    1 
ATOM   5893 C  C2    . DA  C 2 12  ? 7.569   1.801   -19.494 1.00 59.65  ? 15   DA  C C2    1 
ATOM   5894 N  N3    . DA  C 2 12  ? 6.588   2.487   -18.924 1.00 60.23  ? 15   DA  C N3    1 
ATOM   5895 C  C4    . DA  C 2 12  ? 5.462   1.751   -18.886 1.00 61.15  ? 15   DA  C C4    1 
HETATM 5896 N  N1    . 5IU C 2 13  ? 5.954   4.112   -21.782 1.00 79.05  ? 16   5IU C N1    1 
HETATM 5897 C  C2    . 5IU C 2 13  ? 6.774   3.084   -22.264 1.00 80.62  ? 16   5IU C C2    1 
HETATM 5898 N  N3    . 5IU C 2 13  ? 6.245   1.941   -22.685 1.00 83.93  ? 16   5IU C N3    1 
HETATM 5899 C  C4    . 5IU C 2 13  ? 4.922   1.700   -22.676 1.00 89.47  ? 16   5IU C C4    1 
HETATM 5900 C  C5    . 5IU C 2 13  ? 3.916   2.735   -22.178 1.00 92.82  ? 16   5IU C C5    1 
HETATM 5901 C  C6    . 5IU C 2 13  ? 4.594   3.928   -21.745 1.00 87.42  ? 16   5IU C C6    1 
HETATM 5902 O  O2    . 5IU C 2 13  ? 8.008   3.252   -22.295 1.00 79.47  ? 16   5IU C O2    1 
HETATM 5903 O  O4    . 5IU C 2 13  ? 4.584   0.578   -23.109 1.00 88.63  ? 16   5IU C O4    1 
HETATM 5904 I  I5    . 5IU C 2 13  ? 1.733   2.462   -22.137 1.00 108.97 ? 16   5IU C I5    1 
HETATM 5905 C  "C1'" . 5IU C 2 13  ? 6.673   5.330   -21.311 1.00 72.41  ? 16   5IU C "C1'" 1 
HETATM 5906 C  "C2'" . 5IU C 2 13  ? 6.818   6.479   -22.305 1.00 67.66  ? 16   5IU C "C2'" 1 
HETATM 5907 C  "C3'" . 5IU C 2 13  ? 6.389   7.737   -21.556 1.00 63.49  ? 16   5IU C "C3'" 1 
HETATM 5908 C  "C4'" . 5IU C 2 13  ? 5.944   7.284   -20.207 1.00 64.63  ? 16   5IU C "C4'" 1 
HETATM 5909 O  "O3'" . 5IU C 2 13  ? 7.409   8.704   -21.307 1.00 58.13  ? 16   5IU C "O3'" 1 
HETATM 5910 O  "O4'" . 5IU C 2 13  ? 6.119   5.881   -20.109 1.00 68.13  ? 16   5IU C "O4'" 1 
HETATM 5911 C  "C5'" . 5IU C 2 13  ? 4.479   7.554   -20.167 1.00 64.74  ? 16   5IU C "C5'" 1 
HETATM 5912 O  "O5'" . 5IU C 2 13  ? 4.126   7.533   -18.802 1.00 64.20  ? 16   5IU C "O5'" 1 
HETATM 5913 P  P     . 5IU C 2 13  ? 2.562   7.429   -18.495 1.00 63.94  ? 16   5IU C P     1 
HETATM 5914 O  OP1   . 5IU C 2 13  ? 2.211   8.667   -17.712 1.00 65.16  ? 16   5IU C OP1   1 
HETATM 5915 O  OP2   . 5IU C 2 13  ? 1.830   7.085   -19.777 1.00 63.80  ? 16   5IU C OP2   1 
ATOM   5916 P  P     . DG  C 2 14  ? 7.178   10.238  -21.715 1.00 54.15  ? 17   DG  C P     1 
ATOM   5917 O  OP1   . DG  C 2 14  ? 8.198   11.115  -21.103 1.00 54.48  ? 17   DG  C OP1   1 
ATOM   5918 O  OP2   . DG  C 2 14  ? 5.747   10.543  -21.561 1.00 53.93  ? 17   DG  C OP2   1 
ATOM   5919 O  "O5'" . DG  C 2 14  ? 7.563   10.253  -23.254 1.00 53.00  ? 17   DG  C "O5'" 1 
ATOM   5920 C  "C5'" . DG  C 2 14  ? 8.907   9.949   -23.664 1.00 50.16  ? 17   DG  C "C5'" 1 
ATOM   5921 C  "C4'" . DG  C 2 14  ? 8.903   9.180   -24.976 1.00 47.76  ? 17   DG  C "C4'" 1 
ATOM   5922 O  "O4'" . DG  C 2 14  ? 8.305   7.863   -24.822 1.00 47.07  ? 17   DG  C "O4'" 1 
ATOM   5923 C  "C3'" . DG  C 2 14  ? 8.087   9.858   -26.067 1.00 46.39  ? 17   DG  C "C3'" 1 
ATOM   5924 O  "O3'" . DG  C 2 14  ? 8.848   9.906   -27.224 1.00 45.61  ? 17   DG  C "O3'" 1 
ATOM   5925 C  "C2'" . DG  C 2 14  ? 6.871   8.973   -26.268 1.00 46.07  ? 17   DG  C "C2'" 1 
ATOM   5926 C  "C1'" . DG  C 2 14  ? 7.516   7.632   -25.968 1.00 45.98  ? 17   DG  C "C1'" 1 
ATOM   5927 N  N9    . DG  C 2 14  ? 6.540   6.561   -25.810 1.00 45.51  ? 17   DG  C N9    1 
ATOM   5928 C  C8    . DG  C 2 14  ? 5.199   6.684   -25.532 1.00 45.52  ? 17   DG  C C8    1 
ATOM   5929 N  N7    . DG  C 2 14  ? 4.564   5.548   -25.477 1.00 45.16  ? 17   DG  C N7    1 
ATOM   5930 C  C5    . DG  C 2 14  ? 5.548   4.617   -25.744 1.00 45.35  ? 17   DG  C C5    1 
ATOM   5931 C  C6    . DG  C 2 14  ? 5.459   3.217   -25.821 1.00 45.19  ? 17   DG  C C6    1 
ATOM   5932 O  O6    . DG  C 2 14  ? 4.438   2.556   -25.663 1.00 44.89  ? 17   DG  C O6    1 
ATOM   5933 N  N1    . DG  C 2 14  ? 6.682   2.600   -26.114 1.00 45.81  ? 17   DG  C N1    1 
ATOM   5934 C  C2    . DG  C 2 14  ? 7.869   3.287   -26.313 1.00 46.20  ? 17   DG  C C2    1 
ATOM   5935 N  N2    . DG  C 2 14  ? 8.975   2.579   -26.593 1.00 45.29  ? 17   DG  C N2    1 
ATOM   5936 N  N3    . DG  C 2 14  ? 7.959   4.614   -26.246 1.00 46.67  ? 17   DG  C N3    1 
ATOM   5937 C  C4    . DG  C 2 14  ? 6.768   5.215   -25.958 1.00 46.01  ? 17   DG  C C4    1 
ATOM   5938 P  P     . DA  C 2 15  ? 9.228   11.367  -27.685 1.00 45.23  ? 18   DA  C P     1 
ATOM   5939 O  OP1   . DA  C 2 15  ? 10.267  11.873  -26.755 1.00 44.71  ? 18   DA  C OP1   1 
ATOM   5940 O  OP2   . DA  C 2 15  ? 7.941   12.072  -27.874 1.00 46.28  ? 18   DA  C OP2   1 
ATOM   5941 O  "O5'" . DA  C 2 15  ? 9.880   11.169  -29.120 1.00 45.05  ? 18   DA  C "O5'" 1 
ATOM   5942 C  "C5'" . DA  C 2 15  ? 11.213  10.685  -29.170 1.00 44.85  ? 18   DA  C "C5'" 1 
ATOM   5943 C  "C4'" . DA  C 2 15  ? 11.245  9.330   -29.851 1.00 43.67  ? 18   DA  C "C4'" 1 
ATOM   5944 O  "O4'" . DA  C 2 15  ? 10.364  8.389   -29.200 1.00 42.82  ? 18   DA  C "O4'" 1 
ATOM   5945 C  "C3'" . DA  C 2 15  ? 10.775  9.411   -31.285 1.00 43.05  ? 18   DA  C "C3'" 1 
ATOM   5946 O  "O3'" . DA  C 2 15  ? 11.948  9.517   -32.060 1.00 43.21  ? 18   DA  C "O3'" 1 
ATOM   5947 C  "C2'" . DA  C 2 15  ? 9.984   8.132   -31.508 1.00 42.60  ? 18   DA  C "C2'" 1 
ATOM   5948 C  "C1'" . DA  C 2 15  ? 9.952   7.453   -30.153 1.00 42.15  ? 18   DA  C "C1'" 1 
ATOM   5949 N  N9    . DA  C 2 15  ? 8.605   7.091   -29.789 1.00 41.92  ? 18   DA  C N9    1 
ATOM   5950 C  C8    . DA  C 2 15  ? 7.607   7.953   -29.469 1.00 42.79  ? 18   DA  C C8    1 
ATOM   5951 N  N7    . DA  C 2 15  ? 6.481   7.348   -29.188 1.00 43.53  ? 18   DA  C N7    1 
ATOM   5952 C  C5    . DA  C 2 15  ? 6.768   6.009   -29.342 1.00 42.12  ? 18   DA  C C5    1 
ATOM   5953 C  C6    . DA  C 2 15  ? 5.998   4.850   -29.191 1.00 41.94  ? 18   DA  C C6    1 
ATOM   5954 N  N6    . DA  C 2 15  ? 4.726   4.875   -28.824 1.00 43.03  ? 18   DA  C N6    1 
ATOM   5955 N  N1    . DA  C 2 15  ? 6.566   3.658   -29.417 1.00 42.02  ? 18   DA  C N1    1 
ATOM   5956 C  C2    . DA  C 2 15  ? 7.850   3.637   -29.776 1.00 42.68  ? 18   DA  C C2    1 
ATOM   5957 N  N3    . DA  C 2 15  ? 8.678   4.666   -29.951 1.00 42.92  ? 18   DA  C N3    1 
ATOM   5958 C  C4    . DA  C 2 15  ? 8.072   5.835   -29.716 1.00 42.02  ? 18   DA  C C4    1 
ATOM   5959 P  P     . DA  C 2 16  ? 12.243  8.603   -33.331 1.00 43.61  ? 19   DA  C P     1 
ATOM   5960 O  OP1   . DA  C 2 16  ? 13.462  9.157   -33.973 1.00 43.22  ? 19   DA  C OP1   1 
ATOM   5961 O  OP2   . DA  C 2 16  ? 10.979  8.406   -34.105 1.00 43.20  ? 19   DA  C OP2   1 
ATOM   5962 O  "O5'" . DA  C 2 16  ? 12.696  7.261   -32.620 1.00 41.89  ? 19   DA  C "O5'" 1 
ATOM   5963 C  "C5'" . DA  C 2 16  ? 13.415  6.346   -33.376 1.00 40.93  ? 19   DA  C "C5'" 1 
ATOM   5964 C  "C4'" . DA  C 2 16  ? 12.559  5.123   -33.601 1.00 40.43  ? 19   DA  C "C4'" 1 
ATOM   5965 O  "O4'" . DA  C 2 16  ? 11.244  5.254   -33.023 1.00 39.07  ? 19   DA  C "O4'" 1 
ATOM   5966 C  "C3'" . DA  C 2 16  ? 12.324  4.796   -35.059 1.00 40.70  ? 19   DA  C "C3'" 1 
ATOM   5967 O  "O3'" . DA  C 2 16  ? 12.756  3.482   -35.201 1.00 42.36  ? 19   DA  C "O3'" 1 
ATOM   5968 C  "C2'" . DA  C 2 16  ? 10.815  4.869   -35.219 1.00 39.95  ? 19   DA  C "C2'" 1 
ATOM   5969 C  "C1'" . DA  C 2 16  ? 10.403  4.472   -33.820 1.00 38.75  ? 19   DA  C "C1'" 1 
ATOM   5970 N  N9    . DA  C 2 16  ? 9.065   4.857   -33.454 1.00 38.49  ? 19   DA  C N9    1 
ATOM   5971 C  C8    . DA  C 2 16  ? 8.617   6.129   -33.247 1.00 39.06  ? 19   DA  C C8    1 
ATOM   5972 N  N7    . DA  C 2 16  ? 7.357   6.206   -32.897 1.00 39.21  ? 19   DA  C N7    1 
ATOM   5973 C  C5    . DA  C 2 16  ? 6.964   4.884   -32.883 1.00 38.76  ? 19   DA  C C5    1 
ATOM   5974 C  C6    . DA  C 2 16  ? 5.732   4.294   -32.592 1.00 38.61  ? 19   DA  C C6    1 
ATOM   5975 N  N6    . DA  C 2 16  ? 4.678   5.029   -32.264 1.00 37.96  ? 19   DA  C N6    1 
ATOM   5976 N  N1    . DA  C 2 16  ? 5.642   2.944   -32.664 1.00 39.31  ? 19   DA  C N1    1 
ATOM   5977 C  C2    . DA  C 2 16  ? 6.738   2.234   -33.003 1.00 39.17  ? 19   DA  C C2    1 
ATOM   5978 N  N3    . DA  C 2 16  ? 7.963   2.680   -33.299 1.00 38.66  ? 19   DA  C N3    1 
ATOM   5979 C  C4    . DA  C 2 16  ? 8.002   4.028   -33.222 1.00 38.71  ? 19   DA  C C4    1 
ATOM   5980 P  P     . DA  C 2 17  ? 13.344  2.994   -36.593 1.00 43.66  ? 20   DA  C P     1 
ATOM   5981 O  OP1   . DA  C 2 17  ? 14.689  2.436   -36.296 1.00 42.82  ? 20   DA  C OP1   1 
ATOM   5982 O  OP2   . DA  C 2 17  ? 13.177  4.090   -37.586 1.00 43.24  ? 20   DA  C OP2   1 
ATOM   5983 O  "O5'" . DA  C 2 17  ? 12.317  1.819   -36.982 1.00 42.42  ? 20   DA  C "O5'" 1 
ATOM   5984 C  "C5'" . DA  C 2 17  ? 11.773  0.950   -35.982 1.00 40.09  ? 20   DA  C "C5'" 1 
ATOM   5985 C  "C4'" . DA  C 2 17  ? 10.421  0.386   -36.381 1.00 38.46  ? 20   DA  C "C4'" 1 
ATOM   5986 O  "O4'" . DA  C 2 17  ? 9.357   1.251   -35.907 1.00 38.12  ? 20   DA  C "O4'" 1 
ATOM   5987 C  "C3'" . DA  C 2 17  ? 10.177  0.212   -37.872 1.00 37.53  ? 20   DA  C "C3'" 1 
ATOM   5988 O  "O3'" . DA  C 2 17  ? 9.652   -1.109  -38.070 1.00 36.58  ? 20   DA  C "O3'" 1 
ATOM   5989 C  "C2'" . DA  C 2 17  ? 9.197   1.351   -38.181 1.00 36.78  ? 20   DA  C "C2'" 1 
ATOM   5990 C  "C1'" . DA  C 2 17  ? 8.369   1.358   -36.904 1.00 36.57  ? 20   DA  C "C1'" 1 
ATOM   5991 N  N9    . DA  C 2 17  ? 7.561   2.554   -36.642 1.00 36.12  ? 20   DA  C N9    1 
ATOM   5992 C  C8    . DA  C 2 17  ? 7.965   3.856   -36.711 1.00 35.54  ? 20   DA  C C8    1 
ATOM   5993 N  N7    . DA  C 2 17  ? 7.038   4.736   -36.414 1.00 34.64  ? 20   DA  C N7    1 
ATOM   5994 C  C5    . DA  C 2 17  ? 5.934   3.967   -36.122 1.00 34.80  ? 20   DA  C C5    1 
ATOM   5995 C  C6    . DA  C 2 17  ? 4.618   4.307   -35.740 1.00 34.30  ? 20   DA  C C6    1 
ATOM   5996 N  N6    . DA  C 2 17  ? 4.210   5.563   -35.579 1.00 33.86  ? 20   DA  C N6    1 
ATOM   5997 N  N1    . DA  C 2 17  ? 3.735   3.311   -35.522 1.00 34.61  ? 20   DA  C N1    1 
ATOM   5998 C  C2    . DA  C 2 17  ? 4.160   2.047   -35.676 1.00 36.26  ? 20   DA  C C2    1 
ATOM   5999 N  N3    . DA  C 2 17  ? 5.375   1.595   -36.032 1.00 36.91  ? 20   DA  C N3    1 
ATOM   6000 C  C4    . DA  C 2 17  ? 6.234   2.618   -36.251 1.00 36.11  ? 20   DA  C C4    1 
ATOM   6001 P  P     . DT  C 2 18  ? 9.506   -1.806  -39.515 1.00 36.51  ? 21   DT  C P     1 
ATOM   6002 O  OP1   . DT  C 2 18  ? 10.298  -3.042  -39.406 1.00 37.83  ? 21   DT  C OP1   1 
ATOM   6003 O  OP2   . DT  C 2 18  ? 9.787   -0.830  -40.615 1.00 35.49  ? 21   DT  C OP2   1 
ATOM   6004 O  "O5'" . DT  C 2 18  ? 7.961   -2.220  -39.559 1.00 34.82  ? 21   DT  C "O5'" 1 
ATOM   6005 C  "C5'" . DT  C 2 18  ? 7.089   -1.111  -39.677 1.00 34.45  ? 21   DT  C "C5'" 1 
ATOM   6006 C  "C4'" . DT  C 2 18  ? 5.666   -1.396  -39.254 1.00 33.36  ? 21   DT  C "C4'" 1 
ATOM   6007 O  "O4'" . DT  C 2 18  ? 5.133   -0.288  -38.479 1.00 32.29  ? 21   DT  C "O4'" 1 
ATOM   6008 C  "C3'" . DT  C 2 18  ? 4.758   -1.520  -40.464 1.00 32.58  ? 21   DT  C "C3'" 1 
ATOM   6009 O  "O3'" . DT  C 2 18  ? 3.746   -2.470  -40.206 1.00 31.38  ? 21   DT  C "O3'" 1 
ATOM   6010 C  "C2'" . DT  C 2 18  ? 4.193   -0.120  -40.650 1.00 31.66  ? 21   DT  C "C2'" 1 
ATOM   6011 C  "C1'" . DT  C 2 18  ? 4.138   0.393   -39.221 1.00 31.44  ? 21   DT  C "C1'" 1 
ATOM   6012 N  N1    . DT  C 2 18  ? 4.422   1.825   -39.222 1.00 30.63  ? 21   DT  C N1    1 
ATOM   6013 C  C2    . DT  C 2 18  ? 3.437   2.718   -38.872 1.00 30.72  ? 21   DT  C C2    1 
ATOM   6014 O  O2    . DT  C 2 18  ? 2.319   2.391   -38.546 1.00 31.98  ? 21   DT  C O2    1 
ATOM   6015 N  N3    . DT  C 2 18  ? 3.802   4.030   -38.917 1.00 30.71  ? 21   DT  C N3    1 
ATOM   6016 C  C4    . DT  C 2 18  ? 5.039   4.515   -39.281 1.00 31.35  ? 21   DT  C C4    1 
ATOM   6017 O  O4    . DT  C 2 18  ? 5.264   5.721   -39.294 1.00 31.91  ? 21   DT  C O4    1 
ATOM   6018 C  C5    . DT  C 2 18  ? 6.030   3.517   -39.636 1.00 31.40  ? 21   DT  C C5    1 
ATOM   6019 C  C7    . DT  C 2 18  ? 7.422   3.888   -40.048 1.00 32.14  ? 21   DT  C C7    1 
ATOM   6020 C  C6    . DT  C 2 18  ? 5.676   2.236   -39.597 1.00 30.91  ? 21   DT  C C6    1 
ATOM   6021 P  P     . DG  C 2 19  ? 2.983   -3.115  -41.439 1.00 29.67  ? 22   DG  C P     1 
ATOM   6022 O  OP1   . DG  C 2 19  ? 3.356   -4.545  -41.494 1.00 29.11  ? 22   DG  C OP1   1 
ATOM   6023 O  OP2   . DG  C 2 19  ? 3.212   -2.235  -42.614 1.00 29.43  ? 22   DG  C OP2   1 
ATOM   6024 O  "O5'" . DG  C 2 19  ? 1.454   -3.006  -40.980 1.00 30.47  ? 22   DG  C "O5'" 1 
ATOM   6025 C  "C5'" . DG  C 2 19  ? 1.076   -2.165  -39.884 1.00 31.29  ? 22   DG  C "C5'" 1 
ATOM   6026 C  "C4'" . DG  C 2 19  ? -0.299  -1.526  -40.065 1.00 31.72  ? 22   DG  C "C4'" 1 
ATOM   6027 O  "O4'" . DG  C 2 19  ? -0.238  -0.096  -39.800 1.00 31.53  ? 22   DG  C "O4'" 1 
ATOM   6028 C  "C3'" . DG  C 2 19  ? -0.943  -1.701  -41.434 1.00 31.38  ? 22   DG  C "C3'" 1 
ATOM   6029 O  "O3'" . DG  C 2 19  ? -2.296  -2.064  -41.230 1.00 32.69  ? 22   DG  C "O3'" 1 
ATOM   6030 C  "C2'" . DG  C 2 19  ? -0.745  -0.339  -42.092 1.00 30.94  ? 22   DG  C "C2'" 1 
ATOM   6031 C  "C1'" . DG  C 2 19  ? -0.662  0.636   -40.926 1.00 30.91  ? 22   DG  C "C1'" 1 
ATOM   6032 N  N9    . DG  C 2 19  ? 0.301   1.708   -41.140 1.00 30.92  ? 22   DG  C N9    1 
ATOM   6033 C  C8    . DG  C 2 19  ? 1.598   1.578   -41.537 1.00 30.98  ? 22   DG  C C8    1 
ATOM   6034 N  N7    . DG  C 2 19  ? 2.231   2.706   -41.650 1.00 31.75  ? 22   DG  C N7    1 
ATOM   6035 C  C5    . DG  C 2 19  ? 1.295   3.660   -41.303 1.00 32.15  ? 22   DG  C C5    1 
ATOM   6036 C  C6    . DG  C 2 19  ? 1.405   5.072   -41.230 1.00 32.73  ? 22   DG  C C6    1 
ATOM   6037 O  O6    . DG  C 2 19  ? 2.384   5.790   -41.476 1.00 32.85  ? 22   DG  C O6    1 
ATOM   6038 N  N1    . DG  C 2 19  ? 0.213   5.659   -40.825 1.00 33.51  ? 22   DG  C N1    1 
ATOM   6039 C  C2    . DG  C 2 19  ? -0.938  4.958   -40.537 1.00 33.98  ? 22   DG  C C2    1 
ATOM   6040 N  N2    . DG  C 2 19  ? -2.010  5.666   -40.161 1.00 35.05  ? 22   DG  C N2    1 
ATOM   6041 N  N3    . DG  C 2 19  ? -1.045  3.639   -40.599 1.00 33.46  ? 22   DG  C N3    1 
ATOM   6042 C  C4    . DG  C 2 19  ? 0.106   3.053   -40.985 1.00 31.92  ? 22   DG  C C4    1 
ATOM   6043 P  P     . DT  C 2 20  ? -3.461  -1.714  -42.270 1.00 34.21  ? 23   DT  C P     1 
ATOM   6044 O  OP1   . DT  C 2 20  ? -4.716  -2.360  -41.821 1.00 34.75  ? 23   DT  C OP1   1 
ATOM   6045 O  OP2   . DT  C 2 20  ? -2.925  -2.013  -43.616 1.00 34.25  ? 23   DT  C OP2   1 
ATOM   6046 O  "O5'" . DT  C 2 20  ? -3.689  -0.140  -42.083 1.00 34.70  ? 23   DT  C "O5'" 1 
ATOM   6047 C  "C5'" . DT  C 2 20  ? -4.589  0.361   -41.087 1.00 34.88  ? 23   DT  C "C5'" 1 
ATOM   6048 C  "C4'" . DT  C 2 20  ? -5.474  1.454   -41.658 1.00 35.49  ? 23   DT  C "C4'" 1 
ATOM   6049 O  "O4'" . DT  C 2 20  ? -4.683  2.659   -41.856 1.00 35.19  ? 23   DT  C "O4'" 1 
ATOM   6050 C  "C3'" . DT  C 2 20  ? -6.125  1.121   -43.000 1.00 36.13  ? 23   DT  C "C3'" 1 
ATOM   6051 O  "O3'" . DT  C 2 20  ? -7.548  1.426   -42.971 1.00 37.22  ? 23   DT  C "O3'" 1 
ATOM   6052 C  "C2'" . DT  C 2 20  ? -5.265  1.886   -44.015 1.00 35.87  ? 23   DT  C "C2'" 1 
ATOM   6053 C  "C1'" . DT  C 2 20  ? -4.702  3.060   -43.213 1.00 34.87  ? 23   DT  C "C1'" 1 
ATOM   6054 N  N1    . DT  C 2 20  ? -3.316  3.497   -43.592 1.00 34.01  ? 23   DT  C N1    1 
ATOM   6055 C  C2    . DT  C 2 20  ? -2.958  4.822   -43.415 1.00 33.48  ? 23   DT  C C2    1 
ATOM   6056 O  O2    . DT  C 2 20  ? -3.720  5.654   -42.975 1.00 33.42  ? 23   DT  C O2    1 
ATOM   6057 N  N3    . DT  C 2 20  ? -1.673  5.146   -43.779 1.00 33.05  ? 23   DT  C N3    1 
ATOM   6058 C  C4    . DT  C 2 20  ? -0.727  4.271   -44.287 1.00 33.09  ? 23   DT  C C4    1 
ATOM   6059 O  O4    . DT  C 2 20  ? 0.402   4.654   -44.575 1.00 32.66  ? 23   DT  C O4    1 
ATOM   6060 C  C5    . DT  C 2 20  ? -1.167  2.894   -44.449 1.00 33.02  ? 23   DT  C C5    1 
ATOM   6061 C  C7    . DT  C 2 20  ? -0.257  1.838   -44.993 1.00 32.63  ? 23   DT  C C7    1 
ATOM   6062 C  C6    . DT  C 2 20  ? -2.419  2.577   -44.102 1.00 33.31  ? 23   DT  C C6    1 
ATOM   6063 P  P     . DC  C 2 21  ? -8.338  2.417   -43.960 1.00 37.98  ? 24   DC  C P     1 
ATOM   6064 O  OP1   . DC  C 2 21  ? -9.657  2.631   -43.326 1.00 38.28  ? 24   DC  C OP1   1 
ATOM   6065 O  OP2   . DC  C 2 21  ? -8.271  1.888   -45.341 1.00 37.10  ? 24   DC  C OP2   1 
ATOM   6066 O  "O5'" . DC  C 2 21  ? -7.487  3.781   -43.896 1.00 39.13  ? 24   DC  C "O5'" 1 
ATOM   6067 C  "C5'" . DC  C 2 21  ? -8.044  5.063   -43.574 1.00 40.28  ? 24   DC  C "C5'" 1 
ATOM   6068 C  "C4'" . DC  C 2 21  ? -7.903  6.061   -44.726 1.00 40.65  ? 24   DC  C "C4'" 1 
ATOM   6069 O  "O4'" . DC  C 2 21  ? -6.512  6.219   -45.105 1.00 39.57  ? 24   DC  C "O4'" 1 
ATOM   6070 C  "C3'" . DC  C 2 21  ? -8.656  5.753   -46.026 1.00 41.01  ? 24   DC  C "C3'" 1 
ATOM   6071 O  "O3'" . DC  C 2 21  ? -9.119  6.995   -46.581 1.00 42.59  ? 24   DC  C "O3'" 1 
ATOM   6072 C  "C2'" . DC  C 2 21  ? -7.570  5.111   -46.883 1.00 39.83  ? 24   DC  C "C2'" 1 
ATOM   6073 C  "C1'" . DC  C 2 21  ? -6.412  6.025   -46.499 1.00 39.36  ? 24   DC  C "C1'" 1 
ATOM   6074 N  N1    . DC  C 2 21  ? -5.050  5.512   -46.799 1.00 39.24  ? 24   DC  C N1    1 
ATOM   6075 C  C2    . DC  C 2 21  ? -3.948  6.376   -46.649 1.00 38.78  ? 24   DC  C C2    1 
ATOM   6076 O  O2    . DC  C 2 21  ? -4.125  7.544   -46.273 1.00 38.32  ? 24   DC  C O2    1 
ATOM   6077 N  N3    . DC  C 2 21  ? -2.709  5.896   -46.924 1.00 38.38  ? 24   DC  C N3    1 
ATOM   6078 C  C4    . DC  C 2 21  ? -2.561  4.631   -47.332 1.00 38.52  ? 24   DC  C C4    1 
ATOM   6079 N  N4    . DC  C 2 21  ? -1.326  4.206   -47.598 1.00 39.04  ? 24   DC  C N4    1 
ATOM   6080 C  C5    . DC  C 2 21  ? -3.663  3.738   -47.494 1.00 38.63  ? 24   DC  C C5    1 
ATOM   6081 C  C6    . DC  C 2 21  ? -4.880  4.218   -47.218 1.00 39.12  ? 24   DC  C C6    1 
ATOM   6082 P  P     . DG  C 2 22  ? -10.201 7.137   -47.771 1.00 44.27  ? 25   DG  C P     1 
ATOM   6083 O  OP1   . DG  C 2 22  ? -11.417 6.403   -47.350 1.00 44.18  ? 25   DG  C OP1   1 
ATOM   6084 O  OP2   . DG  C 2 22  ? -9.599  6.859   -49.102 1.00 43.51  ? 25   DG  C OP2   1 
ATOM   6085 O  "O5'" . DG  C 2 22  ? -10.469 8.712   -47.720 1.00 44.67  ? 25   DG  C "O5'" 1 
ATOM   6086 C  "C5'" . DG  C 2 22  ? -9.671  9.571   -46.885 1.00 44.85  ? 25   DG  C "C5'" 1 
ATOM   6087 C  "C4'" . DG  C 2 22  ? -8.631  10.356  -47.677 1.00 44.74  ? 25   DG  C "C4'" 1 
ATOM   6088 O  "O4'" . DG  C 2 22  ? -7.432  9.562   -47.844 1.00 43.93  ? 25   DG  C "O4'" 1 
ATOM   6089 C  "C3'" . DG  C 2 22  ? -9.029  10.808  -49.084 1.00 45.63  ? 25   DG  C "C3'" 1 
ATOM   6090 O  "O3'" . DG  C 2 22  ? -8.658  12.194  -49.262 1.00 47.01  ? 25   DG  C "O3'" 1 
ATOM   6091 C  "C2'" . DG  C 2 22  ? -8.257  9.835   -49.982 1.00 44.72  ? 25   DG  C "C2'" 1 
ATOM   6092 C  "C1'" . DG  C 2 22  ? -6.980  9.705   -49.169 1.00 43.38  ? 25   DG  C "C1'" 1 
ATOM   6093 N  N9    . DG  C 2 22  ? -6.123  8.575   -49.521 1.00 42.37  ? 25   DG  C N9    1 
ATOM   6094 C  C8    . DG  C 2 22  ? -6.468  7.255   -49.731 1.00 42.07  ? 25   DG  C C8    1 
ATOM   6095 N  N7    . DG  C 2 22  ? -5.453  6.491   -50.032 1.00 41.20  ? 25   DG  C N7    1 
ATOM   6096 C  C5    . DG  C 2 22  ? -4.370  7.363   -50.018 1.00 41.00  ? 25   DG  C C5    1 
ATOM   6097 C  C6    . DG  C 2 22  ? -2.998  7.127   -50.268 1.00 40.86  ? 25   DG  C C6    1 
ATOM   6098 O  O6    . DG  C 2 22  ? -2.455  6.055   -50.559 1.00 40.54  ? 25   DG  C O6    1 
ATOM   6099 N  N1    . DG  C 2 22  ? -2.232  8.289   -50.153 1.00 40.78  ? 25   DG  C N1    1 
ATOM   6100 C  C2    . DG  C 2 22  ? -2.737  9.531   -49.835 1.00 40.47  ? 25   DG  C C2    1 
ATOM   6101 N  N2    . DG  C 2 22  ? -1.861  10.541  -49.769 1.00 40.41  ? 25   DG  C N2    1 
ATOM   6102 N  N3    . DG  C 2 22  ? -4.016  9.768   -49.594 1.00 40.33  ? 25   DG  C N3    1 
ATOM   6103 C  C4    . DG  C 2 22  ? -4.766  8.644   -49.704 1.00 41.21  ? 25   DG  C C4    1 
ATOM   6104 P  P     . DT  C 2 23  ? -8.826  13.010  -50.641 1.00 47.60  ? 26   DT  C P     1 
ATOM   6105 O  OP1   . DT  C 2 23  ? -9.460  14.319  -50.336 1.00 47.53  ? 26   DT  C OP1   1 
ATOM   6106 O  OP2   . DT  C 2 23  ? -9.414  12.131  -51.679 1.00 47.01  ? 26   DT  C OP2   1 
ATOM   6107 O  "O5'" . DT  C 2 23  ? -7.298  13.272  -51.018 1.00 47.68  ? 26   DT  C "O5'" 1 
ATOM   6108 C  "C5'" . DT  C 2 23  ? -6.425  14.003  -50.155 1.00 48.41  ? 26   DT  C "C5'" 1 
ATOM   6109 C  "C4'" . DT  C 2 23  ? -5.069  14.108  -50.826 1.00 49.04  ? 26   DT  C "C4'" 1 
ATOM   6110 O  "O4'" . DT  C 2 23  ? -4.548  12.760  -50.978 1.00 48.95  ? 26   DT  C "O4'" 1 
ATOM   6111 C  "C3'" . DT  C 2 23  ? -5.096  14.701  -52.237 1.00 49.96  ? 26   DT  C "C3'" 1 
ATOM   6112 O  "O3'" . DT  C 2 23  ? -4.042  15.667  -52.426 1.00 51.35  ? 26   DT  C "O3'" 1 
ATOM   6113 C  "C2'" . DT  C 2 23  ? -4.953  13.480  -53.156 1.00 48.89  ? 26   DT  C "C2'" 1 
ATOM   6114 C  "C1'" . DT  C 2 23  ? -4.067  12.581  -52.300 1.00 47.43  ? 26   DT  C "C1'" 1 
ATOM   6115 N  N1    . DT  C 2 23  ? -4.034  11.115  -52.706 1.00 45.05  ? 26   DT  C N1    1 
ATOM   6116 C  C2    . DT  C 2 23  ? -2.823  10.563  -53.098 1.00 43.54  ? 26   DT  C C2    1 
ATOM   6117 O  O2    . DT  C 2 23  ? -1.775  11.190  -53.133 1.00 42.53  ? 26   DT  C O2    1 
ATOM   6118 N  N3    . DT  C 2 23  ? -2.886  9.234   -53.452 1.00 42.50  ? 26   DT  C N3    1 
ATOM   6119 C  C4    . DT  C 2 23  ? -4.005  8.417   -53.455 1.00 41.80  ? 26   DT  C C4    1 
ATOM   6120 O  O4    . DT  C 2 23  ? -3.947  7.243   -53.794 1.00 40.59  ? 26   DT  C O4    1 
ATOM   6121 C  C5    . DT  C 2 23  ? -5.235  9.045   -53.037 1.00 42.32  ? 26   DT  C C5    1 
ATOM   6122 C  C7    . DT  C 2 23  ? -6.511  8.254   -53.000 1.00 41.82  ? 26   DT  C C7    1 
ATOM   6123 C  C6    . DT  C 2 23  ? -5.194  10.345  -52.689 1.00 43.70  ? 26   DT  C C6    1 
ATOM   6124 P  P     . DT  C 2 24  ? -3.943  16.542  -53.778 1.00 52.32  ? 27   DT  C P     1 
ATOM   6125 O  OP1   . DT  C 2 24  ? -3.523  17.906  -53.382 1.00 52.17  ? 27   DT  C OP1   1 
ATOM   6126 O  OP2   . DT  C 2 24  ? -5.158  16.320  -54.611 1.00 50.94  ? 27   DT  C OP2   1 
ATOM   6127 O  "O5'" . DT  C 2 24  ? -2.695  15.877  -54.519 1.00 52.57  ? 27   DT  C "O5'" 1 
ATOM   6128 C  "C5'" . DT  C 2 24  ? -1.395  15.979  -53.948 1.00 52.78  ? 27   DT  C "C5'" 1 
ATOM   6129 C  "C4'" . DT  C 2 24  ? -0.410  15.175  -54.773 1.00 53.21  ? 27   DT  C "C4'" 1 
ATOM   6130 O  "O4'" . DT  C 2 24  ? -0.821  13.788  -54.854 1.00 52.67  ? 27   DT  C "O4'" 1 
ATOM   6131 C  "C3'" . DT  C 2 24  ? -0.251  15.627  -56.218 1.00 54.28  ? 27   DT  C "C3'" 1 
ATOM   6132 O  "O3'" . DT  C 2 24  ? 1.136   15.624  -56.493 1.00 56.83  ? 27   DT  C "O3'" 1 
ATOM   6133 C  "C2'" . DT  C 2 24  ? -0.986  14.560  -57.028 1.00 52.91  ? 27   DT  C "C2'" 1 
ATOM   6134 C  "C1'" . DT  C 2 24  ? -0.657  13.339  -56.183 1.00 51.57  ? 27   DT  C "C1'" 1 
ATOM   6135 N  N1    . DT  C 2 24  ? -1.535  12.153  -56.369 1.00 50.05  ? 27   DT  C N1    1 
ATOM   6136 C  C2    . DT  C 2 24  ? -0.971  10.936  -56.686 1.00 48.95  ? 27   DT  C C2    1 
ATOM   6137 O  O2    . DT  C 2 24  ? 0.223   10.766  -56.843 1.00 48.66  ? 27   DT  C O2    1 
ATOM   6138 N  N3    . DT  C 2 24  ? -1.869  9.912   -56.819 1.00 48.48  ? 27   DT  C N3    1 
ATOM   6139 C  C4    . DT  C 2 24  ? -3.242  9.988   -56.665 1.00 48.89  ? 27   DT  C C4    1 
ATOM   6140 O  O4    . DT  C 2 24  ? -3.962  9.011   -56.807 1.00 49.17  ? 27   DT  C O4    1 
ATOM   6141 C  C5    . DT  C 2 24  ? -3.774  11.288  -56.329 1.00 49.41  ? 27   DT  C C5    1 
ATOM   6142 C  C7    . DT  C 2 24  ? -5.251  11.502  -56.139 1.00 49.42  ? 27   DT  C C7    1 
ATOM   6143 C  C6    . DT  C 2 24  ? -2.901  12.293  -56.196 1.00 49.91  ? 27   DT  C C6    1 
ATOM   6144 P  P     . DT  C 2 25  ? 1.745   16.355  -57.780 1.00 59.00  ? 28   DT  C P     1 
ATOM   6145 O  OP1   . DT  C 2 25  ? 3.045   16.927  -57.340 1.00 59.06  ? 28   DT  C OP1   1 
ATOM   6146 O  OP2   . DT  C 2 25  ? 0.705   17.217  -58.413 1.00 57.88  ? 28   DT  C OP2   1 
ATOM   6147 O  "O5'" . DT  C 2 25  ? 2.048   15.106  -58.737 1.00 59.20  ? 28   DT  C "O5'" 1 
ATOM   6148 C  "C5'" . DT  C 2 25  ? 2.989   14.085  -58.347 1.00 59.15  ? 28   DT  C "C5'" 1 
ATOM   6149 C  "C4'" . DT  C 2 25  ? 3.344   13.216  -59.539 1.00 58.90  ? 28   DT  C "C4'" 1 
ATOM   6150 O  "O4'" . DT  C 2 25  ? 2.844   11.874  -59.321 1.00 58.61  ? 28   DT  C "O4'" 1 
ATOM   6151 C  "C3'" . DT  C 2 25  ? 2.698   13.664  -60.844 1.00 58.99  ? 28   DT  C "C3'" 1 
ATOM   6152 O  "O3'" . DT  C 2 25  ? 3.491   14.663  -61.470 1.00 59.26  ? 28   DT  C "O3'" 1 
ATOM   6153 C  "C2'" . DT  C 2 25  ? 2.631   12.361  -61.633 1.00 59.00  ? 28   DT  C "C2'" 1 
ATOM   6154 C  "C1'" . DT  C 2 25  ? 2.284   11.372  -60.521 1.00 58.51  ? 28   DT  C "C1'" 1 
ATOM   6155 N  N1    . DT  C 2 25  ? 0.803   11.092  -60.351 1.00 58.28  ? 28   DT  C N1    1 
ATOM   6156 C  C2    . DT  C 2 25  ? 0.398   9.774   -60.255 1.00 58.31  ? 28   DT  C C2    1 
ATOM   6157 O  O2    . DT  C 2 25  ? 1.164   8.832   -60.297 1.00 58.46  ? 28   DT  C O2    1 
ATOM   6158 N  N3    . DT  C 2 25  ? -0.952  9.581   -60.109 1.00 58.43  ? 28   DT  C N3    1 
ATOM   6159 C  C4    . DT  C 2 25  ? -1.928  10.556  -60.053 1.00 58.57  ? 28   DT  C C4    1 
ATOM   6160 O  O4    . DT  C 2 25  ? -3.115  10.272  -59.922 1.00 58.93  ? 28   DT  C O4    1 
ATOM   6161 C  C5    . DT  C 2 25  ? -1.451  11.916  -60.157 1.00 58.41  ? 28   DT  C C5    1 
ATOM   6162 C  C7    . DT  C 2 25  ? -2.424  13.056  -60.097 1.00 58.47  ? 28   DT  C C7    1 
ATOM   6163 C  C6    . DT  C 2 25  ? -0.130  12.117  -60.300 1.00 58.14  ? 28   DT  C C6    1 
ATOM   6164 O  "O5'" . DA  D 3 1   ? -3.031  -0.086  -62.154 1.00 46.13  ? 29   DA  D "O5'" 1 
ATOM   6165 C  "C5'" . DA  D 3 1   ? -1.961  -0.762  -62.808 1.00 46.06  ? 29   DA  D "C5'" 1 
ATOM   6166 C  "C4'" . DA  D 3 1   ? -0.590  -0.231  -62.397 1.00 45.71  ? 29   DA  D "C4'" 1 
ATOM   6167 O  "O4'" . DA  D 3 1   ? -0.605  1.217   -62.285 1.00 45.11  ? 29   DA  D "O4'" 1 
ATOM   6168 C  "C3'" . DA  D 3 1   ? -0.023  -0.728  -61.071 1.00 45.60  ? 29   DA  D "C3'" 1 
ATOM   6169 O  "O3'" . DA  D 3 1   ? 1.399   -0.891  -61.236 1.00 45.54  ? 29   DA  D "O3'" 1 
ATOM   6170 C  "C2'" . DA  D 3 1   ? -0.403  0.385   -60.088 1.00 44.98  ? 29   DA  D "C2'" 1 
ATOM   6171 C  "C1'" . DA  D 3 1   ? -0.320  1.634   -60.964 1.00 44.31  ? 29   DA  D "C1'" 1 
ATOM   6172 N  N9    . DA  D 3 1   ? -1.286  2.691   -60.669 1.00 43.48  ? 29   DA  D N9    1 
ATOM   6173 C  C8    . DA  D 3 1   ? -2.620  2.539   -60.404 1.00 43.35  ? 29   DA  D C8    1 
ATOM   6174 N  N7    . DA  D 3 1   ? -3.260  3.666   -60.196 1.00 43.00  ? 29   DA  D N7    1 
ATOM   6175 C  C5    . DA  D 3 1   ? -2.278  4.630   -60.332 1.00 42.42  ? 29   DA  D C5    1 
ATOM   6176 C  C6    . DA  D 3 1   ? -2.312  6.035   -60.230 1.00 41.68  ? 29   DA  D C6    1 
ATOM   6177 N  N6    . DA  D 3 1   ? -3.423  6.717   -59.949 1.00 41.06  ? 29   DA  D N6    1 
ATOM   6178 N  N1    . DA  D 3 1   ? -1.159  6.710   -60.423 1.00 41.62  ? 29   DA  D N1    1 
ATOM   6179 C  C2    . DA  D 3 1   ? -0.044  6.020   -60.711 1.00 41.87  ? 29   DA  D C2    1 
ATOM   6180 N  N3    . DA  D 3 1   ? 0.113   4.700   -60.833 1.00 42.49  ? 29   DA  D N3    1 
ATOM   6181 C  C4    . DA  D 3 1   ? -1.054  4.051   -60.633 1.00 42.88  ? 29   DA  D C4    1 
ATOM   6182 P  P     . DA  D 3 2   ? 2.346   -1.560  -60.126 1.00 44.94  ? 30   DA  D P     1 
ATOM   6183 O  OP1   . DA  D 3 2   ? 3.211   -2.546  -60.811 1.00 44.92  ? 30   DA  D OP1   1 
ATOM   6184 O  OP2   . DA  D 3 2   ? 1.500   -2.012  -59.007 1.00 45.19  ? 30   DA  D OP2   1 
ATOM   6185 O  "O5'" . DA  D 3 2   ? 3.247   -0.338  -59.606 1.00 44.62  ? 30   DA  D "O5'" 1 
ATOM   6186 C  "C5'" . DA  D 3 2   ? 3.494   0.802   -60.435 1.00 44.37  ? 30   DA  D "C5'" 1 
ATOM   6187 C  "C4'" . DA  D 3 2   ? 4.064   1.995   -59.682 1.00 43.86  ? 30   DA  D "C4'" 1 
ATOM   6188 O  "O4'" . DA  D 3 2   ? 3.025   2.998   -59.546 1.00 43.53  ? 30   DA  D "O4'" 1 
ATOM   6189 C  "C3'" . DA  D 3 2   ? 4.638   1.746   -58.287 1.00 43.50  ? 30   DA  D "C3'" 1 
ATOM   6190 O  "O3'" . DA  D 3 2   ? 5.965   2.278   -58.216 1.00 43.93  ? 30   DA  D "O3'" 1 
ATOM   6191 C  "C2'" . DA  D 3 2   ? 3.666   2.453   -57.340 1.00 43.24  ? 30   DA  D "C2'" 1 
ATOM   6192 C  "C1'" . DA  D 3 2   ? 3.012   3.508   -58.226 1.00 43.02  ? 30   DA  D "C1'" 1 
ATOM   6193 N  N9    . DA  D 3 2   ? 1.618   3.795   -57.897 1.00 42.34  ? 30   DA  D N9    1 
ATOM   6194 C  C8    . DA  D 3 2   ? 0.607   2.882   -57.785 1.00 42.35  ? 30   DA  D C8    1 
ATOM   6195 N  N7    . DA  D 3 2   ? -0.561  3.404   -57.494 1.00 42.26  ? 30   DA  D N7    1 
ATOM   6196 C  C5    . DA  D 3 2   ? -0.301  4.762   -57.407 1.00 42.09  ? 30   DA  D C5    1 
ATOM   6197 C  C6    . DA  D 3 2   ? -1.132  5.871   -57.118 1.00 41.81  ? 30   DA  D C6    1 
ATOM   6198 N  N6    . DA  D 3 2   ? -2.438  5.758   -56.854 1.00 41.07  ? 30   DA  D N6    1 
ATOM   6199 N  N1    . DA  D 3 2   ? -0.565  7.099   -57.114 1.00 41.97  ? 30   DA  D N1    1 
ATOM   6200 C  C2    . DA  D 3 2   ? 0.749   7.203   -57.380 1.00 42.23  ? 30   DA  D C2    1 
ATOM   6201 N  N3    . DA  D 3 2   ? 1.632   6.235   -57.655 1.00 42.18  ? 30   DA  D N3    1 
ATOM   6202 C  C4    . DA  D 3 2   ? 1.040   5.023   -57.655 1.00 42.17  ? 30   DA  D C4    1 
ATOM   6203 P  P     . DA  D 3 3   ? 6.893   2.020   -56.937 1.00 44.82  ? 31   DA  D P     1 
ATOM   6204 O  OP1   . DA  D 3 3   ? 8.321   2.038   -57.313 1.00 45.13  ? 31   DA  D OP1   1 
ATOM   6205 O  OP2   . DA  D 3 3   ? 6.375   0.850   -56.206 1.00 45.72  ? 31   DA  D OP2   1 
ATOM   6206 O  "O5'" . DA  D 3 3   ? 6.587   3.322   -56.079 1.00 46.00  ? 31   DA  D "O5'" 1 
ATOM   6207 C  "C5'" . DA  D 3 3   ? 7.050   4.581   -56.523 1.00 47.75  ? 31   DA  D "C5'" 1 
ATOM   6208 C  "C4'" . DA  D 3 3   ? 6.364   5.663   -55.721 1.00 48.79  ? 31   DA  D "C4'" 1 
ATOM   6209 O  "O4'" . DA  D 3 3   ? 4.936   5.473   -55.842 1.00 49.12  ? 31   DA  D "O4'" 1 
ATOM   6210 C  "C3'" . DA  D 3 3   ? 6.612   5.626   -54.216 1.00 49.58  ? 31   DA  D "C3'" 1 
ATOM   6211 O  "O3'" . DA  D 3 3   ? 7.818   6.361   -53.821 1.00 51.35  ? 31   DA  D "O3'" 1 
ATOM   6212 C  "C2'" . DA  D 3 3   ? 5.297   6.188   -53.667 1.00 49.86  ? 31   DA  D "C2'" 1 
ATOM   6213 C  "C1'" . DA  D 3 3   ? 4.377   6.329   -54.876 1.00 49.68  ? 31   DA  D "C1'" 1 
ATOM   6214 N  N9    . DA  D 3 3   ? 2.976   6.000   -54.578 1.00 49.92  ? 31   DA  D N9    1 
ATOM   6215 C  C8    . DA  D 3 3   ? 2.406   4.764   -54.401 1.00 49.82  ? 31   DA  D C8    1 
ATOM   6216 N  N7    . DA  D 3 3   ? 1.122   4.800   -54.125 1.00 49.47  ? 31   DA  D N7    1 
ATOM   6217 C  C5    . DA  D 3 3   ? 0.826   6.153   -54.117 1.00 49.81  ? 31   DA  D C5    1 
ATOM   6218 C  C6    . DA  D 3 3   ? -0.369  6.873   -53.894 1.00 49.97  ? 31   DA  D C6    1 
ATOM   6219 N  N6    . DA  D 3 3   ? -1.539  6.295   -53.625 1.00 50.05  ? 31   DA  D N6    1 
ATOM   6220 N  N1    . DA  D 3 3   ? -0.321  8.221   -53.959 1.00 50.24  ? 31   DA  D N1    1 
ATOM   6221 C  C2    . DA  D 3 3   ? 0.851   8.815   -54.232 1.00 50.38  ? 31   DA  D C2    1 
ATOM   6222 N  N3    . DA  D 3 3   ? 2.038   8.249   -54.461 1.00 50.04  ? 31   DA  D N3    1 
ATOM   6223 C  C4    . DA  D 3 3   ? 1.957   6.906   -54.388 1.00 49.87  ? 31   DA  D C4    1 
ATOM   6224 P  P     . DC  D 3 4   ? 7.884   7.483   -52.658 1.00 52.97  ? 32   DC  D P     1 
ATOM   6225 O  OP1   . DC  D 3 4   ? 9.232   8.101   -52.605 1.00 51.99  ? 32   DC  D OP1   1 
ATOM   6226 O  OP2   . DC  D 3 4   ? 7.373   6.855   -51.409 1.00 52.90  ? 32   DC  D OP2   1 
ATOM   6227 O  "O5'" . DC  D 3 4   ? 6.810   8.529   -53.265 1.00 53.22  ? 32   DC  D "O5'" 1 
ATOM   6228 C  "C5'" . DC  D 3 4   ? 6.844   9.939   -53.101 1.00 53.81  ? 32   DC  D "C5'" 1 
ATOM   6229 C  "C4'" . DC  D 3 4   ? 5.566   10.491  -52.466 1.00 54.54  ? 32   DC  D "C4'" 1 
ATOM   6230 O  "O4'" . DC  D 3 4   ? 4.382   9.638   -52.577 1.00 54.18  ? 32   DC  D "O4'" 1 
ATOM   6231 C  "C3'" . DC  D 3 4   ? 5.712   10.790  -50.978 1.00 54.88  ? 32   DC  D "C3'" 1 
ATOM   6232 O  "O3'" . DC  D 3 4   ? 5.369   12.131  -50.791 1.00 56.01  ? 32   DC  D "O3'" 1 
ATOM   6233 C  "C2'" . DC  D 3 4   ? 4.674   9.903   -50.303 1.00 54.17  ? 32   DC  D "C2'" 1 
ATOM   6234 C  "C1'" . DC  D 3 4   ? 3.618   9.813   -51.392 1.00 53.12  ? 32   DC  D "C1'" 1 
ATOM   6235 N  N1    . DC  D 3 4   ? 2.645   8.696   -51.149 1.00 52.00  ? 32   DC  D N1    1 
ATOM   6236 C  C2    . DC  D 3 4   ? 1.289   8.979   -50.931 1.00 51.25  ? 32   DC  D C2    1 
ATOM   6237 O  O2    . DC  D 3 4   ? 0.904   10.146  -50.959 1.00 51.37  ? 32   DC  D O2    1 
ATOM   6238 N  N3    . DC  D 3 4   ? 0.421   7.960   -50.708 1.00 50.92  ? 32   DC  D N3    1 
ATOM   6239 C  C4    . DC  D 3 4   ? 0.865   6.701   -50.686 1.00 51.25  ? 32   DC  D C4    1 
ATOM   6240 N  N4    . DC  D 3 4   ? -0.017  5.729   -50.459 1.00 50.93  ? 32   DC  D N4    1 
ATOM   6241 C  C5    . DC  D 3 4   ? 2.240   6.378   -50.893 1.00 51.62  ? 32   DC  D C5    1 
ATOM   6242 C  C6    . DC  D 3 4   ? 3.082   7.398   -51.114 1.00 52.01  ? 32   DC  D C6    1 
ATOM   6243 P  P     . DG  D 3 5   ? 5.989   12.969  -49.583 1.00 57.13  ? 33   DG  D P     1 
ATOM   6244 O  OP1   . DG  D 3 5   ? 7.305   13.451  -50.044 1.00 57.82  ? 33   DG  D OP1   1 
ATOM   6245 O  OP2   . DG  D 3 5   ? 5.980   12.190  -48.313 1.00 56.55  ? 33   DG  D OP2   1 
ATOM   6246 O  "O5'" . DG  D 3 5   ? 4.936   14.200  -49.560 1.00 56.02  ? 33   DG  D "O5'" 1 
ATOM   6247 C  "C5'" . DG  D 3 5   ? 3.535   14.069  -49.934 1.00 53.59  ? 33   DG  D "C5'" 1 
ATOM   6248 C  "C4'" . DG  D 3 5   ? 2.557   14.380  -48.789 1.00 52.11  ? 33   DG  D "C4'" 1 
ATOM   6249 O  "O4'" . DG  D 3 5   ? 1.731   13.238  -48.429 1.00 50.44  ? 33   DG  D "O4'" 1 
ATOM   6250 C  "C3'" . DG  D 3 5   ? 3.119   14.783  -47.429 1.00 51.93  ? 33   DG  D "C3'" 1 
ATOM   6251 O  "O3'" . DG  D 3 5   ? 2.052   15.402  -46.735 1.00 53.81  ? 33   DG  D "O3'" 1 
ATOM   6252 C  "C2'" . DG  D 3 5   ? 3.403   13.438  -46.780 1.00 49.70  ? 33   DG  D "C2'" 1 
ATOM   6253 C  "C1'" . DG  D 3 5   ? 2.066   12.792  -47.116 1.00 48.54  ? 33   DG  D "C1'" 1 
ATOM   6254 N  N9    . DG  D 3 5   ? 2.046   11.339  -47.128 1.00 46.51  ? 33   DG  D N9    1 
ATOM   6255 C  C8    . DG  D 3 5   ? 3.102   10.472  -47.253 1.00 46.10  ? 33   DG  D C8    1 
ATOM   6256 N  N7    . DG  D 3 5   ? 2.753   9.217   -47.251 1.00 45.52  ? 33   DG  D N7    1 
ATOM   6257 C  C5    . DG  D 3 5   ? 1.375   9.262   -47.117 1.00 45.17  ? 33   DG  D C5    1 
ATOM   6258 C  C6    . DG  D 3 5   ? 0.439   8.208   -47.054 1.00 44.83  ? 33   DG  D C6    1 
ATOM   6259 O  O6    . DG  D 3 5   ? 0.659   6.994   -47.101 1.00 44.80  ? 33   DG  D O6    1 
ATOM   6260 N  N1    . DG  D 3 5   ? -0.863  8.680   -46.922 1.00 44.70  ? 33   DG  D N1    1 
ATOM   6261 C  C2    . DG  D 3 5   ? -1.206  10.011  -46.857 1.00 44.57  ? 33   DG  D C2    1 
ATOM   6262 N  N2    . DG  D 3 5   ? -2.509  10.274  -46.733 1.00 44.79  ? 33   DG  D N2    1 
ATOM   6263 N  N3    . DG  D 3 5   ? -0.344  11.013  -46.916 1.00 44.55  ? 33   DG  D N3    1 
ATOM   6264 C  C4    . DG  D 3 5   ? 0.925   10.561  -47.043 1.00 45.41  ? 33   DG  D C4    1 
ATOM   6265 P  P     . DA  D 3 6   ? 2.291   16.515  -45.613 1.00 54.83  ? 34   DA  D P     1 
ATOM   6266 O  OP1   . DA  D 3 6   ? 1.864   17.777  -46.267 1.00 55.16  ? 34   DA  D OP1   1 
ATOM   6267 O  OP2   . DA  D 3 6   ? 3.657   16.344  -45.043 1.00 54.08  ? 34   DA  D OP2   1 
ATOM   6268 O  "O5'" . DA  D 3 6   ? 1.236   16.153  -44.456 1.00 54.38  ? 34   DA  D "O5'" 1 
ATOM   6269 C  "C5'" . DA  D 3 6   ? -0.184  16.100  -44.680 1.00 53.53  ? 34   DA  D "C5'" 1 
ATOM   6270 C  "C4'" . DA  D 3 6   ? -0.813  15.110  -43.712 1.00 52.73  ? 34   DA  D "C4'" 1 
ATOM   6271 O  "O4'" . DA  D 3 6   ? -0.472  13.748  -44.096 1.00 52.23  ? 34   DA  D "O4'" 1 
ATOM   6272 C  "C3'" . DA  D 3 6   ? -0.358  15.262  -42.255 1.00 52.76  ? 34   DA  D "C3'" 1 
ATOM   6273 O  "O3'" . DA  D 3 6   ? -1.509  15.354  -41.380 1.00 53.50  ? 34   DA  D "O3'" 1 
ATOM   6274 C  "C2'" . DA  D 3 6   ? 0.507   14.016  -42.011 1.00 51.79  ? 34   DA  D "C2'" 1 
ATOM   6275 C  "C1'" . DA  D 3 6   ? -0.214  13.017  -42.911 1.00 51.21  ? 34   DA  D "C1'" 1 
ATOM   6276 N  N9    . DA  D 3 6   ? 0.461   11.730  -43.152 1.00 49.71  ? 34   DA  D N9    1 
ATOM   6277 C  C8    . DA  D 3 6   ? 1.801   11.483  -43.272 1.00 49.34  ? 34   DA  D C8    1 
ATOM   6278 N  N7    . DA  D 3 6   ? 2.096   10.215  -43.469 1.00 49.04  ? 34   DA  D N7    1 
ATOM   6279 C  C5    . DA  D 3 6   ? 0.865   9.577   -43.479 1.00 48.87  ? 34   DA  D C5    1 
ATOM   6280 C  C6    . DA  D 3 6   ? 0.476   8.222   -43.642 1.00 48.61  ? 34   DA  D C6    1 
ATOM   6281 N  N6    . DA  D 3 6   ? 1.345   7.226   -43.839 1.00 49.20  ? 34   DA  D N6    1 
ATOM   6282 N  N1    . DA  D 3 6   ? -0.840  7.913   -43.596 1.00 47.60  ? 34   DA  D N1    1 
ATOM   6283 C  C2    . DA  D 3 6   ? -1.711  8.909   -43.392 1.00 47.66  ? 34   DA  D C2    1 
ATOM   6284 N  N3    . DA  D 3 6   ? -1.470  10.214  -43.227 1.00 48.11  ? 34   DA  D N3    1 
ATOM   6285 C  C4    . DA  D 3 6   ? -0.152  10.495  -43.280 1.00 48.94  ? 34   DA  D C4    1 
ATOM   6286 P  P     . DC  D 3 7   ? -1.557  16.275  -40.056 1.00 53.66  ? 35   DC  D P     1 
ATOM   6287 O  OP1   . DC  D 3 7   ? -2.290  17.540  -40.371 1.00 52.75  ? 35   DC  D OP1   1 
ATOM   6288 O  OP2   . DC  D 3 7   ? -0.214  16.299  -39.421 1.00 53.47  ? 35   DC  D OP2   1 
ATOM   6289 O  "O5'" . DC  D 3 7   ? -2.443  15.372  -39.080 1.00 52.89  ? 35   DC  D "O5'" 1 
ATOM   6290 C  "C5'" . DC  D 3 7   ? -1.982  14.115  -38.622 1.00 50.94  ? 35   DC  D "C5'" 1 
ATOM   6291 C  "C4'" . DC  D 3 7   ? -3.109  13.129  -38.838 1.00 49.96  ? 35   DC  D "C4'" 1 
ATOM   6292 O  "O4'" . DC  D 3 7   ? -2.858  12.353  -40.035 1.00 49.70  ? 35   DC  D "O4'" 1 
ATOM   6293 C  "C3'" . DC  D 3 7   ? -3.269  12.140  -37.700 1.00 49.11  ? 35   DC  D "C3'" 1 
ATOM   6294 O  "O3'" . DC  D 3 7   ? -4.421  12.467  -36.951 1.00 47.46  ? 35   DC  D "O3'" 1 
ATOM   6295 C  "C2'" . DC  D 3 7   ? -3.467  10.794  -38.382 1.00 49.26  ? 35   DC  D "C2'" 1 
ATOM   6296 C  "C1'" . DC  D 3 7   ? -2.753  10.973  -39.707 1.00 49.24  ? 35   DC  D "C1'" 1 
ATOM   6297 N  N1    . DC  D 3 7   ? -1.314  10.448  -39.744 1.00 48.20  ? 35   DC  D N1    1 
ATOM   6298 C  C2    . DC  D 3 7   ? -1.079  9.072   -39.927 1.00 46.98  ? 35   DC  D C2    1 
ATOM   6299 O  O2    . DC  D 3 7   ? -2.028  8.301   -40.035 1.00 46.50  ? 35   DC  D O2    1 
ATOM   6300 N  N3    . DC  D 3 7   ? 0.186   8.600   -39.982 1.00 46.71  ? 35   DC  D N3    1 
ATOM   6301 C  C4    . DC  D 3 7   ? 1.202   9.445   -39.867 1.00 47.40  ? 35   DC  D C4    1 
ATOM   6302 N  N4    . DC  D 3 7   ? 2.433   8.941   -39.930 1.00 48.01  ? 35   DC  D N4    1 
ATOM   6303 C  C5    . DC  D 3 7   ? 1.006   10.847  -39.685 1.00 48.09  ? 35   DC  D C5    1 
ATOM   6304 C  C6    . DC  D 3 7   ? -0.250  11.301  -39.628 1.00 48.12  ? 35   DC  D C6    1 
ATOM   6305 P  P     . DA  D 3 8   ? -4.519  11.875  -35.473 1.00 46.16  ? 36   DA  D P     1 
ATOM   6306 O  OP1   . DA  D 3 8   ? -5.802  12.330  -34.880 1.00 46.50  ? 36   DA  D OP1   1 
ATOM   6307 O  OP2   . DA  D 3 8   ? -3.224  12.185  -34.818 1.00 45.82  ? 36   DA  D OP2   1 
ATOM   6308 O  "O5'" . DA  D 3 8   ? -4.639  10.290  -35.688 1.00 43.55  ? 36   DA  D "O5'" 1 
ATOM   6309 C  "C5'" . DA  D 3 8   ? -5.894  9.684   -35.992 1.00 39.86  ? 36   DA  D "C5'" 1 
ATOM   6310 C  "C4'" . DA  D 3 8   ? -5.689  8.197   -36.203 1.00 37.53  ? 36   DA  D "C4'" 1 
ATOM   6311 O  "O4'" . DA  D 3 8   ? -4.479  7.960   -36.969 1.00 36.28  ? 36   DA  D "O4'" 1 
ATOM   6312 C  "C3'" . DA  D 3 8   ? -5.512  7.394   -34.923 1.00 36.94  ? 36   DA  D "C3'" 1 
ATOM   6313 O  "O3'" . DA  D 3 8   ? -6.000  6.063   -35.083 1.00 36.53  ? 36   DA  D "O3'" 1 
ATOM   6314 C  "C2'" . DA  D 3 8   ? -4.001  7.376   -34.809 1.00 36.54  ? 36   DA  D "C2'" 1 
ATOM   6315 C  "C1'" . DA  D 3 8   ? -3.626  7.099   -36.250 1.00 35.49  ? 36   DA  D "C1'" 1 
ATOM   6316 N  N9    . DA  D 3 8   ? -2.229  7.429   -36.509 1.00 34.82  ? 36   DA  D N9    1 
ATOM   6317 C  C8    . DA  D 3 8   ? -1.648  8.669   -36.420 1.00 34.67  ? 36   DA  D C8    1 
ATOM   6318 N  N7    . DA  D 3 8   ? -0.365  8.689   -36.700 1.00 33.90  ? 36   DA  D N7    1 
ATOM   6319 C  C5    . DA  D 3 8   ? -0.089  7.366   -36.981 1.00 33.07  ? 36   DA  D C5    1 
ATOM   6320 C  C6    . DA  D 3 8   ? 1.102   6.741   -37.351 1.00 32.33  ? 36   DA  D C6    1 
ATOM   6321 N  N6    . DA  D 3 8   ? 2.240   7.418   -37.482 1.00 31.95  ? 36   DA  D N6    1 
ATOM   6322 N  N1    . DA  D 3 8   ? 1.064   5.412   -37.572 1.00 32.41  ? 36   DA  D N1    1 
ATOM   6323 C  C2    . DA  D 3 8   ? -0.102  4.761   -37.424 1.00 32.69  ? 36   DA  D C2    1 
ATOM   6324 N  N3    . DA  D 3 8   ? -1.296  5.239   -37.073 1.00 32.88  ? 36   DA  D N3    1 
ATOM   6325 C  C4    . DA  D 3 8   ? -1.217  6.567   -36.867 1.00 33.64  ? 36   DA  D C4    1 
ATOM   6326 P  P     . DT  D 3 9   ? -5.885  4.962   -33.926 1.00 36.09  ? 37   DT  D P     1 
ATOM   6327 O  OP1   . DT  D 3 9   ? -7.122  4.159   -34.040 1.00 35.99  ? 37   DT  D OP1   1 
ATOM   6328 O  OP2   . DT  D 3 9   ? -5.492  5.593   -32.638 1.00 35.47  ? 37   DT  D OP2   1 
ATOM   6329 O  "O5'" . DT  D 3 9   ? -4.640  4.075   -34.390 1.00 35.46  ? 37   DT  D "O5'" 1 
ATOM   6330 C  "C5'" . DT  D 3 9   ? -4.826  3.051   -35.358 1.00 34.24  ? 37   DT  D "C5'" 1 
ATOM   6331 C  "C4'" . DT  D 3 9   ? -3.998  1.820   -35.029 1.00 32.46  ? 37   DT  D "C4'" 1 
ATOM   6332 O  "O4'" . DT  D 3 9   ? -2.617  2.078   -35.370 1.00 31.46  ? 37   DT  D "O4'" 1 
ATOM   6333 C  "C3'" . DT  D 3 9   ? -4.037  1.374   -33.575 1.00 31.93  ? 37   DT  D "C3'" 1 
ATOM   6334 O  "O3'" . DT  D 3 9   ? -4.398  -0.014  -33.538 1.00 33.14  ? 37   DT  D "O3'" 1 
ATOM   6335 C  "C2'" . DT  D 3 9   ? -2.649  1.704   -33.030 1.00 30.93  ? 37   DT  D "C2'" 1 
ATOM   6336 C  "C1'" . DT  D 3 9   ? -1.771  1.856   -34.263 1.00 29.71  ? 37   DT  D "C1'" 1 
ATOM   6337 N  N1    . DT  D 3 9   ? -0.865  3.024   -34.216 1.00 28.01  ? 37   DT  D N1    1 
ATOM   6338 C  C2    . DT  D 3 9   ? 0.454   2.911   -34.624 1.00 27.67  ? 37   DT  D C2    1 
ATOM   6339 O  O2    . DT  D 3 9   ? 0.971   1.881   -35.028 1.00 27.72  ? 37   DT  D O2    1 
ATOM   6340 N  N3    . DT  D 3 9   ? 1.174   4.079   -34.539 1.00 27.15  ? 37   DT  D N3    1 
ATOM   6341 C  C4    . DT  D 3 9   ? 0.717   5.310   -34.106 1.00 26.00  ? 37   DT  D C4    1 
ATOM   6342 O  O4    . DT  D 3 9   ? 1.428   6.304   -34.062 1.00 24.69  ? 37   DT  D O4    1 
ATOM   6343 C  C5    . DT  D 3 9   ? -0.659  5.341   -33.710 1.00 26.20  ? 37   DT  D C5    1 
ATOM   6344 C  C7    . DT  D 3 9   ? -1.256  6.609   -33.217 1.00 27.03  ? 37   DT  D C7    1 
ATOM   6345 C  C6    . DT  D 3 9   ? -1.380  4.226   -33.786 1.00 27.02  ? 37   DT  D C6    1 
ATOM   6346 P  P     . DT  D 3 10  ? -3.452  -1.227  -33.086 1.00 34.54  ? 38   DT  D P     1 
ATOM   6347 O  OP1   . DT  D 3 10  ? -4.308  -2.428  -32.968 1.00 33.85  ? 38   DT  D OP1   1 
ATOM   6348 O  OP2   . DT  D 3 10  ? -2.581  -0.808  -31.957 1.00 34.53  ? 38   DT  D OP2   1 
ATOM   6349 O  "O5'" . DT  D 3 10  ? -2.509  -1.418  -34.365 1.00 36.22  ? 38   DT  D "O5'" 1 
ATOM   6350 C  "C5'" . DT  D 3 10  ? -1.716  -2.609  -34.556 1.00 36.79  ? 38   DT  D "C5'" 1 
ATOM   6351 C  "C4'" . DT  D 3 10  ? -0.314  -2.512  -33.952 1.00 36.50  ? 38   DT  D "C4'" 1 
ATOM   6352 O  "O4'" . DT  D 3 10  ? 0.109   -1.135  -33.776 1.00 34.82  ? 38   DT  D "O4'" 1 
ATOM   6353 C  "C3'" . DT  D 3 10  ? -0.168  -3.161  -32.571 1.00 36.66  ? 38   DT  D "C3'" 1 
ATOM   6354 O  "O3'" . DT  D 3 10  ? 0.433   -4.494  -32.693 1.00 37.46  ? 38   DT  D "O3'" 1 
ATOM   6355 C  "C2'" . DT  D 3 10  ? 0.574   -2.109  -31.738 1.00 35.84  ? 38   DT  D "C2'" 1 
ATOM   6356 C  "C1'" . DT  D 3 10  ? 1.136   -1.206  -32.828 1.00 34.75  ? 38   DT  D "C1'" 1 
ATOM   6357 N  N1    . DT  D 3 10  ? 1.515   0.175   -32.429 1.00 34.73  ? 38   DT  D N1    1 
ATOM   6358 C  C2    . DT  D 3 10  ? 2.788   0.635   -32.758 1.00 34.19  ? 38   DT  D C2    1 
ATOM   6359 O  O2    . DT  D 3 10  ? 3.627   -0.020  -33.356 1.00 33.96  ? 38   DT  D O2    1 
ATOM   6360 N  N3    . DT  D 3 10  ? 3.056   1.920   -32.360 1.00 33.41  ? 38   DT  D N3    1 
ATOM   6361 C  C4    . DT  D 3 10  ? 2.195   2.757   -31.680 1.00 33.57  ? 38   DT  D C4    1 
ATOM   6362 O  O4    . DT  D 3 10  ? 2.503   3.889   -31.365 1.00 33.09  ? 38   DT  D O4    1 
ATOM   6363 C  C5    . DT  D 3 10  ? 0.898   2.230   -31.359 1.00 34.42  ? 38   DT  D C5    1 
ATOM   6364 C  C7    . DT  D 3 10  ? -0.060  3.115   -30.617 1.00 35.19  ? 38   DT  D C7    1 
ATOM   6365 C  C6    . DT  D 3 10  ? 0.607   0.974   -31.743 1.00 34.76  ? 38   DT  D C6    1 
ATOM   6366 P  P     . DT  D 3 11  ? 1.974   -4.895  -32.481 1.00 38.24  ? 39   DT  D P     1 
ATOM   6367 O  OP1   . DT  D 3 11  ? 2.171   -6.270  -33.006 1.00 37.46  ? 39   DT  D OP1   1 
ATOM   6368 O  OP2   . DT  D 3 11  ? 2.287   -4.591  -31.068 1.00 38.28  ? 39   DT  D OP2   1 
ATOM   6369 O  "O5'" . DT  D 3 11  ? 2.807   -3.879  -33.401 1.00 39.81  ? 39   DT  D "O5'" 1 
ATOM   6370 C  "C5'" . DT  D 3 11  ? 4.113   -4.214  -33.897 1.00 42.01  ? 39   DT  D "C5'" 1 
ATOM   6371 C  "C4'" . DT  D 3 11  ? 5.322   -3.895  -33.002 1.00 43.05  ? 39   DT  D "C4'" 1 
ATOM   6372 O  "O4'" . DT  D 3 11  ? 5.314   -2.522  -32.544 1.00 42.81  ? 39   DT  D "O4'" 1 
ATOM   6373 C  "C3'" . DT  D 3 11  ? 5.611   -4.758  -31.768 1.00 43.93  ? 39   DT  D "C3'" 1 
ATOM   6374 O  "O3'" . DT  D 3 11  ? 6.946   -5.250  -31.974 1.00 47.37  ? 39   DT  D "O3'" 1 
ATOM   6375 C  "C2'" . DT  D 3 11  ? 5.486   -3.793  -30.592 1.00 42.42  ? 39   DT  D "C2'" 1 
ATOM   6376 C  "C1'" . DT  D 3 11  ? 5.856   -2.472  -31.246 1.00 41.82  ? 39   DT  D "C1'" 1 
ATOM   6377 N  N1    . DT  D 3 11  ? 5.335   -1.231  -30.573 1.00 41.22  ? 39   DT  D N1    1 
ATOM   6378 C  C2    . DT  D 3 11  ? 6.169   -0.133  -30.549 1.00 41.08  ? 39   DT  D C2    1 
ATOM   6379 O  O2    . DT  D 3 11  ? 7.290   -0.128  -31.039 1.00 42.15  ? 39   DT  D O2    1 
ATOM   6380 N  N3    . DT  D 3 11  ? 5.650   0.971   -29.923 1.00 40.11  ? 39   DT  D N3    1 
ATOM   6381 C  C4    . DT  D 3 11  ? 4.410   1.088   -29.339 1.00 39.70  ? 39   DT  D C4    1 
ATOM   6382 O  O4    . DT  D 3 11  ? 4.044   2.119   -28.797 1.00 39.66  ? 39   DT  D O4    1 
ATOM   6383 C  C5    . DT  D 3 11  ? 3.579   -0.080  -29.400 1.00 39.94  ? 39   DT  D C5    1 
ATOM   6384 C  C7    . DT  D 3 11  ? 2.211   -0.022  -28.783 1.00 40.45  ? 39   DT  D C7    1 
ATOM   6385 C  C6    . DT  D 3 11  ? 4.069   -1.176  -30.006 1.00 40.34  ? 39   DT  D C6    1 
ATOM   6386 P  P     . DC  D 3 12  ? 7.958   -5.831  -30.871 1.00 49.21  ? 40   DC  D P     1 
ATOM   6387 O  OP1   . DC  D 3 12  ? 9.006   -6.631  -31.559 1.00 48.07  ? 40   DC  D OP1   1 
ATOM   6388 O  OP2   . DC  D 3 12  ? 7.155   -6.470  -29.805 1.00 49.45  ? 40   DC  D OP2   1 
ATOM   6389 O  "O5'" . DC  D 3 12  ? 8.617   -4.470  -30.337 1.00 50.60  ? 40   DC  D "O5'" 1 
ATOM   6390 C  "C5'" . DC  D 3 12  ? 10.006  -4.190  -30.531 1.00 52.62  ? 40   DC  D "C5'" 1 
ATOM   6391 C  "C4'" . DC  D 3 12  ? 10.608  -3.675  -29.235 1.00 53.94  ? 40   DC  D "C4'" 1 
ATOM   6392 O  "O4'" . DC  D 3 12  ? 9.825   -2.557  -28.747 1.00 53.35  ? 40   DC  D "O4'" 1 
ATOM   6393 C  "C3'" . DC  D 3 12  ? 10.618  -4.671  -28.082 1.00 55.40  ? 40   DC  D "C3'" 1 
ATOM   6394 O  "O3'" . DC  D 3 12  ? 11.649  -4.306  -27.188 1.00 58.26  ? 40   DC  D "O3'" 1 
ATOM   6395 C  "C2'" . DC  D 3 12  ? 9.285   -4.382  -27.412 1.00 54.60  ? 40   DC  D "C2'" 1 
ATOM   6396 C  "C1'" . DC  D 3 12  ? 9.397   -2.861  -27.436 1.00 53.74  ? 40   DC  D "C1'" 1 
ATOM   6397 N  N1    . DC  D 3 12  ? 8.163   -2.092  -27.141 1.00 53.62  ? 40   DC  D N1    1 
ATOM   6398 C  C2    . DC  D 3 12  ? 8.211   -0.694  -27.247 1.00 53.48  ? 40   DC  D C2    1 
ATOM   6399 O  O2    . DC  D 3 12  ? 9.269   -0.146  -27.590 1.00 53.63  ? 40   DC  D O2    1 
ATOM   6400 N  N3    . DC  D 3 12  ? 7.088   0.021   -26.973 1.00 53.36  ? 40   DC  D N3    1 
ATOM   6401 C  C4    . DC  D 3 12  ? 5.970   -0.615  -26.608 1.00 53.79  ? 40   DC  D C4    1 
ATOM   6402 N  N4    . DC  D 3 12  ? 4.892   0.130   -26.353 1.00 53.99  ? 40   DC  D N4    1 
ATOM   6403 C  C5    . DC  D 3 12  ? 5.902   -2.041  -26.486 1.00 53.79  ? 40   DC  D C5    1 
ATOM   6404 C  C6    . DC  D 3 12  ? 7.014   -2.733  -26.756 1.00 53.73  ? 40   DC  D C6    1 
ATOM   6405 P  P     . DA  D 3 13  ? 13.138  -4.880  -27.256 1.00 60.00  ? 41   DA  D P     1 
ATOM   6406 O  OP1   . DA  D 3 13  ? 13.110  -6.085  -28.132 1.00 60.03  ? 41   DA  D OP1   1 
ATOM   6407 O  OP2   . DA  D 3 13  ? 13.568  -5.033  -25.832 1.00 59.44  ? 41   DA  D OP2   1 
ATOM   6408 O  "O5'" . DA  D 3 13  ? 13.934  -3.665  -27.969 1.00 57.76  ? 41   DA  D "O5'" 1 
ATOM   6409 C  "C5'" . DA  D 3 13  ? 15.227  -3.241  -27.502 1.00 56.62  ? 41   DA  D "C5'" 1 
ATOM   6410 C  "C4'" . DA  D 3 13  ? 15.198  -2.199  -26.383 1.00 55.50  ? 41   DA  D "C4'" 1 
ATOM   6411 O  "O4'" . DA  D 3 13  ? 13.840  -1.836  -26.061 1.00 54.67  ? 41   DA  D "O4'" 1 
ATOM   6412 C  "C3'" . DA  D 3 13  ? 15.866  -2.554  -25.046 1.00 55.06  ? 41   DA  D "C3'" 1 
ATOM   6413 O  "O3'" . DA  D 3 13  ? 16.940  -1.602  -24.808 1.00 55.43  ? 41   DA  D "O3'" 1 
ATOM   6414 C  "C2'" . DA  D 3 13  ? 14.721  -2.511  -24.034 1.00 54.25  ? 41   DA  D "C2'" 1 
ATOM   6415 C  "C1'" . DA  D 3 13  ? 13.770  -1.525  -24.694 1.00 54.30  ? 41   DA  D "C1'" 1 
ATOM   6416 N  N9    . DA  D 3 13  ? 12.359  -1.664  -24.355 1.00 54.65  ? 41   DA  D N9    1 
ATOM   6417 C  C8    . DA  D 3 13  ? 11.657  -2.828  -24.177 1.00 55.21  ? 41   DA  D C8    1 
ATOM   6418 N  N7    . DA  D 3 13  ? 10.384  -2.667  -23.889 1.00 54.71  ? 41   DA  D N7    1 
ATOM   6419 C  C5    . DA  D 3 13  ? 10.240  -1.296  -23.898 1.00 54.19  ? 41   DA  D C5    1 
ATOM   6420 C  C6    . DA  D 3 13  ? 9.117   -0.489  -23.676 1.00 53.89  ? 41   DA  D C6    1 
ATOM   6421 N  N6    . DA  D 3 13  ? 7.917   -1.008  -23.398 1.00 53.59  ? 41   DA  D N6    1 
ATOM   6422 N  N1    . DA  D 3 13  ? 9.286   0.852   -23.759 1.00 54.18  ? 41   DA  D N1    1 
ATOM   6423 C  C2    . DA  D 3 13  ? 10.508  1.336   -24.044 1.00 54.48  ? 41   DA  D C2    1 
ATOM   6424 N  N3    . DA  D 3 13  ? 11.647  0.672   -24.279 1.00 54.46  ? 41   DA  D N3    1 
ATOM   6425 C  C4    . DA  D 3 13  ? 11.438  -0.655  -24.189 1.00 54.47  ? 41   DA  D C4    1 
ATOM   6426 P  P     . DT  D 3 14  ? 17.385  -0.932  -23.406 1.00 55.47  ? 42   DT  D P     1 
ATOM   6427 O  OP1   . DT  D 3 14  ? 18.658  -0.197  -23.652 1.00 54.51  ? 42   DT  D OP1   1 
ATOM   6428 O  OP2   . DT  D 3 14  ? 17.253  -1.935  -22.320 1.00 53.80  ? 42   DT  D OP2   1 
ATOM   6429 O  "O5'" . DT  D 3 14  ? 16.253  0.177   -23.170 1.00 54.68  ? 42   DT  D "O5'" 1 
ATOM   6430 C  "C5'" . DT  D 3 14  ? 16.573  1.549   -22.889 1.00 50.90  ? 42   DT  D "C5'" 1 
ATOM   6431 C  "C4'" . DT  D 3 14  ? 15.556  2.108   -21.918 1.00 47.66  ? 42   DT  D "C4'" 1 
ATOM   6432 O  "O4'" . DT  D 3 14  ? 14.289  1.459   -22.134 1.00 45.32  ? 42   DT  D "O4'" 1 
ATOM   6433 C  "C3'" . DT  D 3 14  ? 15.845  1.754   -20.477 1.00 48.11  ? 42   DT  D "C3'" 1 
ATOM   6434 O  "O3'" . DT  D 3 14  ? 16.886  2.571   -19.902 1.00 50.19  ? 42   DT  D "O3'" 1 
ATOM   6435 C  "C2'" . DT  D 3 14  ? 14.478  1.879   -19.820 1.00 46.63  ? 42   DT  D "C2'" 1 
ATOM   6436 C  "C1'" . DT  D 3 14  ? 13.513  1.648   -20.976 1.00 44.90  ? 42   DT  D "C1'" 1 
ATOM   6437 N  N1    . DT  D 3 14  ? 12.513  0.522   -20.808 1.00 44.17  ? 42   DT  D N1    1 
ATOM   6438 C  C2    . DT  D 3 14  ? 11.233  0.837   -20.383 1.00 44.00  ? 42   DT  D C2    1 
ATOM   6439 O  O2    . DT  D 3 14  ? 10.867  1.964   -20.123 1.00 44.83  ? 42   DT  D O2    1 
ATOM   6440 N  N3    . DT  D 3 14  ? 10.363  -0.208  -20.255 1.00 43.46  ? 42   DT  D N3    1 
ATOM   6441 C  C4    . DT  D 3 14  ? 10.633  -1.531  -20.508 1.00 43.87  ? 42   DT  D C4    1 
ATOM   6442 O  O4    . DT  D 3 14  ? 9.779   -2.394  -20.356 1.00 44.40  ? 42   DT  D O4    1 
ATOM   6443 C  C5    . DT  D 3 14  ? 11.976  -1.819  -20.945 1.00 44.04  ? 42   DT  D C5    1 
ATOM   6444 C  C7    . DT  D 3 14  ? 12.364  -3.243  -21.227 1.00 44.05  ? 42   DT  D C7    1 
ATOM   6445 C  C6    . DT  D 3 14  ? 12.844  -0.794  -21.076 1.00 44.23  ? 42   DT  D C6    1 
ATOM   6446 P  P     . DA  D 3 15  ? 16.862  4.157   -19.611 1.00 52.02  ? 43   DA  D P     1 
ATOM   6447 O  OP1   . DA  D 3 15  ? 16.230  4.961   -20.686 1.00 51.19  ? 43   DA  D OP1   1 
ATOM   6448 O  OP2   . DA  D 3 15  ? 18.257  4.484   -19.254 1.00 53.14  ? 43   DA  D OP2   1 
ATOM   6449 O  "O5'" . DA  D 3 15  ? 16.006  4.270   -18.270 1.00 49.76  ? 43   DA  D "O5'" 1 
ATOM   6450 C  "C5'" . DA  D 3 15  ? 15.343  5.488   -18.026 1.00 46.94  ? 43   DA  D "C5'" 1 
ATOM   6451 C  "C4'" . DA  D 3 15  ? 14.259  5.200   -17.026 1.00 45.20  ? 43   DA  D "C4'" 1 
ATOM   6452 O  "O4'" . DA  D 3 15  ? 13.572  3.991   -17.387 1.00 44.05  ? 43   DA  D "O4'" 1 
ATOM   6453 C  "C3'" . DA  D 3 15  ? 14.802  4.887   -15.654 1.00 44.73  ? 43   DA  D "C3'" 1 
ATOM   6454 O  "O3'" . DA  D 3 15  ? 14.719  6.079   -14.890 1.00 44.25  ? 43   DA  D "O3'" 1 
ATOM   6455 C  "C2'" . DA  D 3 15  ? 13.893  3.767   -15.134 1.00 44.10  ? 43   DA  D "C2'" 1 
ATOM   6456 C  "C1'" . DA  D 3 15  ? 12.894  3.541   -16.244 1.00 43.36  ? 43   DA  D "C1'" 1 
ATOM   6457 N  N9    . DA  D 3 15  ? 12.629  2.149   -16.519 1.00 43.00  ? 43   DA  D N9    1 
ATOM   6458 C  C8    . DA  D 3 15  ? 13.566  1.240   -16.907 1.00 43.96  ? 43   DA  D C8    1 
ATOM   6459 N  N7    . DA  D 3 15  ? 13.095  0.037   -17.129 1.00 44.47  ? 43   DA  D N7    1 
ATOM   6460 C  C5    . DA  D 3 15  ? 11.747  0.175   -16.873 1.00 43.64  ? 43   DA  D C5    1 
ATOM   6461 C  C6    . DA  D 3 15  ? 10.699  -0.757  -16.933 1.00 43.90  ? 43   DA  D C6    1 
ATOM   6462 N  N6    . DA  D 3 15  ? 10.902  -2.035  -17.276 1.00 44.66  ? 43   DA  D N6    1 
ATOM   6463 N  N1    . DA  D 3 15  ? 9.458   -0.325  -16.625 1.00 43.44  ? 43   DA  D N1    1 
ATOM   6464 C  C2    . DA  D 3 15  ? 9.309   0.960   -16.280 1.00 43.35  ? 43   DA  D C2    1 
ATOM   6465 N  N3    . DA  D 3 15  ? 10.228  1.928   -16.185 1.00 43.09  ? 43   DA  D N3    1 
ATOM   6466 C  C4    . DA  D 3 15  ? 11.439  1.468   -16.501 1.00 42.91  ? 43   DA  D C4    1 
ATOM   6467 P  P     . DC  D 3 16  ? 15.035  6.099   -13.324 1.00 43.42  ? 44   DC  D P     1 
ATOM   6468 O  OP1   . DC  D 3 16  ? 14.575  7.427   -12.862 1.00 43.37  ? 44   DC  D OP1   1 
ATOM   6469 O  OP2   . DC  D 3 16  ? 16.421  5.629   -13.092 1.00 43.16  ? 44   DC  D OP2   1 
ATOM   6470 O  "O5'" . DC  D 3 16  ? 14.102  4.962   -12.716 1.00 41.32  ? 44   DC  D "O5'" 1 
ATOM   6471 C  "C5'" . DC  D 3 16  ? 13.183  5.327   -11.763 1.00 39.78  ? 44   DC  D "C5'" 1 
ATOM   6472 C  "C4'" . DC  D 3 16  ? 11.886  4.615   -12.008 1.00 39.69  ? 44   DC  D "C4'" 1 
ATOM   6473 O  "O4'" . DC  D 3 16  ? 12.013  3.562   -12.968 1.00 39.56  ? 44   DC  D "O4'" 1 
ATOM   6474 C  "C3'" . DC  D 3 16  ? 11.420  3.843   -10.810 1.00 39.89  ? 44   DC  D "C3'" 1 
ATOM   6475 O  "O3'" . DC  D 3 16  ? 10.949  4.791   -9.919  1.00 41.76  ? 44   DC  D "O3'" 1 
ATOM   6476 C  "C2'" . DC  D 3 16  ? 10.301  3.020   -11.415 1.00 39.47  ? 44   DC  D "C2'" 1 
ATOM   6477 C  "C1'" . DC  D 3 16  ? 10.821  2.810   -12.834 1.00 40.13  ? 44   DC  D "C1'" 1 
ATOM   6478 N  N1    . DC  D 3 16  ? 11.115  1.393   -13.169 1.00 40.20  ? 44   DC  D N1    1 
ATOM   6479 C  C2    . DC  D 3 16  ? 10.100  0.413   -13.196 1.00 40.55  ? 44   DC  D C2    1 
ATOM   6480 O  O2    . DC  D 3 16  ? 8.919   0.694   -12.935 1.00 40.79  ? 44   DC  D O2    1 
ATOM   6481 N  N3    . DC  D 3 16  ? 10.444  -0.855  -13.514 1.00 40.43  ? 44   DC  D N3    1 
ATOM   6482 C  C4    . DC  D 3 16  ? 11.711  -1.144  -13.794 1.00 40.08  ? 44   DC  D C4    1 
ATOM   6483 N  N4    . DC  D 3 16  ? 12.009  -2.398  -14.112 1.00 41.10  ? 44   DC  D N4    1 
ATOM   6484 C  C5    . DC  D 3 16  ? 12.743  -0.171  -13.771 1.00 39.94  ? 44   DC  D C5    1 
ATOM   6485 C  C6    . DC  D 3 16  ? 12.403  1.074   -13.460 1.00 39.66  ? 44   DC  D C6    1 
ATOM   6486 P  P     . DT  D 3 17  ? 10.538  4.302   -8.476  1.00 43.46  ? 45   DT  D P     1 
ATOM   6487 O  OP1   . DT  D 3 17  ? 10.469  5.508   -7.599  1.00 43.08  ? 45   DT  D OP1   1 
ATOM   6488 O  OP2   . DT  D 3 17  ? 11.393  3.120   -8.196  1.00 43.27  ? 45   DT  D OP2   1 
ATOM   6489 O  "O5'" . DT  D 3 17  ? 9.060   3.764   -8.722  1.00 43.67  ? 45   DT  D "O5'" 1 
ATOM   6490 C  "C5'" . DT  D 3 17  ? 8.281   3.244   -7.683  1.00 44.71  ? 45   DT  D "C5'" 1 
ATOM   6491 C  "C4'" . DT  D 3 17  ? 7.312   2.287   -8.333  1.00 46.29  ? 45   DT  D "C4'" 1 
ATOM   6492 O  "O4'" . DT  D 3 17  ? 7.925   1.714   -9.505  1.00 45.91  ? 45   DT  D "O4'" 1 
ATOM   6493 C  "C3'" . DT  D 3 17  ? 6.952   1.100   -7.476  1.00 47.83  ? 45   DT  D "C3'" 1 
ATOM   6494 O  "O3'" . DT  D 3 17  ? 5.888   1.494   -6.669  1.00 50.94  ? 45   DT  D "O3'" 1 
ATOM   6495 C  "C2'" . DT  D 3 17  ? 6.554   0.042   -8.485  1.00 46.61  ? 45   DT  D "C2'" 1 
ATOM   6496 C  "C1'" . DT  D 3 17  ? 7.532   0.359   -9.616  1.00 45.65  ? 45   DT  D "C1'" 1 
ATOM   6497 N  N1    . DT  D 3 17  ? 8.771   -0.502  -9.775  1.00 44.55  ? 45   DT  D N1    1 
ATOM   6498 C  C2    . DT  D 3 17  ? 8.670   -1.874  -9.946  1.00 44.48  ? 45   DT  D C2    1 
ATOM   6499 O  O2    . DT  D 3 17  ? 7.621   -2.494  -9.940  1.00 45.36  ? 45   DT  D O2    1 
ATOM   6500 N  N3    . DT  D 3 17  ? 9.859   -2.534  -10.116 1.00 43.81  ? 45   DT  D N3    1 
ATOM   6501 C  C4    . DT  D 3 17  ? 11.122  -1.986  -10.147 1.00 43.81  ? 45   DT  D C4    1 
ATOM   6502 O  O4    . DT  D 3 17  ? 12.111  -2.696  -10.309 1.00 42.54  ? 45   DT  D O4    1 
ATOM   6503 C  C5    . DT  D 3 17  ? 11.167  -0.546  -9.972  1.00 44.35  ? 45   DT  D C5    1 
ATOM   6504 C  C7    . DT  D 3 17  ? 12.467  0.205   -9.976  1.00 44.28  ? 45   DT  D C7    1 
ATOM   6505 C  C6    . DT  D 3 17  ? 10.007  0.110   -9.803  1.00 44.34  ? 45   DT  D C6    1 
ATOM   6506 P  P     . DT  D 3 18  ? 6.157   1.466   -5.103  1.00 53.85  ? 46   DT  D P     1 
ATOM   6507 O  OP1   . DT  D 3 18  ? 5.175   2.364   -4.451  1.00 53.42  ? 46   DT  D OP1   1 
ATOM   6508 O  OP2   . DT  D 3 18  ? 7.601   1.688   -4.838  1.00 54.79  ? 46   DT  D OP2   1 
ATOM   6509 O  "O5'" . DT  D 3 18  ? 5.844   -0.076  -4.814  1.00 54.07  ? 46   DT  D "O5'" 1 
ATOM   6510 C  "C5'" . DT  D 3 18  ? 4.511   -0.515  -4.975  1.00 55.77  ? 46   DT  D "C5'" 1 
ATOM   6511 C  "C4'" . DT  D 3 18  ? 4.464   -1.975  -5.360  1.00 57.26  ? 46   DT  D "C4'" 1 
ATOM   6512 O  "O4'" . DT  D 3 18  ? 5.550   -2.318  -6.246  1.00 58.07  ? 46   DT  D "O4'" 1 
ATOM   6513 C  "C3'" . DT  D 3 18  ? 4.606   -2.928  -4.191  1.00 57.71  ? 46   DT  D "C3'" 1 
ATOM   6514 O  "O3'" . DT  D 3 18  ? 3.802   -4.016  -4.422  1.00 58.00  ? 46   DT  D "O3'" 1 
ATOM   6515 C  "C2'" . DT  D 3 18  ? 6.034   -3.419  -4.266  1.00 58.67  ? 46   DT  D "C2'" 1 
ATOM   6516 C  "C1'" . DT  D 3 18  ? 6.133   -3.514  -5.768  1.00 58.86  ? 46   DT  D "C1'" 1 
ATOM   6517 N  N1    . DT  D 3 18  ? 7.517   -3.548  -6.233  1.00 59.69  ? 46   DT  D N1    1 
ATOM   6518 C  C2    . DT  D 3 18  ? 8.018   -4.723  -6.747  1.00 59.83  ? 46   DT  D C2    1 
ATOM   6519 O  O2    . DT  D 3 18  ? 7.378   -5.753  -6.820  1.00 60.58  ? 46   DT  D O2    1 
ATOM   6520 N  N3    . DT  D 3 18  ? 9.312   -4.644  -7.167  1.00 59.97  ? 46   DT  D N3    1 
ATOM   6521 C  C4    . DT  D 3 18  ? 10.112  -3.522  -7.114  1.00 60.54  ? 46   DT  D C4    1 
ATOM   6522 O  O4    . DT  D 3 18  ? 11.263  -3.529  -7.512  1.00 61.77  ? 46   DT  D O4    1 
ATOM   6523 C  C5    . DT  D 3 18  ? 9.522   -2.333  -6.569  1.00 60.53  ? 46   DT  D C5    1 
ATOM   6524 C  C7    . DT  D 3 18  ? 10.319  -1.072  -6.480  1.00 61.36  ? 46   DT  D C7    1 
ATOM   6525 C  C6    . DT  D 3 18  ? 8.261   -2.391  -6.152  1.00 60.02  ? 46   DT  D C6    1 
ATOM   6526 P  P     . DG  D 3 19  ? 3.030   -4.556  -3.151  1.00 59.22  ? 47   DG  D P     1 
ATOM   6527 O  OP1   . DG  D 3 19  ? 1.589   -4.453  -3.490  1.00 59.64  ? 47   DG  D OP1   1 
ATOM   6528 O  OP2   . DG  D 3 19  ? 3.562   -3.884  -1.942  1.00 58.34  ? 47   DG  D OP2   1 
ATOM   6529 O  "O5'" . DG  D 3 19  ? 3.451   -6.101  -3.148  1.00 59.51  ? 47   DG  D "O5'" 1 
ATOM   6530 C  "C5'" . DG  D 3 19  ? 3.505   -6.772  -4.413  1.00 59.34  ? 47   DG  D "C5'" 1 
ATOM   6531 C  "C4'" . DG  D 3 19  ? 4.475   -7.942  -4.397  1.00 58.59  ? 47   DG  D "C4'" 1 
ATOM   6532 O  "O4'" . DG  D 3 19  ? 5.785   -7.535  -4.880  1.00 57.10  ? 47   DG  D "O4'" 1 
ATOM   6533 C  "C3'" . DG  D 3 19  ? 4.678   -8.647  -3.048  1.00 57.87  ? 47   DG  D "C3'" 1 
ATOM   6534 O  "O3'" . DG  D 3 19  ? 4.584   -10.065 -3.302  1.00 58.89  ? 47   DG  D "O3'" 1 
ATOM   6535 C  "C2'" . DG  D 3 19  ? 6.081   -8.200  -2.651  1.00 56.50  ? 47   DG  D "C2'" 1 
ATOM   6536 C  "C1'" . DG  D 3 19  ? 6.737   -8.144  -4.034  1.00 55.52  ? 47   DG  D "C1'" 1 
ATOM   6537 N  N9    . DG  D 3 19  ? 7.979   -7.384  -4.130  1.00 53.51  ? 47   DG  D N9    1 
ATOM   6538 C  C8    . DG  D 3 19  ? 8.235   -6.117  -3.663  1.00 53.13  ? 47   DG  D C8    1 
ATOM   6539 N  N7    . DG  D 3 19  ? 9.445   -5.701  -3.905  1.00 52.52  ? 47   DG  D N7    1 
ATOM   6540 C  C5    . DG  D 3 19  ? 10.030  -6.763  -4.580  1.00 51.78  ? 47   DG  D C5    1 
ATOM   6541 C  C6    . DG  D 3 19  ? 11.337  -6.895  -5.107  1.00 51.10  ? 47   DG  D C6    1 
ATOM   6542 O  O6    . DG  D 3 19  ? 12.277  -6.087  -5.069  1.00 49.56  ? 47   DG  D O6    1 
ATOM   6543 N  N1    . DG  D 3 19  ? 11.507  -8.136  -5.716  1.00 51.17  ? 47   DG  D N1    1 
ATOM   6544 C  C2    . DG  D 3 19  ? 10.546  -9.119  -5.804  1.00 50.91  ? 47   DG  D C2    1 
ATOM   6545 N  N2    . DG  D 3 19  ? 10.908  -10.244 -6.432  1.00 51.09  ? 47   DG  D N2    1 
ATOM   6546 N  N3    . DG  D 3 19  ? 9.320   -9.004  -5.321  1.00 50.80  ? 47   DG  D N3    1 
ATOM   6547 C  C4    . DG  D 3 19  ? 9.138   -7.805  -4.725  1.00 51.95  ? 47   DG  D C4    1 
ATOM   6548 P  P     . DT  D 3 20  ? 4.438   -11.206 -2.177  1.00 58.77  ? 48   DT  D P     1 
ATOM   6549 O  OP1   . DT  D 3 20  ? 3.652   -12.333 -2.723  1.00 58.00  ? 48   DT  D OP1   1 
ATOM   6550 O  OP2   . DT  D 3 20  ? 4.030   -10.564 -0.904  1.00 58.78  ? 48   DT  D OP2   1 
ATOM   6551 O  "O5'" . DT  D 3 20  ? 5.939   -11.741 -2.082  1.00 57.53  ? 48   DT  D "O5'" 1 
ATOM   6552 C  "C5'" . DT  D 3 20  ? 6.728   -11.964 -3.264  1.00 55.87  ? 48   DT  D "C5'" 1 
ATOM   6553 C  "C4'" . DT  D 3 20  ? 8.142   -12.362 -2.871  1.00 54.28  ? 48   DT  D "C4'" 1 
ATOM   6554 O  "O4'" . DT  D 3 20  ? 9.055   -11.268 -3.160  1.00 53.56  ? 48   DT  D "O4'" 1 
ATOM   6555 C  "C3'" . DT  D 3 20  ? 8.299   -12.689 -1.375  1.00 53.77  ? 48   DT  D "C3'" 1 
ATOM   6556 O  "O3'" . DT  D 3 20  ? 9.082   -13.876 -1.076  1.00 52.81  ? 48   DT  D "O3'" 1 
ATOM   6557 C  "C2'" . DT  D 3 20  ? 8.984   -11.433 -0.830  1.00 52.97  ? 48   DT  D "C2'" 1 
ATOM   6558 C  "C1'" . DT  D 3 20  ? 9.881   -11.115 -2.023  1.00 52.24  ? 48   DT  D "C1'" 1 
ATOM   6559 N  N1    . DT  D 3 20  ? 10.547  -9.784  -1.989  1.00 50.66  ? 48   DT  D N1    1 
ATOM   6560 C  C2    . DT  D 3 20  ? 11.771  -9.649  -2.621  1.00 50.26  ? 48   DT  D C2    1 
ATOM   6561 O  O2    . DT  D 3 20  ? 12.354  -10.543 -3.225  1.00 49.76  ? 48   DT  D O2    1 
ATOM   6562 N  N3    . DT  D 3 20  ? 12.308  -8.397  -2.517  1.00 49.58  ? 48   DT  D N3    1 
ATOM   6563 C  C4    . DT  D 3 20  ? 11.765  -7.319  -1.865  1.00 49.13  ? 48   DT  D C4    1 
ATOM   6564 O  O4    . DT  D 3 20  ? 12.332  -6.249  -1.846  1.00 50.32  ? 48   DT  D O4    1 
ATOM   6565 C  C5    . DT  D 3 20  ? 10.500  -7.521  -1.230  1.00 49.27  ? 48   DT  D C5    1 
ATOM   6566 C  C7    . DT  D 3 20  ? 9.847   -6.390  -0.498  1.00 49.74  ? 48   DT  D C7    1 
ATOM   6567 C  C6    . DT  D 3 20  ? 9.953   -8.735  -1.314  1.00 49.88  ? 48   DT  D C6    1 
ATOM   6568 P  P     . DA  D 3 21  ? 9.060   -15.262 -1.887  1.00 51.25  ? 49   DA  D P     1 
ATOM   6569 O  OP1   . DA  D 3 21  ? 8.606   -15.097 -3.294  1.00 49.49  ? 49   DA  D OP1   1 
ATOM   6570 O  OP2   . DA  D 3 21  ? 8.427   -16.238 -0.971  1.00 50.82  ? 49   DA  D OP2   1 
ATOM   6571 O  "O5'" . DA  D 3 21  ? 10.625  -15.578 -1.922  1.00 50.40  ? 49   DA  D "O5'" 1 
ATOM   6572 C  "C5'" . DA  D 3 21  ? 11.446  -14.891 -2.861  1.00 47.88  ? 49   DA  D "C5'" 1 
ATOM   6573 C  "C4'" . DA  D 3 21  ? 12.793  -15.568 -3.064  1.00 45.74  ? 49   DA  D "C4'" 1 
ATOM   6574 O  "O4'" . DA  D 3 21  ? 13.833  -14.585 -2.923  1.00 45.24  ? 49   DA  D "O4'" 1 
ATOM   6575 C  "C3'" . DA  D 3 21  ? 13.226  -16.622 -2.062  1.00 44.46  ? 49   DA  D "C3'" 1 
ATOM   6576 O  "O3'" . DA  D 3 21  ? 14.310  -17.341 -2.664  1.00 43.51  ? 49   DA  D "O3'" 1 
ATOM   6577 C  "C2'" . DA  D 3 21  ? 13.643  -15.763 -0.870  1.00 43.75  ? 49   DA  D "C2'" 1 
ATOM   6578 C  "C1'" . DA  D 3 21  ? 14.225  -14.522 -1.560  1.00 44.15  ? 49   DA  D "C1'" 1 
ATOM   6579 N  N9    . DA  D 3 21  ? 13.856  -13.209 -0.984  1.00 42.94  ? 49   DA  D N9    1 
ATOM   6580 C  C8    . DA  D 3 21  ? 12.673  -12.847 -0.394  1.00 42.79  ? 49   DA  D C8    1 
ATOM   6581 N  N7    . DA  D 3 21  ? 12.634  -11.610 0.048   1.00 41.87  ? 49   DA  D N7    1 
ATOM   6582 C  C5    . DA  D 3 21  ? 13.880  -11.111 -0.277  1.00 41.17  ? 49   DA  D C5    1 
ATOM   6583 C  C6    . DA  D 3 21  ? 14.470  -9.838  -0.083  1.00 40.93  ? 49   DA  D C6    1 
ATOM   6584 N  N6    . DA  D 3 21  ? 13.858  -8.801  0.501   1.00 40.18  ? 49   DA  D N6    1 
ATOM   6585 N  N1    . DA  D 3 21  ? 15.729  -9.671  -0.526  1.00 40.40  ? 49   DA  D N1    1 
ATOM   6586 C  C2    . DA  D 3 21  ? 16.338  -10.709 -1.119  1.00 40.45  ? 49   DA  D C2    1 
ATOM   6587 N  N3    . DA  D 3 21  ? 15.892  -11.939 -1.350  1.00 40.00  ? 49   DA  D N3    1 
ATOM   6588 C  C4    . DA  D 3 21  ? 14.643  -12.079 -0.905  1.00 41.01  ? 49   DA  D C4    1 
ATOM   6589 P  P     . DC  D 3 22  ? 15.162  -18.451 -1.873  1.00 42.08  ? 50   DC  D P     1 
ATOM   6590 O  OP1   . DC  D 3 22  ? 15.814  -19.365 -2.839  1.00 39.98  ? 50   DC  D OP1   1 
ATOM   6591 O  OP2   . DC  D 3 22  ? 14.368  -18.971 -0.730  1.00 40.93  ? 50   DC  D OP2   1 
ATOM   6592 O  "O5'" . DC  D 3 22  ? 16.247  -17.491 -1.219  1.00 42.19  ? 50   DC  D "O5'" 1 
ATOM   6593 C  "C5'" . DC  D 3 22  ? 17.260  -16.765 -1.905  1.00 40.36  ? 50   DC  D "C5'" 1 
ATOM   6594 C  "C4'" . DC  D 3 22  ? 18.171  -16.221 -0.815  1.00 38.76  ? 50   DC  D "C4'" 1 
ATOM   6595 O  "O4'" . DC  D 3 22  ? 17.667  -14.935 -0.385  1.00 38.18  ? 50   DC  D "O4'" 1 
ATOM   6596 C  "C3'" . DC  D 3 22  ? 18.209  -17.100 0.450   1.00 37.85  ? 50   DC  D "C3'" 1 
ATOM   6597 O  "O3'" . DC  D 3 22  ? 19.420  -17.014 1.160   1.00 37.30  ? 50   DC  D "O3'" 1 
ATOM   6598 C  "C2'" . DC  D 3 22  ? 17.140  -16.459 1.309   1.00 38.24  ? 50   DC  D "C2'" 1 
ATOM   6599 C  "C1'" . DC  D 3 22  ? 17.581  -15.036 1.018   1.00 38.62  ? 50   DC  D "C1'" 1 
ATOM   6600 N  N1    . DC  D 3 22  ? 16.722  -13.997 1.563   1.00 39.13  ? 50   DC  D N1    1 
ATOM   6601 C  C2    . DC  D 3 22  ? 17.187  -12.693 1.496   1.00 39.64  ? 50   DC  D C2    1 
ATOM   6602 O  O2    . DC  D 3 22  ? 18.272  -12.480 0.967   1.00 40.26  ? 50   DC  D O2    1 
ATOM   6603 N  N3    . DC  D 3 22  ? 16.436  -11.700 2.003   1.00 40.57  ? 50   DC  D N3    1 
ATOM   6604 C  C4    . DC  D 3 22  ? 15.267  -11.990 2.564   1.00 40.66  ? 50   DC  D C4    1 
ATOM   6605 N  N4    . DC  D 3 22  ? 14.560  -10.972 3.046   1.00 40.78  ? 50   DC  D N4    1 
ATOM   6606 C  C5    . DC  D 3 22  ? 14.773  -13.327 2.661   1.00 40.64  ? 50   DC  D C5    1 
ATOM   6607 C  C6    . DC  D 3 22  ? 15.535  -14.301 2.154   1.00 39.87  ? 50   DC  D C6    1 
ATOM   6608 P  P     . DA  D 3 23  ? 20.734  -17.742 0.639   1.00 37.97  ? 51   DA  D P     1 
ATOM   6609 O  OP1   . DA  D 3 23  ? 20.826  -17.652 -0.843  1.00 37.62  ? 51   DA  D OP1   1 
ATOM   6610 O  OP2   . DA  D 3 23  ? 20.818  -19.045 1.333   1.00 37.31  ? 51   DA  D OP2   1 
ATOM   6611 O  "O5'" . DA  D 3 23  ? 21.851  -16.767 1.217   1.00 38.01  ? 51   DA  D "O5'" 1 
ATOM   6612 C  "C5'" . DA  D 3 23  ? 22.695  -16.078 0.291   1.00 37.79  ? 51   DA  D "C5'" 1 
ATOM   6613 C  "C4'" . DA  D 3 23  ? 23.340  -14.880 0.959   1.00 37.30  ? 51   DA  D "C4'" 1 
ATOM   6614 O  "O4'" . DA  D 3 23  ? 22.280  -14.014 1.413   1.00 36.42  ? 51   DA  D "O4'" 1 
ATOM   6615 C  "C3'" . DA  D 3 23  ? 24.186  -15.232 2.170   1.00 36.96  ? 51   DA  D "C3'" 1 
ATOM   6616 O  "O3'" . DA  D 3 23  ? 25.359  -14.444 2.218   1.00 38.53  ? 51   DA  D "O3'" 1 
ATOM   6617 C  "C2'" . DA  D 3 23  ? 23.240  -14.946 3.325   1.00 36.72  ? 51   DA  D "C2'" 1 
ATOM   6618 C  "C1'" . DA  D 3 23  ? 22.426  -13.777 2.787   1.00 36.73  ? 51   DA  D "C1'" 1 
ATOM   6619 N  N9    . DA  D 3 23  ? 21.086  -13.655 3.364   1.00 36.84  ? 51   DA  D N9    1 
ATOM   6620 C  C8    . DA  D 3 23  ? 20.107  -14.611 3.432   1.00 37.14  ? 51   DA  D C8    1 
ATOM   6621 N  N7    . DA  D 3 23  ? 18.998  -14.212 4.013   1.00 36.80  ? 51   DA  D N7    1 
ATOM   6622 C  C5    . DA  D 3 23  ? 19.269  -12.904 4.340   1.00 36.61  ? 51   DA  D C5    1 
ATOM   6623 C  C6    . DA  D 3 23  ? 18.491  -11.930 4.981   1.00 36.83  ? 51   DA  D C6    1 
ATOM   6624 N  N6    . DA  D 3 23  ? 17.260  -12.176 5.392   1.00 36.49  ? 51   DA  D N6    1 
ATOM   6625 N  N1    . DA  D 3 23  ? 19.029  -10.710 5.182   1.00 37.66  ? 51   DA  D N1    1 
ATOM   6626 C  C2    . DA  D 3 23  ? 20.294  -10.499 4.752   1.00 38.43  ? 51   DA  D C2    1 
ATOM   6627 N  N3    . DA  D 3 23  ? 21.138  -11.335 4.126   1.00 37.29  ? 51   DA  D N3    1 
ATOM   6628 C  C4    . DA  D 3 23  ? 20.551  -12.538 3.956   1.00 36.91  ? 51   DA  D C4    1 
ATOM   6629 P  P     . DC  D 3 24  ? 26.446  -14.725 3.373   1.00 42.05  ? 52   DC  D P     1 
ATOM   6630 O  OP1   . DC  D 3 24  ? 27.792  -14.343 2.884   1.00 42.10  ? 52   DC  D OP1   1 
ATOM   6631 O  OP2   . DC  D 3 24  ? 26.249  -16.081 3.919   1.00 42.78  ? 52   DC  D OP2   1 
ATOM   6632 O  "O5'" . DC  D 3 24  ? 26.009  -13.761 4.561   1.00 40.52  ? 52   DC  D "O5'" 1 
ATOM   6633 C  "C5'" . DC  D 3 24  ? 25.707  -12.394 4.324   1.00 39.99  ? 52   DC  D "C5'" 1 
ATOM   6634 C  "C4'" . DC  D 3 24  ? 25.630  -11.688 5.667   1.00 38.79  ? 52   DC  D "C4'" 1 
ATOM   6635 O  "O4'" . DC  D 3 24  ? 24.253  -11.455 6.083   1.00 37.37  ? 52   DC  D "O4'" 1 
ATOM   6636 C  "C3'" . DC  D 3 24  ? 26.257  -12.489 6.791   1.00 38.57  ? 52   DC  D "C3'" 1 
ATOM   6637 O  "O3'" . DC  D 3 24  ? 26.622  -11.559 7.797   1.00 39.74  ? 52   DC  D "O3'" 1 
ATOM   6638 C  "C2'" . DC  D 3 24  ? 25.074  -13.360 7.176   1.00 37.64  ? 52   DC  D "C2'" 1 
ATOM   6639 C  "C1'" . DC  D 3 24  ? 24.026  -12.256 7.218   1.00 36.92  ? 52   DC  D "C1'" 1 
ATOM   6640 N  N1    . DC  D 3 24  ? 22.659  -12.797 7.276   1.00 36.06  ? 52   DC  D N1    1 
ATOM   6641 C  C2    . DC  D 3 24  ? 21.577  -11.966 7.602   1.00 35.70  ? 52   DC  D C2    1 
ATOM   6642 O  O2    . DC  D 3 24  ? 21.772  -10.764 7.805   1.00 34.18  ? 52   DC  D O2    1 
ATOM   6643 N  N3    . DC  D 3 24  ? 20.338  -12.521 7.672   1.00 36.59  ? 52   DC  D N3    1 
ATOM   6644 C  C4    . DC  D 3 24  ? 20.188  -13.837 7.437   1.00 36.80  ? 52   DC  D C4    1 
ATOM   6645 N  N4    . DC  D 3 24  ? 18.966  -14.382 7.499   1.00 37.84  ? 52   DC  D N4    1 
ATOM   6646 C  C5    . DC  D 3 24  ? 21.287  -14.681 7.121   1.00 36.03  ? 52   DC  D C5    1 
ATOM   6647 C  C6    . DC  D 3 24  ? 22.494  -14.130 7.055   1.00 35.41  ? 52   DC  D C6    1 
ATOM   6648 P  P     . DC  D 3 25  ? 27.261  -11.880 9.246   1.00 40.26  ? 53   DC  D P     1 
ATOM   6649 O  OP1   . DC  D 3 25  ? 28.669  -12.275 9.024   1.00 38.72  ? 53   DC  D OP1   1 
ATOM   6650 O  OP2   . DC  D 3 25  ? 26.395  -12.749 10.101  1.00 38.13  ? 53   DC  D OP2   1 
ATOM   6651 O  "O5'" . DC  D 3 25  ? 27.208  -10.348 9.772   1.00 40.80  ? 53   DC  D "O5'" 1 
ATOM   6652 C  "C5'" . DC  D 3 25  ? 26.183  -9.414  9.294   1.00 40.19  ? 53   DC  D "C5'" 1 
ATOM   6653 C  "C4'" . DC  D 3 25  ? 25.282  -8.822  10.382  1.00 38.95  ? 53   DC  D "C4'" 1 
ATOM   6654 O  "O4'" . DC  D 3 25  ? 23.897  -9.291  10.363  1.00 38.08  ? 53   DC  D "O4'" 1 
ATOM   6655 C  "C3'" . DC  D 3 25  ? 25.746  -9.087  11.793  1.00 39.33  ? 53   DC  D "C3'" 1 
ATOM   6656 O  "O3'" . DC  D 3 25  ? 25.389  -7.964  12.555  1.00 40.82  ? 53   DC  D "O3'" 1 
ATOM   6657 C  "C2'" . DC  D 3 25  ? 24.915  -10.297 12.179  1.00 39.08  ? 53   DC  D "C2'" 1 
ATOM   6658 C  "C1'" . DC  D 3 25  ? 23.568  -9.933  11.576  1.00 37.88  ? 53   DC  D "C1'" 1 
ATOM   6659 N  N1    . DC  D 3 25  ? 22.716  -11.143 11.331  1.00 38.24  ? 53   DC  D N1    1 
ATOM   6660 C  C2    . DC  D 3 25  ? 21.386  -11.211 11.796  1.00 38.78  ? 53   DC  D C2    1 
ATOM   6661 O  O2    . DC  D 3 25  ? 20.896  -10.248 12.403  1.00 39.80  ? 53   DC  D O2    1 
ATOM   6662 N  N3    . DC  D 3 25  ? 20.656  -12.341 11.556  1.00 37.92  ? 53   DC  D N3    1 
ATOM   6663 C  C4    . DC  D 3 25  ? 21.206  -13.354 10.887  1.00 37.17  ? 53   DC  D C4    1 
ATOM   6664 N  N4    . DC  D 3 25  ? 20.467  -14.429 10.663  1.00 36.79  ? 53   DC  D N4    1 
ATOM   6665 C  C5    . DC  D 3 25  ? 22.550  -13.323 10.425  1.00 37.43  ? 53   DC  D C5    1 
ATOM   6666 C  C6    . DC  D 3 25  ? 23.257  -12.213 10.667  1.00 37.82  ? 53   DC  D C6    1 
ATOM   6667 P  P     . DT  D 3 26  ? 26.002  -7.724  14.008  1.00 41.12  ? 54   DT  D P     1 
ATOM   6668 O  OP1   . DT  D 3 26  ? 26.047  -6.233  14.115  1.00 39.16  ? 54   DT  D OP1   1 
ATOM   6669 O  OP2   . DT  D 3 26  ? 27.177  -8.636  14.208  1.00 39.93  ? 54   DT  D OP2   1 
ATOM   6670 O  "O5'" . DT  D 3 26  ? 24.887  -8.332  14.976  1.00 40.08  ? 54   DT  D "O5'" 1 
ATOM   6671 C  "C5'" . DT  D 3 26  ? 23.772  -7.568  15.318  1.00 40.50  ? 54   DT  D "C5'" 1 
ATOM   6672 C  "C4'" . DT  D 3 26  ? 23.032  -8.322  16.377  1.00 40.48  ? 54   DT  D "C4'" 1 
ATOM   6673 O  "O4'" . DT  D 3 26  ? 22.195  -9.275  15.698  1.00 40.57  ? 54   DT  D "O4'" 1 
ATOM   6674 C  "C3'" . DT  D 3 26  ? 23.960  -9.132  17.263  1.00 41.40  ? 54   DT  D "C3'" 1 
ATOM   6675 O  "O3'" . DT  D 3 26  ? 24.398  -8.274  18.350  1.00 41.47  ? 54   DT  D "O3'" 1 
ATOM   6676 C  "C2'" . DT  D 3 26  ? 23.058  -10.312 17.649  1.00 42.12  ? 54   DT  D "C2'" 1 
ATOM   6677 C  "C1'" . DT  D 3 26  ? 22.019  -10.396 16.524  1.00 41.67  ? 54   DT  D "C1'" 1 
ATOM   6678 N  N1    . DT  D 3 26  ? 22.122  -11.614 15.671  1.00 42.75  ? 54   DT  D N1    1 
ATOM   6679 C  C2    . DT  D 3 26  ? 20.971  -12.202 15.218  1.00 43.40  ? 54   DT  D C2    1 
ATOM   6680 O  O2    . DT  D 3 26  ? 19.880  -11.753 15.491  1.00 44.51  ? 54   DT  D O2    1 
ATOM   6681 N  N3    . DT  D 3 26  ? 21.139  -13.324 14.440  1.00 43.72  ? 54   DT  D N3    1 
ATOM   6682 C  C4    . DT  D 3 26  ? 22.340  -13.913 14.080  1.00 44.82  ? 54   DT  D C4    1 
ATOM   6683 O  O4    . DT  D 3 26  ? 22.403  -14.928 13.384  1.00 45.17  ? 54   DT  D O4    1 
ATOM   6684 C  C5    . DT  D 3 26  ? 23.520  -13.245 14.589  1.00 45.69  ? 54   DT  D C5    1 
ATOM   6685 C  C7    . DT  D 3 26  ? 24.905  -13.770 14.286  1.00 47.43  ? 54   DT  D C7    1 
ATOM   6686 C  C6    . DT  D 3 26  ? 23.352  -12.144 15.345  1.00 44.46  ? 54   DT  D C6    1 
ATOM   6687 P  P     . DG  D 3 27  ? 25.340  -8.676  19.601  1.00 41.79  ? 55   DG  D P     1 
ATOM   6688 O  OP1   . DG  D 3 27  ? 25.507  -7.362  20.275  1.00 41.06  ? 55   DG  D OP1   1 
ATOM   6689 O  OP2   . DG  D 3 27  ? 26.498  -9.499  19.188  1.00 41.34  ? 55   DG  D OP2   1 
ATOM   6690 O  "O5'" . DG  D 3 27  ? 24.502  -9.688  20.507  1.00 40.97  ? 55   DG  D "O5'" 1 
ATOM   6691 C  "C5'" . DG  D 3 27  ? 23.275  -9.228  21.031  1.00 41.68  ? 55   DG  D "C5'" 1 
ATOM   6692 C  "C4'" . DG  D 3 27  ? 22.592  -10.280 21.861  1.00 41.14  ? 55   DG  D "C4'" 1 
ATOM   6693 O  "O4'" . DG  D 3 27  ? 21.796  -11.116 20.996  1.00 40.75  ? 55   DG  D "O4'" 1 
ATOM   6694 C  "C3'" . DG  D 3 27  ? 23.532  -11.192 22.614  1.00 41.20  ? 55   DG  D "C3'" 1 
ATOM   6695 O  "O3'" . DG  D 3 27  ? 23.875  -10.582 23.853  1.00 41.23  ? 55   DG  D "O3'" 1 
ATOM   6696 C  "C2'" . DG  D 3 27  ? 22.635  -12.412 22.767  1.00 41.83  ? 55   DG  D "C2'" 1 
ATOM   6697 C  "C1'" . DG  D 3 27  ? 21.857  -12.445 21.447  1.00 42.34  ? 55   DG  D "C1'" 1 
ATOM   6698 N  N9    . DG  D 3 27  ? 22.492  -13.166 20.355  1.00 43.66  ? 55   DG  D N9    1 
ATOM   6699 C  C8    . DG  D 3 27  ? 23.835  -13.194 20.120  1.00 44.93  ? 55   DG  D C8    1 
ATOM   6700 N  N7    . DG  D 3 27  ? 24.172  -13.880 19.071  1.00 45.75  ? 55   DG  D N7    1 
ATOM   6701 C  C5    . DG  D 3 27  ? 22.980  -14.341 18.564  1.00 44.96  ? 55   DG  D C5    1 
ATOM   6702 C  C6    . DG  D 3 27  ? 22.768  -15.143 17.416  1.00 45.36  ? 55   DG  D C6    1 
ATOM   6703 O  O6    . DG  D 3 27  ? 23.617  -15.610 16.630  1.00 44.85  ? 55   DG  D O6    1 
ATOM   6704 N  N1    . DG  D 3 27  ? 21.409  -15.390 17.237  1.00 45.78  ? 55   DG  D N1    1 
ATOM   6705 C  C2    . DG  D 3 27  ? 20.406  -14.921 18.062  1.00 45.54  ? 55   DG  D C2    1 
ATOM   6706 N  N2    . DG  D 3 27  ? 19.162  -15.280 17.705  1.00 46.46  ? 55   DG  D N2    1 
ATOM   6707 N  N3    . DG  D 3 27  ? 20.607  -14.165 19.144  1.00 44.83  ? 55   DG  D N3    1 
ATOM   6708 C  C4    . DG  D 3 27  ? 21.923  -13.907 19.338  1.00 44.36  ? 55   DG  D C4    1 
ATOM   6709 P  P     . DA  D 3 28  ? 25.296  -10.776 24.575  1.00 42.20  ? 56   DA  D P     1 
ATOM   6710 O  OP1   . DA  D 3 28  ? 25.120  -11.638 25.772  1.00 41.62  ? 56   DA  D OP1   1 
ATOM   6711 O  OP2   . DA  D 3 28  ? 25.883  -9.432  24.712  1.00 42.28  ? 56   DA  D OP2   1 
ATOM   6712 O  "O5'" . DA  D 3 28  ? 26.200  -11.544 23.496  1.00 45.29  ? 56   DA  D "O5'" 1 
ATOM   6713 C  "C5'" . DA  D 3 28  ? 26.844  -12.782 23.808  1.00 46.55  ? 56   DA  D "C5'" 1 
ATOM   6714 C  "C4'" . DA  D 3 28  ? 25.811  -13.779 24.302  1.00 47.50  ? 56   DA  D "C4'" 1 
ATOM   6715 O  "O4'" . DA  D 3 28  ? 25.182  -14.359 23.139  1.00 47.30  ? 56   DA  D "O4'" 1 
ATOM   6716 C  "C3'" . DA  D 3 28  ? 26.329  -14.912 25.195  1.00 47.82  ? 56   DA  D "C3'" 1 
ATOM   6717 O  "O3'" . DA  D 3 28  ? 25.789  -14.788 26.519  1.00 46.99  ? 56   DA  D "O3'" 1 
ATOM   6718 C  "C2'" . DA  D 3 28  ? 25.890  -16.191 24.471  1.00 47.85  ? 56   DA  D "C2'" 1 
ATOM   6719 C  "C1'" . DA  D 3 28  ? 24.836  -15.678 23.481  1.00 48.06  ? 56   DA  D "C1'" 1 
ATOM   6720 N  N9    . DA  D 3 28  ? 24.692  -16.409 22.219  1.00 48.55  ? 56   DA  D N9    1 
ATOM   6721 C  C8    . DA  D 3 28  ? 25.644  -16.987 21.417  1.00 48.01  ? 56   DA  D C8    1 
ATOM   6722 N  N7    . DA  D 3 28  ? 25.147  -17.558 20.346  1.00 47.55  ? 56   DA  D N7    1 
ATOM   6723 C  C5    . DA  D 3 28  ? 23.784  -17.340 20.454  1.00 48.06  ? 56   DA  D C5    1 
ATOM   6724 C  C6    . DA  D 3 28  ? 22.673  -17.686 19.658  1.00 48.80  ? 56   DA  D C6    1 
ATOM   6725 N  N6    . DA  D 3 28  ? 22.738  -18.362 18.509  1.00 49.37  ? 56   DA  D N6    1 
ATOM   6726 N  N1    . DA  D 3 28  ? 21.451  -17.303 20.075  1.00 49.97  ? 56   DA  D N1    1 
ATOM   6727 C  C2    . DA  D 3 28  ? 21.327  -16.619 21.217  1.00 50.34  ? 56   DA  D C2    1 
ATOM   6728 N  N3    . DA  D 3 28  ? 22.290  -16.235 22.044  1.00 49.99  ? 56   DA  D N3    1 
ATOM   6729 C  C4    . DA  D 3 28  ? 23.495  -16.630 21.599  1.00 48.69  ? 56   DA  D C4    1 
ATOM   6730 O  OP3   . DG  E 2 1   ? 56.755  -6.371  1.247   1.00 95.81  ? 4    DG  E OP3   1 
ATOM   6731 P  P     . DG  E 2 1   ? 55.764  -7.481  1.123   1.00 95.82  ? 4    DG  E P     1 
ATOM   6732 O  OP1   . DG  E 2 1   ? 55.167  -8.064  -0.123  1.00 96.09  ? 4    DG  E OP1   1 
ATOM   6733 O  OP2   . DG  E 2 1   ? 56.984  -8.250  0.776   1.00 96.25  ? 4    DG  E OP2   1 
ATOM   6734 O  "O5'" . DG  E 2 1   ? 55.520  -8.364  2.470   1.00 92.15  ? 4    DG  E "O5'" 1 
ATOM   6735 C  "C5'" . DG  E 2 1   ? 54.166  -8.585  2.980   1.00 85.02  ? 4    DG  E "C5'" 1 
ATOM   6736 C  "C4'" . DG  E 2 1   ? 54.010  -9.509  4.199   1.00 78.82  ? 4    DG  E "C4'" 1 
ATOM   6737 O  "O4'" . DG  E 2 1   ? 53.552  -8.798  5.397   1.00 77.08  ? 4    DG  E "O4'" 1 
ATOM   6738 C  "C3'" . DG  E 2 1   ? 52.974  -10.609 3.979   1.00 74.46  ? 4    DG  E "C3'" 1 
ATOM   6739 O  "O3'" . DG  E 2 1   ? 53.658  -11.777 3.473   1.00 68.56  ? 4    DG  E "O3'" 1 
ATOM   6740 C  "C2'" . DG  E 2 1   ? 52.283  -10.683 5.345   1.00 74.93  ? 4    DG  E "C2'" 1 
ATOM   6741 C  "C1'" . DG  E 2 1   ? 52.227  -9.195  5.696   1.00 76.73  ? 4    DG  E "C1'" 1 
ATOM   6742 N  N9    . DG  E 2 1   ? 51.426  -8.366  4.800   1.00 78.10  ? 4    DG  E N9    1 
ATOM   6743 C  C8    . DG  E 2 1   ? 51.787  -7.097  4.407   1.00 79.14  ? 4    DG  E C8    1 
ATOM   6744 N  N7    . DG  E 2 1   ? 50.964  -6.552  3.560   1.00 79.74  ? 4    DG  E N7    1 
ATOM   6745 C  C5    . DG  E 2 1   ? 49.986  -7.511  3.372   1.00 78.16  ? 4    DG  E C5    1 
ATOM   6746 C  C6    . DG  E 2 1   ? 48.839  -7.442  2.562   1.00 76.78  ? 4    DG  E C6    1 
ATOM   6747 O  O6    . DG  E 2 1   ? 48.490  -6.497  1.848   1.00 74.99  ? 4    DG  E O6    1 
ATOM   6748 N  N1    . DG  E 2 1   ? 48.095  -8.616  2.652   1.00 76.65  ? 4    DG  E N1    1 
ATOM   6749 C  C2    . DG  E 2 1   ? 48.438  -9.701  3.426   1.00 76.31  ? 4    DG  E C2    1 
ATOM   6750 N  N2    . DG  E 2 1   ? 47.613  -10.742 3.401   1.00 75.83  ? 4    DG  E N2    1 
ATOM   6751 N  N3    . DG  E 2 1   ? 49.514  -9.778  4.186   1.00 77.00  ? 4    DG  E N3    1 
ATOM   6752 C  C4    . DG  E 2 1   ? 50.248  -8.643  4.121   1.00 78.17  ? 4    DG  E C4    1 
ATOM   6753 P  P     . DG  E 2 2   ? 53.520  -13.248 4.055   1.00 63.79  ? 5    DG  E P     1 
ATOM   6754 O  OP1   . DG  E 2 2   ? 54.032  -13.230 5.426   1.00 63.71  ? 5    DG  E OP1   1 
ATOM   6755 O  OP2   . DG  E 2 2   ? 54.100  -14.222 3.109   1.00 63.45  ? 5    DG  E OP2   1 
ATOM   6756 O  "O5'" . DG  E 2 2   ? 51.931  -13.401 4.059   1.00 62.58  ? 5    DG  E "O5'" 1 
ATOM   6757 C  "C5'" . DG  E 2 2   ? 51.276  -14.504 4.698   1.00 59.11  ? 5    DG  E "C5'" 1 
ATOM   6758 C  "C4'" . DG  E 2 2   ? 50.113  -15.006 3.862   1.00 55.52  ? 5    DG  E "C4'" 1 
ATOM   6759 O  "O4'" . DG  E 2 2   ? 49.345  -13.898 3.349   1.00 54.09  ? 5    DG  E "O4'" 1 
ATOM   6760 C  "C3'" . DG  E 2 2   ? 50.544  -15.837 2.661   1.00 54.34  ? 5    DG  E "C3'" 1 
ATOM   6761 O  "O3'" . DG  E 2 2   ? 50.016  -17.144 2.904   1.00 53.51  ? 5    DG  E "O3'" 1 
ATOM   6762 C  "C2'" . DG  E 2 2   ? 50.077  -15.055 1.421   1.00 53.22  ? 5    DG  E "C2'" 1 
ATOM   6763 C  "C1'" . DG  E 2 2   ? 49.000  -14.147 2.002   1.00 53.38  ? 5    DG  E "C1'" 1 
ATOM   6764 N  N9    . DG  E 2 2   ? 48.739  -12.860 1.327   1.00 53.42  ? 5    DG  E N9    1 
ATOM   6765 C  C8    . DG  E 2 2   ? 49.590  -11.979 0.684   1.00 53.28  ? 5    DG  E C8    1 
ATOM   6766 N  N7    . DG  E 2 2   ? 48.999  -10.911 0.199   1.00 52.26  ? 5    DG  E N7    1 
ATOM   6767 C  C5    . DG  E 2 2   ? 47.669  -11.090 0.542   1.00 51.98  ? 5    DG  E C5    1 
ATOM   6768 C  C6    . DG  E 2 2   ? 46.535  -10.283 0.307   1.00 51.45  ? 5    DG  E C6    1 
ATOM   6769 O  O6    . DG  E 2 2   ? 46.502  -9.210  -0.290  1.00 51.33  ? 5    DG  E O6    1 
ATOM   6770 N  N1    . DG  E 2 2   ? 45.362  -10.827 0.833   1.00 51.19  ? 5    DG  E N1    1 
ATOM   6771 C  C2    . DG  E 2 2   ? 45.309  -12.024 1.517   1.00 51.58  ? 5    DG  E C2    1 
ATOM   6772 N  N2    . DG  E 2 2   ? 44.132  -12.452 1.980   1.00 52.02  ? 5    DG  E N2    1 
ATOM   6773 N  N3    . DG  E 2 2   ? 46.355  -12.791 1.744   1.00 52.13  ? 5    DG  E N3    1 
ATOM   6774 C  C4    . DG  E 2 2   ? 47.498  -12.271 1.233   1.00 52.79  ? 5    DG  E C4    1 
ATOM   6775 P  P     . DT  E 2 3   ? 49.213  -18.086 1.893   1.00 53.59  ? 6    DT  E P     1 
ATOM   6776 O  OP1   . DT  E 2 3   ? 48.975  -19.350 2.631   1.00 53.82  ? 6    DT  E OP1   1 
ATOM   6777 O  OP2   . DT  E 2 3   ? 49.848  -18.105 0.557   1.00 54.00  ? 6    DT  E OP2   1 
ATOM   6778 O  "O5'" . DT  E 2 3   ? 47.835  -17.313 1.712   1.00 53.47  ? 6    DT  E "O5'" 1 
ATOM   6779 C  "C5'" . DT  E 2 3   ? 46.768  -17.459 2.660   1.00 52.16  ? 6    DT  E "C5'" 1 
ATOM   6780 C  "C4'" . DT  E 2 3   ? 45.429  -17.433 1.940   1.00 49.77  ? 6    DT  E "C4'" 1 
ATOM   6781 O  "O4'" . DT  E 2 3   ? 45.149  -16.137 1.331   1.00 48.43  ? 6    DT  E "O4'" 1 
ATOM   6782 C  "C3'" . DT  E 2 3   ? 45.328  -18.414 0.787   1.00 48.75  ? 6    DT  E "C3'" 1 
ATOM   6783 O  "O3'" . DT  E 2 3   ? 43.952  -18.517 0.658   1.00 48.32  ? 6    DT  E "O3'" 1 
ATOM   6784 C  "C2'" . DT  E 2 3   ? 45.901  -17.583 -0.358  1.00 47.73  ? 6    DT  E "C2'" 1 
ATOM   6785 C  "C1'" . DT  E 2 3   ? 45.093  -16.316 -0.074  1.00 47.05  ? 6    DT  E "C1'" 1 
ATOM   6786 N  N1    . DT  E 2 3   ? 45.485  -15.047 -0.757  1.00 45.80  ? 6    DT  E N1    1 
ATOM   6787 C  C2    . DT  E 2 3   ? 44.488  -14.099 -0.960  1.00 45.41  ? 6    DT  E C2    1 
ATOM   6788 O  O2    . DT  E 2 3   ? 43.332  -14.271 -0.612  1.00 45.72  ? 6    DT  E O2    1 
ATOM   6789 N  N3    . DT  E 2 3   ? 44.880  -12.942 -1.598  1.00 44.05  ? 6    DT  E N3    1 
ATOM   6790 C  C4    . DT  E 2 3   ? 46.159  -12.664 -2.033  1.00 43.65  ? 6    DT  E C4    1 
ATOM   6791 O  O4    . DT  E 2 3   ? 46.437  -11.617 -2.588  1.00 43.13  ? 6    DT  E O4    1 
ATOM   6792 C  C5    . DT  E 2 3   ? 47.151  -13.687 -1.792  1.00 44.21  ? 6    DT  E C5    1 
ATOM   6793 C  C7    . DT  E 2 3   ? 48.560  -13.460 -2.241  1.00 44.60  ? 6    DT  E C7    1 
ATOM   6794 C  C6    . DT  E 2 3   ? 46.786  -14.825 -1.175  1.00 44.88  ? 6    DT  E C6    1 
ATOM   6795 P  P     . DG  E 2 4   ? 43.176  -19.883 0.444   1.00 47.87  ? 7    DG  E P     1 
ATOM   6796 O  OP1   . DG  E 2 4   ? 42.812  -20.465 1.772   1.00 46.83  ? 7    DG  E OP1   1 
ATOM   6797 O  OP2   . DG  E 2 4   ? 43.811  -20.619 -0.682  1.00 46.69  ? 7    DG  E OP2   1 
ATOM   6798 O  "O5'" . DG  E 2 4   ? 41.833  -19.289 -0.151  1.00 45.80  ? 7    DG  E "O5'" 1 
ATOM   6799 C  "C5'" . DG  E 2 4   ? 41.237  -18.113 0.389   1.00 41.63  ? 7    DG  E "C5'" 1 
ATOM   6800 C  "C4'" . DG  E 2 4   ? 40.233  -17.668 -0.651  1.00 38.17  ? 7    DG  E "C4'" 1 
ATOM   6801 O  "O4'" . DG  E 2 4   ? 40.772  -16.548 -1.380  1.00 37.02  ? 7    DG  E "O4'" 1 
ATOM   6802 C  "C3'" . DG  E 2 4   ? 39.934  -18.710 -1.726  1.00 36.13  ? 7    DG  E "C3'" 1 
ATOM   6803 O  "O3'" . DG  E 2 4   ? 38.683  -18.369 -2.276  1.00 34.51  ? 7    DG  E "O3'" 1 
ATOM   6804 C  "C2'" . DG  E 2 4   ? 41.074  -18.473 -2.712  1.00 35.84  ? 7    DG  E "C2'" 1 
ATOM   6805 C  "C1'" . DG  E 2 4   ? 40.992  -16.947 -2.722  1.00 35.58  ? 7    DG  E "C1'" 1 
ATOM   6806 N  N9    . DG  E 2 4   ? 42.136  -16.181 -3.199  1.00 33.75  ? 7    DG  E N9    1 
ATOM   6807 C  C8    . DG  E 2 4   ? 43.462  -16.514 -3.208  1.00 33.14  ? 7    DG  E C8    1 
ATOM   6808 N  N7    . DG  E 2 4   ? 44.212  -15.572 -3.709  1.00 33.26  ? 7    DG  E N7    1 
ATOM   6809 C  C5    . DG  E 2 4   ? 43.328  -14.545 -4.031  1.00 32.55  ? 7    DG  E C5    1 
ATOM   6810 C  C6    . DG  E 2 4   ? 43.547  -13.262 -4.601  1.00 31.45  ? 7    DG  E C6    1 
ATOM   6811 O  O6    . DG  E 2 4   ? 44.604  -12.743 -4.948  1.00 30.61  ? 7    DG  E O6    1 
ATOM   6812 N  N1    . DG  E 2 4   ? 42.374  -12.550 -4.777  1.00 31.23  ? 7    DG  E N1    1 
ATOM   6813 C  C2    . DG  E 2 4   ? 41.133  -13.029 -4.433  1.00 31.77  ? 7    DG  E C2    1 
ATOM   6814 N  N2    . DG  E 2 4   ? 40.103  -12.215 -4.665  1.00 32.43  ? 7    DG  E N2    1 
ATOM   6815 N  N3    . DG  E 2 4   ? 40.903  -14.212 -3.889  1.00 31.84  ? 7    DG  E N3    1 
ATOM   6816 C  C4    . DG  E 2 4   ? 42.047  -14.915 -3.718  1.00 32.68  ? 7    DG  E C4    1 
ATOM   6817 P  P     . DT  E 2 5   ? 37.702  -19.460 -2.888  1.00 32.98  ? 8    DT  E P     1 
ATOM   6818 O  OP1   . DT  E 2 5   ? 36.620  -19.712 -1.908  1.00 32.75  ? 8    DT  E OP1   1 
ATOM   6819 O  OP2   . DT  E 2 5   ? 38.548  -20.547 -3.454  1.00 33.73  ? 8    DT  E OP2   1 
ATOM   6820 O  "O5'" . DT  E 2 5   ? 37.020  -18.629 -4.048  1.00 32.92  ? 8    DT  E "O5'" 1 
ATOM   6821 C  "C5'" . DT  E 2 5   ? 36.538  -17.339 -3.680  1.00 33.84  ? 8    DT  E "C5'" 1 
ATOM   6822 C  "C4'" . DT  E 2 5   ? 36.297  -16.453 -4.887  1.00 33.97  ? 8    DT  E "C4'" 1 
ATOM   6823 O  "O4'" . DT  E 2 5   ? 37.493  -15.733 -5.292  1.00 34.09  ? 8    DT  E "O4'" 1 
ATOM   6824 C  "C3'" . DT  E 2 5   ? 35.814  -17.197 -6.116  1.00 33.94  ? 8    DT  E "C3'" 1 
ATOM   6825 O  "O3'" . DT  E 2 5   ? 34.727  -16.431 -6.566  1.00 34.20  ? 8    DT  E "O3'" 1 
ATOM   6826 C  "C2'" . DT  E 2 5   ? 37.042  -17.195 -7.032  1.00 33.98  ? 8    DT  E "C2'" 1 
ATOM   6827 C  "C1'" . DT  E 2 5   ? 37.696  -15.871 -6.677  1.00 34.03  ? 8    DT  E "C1'" 1 
ATOM   6828 N  N1    . DT  E 2 5   ? 39.162  -15.699 -6.903  1.00 35.21  ? 8    DT  E N1    1 
ATOM   6829 C  C2    . DT  E 2 5   ? 39.591  -14.436 -7.241  1.00 36.77  ? 8    DT  E C2    1 
ATOM   6830 O  O2    . DT  E 2 5   ? 38.829  -13.498 -7.377  1.00 38.13  ? 8    DT  E O2    1 
ATOM   6831 N  N3    . DT  E 2 5   ? 40.946  -14.294 -7.426  1.00 38.04  ? 8    DT  E N3    1 
ATOM   6832 C  C4    . DT  E 2 5   ? 41.913  -15.283 -7.296  1.00 38.65  ? 8    DT  E C4    1 
ATOM   6833 O  O4    . DT  E 2 5   ? 43.118  -15.074 -7.472  1.00 39.39  ? 8    DT  E O4    1 
ATOM   6834 C  C5    . DT  E 2 5   ? 41.409  -16.588 -6.933  1.00 37.94  ? 8    DT  E C5    1 
ATOM   6835 C  C7    . DT  E 2 5   ? 42.395  -17.717 -6.770  1.00 37.52  ? 8    DT  E C7    1 
ATOM   6836 C  C6    . DT  E 2 5   ? 40.072  -16.731 -6.753  1.00 36.55  ? 8    DT  E C6    1 
ATOM   6837 P  P     . DA  E 2 6   ? 33.745  -16.858 -7.733  1.00 33.40  ? 9    DA  E P     1 
ATOM   6838 O  OP1   . DA  E 2 6   ? 32.377  -16.527 -7.278  1.00 32.30  ? 9    DA  E OP1   1 
ATOM   6839 O  OP2   . DA  E 2 6   ? 34.144  -18.188 -8.226  1.00 33.61  ? 9    DA  E OP2   1 
ATOM   6840 O  "O5'" . DA  E 2 6   ? 34.134  -15.835 -8.869  1.00 34.29  ? 9    DA  E "O5'" 1 
ATOM   6841 C  "C5'" . DA  E 2 6   ? 33.685  -14.519 -8.704  1.00 37.20  ? 9    DA  E "C5'" 1 
ATOM   6842 C  "C4'" . DA  E 2 6   ? 34.418  -13.667 -9.715  1.00 40.21  ? 9    DA  E "C4'" 1 
ATOM   6843 O  "O4'" . DA  E 2 6   ? 35.839  -13.925 -9.625  1.00 40.24  ? 9    DA  E "O4'" 1 
ATOM   6844 C  "C3'" . DA  E 2 6   ? 34.048  -13.930 -11.167 1.00 42.07  ? 9    DA  E "C3'" 1 
ATOM   6845 O  "O3'" . DA  E 2 6   ? 33.978  -12.691 -11.861 1.00 45.41  ? 9    DA  E "O3'" 1 
ATOM   6846 C  "C2'" . DA  E 2 6   ? 35.204  -14.793 -11.658 1.00 41.37  ? 9    DA  E "C2'" 1 
ATOM   6847 C  "C1'" . DA  E 2 6   ? 36.333  -14.101 -10.919 1.00 40.08  ? 9    DA  E "C1'" 1 
ATOM   6848 N  N9    . DA  E 2 6   ? 37.496  -14.933 -10.782 1.00 39.62  ? 9    DA  E N9    1 
ATOM   6849 C  C8    . DA  E 2 6   ? 37.512  -16.267 -10.490 1.00 39.71  ? 9    DA  E C8    1 
ATOM   6850 N  N7    . DA  E 2 6   ? 38.723  -16.769 -10.425 1.00 39.39  ? 9    DA  E N7    1 
ATOM   6851 C  C5    . DA  E 2 6   ? 39.532  -15.692 -10.691 1.00 38.62  ? 9    DA  E C5    1 
ATOM   6852 C  C6    . DA  E 2 6   ? 40.919  -15.595 -10.771 1.00 38.28  ? 9    DA  E C6    1 
ATOM   6853 N  N6    . DA  E 2 6   ? 41.702  -16.650 -10.575 1.00 36.50  ? 9    DA  E N6    1 
ATOM   6854 N  N1    . DA  E 2 6   ? 41.432  -14.373 -11.065 1.00 39.62  ? 9    DA  E N1    1 
ATOM   6855 C  C2    . DA  E 2 6   ? 40.585  -13.334 -11.265 1.00 39.52  ? 9    DA  E C2    1 
ATOM   6856 N  N3    . DA  E 2 6   ? 39.247  -13.307 -11.215 1.00 38.45  ? 9    DA  E N3    1 
ATOM   6857 C  C4    . DA  E 2 6   ? 38.794  -14.538 -10.918 1.00 38.99  ? 9    DA  E C4    1 
ATOM   6858 P  P     . DC  E 2 7   ? 33.163  -12.605 -13.230 1.00 48.63  ? 10   DC  E P     1 
ATOM   6859 O  OP1   . DC  E 2 7   ? 31.891  -11.905 -12.916 1.00 48.38  ? 10   DC  E OP1   1 
ATOM   6860 O  OP2   . DC  E 2 7   ? 33.183  -13.927 -13.917 1.00 48.17  ? 10   DC  E OP2   1 
ATOM   6861 O  "O5'" . DC  E 2 7   ? 34.076  -11.652 -14.107 1.00 49.23  ? 10   DC  E "O5'" 1 
ATOM   6862 C  "C5'" . DC  E 2 7   ? 34.361  -10.342 -13.698 1.00 52.05  ? 10   DC  E "C5'" 1 
ATOM   6863 C  "C4'" . DC  E 2 7   ? 35.614  -9.999  -14.460 1.00 54.94  ? 10   DC  E "C4'" 1 
ATOM   6864 O  "O4'" . DC  E 2 7   ? 36.657  -10.940 -14.087 1.00 54.80  ? 10   DC  E "O4'" 1 
ATOM   6865 C  "C3'" . DC  E 2 7   ? 35.483  -10.172 -15.966 1.00 57.45  ? 10   DC  E "C3'" 1 
ATOM   6866 O  "O3'" . DC  E 2 7   ? 36.270  -9.160  -16.598 1.00 61.35  ? 10   DC  E "O3'" 1 
ATOM   6867 C  "C2'" . DC  E 2 7   ? 36.058  -11.575 -16.181 1.00 56.10  ? 10   DC  E "C2'" 1 
ATOM   6868 C  "C1'" . DC  E 2 7   ? 37.253  -11.444 -15.256 1.00 54.22  ? 10   DC  E "C1'" 1 
ATOM   6869 N  N1    . DC  E 2 7   ? 37.982  -12.690 -14.944 1.00 53.33  ? 10   DC  E N1    1 
ATOM   6870 C  C2    . DC  E 2 7   ? 39.383  -12.695 -15.015 1.00 53.12  ? 10   DC  E C2    1 
ATOM   6871 O  O2    . DC  E 2 7   ? 39.984  -11.663 -15.342 1.00 53.01  ? 10   DC  E O2    1 
ATOM   6872 N  N3    . DC  E 2 7   ? 40.049  -13.843 -14.725 1.00 53.04  ? 10   DC  E N3    1 
ATOM   6873 C  C4    . DC  E 2 7   ? 39.368  -14.943 -14.382 1.00 53.48  ? 10   DC  E C4    1 
ATOM   6874 N  N4    . DC  E 2 7   ? 40.061  -16.053 -14.106 1.00 53.79  ? 10   DC  E N4    1 
ATOM   6875 C  C5    . DC  E 2 7   ? 37.942  -14.958 -14.307 1.00 53.66  ? 10   DC  E C5    1 
ATOM   6876 C  C6    . DC  E 2 7   ? 37.296  -13.817 -14.590 1.00 53.42  ? 10   DC  E C6    1 
ATOM   6877 P  P     . DA  E 2 8   ? 36.245  -8.932  -18.187 1.00 64.10  ? 11   DA  E P     1 
ATOM   6878 O  OP1   . DA  E 2 8   ? 35.408  -7.719  -18.360 1.00 64.37  ? 11   DA  E OP1   1 
ATOM   6879 O  OP2   . DA  E 2 8   ? 35.951  -10.208 -18.916 1.00 62.56  ? 11   DA  E OP2   1 
ATOM   6880 O  "O5'" . DA  E 2 8   ? 37.743  -8.470  -18.508 1.00 64.46  ? 11   DA  E "O5'" 1 
ATOM   6881 C  "C5'" . DA  E 2 8   ? 38.828  -9.201  -18.001 1.00 65.37  ? 11   DA  E "C5'" 1 
ATOM   6882 C  "C4'" . DA  E 2 8   ? 39.902  -9.381  -19.054 1.00 65.85  ? 11   DA  E "C4'" 1 
ATOM   6883 O  "O4'" . DA  E 2 8   ? 40.652  -10.588 -18.755 1.00 66.42  ? 11   DA  E "O4'" 1 
ATOM   6884 C  "C3'" . DA  E 2 8   ? 39.458  -9.530  -20.501 1.00 66.34  ? 11   DA  E "C3'" 1 
ATOM   6885 O  "O3'" . DA  E 2 8   ? 40.532  -9.028  -21.298 1.00 67.76  ? 11   DA  E "O3'" 1 
ATOM   6886 C  "C2'" . DA  E 2 8   ? 39.280  -11.043 -20.610 1.00 65.87  ? 11   DA  E "C2'" 1 
ATOM   6887 C  "C1'" . DA  E 2 8   ? 40.436  -11.560 -19.752 1.00 65.08  ? 11   DA  E "C1'" 1 
ATOM   6888 N  N9    . DA  E 2 8   ? 40.123  -12.804 -19.076 1.00 63.36  ? 11   DA  E N9    1 
ATOM   6889 C  C8    . DA  E 2 8   ? 38.893  -13.160 -18.618 1.00 63.32  ? 11   DA  E C8    1 
ATOM   6890 N  N7    . DA  E 2 8   ? 38.851  -14.335 -18.049 1.00 63.04  ? 11   DA  E N7    1 
ATOM   6891 C  C5    . DA  E 2 8   ? 40.145  -14.775 -18.141 1.00 62.64  ? 11   DA  E C5    1 
ATOM   6892 C  C6    . DA  E 2 8   ? 40.728  -15.968 -17.709 1.00 62.52  ? 11   DA  E C6    1 
ATOM   6893 N  N6    . DA  E 2 8   ? 40.013  -16.912 -17.093 1.00 62.09  ? 11   DA  E N6    1 
ATOM   6894 N  N1    . DA  E 2 8   ? 42.048  -16.129 -17.940 1.00 62.86  ? 11   DA  E N1    1 
ATOM   6895 C  C2    . DA  E 2 8   ? 42.713  -15.142 -18.567 1.00 62.86  ? 11   DA  E C2    1 
ATOM   6896 N  N3    . DA  E 2 8   ? 42.262  -13.966 -19.016 1.00 62.54  ? 11   DA  E N3    1 
ATOM   6897 C  C4    . DA  E 2 8   ? 40.953  -13.846 -18.767 1.00 62.63  ? 11   DA  E C4    1 
ATOM   6898 P  P     . DA  E 2 9   ? 40.575  -9.041  -22.898 1.00 68.69  ? 12   DA  E P     1 
ATOM   6899 O  OP1   . DA  E 2 9   ? 40.197  -7.674  -23.305 1.00 69.08  ? 12   DA  E OP1   1 
ATOM   6900 O  OP2   . DA  E 2 9   ? 39.826  -10.204 -23.442 1.00 68.39  ? 12   DA  E OP2   1 
ATOM   6901 O  "O5'" . DA  E 2 9   ? 42.134  -9.250  -23.194 1.00 69.27  ? 12   DA  E "O5'" 1 
ATOM   6902 C  "C5'" . DA  E 2 9   ? 42.891  -10.148 -22.382 1.00 70.94  ? 12   DA  E "C5'" 1 
ATOM   6903 C  "C4'" . DA  E 2 9   ? 43.539  -11.303 -23.154 1.00 72.18  ? 12   DA  E "C4'" 1 
ATOM   6904 O  "O4'" . DA  E 2 9   ? 43.262  -12.592 -22.526 1.00 71.44  ? 12   DA  E "O4'" 1 
ATOM   6905 C  "C3'" . DA  E 2 9   ? 43.178  -11.486 -24.630 1.00 72.81  ? 12   DA  E "C3'" 1 
ATOM   6906 O  "O3'" . DA  E 2 9   ? 44.369  -12.002 -25.247 1.00 74.55  ? 12   DA  E "O3'" 1 
ATOM   6907 C  "C2'" . DA  E 2 9   ? 42.037  -12.492 -24.515 1.00 72.00  ? 12   DA  E "C2'" 1 
ATOM   6908 C  "C1'" . DA  E 2 9   ? 42.624  -13.439 -23.466 1.00 71.09  ? 12   DA  E "C1'" 1 
ATOM   6909 N  N9    . DA  E 2 9   ? 41.671  -14.310 -22.771 1.00 70.14  ? 12   DA  E N9    1 
ATOM   6910 C  C8    . DA  E 2 9   ? 40.319  -14.150 -22.639 1.00 70.15  ? 12   DA  E C8    1 
ATOM   6911 N  N7    . DA  E 2 9   ? 39.731  -15.103 -21.955 1.00 69.84  ? 12   DA  E N7    1 
ATOM   6912 C  C5    . DA  E 2 9   ? 40.767  -15.945 -21.609 1.00 68.96  ? 12   DA  E C5    1 
ATOM   6913 C  C6    . DA  E 2 9   ? 40.814  -17.142 -20.877 1.00 68.75  ? 12   DA  E C6    1 
ATOM   6914 N  N6    . DA  E 2 9   ? 39.747  -17.723 -20.334 1.00 69.38  ? 12   DA  E N6    1 
ATOM   6915 N  N1    . DA  E 2 9   ? 42.006  -17.734 -20.713 1.00 68.83  ? 12   DA  E N1    1 
ATOM   6916 C  C2    . DA  E 2 9   ? 43.084  -17.162 -21.251 1.00 68.89  ? 12   DA  E C2    1 
ATOM   6917 N  N3    . DA  E 2 9   ? 43.164  -16.039 -21.957 1.00 68.93  ? 12   DA  E N3    1 
ATOM   6918 C  C4    . DA  E 2 9   ? 41.963  -15.473 -22.101 1.00 69.09  ? 12   DA  E C4    1 
ATOM   6919 P  P     . DG  E 2 10  ? 44.474  -12.685 -26.697 1.00 75.56  ? 13   DG  E P     1 
ATOM   6920 O  OP1   . DG  E 2 10  ? 44.706  -11.573 -27.644 1.00 75.72  ? 13   DG  E OP1   1 
ATOM   6921 O  OP2   . DG  E 2 10  ? 43.351  -13.626 -26.925 1.00 75.46  ? 13   DG  E OP2   1 
ATOM   6922 O  "O5'" . DG  E 2 10  ? 45.806  -13.577 -26.583 1.00 75.21  ? 13   DG  E "O5'" 1 
ATOM   6923 C  "C5'" . DG  E 2 10  ? 46.160  -14.205 -25.344 1.00 74.86  ? 13   DG  E "C5'" 1 
ATOM   6924 C  "C4'" . DG  E 2 10  ? 46.275  -15.725 -25.430 1.00 74.40  ? 13   DG  E "C4'" 1 
ATOM   6925 O  "O4'" . DG  E 2 10  ? 45.224  -16.367 -24.659 1.00 73.67  ? 13   DG  E "O4'" 1 
ATOM   6926 C  "C3'" . DG  E 2 10  ? 46.191  -16.385 -26.803 1.00 74.76  ? 13   DG  E "C3'" 1 
ATOM   6927 O  "O3'" . DG  E 2 10  ? 46.996  -17.563 -26.713 1.00 76.38  ? 13   DG  E "O3'" 1 
ATOM   6928 C  "C2'" . DG  E 2 10  ? 44.707  -16.728 -26.894 1.00 73.64  ? 13   DG  E "C2'" 1 
ATOM   6929 C  "C1'" . DG  E 2 10  ? 44.572  -17.311 -25.492 1.00 72.95  ? 13   DG  E "C1'" 1 
ATOM   6930 N  N9    . DG  E 2 10  ? 43.227  -17.623 -24.984 1.00 71.83  ? 13   DG  E N9    1 
ATOM   6931 C  C8    . DG  E 2 10  ? 42.083  -16.853 -25.002 1.00 71.16  ? 13   DG  E C8    1 
ATOM   6932 N  N7    . DG  E 2 10  ? 41.051  -17.439 -24.455 1.00 70.48  ? 13   DG  E N7    1 
ATOM   6933 C  C5    . DG  E 2 10  ? 41.539  -18.678 -24.046 1.00 70.20  ? 13   DG  E C5    1 
ATOM   6934 C  C6    . DG  E 2 10  ? 40.900  -19.762 -23.389 1.00 69.44  ? 13   DG  E C6    1 
ATOM   6935 O  O6    . DG  E 2 10  ? 39.726  -19.842 -23.023 1.00 68.56  ? 13   DG  E O6    1 
ATOM   6936 N  N1    . DG  E 2 10  ? 41.760  -20.838 -23.158 1.00 69.28  ? 13   DG  E N1    1 
ATOM   6937 C  C2    . DG  E 2 10  ? 43.089  -20.876 -23.517 1.00 69.44  ? 13   DG  E C2    1 
ATOM   6938 N  N2    . DG  E 2 10  ? 43.778  -21.990 -23.219 1.00 68.91  ? 13   DG  E N2    1 
ATOM   6939 N  N3    . DG  E 2 10  ? 43.700  -19.868 -24.129 1.00 70.32  ? 13   DG  E N3    1 
ATOM   6940 C  C4    . DG  E 2 10  ? 42.873  -18.806 -24.364 1.00 70.87  ? 13   DG  E C4    1 
ATOM   6941 P  P     . DT  E 2 11  ? 47.693  -18.279 -27.968 1.00 77.60  ? 14   DT  E P     1 
ATOM   6942 O  OP1   . DT  E 2 11  ? 49.148  -18.327 -27.682 1.00 77.38  ? 14   DT  E OP1   1 
ATOM   6943 O  OP2   . DT  E 2 11  ? 47.176  -17.684 -29.230 1.00 77.24  ? 14   DT  E OP2   1 
ATOM   6944 O  "O5'" . DT  E 2 11  ? 47.134  -19.775 -27.857 1.00 77.03  ? 14   DT  E "O5'" 1 
ATOM   6945 C  "C5'" . DT  E 2 11  ? 47.720  -20.723 -26.965 1.00 75.81  ? 14   DT  E "C5'" 1 
ATOM   6946 C  "C4'" . DT  E 2 11  ? 46.917  -22.013 -26.986 1.00 74.66  ? 14   DT  E "C4'" 1 
ATOM   6947 O  "O4'" . DT  E 2 11  ? 45.568  -21.772 -26.505 1.00 74.03  ? 14   DT  E "O4'" 1 
ATOM   6948 C  "C3'" . DT  E 2 11  ? 46.741  -22.647 -28.362 1.00 73.66  ? 14   DT  E "C3'" 1 
ATOM   6949 O  "O3'" . DT  E 2 11  ? 46.894  -24.052 -28.243 1.00 72.82  ? 14   DT  E "O3'" 1 
ATOM   6950 C  "C2'" . DT  E 2 11  ? 45.311  -22.277 -28.747 1.00 73.14  ? 14   DT  E "C2'" 1 
ATOM   6951 C  "C1'" . DT  E 2 11  ? 44.672  -22.433 -27.375 1.00 72.87  ? 14   DT  E "C1'" 1 
ATOM   6952 N  N1    . DT  E 2 11  ? 43.311  -21.847 -27.199 1.00 71.97  ? 14   DT  E N1    1 
ATOM   6953 C  C2    . DT  E 2 11  ? 42.383  -22.525 -26.424 1.00 71.60  ? 14   DT  E C2    1 
ATOM   6954 O  O2    . DT  E 2 11  ? 42.603  -23.589 -25.868 1.00 71.95  ? 14   DT  E O2    1 
ATOM   6955 N  N3    . DT  E 2 11  ? 41.163  -21.909 -26.314 1.00 70.99  ? 14   DT  E N3    1 
ATOM   6956 C  C4    . DT  E 2 11  ? 40.789  -20.708 -26.885 1.00 71.04  ? 14   DT  E C4    1 
ATOM   6957 O  O4    . DT  E 2 11  ? 39.665  -20.248 -26.717 1.00 71.18  ? 14   DT  E O4    1 
ATOM   6958 C  C5    . DT  E 2 11  ? 41.807  -20.050 -27.680 1.00 70.87  ? 14   DT  E C5    1 
ATOM   6959 C  C7    . DT  E 2 11  ? 41.533  -18.743 -28.356 1.00 70.57  ? 14   DT  E C7    1 
ATOM   6960 C  C6    . DT  E 2 11  ? 43.003  -20.639 -27.796 1.00 71.24  ? 14   DT  E C6    1 
ATOM   6961 P  P     . DA  E 2 12  ? 47.352  -24.865 -29.539 1.00 72.40  ? 15   DA  E P     1 
ATOM   6962 O  OP1   . DA  E 2 12  ? 48.701  -24.365 -29.882 1.00 72.79  ? 15   DA  E OP1   1 
ATOM   6963 O  OP2   . DA  E 2 12  ? 46.272  -24.760 -30.554 1.00 72.35  ? 15   DA  E OP2   1 
ATOM   6964 O  "O5'" . DA  E 2 12  ? 47.478  -26.383 -29.014 1.00 70.21  ? 15   DA  E "O5'" 1 
ATOM   6965 C  "C5'" . DA  E 2 12  ? 46.644  -27.417 -29.523 1.00 66.72  ? 15   DA  E "C5'" 1 
ATOM   6966 C  "C4'" . DA  E 2 12  ? 45.365  -27.530 -28.713 1.00 64.18  ? 15   DA  E "C4'" 1 
ATOM   6967 O  "O4'" . DA  E 2 12  ? 44.675  -26.268 -28.635 1.00 63.16  ? 15   DA  E "O4'" 1 
ATOM   6968 C  "C3'" . DA  E 2 12  ? 44.325  -28.440 -29.322 1.00 63.02  ? 15   DA  E "C3'" 1 
ATOM   6969 O  "O3'" . DA  E 2 12  ? 44.643  -29.761 -28.924 1.00 62.74  ? 15   DA  E "O3'" 1 
ATOM   6970 C  "C2'" . DA  E 2 12  ? 43.024  -27.946 -28.691 1.00 62.20  ? 15   DA  E "C2'" 1 
ATOM   6971 C  "C1'" . DA  E 2 12  ? 43.337  -26.521 -28.256 1.00 62.30  ? 15   DA  E "C1'" 1 
ATOM   6972 N  N9    . DA  E 2 12  ? 42.447  -25.488 -28.814 1.00 61.72  ? 15   DA  E N9    1 
ATOM   6973 C  C8    . DA  E 2 12  ? 42.763  -24.511 -29.721 1.00 60.83  ? 15   DA  E C8    1 
ATOM   6974 N  N7    . DA  E 2 12  ? 41.772  -23.712 -30.032 1.00 59.91  ? 15   DA  E N7    1 
ATOM   6975 C  C5    . DA  E 2 12  ? 40.728  -24.186 -29.275 1.00 60.47  ? 15   DA  E C5    1 
ATOM   6976 C  C6    . DA  E 2 12  ? 39.394  -23.770 -29.147 1.00 60.76  ? 15   DA  E C6    1 
ATOM   6977 N  N6    . DA  E 2 12  ? 38.900  -22.746 -29.821 1.00 61.63  ? 15   DA  E N6    1 
ATOM   6978 N  N1    . DA  E 2 12  ? 38.578  -24.434 -28.308 1.00 61.19  ? 15   DA  E N1    1 
ATOM   6979 C  C2    . DA  E 2 12  ? 39.086  -25.473 -27.629 1.00 61.79  ? 15   DA  E C2    1 
ATOM   6980 N  N3    . DA  E 2 12  ? 40.331  -25.963 -27.660 1.00 62.13  ? 15   DA  E N3    1 
ATOM   6981 C  C4    . DA  E 2 12  ? 41.115  -25.272 -28.516 1.00 61.45  ? 15   DA  E C4    1 
HETATM 6982 N  N1    . 5IU E 2 13  ? 39.449  -27.970 -30.699 1.00 77.44  ? 16   5IU E N1    1 
HETATM 6983 C  C2    . 5IU E 2 13  ? 38.359  -27.121 -30.973 1.00 78.90  ? 16   5IU E C2    1 
HETATM 6984 N  N3    . 5IU E 2 13  ? 38.511  -26.068 -31.778 1.00 82.25  ? 16   5IU E N3    1 
HETATM 6985 C  C4    . 5IU E 2 13  ? 39.684  -25.759 -32.355 1.00 87.80  ? 16   5IU E C4    1 
HETATM 6986 C  C5    . 5IU E 2 13  ? 40.928  -26.595 -32.127 1.00 91.12  ? 16   5IU E C5    1 
HETATM 6987 C  C6    . 5IU E 2 13  ? 40.676  -27.697 -31.253 1.00 85.79  ? 16   5IU E C6    1 
HETATM 6988 O  O2    . 5IU E 2 13  ? 37.244  -27.363 -30.463 1.00 77.01  ? 16   5IU E O2    1 
HETATM 6989 O  O4    . 5IU E 2 13  ? 39.684  -24.751 -33.091 1.00 86.98  ? 16   5IU E O4    1 
HETATM 6990 I  I5    . 5IU E 2 13  ? 42.869  -26.169 -33.023 1.00 108.58 ? 16   5IU E I5    1 
HETATM 6991 C  "C1'" . 5IU E 2 13  ? 39.184  -29.105 -29.770 1.00 70.64  ? 16   5IU E "C1'" 1 
HETATM 6992 C  "C2'" . 5IU E 2 13  ? 38.397  -30.274 -30.357 1.00 65.75  ? 16   5IU E "C2'" 1 
HETATM 6993 C  "C3'" . 5IU E 2 13  ? 39.169  -31.518 -29.948 1.00 62.07  ? 16   5IU E "C3'" 1 
HETATM 6994 C  "C4'" . 5IU E 2 13  ? 40.143  -31.050 -28.916 1.00 63.53  ? 16   5IU E "C4'" 1 
HETATM 6995 O  "O3'" . 5IU E 2 13  ? 38.384  -32.495 -29.284 1.00 57.65  ? 16   5IU E "O3'" 1 
HETATM 6996 O  "O4'" . 5IU E 2 13  ? 40.365  -29.677 -29.204 1.00 66.77  ? 16   5IU E "O4'" 1 
HETATM 6997 C  "C5'" . 5IU E 2 13  ? 41.418  -31.848 -29.046 1.00 63.05  ? 16   5IU E "C5'" 1 
HETATM 6998 O  "O5'" . 5IU E 2 13  ? 42.460  -30.943 -28.737 1.00 62.81  ? 16   5IU E "O5'" 1 
HETATM 6999 P  P     . 5IU E 2 13  ? 43.840  -30.994 -29.537 1.00 62.27  ? 16   5IU E P     1 
HETATM 7000 O  OP1   . 5IU E 2 13  ? 44.474  -32.283 -29.100 1.00 62.13  ? 16   5IU E OP1   1 
HETATM 7001 O  OP2   . 5IU E 2 13  ? 43.601  -30.680 -30.994 1.00 62.32  ? 16   5IU E OP2   1 
ATOM   7002 P  P     . DG  E 2 14  ? 38.593  -34.063 -29.538 1.00 54.03  ? 17   DG  E P     1 
ATOM   7003 O  OP1   . DG  E 2 14  ? 39.092  -34.661 -28.291 1.00 54.12  ? 17   DG  E OP1   1 
ATOM   7004 O  OP2   . DG  E 2 14  ? 39.376  -34.241 -30.772 1.00 54.10  ? 17   DG  E OP2   1 
ATOM   7005 O  "O5'" . DG  E 2 14  ? 37.097  -34.594 -29.793 1.00 52.69  ? 17   DG  E "O5'" 1 
ATOM   7006 C  "C5'" . DG  E 2 14  ? 35.957  -33.697 -29.732 1.00 50.93  ? 17   DG  E "C5'" 1 
ATOM   7007 C  "C4'" . DG  E 2 14  ? 35.218  -33.328 -31.035 1.00 49.07  ? 17   DG  E "C4'" 1 
ATOM   7008 O  "O4'" . DG  E 2 14  ? 35.531  -32.015 -31.584 1.00 47.48  ? 17   DG  E "O4'" 1 
ATOM   7009 C  "C3'" . DG  E 2 14  ? 35.370  -34.230 -32.238 1.00 49.15  ? 17   DG  E "C3'" 1 
ATOM   7010 O  "O3'" . DG  E 2 14  ? 34.094  -34.261 -32.790 1.00 51.49  ? 17   DG  E "O3'" 1 
ATOM   7011 C  "C2'" . DG  E 2 14  ? 36.331  -33.490 -33.158 1.00 47.04  ? 17   DG  E "C2'" 1 
ATOM   7012 C  "C1'" . DG  E 2 14  ? 35.746  -32.107 -32.980 1.00 45.15  ? 17   DG  E "C1'" 1 
ATOM   7013 N  N9    . DG  E 2 14  ? 36.576  -30.997 -33.451 1.00 42.92  ? 17   DG  E N9    1 
ATOM   7014 C  C8    . DG  E 2 14  ? 37.882  -31.026 -33.862 1.00 41.99  ? 17   DG  E C8    1 
ATOM   7015 N  N7    . DG  E 2 14  ? 38.345  -29.860 -34.232 1.00 41.34  ? 17   DG  E N7    1 
ATOM   7016 C  C5    . DG  E 2 14  ? 37.281  -28.991 -34.060 1.00 41.00  ? 17   DG  E C5    1 
ATOM   7017 C  C6    . DG  E 2 14  ? 37.173  -27.597 -34.299 1.00 40.15  ? 17   DG  E C6    1 
ATOM   7018 O  O6    . DG  E 2 14  ? 38.021  -26.808 -34.715 1.00 39.50  ? 17   DG  E O6    1 
ATOM   7019 N  N1    . DG  E 2 14  ? 35.912  -27.113 -33.999 1.00 40.43  ? 17   DG  E N1    1 
ATOM   7020 C  C2    . DG  E 2 14  ? 34.881  -27.885 -33.512 1.00 41.16  ? 17   DG  E C2    1 
ATOM   7021 N  N2    . DG  E 2 14  ? 33.717  -27.269 -33.264 1.00 42.37  ? 17   DG  E N2    1 
ATOM   7022 N  N3    . DG  E 2 14  ? 34.962  -29.185 -33.287 1.00 41.40  ? 17   DG  E N3    1 
ATOM   7023 C  C4    . DG  E 2 14  ? 36.188  -29.679 -33.580 1.00 41.88  ? 17   DG  E C4    1 
ATOM   7024 P  P     . DA  E 2 15  ? 33.535  -35.674 -33.266 1.00 54.21  ? 18   DA  E P     1 
ATOM   7025 O  OP1   . DA  E 2 15  ? 33.568  -36.613 -32.113 1.00 53.91  ? 18   DA  E OP1   1 
ATOM   7026 O  OP2   . DA  E 2 15  ? 34.230  -35.981 -34.545 1.00 53.17  ? 18   DA  E OP2   1 
ATOM   7027 O  "O5'" . DA  E 2 15  ? 31.989  -35.368 -33.569 1.00 54.85  ? 18   DA  E "O5'" 1 
ATOM   7028 C  "C5'" . DA  E 2 15  ? 31.229  -34.422 -32.797 1.00 54.05  ? 18   DA  E "C5'" 1 
ATOM   7029 C  "C4'" . DA  E 2 15  ? 30.540  -33.394 -33.694 1.00 52.85  ? 18   DA  E "C4'" 1 
ATOM   7030 O  "O4'" . DA  E 2 15  ? 31.475  -32.377 -34.124 1.00 51.14  ? 18   DA  E "O4'" 1 
ATOM   7031 C  "C3'" . DA  E 2 15  ? 29.912  -33.906 -34.991 1.00 52.91  ? 18   DA  E "C3'" 1 
ATOM   7032 O  "O3'" . DA  E 2 15  ? 28.805  -33.023 -35.267 1.00 54.92  ? 18   DA  E "O3'" 1 
ATOM   7033 C  "C2'" . DA  E 2 15  ? 31.056  -33.763 -35.991 1.00 51.10  ? 18   DA  E "C2'" 1 
ATOM   7034 C  "C1'" . DA  E 2 15  ? 31.533  -32.389 -35.533 1.00 50.25  ? 18   DA  E "C1'" 1 
ATOM   7035 N  N9    . DA  E 2 15  ? 32.872  -31.976 -35.920 1.00 49.19  ? 18   DA  E N9    1 
ATOM   7036 C  C8    . DA  E 2 15  ? 33.988  -32.728 -36.152 1.00 48.86  ? 18   DA  E C8    1 
ATOM   7037 N  N7    . DA  E 2 15  ? 35.040  -32.014 -36.482 1.00 48.41  ? 18   DA  E N7    1 
ATOM   7038 C  C5    . DA  E 2 15  ? 34.576  -30.707 -36.459 1.00 48.66  ? 18   DA  E C5    1 
ATOM   7039 C  C6    . DA  E 2 15  ? 35.181  -29.450 -36.710 1.00 48.88  ? 18   DA  E C6    1 
ATOM   7040 N  N6    . DA  E 2 15  ? 36.461  -29.302 -37.056 1.00 49.54  ? 18   DA  E N6    1 
ATOM   7041 N  N1    . DA  E 2 15  ? 34.427  -28.336 -36.592 1.00 48.34  ? 18   DA  E N1    1 
ATOM   7042 C  C2    . DA  E 2 15  ? 33.142  -28.470 -36.243 1.00 48.34  ? 18   DA  E C2    1 
ATOM   7043 N  N3    . DA  E 2 15  ? 32.464  -29.585 -35.972 1.00 48.31  ? 18   DA  E N3    1 
ATOM   7044 C  C4    . DA  E 2 15  ? 33.243  -30.673 -36.107 1.00 48.70  ? 18   DA  E C4    1 
ATOM   7045 P  P     . DA  E 2 16  ? 27.786  -33.270 -36.484 1.00 55.14  ? 19   DA  E P     1 
ATOM   7046 O  OP1   . DA  E 2 16  ? 27.406  -34.697 -36.376 1.00 55.84  ? 19   DA  E OP1   1 
ATOM   7047 O  OP2   . DA  E 2 16  ? 28.454  -32.783 -37.712 1.00 54.74  ? 19   DA  E OP2   1 
ATOM   7048 O  "O5'" . DA  E 2 16  ? 26.481  -32.363 -36.226 1.00 52.82  ? 19   DA  E "O5'" 1 
ATOM   7049 C  "C5'" . DA  E 2 16  ? 26.561  -31.050 -35.701 1.00 51.10  ? 19   DA  E "C5'" 1 
ATOM   7050 C  "C4'" . DA  E 2 16  ? 27.020  -30.017 -36.716 1.00 50.31  ? 19   DA  E "C4'" 1 
ATOM   7051 O  "O4'" . DA  E 2 16  ? 28.400  -30.188 -37.062 1.00 48.49  ? 19   DA  E "O4'" 1 
ATOM   7052 C  "C3'" . DA  E 2 16  ? 26.300  -29.949 -38.049 1.00 51.48  ? 19   DA  E "C3'" 1 
ATOM   7053 O  "O3'" . DA  E 2 16  ? 25.570  -28.749 -37.901 1.00 54.76  ? 19   DA  E "O3'" 1 
ATOM   7054 C  "C2'" . DA  E 2 16  ? 27.416  -29.869 -39.103 1.00 49.51  ? 19   DA  E "C2'" 1 
ATOM   7055 C  "C1'" . DA  E 2 16  ? 28.638  -29.523 -38.269 1.00 47.17  ? 19   DA  E "C1'" 1 
ATOM   7056 N  N9    . DA  E 2 16  ? 29.954  -30.023 -38.667 1.00 45.45  ? 19   DA  E N9    1 
ATOM   7057 C  C8    . DA  E 2 16  ? 30.402  -31.317 -38.682 1.00 44.05  ? 19   DA  E C8    1 
ATOM   7058 N  N7    . DA  E 2 16  ? 31.653  -31.458 -39.045 1.00 43.67  ? 19   DA  E N7    1 
ATOM   7059 C  C5    . DA  E 2 16  ? 32.073  -30.157 -39.280 1.00 44.42  ? 19   DA  E C5    1 
ATOM   7060 C  C6    . DA  E 2 16  ? 33.308  -29.594 -39.698 1.00 44.44  ? 19   DA  E C6    1 
ATOM   7061 N  N6    . DA  E 2 16  ? 34.403  -30.299 -39.976 1.00 44.63  ? 19   DA  E N6    1 
ATOM   7062 N  N1    . DA  E 2 16  ? 33.390  -28.256 -39.830 1.00 44.61  ? 19   DA  E N1    1 
ATOM   7063 C  C2    . DA  E 2 16  ? 32.301  -27.519 -39.558 1.00 45.40  ? 19   DA  E C2    1 
ATOM   7064 N  N3    . DA  E 2 16  ? 31.090  -27.919 -39.160 1.00 45.42  ? 19   DA  E N3    1 
ATOM   7065 C  C4    . DA  E 2 16  ? 31.039  -29.263 -39.040 1.00 45.05  ? 19   DA  E C4    1 
ATOM   7066 P  P     . DA  E 2 17  ? 24.682  -28.044 -39.025 1.00 56.95  ? 20   DA  E P     1 
ATOM   7067 O  OP1   . DA  E 2 17  ? 23.888  -27.054 -38.243 1.00 56.21  ? 20   DA  E OP1   1 
ATOM   7068 O  OP2   . DA  E 2 17  ? 24.037  -29.071 -39.885 1.00 56.34  ? 20   DA  E OP2   1 
ATOM   7069 O  "O5'" . DA  E 2 17  ? 25.758  -27.282 -39.939 1.00 55.64  ? 20   DA  E "O5'" 1 
ATOM   7070 C  "C5'" . DA  E 2 17  ? 26.164  -25.982 -39.541 1.00 54.34  ? 20   DA  E "C5'" 1 
ATOM   7071 C  "C4'" . DA  E 2 17  ? 27.127  -25.411 -40.551 1.00 52.75  ? 20   DA  E "C4'" 1 
ATOM   7072 O  "O4'" . DA  E 2 17  ? 28.231  -26.335 -40.652 1.00 51.83  ? 20   DA  E "O4'" 1 
ATOM   7073 C  "C3'" . DA  E 2 17  ? 26.553  -25.251 -41.955 1.00 52.55  ? 20   DA  E "C3'" 1 
ATOM   7074 O  "O3'" . DA  E 2 17  ? 26.917  -23.954 -42.493 1.00 53.15  ? 20   DA  E "O3'" 1 
ATOM   7075 C  "C2'" . DA  E 2 17  ? 27.187  -26.421 -42.709 1.00 52.00  ? 20   DA  E "C2'" 1 
ATOM   7076 C  "C1'" . DA  E 2 17  ? 28.539  -26.459 -42.015 1.00 51.28  ? 20   DA  E "C1'" 1 
ATOM   7077 N  N9    . DA  E 2 17  ? 29.311  -27.678 -42.197 1.00 50.05  ? 20   DA  E N9    1 
ATOM   7078 C  C8    . DA  E 2 17  ? 28.884  -28.968 -42.053 1.00 49.77  ? 20   DA  E C8    1 
ATOM   7079 N  N7    . DA  E 2 17  ? 29.816  -29.867 -42.282 1.00 49.13  ? 20   DA  E N7    1 
ATOM   7080 C  C5    . DA  E 2 17  ? 30.929  -29.108 -42.585 1.00 48.54  ? 20   DA  E C5    1 
ATOM   7081 C  C6    . DA  E 2 17  ? 32.247  -29.467 -42.921 1.00 47.86  ? 20   DA  E C6    1 
ATOM   7082 N  N6    . DA  E 2 17  ? 32.664  -30.730 -43.006 1.00 46.46  ? 20   DA  E N6    1 
ATOM   7083 N  N1    . DA  E 2 17  ? 33.116  -28.463 -43.164 1.00 48.51  ? 20   DA  E N1    1 
ATOM   7084 C  C2    . DA  E 2 17  ? 32.687  -27.187 -43.085 1.00 48.72  ? 20   DA  E C2    1 
ATOM   7085 N  N3    . DA  E 2 17  ? 31.475  -26.725 -42.779 1.00 48.44  ? 20   DA  E N3    1 
ATOM   7086 C  C4    . DA  E 2 17  ? 30.637  -27.752 -42.539 1.00 49.01  ? 20   DA  E C4    1 
ATOM   7087 P  P     . DT  E 2 18  ? 26.287  -23.346 -43.856 1.00 53.32  ? 21   DT  E P     1 
ATOM   7088 O  OP1   . DT  E 2 18  ? 25.492  -22.138 -43.514 1.00 52.21  ? 21   DT  E OP1   1 
ATOM   7089 O  OP2   . DT  E 2 18  ? 25.611  -24.477 -44.552 1.00 54.19  ? 21   DT  E OP2   1 
ATOM   7090 O  "O5'" . DT  E 2 18  ? 27.562  -22.912 -44.751 1.00 51.30  ? 21   DT  E "O5'" 1 
ATOM   7091 C  "C5'" . DT  E 2 18  ? 28.930  -23.106 -44.350 1.00 49.13  ? 21   DT  E "C5'" 1 
ATOM   7092 C  "C4'" . DT  E 2 18  ? 29.779  -23.919 -45.330 1.00 47.62  ? 21   DT  E "C4'" 1 
ATOM   7093 O  "O4'" . DT  E 2 18  ? 29.856  -25.320 -44.953 1.00 46.87  ? 21   DT  E "O4'" 1 
ATOM   7094 C  "C3'" . DT  E 2 18  ? 29.377  -23.923 -46.813 1.00 46.80  ? 21   DT  E "C3'" 1 
ATOM   7095 O  "O3'" . DT  E 2 18  ? 30.467  -23.421 -47.596 1.00 45.63  ? 21   DT  E "O3'" 1 
ATOM   7096 C  "C2'" . DT  E 2 18  ? 29.126  -25.402 -47.111 1.00 46.41  ? 21   DT  E "C2'" 1 
ATOM   7097 C  "C1'" . DT  E 2 18  ? 30.177  -25.955 -46.164 1.00 46.28  ? 21   DT  E "C1'" 1 
ATOM   7098 N  N1    . DT  E 2 18  ? 30.264  -27.424 -46.000 1.00 45.77  ? 21   DT  E N1    1 
ATOM   7099 C  C2    . DT  E 2 18  ? 31.487  -28.007 -46.261 1.00 45.25  ? 21   DT  E C2    1 
ATOM   7100 O  O2    . DT  E 2 18  ? 32.468  -27.377 -46.617 1.00 45.27  ? 21   DT  E O2    1 
ATOM   7101 N  N3    . DT  E 2 18  ? 31.522  -29.367 -46.096 1.00 44.91  ? 21   DT  E N3    1 
ATOM   7102 C  C4    . DT  E 2 18  ? 30.471  -30.175 -45.699 1.00 45.16  ? 21   DT  E C4    1 
ATOM   7103 O  O4    . DT  E 2 18  ? 30.584  -31.381 -45.570 1.00 45.65  ? 21   DT  E O4    1 
ATOM   7104 C  C5    . DT  E 2 18  ? 29.220  -29.516 -45.440 1.00 45.70  ? 21   DT  E C5    1 
ATOM   7105 C  C7    . DT  E 2 18  ? 28.041  -30.350 -45.014 1.00 45.32  ? 21   DT  E C7    1 
ATOM   7106 C  C6    . DT  E 2 18  ? 29.170  -28.176 -45.597 1.00 46.09  ? 21   DT  E C6    1 
ATOM   7107 P  P     . DG  E 2 19  ? 30.225  -22.661 -48.981 1.00 44.04  ? 22   DG  E P     1 
ATOM   7108 O  OP1   . DG  E 2 19  ? 29.861  -21.266 -48.670 1.00 43.69  ? 22   DG  E OP1   1 
ATOM   7109 O  OP2   . DG  E 2 19  ? 29.319  -23.497 -49.794 1.00 43.81  ? 22   DG  E OP2   1 
ATOM   7110 O  "O5'" . DG  E 2 19  ? 31.659  -22.648 -49.692 1.00 44.37  ? 22   DG  E "O5'" 1 
ATOM   7111 C  "C5'" . DG  E 2 19  ? 32.862  -23.010 -49.009 1.00 44.32  ? 22   DG  E "C5'" 1 
ATOM   7112 C  "C4'" . DG  E 2 19  ? 33.600  -24.185 -49.648 1.00 43.80  ? 22   DG  E "C4'" 1 
ATOM   7113 O  "O4'" . DG  E 2 19  ? 33.088  -25.436 -49.130 1.00 43.10  ? 22   DG  E "O4'" 1 
ATOM   7114 C  "C3'" . DG  E 2 19  ? 33.514  -24.318 -51.166 1.00 44.07  ? 22   DG  E "C3'" 1 
ATOM   7115 O  "O3'" . DG  E 2 19  ? 34.731  -23.858 -51.779 1.00 45.38  ? 22   DG  E "O3'" 1 
ATOM   7116 C  "C2'" . DG  E 2 19  ? 33.239  -25.808 -51.398 1.00 43.46  ? 22   DG  E "C2'" 1 
ATOM   7117 C  "C1'" . DG  E 2 19  ? 33.476  -26.437 -50.038 1.00 42.84  ? 22   DG  E "C1'" 1 
ATOM   7118 N  N9    . DG  E 2 19  ? 32.665  -27.625 -49.794 1.00 42.46  ? 22   DG  E N9    1 
ATOM   7119 C  C8    . DG  E 2 19  ? 31.345  -27.648 -49.411 1.00 42.10  ? 22   DG  E C8    1 
ATOM   7120 N  N7    . DG  E 2 19  ? 30.869  -28.852 -49.255 1.00 41.80  ? 22   DG  E N7    1 
ATOM   7121 C  C5    . DG  E 2 19  ? 31.937  -29.691 -49.559 1.00 41.87  ? 22   DG  E C5    1 
ATOM   7122 C  C6    . DG  E 2 19  ? 32.027  -31.113 -49.567 1.00 41.42  ? 22   DG  E C6    1 
ATOM   7123 O  O6    . DG  E 2 19  ? 31.157  -31.945 -49.302 1.00 40.77  ? 22   DG  E O6    1 
ATOM   7124 N  N1    . DG  E 2 19  ? 33.288  -31.577 -49.927 1.00 41.73  ? 22   DG  E N1    1 
ATOM   7125 C  C2    . DG  E 2 19  ? 34.347  -30.760 -50.250 1.00 42.44  ? 22   DG  E C2    1 
ATOM   7126 N  N2    . DG  E 2 19  ? 35.491  -31.393 -50.572 1.00 42.70  ? 22   DG  E N2    1 
ATOM   7127 N  N3    . DG  E 2 19  ? 34.282  -29.421 -50.246 1.00 42.46  ? 22   DG  E N3    1 
ATOM   7128 C  C4    . DG  E 2 19  ? 33.053  -28.949 -49.894 1.00 42.20  ? 22   DG  E C4    1 
ATOM   7129 P  P     . DT  E 2 20  ? 35.171  -24.254 -53.280 1.00 47.05  ? 23   DT  E P     1 
ATOM   7130 O  OP1   . DT  E 2 20  ? 36.236  -23.311 -53.693 1.00 47.02  ? 23   DT  E OP1   1 
ATOM   7131 O  OP2   . DT  E 2 20  ? 33.971  -24.468 -54.134 1.00 46.06  ? 23   DT  E OP2   1 
ATOM   7132 O  "O5'" . DT  E 2 20  ? 35.854  -25.680 -53.051 1.00 47.84  ? 23   DT  E "O5'" 1 
ATOM   7133 C  "C5'" . DT  E 2 20  ? 37.261  -25.900 -53.153 1.00 48.43  ? 23   DT  E "C5'" 1 
ATOM   7134 C  "C4'" . DT  E 2 20  ? 37.486  -27.207 -53.892 1.00 49.08  ? 23   DT  E "C4'" 1 
ATOM   7135 O  "O4'" . DT  E 2 20  ? 36.624  -28.272 -53.387 1.00 48.98  ? 23   DT  E "O4'" 1 
ATOM   7136 C  "C3'" . DT  E 2 20  ? 37.179  -27.091 -55.376 1.00 49.63  ? 23   DT  E "C3'" 1 
ATOM   7137 O  "O3'" . DT  E 2 20  ? 38.260  -27.683 -56.101 1.00 50.86  ? 23   DT  E "O3'" 1 
ATOM   7138 C  "C2'" . DT  E 2 20  ? 35.832  -27.803 -55.537 1.00 48.78  ? 23   DT  E "C2'" 1 
ATOM   7139 C  "C1'" . DT  E 2 20  ? 35.897  -28.867 -54.449 1.00 48.17  ? 23   DT  E "C1'" 1 
ATOM   7140 N  N1    . DT  E 2 20  ? 34.526  -29.376 -54.018 1.00 47.33  ? 23   DT  E N1    1 
ATOM   7141 C  C2    . DT  E 2 20  ? 34.337  -30.730 -53.765 1.00 46.65  ? 23   DT  E C2    1 
ATOM   7142 O  O2    . DT  E 2 20  ? 35.233  -31.556 -53.848 1.00 46.55  ? 23   DT  E O2    1 
ATOM   7143 N  N3    . DT  E 2 20  ? 33.049  -31.090 -53.398 1.00 45.87  ? 23   DT  E N3    1 
ATOM   7144 C  C4    . DT  E 2 20  ? 31.942  -30.257 -53.262 1.00 45.31  ? 23   DT  E C4    1 
ATOM   7145 O  O4    . DT  E 2 20  ? 30.832  -30.678 -52.929 1.00 43.30  ? 23   DT  E O4    1 
ATOM   7146 C  C5    . DT  E 2 20  ? 32.209  -28.858 -53.545 1.00 45.85  ? 23   DT  E C5    1 
ATOM   7147 C  C7    . DT  E 2 20  ? 31.115  -27.840 -53.448 1.00 45.94  ? 23   DT  E C7    1 
ATOM   7148 C  C6    . DT  E 2 20  ? 33.457  -28.492 -53.904 1.00 46.67  ? 23   DT  E C6    1 
ATOM   7149 P  P     . DC  E 2 21  ? 38.113  -28.120 -57.636 1.00 51.18  ? 24   DC  E P     1 
ATOM   7150 O  OP1   . DC  E 2 21  ? 39.462  -28.260 -58.237 1.00 50.62  ? 24   DC  E OP1   1 
ATOM   7151 O  OP2   . DC  E 2 21  ? 37.119  -27.226 -58.285 1.00 51.41  ? 24   DC  E OP2   1 
ATOM   7152 O  "O5'" . DC  E 2 21  ? 37.460  -29.562 -57.430 1.00 50.47  ? 24   DC  E "O5'" 1 
ATOM   7153 C  "C5'" . DC  E 2 21  ? 38.260  -30.687 -57.112 1.00 49.51  ? 24   DC  E "C5'" 1 
ATOM   7154 C  "C4'" . DC  E 2 21  ? 37.575  -31.893 -57.717 1.00 49.03  ? 24   DC  E "C4'" 1 
ATOM   7155 O  "O4'" . DC  E 2 21  ? 36.286  -32.047 -57.073 1.00 48.32  ? 24   DC  E "O4'" 1 
ATOM   7156 C  "C3'" . DC  E 2 21  ? 37.299  -31.814 -59.225 1.00 48.60  ? 24   DC  E "C3'" 1 
ATOM   7157 O  "O3'" . DC  E 2 21  ? 37.659  -33.073 -59.794 1.00 48.29  ? 24   DC  E "O3'" 1 
ATOM   7158 C  "C2'" . DC  E 2 21  ? 35.797  -31.528 -59.307 1.00 47.94  ? 24   DC  E "C2'" 1 
ATOM   7159 C  "C1'" . DC  E 2 21  ? 35.335  -32.315 -58.080 1.00 47.80  ? 24   DC  E "C1'" 1 
ATOM   7160 N  N1    . DC  E 2 21  ? 33.983  -32.001 -57.534 1.00 47.14  ? 24   DC  E N1    1 
ATOM   7161 C  C2    . DC  E 2 21  ? 33.215  -33.053 -57.001 1.00 46.96  ? 24   DC  E C2    1 
ATOM   7162 O  O2    . DC  E 2 21  ? 33.666  -34.212 -56.996 1.00 46.82  ? 24   DC  E O2    1 
ATOM   7163 N  N3    . DC  E 2 21  ? 31.983  -32.767 -56.503 1.00 46.32  ? 24   DC  E N3    1 
ATOM   7164 C  C4    . DC  E 2 21  ? 31.533  -31.511 -56.526 1.00 45.80  ? 24   DC  E C4    1 
ATOM   7165 N  N4    . DC  E 2 21  ? 30.323  -31.295 -56.021 1.00 46.19  ? 24   DC  E N4    1 
ATOM   7166 C  C5    . DC  E 2 21  ? 32.294  -30.427 -57.060 1.00 45.72  ? 24   DC  E C5    1 
ATOM   7167 C  C6    . DC  E 2 21  ? 33.507  -30.715 -57.545 1.00 46.47  ? 24   DC  E C6    1 
ATOM   7168 P  P     . DG  E 2 22  ? 37.615  -33.365 -61.363 1.00 47.82  ? 25   DG  E P     1 
ATOM   7169 O  OP1   . DG  E 2 22  ? 38.615  -32.468 -61.987 1.00 47.45  ? 25   DG  E OP1   1 
ATOM   7170 O  OP2   . DG  E 2 22  ? 36.213  -33.328 -61.837 1.00 47.75  ? 25   DG  E OP2   1 
ATOM   7171 O  "O5'" . DG  E 2 22  ? 38.091  -34.904 -61.438 1.00 47.86  ? 25   DG  E "O5'" 1 
ATOM   7172 C  "C5'" . DG  E 2 22  ? 37.781  -35.920 -60.438 1.00 46.63  ? 25   DG  E "C5'" 1 
ATOM   7173 C  "C4'" . DG  E 2 22  ? 36.456  -36.649 -60.657 1.00 45.89  ? 25   DG  E "C4'" 1 
ATOM   7174 O  "O4'" . DG  E 2 22  ? 35.458  -35.911 -59.909 1.00 44.33  ? 25   DG  E "O4'" 1 
ATOM   7175 C  "C3'" . DG  E 2 22  ? 35.914  -36.736 -62.100 1.00 46.78  ? 25   DG  E "C3'" 1 
ATOM   7176 O  "O3'" . DG  E 2 22  ? 36.028  -38.030 -62.810 1.00 49.06  ? 25   DG  E "O3'" 1 
ATOM   7177 C  "C2'" . DG  E 2 22  ? 34.459  -36.284 -62.006 1.00 44.89  ? 25   DG  E "C2'" 1 
ATOM   7178 C  "C1'" . DG  E 2 22  ? 34.205  -36.109 -60.515 1.00 43.23  ? 25   DG  E "C1'" 1 
ATOM   7179 N  N9    . DG  E 2 22  ? 33.248  -35.014 -60.334 1.00 41.59  ? 25   DG  E N9    1 
ATOM   7180 C  C8    . DG  E 2 22  ? 33.327  -33.707 -60.772 1.00 41.15  ? 25   DG  E C8    1 
ATOM   7181 N  N7    . DG  E 2 22  ? 32.272  -32.983 -60.490 1.00 39.96  ? 25   DG  E N7    1 
ATOM   7182 C  C5    . DG  E 2 22  ? 31.429  -33.875 -59.836 1.00 39.32  ? 25   DG  E C5    1 
ATOM   7183 C  C6    . DG  E 2 22  ? 30.138  -33.684 -59.289 1.00 38.45  ? 25   DG  E C6    1 
ATOM   7184 O  O6    . DG  E 2 22  ? 29.467  -32.648 -59.283 1.00 37.83  ? 25   DG  E O6    1 
ATOM   7185 N  N1    . DG  E 2 22  ? 29.636  -34.853 -58.711 1.00 38.17  ? 25   DG  E N1    1 
ATOM   7186 C  C2    . DG  E 2 22  ? 30.307  -36.060 -58.670 1.00 38.15  ? 25   DG  E C2    1 
ATOM   7187 N  N2    . DG  E 2 22  ? 29.695  -37.099 -58.088 1.00 37.83  ? 25   DG  E N2    1 
ATOM   7188 N  N3    . DG  E 2 22  ? 31.513  -36.251 -59.175 1.00 38.82  ? 25   DG  E N3    1 
ATOM   7189 C  C4    . DG  E 2 22  ? 32.013  -35.123 -59.739 1.00 40.02  ? 25   DG  E C4    1 
ATOM   7190 P  P     . DT  E 2 23  ? 35.452  -39.484 -62.371 1.00 50.83  ? 26   DT  E P     1 
ATOM   7191 O  OP1   . DT  E 2 23  ? 35.777  -39.684 -60.936 1.00 50.99  ? 26   DT  E OP1   1 
ATOM   7192 O  OP2   . DT  E 2 23  ? 35.952  -40.443 -63.381 1.00 50.89  ? 26   DT  E OP2   1 
ATOM   7193 O  "O5'" . DT  E 2 23  ? 33.861  -39.502 -62.546 1.00 50.18  ? 26   DT  E "O5'" 1 
ATOM   7194 C  "C5'" . DT  E 2 23  ? 33.163  -40.698 -62.167 1.00 49.62  ? 26   DT  E "C5'" 1 
ATOM   7195 C  "C4'" . DT  E 2 23  ? 31.837  -40.425 -61.473 1.00 49.71  ? 26   DT  E "C4'" 1 
ATOM   7196 O  "O4'" . DT  E 2 23  ? 31.607  -38.996 -61.335 1.00 50.14  ? 26   DT  E "O4'" 1 
ATOM   7197 C  "C3'" . DT  E 2 23  ? 30.644  -40.947 -62.263 1.00 49.58  ? 26   DT  E "C3'" 1 
ATOM   7198 O  "O3'" . DT  E 2 23  ? 29.925  -41.961 -61.585 1.00 48.73  ? 26   DT  E "O3'" 1 
ATOM   7199 C  "C2'" . DT  E 2 23  ? 29.733  -39.739 -62.464 1.00 49.92  ? 26   DT  E "C2'" 1 
ATOM   7200 C  "C1'" . DT  E 2 23  ? 30.216  -38.763 -61.420 1.00 49.83  ? 26   DT  E "C1'" 1 
ATOM   7201 N  N1    . DT  E 2 23  ? 29.877  -37.338 -61.770 1.00 49.89  ? 26   DT  E N1    1 
ATOM   7202 C  C2    . DT  E 2 23  ? 28.683  -36.827 -61.289 1.00 50.26  ? 26   DT  E C2    1 
ATOM   7203 O  O2    . DT  E 2 23  ? 27.907  -37.476 -60.602 1.00 50.49  ? 26   DT  E O2    1 
ATOM   7204 N  N3    . DT  E 2 23  ? 28.434  -35.515 -61.634 1.00 50.16  ? 26   DT  E N3    1 
ATOM   7205 C  C4    . DT  E 2 23  ? 29.236  -34.685 -62.402 1.00 49.85  ? 26   DT  E C4    1 
ATOM   7206 O  O4    . DT  E 2 23  ? 28.908  -33.528 -62.642 1.00 49.50  ? 26   DT  E O4    1 
ATOM   7207 C  C5    . DT  E 2 23  ? 30.469  -35.280 -62.885 1.00 49.90  ? 26   DT  E C5    1 
ATOM   7208 C  C7    . DT  E 2 23  ? 31.428  -34.483 -63.729 1.00 49.67  ? 26   DT  E C7    1 
ATOM   7209 C  C6    . DT  E 2 23  ? 30.725  -36.561 -62.551 1.00 49.82  ? 26   DT  E C6    1 
ATOM   7210 P  P     . DT  E 2 24  ? 28.847  -42.791 -62.440 1.00 48.55  ? 27   DT  E P     1 
ATOM   7211 O  OP1   . DT  E 2 24  ? 29.463  -44.091 -62.804 1.00 48.25  ? 27   DT  E OP1   1 
ATOM   7212 O  OP2   . DT  E 2 24  ? 28.337  -41.951 -63.549 1.00 48.45  ? 27   DT  E OP2   1 
ATOM   7213 O  "O5'" . DT  E 2 24  ? 27.653  -43.004 -61.386 1.00 46.98  ? 27   DT  E "O5'" 1 
ATOM   7214 C  "C5'" . DT  E 2 24  ? 27.047  -41.905 -60.702 1.00 44.73  ? 27   DT  E "C5'" 1 
ATOM   7215 C  "C4'" . DT  E 2 24  ? 25.612  -41.595 -61.150 1.00 42.80  ? 27   DT  E "C4'" 1 
ATOM   7216 O  "O4'" . DT  E 2 24  ? 25.482  -40.172 -61.429 1.00 41.57  ? 27   DT  E "O4'" 1 
ATOM   7217 C  "C3'" . DT  E 2 24  ? 25.059  -42.313 -62.381 1.00 41.59  ? 27   DT  E "C3'" 1 
ATOM   7218 O  "O3'" . DT  E 2 24  ? 23.655  -42.521 -62.236 1.00 42.22  ? 27   DT  E "O3'" 1 
ATOM   7219 C  "C2'" . DT  E 2 24  ? 25.331  -41.285 -63.462 1.00 40.86  ? 27   DT  E "C2'" 1 
ATOM   7220 C  "C1'" . DT  E 2 24  ? 24.985  -39.996 -62.731 1.00 39.93  ? 27   DT  E "C1'" 1 
ATOM   7221 N  N1    . DT  E 2 24  ? 25.596  -38.784 -63.350 1.00 38.79  ? 27   DT  E N1    1 
ATOM   7222 C  C2    . DT  E 2 24  ? 24.917  -37.582 -63.292 1.00 38.17  ? 27   DT  E C2    1 
ATOM   7223 O  O2    . DT  E 2 24  ? 23.838  -37.456 -62.746 1.00 37.89  ? 27   DT  E O2    1 
ATOM   7224 N  N3    . DT  E 2 24  ? 25.552  -36.524 -63.904 1.00 37.76  ? 27   DT  E N3    1 
ATOM   7225 C  C4    . DT  E 2 24  ? 26.774  -36.553 -64.559 1.00 37.58  ? 27   DT  E C4    1 
ATOM   7226 O  O4    . DT  E 2 24  ? 27.261  -35.553 -65.078 1.00 36.95  ? 27   DT  E O4    1 
ATOM   7227 C  C5    . DT  E 2 24  ? 27.431  -37.842 -64.586 1.00 37.87  ? 27   DT  E C5    1 
ATOM   7228 C  C7    . DT  E 2 24  ? 28.759  -38.005 -65.264 1.00 37.98  ? 27   DT  E C7    1 
ATOM   7229 C  C6    . DT  E 2 24  ? 26.819  -38.879 -63.992 1.00 38.18  ? 27   DT  E C6    1 
ATOM   7230 P  P     . DT  E 2 25  ? 22.713  -43.218 -63.350 1.00 43.61  ? 28   DT  E P     1 
ATOM   7231 O  OP1   . DT  E 2 25  ? 21.811  -44.079 -62.556 1.00 44.20  ? 28   DT  E OP1   1 
ATOM   7232 O  OP2   . DT  E 2 25  ? 23.494  -43.799 -64.475 1.00 42.34  ? 28   DT  E OP2   1 
ATOM   7233 O  "O5'" . DT  E 2 25  ? 21.818  -42.016 -63.922 1.00 43.34  ? 28   DT  E "O5'" 1 
ATOM   7234 C  "C5'" . DT  E 2 25  ? 20.646  -41.595 -63.195 1.00 42.42  ? 28   DT  E "C5'" 1 
ATOM   7235 C  "C4'" . DT  E 2 25  ? 19.927  -40.430 -63.859 1.00 41.40  ? 28   DT  E "C4'" 1 
ATOM   7236 O  "O4'" . DT  E 2 25  ? 20.803  -39.275 -63.851 1.00 40.69  ? 28   DT  E "O4'" 1 
ATOM   7237 C  "C3'" . DT  E 2 25  ? 19.533  -40.618 -65.322 1.00 41.06  ? 28   DT  E "C3'" 1 
ATOM   7238 O  "O3'" . DT  E 2 25  ? 18.249  -41.235 -65.451 1.00 41.00  ? 28   DT  E "O3'" 1 
ATOM   7239 C  "C2'" . DT  E 2 25  ? 19.503  -39.184 -65.847 1.00 40.46  ? 28   DT  E "C2'" 1 
ATOM   7240 C  "C1'" . DT  E 2 25  ? 20.496  -38.438 -64.953 1.00 39.38  ? 28   DT  E "C1'" 1 
ATOM   7241 N  N1    . DT  E 2 25  ? 21.772  -37.996 -65.635 1.00 37.57  ? 28   DT  E N1    1 
ATOM   7242 C  C2    . DT  E 2 25  ? 21.957  -36.656 -65.941 1.00 36.97  ? 28   DT  E C2    1 
ATOM   7243 O  O2    . DT  E 2 25  ? 21.148  -35.778 -65.701 1.00 37.34  ? 28   DT  E O2    1 
ATOM   7244 N  N3    . DT  E 2 25  ? 23.149  -36.357 -66.552 1.00 36.31  ? 28   DT  E N3    1 
ATOM   7245 C  C4    . DT  E 2 25  ? 24.159  -37.238 -66.884 1.00 36.06  ? 28   DT  E C4    1 
ATOM   7246 O  O4    . DT  E 2 25  ? 25.185  -36.854 -67.434 1.00 35.57  ? 28   DT  E O4    1 
ATOM   7247 C  C5    . DT  E 2 25  ? 23.906  -38.622 -66.542 1.00 36.36  ? 28   DT  E C5    1 
ATOM   7248 C  C7    . DT  E 2 25  ? 24.919  -39.685 -66.850 1.00 36.56  ? 28   DT  E C7    1 
ATOM   7249 C  C6    . DT  E 2 25  ? 22.746  -38.930 -65.942 1.00 36.65  ? 28   DT  E C6    1 
ATOM   7250 O  "O5'" . DA  F 3 1   ? 21.923  -26.097 -70.430 1.00 47.02  ? 29   DA  F "O5'" 1 
ATOM   7251 C  "C5'" . DA  F 3 1   ? 22.539  -25.794 -69.168 1.00 47.00  ? 29   DA  F "C5'" 1 
ATOM   7252 C  "C4'" . DA  F 3 1   ? 21.824  -26.433 -67.983 1.00 46.41  ? 29   DA  F "C4'" 1 
ATOM   7253 O  "O4'" . DA  F 3 1   ? 22.048  -27.872 -67.963 1.00 46.48  ? 29   DA  F "O4'" 1 
ATOM   7254 C  "C3'" . DA  F 3 1   ? 22.266  -25.906 -66.620 1.00 46.13  ? 29   DA  F "C3'" 1 
ATOM   7255 O  "O3'" . DA  F 3 1   ? 21.112  -25.323 -65.975 1.00 45.67  ? 29   DA  F "O3'" 1 
ATOM   7256 C  "C2'" . DA  F 3 1   ? 22.940  -27.094 -65.910 1.00 46.12  ? 29   DA  F "C2'" 1 
ATOM   7257 C  "C1'" . DA  F 3 1   ? 22.454  -28.323 -66.682 1.00 46.09  ? 29   DA  F "C1'" 1 
ATOM   7258 N  N9    . DA  F 3 1   ? 23.440  -29.403 -66.852 1.00 45.59  ? 29   DA  F N9    1 
ATOM   7259 C  C8    . DA  F 3 1   ? 24.781  -29.274 -67.119 1.00 45.58  ? 29   DA  F C8    1 
ATOM   7260 N  N7    . DA  F 3 1   ? 25.432  -30.409 -67.229 1.00 45.24  ? 29   DA  F N7    1 
ATOM   7261 C  C5    . DA  F 3 1   ? 24.448  -31.359 -67.018 1.00 45.00  ? 29   DA  F C5    1 
ATOM   7262 C  C6    . DA  F 3 1   ? 24.493  -32.766 -67.002 1.00 44.38  ? 29   DA  F C6    1 
ATOM   7263 N  N6    . DA  F 3 1   ? 25.622  -33.447 -67.208 1.00 43.94  ? 29   DA  F N6    1 
ATOM   7264 N  N1    . DA  F 3 1   ? 23.340  -33.435 -66.757 1.00 44.09  ? 29   DA  F N1    1 
ATOM   7265 C  C2    . DA  F 3 1   ? 22.213  -32.735 -66.547 1.00 44.13  ? 29   DA  F C2    1 
ATOM   7266 N  N3    . DA  F 3 1   ? 22.047  -31.409 -66.543 1.00 44.62  ? 29   DA  F N3    1 
ATOM   7267 C  C4    . DA  F 3 1   ? 23.213  -30.767 -66.785 1.00 45.23  ? 29   DA  F C4    1 
ATOM   7268 P  P     . DA  F 3 2   ? 20.536  -25.715 -64.530 1.00 45.16  ? 30   DA  F P     1 
ATOM   7269 O  OP1   . DA  F 3 2   ? 19.502  -24.704 -64.187 1.00 44.98  ? 30   DA  F OP1   1 
ATOM   7270 O  OP2   . DA  F 3 2   ? 21.678  -25.950 -63.618 1.00 45.15  ? 30   DA  F OP2   1 
ATOM   7271 O  "O5'" . DA  F 3 2   ? 19.816  -27.114 -64.815 1.00 44.87  ? 30   DA  F "O5'" 1 
ATOM   7272 C  "C5'" . DA  F 3 2   ? 18.694  -27.543 -64.056 1.00 44.92  ? 30   DA  F "C5'" 1 
ATOM   7273 C  "C4'" . DA  F 3 2   ? 19.013  -28.754 -63.192 1.00 44.77  ? 30   DA  F "C4'" 1 
ATOM   7274 O  "O4'" . DA  F 3 2   ? 20.144  -29.496 -63.716 1.00 44.63  ? 30   DA  F "O4'" 1 
ATOM   7275 C  "C3'" . DA  F 3 2   ? 19.355  -28.433 -61.742 1.00 44.58  ? 30   DA  F "C3'" 1 
ATOM   7276 O  "O3'" . DA  F 3 2   ? 18.343  -28.972 -60.908 1.00 44.94  ? 30   DA  F "O3'" 1 
ATOM   7277 C  "C2'" . DA  F 3 2   ? 20.717  -29.086 -61.499 1.00 44.18  ? 30   DA  F "C2'" 1 
ATOM   7278 C  "C1'" . DA  F 3 2   ? 20.809  -30.106 -62.630 1.00 43.76  ? 30   DA  F "C1'" 1 
ATOM   7279 N  N9    . DA  F 3 2   ? 22.170  -30.503 -63.027 1.00 42.87  ? 30   DA  F N9    1 
ATOM   7280 C  C8    . DA  F 3 2   ? 23.230  -29.702 -63.375 1.00 42.33  ? 30   DA  F C8    1 
ATOM   7281 N  N7    . DA  F 3 2   ? 24.322  -30.361 -63.681 1.00 41.70  ? 30   DA  F N7    1 
ATOM   7282 C  C5    . DA  F 3 2   ? 23.955  -31.686 -63.525 1.00 41.72  ? 30   DA  F C5    1 
ATOM   7283 C  C6    . DA  F 3 2   ? 24.650  -32.896 -63.694 1.00 41.60  ? 30   DA  F C6    1 
ATOM   7284 N  N6    . DA  F 3 2   ? 25.921  -32.956 -64.074 1.00 41.94  ? 30   DA  F N6    1 
ATOM   7285 N  N1    . DA  F 3 2   ? 24.000  -34.054 -63.461 1.00 41.83  ? 30   DA  F N1    1 
ATOM   7286 C  C2    . DA  F 3 2   ? 22.717  -34.006 -63.078 1.00 42.24  ? 30   DA  F C2    1 
ATOM   7287 N  N3    . DA  F 3 2   ? 21.955  -32.930 -62.883 1.00 42.35  ? 30   DA  F N3    1 
ATOM   7288 C  C4    . DA  F 3 2   ? 22.638  -31.794 -63.125 1.00 42.23  ? 30   DA  F C4    1 
ATOM   7289 P  P     . DA  F 3 3   ? 18.258  -28.531 -59.382 1.00 45.55  ? 31   DA  F P     1 
ATOM   7290 O  OP1   . DA  F 3 3   ? 16.843  -28.594 -58.958 1.00 45.55  ? 31   DA  F OP1   1 
ATOM   7291 O  OP2   . DA  F 3 3   ? 18.984  -27.251 -59.225 1.00 45.66  ? 31   DA  F OP2   1 
ATOM   7292 O  "O5'" . DA  F 3 3   ? 19.089  -29.712 -58.681 1.00 47.38  ? 31   DA  F "O5'" 1 
ATOM   7293 C  "C5'" . DA  F 3 3   ? 18.472  -30.970 -58.381 1.00 50.13  ? 31   DA  F "C5'" 1 
ATOM   7294 C  "C4'" . DA  F 3 3   ? 19.435  -32.147 -58.247 1.00 52.14  ? 31   DA  F "C4'" 1 
ATOM   7295 O  "O4'" . DA  F 3 3   ? 20.197  -32.342 -59.470 1.00 53.10  ? 31   DA  F "O4'" 1 
ATOM   7296 C  "C3'" . DA  F 3 3   ? 20.554  -32.070 -57.213 1.00 53.27  ? 31   DA  F "C3'" 1 
ATOM   7297 O  "O3'" . DA  F 3 3   ? 20.148  -32.043 -55.799 1.00 54.85  ? 31   DA  F "O3'" 1 
ATOM   7298 C  "C2'" . DA  F 3 3   ? 21.312  -33.309 -57.668 1.00 53.56  ? 31   DA  F "C2'" 1 
ATOM   7299 C  "C1'" . DA  F 3 3   ? 21.354  -33.110 -59.177 1.00 53.99  ? 31   DA  F "C1'" 1 
ATOM   7300 N  N9    . DA  F 3 3   ? 22.590  -32.434 -59.596 1.00 55.46  ? 31   DA  F N9    1 
ATOM   7301 C  C8    . DA  F 3 3   ? 22.818  -31.082 -59.637 1.00 56.33  ? 31   DA  F C8    1 
ATOM   7302 N  N7    . DA  F 3 3   ? 24.021  -30.736 -60.039 1.00 56.64  ? 31   DA  F N7    1 
ATOM   7303 C  C5    . DA  F 3 3   ? 24.643  -31.949 -60.271 1.00 56.62  ? 31   DA  F C5    1 
ATOM   7304 C  C6    . DA  F 3 3   ? 25.949  -32.267 -60.712 1.00 56.73  ? 31   DA  F C6    1 
ATOM   7305 N  N6    . DA  F 3 3   ? 26.864  -31.336 -61.001 1.00 56.23  ? 31   DA  F N6    1 
ATOM   7306 N  N1    . DA  F 3 3   ? 26.269  -33.578 -60.844 1.00 56.99  ? 31   DA  F N1    1 
ATOM   7307 C  C2    . DA  F 3 3   ? 25.335  -34.501 -60.547 1.00 57.01  ? 31   DA  F C2    1 
ATOM   7308 N  N3    . DA  F 3 3   ? 24.075  -34.323 -60.122 1.00 56.59  ? 31   DA  F N3    1 
ATOM   7309 C  C4    . DA  F 3 3   ? 23.781  -33.010 -60.003 1.00 56.32  ? 31   DA  F C4    1 
ATOM   7310 P  P     . DC  F 3 4   ? 19.608  -33.238 -54.853 1.00 55.28  ? 32   DC  F P     1 
ATOM   7311 O  OP1   . DC  F 3 4   ? 18.440  -33.828 -55.544 1.00 55.64  ? 32   DC  F OP1   1 
ATOM   7312 O  OP2   . DC  F 3 4   ? 19.425  -32.651 -53.502 1.00 54.30  ? 32   DC  F OP2   1 
ATOM   7313 O  "O5'" . DC  F 3 4   ? 20.796  -34.330 -54.778 1.00 55.80  ? 32   DC  F "O5'" 1 
ATOM   7314 C  "C5'" . DC  F 3 4   ? 20.576  -35.733 -55.058 1.00 56.10  ? 32   DC  F "C5'" 1 
ATOM   7315 C  "C4'" . DC  F 3 4   ? 21.803  -36.485 -55.577 1.00 56.58  ? 32   DC  F "C4'" 1 
ATOM   7316 O  "O4'" . DC  F 3 4   ? 22.576  -35.720 -56.531 1.00 55.73  ? 32   DC  F "O4'" 1 
ATOM   7317 C  "C3'" . DC  F 3 4   ? 22.813  -36.867 -54.512 1.00 57.74  ? 32   DC  F "C3'" 1 
ATOM   7318 O  "O3'" . DC  F 3 4   ? 22.438  -38.143 -54.007 1.00 60.87  ? 32   DC  F "O3'" 1 
ATOM   7319 C  "C2'" . DC  F 3 4   ? 24.158  -36.910 -55.247 1.00 56.05  ? 32   DC  F "C2'" 1 
ATOM   7320 C  "C1'" . DC  F 3 4   ? 23.921  -36.162 -56.548 1.00 54.28  ? 32   DC  F "C1'" 1 
ATOM   7321 N  N1    . DC  F 3 4   ? 24.845  -34.996 -56.791 1.00 52.08  ? 32   DC  F N1    1 
ATOM   7322 C  C2    . DC  F 3 4   ? 26.168  -35.203 -57.198 1.00 51.02  ? 32   DC  F C2    1 
ATOM   7323 O  O2    . DC  F 3 4   ? 26.594  -36.348 -57.340 1.00 51.19  ? 32   DC  F O2    1 
ATOM   7324 N  N3    . DC  F 3 4   ? 26.964  -34.135 -57.427 1.00 50.37  ? 32   DC  F N3    1 
ATOM   7325 C  C4    . DC  F 3 4   ? 26.482  -32.905 -57.262 1.00 50.39  ? 32   DC  F C4    1 
ATOM   7326 N  N4    . DC  F 3 4   ? 27.298  -31.885 -57.495 1.00 50.93  ? 32   DC  F N4    1 
ATOM   7327 C  C5    . DC  F 3 4   ? 25.146  -32.652 -56.852 1.00 50.54  ? 32   DC  F C5    1 
ATOM   7328 C  C6    . DC  F 3 4   ? 24.379  -33.722 -56.633 1.00 51.37  ? 32   DC  F C6    1 
ATOM   7329 P  P     . DG  F 3 5   ? 23.144  -38.828 -52.735 1.00 63.34  ? 33   DG  F P     1 
ATOM   7330 O  OP1   . DG  F 3 5   ? 22.061  -39.143 -51.767 1.00 62.91  ? 33   DG  F OP1   1 
ATOM   7331 O  OP2   . DG  F 3 5   ? 24.250  -37.978 -52.214 1.00 63.11  ? 33   DG  F OP2   1 
ATOM   7332 O  "O5'" . DG  F 3 5   ? 23.721  -40.189 -53.418 1.00 63.53  ? 33   DG  F "O5'" 1 
ATOM   7333 C  "C5'" . DG  F 3 5   ? 24.585  -40.230 -54.591 1.00 63.50  ? 33   DG  F "C5'" 1 
ATOM   7334 C  "C4'" . DG  F 3 5   ? 26.084  -40.432 -54.317 1.00 64.40  ? 33   DG  F "C4'" 1 
ATOM   7335 O  "O4'" . DG  F 3 5   ? 26.832  -39.254 -54.736 1.00 64.04  ? 33   DG  F "O4'" 1 
ATOM   7336 C  "C3'" . DG  F 3 5   ? 26.552  -40.708 -52.880 1.00 65.31  ? 33   DG  F "C3'" 1 
ATOM   7337 O  "O3'" . DG  F 3 5   ? 27.510  -41.783 -52.857 1.00 67.00  ? 33   DG  F "O3'" 1 
ATOM   7338 C  "C2'" . DG  F 3 5   ? 27.175  -39.387 -52.420 1.00 64.24  ? 33   DG  F "C2'" 1 
ATOM   7339 C  "C1'" . DG  F 3 5   ? 27.743  -38.849 -53.724 1.00 63.35  ? 33   DG  F "C1'" 1 
ATOM   7340 N  N9    . DG  F 3 5   ? 27.819  -37.396 -53.770 1.00 62.05  ? 33   DG  F N9    1 
ATOM   7341 C  C8    . DG  F 3 5   ? 26.888  -36.518 -53.278 1.00 61.74  ? 33   DG  F C8    1 
ATOM   7342 N  N7    . DG  F 3 5   ? 27.192  -35.268 -53.466 1.00 61.67  ? 33   DG  F N7    1 
ATOM   7343 C  C5    . DG  F 3 5   ? 28.410  -35.317 -54.129 1.00 61.69  ? 33   DG  F C5    1 
ATOM   7344 C  C6    . DG  F 3 5   ? 29.236  -34.261 -54.595 1.00 61.63  ? 33   DG  F C6    1 
ATOM   7345 O  O6    . DG  F 3 5   ? 29.045  -33.043 -54.506 1.00 62.08  ? 33   DG  F O6    1 
ATOM   7346 N  N1    . DG  F 3 5   ? 30.392  -34.723 -55.214 1.00 61.23  ? 33   DG  F N1    1 
ATOM   7347 C  C2    . DG  F 3 5   ? 30.708  -36.051 -55.361 1.00 61.35  ? 33   DG  F C2    1 
ATOM   7348 N  N2    . DG  F 3 5   ? 31.867  -36.296 -55.989 1.00 61.55  ? 33   DG  F N2    1 
ATOM   7349 N  N3    . DG  F 3 5   ? 29.945  -37.058 -54.934 1.00 61.39  ? 33   DG  F N3    1 
ATOM   7350 C  C4    . DG  F 3 5   ? 28.812  -36.622 -54.325 1.00 61.64  ? 33   DG  F C4    1 
ATOM   7351 P  P     . DA  F 3 6   ? 28.191  -42.316 -51.496 1.00 68.57  ? 34   DA  F P     1 
ATOM   7352 O  OP1   . DA  F 3 6   ? 28.312  -43.788 -51.606 1.00 68.86  ? 34   DA  F OP1   1 
ATOM   7353 O  OP2   . DA  F 3 6   ? 27.531  -41.720 -50.306 1.00 68.36  ? 34   DA  F OP2   1 
ATOM   7354 O  "O5'" . DA  F 3 6   ? 29.654  -41.691 -51.598 1.00 69.22  ? 34   DA  F "O5'" 1 
ATOM   7355 C  "C5'" . DA  F 3 6   ? 30.568  -42.106 -52.620 1.00 69.74  ? 34   DA  F "C5'" 1 
ATOM   7356 C  "C4'" . DA  F 3 6   ? 31.823  -41.263 -52.497 1.00 69.99  ? 34   DA  F "C4'" 1 
ATOM   7357 O  "O4'" . DA  F 3 6   ? 31.464  -39.864 -52.691 1.00 69.86  ? 34   DA  F "O4'" 1 
ATOM   7358 C  "C3'" . DA  F 3 6   ? 32.505  -41.357 -51.127 1.00 70.09  ? 34   DA  F "C3'" 1 
ATOM   7359 O  "O3'" . DA  F 3 6   ? 33.905  -41.718 -51.289 1.00 70.21  ? 34   DA  F "O3'" 1 
ATOM   7360 C  "C2'" . DA  F 3 6   ? 32.239  -39.977 -50.504 1.00 69.69  ? 34   DA  F "C2'" 1 
ATOM   7361 C  "C1'" . DA  F 3 6   ? 32.165  -39.088 -51.740 1.00 69.01  ? 34   DA  F "C1'" 1 
ATOM   7362 N  N9    . DA  F 3 6   ? 31.528  -37.779 -51.546 1.00 67.86  ? 34   DA  F N9    1 
ATOM   7363 C  C8    . DA  F 3 6   ? 30.386  -37.498 -50.853 1.00 67.13  ? 34   DA  F C8    1 
ATOM   7364 N  N7    . DA  F 3 6   ? 30.072  -36.222 -50.856 1.00 67.02  ? 34   DA  F N7    1 
ATOM   7365 C  C5    . DA  F 3 6   ? 31.073  -35.615 -51.597 1.00 67.18  ? 34   DA  F C5    1 
ATOM   7366 C  C6    . DA  F 3 6   ? 31.326  -34.271 -51.977 1.00 67.13  ? 34   DA  F C6    1 
ATOM   7367 N  N6    . DA  F 3 6   ? 30.544  -33.240 -51.642 1.00 67.22  ? 34   DA  F N6    1 
ATOM   7368 N  N1    . DA  F 3 6   ? 32.421  -34.008 -52.727 1.00 67.02  ? 34   DA  F N1    1 
ATOM   7369 C  C2    . DA  F 3 6   ? 33.218  -35.027 -53.076 1.00 67.39  ? 34   DA  F C2    1 
ATOM   7370 N  N3    . DA  F 3 6   ? 33.082  -36.325 -52.780 1.00 67.77  ? 34   DA  F N3    1 
ATOM   7371 C  C4    . DA  F 3 6   ? 31.981  -36.564 -52.031 1.00 67.61  ? 34   DA  F C4    1 
ATOM   7372 P  P     . DC  F 3 7   ? 35.028  -41.611 -50.133 1.00 70.09  ? 35   DC  F P     1 
ATOM   7373 O  OP1   . DC  F 3 7   ? 36.091  -42.592 -50.456 1.00 70.26  ? 35   DC  F OP1   1 
ATOM   7374 O  OP2   . DC  F 3 7   ? 34.393  -41.622 -48.792 1.00 69.15  ? 35   DC  F OP2   1 
ATOM   7375 O  "O5'" . DC  F 3 7   ? 35.625  -40.151 -50.398 1.00 69.04  ? 35   DC  F "O5'" 1 
ATOM   7376 C  "C5'" . DC  F 3 7   ? 36.547  -39.896 -51.469 1.00 67.12  ? 35   DC  F "C5'" 1 
ATOM   7377 C  "C4'" . DC  F 3 7   ? 37.248  -38.580 -51.185 1.00 65.69  ? 35   DC  F "C4'" 1 
ATOM   7378 O  "O4'" . DC  F 3 7   ? 36.247  -37.524 -51.137 1.00 64.28  ? 35   DC  F "O4'" 1 
ATOM   7379 C  "C3'" . DC  F 3 7   ? 37.981  -38.554 -49.839 1.00 65.85  ? 35   DC  F "C3'" 1 
ATOM   7380 O  "O3'" . DC  F 3 7   ? 39.281  -37.926 -49.953 1.00 66.59  ? 35   DC  F "O3'" 1 
ATOM   7381 C  "C2'" . DC  F 3 7   ? 36.999  -37.807 -48.937 1.00 64.82  ? 35   DC  F "C2'" 1 
ATOM   7382 C  "C1'" . DC  F 3 7   ? 36.383  -36.814 -49.918 1.00 63.41  ? 35   DC  F "C1'" 1 
ATOM   7383 N  N1    . DC  F 3 7   ? 35.084  -36.223 -49.418 1.00 61.57  ? 35   DC  F N1    1 
ATOM   7384 C  C2    . DC  F 3 7   ? 34.693  -34.923 -49.800 1.00 60.56  ? 35   DC  F C2    1 
ATOM   7385 O  O2    . DC  F 3 7   ? 35.407  -34.261 -50.571 1.00 59.87  ? 35   DC  F O2    1 
ATOM   7386 N  N3    . DC  F 3 7   ? 33.518  -34.428 -49.311 1.00 59.88  ? 35   DC  F N3    1 
ATOM   7387 C  C4    . DC  F 3 7   ? 32.766  -35.162 -48.478 1.00 59.53  ? 35   DC  F C4    1 
ATOM   7388 N  N4    . DC  F 3 7   ? 31.631  -34.635 -48.021 1.00 58.73  ? 35   DC  F N4    1 
ATOM   7389 C  C5    . DC  F 3 7   ? 33.148  -36.475 -48.071 1.00 59.90  ? 35   DC  F C5    1 
ATOM   7390 C  C6    . DC  F 3 7   ? 34.300  -36.955 -48.558 1.00 60.71  ? 35   DC  F C6    1 
ATOM   7391 P  P     . DA  F 3 8   ? 39.978  -36.975 -48.844 1.00 66.93  ? 36   DA  F P     1 
ATOM   7392 O  OP1   . DA  F 3 8   ? 41.430  -37.074 -49.117 1.00 67.10  ? 36   DA  F OP1   1 
ATOM   7393 O  OP2   . DA  F 3 8   ? 39.443  -37.221 -47.481 1.00 66.35  ? 36   DA  F OP2   1 
ATOM   7394 O  "O5'" . DA  F 3 8   ? 39.516  -35.505 -49.270 1.00 65.60  ? 36   DA  F "O5'" 1 
ATOM   7395 C  "C5'" . DA  F 3 8   ? 40.278  -34.745 -50.207 1.00 62.97  ? 36   DA  F "C5'" 1 
ATOM   7396 C  "C4'" . DA  F 3 8   ? 40.201  -33.269 -49.855 1.00 60.92  ? 36   DA  F "C4'" 1 
ATOM   7397 O  "O4'" . DA  F 3 8   ? 38.836  -32.882 -49.546 1.00 59.85  ? 36   DA  F "O4'" 1 
ATOM   7398 C  "C3'" . DA  F 3 8   ? 41.002  -32.812 -48.643 1.00 59.96  ? 36   DA  F "C3'" 1 
ATOM   7399 O  "O3'" . DA  F 3 8   ? 41.217  -31.434 -48.847 1.00 59.42  ? 36   DA  F "O3'" 1 
ATOM   7400 C  "C2'" . DA  F 3 8   ? 40.004  -33.059 -47.526 1.00 59.29  ? 36   DA  F "C2'" 1 
ATOM   7401 C  "C1'" . DA  F 3 8   ? 38.794  -32.430 -48.210 1.00 59.30  ? 36   DA  F "C1'" 1 
ATOM   7402 N  N9    . DA  F 3 8   ? 37.516  -32.809 -47.627 1.00 58.91  ? 36   DA  F N9    1 
ATOM   7403 C  C8    . DA  F 3 8   ? 37.144  -34.060 -47.204 1.00 58.97  ? 36   DA  F C8    1 
ATOM   7404 N  N7    . DA  F 3 8   ? 35.932  -34.111 -46.702 1.00 58.39  ? 36   DA  F N7    1 
ATOM   7405 C  C5    . DA  F 3 8   ? 35.487  -32.807 -46.812 1.00 57.59  ? 36   DA  F C5    1 
ATOM   7406 C  C6    . DA  F 3 8   ? 34.269  -32.218 -46.461 1.00 57.01  ? 36   DA  F C6    1 
ATOM   7407 N  N6    . DA  F 3 8   ? 33.283  -32.934 -45.915 1.00 56.68  ? 36   DA  F N6    1 
ATOM   7408 N  N1    . DA  F 3 8   ? 34.124  -30.891 -46.695 1.00 56.67  ? 36   DA  F N1    1 
ATOM   7409 C  C2    . DA  F 3 8   ? 35.143  -30.208 -47.241 1.00 56.43  ? 36   DA  F C2    1 
ATOM   7410 N  N3    . DA  F 3 8   ? 36.338  -30.659 -47.625 1.00 56.62  ? 36   DA  F N3    1 
ATOM   7411 C  C4    . DA  F 3 8   ? 36.444  -31.981 -47.379 1.00 57.77  ? 36   DA  F C4    1 
ATOM   7412 P  P     . DT  F 3 9   ? 42.138  -30.520 -47.914 1.00 59.08  ? 37   DT  F P     1 
ATOM   7413 O  OP1   . DT  F 3 9   ? 43.538  -30.868 -48.245 1.00 59.05  ? 37   DT  F OP1   1 
ATOM   7414 O  OP2   . DT  F 3 9   ? 41.659  -30.581 -46.507 1.00 58.65  ? 37   DT  F OP2   1 
ATOM   7415 O  "O5'" . DT  F 3 9   ? 41.794  -29.059 -48.493 1.00 58.02  ? 37   DT  F "O5'" 1 
ATOM   7416 C  "C5'" . DT  F 3 9   ? 40.421  -28.698 -48.795 1.00 56.23  ? 37   DT  F "C5'" 1 
ATOM   7417 C  "C4'" . DT  F 3 9   ? 39.758  -27.796 -47.753 1.00 54.14  ? 37   DT  F "C4'" 1 
ATOM   7418 O  "O4'" . DT  F 3 9   ? 38.609  -28.437 -47.142 1.00 52.19  ? 37   DT  F "O4'" 1 
ATOM   7419 C  "C3'" . DT  F 3 9   ? 40.656  -27.337 -46.607 1.00 53.58  ? 37   DT  F "C3'" 1 
ATOM   7420 O  "O3'" . DT  F 3 9   ? 40.818  -25.909 -46.759 1.00 54.83  ? 37   DT  F "O3'" 1 
ATOM   7421 C  "C2'" . DT  F 3 9   ? 39.962  -27.845 -45.341 1.00 51.74  ? 37   DT  F "C2'" 1 
ATOM   7422 C  "C1'" . DT  F 3 9   ? 38.528  -27.998 -45.810 1.00 50.41  ? 37   DT  F "C1'" 1 
ATOM   7423 N  N1    . DT  F 3 9   ? 37.723  -28.982 -45.044 1.00 49.03  ? 37   DT  F N1    1 
ATOM   7424 C  C2    . DT  F 3 9   ? 36.542  -28.547 -44.484 1.00 48.58  ? 37   DT  F C2    1 
ATOM   7425 O  O2    . DT  F 3 9   ? 36.141  -27.400 -44.589 1.00 48.56  ? 37   DT  F O2    1 
ATOM   7426 N  N3    . DT  F 3 9   ? 35.844  -29.513 -43.788 1.00 48.12  ? 37   DT  F N3    1 
ATOM   7427 C  C4    . DT  F 3 9   ? 36.200  -30.844 -43.604 1.00 47.51  ? 37   DT  F C4    1 
ATOM   7428 O  O4    . DT  F 3 9   ? 35.510  -31.637 -42.971 1.00 46.91  ? 37   DT  F O4    1 
ATOM   7429 C  C5    . DT  F 3 9   ? 37.443  -31.239 -44.216 1.00 47.57  ? 37   DT  F C5    1 
ATOM   7430 C  C7    . DT  F 3 9   ? 37.912  -32.661 -44.067 1.00 46.64  ? 37   DT  F C7    1 
ATOM   7431 C  C6    . DT  F 3 9   ? 38.138  -30.301 -44.896 1.00 48.44  ? 37   DT  F C6    1 
ATOM   7432 P  P     . DT  F 3 10  ? 40.668  -24.790 -45.616 1.00 56.14  ? 38   DT  F P     1 
ATOM   7433 O  OP1   . DT  F 3 10  ? 41.169  -23.505 -46.175 1.00 55.92  ? 38   DT  F OP1   1 
ATOM   7434 O  OP2   . DT  F 3 10  ? 41.247  -25.318 -44.354 1.00 56.35  ? 38   DT  F OP2   1 
ATOM   7435 O  "O5'" . DT  F 3 10  ? 39.077  -24.682 -45.435 1.00 55.83  ? 38   DT  F "O5'" 1 
ATOM   7436 C  "C5'" . DT  F 3 10  ? 38.331  -23.589 -45.995 1.00 54.22  ? 38   DT  F "C5'" 1 
ATOM   7437 C  "C4'" . DT  F 3 10  ? 37.318  -23.051 -44.995 1.00 52.66  ? 38   DT  F "C4'" 1 
ATOM   7438 O  "O4'" . DT  F 3 10  ? 36.670  -24.153 -44.312 1.00 51.08  ? 38   DT  F "O4'" 1 
ATOM   7439 C  "C3'" . DT  F 3 10  ? 37.887  -22.133 -43.909 1.00 52.44  ? 38   DT  F "C3'" 1 
ATOM   7440 O  "O3'" . DT  F 3 10  ? 37.071  -20.920 -43.906 1.00 52.92  ? 38   DT  F "O3'" 1 
ATOM   7441 C  "C2'" . DT  F 3 10  ? 37.925  -23.009 -42.650 1.00 50.91  ? 38   DT  F "C2'" 1 
ATOM   7442 C  "C1'" . DT  F 3 10  ? 36.760  -23.963 -42.915 1.00 50.23  ? 38   DT  F "C1'" 1 
ATOM   7443 N  N1    . DT  F 3 10  ? 36.808  -25.318 -42.274 1.00 48.96  ? 38   DT  F N1    1 
ATOM   7444 C  C2    . DT  F 3 10  ? 35.642  -25.829 -41.746 1.00 48.09  ? 38   DT  F C2    1 
ATOM   7445 O  O2    . DT  F 3 10  ? 34.585  -25.239 -41.761 1.00 48.94  ? 38   DT  F O2    1 
ATOM   7446 N  N3    . DT  F 3 10  ? 35.739  -27.066 -41.183 1.00 47.14  ? 38   DT  F N3    1 
ATOM   7447 C  C4    . DT  F 3 10  ? 36.871  -27.835 -41.102 1.00 47.51  ? 38   DT  F C4    1 
ATOM   7448 O  O4    . DT  F 3 10  ? 36.828  -28.934 -40.572 1.00 47.78  ? 38   DT  F O4    1 
ATOM   7449 C  C5    . DT  F 3 10  ? 38.070  -27.258 -41.675 1.00 48.05  ? 38   DT  F C5    1 
ATOM   7450 C  C7    . DT  F 3 10  ? 39.378  -27.992 -41.649 1.00 48.15  ? 38   DT  F C7    1 
ATOM   7451 C  C6    . DT  F 3 10  ? 37.983  -26.041 -42.230 1.00 48.68  ? 38   DT  F C6    1 
ATOM   7452 P  P     . DT  F 3 11  ? 36.280  -20.241 -42.686 1.00 52.68  ? 39   DT  F P     1 
ATOM   7453 O  OP1   . DT  F 3 11  ? 35.637  -19.011 -43.222 1.00 52.27  ? 39   DT  F OP1   1 
ATOM   7454 O  OP2   . DT  F 3 11  ? 37.206  -20.191 -41.528 1.00 52.40  ? 39   DT  F OP2   1 
ATOM   7455 O  "O5'" . DT  F 3 11  ? 35.120  -21.282 -42.346 1.00 52.54  ? 39   DT  F "O5'" 1 
ATOM   7456 C  "C5'" . DT  F 3 11  ? 33.802  -20.845 -42.054 1.00 52.48  ? 39   DT  F "C5'" 1 
ATOM   7457 C  "C4'" . DT  F 3 11  ? 33.339  -21.365 -40.703 1.00 52.45  ? 39   DT  F "C4'" 1 
ATOM   7458 O  "O4'" . DT  F 3 11  ? 33.914  -22.672 -40.428 1.00 52.46  ? 39   DT  F "O4'" 1 
ATOM   7459 C  "C3'" . DT  F 3 11  ? 33.694  -20.492 -39.497 1.00 52.02  ? 39   DT  F "C3'" 1 
ATOM   7460 O  "O3'" . DT  F 3 11  ? 32.542  -20.296 -38.691 1.00 50.82  ? 39   DT  F "O3'" 1 
ATOM   7461 C  "C2'" . DT  F 3 11  ? 34.724  -21.324 -38.746 1.00 52.34  ? 39   DT  F "C2'" 1 
ATOM   7462 C  "C1'" . DT  F 3 11  ? 34.146  -22.703 -39.041 1.00 52.84  ? 39   DT  F "C1'" 1 
ATOM   7463 N  N1    . DT  F 3 11  ? 35.004  -23.860 -38.645 1.00 53.53  ? 39   DT  F N1    1 
ATOM   7464 C  C2    . DT  F 3 11  ? 34.405  -24.978 -38.075 1.00 53.82  ? 39   DT  F C2    1 
ATOM   7465 O  O2    . DT  F 3 11  ? 33.201  -25.098 -37.882 1.00 53.25  ? 39   DT  F O2    1 
ATOM   7466 N  N3    . DT  F 3 11  ? 35.286  -25.976 -37.730 1.00 54.50  ? 39   DT  F N3    1 
ATOM   7467 C  C4    . DT  F 3 11  ? 36.665  -25.965 -37.892 1.00 55.26  ? 39   DT  F C4    1 
ATOM   7468 O  O4    . DT  F 3 11  ? 37.358  -26.920 -37.549 1.00 55.56  ? 39   DT  F O4    1 
ATOM   7469 C  C5    . DT  F 3 11  ? 37.223  -24.763 -38.488 1.00 55.09  ? 39   DT  F C5    1 
ATOM   7470 C  C7    . DT  F 3 11  ? 38.705  -24.626 -38.715 1.00 55.52  ? 39   DT  F C7    1 
ATOM   7471 C  C6    . DT  F 3 11  ? 36.375  -23.780 -38.829 1.00 54.15  ? 39   DT  F C6    1 
ATOM   7472 P  P     . DC  F 3 12  ? 32.150  -18.812 -38.269 1.00 50.24  ? 40   DC  F P     1 
ATOM   7473 O  OP1   . DC  F 3 12  ? 31.551  -18.151 -39.443 1.00 50.31  ? 40   DC  F OP1   1 
ATOM   7474 O  OP2   . DC  F 3 12  ? 33.356  -18.223 -37.642 1.00 50.44  ? 40   DC  F OP2   1 
ATOM   7475 O  "O5'" . DC  F 3 12  ? 31.008  -19.000 -37.158 1.00 50.61  ? 40   DC  F "O5'" 1 
ATOM   7476 C  "C5'" . DC  F 3 12  ? 30.488  -20.294 -36.788 1.00 50.88  ? 40   DC  F "C5'" 1 
ATOM   7477 C  "C4'" . DC  F 3 12  ? 30.795  -20.750 -35.355 1.00 50.68  ? 40   DC  F "C4'" 1 
ATOM   7478 O  "O4'" . DC  F 3 12  ? 31.730  -21.856 -35.420 1.00 48.98  ? 40   DC  F "O4'" 1 
ATOM   7479 C  "C3'" . DC  F 3 12  ? 31.433  -19.756 -34.377 1.00 51.48  ? 40   DC  F "C3'" 1 
ATOM   7480 O  "O3'" . DC  F 3 12  ? 30.421  -18.953 -33.686 1.00 54.31  ? 40   DC  F "O3'" 1 
ATOM   7481 C  "C2'" . DC  F 3 12  ? 32.341  -20.604 -33.484 1.00 49.45  ? 40   DC  F "C2'" 1 
ATOM   7482 C  "C1'" . DC  F 3 12  ? 32.422  -21.957 -34.193 1.00 47.74  ? 40   DC  F "C1'" 1 
ATOM   7483 N  N1    . DC  F 3 12  ? 33.818  -22.466 -34.477 1.00 45.33  ? 40   DC  F N1    1 
ATOM   7484 C  C2    . DC  F 3 12  ? 34.087  -23.850 -34.365 1.00 43.25  ? 40   DC  F C2    1 
ATOM   7485 O  O2    . DC  F 3 12  ? 33.176  -24.615 -34.033 1.00 41.95  ? 40   DC  F O2    1 
ATOM   7486 N  N3    . DC  F 3 12  ? 35.340  -24.321 -34.626 1.00 42.01  ? 40   DC  F N3    1 
ATOM   7487 C  C4    . DC  F 3 12  ? 36.306  -23.467 -34.987 1.00 42.41  ? 40   DC  F C4    1 
ATOM   7488 N  N4    . DC  F 3 12  ? 37.526  -23.963 -35.235 1.00 41.22  ? 40   DC  F N4    1 
ATOM   7489 C  C5    . DC  F 3 12  ? 36.054  -22.056 -35.106 1.00 43.48  ? 40   DC  F C5    1 
ATOM   7490 C  C6    . DC  F 3 12  ? 34.815  -21.598 -34.849 1.00 44.20  ? 40   DC  F C6    1 
ATOM   7491 P  P     . DA  F 3 13  ? 29.840  -19.122 -32.189 1.00 56.78  ? 41   DA  F P     1 
ATOM   7492 O  OP1   . DA  F 3 13  ? 28.680  -18.199 -32.055 1.00 56.00  ? 41   DA  F OP1   1 
ATOM   7493 O  OP2   . DA  F 3 13  ? 30.973  -19.016 -31.234 1.00 55.73  ? 41   DA  F OP2   1 
ATOM   7494 O  "O5'" . DA  F 3 13  ? 29.229  -20.610 -32.194 1.00 57.03  ? 41   DA  F "O5'" 1 
ATOM   7495 C  "C5'" . DA  F 3 13  ? 28.106  -20.949 -31.351 1.00 55.67  ? 41   DA  F "C5'" 1 
ATOM   7496 C  "C4'" . DA  F 3 13  ? 28.500  -21.926 -30.245 1.00 54.27  ? 41   DA  F "C4'" 1 
ATOM   7497 O  "O4'" . DA  F 3 13  ? 29.804  -22.508 -30.527 1.00 53.56  ? 41   DA  F "O4'" 1 
ATOM   7498 C  "C3'" . DA  F 3 13  ? 28.563  -21.395 -28.805 1.00 52.49  ? 41   DA  F "C3'" 1 
ATOM   7499 O  "O3'" . DA  F 3 13  ? 28.009  -22.416 -27.927 1.00 50.35  ? 41   DA  F "O3'" 1 
ATOM   7500 C  "C2'" . DA  F 3 13  ? 30.053  -21.127 -28.641 1.00 52.26  ? 41   DA  F "C2'" 1 
ATOM   7501 C  "C1'" . DA  F 3 13  ? 30.621  -22.321 -29.398 1.00 53.06  ? 41   DA  F "C1'" 1 
ATOM   7502 N  N9    . DA  F 3 13  ? 31.991  -22.182 -29.868 1.00 53.78  ? 41   DA  F N9    1 
ATOM   7503 C  C8    . DA  F 3 13  ? 32.686  -21.037 -30.163 1.00 54.38  ? 41   DA  F C8    1 
ATOM   7504 N  N7    . DA  F 3 13  ? 33.927  -21.235 -30.557 1.00 54.36  ? 41   DA  F N7    1 
ATOM   7505 C  C5    . DA  F 3 13  ? 34.048  -22.618 -30.527 1.00 54.07  ? 41   DA  F C5    1 
ATOM   7506 C  C6    . DA  F 3 13  ? 35.119  -23.482 -30.832 1.00 53.29  ? 41   DA  F C6    1 
ATOM   7507 N  N6    . DA  F 3 13  ? 36.309  -23.051 -31.252 1.00 52.78  ? 41   DA  F N6    1 
ATOM   7508 N  N1    . DA  F 3 13  ? 34.909  -24.809 -30.687 1.00 53.24  ? 41   DA  F N1    1 
ATOM   7509 C  C2    . DA  F 3 13  ? 33.710  -25.252 -30.269 1.00 53.33  ? 41   DA  F C2    1 
ATOM   7510 N  N3    . DA  F 3 13  ? 32.625  -24.544 -29.949 1.00 53.68  ? 41   DA  F N3    1 
ATOM   7511 C  C4    . DA  F 3 13  ? 32.865  -23.220 -30.101 1.00 54.14  ? 41   DA  F C4    1 
ATOM   7512 P  P     . DT  F 3 14  ? 28.454  -22.724 -26.420 1.00 48.29  ? 42   DT  F P     1 
ATOM   7513 O  OP1   . DT  F 3 14  ? 27.337  -23.395 -25.706 1.00 47.54  ? 42   DT  F OP1   1 
ATOM   7514 O  OP2   . DT  F 3 14  ? 29.034  -21.468 -25.915 1.00 48.68  ? 42   DT  F OP2   1 
ATOM   7515 O  "O5'" . DT  F 3 14  ? 29.638  -23.792 -26.561 1.00 47.18  ? 42   DT  F "O5'" 1 
ATOM   7516 C  "C5'" . DT  F 3 14  ? 29.439  -25.156 -26.174 1.00 44.05  ? 42   DT  F "C5'" 1 
ATOM   7517 C  "C4'" . DT  F 3 14  ? 30.745  -25.810 -25.759 1.00 41.17  ? 42   DT  F "C4'" 1 
ATOM   7518 O  "O4'" . DT  F 3 14  ? 31.773  -25.397 -26.672 1.00 39.80  ? 42   DT  F "O4'" 1 
ATOM   7519 C  "C3'" . DT  F 3 14  ? 31.263  -25.396 -24.397 1.00 40.46  ? 42   DT  F "C3'" 1 
ATOM   7520 O  "O3'" . DT  F 3 14  ? 30.753  -26.278 -23.353 1.00 42.00  ? 42   DT  F "O3'" 1 
ATOM   7521 C  "C2'" . DT  F 3 14  ? 32.778  -25.400 -24.548 1.00 39.33  ? 42   DT  F "C2'" 1 
ATOM   7522 C  "C1'" . DT  F 3 14  ? 33.032  -25.402 -26.044 1.00 38.28  ? 42   DT  F "C1'" 1 
ATOM   7523 N  N1    . DT  F 3 14  ? 33.814  -24.230 -26.563 1.00 37.50  ? 42   DT  F N1    1 
ATOM   7524 C  C2    . DT  F 3 14  ? 35.093  -24.387 -27.057 1.00 37.58  ? 42   DT  F C2    1 
ATOM   7525 O  O2    . DT  F 3 14  ? 35.668  -25.448 -27.095 1.00 38.38  ? 42   DT  F O2    1 
ATOM   7526 N  N3    . DT  F 3 14  ? 35.717  -23.255 -27.519 1.00 38.03  ? 42   DT  F N3    1 
ATOM   7527 C  C4    . DT  F 3 14  ? 35.200  -21.973 -27.547 1.00 38.92  ? 42   DT  F C4    1 
ATOM   7528 O  O4    . DT  F 3 14  ? 35.835  -21.004 -27.991 1.00 37.94  ? 42   DT  F O4    1 
ATOM   7529 C  C5    . DT  F 3 14  ? 33.848  -21.882 -27.023 1.00 39.32  ? 42   DT  F C5    1 
ATOM   7530 C  C7    . DT  F 3 14  ? 33.132  -20.562 -26.971 1.00 41.31  ? 42   DT  F C7    1 
ATOM   7531 C  C6    . DT  F 3 14  ? 33.234  -22.988 -26.570 1.00 38.29  ? 42   DT  F C6    1 
ATOM   7532 P  P     . DA  F 3 15  ? 31.217  -27.767 -22.894 1.00 42.15  ? 43   DA  F P     1 
ATOM   7533 O  OP1   . DA  F 3 15  ? 31.024  -28.786 -23.952 1.00 41.78  ? 43   DA  F OP1   1 
ATOM   7534 O  OP2   . DA  F 3 15  ? 30.546  -27.978 -21.595 1.00 42.67  ? 43   DA  F OP2   1 
ATOM   7535 O  "O5'" . DA  F 3 15  ? 32.771  -27.625 -22.587 1.00 40.93  ? 43   DA  F "O5'" 1 
ATOM   7536 C  "C5'" . DA  F 3 15  ? 33.606  -28.756 -22.714 1.00 38.88  ? 43   DA  F "C5'" 1 
ATOM   7537 C  "C4'" . DA  F 3 15  ? 34.979  -28.396 -22.194 1.00 37.52  ? 43   DA  F "C4'" 1 
ATOM   7538 O  "O4'" . DA  F 3 15  ? 35.514  -27.294 -22.962 1.00 36.46  ? 43   DA  F "O4'" 1 
ATOM   7539 C  "C3'" . DA  F 3 15  ? 34.975  -27.939 -20.747 1.00 36.93  ? 43   DA  F "C3'" 1 
ATOM   7540 O  "O3'" . DA  F 3 15  ? 35.861  -28.770 -20.031 1.00 36.84  ? 43   DA  F "O3'" 1 
ATOM   7541 C  "C2'" . DA  F 3 15  ? 35.448  -26.491 -20.817 1.00 36.34  ? 43   DA  F "C2'" 1 
ATOM   7542 C  "C1'" . DA  F 3 15  ? 36.244  -26.474 -22.106 1.00 35.39  ? 43   DA  F "C1'" 1 
ATOM   7543 N  N9    . DA  F 3 15  ? 36.266  -25.165 -22.714 1.00 34.78  ? 43   DA  F N9    1 
ATOM   7544 C  C8    . DA  F 3 15  ? 35.273  -24.245 -22.649 1.00 35.14  ? 43   DA  F C8    1 
ATOM   7545 N  N7    . DA  F 3 15  ? 35.535  -23.134 -23.285 1.00 35.28  ? 43   DA  F N7    1 
ATOM   7546 C  C5    . DA  F 3 15  ? 36.784  -23.339 -23.789 1.00 34.85  ? 43   DA  F C5    1 
ATOM   7547 C  C6    . DA  F 3 15  ? 37.601  -22.514 -24.558 1.00 35.65  ? 43   DA  F C6    1 
ATOM   7548 N  N6    . DA  F 3 15  ? 37.223  -21.300 -24.939 1.00 35.96  ? 43   DA  F N6    1 
ATOM   7549 N  N1    . DA  F 3 15  ? 38.806  -22.991 -24.923 1.00 37.02  ? 43   DA  F N1    1 
ATOM   7550 C  C2    . DA  F 3 15  ? 39.138  -24.235 -24.532 1.00 37.52  ? 43   DA  F C2    1 
ATOM   7551 N  N3    . DA  F 3 15  ? 38.438  -25.111 -23.801 1.00 36.72  ? 43   DA  F N3    1 
ATOM   7552 C  C4    . DA  F 3 15  ? 37.257  -24.587 -23.453 1.00 35.19  ? 43   DA  F C4    1 
ATOM   7553 P  P     . DC  F 3 16  ? 35.955  -28.708 -18.435 1.00 37.41  ? 44   DC  F P     1 
ATOM   7554 O  OP1   . DC  F 3 16  ? 35.405  -29.982 -17.913 1.00 37.35  ? 44   DC  F OP1   1 
ATOM   7555 O  OP2   . DC  F 3 16  ? 35.484  -27.398 -17.871 1.00 37.65  ? 44   DC  F OP2   1 
ATOM   7556 O  "O5'" . DC  F 3 16  ? 37.546  -28.762 -18.335 1.00 35.34  ? 44   DC  F "O5'" 1 
ATOM   7557 C  "C5'" . DC  F 3 16  ? 38.260  -27.607 -17.964 1.00 32.14  ? 44   DC  F "C5'" 1 
ATOM   7558 C  "C4'" . DC  F 3 16  ? 39.390  -27.427 -18.933 1.00 30.06  ? 44   DC  F "C4'" 1 
ATOM   7559 O  "O4'" . DC  F 3 16  ? 38.860  -26.708 -20.045 1.00 29.11  ? 44   DC  F "O4'" 1 
ATOM   7560 C  "C3'" . DC  F 3 16  ? 40.512  -26.557 -18.432 1.00 29.98  ? 44   DC  F "C3'" 1 
ATOM   7561 O  "O3'" . DC  F 3 16  ? 41.438  -27.344 -17.732 1.00 31.39  ? 44   DC  F "O3'" 1 
ATOM   7562 C  "C2'" . DC  F 3 16  ? 41.106  -26.053 -19.728 1.00 29.56  ? 44   DC  F "C2'" 1 
ATOM   7563 C  "C1'" . DC  F 3 16  ? 39.873  -25.907 -20.597 1.00 29.35  ? 44   DC  F "C1'" 1 
ATOM   7564 N  N1    . DC  F 3 16  ? 39.337  -24.522 -20.764 1.00 29.80  ? 44   DC  F N1    1 
ATOM   7565 C  C2    . DC  F 3 16  ? 40.034  -23.608 -21.563 1.00 30.12  ? 44   DC  F C2    1 
ATOM   7566 O  O2    . DC  F 3 16  ? 41.100  -23.939 -22.096 1.00 30.41  ? 44   DC  F O2    1 
ATOM   7567 N  N3    . DC  F 3 16  ? 39.525  -22.365 -21.744 1.00 31.17  ? 44   DC  F N3    1 
ATOM   7568 C  C4    . DC  F 3 16  ? 38.381  -22.014 -21.162 1.00 32.17  ? 44   DC  F C4    1 
ATOM   7569 N  N4    . DC  F 3 16  ? 37.958  -20.764 -21.374 1.00 32.35  ? 44   DC  F N4    1 
ATOM   7570 C  C5    . DC  F 3 16  ? 37.639  -22.929 -20.340 1.00 32.25  ? 44   DC  F C5    1 
ATOM   7571 C  C6    . DC  F 3 16  ? 38.153  -24.159 -20.175 1.00 31.17  ? 44   DC  F C6    1 
ATOM   7572 P  P     . DT  F 3 17  ? 42.564  -26.623 -16.868 1.00 33.12  ? 45   DT  F P     1 
ATOM   7573 O  OP1   . DT  F 3 17  ? 43.155  -27.611 -15.941 1.00 33.59  ? 45   DT  F OP1   1 
ATOM   7574 O  OP2   . DT  F 3 17  ? 42.029  -25.331 -16.366 1.00 32.97  ? 45   DT  F OP2   1 
ATOM   7575 O  "O5'" . DT  F 3 17  ? 43.650  -26.331 -17.983 1.00 33.51  ? 45   DT  F "O5'" 1 
ATOM   7576 C  "C5'" . DT  F 3 17  ? 44.853  -25.719 -17.629 1.00 35.19  ? 45   DT  F "C5'" 1 
ATOM   7577 C  "C4'" . DT  F 3 17  ? 45.209  -24.869 -18.815 1.00 36.37  ? 45   DT  F "C4'" 1 
ATOM   7578 O  "O4'" . DT  F 3 17  ? 43.974  -24.376 -19.334 1.00 35.13  ? 45   DT  F "O4'" 1 
ATOM   7579 C  "C3'" . DT  F 3 17  ? 45.974  -23.606 -18.513 1.00 38.27  ? 45   DT  F "C3'" 1 
ATOM   7580 O  "O3'" . DT  F 3 17  ? 47.331  -23.920 -18.533 1.00 42.50  ? 45   DT  F "O3'" 1 
ATOM   7581 C  "C2'" . DT  F 3 17  ? 45.656  -22.764 -19.727 1.00 37.09  ? 45   DT  F "C2'" 1 
ATOM   7582 C  "C1'" . DT  F 3 17  ? 44.224  -23.170 -20.004 1.00 35.99  ? 45   DT  F "C1'" 1 
ATOM   7583 N  N1    . DT  F 3 17  ? 43.173  -22.241 -19.552 1.00 36.27  ? 45   DT  F N1    1 
ATOM   7584 C  C2    . DT  F 3 17  ? 43.166  -20.903 -19.925 1.00 36.44  ? 45   DT  F C2    1 
ATOM   7585 O  O2    . DT  F 3 17  ? 44.017  -20.362 -20.607 1.00 37.29  ? 45   DT  F O2    1 
ATOM   7586 N  N3    . DT  F 3 17  ? 42.107  -20.187 -19.449 1.00 36.22  ? 45   DT  F N3    1 
ATOM   7587 C  C4    . DT  F 3 17  ? 41.077  -20.672 -18.673 1.00 36.49  ? 45   DT  F C4    1 
ATOM   7588 O  O4    . DT  F 3 17  ? 40.170  -19.926 -18.322 1.00 37.12  ? 45   DT  F O4    1 
ATOM   7589 C  C5    . DT  F 3 17  ? 41.147  -22.083 -18.333 1.00 35.78  ? 45   DT  F C5    1 
ATOM   7590 C  C7    . DT  F 3 17  ? 40.113  -22.758 -17.502 1.00 35.57  ? 45   DT  F C7    1 
ATOM   7591 C  C6    . DT  F 3 17  ? 42.171  -22.791 -18.785 1.00 35.60  ? 45   DT  F C6    1 
ATOM   7592 P  P     . DT  F 3 18  ? 48.132  -23.856 -17.174 1.00 45.51  ? 46   DT  F P     1 
ATOM   7593 O  OP1   . DT  F 3 18  ? 49.557  -23.771 -17.563 1.00 45.37  ? 46   DT  F OP1   1 
ATOM   7594 O  OP2   . DT  F 3 18  ? 47.693  -24.971 -16.289 1.00 46.32  ? 46   DT  F OP2   1 
ATOM   7595 O  "O5'" . DT  F 3 18  ? 47.611  -22.457 -16.591 1.00 46.37  ? 46   DT  F "O5'" 1 
ATOM   7596 C  "C5'" . DT  F 3 18  ? 48.546  -21.429 -16.368 1.00 50.02  ? 46   DT  F "C5'" 1 
ATOM   7597 C  "C4'" . DT  F 3 18  ? 49.056  -20.861 -17.674 1.00 51.68  ? 46   DT  F "C4'" 1 
ATOM   7598 O  "O4'" . DT  F 3 18  ? 47.984  -20.894 -18.628 1.00 52.44  ? 46   DT  F "O4'" 1 
ATOM   7599 C  "C3'" . DT  F 3 18  ? 49.452  -19.409 -17.545 1.00 53.59  ? 46   DT  F "C3'" 1 
ATOM   7600 O  "O3'" . DT  F 3 18  ? 50.819  -19.257 -17.812 1.00 55.02  ? 46   DT  F "O3'" 1 
ATOM   7601 C  "C2'" . DT  F 3 18  ? 48.638  -18.632 -18.577 1.00 53.58  ? 46   DT  F "C2'" 1 
ATOM   7602 C  "C1'" . DT  F 3 18  ? 47.505  -19.583 -18.890 1.00 54.23  ? 46   DT  F "C1'" 1 
ATOM   7603 N  N1    . DT  F 3 18  ? 46.175  -19.295 -18.191 1.00 55.33  ? 46   DT  F N1    1 
ATOM   7604 C  C2    . DT  F 3 18  ? 45.586  -18.042 -18.289 1.00 55.56  ? 46   DT  F C2    1 
ATOM   7605 O  O2    . DT  F 3 18  ? 46.081  -17.102 -18.883 1.00 56.57  ? 46   DT  F O2    1 
ATOM   7606 N  N3    . DT  F 3 18  ? 44.379  -17.915 -17.648 1.00 55.32  ? 46   DT  F N3    1 
ATOM   7607 C  C4    . DT  F 3 18  ? 43.700  -18.889 -16.943 1.00 55.21  ? 46   DT  F C4    1 
ATOM   7608 O  O4    . DT  F 3 18  ? 42.627  -18.672 -16.400 1.00 55.08  ? 46   DT  F O4    1 
ATOM   7609 C  C5    . DT  F 3 18  ? 44.352  -20.168 -16.888 1.00 55.39  ? 46   DT  F C5    1 
ATOM   7610 C  C7    . DT  F 3 18  ? 43.734  -21.314 -16.157 1.00 55.90  ? 46   DT  F C7    1 
ATOM   7611 C  C6    . DT  F 3 18  ? 45.530  -20.303 -17.501 1.00 55.48  ? 46   DT  F C6    1 
ATOM   7612 P  P     . DG  F 3 19  ? 51.417  -17.817 -17.476 1.00 55.68  ? 47   DG  F P     1 
ATOM   7613 O  OP1   . DG  F 3 19  ? 52.204  -17.309 -18.618 1.00 55.35  ? 47   DG  F OP1   1 
ATOM   7614 O  OP2   . DG  F 3 19  ? 51.990  -17.975 -16.128 1.00 55.89  ? 47   DG  F OP2   1 
ATOM   7615 O  "O5'" . DG  F 3 19  ? 50.158  -16.858 -17.338 1.00 55.92  ? 47   DG  F "O5'" 1 
ATOM   7616 C  "C5'" . DG  F 3 19  ? 50.338  -15.713 -16.582 1.00 57.39  ? 47   DG  F "C5'" 1 
ATOM   7617 C  "C4'" . DG  F 3 19  ? 49.809  -14.565 -17.383 1.00 58.50  ? 47   DG  F "C4'" 1 
ATOM   7618 O  "O4'" . DG  F 3 19  ? 48.561  -14.974 -17.995 1.00 58.64  ? 47   DG  F "O4'" 1 
ATOM   7619 C  "C3'" . DG  F 3 19  ? 49.494  -13.407 -16.477 1.00 59.45  ? 47   DG  F "C3'" 1 
ATOM   7620 O  "O3'" . DG  F 3 19  ? 50.593  -12.520 -16.546 1.00 61.88  ? 47   DG  F "O3'" 1 
ATOM   7621 C  "C2'" . DG  F 3 19  ? 48.200  -12.870 -17.085 1.00 58.74  ? 47   DG  F "C2'" 1 
ATOM   7622 C  "C1'" . DG  F 3 19  ? 47.505  -14.126 -17.566 1.00 58.27  ? 47   DG  F "C1'" 1 
ATOM   7623 N  N9    . DG  F 3 19  ? 46.620  -14.816 -16.601 1.00 57.41  ? 47   DG  F N9    1 
ATOM   7624 C  C8    . DG  F 3 19  ? 46.891  -15.994 -15.943 1.00 56.69  ? 47   DG  F C8    1 
ATOM   7625 N  N7    . DG  F 3 19  ? 45.927  -16.401 -15.171 1.00 56.48  ? 47   DG  F N7    1 
ATOM   7626 C  C5    . DG  F 3 19  ? 44.936  -15.443 -15.323 1.00 56.59  ? 47   DG  F C5    1 
ATOM   7627 C  C6    . DG  F 3 19  ? 43.653  -15.352 -14.724 1.00 56.61  ? 47   DG  F C6    1 
ATOM   7628 O  O6    . DG  F 3 19  ? 43.132  -16.129 -13.922 1.00 56.63  ? 47   DG  F O6    1 
ATOM   7629 N  N1    . DG  F 3 19  ? 42.937  -14.227 -15.128 1.00 56.68  ? 47   DG  F N1    1 
ATOM   7630 C  C2    . DG  F 3 19  ? 43.406  -13.288 -16.011 1.00 57.00  ? 47   DG  F C2    1 
ATOM   7631 N  N2    . DG  F 3 19  ? 42.571  -12.269 -16.285 1.00 56.52  ? 47   DG  F N2    1 
ATOM   7632 N  N3    . DG  F 3 19  ? 44.615  -13.364 -16.581 1.00 57.31  ? 47   DG  F N3    1 
ATOM   7633 C  C4    . DG  F 3 19  ? 45.336  -14.460 -16.201 1.00 56.91  ? 47   DG  F C4    1 
ATOM   7634 P  P     . DT  F 3 20  ? 50.405  -10.928 -16.407 1.00 65.31  ? 48   DT  F P     1 
ATOM   7635 O  OP1   . DT  F 3 20  ? 49.750  -10.387 -17.630 1.00 65.51  ? 48   DT  F OP1   1 
ATOM   7636 O  OP2   . DT  F 3 20  ? 51.721  -10.387 -16.003 1.00 66.08  ? 48   DT  F OP2   1 
ATOM   7637 O  "O5'" . DT  F 3 20  ? 49.408  -10.734 -15.160 1.00 64.89  ? 48   DT  F "O5'" 1 
ATOM   7638 C  "C5'" . DT  F 3 20  ? 48.470  -9.652  -15.157 1.00 63.13  ? 48   DT  F "C5'" 1 
ATOM   7639 C  "C4'" . DT  F 3 20  ? 47.016  -10.074 -14.976 1.00 62.01  ? 48   DT  F "C4'" 1 
ATOM   7640 O  "O4'" . DT  F 3 20  ? 46.832  -11.456 -14.597 1.00 62.00  ? 48   DT  F "O4'" 1 
ATOM   7641 C  "C3'" . DT  F 3 20  ? 46.345  -9.393  -13.810 1.00 61.27  ? 48   DT  F "C3'" 1 
ATOM   7642 O  "O3'" . DT  F 3 20  ? 46.060  -8.093  -14.212 1.00 59.57  ? 48   DT  F "O3'" 1 
ATOM   7643 C  "C2'" . DT  F 3 20  ? 45.088  -10.234 -13.587 1.00 61.37  ? 48   DT  F "C2'" 1 
ATOM   7644 C  "C1'" . DT  F 3 20  ? 45.522  -11.609 -14.081 1.00 60.99  ? 48   DT  F "C1'" 1 
ATOM   7645 N  N1    . DT  F 3 20  ? 45.505  -12.754 -13.103 1.00 60.54  ? 48   DT  F N1    1 
ATOM   7646 C  C2    . DT  F 3 20  ? 44.484  -12.932 -12.196 1.00 60.79  ? 48   DT  F C2    1 
ATOM   7647 O  O2    . DT  F 3 20  ? 43.533  -12.194 -12.071 1.00 61.03  ? 48   DT  F O2    1 
ATOM   7648 N  N3    . DT  F 3 20  ? 44.606  -14.032 -11.394 1.00 61.55  ? 48   DT  F N3    1 
ATOM   7649 C  C4    . DT  F 3 20  ? 45.617  -14.974 -11.400 1.00 62.65  ? 48   DT  F C4    1 
ATOM   7650 O  O4    . DT  F 3 20  ? 45.640  -15.938 -10.632 1.00 63.40  ? 48   DT  F O4    1 
ATOM   7651 C  C5    . DT  F 3 20  ? 46.649  -14.743 -12.376 1.00 62.73  ? 48   DT  F C5    1 
ATOM   7652 C  C7    . DT  F 3 20  ? 47.811  -15.698 -12.487 1.00 63.44  ? 48   DT  F C7    1 
ATOM   7653 C  C6    . DT  F 3 20  ? 46.538  -13.660 -13.159 1.00 61.66  ? 48   DT  F C6    1 
ATOM   7654 P  P     . DA  F 3 21  ? 46.929  -6.932  -13.570 1.00 58.55  ? 49   DA  F P     1 
ATOM   7655 O  OP1   . DA  F 3 21  ? 47.928  -6.586  -14.588 1.00 59.60  ? 49   DA  F OP1   1 
ATOM   7656 O  OP2   . DA  F 3 21  ? 47.419  -7.344  -12.233 1.00 58.07  ? 49   DA  F OP2   1 
ATOM   7657 O  "O5'" . DA  F 3 21  ? 45.847  -5.746  -13.457 1.00 57.71  ? 49   DA  F "O5'" 1 
ATOM   7658 C  "C5'" . DA  F 3 21  ? 44.513  -5.917  -13.999 1.00 55.25  ? 49   DA  F "C5'" 1 
ATOM   7659 C  "C4'" . DA  F 3 21  ? 43.378  -6.112  -12.977 1.00 52.77  ? 49   DA  F "C4'" 1 
ATOM   7660 O  "O4'" . DA  F 3 21  ? 43.315  -7.462  -12.434 1.00 52.46  ? 49   DA  F "O4'" 1 
ATOM   7661 C  "C3'" . DA  F 3 21  ? 43.342  -5.211  -11.754 1.00 50.79  ? 49   DA  F "C3'" 1 
ATOM   7662 O  "O3'" . DA  F 3 21  ? 42.015  -4.786  -11.646 1.00 48.43  ? 49   DA  F "O3'" 1 
ATOM   7663 C  "C2'" . DA  F 3 21  ? 43.703  -6.141  -10.603 1.00 50.93  ? 49   DA  F "C2'" 1 
ATOM   7664 C  "C1'" . DA  F 3 21  ? 43.007  -7.409  -11.061 1.00 51.65  ? 49   DA  F "C1'" 1 
ATOM   7665 N  N9    . DA  F 3 21  ? 43.530  -8.627  -10.462 1.00 51.98  ? 49   DA  F N9    1 
ATOM   7666 C  C8    . DA  F 3 21  ? 44.840  -8.994  -10.420 1.00 52.30  ? 49   DA  F C8    1 
ATOM   7667 N  N7    . DA  F 3 21  ? 45.053  -10.149 -9.829  1.00 53.06  ? 49   DA  F N7    1 
ATOM   7668 C  C5    . DA  F 3 21  ? 43.793  -10.583 -9.458  1.00 52.43  ? 49   DA  F C5    1 
ATOM   7669 C  C6    . DA  F 3 21  ? 43.347  -11.747 -8.785  1.00 51.58  ? 49   DA  F C6    1 
ATOM   7670 N  N6    . DA  F 3 21  ? 44.157  -12.711 -8.358  1.00 51.03  ? 49   DA  F N6    1 
ATOM   7671 N  N1    . DA  F 3 21  ? 42.033  -11.885 -8.561  1.00 51.27  ? 49   DA  F N1    1 
ATOM   7672 C  C2    . DA  F 3 21  ? 41.229  -10.902 -8.992  1.00 52.68  ? 49   DA  F C2    1 
ATOM   7673 N  N3    . DA  F 3 21  ? 41.522  -9.761  -9.635  1.00 52.97  ? 49   DA  F N3    1 
ATOM   7674 C  C4    . DA  F 3 21  ? 42.842  -9.652  -9.843  1.00 52.49  ? 49   DA  F C4    1 
ATOM   7675 P  P     . DC  F 3 22  ? 41.617  -3.600  -10.663 1.00 47.20  ? 50   DC  F P     1 
ATOM   7676 O  OP1   . DC  F 3 22  ? 40.421  -2.947  -11.246 1.00 46.92  ? 50   DC  F OP1   1 
ATOM   7677 O  OP2   . DC  F 3 22  ? 42.816  -2.794  -10.320 1.00 47.07  ? 50   DC  F OP2   1 
ATOM   7678 O  "O5'" . DC  F 3 22  ? 41.254  -4.423  -9.346  1.00 45.21  ? 50   DC  F "O5'" 1 
ATOM   7679 C  "C5'" . DC  F 3 22  ? 39.960  -4.915  -9.079  1.00 43.04  ? 50   DC  F "C5'" 1 
ATOM   7680 C  "C4'" . DC  F 3 22  ? 40.008  -5.766  -7.829  1.00 41.54  ? 50   DC  F "C4'" 1 
ATOM   7681 O  "O4'" . DC  F 3 22  ? 41.032  -6.782  -7.949  1.00 41.58  ? 50   DC  F "O4'" 1 
ATOM   7682 C  "C3'" . DC  F 3 22  ? 40.380  -5.020  -6.554  1.00 40.40  ? 50   DC  F "C3'" 1 
ATOM   7683 O  "O3'" . DC  F 3 22  ? 39.332  -5.120  -5.627  1.00 39.59  ? 50   DC  F "O3'" 1 
ATOM   7684 C  "C2'" . DC  F 3 22  ? 41.609  -5.745  -6.026  1.00 40.41  ? 50   DC  F "C2'" 1 
ATOM   7685 C  "C1'" . DC  F 3 22  ? 41.313  -7.103  -6.613  1.00 41.56  ? 50   DC  F "C1'" 1 
ATOM   7686 N  N1    . DC  F 3 22  ? 42.417  -8.048  -6.541  1.00 42.61  ? 50   DC  F N1    1 
ATOM   7687 C  C2    . DC  F 3 22  ? 42.234  -9.295  -5.920  1.00 43.83  ? 50   DC  F C2    1 
ATOM   7688 O  O2    . DC  F 3 22  ? 41.143  -9.612  -5.434  1.00 44.06  ? 50   DC  F O2    1 
ATOM   7689 N  N3    . DC  F 3 22  ? 43.270  -10.154 -5.864  1.00 45.15  ? 50   DC  F N3    1 
ATOM   7690 C  C4    . DC  F 3 22  ? 44.438  -9.794  -6.395  1.00 46.07  ? 50   DC  F C4    1 
ATOM   7691 N  N4    . DC  F 3 22  ? 45.448  -10.670 -6.334  1.00 47.51  ? 50   DC  F N4    1 
ATOM   7692 C  C5    . DC  F 3 22  ? 44.632  -8.526  -7.025  1.00 45.52  ? 50   DC  F C5    1 
ATOM   7693 C  C6    . DC  F 3 22  ? 43.603  -7.688  -7.081  1.00 43.50  ? 50   DC  F C6    1 
ATOM   7694 P  P     . DA  F 3 23  ? 38.548  -3.795  -5.183  1.00 38.74  ? 51   DA  F P     1 
ATOM   7695 O  OP1   . DA  F 3 23  ? 37.813  -3.357  -6.384  1.00 38.89  ? 51   DA  F OP1   1 
ATOM   7696 O  OP2   . DA  F 3 23  ? 39.505  -2.879  -4.503  1.00 37.81  ? 51   DA  F OP2   1 
ATOM   7697 O  "O5'" . DA  F 3 23  ? 37.490  -4.378  -4.122  1.00 37.01  ? 51   DA  F "O5'" 1 
ATOM   7698 C  "C5'" . DA  F 3 23  ? 36.741  -5.553  -4.458  1.00 34.65  ? 51   DA  F "C5'" 1 
ATOM   7699 C  "C4'" . DA  F 3 23  ? 36.818  -6.679  -3.435  1.00 32.49  ? 51   DA  F "C4'" 1 
ATOM   7700 O  "O4'" . DA  F 3 23  ? 38.049  -7.412  -3.587  1.00 30.71  ? 51   DA  F "O4'" 1 
ATOM   7701 C  "C3'" . DA  F 3 23  ? 36.725  -6.289  -1.971  1.00 32.08  ? 51   DA  F "C3'" 1 
ATOM   7702 O  "O3'" . DA  F 3 23  ? 35.862  -7.173  -1.302  1.00 34.03  ? 51   DA  F "O3'" 1 
ATOM   7703 C  "C2'" . DA  F 3 23  ? 38.137  -6.479  -1.480  1.00 31.76  ? 51   DA  F "C2'" 1 
ATOM   7704 C  "C1'" . DA  F 3 23  ? 38.567  -7.673  -2.307  1.00 30.94  ? 51   DA  F "C1'" 1 
ATOM   7705 N  N9    . DA  F 3 23  ? 40.014  -7.818  -2.459  1.00 30.67  ? 51   DA  F N9    1 
ATOM   7706 C  C8    . DA  F 3 23  ? 40.923  -6.870  -2.855  1.00 30.64  ? 51   DA  F C8    1 
ATOM   7707 N  N7    . DA  F 3 23  ? 42.164  -7.292  -2.919  1.00 30.73  ? 51   DA  F N7    1 
ATOM   7708 C  C5    . DA  F 3 23  ? 42.059  -8.618  -2.535  1.00 30.67  ? 51   DA  F C5    1 
ATOM   7709 C  C6    . DA  F 3 23  ? 43.022  -9.636  -2.389  1.00 30.71  ? 51   DA  F C6    1 
ATOM   7710 N  N6    . DA  F 3 23  ? 44.315  -9.464  -2.630  1.00 30.96  ? 51   DA  F N6    1 
ATOM   7711 N  N1    . DA  F 3 23  ? 42.603  -10.845 -1.980  1.00 30.95  ? 51   DA  F N1    1 
ATOM   7712 C  C2    . DA  F 3 23  ? 41.288  -11.012 -1.734  1.00 31.22  ? 51   DA  F C2    1 
ATOM   7713 N  N3    . DA  F 3 23  ? 40.279  -10.146 -1.838  1.00 29.81  ? 51   DA  F N3    1 
ATOM   7714 C  C4    . DA  F 3 23  ? 40.744  -8.957  -2.247  1.00 30.24  ? 51   DA  F C4    1 
ATOM   7715 P  P     . DC  F 3 24  ? 35.318  -6.786  0.166   1.00 36.89  ? 52   DC  F P     1 
ATOM   7716 O  OP1   . DC  F 3 24  ? 33.846  -6.924  0.259   1.00 36.49  ? 52   DC  F OP1   1 
ATOM   7717 O  OP2   . DC  F 3 24  ? 35.965  -5.547  0.689   1.00 35.81  ? 52   DC  F OP2   1 
ATOM   7718 O  "O5'" . DC  F 3 24  ? 35.919  -8.049  0.897   1.00 36.20  ? 52   DC  F "O5'" 1 
ATOM   7719 C  "C5'" . DC  F 3 24  ? 36.650  -7.750  2.004   1.00 35.35  ? 52   DC  F "C5'" 1 
ATOM   7720 C  "C4'" . DC  F 3 24  ? 37.558  -8.874  2.344   1.00 33.74  ? 52   DC  F "C4'" 1 
ATOM   7721 O  "O4'" . DC  F 3 24  ? 38.470  -9.042  1.254   1.00 32.99  ? 52   DC  F "O4'" 1 
ATOM   7722 C  "C3'" . DC  F 3 24  ? 38.439  -8.353  3.434   1.00 34.47  ? 52   DC  F "C3'" 1 
ATOM   7723 O  "O3'" . DC  F 3 24  ? 37.670  -8.373  4.638   1.00 35.66  ? 52   DC  F "O3'" 1 
ATOM   7724 C  "C2'" . DC  F 3 24  ? 39.573  -9.354  3.292   1.00 33.33  ? 52   DC  F "C2'" 1 
ATOM   7725 C  "C1'" . DC  F 3 24  ? 39.703  -9.454  1.787   1.00 31.05  ? 52   DC  F "C1'" 1 
ATOM   7726 N  N1    . DC  F 3 24  ? 40.791  -8.608  1.315   1.00 28.79  ? 52   DC  F N1    1 
ATOM   7727 C  C2    . DC  F 3 24  ? 42.028  -9.229  1.178   1.00 28.81  ? 52   DC  F C2    1 
ATOM   7728 O  O2    . DC  F 3 24  ? 42.101  -10.418 1.453   1.00 29.55  ? 52   DC  F O2    1 
ATOM   7729 N  N3    . DC  F 3 24  ? 43.106  -8.535  0.754   1.00 28.74  ? 52   DC  F N3    1 
ATOM   7730 C  C4    . DC  F 3 24  ? 42.946  -7.244  0.477   1.00 29.12  ? 52   DC  F C4    1 
ATOM   7731 N  N4    . DC  F 3 24  ? 44.035  -6.593  0.065   1.00 29.26  ? 52   DC  F N4    1 
ATOM   7732 C  C5    . DC  F 3 24  ? 41.679  -6.573  0.608   1.00 28.96  ? 52   DC  F C5    1 
ATOM   7733 C  C6    . DC  F 3 24  ? 40.628  -7.283  1.036   1.00 28.35  ? 52   DC  F C6    1 
ATOM   7734 P  P     . DC  F 3 25  ? 38.159  -9.155  5.928   1.00 37.41  ? 53   DC  F P     1 
ATOM   7735 O  OP1   . DC  F 3 25  ? 37.049  -9.125  6.902   1.00 37.47  ? 53   DC  F OP1   1 
ATOM   7736 O  OP2   . DC  F 3 25  ? 39.473  -8.559  6.264   1.00 36.83  ? 53   DC  F OP2   1 
ATOM   7737 O  "O5'" . DC  F 3 25  ? 38.331  -10.689 5.399   1.00 38.77  ? 53   DC  F "O5'" 1 
ATOM   7738 C  "C5'" . DC  F 3 25  ? 38.804  -11.816 6.185   1.00 37.14  ? 53   DC  F "C5'" 1 
ATOM   7739 C  "C4'" . DC  F 3 25  ? 40.304  -12.171 6.097   1.00 36.84  ? 53   DC  F "C4'" 1 
ATOM   7740 O  "O4'" . DC  F 3 25  ? 41.105  -11.516 5.058   1.00 35.06  ? 53   DC  F "O4'" 1 
ATOM   7741 C  "C3'" . DC  F 3 25  ? 41.051  -11.885 7.395   1.00 37.36  ? 53   DC  F "C3'" 1 
ATOM   7742 O  "O3'" . DC  F 3 25  ? 41.947  -12.925 7.741   1.00 39.14  ? 53   DC  F "O3'" 1 
ATOM   7743 C  "C2'" . DC  F 3 25  ? 41.868  -10.668 7.039   1.00 36.73  ? 53   DC  F "C2'" 1 
ATOM   7744 C  "C1'" . DC  F 3 25  ? 42.306  -11.130 5.665   1.00 34.39  ? 53   DC  F "C1'" 1 
ATOM   7745 N  N1    . DC  F 3 25  ? 43.025  -10.052 4.979   1.00 33.73  ? 53   DC  F N1    1 
ATOM   7746 C  C2    . DC  F 3 25  ? 44.325  -10.335 4.598   1.00 34.52  ? 53   DC  F C2    1 
ATOM   7747 O  O2    . DC  F 3 25  ? 44.746  -11.468 4.825   1.00 36.09  ? 53   DC  F O2    1 
ATOM   7748 N  N3    . DC  F 3 25  ? 45.071  -9.385  3.983   1.00 34.23  ? 53   DC  F N3    1 
ATOM   7749 C  C4    . DC  F 3 25  ? 44.547  -8.185  3.755   1.00 32.65  ? 53   DC  F C4    1 
ATOM   7750 N  N4    . DC  F 3 25  ? 45.328  -7.295  3.136   1.00 31.73  ? 53   DC  F N4    1 
ATOM   7751 C  C5    . DC  F 3 25  ? 43.216  -7.862  4.162   1.00 32.51  ? 53   DC  F C5    1 
ATOM   7752 C  C6    . DC  F 3 25  ? 42.500  -8.813  4.773   1.00 32.74  ? 53   DC  F C6    1 
ATOM   7753 P  P     . DT  F 3 26  ? 42.108  -13.229 9.300   1.00 39.69  ? 54   DT  F P     1 
ATOM   7754 O  OP1   . DT  F 3 26  ? 41.997  -14.705 9.476   1.00 40.51  ? 54   DT  F OP1   1 
ATOM   7755 O  OP2   . DT  F 3 26  ? 41.200  -12.282 10.007  1.00 38.24  ? 54   DT  F OP2   1 
ATOM   7756 O  "O5'" . DT  F 3 26  ? 43.616  -12.826 9.654   1.00 40.16  ? 54   DT  F "O5'" 1 
ATOM   7757 C  "C5'" . DT  F 3 26  ? 44.758  -13.176 8.858   1.00 40.36  ? 54   DT  F "C5'" 1 
ATOM   7758 C  "C4'" . DT  F 3 26  ? 45.946  -12.362 9.340   1.00 38.98  ? 54   DT  F "C4'" 1 
ATOM   7759 O  "O4'" . DT  F 3 26  ? 46.363  -11.440 8.315   1.00 38.37  ? 54   DT  F "O4'" 1 
ATOM   7760 C  "C3'" . DT  F 3 26  ? 45.570  -11.536 10.557  1.00 39.12  ? 54   DT  F "C3'" 1 
ATOM   7761 O  "O3'" . DT  F 3 26  ? 46.349  -11.947 11.637  1.00 39.41  ? 54   DT  F "O3'" 1 
ATOM   7762 C  "C2'" . DT  F 3 26  ? 45.885  -10.104 10.196  1.00 39.23  ? 54   DT  F "C2'" 1 
ATOM   7763 C  "C1'" . DT  F 3 26  ? 46.685  -10.224 8.914   1.00 39.38  ? 54   DT  F "C1'" 1 
ATOM   7764 N  N1    . DT  F 3 26  ? 46.284  -9.127  8.065   1.00 40.63  ? 54   DT  F N1    1 
ATOM   7765 C  C2    . DT  F 3 26  ? 47.091  -8.668  7.054   1.00 42.25  ? 54   DT  F C2    1 
ATOM   7766 O  O2    . DT  F 3 26  ? 48.172  -9.133  6.754   1.00 41.97  ? 54   DT  F O2    1 
ATOM   7767 N  N3    . DT  F 3 26  ? 46.567  -7.601  6.374   1.00 44.65  ? 54   DT  F N3    1 
ATOM   7768 C  C4    . DT  F 3 26  ? 45.356  -6.967  6.617   1.00 45.26  ? 54   DT  F C4    1 
ATOM   7769 O  O4    . DT  F 3 26  ? 44.954  -6.005  5.968   1.00 47.28  ? 54   DT  F O4    1 
ATOM   7770 C  C5    . DT  F 3 26  ? 44.575  -7.508  7.689   1.00 44.45  ? 54   DT  F C5    1 
ATOM   7771 C  C7    . DT  F 3 26  ? 43.245  -6.893  8.022   1.00 45.44  ? 54   DT  F C7    1 
ATOM   7772 C  C6    . DT  F 3 26  ? 45.076  -8.545  8.356   1.00 42.48  ? 54   DT  F C6    1 
ATOM   7773 P  P     . DG  F 3 27  ? 45.851  -11.802 13.148  1.00 39.45  ? 55   DG  F P     1 
ATOM   7774 O  OP1   . DG  F 3 27  ? 45.509  -13.168 13.623  1.00 36.87  ? 55   DG  F OP1   1 
ATOM   7775 O  OP2   . DG  F 3 27  ? 44.912  -10.648 13.263  1.00 38.24  ? 55   DG  F OP2   1 
ATOM   7776 O  "O5'" . DG  F 3 27  ? 47.203  -11.333 13.851  1.00 38.95  ? 55   DG  F "O5'" 1 
ATOM   7777 C  "C5'" . DG  F 3 27  ? 48.371  -11.169 13.086  1.00 39.77  ? 55   DG  F "C5'" 1 
ATOM   7778 C  "C4'" . DG  F 3 27  ? 49.076  -9.885  13.438  1.00 40.56  ? 55   DG  F "C4'" 1 
ATOM   7779 O  "O4'" . DG  F 3 27  ? 49.031  -8.986  12.316  1.00 41.43  ? 55   DG  F "O4'" 1 
ATOM   7780 C  "C3'" . DG  F 3 27  ? 48.444  -9.112  14.562  1.00 40.93  ? 55   DG  F "C3'" 1 
ATOM   7781 O  "O3'" . DG  F 3 27  ? 48.952  -9.743  15.707  1.00 41.31  ? 55   DG  F "O3'" 1 
ATOM   7782 C  "C2'" . DG  F 3 27  ? 48.972  -7.701  14.308  1.00 41.14  ? 55   DG  F "C2'" 1 
ATOM   7783 C  "C1'" . DG  F 3 27  ? 49.102  -7.664  12.782  1.00 41.65  ? 55   DG  F "C1'" 1 
ATOM   7784 N  N9    . DG  F 3 27  ? 48.026  -7.040  12.041  1.00 42.30  ? 55   DG  F N9    1 
ATOM   7785 C  C8    . DG  F 3 27  ? 46.707  -7.071  12.389  1.00 43.36  ? 55   DG  F C8    1 
ATOM   7786 N  N7    . DG  F 3 27  ? 45.929  -6.458  11.546  1.00 43.87  ? 55   DG  F N7    1 
ATOM   7787 C  C5    . DG  F 3 27  ? 46.791  -6.002  10.571  1.00 43.24  ? 55   DG  F C5    1 
ATOM   7788 C  C6    . DG  F 3 27  ? 46.486  -5.262  9.413   1.00 43.30  ? 55   DG  F C6    1 
ATOM   7789 O  O6    . DG  F 3 27  ? 45.370  -4.872  9.043   1.00 42.89  ? 55   DG  F O6    1 
ATOM   7790 N  N1    . DG  F 3 27  ? 47.633  -4.975  8.673   1.00 43.53  ? 55   DG  F N1    1 
ATOM   7791 C  C2    . DG  F 3 27  ? 48.906  -5.355  9.020   1.00 43.03  ? 55   DG  F C2    1 
ATOM   7792 N  N2    . DG  F 3 27  ? 49.857  -4.980  8.161   1.00 43.17  ? 55   DG  F N2    1 
ATOM   7793 N  N3    . DG  F 3 27  ? 49.203  -6.062  10.110  1.00 43.17  ? 55   DG  F N3    1 
ATOM   7794 C  C4    . DG  F 3 27  ? 48.093  -6.356  10.844  1.00 42.95  ? 55   DG  F C4    1 
ATOM   7795 P  P     . DA  F 3 28  ? 48.615  -9.271  17.196  1.00 42.85  ? 56   DA  F P     1 
ATOM   7796 O  OP1   . DA  F 3 28  ? 49.739  -8.376  17.573  1.00 43.25  ? 56   DA  F OP1   1 
ATOM   7797 O  OP2   . DA  F 3 28  ? 48.309  -10.504 17.964  1.00 41.24  ? 56   DA  F OP2   1 
ATOM   7798 O  "O5'" . DA  F 3 28  ? 47.283  -8.372  17.154  1.00 43.74  ? 56   DA  F "O5'" 1 
ATOM   7799 C  "C5'" . DA  F 3 28  ? 47.020  -7.425  18.199  1.00 45.35  ? 56   DA  F "C5'" 1 
ATOM   7800 C  "C4'" . DA  F 3 28  ? 48.037  -6.318  18.064  1.00 47.22  ? 56   DA  F "C4'" 1 
ATOM   7801 O  "O4'" . DA  F 3 28  ? 47.931  -5.973  16.663  1.00 47.52  ? 56   DA  F "O4'" 1 
ATOM   7802 C  "C3'" . DA  F 3 28  ? 47.857  -5.039  18.901  1.00 48.20  ? 56   DA  F "C3'" 1 
ATOM   7803 O  "O3'" . DA  F 3 28  ? 48.712  -4.933  20.104  1.00 46.39  ? 56   DA  F "O3'" 1 
ATOM   7804 C  "C2'" . DA  F 3 28  ? 48.147  -3.940  17.865  1.00 48.92  ? 56   DA  F "C2'" 1 
ATOM   7805 C  "C1'" . DA  F 3 28  ? 48.364  -4.652  16.518  1.00 48.73  ? 56   DA  F "C1'" 1 
ATOM   7806 N  N9    . DA  F 3 28  ? 47.616  -4.094  15.403  1.00 49.26  ? 56   DA  F N9    1 
ATOM   7807 C  C8    . DA  F 3 28  ? 46.318  -3.675  15.403  1.00 50.11  ? 56   DA  F C8    1 
ATOM   7808 N  N7    . DA  F 3 28  ? 45.897  -3.204  14.253  1.00 49.98  ? 56   DA  F N7    1 
ATOM   7809 C  C5    . DA  F 3 28  ? 47.001  -3.336  13.449  1.00 49.96  ? 56   DA  F C5    1 
ATOM   7810 C  C6    . DA  F 3 28  ? 47.203  -3.010  12.106  1.00 50.51  ? 56   DA  F C6    1 
ATOM   7811 N  N6    . DA  F 3 28  ? 46.229  -2.485  11.365  1.00 51.35  ? 56   DA  F N6    1 
ATOM   7812 N  N1    . DA  F 3 28  ? 48.423  -3.248  11.569  1.00 51.22  ? 56   DA  F N1    1 
ATOM   7813 C  C2    . DA  F 3 28  ? 49.381  -3.776  12.355  1.00 51.52  ? 56   DA  F C2    1 
ATOM   7814 N  N3    . DA  F 3 28  ? 49.303  -4.129  13.645  1.00 51.02  ? 56   DA  F N3    1 
ATOM   7815 C  C4    . DA  F 3 28  ? 48.072  -3.881  14.132  1.00 50.09  ? 56   DA  F C4    1 
ATOM   7816 O  OP3   . DG  G 2 1   ? 40.019  -13.411 34.911  1.00 53.19  ? 4    DG  G OP3   1 
ATOM   7817 P  P     . DG  G 2 1   ? 40.843  -12.439 34.155  1.00 53.56  ? 4    DG  G P     1 
ATOM   7818 O  OP1   . DG  G 2 1   ? 41.111  -11.127 34.790  1.00 54.10  ? 4    DG  G OP1   1 
ATOM   7819 O  OP2   . DG  G 2 1   ? 42.158  -13.088 33.936  1.00 54.21  ? 4    DG  G OP2   1 
ATOM   7820 O  "O5'" . DG  G 2 1   ? 40.179  -12.175 32.709  1.00 52.06  ? 4    DG  G "O5'" 1 
ATOM   7821 C  "C5'" . DG  G 2 1   ? 39.556  -10.918 32.398  1.00 49.80  ? 4    DG  G "C5'" 1 
ATOM   7822 C  "C4'" . DG  G 2 1   ? 38.157  -10.859 32.996  1.00 48.28  ? 4    DG  G "C4'" 1 
ATOM   7823 O  "O4'" . DG  G 2 1   ? 37.322  -11.768 32.221  1.00 48.11  ? 4    DG  G "O4'" 1 
ATOM   7824 C  "C3'" . DG  G 2 1   ? 37.987  -11.330 34.453  1.00 46.55  ? 4    DG  G "C3'" 1 
ATOM   7825 O  "O3'" . DG  G 2 1   ? 38.222  -10.331 35.470  1.00 43.65  ? 4    DG  G "O3'" 1 
ATOM   7826 C  "C2'" . DG  G 2 1   ? 36.548  -11.824 34.411  1.00 47.10  ? 4    DG  G "C2'" 1 
ATOM   7827 C  "C1'" . DG  G 2 1   ? 36.547  -12.582 33.095  1.00 47.19  ? 4    DG  G "C1'" 1 
ATOM   7828 N  N9    . DG  G 2 1   ? 37.086  -13.950 33.181  1.00 46.09  ? 4    DG  G N9    1 
ATOM   7829 C  C8    . DG  G 2 1   ? 38.336  -14.363 33.567  1.00 45.21  ? 4    DG  G C8    1 
ATOM   7830 N  N7    . DG  G 2 1   ? 38.530  -15.645 33.541  1.00 44.77  ? 4    DG  G N7    1 
ATOM   7831 C  C5    . DG  G 2 1   ? 37.318  -16.130 33.101  1.00 44.72  ? 4    DG  G C5    1 
ATOM   7832 C  C6    . DG  G 2 1   ? 36.924  -17.459 32.870  1.00 44.49  ? 4    DG  G C6    1 
ATOM   7833 O  O6    . DG  G 2 1   ? 37.598  -18.485 33.022  1.00 44.36  ? 4    DG  G O6    1 
ATOM   7834 N  N1    . DG  G 2 1   ? 35.606  -17.526 32.430  1.00 44.62  ? 4    DG  G N1    1 
ATOM   7835 C  C2    . DG  G 2 1   ? 34.791  -16.431 32.244  1.00 44.73  ? 4    DG  G C2    1 
ATOM   7836 N  N2    . DG  G 2 1   ? 33.556  -16.665 31.805  1.00 45.30  ? 4    DG  G N2    1 
ATOM   7837 N  N3    . DG  G 2 1   ? 35.149  -15.179 32.449  1.00 44.71  ? 4    DG  G N3    1 
ATOM   7838 C  C4    . DG  G 2 1   ? 36.423  -15.107 32.879  1.00 45.20  ? 4    DG  G C4    1 
ATOM   7839 P  P     . DG  G 2 2   ? 38.514  -10.683 37.014  1.00 41.61  ? 5    DG  G P     1 
ATOM   7840 O  OP1   . DG  G 2 2   ? 38.906  -9.396  37.613  1.00 41.66  ? 5    DG  G OP1   1 
ATOM   7841 O  OP2   . DG  G 2 2   ? 39.385  -11.871 37.151  1.00 40.99  ? 5    DG  G OP2   1 
ATOM   7842 O  "O5'" . DG  G 2 2   ? 37.111  -11.115 37.639  1.00 41.85  ? 5    DG  G "O5'" 1 
ATOM   7843 C  "C5'" . DG  G 2 2   ? 35.931  -10.326 37.441  1.00 41.80  ? 5    DG  G "C5'" 1 
ATOM   7844 C  "C4'" . DG  G 2 2   ? 34.658  -11.167 37.479  1.00 41.57  ? 5    DG  G "C4'" 1 
ATOM   7845 O  "O4'" . DG  G 2 2   ? 34.507  -12.007 36.294  1.00 42.41  ? 5    DG  G "O4'" 1 
ATOM   7846 C  "C3'" . DG  G 2 2   ? 34.569  -12.133 38.644  1.00 40.52  ? 5    DG  G "C3'" 1 
ATOM   7847 O  "O3'" . DG  G 2 2   ? 34.118  -11.424 39.782  1.00 38.53  ? 5    DG  G "O3'" 1 
ATOM   7848 C  "C2'" . DG  G 2 2   ? 33.518  -13.104 38.116  1.00 41.84  ? 5    DG  G "C2'" 1 
ATOM   7849 C  "C1'" . DG  G 2 2   ? 33.848  -13.215 36.633  1.00 42.82  ? 5    DG  G "C1'" 1 
ATOM   7850 N  N9    . DG  G 2 2   ? 34.674  -14.401 36.402  1.00 43.74  ? 5    DG  G N9    1 
ATOM   7851 C  C8    . DG  G 2 2   ? 36.041  -14.509 36.460  1.00 44.49  ? 5    DG  G C8    1 
ATOM   7852 N  N7    . DG  G 2 2   ? 36.492  -15.709 36.231  1.00 44.55  ? 5    DG  G N7    1 
ATOM   7853 C  C5    . DG  G 2 2   ? 35.351  -16.453 36.024  1.00 44.28  ? 5    DG  G C5    1 
ATOM   7854 C  C6    . DG  G 2 2   ? 35.217  -17.826 35.732  1.00 44.54  ? 5    DG  G C6    1 
ATOM   7855 O  O6    . DG  G 2 2   ? 36.122  -18.663 35.608  1.00 44.62  ? 5    DG  G O6    1 
ATOM   7856 N  N1    . DG  G 2 2   ? 33.878  -18.193 35.591  1.00 44.72  ? 5    DG  G N1    1 
ATOM   7857 C  C2    . DG  G 2 2   ? 32.815  -17.324 35.723  1.00 44.55  ? 5    DG  G C2    1 
ATOM   7858 N  N2    . DG  G 2 2   ? 31.592  -17.836 35.559  1.00 44.65  ? 5    DG  G N2    1 
ATOM   7859 N  N3    . DG  G 2 2   ? 32.932  -16.033 35.997  1.00 44.34  ? 5    DG  G N3    1 
ATOM   7860 C  C4    . DG  G 2 2   ? 34.226  -15.667 36.133  1.00 44.09  ? 5    DG  G C4    1 
ATOM   7861 P  P     . DT  G 2 3   ? 34.208  -12.093 41.228  1.00 37.59  ? 6    DT  G P     1 
ATOM   7862 O  OP1   . DT  G 2 3   ? 33.766  -11.123 42.249  1.00 37.98  ? 6    DT  G OP1   1 
ATOM   7863 O  OP2   . DT  G 2 3   ? 35.520  -12.747 41.380  1.00 38.02  ? 6    DT  G OP2   1 
ATOM   7864 O  "O5'" . DT  G 2 3   ? 33.144  -13.265 41.113  1.00 37.25  ? 6    DT  G "O5'" 1 
ATOM   7865 C  "C5'" . DT  G 2 3   ? 31.780  -13.069 40.739  1.00 36.07  ? 6    DT  G "C5'" 1 
ATOM   7866 C  "C4'" . DT  G 2 3   ? 31.130  -14.427 40.880  1.00 35.28  ? 6    DT  G "C4'" 1 
ATOM   7867 O  "O4'" . DT  G 2 3   ? 31.733  -15.340 39.923  1.00 35.51  ? 6    DT  G "O4'" 1 
ATOM   7868 C  "C3'" . DT  G 2 3   ? 31.374  -14.983 42.281  1.00 34.31  ? 6    DT  G "C3'" 1 
ATOM   7869 O  "O3'" . DT  G 2 3   ? 30.128  -15.151 42.974  1.00 31.94  ? 6    DT  G "O3'" 1 
ATOM   7870 C  "C2'" . DT  G 2 3   ? 32.203  -16.254 42.063  1.00 35.06  ? 6    DT  G "C2'" 1 
ATOM   7871 C  "C1'" . DT  G 2 3   ? 32.089  -16.551 40.567  1.00 35.98  ? 6    DT  G "C1'" 1 
ATOM   7872 N  N1    . DT  G 2 3   ? 33.336  -17.157 39.940  1.00 36.78  ? 6    DT  G N1    1 
ATOM   7873 C  C2    . DT  G 2 3   ? 33.247  -18.393 39.328  1.00 36.86  ? 6    DT  G C2    1 
ATOM   7874 O  O2    . DT  G 2 3   ? 32.218  -19.034 39.263  1.00 36.53  ? 6    DT  G O2    1 
ATOM   7875 N  N3    . DT  G 2 3   ? 34.419  -18.867 38.786  1.00 37.24  ? 6    DT  G N3    1 
ATOM   7876 C  C4    . DT  G 2 3   ? 35.655  -18.246 38.784  1.00 37.65  ? 6    DT  G C4    1 
ATOM   7877 O  O4    . DT  G 2 3   ? 36.641  -18.759 38.267  1.00 37.30  ? 6    DT  G O4    1 
ATOM   7878 C  C5    . DT  G 2 3   ? 35.692  -16.957 39.434  1.00 38.08  ? 6    DT  G C5    1 
ATOM   7879 C  C7    . DT  G 2 3   ? 36.981  -16.183 39.500  1.00 38.44  ? 6    DT  G C7    1 
ATOM   7880 C  C6    . DT  G 2 3   ? 34.549  -16.484 39.972  1.00 37.82  ? 6    DT  G C6    1 
ATOM   7881 P  P     . DG  G 2 4   ? 30.021  -15.913 44.370  1.00 30.14  ? 7    DG  G P     1 
ATOM   7882 O  OP1   . DG  G 2 4   ? 28.799  -15.463 45.058  1.00 29.82  ? 7    DG  G OP1   1 
ATOM   7883 O  OP2   . DG  G 2 4   ? 31.321  -15.879 45.059  1.00 30.43  ? 7    DG  G OP2   1 
ATOM   7884 O  "O5'" . DG  G 2 4   ? 29.830  -17.404 43.876  1.00 30.82  ? 7    DG  G "O5'" 1 
ATOM   7885 C  "C5'" . DG  G 2 4   ? 28.543  -17.931 43.654  1.00 31.98  ? 7    DG  G "C5'" 1 
ATOM   7886 C  "C4'" . DG  G 2 4   ? 28.607  -19.392 44.022  1.00 32.80  ? 7    DG  G "C4'" 1 
ATOM   7887 O  "O4'" . DG  G 2 4   ? 29.509  -20.036 43.085  1.00 32.23  ? 7    DG  G "O4'" 1 
ATOM   7888 C  "C3'" . DG  G 2 4   ? 29.141  -19.577 45.442  1.00 33.62  ? 7    DG  G "C3'" 1 
ATOM   7889 O  "O3'" . DG  G 2 4   ? 28.142  -20.172 46.299  1.00 34.35  ? 7    DG  G "O3'" 1 
ATOM   7890 C  "C2'" . DG  G 2 4   ? 30.436  -20.375 45.271  1.00 33.55  ? 7    DG  G "C2'" 1 
ATOM   7891 C  "C1'" . DG  G 2 4   ? 30.547  -20.697 43.774  1.00 33.33  ? 7    DG  G "C1'" 1 
ATOM   7892 N  N9    . DG  G 2 4   ? 31.834  -20.301 43.208  1.00 33.32  ? 7    DG  G N9    1 
ATOM   7893 C  C8    . DG  G 2 4   ? 32.502  -19.133 43.473  1.00 33.92  ? 7    DG  G C8    1 
ATOM   7894 N  N7    . DG  G 2 4   ? 33.640  -19.016 42.851  1.00 34.24  ? 7    DG  G N7    1 
ATOM   7895 C  C5    . DG  G 2 4   ? 33.742  -20.191 42.130  1.00 33.97  ? 7    DG  G C5    1 
ATOM   7896 C  C6    . DG  G 2 4   ? 34.780  -20.615 41.269  1.00 33.99  ? 7    DG  G C6    1 
ATOM   7897 O  O6    . DG  G 2 4   ? 35.816  -20.001 40.987  1.00 33.03  ? 7    DG  G O6    1 
ATOM   7898 N  N1    . DG  G 2 4   ? 34.516  -21.872 40.717  1.00 34.45  ? 7    DG  G N1    1 
ATOM   7899 C  C2    . DG  G 2 4   ? 33.380  -22.618 40.985  1.00 34.36  ? 7    DG  G C2    1 
ATOM   7900 N  N2    . DG  G 2 4   ? 33.290  -23.808 40.370  1.00 34.62  ? 7    DG  G N2    1 
ATOM   7901 N  N3    . DG  G 2 4   ? 32.398  -22.223 41.798  1.00 33.58  ? 7    DG  G N3    1 
ATOM   7902 C  C4    . DG  G 2 4   ? 32.642  -21.001 42.337  1.00 33.57  ? 7    DG  G C4    1 
ATOM   7903 P  P     . DT  G 2 5   ? 28.075  -21.733 46.656  1.00 35.36  ? 8    DT  G P     1 
ATOM   7904 O  OP1   . DT  G 2 5   ? 26.985  -21.889 47.638  1.00 35.26  ? 8    DT  G OP1   1 
ATOM   7905 O  OP2   . DT  G 2 5   ? 29.437  -22.225 46.939  1.00 35.03  ? 8    DT  G OP2   1 
ATOM   7906 O  "O5'" . DT  G 2 5   ? 27.626  -22.476 45.322  1.00 38.59  ? 8    DT  G "O5'" 1 
ATOM   7907 C  "C5'" . DT  G 2 5   ? 27.173  -23.823 45.424  1.00 42.60  ? 8    DT  G "C5'" 1 
ATOM   7908 C  "C4'" . DT  G 2 5   ? 28.280  -24.855 45.251  1.00 45.24  ? 8    DT  G "C4'" 1 
ATOM   7909 O  "O4'" . DT  G 2 5   ? 29.540  -24.283 44.825  1.00 45.83  ? 8    DT  G "O4'" 1 
ATOM   7910 C  "C3'" . DT  G 2 5   ? 28.643  -25.669 46.486  1.00 46.90  ? 8    DT  G "C3'" 1 
ATOM   7911 O  "O3'" . DT  G 2 5   ? 28.637  -27.013 46.053  1.00 49.13  ? 8    DT  G "O3'" 1 
ATOM   7912 C  "C2'" . DT  G 2 5   ? 30.067  -25.219 46.816  1.00 46.78  ? 8    DT  G "C2'" 1 
ATOM   7913 C  "C1'" . DT  G 2 5   ? 30.550  -25.100 45.380  1.00 46.49  ? 8    DT  G "C1'" 1 
ATOM   7914 N  N1    . DT  G 2 5   ? 31.876  -24.483 45.042  1.00 46.88  ? 8    DT  G N1    1 
ATOM   7915 C  C2    . DT  G 2 5   ? 32.693  -25.127 44.113  1.00 47.00  ? 8    DT  G C2    1 
ATOM   7916 O  O2    . DT  G 2 5   ? 32.430  -26.189 43.570  1.00 46.81  ? 8    DT  G O2    1 
ATOM   7917 N  N3    . DT  G 2 5   ? 33.866  -24.479 43.830  1.00 46.99  ? 8    DT  G N3    1 
ATOM   7918 C  C4    . DT  G 2 5   ? 34.287  -23.276 44.366  1.00 47.41  ? 8    DT  G C4    1 
ATOM   7919 O  O4    . DT  G 2 5   ? 35.363  -22.793 44.034  1.00 47.99  ? 8    DT  G O4    1 
ATOM   7920 C  C5    . DT  G 2 5   ? 33.393  -22.644 45.324  1.00 47.32  ? 8    DT  G C5    1 
ATOM   7921 C  C7    . DT  G 2 5   ? 33.750  -21.335 45.977  1.00 47.23  ? 8    DT  G C7    1 
ATOM   7922 C  C6    . DT  G 2 5   ? 32.241  -23.272 45.608  1.00 46.86  ? 8    DT  G C6    1 
ATOM   7923 P  P     . DA  G 2 6   ? 28.287  -28.194 47.062  1.00 51.02  ? 9    DA  G P     1 
ATOM   7924 O  OP1   . DA  G 2 6   ? 26.840  -28.091 47.376  1.00 51.07  ? 9    DA  G OP1   1 
ATOM   7925 O  OP2   . DA  G 2 6   ? 29.296  -28.170 48.155  1.00 50.81  ? 9    DA  G OP2   1 
ATOM   7926 O  "O5'" . DA  G 2 6   ? 28.530  -29.477 46.132  1.00 51.79  ? 9    DA  G "O5'" 1 
ATOM   7927 C  "C5'" . DA  G 2 6   ? 29.261  -30.597 46.610  1.00 53.19  ? 9    DA  G "C5'" 1 
ATOM   7928 C  "C4'" . DA  G 2 6   ? 30.719  -30.560 46.181  1.00 54.19  ? 9    DA  G "C4'" 1 
ATOM   7929 O  "O4'" . DA  G 2 6   ? 31.275  -29.216 46.141  1.00 54.19  ? 9    DA  G "O4'" 1 
ATOM   7930 C  "C3'" . DA  G 2 6   ? 31.624  -31.318 47.140  1.00 54.98  ? 9    DA  G "C3'" 1 
ATOM   7931 O  "O3'" . DA  G 2 6   ? 32.044  -32.530 46.535  1.00 56.36  ? 9    DA  G "O3'" 1 
ATOM   7932 C  "C2'" . DA  G 2 6   ? 32.800  -30.377 47.410  1.00 54.56  ? 9    DA  G "C2'" 1 
ATOM   7933 C  "C1'" . DA  G 2 6   ? 32.673  -29.388 46.263  1.00 53.89  ? 9    DA  G "C1'" 1 
ATOM   7934 N  N9    . DA  G 2 6   ? 33.395  -28.127 46.477  1.00 53.09  ? 9    DA  G N9    1 
ATOM   7935 C  C8    . DA  G 2 6   ? 32.934  -26.986 47.076  1.00 52.62  ? 9    DA  G C8    1 
ATOM   7936 N  N7    . DA  G 2 6   ? 33.807  -26.007 47.126  1.00 52.06  ? 9    DA  G N7    1 
ATOM   7937 C  C5    . DA  G 2 6   ? 34.927  -26.548 46.523  1.00 52.17  ? 9    DA  G C5    1 
ATOM   7938 C  C6    . DA  G 2 6   ? 36.208  -26.024 46.263  1.00 52.01  ? 9    DA  G C6    1 
ATOM   7939 N  N6    . DA  G 2 6   ? 36.543  -24.782 46.611  1.00 51.83  ? 9    DA  G N6    1 
ATOM   7940 N  N1    . DA  G 2 6   ? 37.120  -26.814 45.641  1.00 51.96  ? 9    DA  G N1    1 
ATOM   7941 C  C2    . DA  G 2 6   ? 36.767  -28.061 45.298  1.00 51.90  ? 9    DA  G C2    1 
ATOM   7942 N  N3    . DA  G 2 6   ? 35.590  -28.663 45.495  1.00 52.35  ? 9    DA  G N3    1 
ATOM   7943 C  C4    . DA  G 2 6   ? 34.701  -27.851 46.115  1.00 52.60  ? 9    DA  G C4    1 
ATOM   7944 P  P     . DC  G 2 7   ? 32.433  -33.769 47.471  1.00 57.67  ? 10   DC  G P     1 
ATOM   7945 O  OP1   . DC  G 2 7   ? 32.063  -35.001 46.740  1.00 57.55  ? 10   DC  G OP1   1 
ATOM   7946 O  OP2   . DC  G 2 7   ? 31.877  -33.524 48.821  1.00 57.68  ? 10   DC  G OP2   1 
ATOM   7947 O  "O5'" . DC  G 2 7   ? 34.027  -33.670 47.585  1.00 57.96  ? 10   DC  G "O5'" 1 
ATOM   7948 C  "C5'" . DC  G 2 7   ? 34.849  -33.927 46.451  1.00 59.02  ? 10   DC  G "C5'" 1 
ATOM   7949 C  "C4'" . DC  G 2 7   ? 36.288  -33.567 46.754  1.00 59.82  ? 10   DC  G "C4'" 1 
ATOM   7950 O  "O4'" . DC  G 2 7   ? 36.389  -32.141 46.996  1.00 59.73  ? 10   DC  G "O4'" 1 
ATOM   7951 C  "C3'" . DC  G 2 7   ? 36.862  -34.246 47.990  1.00 60.66  ? 10   DC  G "C3'" 1 
ATOM   7952 O  "O3'" . DC  G 2 7   ? 38.158  -34.729 47.684  1.00 62.26  ? 10   DC  G "O3'" 1 
ATOM   7953 C  "C2'" . DC  G 2 7   ? 36.907  -33.142 49.045  1.00 60.09  ? 10   DC  G "C2'" 1 
ATOM   7954 C  "C1'" . DC  G 2 7   ? 37.143  -31.918 48.170  1.00 59.58  ? 10   DC  G "C1'" 1 
ATOM   7955 N  N1    . DC  G 2 7   ? 36.688  -30.634 48.770  1.00 58.90  ? 10   DC  G N1    1 
ATOM   7956 C  C2    . DC  G 2 7   ? 37.354  -29.431 48.464  1.00 58.48  ? 10   DC  G C2    1 
ATOM   7957 O  O2    . DC  G 2 7   ? 38.327  -29.430 47.698  1.00 58.27  ? 10   DC  G O2    1 
ATOM   7958 N  N3    . DC  G 2 7   ? 36.905  -28.280 49.027  1.00 58.01  ? 10   DC  G N3    1 
ATOM   7959 C  C4    . DC  G 2 7   ? 35.851  -28.310 49.847  1.00 57.95  ? 10   DC  G C4    1 
ATOM   7960 N  N4    . DC  G 2 7   ? 35.442  -27.159 50.374  1.00 58.05  ? 10   DC  G N4    1 
ATOM   7961 C  C5    . DC  G 2 7   ? 35.160  -29.515 50.169  1.00 58.09  ? 10   DC  G C5    1 
ATOM   7962 C  C6    . DC  G 2 7   ? 35.610  -30.641 49.611  1.00 58.54  ? 10   DC  G C6    1 
ATOM   7963 P  P     . DA  G 2 8   ? 38.890  -35.731 48.688  1.00 63.79  ? 11   DA  G P     1 
ATOM   7964 O  OP1   . DA  G 2 8   ? 40.080  -36.248 47.973  1.00 63.72  ? 11   DA  G OP1   1 
ATOM   7965 O  OP2   . DA  G 2 8   ? 37.869  -36.689 49.170  1.00 64.06  ? 11   DA  G OP2   1 
ATOM   7966 O  "O5'" . DA  G 2 8   ? 39.303  -34.798 49.939  1.00 64.25  ? 11   DA  G "O5'" 1 
ATOM   7967 C  "C5'" . DA  G 2 8   ? 40.664  -34.524 50.316  1.00 65.24  ? 11   DA  G "C5'" 1 
ATOM   7968 C  "C4'" . DA  G 2 8   ? 41.373  -33.684 49.262  1.00 66.06  ? 11   DA  G "C4'" 1 
ATOM   7969 O  "O4'" . DA  G 2 8   ? 40.530  -32.565 48.903  1.00 65.80  ? 11   DA  G "O4'" 1 
ATOM   7970 C  "C3'" . DA  G 2 8   ? 42.744  -33.130 49.646  1.00 66.71  ? 11   DA  G "C3'" 1 
ATOM   7971 O  "O3'" . DA  G 2 8   ? 43.734  -33.594 48.722  1.00 68.00  ? 11   DA  G "O3'" 1 
ATOM   7972 C  "C2'" . DA  G 2 8   ? 42.624  -31.613 49.552  1.00 66.04  ? 11   DA  G "C2'" 1 
ATOM   7973 C  "C1'" . DA  G 2 8   ? 41.171  -31.342 49.186  1.00 65.49  ? 11   DA  G "C1'" 1 
ATOM   7974 N  N9    . DA  G 2 8   ? 40.405  -30.639 50.215  1.00 64.95  ? 11   DA  G N9    1 
ATOM   7975 C  C8    . DA  G 2 8   ? 39.263  -31.057 50.847  1.00 64.44  ? 11   DA  G C8    1 
ATOM   7976 N  N7    . DA  G 2 8   ? 38.793  -30.192 51.714  1.00 64.01  ? 11   DA  G N7    1 
ATOM   7977 C  C5    . DA  G 2 8   ? 39.687  -29.135 51.643  1.00 64.24  ? 11   DA  G C5    1 
ATOM   7978 C  C6    . DA  G 2 8   ? 39.764  -27.890 52.306  1.00 64.23  ? 11   DA  G C6    1 
ATOM   7979 N  N6    . DA  G 2 8   ? 38.883  -27.498 53.227  1.00 64.38  ? 11   DA  G N6    1 
ATOM   7980 N  N1    . DA  G 2 8   ? 40.791  -27.060 52.001  1.00 64.18  ? 11   DA  G N1    1 
ATOM   7981 C  C2    . DA  G 2 8   ? 41.688  -27.448 51.087  1.00 64.07  ? 11   DA  G C2    1 
ATOM   7982 N  N3    . DA  G 2 8   ? 41.720  -28.589 50.399  1.00 64.24  ? 11   DA  G N3    1 
ATOM   7983 C  C4    . DA  G 2 8   ? 40.686  -29.392 50.722  1.00 64.53  ? 11   DA  G C4    1 
ATOM   7984 P  P     . DA  G 2 9   ? 44.929  -34.570 49.176  1.00 68.86  ? 12   DA  G P     1 
ATOM   7985 O  OP1   . DA  G 2 9   ? 45.456  -35.208 47.950  1.00 68.82  ? 12   DA  G OP1   1 
ATOM   7986 O  OP2   . DA  G 2 9   ? 44.442  -35.411 50.295  1.00 68.94  ? 12   DA  G OP2   1 
ATOM   7987 O  "O5'" . DA  G 2 9   ? 46.052  -33.604 49.783  1.00 68.82  ? 12   DA  G "O5'" 1 
ATOM   7988 C  "C5'" . DA  G 2 9   ? 46.551  -32.472 49.074  1.00 68.79  ? 12   DA  G "C5'" 1 
ATOM   7989 C  "C4'" . DA  G 2 9   ? 46.840  -31.340 50.044  1.00 68.79  ? 12   DA  G "C4'" 1 
ATOM   7990 O  "O4'" . DA  G 2 9   ? 45.588  -30.776 50.525  1.00 68.59  ? 12   DA  G "O4'" 1 
ATOM   7991 C  "C3'" . DA  G 2 9   ? 47.643  -31.743 51.283  1.00 69.17  ? 12   DA  G "C3'" 1 
ATOM   7992 O  "O3'" . DA  G 2 9   ? 48.790  -30.895 51.395  1.00 70.02  ? 12   DA  G "O3'" 1 
ATOM   7993 C  "C2'" . DA  G 2 9   ? 46.647  -31.573 52.429  1.00 68.72  ? 12   DA  G "C2'" 1 
ATOM   7994 C  "C1'" . DA  G 2 9   ? 45.725  -30.486 51.899  1.00 68.13  ? 12   DA  G "C1'" 1 
ATOM   7995 N  N9    . DA  G 2 9   ? 44.432  -30.478 52.582  1.00 67.35  ? 12   DA  G N9    1 
ATOM   7996 C  C8    . DA  G 2 9   ? 43.562  -31.527 52.735  1.00 66.95  ? 12   DA  G C8    1 
ATOM   7997 N  N7    . DA  G 2 9   ? 42.478  -31.231 53.409  1.00 66.56  ? 12   DA  G N7    1 
ATOM   7998 C  C5    . DA  G 2 9   ? 42.654  -29.895 53.734  1.00 66.44  ? 12   DA  G C5    1 
ATOM   7999 C  C6    . DA  G 2 9   ? 41.858  -28.978 54.451  1.00 65.99  ? 12   DA  G C6    1 
ATOM   8000 N  N6    . DA  G 2 9   ? 40.683  -29.311 54.985  1.00 65.74  ? 12   DA  G N6    1 
ATOM   8001 N  N1    . DA  G 2 9   ? 42.313  -27.710 54.600  1.00 65.79  ? 12   DA  G N1    1 
ATOM   8002 C  C2    . DA  G 2 9   ? 43.496  -27.381 54.058  1.00 65.93  ? 12   DA  G C2    1 
ATOM   8003 N  N3    . DA  G 2 9   ? 44.338  -28.157 53.368  1.00 66.23  ? 12   DA  G N3    1 
ATOM   8004 C  C4    . DA  G 2 9   ? 43.854  -29.411 53.235  1.00 66.75  ? 12   DA  G C4    1 
ATOM   8005 P  P     . DG  G 2 10  ? 49.712  -30.743 52.706  1.00 70.64  ? 13   DG  G P     1 
ATOM   8006 O  OP1   . DG  G 2 10  ? 50.998  -31.411 52.409  1.00 70.34  ? 13   DG  G OP1   1 
ATOM   8007 O  OP2   . DG  G 2 10  ? 48.969  -31.119 53.935  1.00 70.46  ? 13   DG  G OP2   1 
ATOM   8008 O  "O5'" . DG  G 2 10  ? 49.936  -29.154 52.735  1.00 71.02  ? 13   DG  G "O5'" 1 
ATOM   8009 C  "C5'" . DG  G 2 10  ? 48.824  -28.249 52.618  1.00 71.62  ? 13   DG  G "C5'" 1 
ATOM   8010 C  "C4'" . DG  G 2 10  ? 48.781  -27.198 53.722  1.00 72.27  ? 13   DG  G "C4'" 1 
ATOM   8011 O  "O4'" . DG  G 2 10  ? 47.455  -27.144 54.312  1.00 71.97  ? 13   DG  G "O4'" 1 
ATOM   8012 C  "C3'" . DG  G 2 10  ? 49.757  -27.365 54.890  1.00 72.84  ? 13   DG  G "C3'" 1 
ATOM   8013 O  "O3'" . DG  G 2 10  ? 50.306  -26.075 55.205  1.00 73.89  ? 13   DG  G "O3'" 1 
ATOM   8014 C  "C2'" . DG  G 2 10  ? 48.908  -27.996 55.991  1.00 72.20  ? 13   DG  G "C2'" 1 
ATOM   8015 C  "C1'" . DG  G 2 10  ? 47.515  -27.464 55.689  1.00 71.64  ? 13   DG  G "C1'" 1 
ATOM   8016 N  N9    . DG  G 2 10  ? 46.477  -28.452 55.930  1.00 71.00  ? 13   DG  G N9    1 
ATOM   8017 C  C8    . DG  G 2 10  ? 46.489  -29.777 55.569  1.00 70.77  ? 13   DG  G C8    1 
ATOM   8018 N  N7    . DG  G 2 10  ? 45.409  -30.412 55.919  1.00 70.76  ? 13   DG  G N7    1 
ATOM   8019 C  C5    . DG  G 2 10  ? 44.633  -29.446 56.547  1.00 70.75  ? 13   DG  G C5    1 
ATOM   8020 C  C6    . DG  G 2 10  ? 43.346  -29.536 57.139  1.00 70.78  ? 13   DG  G C6    1 
ATOM   8021 O  O6    . DG  G 2 10  ? 42.608  -30.522 57.223  1.00 70.92  ? 13   DG  G O6    1 
ATOM   8022 N  N1    . DG  G 2 10  ? 42.915  -28.320 57.664  1.00 70.83  ? 13   DG  G N1    1 
ATOM   8023 C  C2    . DG  G 2 10  ? 43.646  -27.156 57.623  1.00 70.89  ? 13   DG  G C2    1 
ATOM   8024 N  N2    . DG  G 2 10  ? 43.075  -26.083 58.184  1.00 71.19  ? 13   DG  G N2    1 
ATOM   8025 N  N3    . DG  G 2 10  ? 44.854  -27.054 57.078  1.00 70.70  ? 13   DG  G N3    1 
ATOM   8026 C  C4    . DG  G 2 10  ? 45.282  -28.233 56.562  1.00 70.74  ? 13   DG  G C4    1 
ATOM   8027 P  P     . DT  G 2 11  ? 50.572  -25.476 56.668  1.00 74.55  ? 14   DT  G P     1 
ATOM   8028 O  OP1   . DT  G 2 11  ? 51.714  -24.549 56.511  1.00 74.53  ? 14   DT  G OP1   1 
ATOM   8029 O  OP2   . DT  G 2 11  ? 50.664  -26.565 57.671  1.00 74.55  ? 14   DT  G OP2   1 
ATOM   8030 O  "O5'" . DT  G 2 11  ? 49.231  -24.637 56.935  1.00 75.25  ? 14   DT  G "O5'" 1 
ATOM   8031 C  "C5'" . DT  G 2 11  ? 49.267  -23.419 57.680  1.00 76.64  ? 14   DT  G "C5'" 1 
ATOM   8032 C  "C4'" . DT  G 2 11  ? 48.279  -23.420 58.839  1.00 77.98  ? 14   DT  G "C4'" 1 
ATOM   8033 O  "O4'" . DT  G 2 11  ? 47.391  -24.574 58.765  1.00 77.70  ? 14   DT  G "O4'" 1 
ATOM   8034 C  "C3'" . DT  G 2 11  ? 48.880  -23.434 60.252  1.00 79.14  ? 14   DT  G "C3'" 1 
ATOM   8035 O  "O3'" . DT  G 2 11  ? 48.171  -22.478 61.063  1.00 81.78  ? 14   DT  G "O3'" 1 
ATOM   8036 C  "C2'" . DT  G 2 11  ? 48.624  -24.874 60.695  1.00 78.20  ? 14   DT  G "C2'" 1 
ATOM   8037 C  "C1'" . DT  G 2 11  ? 47.242  -25.081 60.079  1.00 77.14  ? 14   DT  G "C1'" 1 
ATOM   8038 N  N1    . DT  G 2 11  ? 46.738  -26.498 60.055  1.00 75.66  ? 14   DT  G N1    1 
ATOM   8039 C  C2    . DT  G 2 11  ? 45.424  -26.774 60.409  1.00 74.66  ? 14   DT  G C2    1 
ATOM   8040 O  O2    . DT  G 2 11  ? 44.602  -25.938 60.747  1.00 73.80  ? 14   DT  G O2    1 
ATOM   8041 N  N3    . DT  G 2 11  ? 45.089  -28.103 60.348  1.00 74.39  ? 14   DT  G N3    1 
ATOM   8042 C  C4    . DT  G 2 11  ? 45.913  -29.155 59.978  1.00 74.62  ? 14   DT  G C4    1 
ATOM   8043 O  O4    . DT  G 2 11  ? 45.505  -30.311 59.958  1.00 74.73  ? 14   DT  G O4    1 
ATOM   8044 C  C5    . DT  G 2 11  ? 47.271  -28.801 59.624  1.00 74.73  ? 14   DT  G C5    1 
ATOM   8045 C  C7    . DT  G 2 11  ? 48.269  -29.844 59.207  1.00 74.47  ? 14   DT  G C7    1 
ATOM   8046 C  C6    . DT  G 2 11  ? 47.610  -27.507 59.680  1.00 75.19  ? 14   DT  G C6    1 
ATOM   8047 P  P     . DA  G 2 12  ? 48.444  -22.183 62.620  1.00 83.82  ? 15   DA  G P     1 
ATOM   8048 O  OP1   . DA  G 2 12  ? 49.367  -21.028 62.671  1.00 83.86  ? 15   DA  G OP1   1 
ATOM   8049 O  OP2   . DA  G 2 12  ? 48.805  -23.445 63.304  1.00 83.98  ? 15   DA  G OP2   1 
ATOM   8050 O  "O5'" . DA  G 2 12  ? 47.011  -21.684 63.153  1.00 85.73  ? 15   DA  G "O5'" 1 
ATOM   8051 C  "C5'" . DA  G 2 12  ? 46.502  -22.044 64.444  1.00 88.95  ? 15   DA  G "C5'" 1 
ATOM   8052 C  "C4'" . DA  G 2 12  ? 45.043  -22.466 64.360  1.00 91.65  ? 15   DA  G "C4'" 1 
ATOM   8053 O  "O4'" . DA  G 2 12  ? 44.886  -23.462 63.317  1.00 92.08  ? 15   DA  G "O4'" 1 
ATOM   8054 C  "C3'" . DA  G 2 12  ? 44.490  -23.107 65.624  1.00 93.67  ? 15   DA  G "C3'" 1 
ATOM   8055 O  "O3'" . DA  G 2 12  ? 43.755  -22.151 66.363  1.00 97.40  ? 15   DA  G "O3'" 1 
ATOM   8056 C  "C2'" . DA  G 2 12  ? 43.559  -24.189 65.093  1.00 93.04  ? 15   DA  G "C2'" 1 
ATOM   8057 C  "C1'" . DA  G 2 12  ? 44.243  -24.625 63.808  1.00 92.46  ? 15   DA  G "C1'" 1 
ATOM   8058 N  N9    . DA  G 2 12  ? 45.225  -25.717 63.916  1.00 92.29  ? 15   DA  G N9    1 
ATOM   8059 C  C8    . DA  G 2 12  ? 46.578  -25.589 64.095  1.00 92.09  ? 15   DA  G C8    1 
ATOM   8060 N  N7    . DA  G 2 12  ? 47.236  -26.723 64.140  1.00 92.01  ? 15   DA  G N7    1 
ATOM   8061 C  C5    . DA  G 2 12  ? 46.251  -27.681 63.974  1.00 92.09  ? 15   DA  G C5    1 
ATOM   8062 C  C6    . DA  G 2 12  ? 46.299  -29.096 63.929  1.00 91.96  ? 15   DA  G C6    1 
ATOM   8063 N  N6    . DA  G 2 12  ? 47.434  -29.794 64.054  1.00 91.79  ? 15   DA  G N6    1 
ATOM   8064 N  N1    . DA  G 2 12  ? 45.137  -29.769 63.749  1.00 91.89  ? 15   DA  G N1    1 
ATOM   8065 C  C2    . DA  G 2 12  ? 44.005  -29.062 63.621  1.00 91.97  ? 15   DA  G C2    1 
ATOM   8066 N  N3    . DA  G 2 12  ? 43.839  -27.734 63.651  1.00 92.22  ? 15   DA  G N3    1 
ATOM   8067 C  C4    . DA  G 2 12  ? 45.006  -27.083 63.830  1.00 92.25  ? 15   DA  G C4    1 
HETATM 8068 N  N1    . 5IU G 2 13  ? 41.304  -25.674 67.493  1.00 125.86 ? 16   5IU G N1    1 
HETATM 8069 C  C2    . 5IU G 2 13  ? 40.683  -26.839 66.941  1.00 127.89 ? 16   5IU G C2    1 
HETATM 8070 N  N3    . 5IU G 2 13  ? 41.406  -27.928 66.615  1.00 129.50 ? 16   5IU G N3    1 
HETATM 8071 C  C4    . 5IU G 2 13  ? 42.731  -27.949 66.806  1.00 131.16 ? 16   5IU G C4    1 
HETATM 8072 C  C5    . 5IU G 2 13  ? 43.390  -26.750 67.385  1.00 131.82 ? 16   5IU G C5    1 
HETATM 8073 C  C6    . 5IU G 2 13  ? 42.621  -25.655 67.708  1.00 129.25 ? 16   5IU G C6    1 
HETATM 8074 O  O2    . 5IU G 2 13  ? 39.446  -26.876 66.740  1.00 128.33 ? 16   5IU G O2    1 
HETATM 8075 O  O4    . 5IU G 2 13  ? 43.401  -28.954 66.506  1.00 130.89 ? 16   5IU G O4    1 
HETATM 8076 I  I5    . 5IU G 2 13  ? 45.438  -26.627 67.739  1.00 139.03 ? 16   5IU G I5    1 
HETATM 8077 C  "C1'" . 5IU G 2 13  ? 40.539  -24.472 67.861  1.00 121.24 ? 16   5IU G "C1'" 1 
HETATM 8078 C  "C2'" . 5IU G 2 13  ? 40.064  -24.654 69.288  1.00 118.35 ? 16   5IU G "C2'" 1 
HETATM 8079 C  "C3'" . 5IU G 2 13  ? 40.930  -23.732 70.125  1.00 115.78 ? 16   5IU G "C3'" 1 
HETATM 8080 C  "C4'" . 5IU G 2 13  ? 41.493  -22.715 69.145  1.00 114.50 ? 16   5IU G "C4'" 1 
HETATM 8081 O  "O3'" . 5IU G 2 13  ? 40.124  -23.131 71.143  1.00 114.71 ? 16   5IU G "O3'" 1 
HETATM 8082 O  "O4'" . 5IU G 2 13  ? 41.351  -23.286 67.840  1.00 117.70 ? 16   5IU G "O4'" 1 
HETATM 8083 C  "C5'" . 5IU G 2 13  ? 42.966  -22.411 69.397  1.00 110.10 ? 16   5IU G "C5'" 1 
HETATM 8084 O  "O5'" . 5IU G 2 13  ? 43.330  -21.242 68.660  1.00 104.34 ? 16   5IU G "O5'" 1 
HETATM 8085 P  P     . 5IU G 2 13  ? 44.445  -21.258 67.495  1.00 100.52 ? 16   5IU G P     1 
HETATM 8086 O  OP1   . 5IU G 2 13  ? 44.576  -19.859 66.950  1.00 100.19 ? 16   5IU G OP1   1 
HETATM 8087 O  OP2   . 5IU G 2 13  ? 45.677  -21.956 68.016  1.00 100.55 ? 16   5IU G OP2   1 
ATOM   8088 P  P     . DG  G 2 14  ? 39.299  -24.051 72.170  1.00 113.83 ? 17   DG  G P     1 
ATOM   8089 O  OP1   . DG  G 2 14  ? 38.050  -24.483 71.499  1.00 113.51 ? 17   DG  G OP1   1 
ATOM   8090 O  OP2   . DG  G 2 14  ? 39.225  -23.308 73.445  1.00 114.01 ? 17   DG  G OP2   1 
ATOM   8091 O  "O5'" . DG  G 2 14  ? 40.250  -25.318 72.422  1.00 113.40 ? 17   DG  G "O5'" 1 
ATOM   8092 C  "C5'" . DG  G 2 14  ? 39.761  -26.486 73.072  1.00 112.53 ? 17   DG  G "C5'" 1 
ATOM   8093 C  "C4'" . DG  G 2 14  ? 39.081  -27.415 72.079  1.00 111.99 ? 17   DG  G "C4'" 1 
ATOM   8094 O  "O4'" . DG  G 2 14  ? 39.783  -27.380 70.811  1.00 111.66 ? 17   DG  G "O4'" 1 
ATOM   8095 C  "C3'" . DG  G 2 14  ? 39.033  -28.876 72.508  1.00 111.79 ? 17   DG  G "C3'" 1 
ATOM   8096 O  "O3'" . DG  G 2 14  ? 37.712  -29.190 72.921  1.00 111.35 ? 17   DG  G "O3'" 1 
ATOM   8097 C  "C2'" . DG  G 2 14  ? 39.393  -29.651 71.245  1.00 111.67 ? 17   DG  G "C2'" 1 
ATOM   8098 C  "C1'" . DG  G 2 14  ? 40.274  -28.665 70.486  1.00 111.50 ? 17   DG  G "C1'" 1 
ATOM   8099 N  N9    . DG  G 2 14  ? 41.715  -28.734 70.775  1.00 111.16 ? 17   DG  G N9    1 
ATOM   8100 C  C8    . DG  G 2 14  ? 42.533  -27.698 71.175  1.00 110.99 ? 17   DG  G C8    1 
ATOM   8101 N  N7    . DG  G 2 14  ? 43.778  -28.040 71.350  1.00 110.66 ? 17   DG  G N7    1 
ATOM   8102 C  C5    . DG  G 2 14  ? 43.796  -29.392 71.038  1.00 110.74 ? 17   DG  G C5    1 
ATOM   8103 C  C6    . DG  G 2 14  ? 44.874  -30.312 71.040  1.00 110.72 ? 17   DG  G C6    1 
ATOM   8104 O  O6    . DG  G 2 14  ? 46.058  -30.097 71.332  1.00 110.66 ? 17   DG  G O6    1 
ATOM   8105 N  N1    . DG  G 2 14  ? 44.476  -31.599 70.665  1.00 110.74 ? 17   DG  G N1    1 
ATOM   8106 C  C2    . DG  G 2 14  ? 43.187  -31.952 70.330  1.00 110.68 ? 17   DG  G C2    1 
ATOM   8107 N  N2    . DG  G 2 14  ? 42.984  -33.236 69.995  1.00 110.54 ? 17   DG  G N2    1 
ATOM   8108 N  N3    . DG  G 2 14  ? 42.168  -31.096 70.319  1.00 110.70 ? 17   DG  G N3    1 
ATOM   8109 C  C4    . DG  G 2 14  ? 42.538  -29.838 70.681  1.00 110.85 ? 17   DG  G C4    1 
ATOM   8110 P  P     . DA  G 2 15  ? 37.335  -29.462 74.459  1.00 110.79 ? 18   DA  G P     1 
ATOM   8111 O  OP1   . DA  G 2 15  ? 36.534  -28.309 74.928  1.00 110.63 ? 18   DA  G OP1   1 
ATOM   8112 O  OP2   . DA  G 2 15  ? 38.549  -29.825 75.224  1.00 110.68 ? 18   DA  G OP2   1 
ATOM   8113 O  "O5'" . DA  G 2 15  ? 36.389  -30.757 74.352  1.00 109.49 ? 18   DA  G "O5'" 1 
ATOM   8114 C  "C5'" . DA  G 2 15  ? 36.360  -31.589 73.177  1.00 106.89 ? 18   DA  G "C5'" 1 
ATOM   8115 C  "C4'" . DA  G 2 15  ? 37.340  -32.746 73.293  1.00 104.85 ? 18   DA  G "C4'" 1 
ATOM   8116 O  "O4'" . DA  G 2 15  ? 38.698  -32.292 73.044  1.00 104.37 ? 18   DA  G "O4'" 1 
ATOM   8117 C  "C3'" . DA  G 2 15  ? 37.392  -33.432 74.657  1.00 103.49 ? 18   DA  G "C3'" 1 
ATOM   8118 O  "O3'" . DA  G 2 15  ? 37.528  -34.827 74.472  1.00 101.88 ? 18   DA  G "O3'" 1 
ATOM   8119 C  "C2'" . DA  G 2 15  ? 38.666  -32.870 75.273  1.00 103.48 ? 18   DA  G "C2'" 1 
ATOM   8120 C  "C1'" . DA  G 2 15  ? 39.521  -32.894 74.018  1.00 103.79 ? 18   DA  G "C1'" 1 
ATOM   8121 N  N9    . DA  G 2 15  ? 40.796  -32.201 74.152  1.00 103.77 ? 18   DA  G N9    1 
ATOM   8122 C  C8    . DA  G 2 15  ? 41.032  -30.950 74.652  1.00 103.66 ? 18   DA  G C8    1 
ATOM   8123 N  N7    . DA  G 2 15  ? 42.296  -30.603 74.654  1.00 103.64 ? 18   DA  G N7    1 
ATOM   8124 C  C5    . DA  G 2 15  ? 42.937  -31.711 74.123  1.00 103.73 ? 18   DA  G C5    1 
ATOM   8125 C  C6    . DA  G 2 15  ? 44.296  -31.991 73.857  1.00 103.65 ? 18   DA  G C6    1 
ATOM   8126 N  N6    . DA  G 2 15  ? 45.289  -31.127 74.105  1.00 103.27 ? 18   DA  G N6    1 
ATOM   8127 N  N1    . DA  G 2 15  ? 44.595  -33.198 73.318  1.00 103.79 ? 18   DA  G N1    1 
ATOM   8128 C  C2    . DA  G 2 15  ? 43.602  -34.069 73.066  1.00 103.82 ? 18   DA  G C2    1 
ATOM   8129 N  N3    . DA  G 2 15  ? 42.291  -33.918 73.276  1.00 103.75 ? 18   DA  G N3    1 
ATOM   8130 C  C4    . DA  G 2 15  ? 42.025  -32.708 73.809  1.00 103.80 ? 18   DA  G C4    1 
ATOM   8131 P  P     . DA  G 2 16  ? 37.427  -35.797 75.736  1.00 100.57 ? 19   DA  G P     1 
ATOM   8132 O  OP1   . DA  G 2 16  ? 36.036  -35.682 76.228  1.00 100.92 ? 19   DA  G OP1   1 
ATOM   8133 O  OP2   . DA  G 2 16  ? 38.554  -35.502 76.650  1.00 100.76 ? 19   DA  G OP2   1 
ATOM   8134 O  "O5'" . DA  G 2 16  ? 37.654  -37.259 75.120  1.00 98.64  ? 19   DA  G "O5'" 1 
ATOM   8135 C  "C5'" . DA  G 2 16  ? 38.169  -38.316 75.922  1.00 95.81  ? 19   DA  G "C5'" 1 
ATOM   8136 C  "C4'" . DA  G 2 16  ? 39.608  -38.594 75.533  1.00 93.96  ? 19   DA  G "C4'" 1 
ATOM   8137 O  "O4'" . DA  G 2 16  ? 40.298  -37.341 75.289  1.00 93.82  ? 19   DA  G "O4'" 1 
ATOM   8138 C  "C3'" . DA  G 2 16  ? 40.418  -39.351 76.580  1.00 92.57  ? 19   DA  G "C3'" 1 
ATOM   8139 O  "O3'" . DA  G 2 16  ? 40.753  -40.643 76.060  1.00 90.48  ? 19   DA  G "O3'" 1 
ATOM   8140 C  "C2'" . DA  G 2 16  ? 41.647  -38.475 76.817  1.00 92.99  ? 19   DA  G "C2'" 1 
ATOM   8141 C  "C1'" . DA  G 2 16  ? 41.650  -37.498 75.651  1.00 93.69  ? 19   DA  G "C1'" 1 
ATOM   8142 N  N9    . DA  G 2 16  ? 42.234  -36.221 76.058  1.00 94.12  ? 19   DA  G N9    1 
ATOM   8143 C  C8    . DA  G 2 16  ? 41.598  -35.154 76.635  1.00 94.22  ? 19   DA  G C8    1 
ATOM   8144 N  N7    . DA  G 2 16  ? 42.387  -34.142 76.912  1.00 94.29  ? 19   DA  G N7    1 
ATOM   8145 C  C5    . DA  G 2 16  ? 43.636  -34.575 76.497  1.00 94.55  ? 19   DA  G C5    1 
ATOM   8146 C  C6    . DA  G 2 16  ? 44.915  -33.968 76.513  1.00 94.67  ? 19   DA  G C6    1 
ATOM   8147 N  N6    . DA  G 2 16  ? 45.135  -32.738 76.987  1.00 94.77  ? 19   DA  G N6    1 
ATOM   8148 N  N1    . DA  G 2 16  ? 45.963  -34.670 76.020  1.00 94.68  ? 19   DA  G N1    1 
ATOM   8149 C  C2    . DA  G 2 16  ? 45.735  -35.901 75.537  1.00 94.71  ? 19   DA  G C2    1 
ATOM   8150 N  N3    . DA  G 2 16  ? 44.585  -36.580 75.474  1.00 94.63  ? 19   DA  G N3    1 
ATOM   8151 C  C4    . DA  G 2 16  ? 43.561  -35.857 75.972  1.00 94.46  ? 19   DA  G C4    1 
ATOM   8152 P  P     . DA  G 2 17  ? 41.867  -41.616 76.687  1.00 88.92  ? 20   DA  G P     1 
ATOM   8153 O  OP1   . DA  G 2 17  ? 41.450  -43.004 76.390  1.00 88.83  ? 20   DA  G OP1   1 
ATOM   8154 O  OP2   . DA  G 2 17  ? 42.135  -41.226 78.089  1.00 89.04  ? 20   DA  G OP2   1 
ATOM   8155 O  "O5'" . DA  G 2 17  ? 43.175  -41.277 75.827  1.00 87.62  ? 20   DA  G "O5'" 1 
ATOM   8156 C  "C5'" . DA  G 2 17  ? 44.338  -42.097 75.943  1.00 85.49  ? 20   DA  G "C5'" 1 
ATOM   8157 C  "C4'" . DA  G 2 17  ? 45.627  -41.308 75.768  1.00 83.95  ? 20   DA  G "C4'" 1 
ATOM   8158 O  "O4'" . DA  G 2 17  ? 45.417  -39.896 75.988  1.00 83.72  ? 20   DA  G "O4'" 1 
ATOM   8159 C  "C3'" . DA  G 2 17  ? 46.686  -41.648 76.793  1.00 83.03  ? 20   DA  G "C3'" 1 
ATOM   8160 O  "O3'" . DA  G 2 17  ? 47.379  -42.782 76.348  1.00 82.10  ? 20   DA  G "O3'" 1 
ATOM   8161 C  "C2'" . DA  G 2 17  ? 47.590  -40.423 76.796  1.00 82.96  ? 20   DA  G "C2'" 1 
ATOM   8162 C  "C1'" . DA  G 2 17  ? 46.614  -39.306 76.467  1.00 83.18  ? 20   DA  G "C1'" 1 
ATOM   8163 N  N9    . DA  G 2 17  ? 46.270  -38.394 77.561  1.00 83.01  ? 20   DA  G N9    1 
ATOM   8164 C  C8    . DA  G 2 17  ? 45.146  -38.423 78.343  1.00 82.78  ? 20   DA  G C8    1 
ATOM   8165 N  N7    . DA  G 2 17  ? 45.087  -37.460 79.232  1.00 82.60  ? 20   DA  G N7    1 
ATOM   8166 C  C5    . DA  G 2 17  ? 46.249  -36.740 79.018  1.00 82.70  ? 20   DA  G C5    1 
ATOM   8167 C  C6    . DA  G 2 17  ? 46.785  -35.585 79.632  1.00 82.64  ? 20   DA  G C6    1 
ATOM   8168 N  N6    . DA  G 2 17  ? 46.189  -34.939 80.638  1.00 82.34  ? 20   DA  G N6    1 
ATOM   8169 N  N1    . DA  G 2 17  ? 47.974  -35.121 79.186  1.00 82.74  ? 20   DA  G N1    1 
ATOM   8170 C  C2    . DA  G 2 17  ? 48.574  -35.772 78.180  1.00 82.91  ? 20   DA  G C2    1 
ATOM   8171 N  N3    . DA  G 2 17  ? 48.170  -36.858 77.516  1.00 82.91  ? 20   DA  G N3    1 
ATOM   8172 C  C4    . DA  G 2 17  ? 46.990  -37.302 77.990  1.00 82.88  ? 20   DA  G C4    1 
ATOM   8173 P  P     . DT  G 2 18  ? 47.588  -43.993 77.364  1.00 81.41  ? 21   DT  G P     1 
ATOM   8174 O  OP1   . DT  G 2 18  ? 47.630  -45.248 76.579  1.00 81.60  ? 21   DT  G OP1   1 
ATOM   8175 O  OP2   . DT  G 2 18  ? 46.577  -43.850 78.438  1.00 81.54  ? 21   DT  G OP2   1 
ATOM   8176 O  "O5'" . DT  G 2 18  ? 49.050  -43.692 77.953  1.00 80.15  ? 21   DT  G "O5'" 1 
ATOM   8177 C  "C5'" . DT  G 2 18  ? 49.186  -43.048 79.209  1.00 78.58  ? 21   DT  G "C5'" 1 
ATOM   8178 C  "C4'" . DT  G 2 18  ? 49.958  -41.749 79.084  1.00 77.26  ? 21   DT  G "C4'" 1 
ATOM   8179 O  "O4'" . DT  G 2 18  ? 49.068  -40.606 79.236  1.00 77.28  ? 21   DT  G "O4'" 1 
ATOM   8180 C  "C3'" . DT  G 2 18  ? 51.029  -41.617 80.158  1.00 76.21  ? 21   DT  G "C3'" 1 
ATOM   8181 O  "O3'" . DT  G 2 18  ? 52.316  -41.387 79.588  1.00 73.78  ? 21   DT  G "O3'" 1 
ATOM   8182 C  "C2'" . DT  G 2 18  ? 50.564  -40.422 80.978  1.00 76.90  ? 21   DT  G "C2'" 1 
ATOM   8183 C  "C1'" . DT  G 2 18  ? 49.735  -39.617 79.990  1.00 77.38  ? 21   DT  G "C1'" 1 
ATOM   8184 N  N1    . DT  G 2 18  ? 48.831  -38.728 80.790  1.00 77.80  ? 21   DT  G N1    1 
ATOM   8185 C  C2    . DT  G 2 18  ? 49.264  -37.447 81.112  1.00 77.87  ? 21   DT  G C2    1 
ATOM   8186 O  O2    . DT  G 2 18  ? 50.326  -36.965 80.747  1.00 77.62  ? 21   DT  G O2    1 
ATOM   8187 N  N3    . DT  G 2 18  ? 48.381  -36.725 81.879  1.00 78.04  ? 21   DT  G N3    1 
ATOM   8188 C  C4    . DT  G 2 18  ? 47.146  -37.145 82.356  1.00 78.13  ? 21   DT  G C4    1 
ATOM   8189 O  O4    . DT  G 2 18  ? 46.437  -36.403 83.029  1.00 78.31  ? 21   DT  G O4    1 
ATOM   8190 C  C5    . DT  G 2 18  ? 46.758  -38.493 81.997  1.00 78.00  ? 21   DT  G C5    1 
ATOM   8191 C  C7    . DT  G 2 18  ? 45.445  -39.066 82.451  1.00 77.77  ? 21   DT  G C7    1 
ATOM   8192 C  C6    . DT  G 2 18  ? 47.613  -39.211 81.250  1.00 77.94  ? 21   DT  G C6    1 
ATOM   8193 P  P     . DG  G 2 19  ? 53.634  -41.292 80.502  1.00 71.32  ? 22   DG  G P     1 
ATOM   8194 O  OP1   . DG  G 2 19  ? 54.526  -42.396 80.089  1.00 71.29  ? 22   DG  G OP1   1 
ATOM   8195 O  OP2   . DG  G 2 19  ? 53.264  -41.175 81.932  1.00 71.18  ? 22   DG  G OP2   1 
ATOM   8196 O  "O5'" . DG  G 2 19  ? 54.265  -39.896 80.023  1.00 69.33  ? 22   DG  G "O5'" 1 
ATOM   8197 C  "C5'" . DG  G 2 19  ? 53.620  -38.638 80.283  1.00 65.88  ? 22   DG  G "C5'" 1 
ATOM   8198 C  "C4'" . DG  G 2 19  ? 54.445  -37.755 81.217  1.00 63.13  ? 22   DG  G "C4'" 1 
ATOM   8199 O  "O4'" . DG  G 2 19  ? 53.592  -36.932 82.061  1.00 62.55  ? 22   DG  G "O4'" 1 
ATOM   8200 C  "C3'" . DG  G 2 19  ? 55.388  -38.435 82.200  1.00 61.10  ? 22   DG  G "C3'" 1 
ATOM   8201 O  "O3'" . DG  G 2 19  ? 56.485  -37.543 82.356  1.00 58.84  ? 22   DG  G "O3'" 1 
ATOM   8202 C  "C2'" . DG  G 2 19  ? 54.526  -38.591 83.456  1.00 60.89  ? 22   DG  G "C2'" 1 
ATOM   8203 C  "C1'" . DG  G 2 19  ? 53.686  -37.317 83.424  1.00 60.86  ? 22   DG  G "C1'" 1 
ATOM   8204 N  N9    . DG  G 2 19  ? 52.310  -37.434 83.910  1.00 59.62  ? 22   DG  G N9    1 
ATOM   8205 C  C8    . DG  G 2 19  ? 51.449  -38.500 83.761  1.00 58.89  ? 22   DG  G C8    1 
ATOM   8206 N  N7    . DG  G 2 19  ? 50.276  -38.302 84.288  1.00 58.45  ? 22   DG  G N7    1 
ATOM   8207 C  C5    . DG  G 2 19  ? 50.361  -37.017 84.811  1.00 58.60  ? 22   DG  G C5    1 
ATOM   8208 C  C6    . DG  G 2 19  ? 49.394  -36.250 85.505  1.00 58.48  ? 22   DG  G C6    1 
ATOM   8209 O  O6    . DG  G 2 19  ? 48.237  -36.584 85.791  1.00 58.68  ? 22   DG  G O6    1 
ATOM   8210 N  N1    . DG  G 2 19  ? 49.875  -34.986 85.873  1.00 58.09  ? 22   DG  G N1    1 
ATOM   8211 C  C2    . DG  G 2 19  ? 51.142  -34.520 85.602  1.00 57.90  ? 22   DG  G C2    1 
ATOM   8212 N  N2    . DG  G 2 19  ? 51.433  -33.281 86.028  1.00 57.28  ? 22   DG  G N2    1 
ATOM   8213 N  N3    . DG  G 2 19  ? 52.060  -35.231 84.952  1.00 58.31  ? 22   DG  G N3    1 
ATOM   8214 C  C4    . DG  G 2 19  ? 51.603  -36.464 84.586  1.00 58.87  ? 22   DG  G C4    1 
ATOM   8215 P  P     . DT  G 2 20  ? 57.533  -37.659 83.553  1.00 57.37  ? 23   DT  G P     1 
ATOM   8216 O  OP1   . DT  G 2 20  ? 58.813  -37.094 83.077  1.00 57.47  ? 23   DT  G OP1   1 
ATOM   8217 O  OP2   . DT  G 2 20  ? 57.503  -39.052 84.053  1.00 57.58  ? 23   DT  G OP2   1 
ATOM   8218 O  "O5'" . DT  G 2 20  ? 56.909  -36.689 84.673  1.00 55.79  ? 23   DT  G "O5'" 1 
ATOM   8219 C  "C5'" . DT  G 2 20  ? 57.208  -35.281 84.721  1.00 52.22  ? 23   DT  G "C5'" 1 
ATOM   8220 C  "C4'" . DT  G 2 20  ? 56.692  -34.623 85.998  1.00 49.29  ? 23   DT  G "C4'" 1 
ATOM   8221 O  "O4'" . DT  G 2 20  ? 55.276  -34.904 86.191  1.00 48.50  ? 23   DT  G "O4'" 1 
ATOM   8222 C  "C3'" . DT  G 2 20  ? 57.369  -35.033 87.308  1.00 47.35  ? 23   DT  G "C3'" 1 
ATOM   8223 O  "O3'" . DT  G 2 20  ? 57.448  -33.899 88.177  1.00 45.23  ? 23   DT  G "O3'" 1 
ATOM   8224 C  "C2'" . DT  G 2 20  ? 56.378  -36.045 87.870  1.00 47.03  ? 23   DT  G "C2'" 1 
ATOM   8225 C  "C1'" . DT  G 2 20  ? 55.115  -35.258 87.549  1.00 47.01  ? 23   DT  G "C1'" 1 
ATOM   8226 N  N1    . DT  G 2 20  ? 53.818  -35.955 87.763  1.00 46.11  ? 23   DT  G N1    1 
ATOM   8227 C  C2    . DT  G 2 20  ? 52.800  -35.245 88.370  1.00 45.60  ? 23   DT  G C2    1 
ATOM   8228 O  O2    . DT  G 2 20  ? 52.902  -34.086 88.735  1.00 44.82  ? 23   DT  G O2    1 
ATOM   8229 N  N3    . DT  G 2 20  ? 51.636  -35.954 88.536  1.00 45.78  ? 23   DT  G N3    1 
ATOM   8230 C  C4    . DT  G 2 20  ? 51.393  -37.269 88.162  1.00 46.01  ? 23   DT  G C4    1 
ATOM   8231 O  O4    . DT  G 2 20  ? 50.301  -37.799 88.363  1.00 45.84  ? 23   DT  G O4    1 
ATOM   8232 C  C5    . DT  G 2 20  ? 52.504  -37.958 87.530  1.00 46.02  ? 23   DT  G C5    1 
ATOM   8233 C  C7    . DT  G 2 20  ? 52.372  -39.388 87.077  1.00 45.64  ? 23   DT  G C7    1 
ATOM   8234 C  C6    . DT  G 2 20  ? 53.650  -37.273 87.363  1.00 45.99  ? 23   DT  G C6    1 
ATOM   8235 P  P     . DC  G 2 21  ? 58.794  -33.406 88.904  1.00 43.81  ? 24   DC  G P     1 
ATOM   8236 O  OP1   . DC  G 2 21  ? 58.760  -31.928 88.803  1.00 43.28  ? 24   DC  G OP1   1 
ATOM   8237 O  OP2   . DC  G 2 21  ? 59.946  -34.148 88.353  1.00 44.09  ? 24   DC  G OP2   1 
ATOM   8238 O  "O5'" . DC  G 2 21  ? 58.693  -33.850 90.451  1.00 41.65  ? 24   DC  G "O5'" 1 
ATOM   8239 C  "C5'" . DC  G 2 21  ? 57.560  -34.526 91.020  1.00 38.38  ? 24   DC  G "C5'" 1 
ATOM   8240 C  "C4'" . DC  G 2 21  ? 56.432  -33.555 91.344  1.00 35.77  ? 24   DC  G "C4'" 1 
ATOM   8241 O  "O4'" . DC  G 2 21  ? 55.213  -33.988 90.690  1.00 35.23  ? 24   DC  G "O4'" 1 
ATOM   8242 C  "C3'" . DC  G 2 21  ? 56.120  -33.418 92.823  1.00 34.12  ? 24   DC  G "C3'" 1 
ATOM   8243 O  "O3'" . DC  G 2 21  ? 56.338  -32.086 93.243  1.00 32.10  ? 24   DC  G "O3'" 1 
ATOM   8244 C  "C2'" . DC  G 2 21  ? 54.644  -33.758 92.980  1.00 34.23  ? 24   DC  G "C2'" 1 
ATOM   8245 C  "C1'" . DC  G 2 21  ? 54.159  -34.190 91.612  1.00 34.41  ? 24   DC  G "C1'" 1 
ATOM   8246 N  N1    . DC  G 2 21  ? 53.650  -35.615 91.509  1.00 34.25  ? 24   DC  G N1    1 
ATOM   8247 C  C2    . DC  G 2 21  ? 52.336  -35.948 91.918  1.00 33.73  ? 24   DC  G C2    1 
ATOM   8248 O  O2    . DC  G 2 21  ? 51.583  -35.086 92.390  1.00 33.20  ? 24   DC  G O2    1 
ATOM   8249 N  N3    . DC  G 2 21  ? 51.913  -37.235 91.789  1.00 33.52  ? 24   DC  G N3    1 
ATOM   8250 C  C4    . DC  G 2 21  ? 52.726  -38.167 91.279  1.00 33.77  ? 24   DC  G C4    1 
ATOM   8251 N  N4    . DC  G 2 21  ? 52.259  -39.416 91.170  1.00 33.41  ? 24   DC  G N4    1 
ATOM   8252 C  C5    . DC  G 2 21  ? 54.059  -37.858 90.858  1.00 34.24  ? 24   DC  G C5    1 
ATOM   8253 C  C6    . DC  G 2 21  ? 54.470  -36.587 90.990  1.00 34.43  ? 24   DC  G C6    1 
ATOM   8254 P  P     . DG  G 2 22  ? 56.796  -31.822 94.753  1.00 31.05  ? 25   DG  G P     1 
ATOM   8255 O  OP1   . DG  G 2 22  ? 56.318  -30.477 95.156  1.00 30.82  ? 25   DG  G OP1   1 
ATOM   8256 O  OP2   . DG  G 2 22  ? 58.233  -32.157 94.838  1.00 30.87  ? 25   DG  G OP2   1 
ATOM   8257 O  "O5'" . DG  G 2 22  ? 56.017  -32.953 95.580  1.00 30.15  ? 25   DG  G "O5'" 1 
ATOM   8258 C  "C5'" . DG  G 2 22  ? 55.566  -32.741 96.918  1.00 28.29  ? 25   DG  G "C5'" 1 
ATOM   8259 C  "C4'" . DG  G 2 22  ? 54.111  -32.301 96.952  1.00 26.33  ? 25   DG  G "C4'" 1 
ATOM   8260 O  "O4'" . DG  G 2 22  ? 53.377  -32.759 95.798  1.00 26.37  ? 25   DG  G "O4'" 1 
ATOM   8261 C  "C3'" . DG  G 2 22  ? 53.347  -32.826 98.141  1.00 24.91  ? 25   DG  G "C3'" 1 
ATOM   8262 O  "O3'" . DG  G 2 22  ? 53.108  -31.723 98.927  1.00 23.13  ? 25   DG  G "O3'" 1 
ATOM   8263 C  "C2'" . DG  G 2 22  ? 52.019  -33.362 97.640  1.00 25.23  ? 25   DG  G "C2'" 1 
ATOM   8264 C  "C1'" . DG  G 2 22  ? 52.287  -33.577 96.168  1.00 26.03  ? 25   DG  G "C1'" 1 
ATOM   8265 N  N9    . DG  G 2 22  ? 52.623  -34.948 95.818  1.00 26.46  ? 25   DG  G N9    1 
ATOM   8266 C  C8    . DG  G 2 22  ? 53.861  -35.410 95.447  1.00 26.58  ? 25   DG  G C8    1 
ATOM   8267 N  N7    . DG  G 2 22  ? 53.889  -36.673 95.157  1.00 26.79  ? 25   DG  G N7    1 
ATOM   8268 C  C5    . DG  G 2 22  ? 52.580  -37.073 95.356  1.00 26.90  ? 25   DG  G C5    1 
ATOM   8269 C  C6    . DG  G 2 22  ? 52.018  -38.352 95.205  1.00 27.12  ? 25   DG  G C6    1 
ATOM   8270 O  O6    . DG  G 2 22  ? 52.620  -39.370 94.856  1.00 27.39  ? 25   DG  G O6    1 
ATOM   8271 N  N1    . DG  G 2 22  ? 50.652  -38.377 95.498  1.00 27.16  ? 25   DG  G N1    1 
ATOM   8272 C  C2    . DG  G 2 22  ? 49.926  -37.277 95.892  1.00 26.98  ? 25   DG  G C2    1 
ATOM   8273 N  N2    . DG  G 2 22  ? 48.623  -37.485 96.124  1.00 26.78  ? 25   DG  G N2    1 
ATOM   8274 N  N3    . DG  G 2 22  ? 50.448  -36.062 96.046  1.00 27.06  ? 25   DG  G N3    1 
ATOM   8275 C  C4    . DG  G 2 22  ? 51.778  -36.032 95.760  1.00 26.84  ? 25   DG  G C4    1 
ATOM   8276 P  P     . DT  G 2 23  ? 53.234  -32.005 100.472 1.00 22.35  ? 26   DT  G P     1 
ATOM   8277 O  OP1   . DT  G 2 23  ? 53.439  -30.714 101.172 1.00 22.70  ? 26   DT  G OP1   1 
ATOM   8278 O  OP2   . DT  G 2 23  ? 54.221  -33.102 100.644 1.00 22.67  ? 26   DT  G OP2   1 
ATOM   8279 O  "O5'" . DT  G 2 23  ? 51.761  -32.558 100.770 1.00 20.23  ? 26   DT  G "O5'" 1 
ATOM   8280 C  "C5'" . DT  G 2 23  ? 51.581  -33.723 101.551 1.00 16.03  ? 26   DT  G "C5'" 1 
ATOM   8281 C  "C4'" . DT  G 2 23  ? 50.502  -34.575 100.935 1.00 12.85  ? 26   DT  G "C4'" 1 
ATOM   8282 O  "O4'" . DT  G 2 23  ? 50.998  -35.210 99.740  1.00 11.92  ? 26   DT  G "O4'" 1 
ATOM   8283 C  "C3'" . DT  G 2 23  ? 50.110  -35.738 101.808 1.00 11.18  ? 26   DT  G "C3'" 1 
ATOM   8284 O  "O3'" . DT  G 2 23  ? 49.223  -35.304 102.819 1.00 9.09   ? 26   DT  G "O3'" 1 
ATOM   8285 C  "C2'" . DT  G 2 23  ? 49.451  -36.666 100.802 1.00 11.54  ? 26   DT  G "C2'" 1 
ATOM   8286 C  "C1'" . DT  G 2 23  ? 50.238  -36.381 99.520  1.00 12.27  ? 26   DT  G "C1'" 1 
ATOM   8287 N  N1    . DT  G 2 23  ? 51.137  -37.498 99.043  1.00 13.48  ? 26   DT  G N1    1 
ATOM   8288 C  C2    . DT  G 2 23  ? 50.654  -38.799 98.864  1.00 14.09  ? 26   DT  G C2    1 
ATOM   8289 O  O2    . DT  G 2 23  ? 49.503  -39.170 99.073  1.00 14.25  ? 26   DT  G O2    1 
ATOM   8290 N  N3    . DT  G 2 23  ? 51.595  -39.699 98.419  1.00 14.05  ? 26   DT  G N3    1 
ATOM   8291 C  C4    . DT  G 2 23  ? 52.930  -39.465 98.132  1.00 14.15  ? 26   DT  G C4    1 
ATOM   8292 O  O4    . DT  G 2 23  ? 53.667  -40.366 97.732  1.00 13.61  ? 26   DT  G O4    1 
ATOM   8293 C  C5    . DT  G 2 23  ? 53.376  -38.098 98.338  1.00 14.45  ? 26   DT  G C5    1 
ATOM   8294 C  C7    . DT  G 2 23  ? 54.809  -37.704 98.081  1.00 14.44  ? 26   DT  G C7    1 
ATOM   8295 C  C6    . DT  G 2 23  ? 52.467  -37.200 98.772  1.00 14.15  ? 26   DT  G C6    1 
ATOM   8296 P  P     . DT  G 2 24  ? 49.641  -35.579 104.337 1.00 8.69   ? 27   DT  G P     1 
ATOM   8297 O  OP1   . DT  G 2 24  ? 49.939  -34.280 104.979 1.00 9.20   ? 27   DT  G OP1   1 
ATOM   8298 O  OP2   . DT  G 2 24  ? 50.691  -36.617 104.342 1.00 8.90   ? 27   DT  G OP2   1 
ATOM   8299 O  "O5'" . DT  G 2 24  ? 48.341  -36.209 105.026 1.00 6.76   ? 27   DT  G "O5'" 1 
ATOM   8300 C  "C5'" . DT  G 2 24  ? 47.330  -36.911 104.323 1.00 3.64   ? 27   DT  G "C5'" 1 
ATOM   8301 C  "C4'" . DT  G 2 24  ? 47.602  -38.402 104.251 1.00 2.03   ? 27   DT  G "C4'" 1 
ATOM   8302 O  "O4'" . DT  G 2 24  ? 48.632  -38.668 103.286 1.00 2.29   ? 27   DT  G "O4'" 1 
ATOM   8303 C  "C3'" . DT  G 2 24  ? 48.129  -39.098 105.494 1.00 2.00   ? 27   DT  G "C3'" 1 
ATOM   8304 O  "O3'" . DT  G 2 24  ? 47.054  -39.703 106.152 1.00 2.00   ? 27   DT  G "O3'" 1 
ATOM   8305 C  "C2'" . DT  G 2 24  ? 49.087  -40.163 104.960 1.00 2.04   ? 27   DT  G "C2'" 1 
ATOM   8306 C  "C1'" . DT  G 2 24  ? 48.914  -40.031 103.461 1.00 3.28   ? 27   DT  G "C1'" 1 
ATOM   8307 N  N1    . DT  G 2 24  ? 50.113  -40.409 102.667 1.00 5.51   ? 27   DT  G N1    1 
ATOM   8308 C  C2    . DT  G 2 24  ? 50.172  -41.662 102.093 1.00 6.87   ? 27   DT  G C2    1 
ATOM   8309 O  O2    . DT  G 2 24  ? 49.302  -42.504 102.192 1.00 8.14   ? 27   DT  G O2    1 
ATOM   8310 N  N3    . DT  G 2 24  ? 51.309  -41.910 101.377 1.00 7.49   ? 27   DT  G N3    1 
ATOM   8311 C  C4    . DT  G 2 24  ? 52.373  -41.056 101.178 1.00 7.76   ? 27   DT  G C4    1 
ATOM   8312 O  O4    . DT  G 2 24  ? 53.344  -41.402 100.518 1.00 8.55   ? 27   DT  G O4    1 
ATOM   8313 C  C5    . DT  G 2 24  ? 52.263  -39.757 101.803 1.00 7.71   ? 27   DT  G C5    1 
ATOM   8314 C  C7    . DT  G 2 24  ? 53.366  -38.738 101.673 1.00 8.01   ? 27   DT  G C7    1 
ATOM   8315 C  C6    . DT  G 2 24  ? 51.148  -39.504 102.507 1.00 6.87   ? 27   DT  G C6    1 
ATOM   8316 P  P     . DT  G 2 25  ? 47.278  -40.519 107.498 1.00 2.00   ? 28   DT  G P     1 
ATOM   8317 O  OP1   . DT  G 2 25  ? 45.949  -40.658 108.116 1.00 2.00   ? 28   DT  G OP1   1 
ATOM   8318 O  OP2   . DT  G 2 25  ? 48.384  -39.967 108.315 1.00 2.00   ? 28   DT  G OP2   1 
ATOM   8319 O  "O5'" . DT  G 2 25  ? 47.732  -41.913 106.884 1.00 2.00   ? 28   DT  G "O5'" 1 
ATOM   8320 C  "C5'" . DT  G 2 25  ? 46.744  -42.845 106.507 1.00 2.00   ? 28   DT  G "C5'" 1 
ATOM   8321 C  "C4'" . DT  G 2 25  ? 47.383  -44.197 106.310 1.00 2.00   ? 28   DT  G "C4'" 1 
ATOM   8322 O  "O4'" . DT  G 2 25  ? 48.385  -44.005 105.297 1.00 2.00   ? 28   DT  G "O4'" 1 
ATOM   8323 C  "C3'" . DT  G 2 25  ? 48.090  -44.744 107.551 1.00 2.00   ? 28   DT  G "C3'" 1 
ATOM   8324 O  "O3'" . DT  G 2 25  ? 47.680  -46.079 107.848 1.00 2.00   ? 28   DT  G "O3'" 1 
ATOM   8325 C  "C2'" . DT  G 2 25  ? 49.565  -44.685 107.191 1.00 2.00   ? 28   DT  G "C2'" 1 
ATOM   8326 C  "C1'" . DT  G 2 25  ? 49.491  -44.763 105.672 1.00 2.00   ? 28   DT  G "C1'" 1 
ATOM   8327 N  N1    . DT  G 2 25  ? 50.678  -44.226 104.988 1.00 2.44   ? 28   DT  G N1    1 
ATOM   8328 C  C2    . DT  G 2 25  ? 51.140  -44.906 103.882 1.00 3.93   ? 28   DT  G C2    1 
ATOM   8329 O  O2    . DT  G 2 25  ? 50.606  -45.912 103.438 1.00 5.09   ? 28   DT  G O2    1 
ATOM   8330 N  N3    . DT  G 2 25  ? 52.256  -44.354 103.305 1.00 4.30   ? 28   DT  G N3    1 
ATOM   8331 C  C4    . DT  G 2 25  ? 52.933  -43.225 103.728 1.00 4.15   ? 28   DT  G C4    1 
ATOM   8332 O  O4    . DT  G 2 25  ? 53.926  -42.803 103.154 1.00 4.93   ? 28   DT  G O4    1 
ATOM   8333 C  C5    . DT  G 2 25  ? 52.399  -42.568 104.885 1.00 3.82   ? 28   DT  G C5    1 
ATOM   8334 C  C7    . DT  G 2 25  ? 53.079  -41.336 105.402 1.00 4.19   ? 28   DT  G C7    1 
ATOM   8335 C  C6    . DT  G 2 25  ? 51.308  -43.091 105.459 1.00 3.22   ? 28   DT  G C6    1 
ATOM   8336 O  "O5'" . DA  H 3 1   ? 58.926  -48.540 95.782  1.00 33.67  ? 29   DA  H "O5'" 1 
ATOM   8337 C  "C5'" . DA  H 3 1   ? 57.572  -48.945 95.668  1.00 33.24  ? 29   DA  H "C5'" 1 
ATOM   8338 C  "C4'" . DA  H 3 1   ? 57.253  -50.070 96.635  1.00 32.61  ? 29   DA  H "C4'" 1 
ATOM   8339 O  "O4'" . DA  H 3 1   ? 57.749  -49.785 97.961  1.00 33.81  ? 29   DA  H "O4'" 1 
ATOM   8340 C  "C3'" . DA  H 3 1   ? 55.765  -50.285 96.805  1.00 31.83  ? 29   DA  H "C3'" 1 
ATOM   8341 O  "O3'" . DA  H 3 1   ? 55.480  -51.489 96.188  1.00 29.79  ? 29   DA  H "O3'" 1 
ATOM   8342 C  "C2'" . DA  H 3 1   ? 55.512  -50.395 98.299  1.00 32.94  ? 29   DA  H "C2'" 1 
ATOM   8343 C  "C1'" . DA  H 3 1   ? 56.662  -49.567 98.837  1.00 34.47  ? 29   DA  H "C1'" 1 
ATOM   8344 N  N9    . DA  H 3 1   ? 56.426  -48.126 98.949  1.00 36.12  ? 29   DA  H N9    1 
ATOM   8345 C  C8    . DA  H 3 1   ? 57.192  -47.127 98.412  1.00 36.59  ? 29   DA  H C8    1 
ATOM   8346 N  N7    . DA  H 3 1   ? 56.783  -45.914 98.680  1.00 37.02  ? 29   DA  H N7    1 
ATOM   8347 C  C5    . DA  H 3 1   ? 55.668  -46.132 99.458  1.00 37.38  ? 29   DA  H C5    1 
ATOM   8348 C  C6    . DA  H 3 1   ? 54.778  -45.238 100.069 1.00 37.66  ? 29   DA  H C6    1 
ATOM   8349 N  N6    . DA  H 3 1   ? 54.920  -43.915 99.965  1.00 37.41  ? 29   DA  H N6    1 
ATOM   8350 N  N1    . DA  H 3 1   ? 53.759  -45.761 100.789 1.00 38.14  ? 29   DA  H N1    1 
ATOM   8351 C  C2    . DA  H 3 1   ? 53.639  -47.098 100.886 1.00 38.27  ? 29   DA  H C2    1 
ATOM   8352 N  N3    . DA  H 3 1   ? 54.422  -48.038 100.353 1.00 38.01  ? 29   DA  H N3    1 
ATOM   8353 C  C4    . DA  H 3 1   ? 55.427  -47.485 99.644  1.00 37.24  ? 29   DA  H C4    1 
ATOM   8354 P  P     . DA  H 3 2   ? 54.617  -51.440 94.859  1.00 29.05  ? 30   DA  H P     1 
ATOM   8355 O  OP1   . DA  H 3 2   ? 54.438  -52.857 94.487  1.00 29.26  ? 30   DA  H OP1   1 
ATOM   8356 O  OP2   . DA  H 3 2   ? 55.160  -50.430 93.911  1.00 28.14  ? 30   DA  H OP2   1 
ATOM   8357 O  "O5'" . DA  H 3 2   ? 53.219  -50.877 95.376  1.00 29.43  ? 30   DA  H "O5'" 1 
ATOM   8358 C  "C5'" . DA  H 3 2   ? 52.511  -51.579 96.399  1.00 29.58  ? 30   DA  H "C5'" 1 
ATOM   8359 C  "C4'" . DA  H 3 2   ? 51.406  -50.728 97.010  1.00 29.45  ? 30   DA  H "C4'" 1 
ATOM   8360 O  "O4'" . DA  H 3 2   ? 51.925  -49.766 97.979  1.00 29.59  ? 30   DA  H "O4'" 1 
ATOM   8361 C  "C3'" . DA  H 3 2   ? 50.590  -49.894 96.029  1.00 28.66  ? 30   DA  H "C3'" 1 
ATOM   8362 O  "O3'" . DA  H 3 2   ? 49.713  -50.743 95.297  1.00 27.54  ? 30   DA  H "O3'" 1 
ATOM   8363 C  "C2'" . DA  H 3 2   ? 49.888  -49.013 97.052  1.00 29.23  ? 30   DA  H "C2'" 1 
ATOM   8364 C  "C1'" . DA  H 3 2   ? 51.024  -48.673 98.016  1.00 28.99  ? 30   DA  H "C1'" 1 
ATOM   8365 N  N9    . DA  H 3 2   ? 51.676  -47.417 97.647  1.00 27.88  ? 30   DA  H N9    1 
ATOM   8366 C  C8    . DA  H 3 2   ? 52.448  -47.146 96.549  1.00 27.29  ? 30   DA  H C8    1 
ATOM   8367 N  N7    . DA  H 3 2   ? 52.875  -45.911 96.497  1.00 26.86  ? 30   DA  H N7    1 
ATOM   8368 C  C5    . DA  H 3 2   ? 52.336  -45.336 97.632  1.00 26.54  ? 30   DA  H C5    1 
ATOM   8369 C  C6    . DA  H 3 2   ? 52.404  -44.037 98.163  1.00 26.06  ? 30   DA  H C6    1 
ATOM   8370 N  N6    . DA  H 3 2   ? 53.091  -43.051 97.587  1.00 25.35  ? 30   DA  H N6    1 
ATOM   8371 N  N1    . DA  H 3 2   ? 51.747  -43.792 99.320  1.00 26.39  ? 30   DA  H N1    1 
ATOM   8372 C  C2    . DA  H 3 2   ? 51.052  -44.780 99.908  1.00 26.63  ? 30   DA  H C2    1 
ATOM   8373 N  N3    . DA  H 3 2   ? 50.916  -46.041 99.501  1.00 26.85  ? 30   DA  H N3    1 
ATOM   8374 C  C4    . DA  H 3 2   ? 51.588  -46.248 98.350  1.00 27.07  ? 30   DA  H C4    1 
ATOM   8375 P  P     . DA  H 3 3   ? 48.389  -50.246 94.557  1.00 27.26  ? 31   DA  H P     1 
ATOM   8376 O  OP1   . DA  H 3 3   ? 47.288  -50.303 95.541  1.00 26.68  ? 31   DA  H OP1   1 
ATOM   8377 O  OP2   . DA  H 3 3   ? 48.278  -51.020 93.304  1.00 27.51  ? 31   DA  H OP2   1 
ATOM   8378 O  "O5'" . DA  H 3 3   ? 48.661  -48.723 94.156  1.00 28.10  ? 31   DA  H "O5'" 1 
ATOM   8379 C  "C5'" . DA  H 3 3   ? 47.563  -47.871 93.847  1.00 29.60  ? 31   DA  H "C5'" 1 
ATOM   8380 C  "C4'" . DA  H 3 3   ? 46.891  -47.439 95.138  1.00 30.74  ? 31   DA  H "C4'" 1 
ATOM   8381 O  "O4'" . DA  H 3 3   ? 47.917  -47.323 96.153  1.00 31.55  ? 31   DA  H "O4'" 1 
ATOM   8382 C  "C3'" . DA  H 3 3   ? 46.181  -46.094 95.114  1.00 31.06  ? 31   DA  H "C3'" 1 
ATOM   8383 O  "O3'" . DA  H 3 3   ? 44.808  -46.313 95.045  1.00 30.72  ? 31   DA  H "O3'" 1 
ATOM   8384 C  "C2'" . DA  H 3 3   ? 46.487  -45.538 96.495  1.00 32.20  ? 31   DA  H "C2'" 1 
ATOM   8385 C  "C1'" . DA  H 3 3   ? 47.907  -46.024 96.702  1.00 32.77  ? 31   DA  H "C1'" 1 
ATOM   8386 N  N9    . DA  H 3 3   ? 48.870  -45.146 96.034  1.00 34.12  ? 31   DA  H N9    1 
ATOM   8387 C  C8    . DA  H 3 3   ? 49.495  -45.311 94.826  1.00 34.49  ? 31   DA  H C8    1 
ATOM   8388 N  N7    . DA  H 3 3   ? 50.297  -44.333 94.500  1.00 34.59  ? 31   DA  H N7    1 
ATOM   8389 C  C5    . DA  H 3 3   ? 50.182  -43.469 95.566  1.00 34.93  ? 31   DA  H C5    1 
ATOM   8390 C  C6    . DA  H 3 3   ? 50.778  -42.236 95.844  1.00 35.57  ? 31   DA  H C6    1 
ATOM   8391 N  N6    . DA  H 3 3   ? 51.645  -41.683 95.005  1.00 36.08  ? 31   DA  H N6    1 
ATOM   8392 N  N1    . DA  H 3 3   ? 50.470  -41.607 97.002  1.00 35.94  ? 31   DA  H N1    1 
ATOM   8393 C  C2    . DA  H 3 3   ? 49.601  -42.183 97.840  1.00 35.66  ? 31   DA  H C2    1 
ATOM   8394 N  N3    . DA  H 3 3   ? 48.981  -43.352 97.684  1.00 35.41  ? 31   DA  H N3    1 
ATOM   8395 C  C4    . DA  H 3 3   ? 49.313  -43.943 96.520  1.00 34.83  ? 31   DA  H C4    1 
ATOM   8396 P  P     . DC  H 3 4   ? 43.951  -45.804 93.812  1.00 30.76  ? 32   DC  H P     1 
ATOM   8397 O  OP1   . DC  H 3 4   ? 43.371  -47.041 93.246  1.00 30.90  ? 32   DC  H OP1   1 
ATOM   8398 O  OP2   . DC  H 3 4   ? 44.737  -44.883 92.955  1.00 31.09  ? 32   DC  H OP2   1 
ATOM   8399 O  "O5'" . DC  H 3 4   ? 42.808  -44.925 94.500  1.00 30.83  ? 32   DC  H "O5'" 1 
ATOM   8400 C  "C5'" . DC  H 3 4   ? 43.077  -44.135 95.659  1.00 30.47  ? 32   DC  H "C5'" 1 
ATOM   8401 C  "C4'" . DC  H 3 4   ? 43.393  -42.675 95.370  1.00 30.54  ? 32   DC  H "C4'" 1 
ATOM   8402 O  "O4'" . DC  H 3 4   ? 44.827  -42.471 95.336  1.00 29.14  ? 32   DC  H "O4'" 1 
ATOM   8403 C  "C3'" . DC  H 3 4   ? 42.832  -42.044 94.085  1.00 31.68  ? 32   DC  H "C3'" 1 
ATOM   8404 O  "O3'" . DC  H 3 4   ? 42.079  -40.900 94.501  1.00 34.05  ? 32   DC  H "O3'" 1 
ATOM   8405 C  "C2'" . DC  H 3 4   ? 44.090  -41.645 93.322  1.00 30.16  ? 32   DC  H "C2'" 1 
ATOM   8406 C  "C1'" . DC  H 3 4   ? 44.989  -41.345 94.521  1.00 28.77  ? 32   DC  H "C1'" 1 
ATOM   8407 N  N1    . DC  H 3 4   ? 46.410  -41.130 94.204  1.00 27.27  ? 32   DC  H N1    1 
ATOM   8408 C  C2    . DC  H 3 4   ? 47.142  -40.201 94.942  1.00 25.94  ? 32   DC  H C2    1 
ATOM   8409 O  O2    . DC  H 3 4   ? 46.585  -39.593 95.850  1.00 25.02  ? 32   DC  H O2    1 
ATOM   8410 N  N3    . DC  H 3 4   ? 48.440  -39.995 94.640  1.00 25.92  ? 32   DC  H N3    1 
ATOM   8411 C  C4    . DC  H 3 4   ? 48.983  -40.683 93.634  1.00 26.98  ? 32   DC  H C4    1 
ATOM   8412 N  N4    . DC  H 3 4   ? 50.258  -40.464 93.337  1.00 27.20  ? 32   DC  H N4    1 
ATOM   8413 C  C5    . DC  H 3 4   ? 48.259  -41.630 92.858  1.00 27.74  ? 32   DC  H C5    1 
ATOM   8414 C  C6    . DC  H 3 4   ? 46.979  -41.820 93.177  1.00 27.93  ? 32   DC  H C6    1 
ATOM   8415 P  P     . DG  H 3 5   ? 41.171  -39.969 93.567  1.00 34.92  ? 33   DG  H P     1 
ATOM   8416 O  OP1   . DG  H 3 5   ? 39.843  -40.615 93.399  1.00 34.76  ? 33   DG  H OP1   1 
ATOM   8417 O  OP2   . DG  H 3 5   ? 41.983  -39.571 92.400  1.00 34.38  ? 33   DG  H OP2   1 
ATOM   8418 O  "O5'" . DG  H 3 5   ? 41.002  -38.705 94.538  1.00 37.09  ? 33   DG  H "O5'" 1 
ATOM   8419 C  "C5'" . DG  H 3 5   ? 40.711  -37.421 94.047  1.00 40.59  ? 33   DG  H "C5'" 1 
ATOM   8420 C  "C4'" . DG  H 3 5   ? 41.797  -36.422 94.406  1.00 43.53  ? 33   DG  H "C4'" 1 
ATOM   8421 O  "O4'" . DG  H 3 5   ? 43.123  -36.996 94.336  1.00 43.78  ? 33   DG  H "O4'" 1 
ATOM   8422 C  "C3'" . DG  H 3 5   ? 41.837  -35.264 93.427  1.00 46.23  ? 33   DG  H "C3'" 1 
ATOM   8423 O  "O3'" . DG  H 3 5   ? 42.021  -34.045 94.117  1.00 49.63  ? 33   DG  H "O3'" 1 
ATOM   8424 C  "C2'" . DG  H 3 5   ? 43.006  -35.574 92.508  1.00 45.48  ? 33   DG  H "C2'" 1 
ATOM   8425 C  "C1'" . DG  H 3 5   ? 43.953  -36.202 93.509  1.00 44.54  ? 33   DG  H "C1'" 1 
ATOM   8426 N  N9    . DG  H 3 5   ? 44.962  -37.032 92.857  1.00 44.96  ? 33   DG  H N9    1 
ATOM   8427 C  C8    . DG  H 3 5   ? 44.761  -38.241 92.231  1.00 45.15  ? 33   DG  H C8    1 
ATOM   8428 N  N7    . DG  H 3 5   ? 45.843  -38.770 91.731  1.00 45.19  ? 33   DG  H N7    1 
ATOM   8429 C  C5    . DG  H 3 5   ? 46.832  -37.851 92.041  1.00 45.27  ? 33   DG  H C5    1 
ATOM   8430 C  C6    . DG  H 3 5   ? 48.217  -37.889 91.752  1.00 45.54  ? 33   DG  H C6    1 
ATOM   8431 O  O6    . DG  H 3 5   ? 48.833  -38.776 91.140  1.00 45.72  ? 33   DG  H O6    1 
ATOM   8432 N  N1    . DG  H 3 5   ? 48.884  -36.758 92.244  1.00 45.62  ? 33   DG  H N1    1 
ATOM   8433 C  C2    . DG  H 3 5   ? 48.278  -35.719 92.930  1.00 45.52  ? 33   DG  H C2    1 
ATOM   8434 N  N2    . DG  H 3 5   ? 49.069  -34.707 93.329  1.00 45.12  ? 33   DG  H N2    1 
ATOM   8435 N  N3    . DG  H 3 5   ? 46.973  -35.679 93.204  1.00 45.45  ? 33   DG  H N3    1 
ATOM   8436 C  C4    . DG  H 3 5   ? 46.311  -36.773 92.734  1.00 45.22  ? 33   DG  H C4    1 
ATOM   8437 P  P     . DA  H 3 6   ? 40.898  -32.937 93.862  1.00 52.09  ? 34   DA  H P     1 
ATOM   8438 O  OP1   . DA  H 3 6   ? 40.179  -32.809 95.155  1.00 51.97  ? 34   DA  H OP1   1 
ATOM   8439 O  OP2   . DA  H 3 6   ? 40.168  -33.268 92.603  1.00 51.50  ? 34   DA  H OP2   1 
ATOM   8440 O  "O5'" . DA  H 3 6   ? 41.737  -31.611 93.567  1.00 52.34  ? 34   DA  H "O5'" 1 
ATOM   8441 C  "C5'" . DA  H 3 6   ? 42.432  -31.520 92.349  1.00 52.91  ? 34   DA  H "C5'" 1 
ATOM   8442 C  "C4'" . DA  H 3 6   ? 43.770  -30.861 92.587  1.00 53.57  ? 34   DA  H "C4'" 1 
ATOM   8443 O  "O4'" . DA  H 3 6   ? 44.820  -31.861 92.612  1.00 53.27  ? 34   DA  H "O4'" 1 
ATOM   8444 C  "C3'" . DA  H 3 6   ? 44.120  -29.896 91.474  1.00 54.47  ? 34   DA  H "C3'" 1 
ATOM   8445 O  "O3'" . DA  H 3 6   ? 44.868  -28.792 91.967  1.00 55.85  ? 34   DA  H "O3'" 1 
ATOM   8446 C  "C2'" . DA  H 3 6   ? 44.933  -30.769 90.526  1.00 54.17  ? 34   DA  H "C2'" 1 
ATOM   8447 C  "C1'" . DA  H 3 6   ? 45.648  -31.721 91.476  1.00 53.35  ? 34   DA  H "C1'" 1 
ATOM   8448 N  N9    . DA  H 3 6   ? 45.877  -33.024 90.858  1.00 53.04  ? 34   DA  H N9    1 
ATOM   8449 C  C8    . DA  H 3 6   ? 44.954  -34.007 90.625  1.00 52.68  ? 34   DA  H C8    1 
ATOM   8450 N  N7    . DA  H 3 6   ? 45.445  -35.078 90.045  1.00 52.26  ? 34   DA  H N7    1 
ATOM   8451 C  C5    . DA  H 3 6   ? 46.787  -34.774 89.876  1.00 52.39  ? 34   DA  H C5    1 
ATOM   8452 C  C6    . DA  H 3 6   ? 47.870  -35.491 89.318  1.00 52.14  ? 34   DA  H C6    1 
ATOM   8453 N  N6    . DA  H 3 6   ? 47.751  -36.718 88.807  1.00 52.00  ? 34   DA  H N6    1 
ATOM   8454 N  N1    . DA  H 3 6   ? 49.087  -34.898 89.301  1.00 52.25  ? 34   DA  H N1    1 
ATOM   8455 C  C2    . DA  H 3 6   ? 49.216  -33.666 89.816  1.00 52.48  ? 34   DA  H C2    1 
ATOM   8456 N  N3    . DA  H 3 6   ? 48.274  -32.893 90.366  1.00 52.68  ? 34   DA  H N3    1 
ATOM   8457 C  C4    . DA  H 3 6   ? 47.072  -33.508 90.368  1.00 52.78  ? 34   DA  H C4    1 
ATOM   8458 P  P     . DC  H 3 7   ? 44.835  -27.414 91.150  1.00 56.83  ? 35   DC  H P     1 
ATOM   8459 O  OP1   . DC  H 3 7   ? 45.465  -26.386 92.013  1.00 56.78  ? 35   DC  H OP1   1 
ATOM   8460 O  OP2   . DC  H 3 7   ? 43.457  -27.238 90.625  1.00 56.64  ? 35   DC  H OP2   1 
ATOM   8461 O  "O5'" . DC  H 3 7   ? 45.780  -27.672 89.884  1.00 57.51  ? 35   DC  H "O5'" 1 
ATOM   8462 C  "C5'" . DC  H 3 7   ? 47.190  -27.483 89.967  1.00 58.40  ? 35   DC  H "C5'" 1 
ATOM   8463 C  "C4'" . DC  H 3 7   ? 47.874  -28.202 88.819  1.00 59.16  ? 35   DC  H "C4'" 1 
ATOM   8464 O  "O4'" . DC  H 3 7   ? 47.513  -29.608 88.802  1.00 59.18  ? 35   DC  H "O4'" 1 
ATOM   8465 C  "C3'" . DC  H 3 7   ? 47.516  -27.681 87.427  1.00 59.61  ? 35   DC  H "C3'" 1 
ATOM   8466 O  "O3'" . DC  H 3 7   ? 48.705  -27.438 86.703  1.00 60.60  ? 35   DC  H "O3'" 1 
ATOM   8467 C  "C2'" . DC  H 3 7   ? 46.747  -28.835 86.804  1.00 59.40  ? 35   DC  H "C2'" 1 
ATOM   8468 C  "C1'" . DC  H 3 7   ? 47.526  -29.969 87.447  1.00 58.90  ? 35   DC  H "C1'" 1 
ATOM   8469 N  N1    . DC  H 3 7   ? 46.963  -31.317 87.240  1.00 58.70  ? 35   DC  H N1    1 
ATOM   8470 C  C2    . DC  H 3 7   ? 47.834  -32.389 86.978  1.00 58.78  ? 35   DC  H C2    1 
ATOM   8471 O  O2    . DC  H 3 7   ? 49.061  -32.203 86.938  1.00 58.16  ? 35   DC  H O2    1 
ATOM   8472 N  N3    . DC  H 3 7   ? 47.293  -33.622 86.778  1.00 59.35  ? 35   DC  H N3    1 
ATOM   8473 C  C4    . DC  H 3 7   ? 45.963  -33.798 86.823  1.00 59.46  ? 35   DC  H C4    1 
ATOM   8474 N  N4    . DC  H 3 7   ? 45.479  -35.031 86.620  1.00 59.42  ? 35   DC  H N4    1 
ATOM   8475 C  C5    . DC  H 3 7   ? 45.070  -32.711 87.084  1.00 59.30  ? 35   DC  H C5    1 
ATOM   8476 C  C6    . DC  H 3 7   ? 45.608  -31.501 87.281  1.00 58.83  ? 35   DC  H C6    1 
ATOM   8477 P  P     . DA  H 3 8   ? 49.260  -25.948 86.604  1.00 61.55  ? 36   DA  H P     1 
ATOM   8478 O  OP1   . DA  H 3 8   ? 49.000  -25.266 87.897  1.00 61.44  ? 36   DA  H OP1   1 
ATOM   8479 O  OP2   . DA  H 3 8   ? 48.735  -25.390 85.336  1.00 61.30  ? 36   DA  H OP2   1 
ATOM   8480 O  "O5'" . DA  H 3 8   ? 50.844  -26.163 86.482  1.00 62.16  ? 36   DA  H "O5'" 1 
ATOM   8481 C  "C5'" . DA  H 3 8   ? 51.553  -25.870 85.287  1.00 62.62  ? 36   DA  H "C5'" 1 
ATOM   8482 C  "C4'" . DA  H 3 8   ? 52.302  -27.102 84.815  1.00 63.16  ? 36   DA  H "C4'" 1 
ATOM   8483 O  "O4'" . DA  H 3 8   ? 51.539  -28.312 85.096  1.00 63.00  ? 36   DA  H "O4'" 1 
ATOM   8484 C  "C3'" . DA  H 3 8   ? 52.589  -27.105 83.318  1.00 63.85  ? 36   DA  H "C3'" 1 
ATOM   8485 O  "O3'" . DA  H 3 8   ? 53.975  -27.416 83.121  1.00 64.86  ? 36   DA  H "O3'" 1 
ATOM   8486 C  "C2'" . DA  H 3 8   ? 51.626  -28.170 82.787  1.00 63.62  ? 36   DA  H "C2'" 1 
ATOM   8487 C  "C1'" . DA  H 3 8   ? 51.584  -29.144 83.955  1.00 62.92  ? 36   DA  H "C1'" 1 
ATOM   8488 N  N9    . DA  H 3 8   ? 50.432  -30.044 83.899  1.00 62.23  ? 36   DA  H N9    1 
ATOM   8489 C  C8    . DA  H 3 8   ? 49.150  -29.784 84.294  1.00 61.85  ? 36   DA  H C8    1 
ATOM   8490 N  N7    . DA  H 3 8   ? 48.326  -30.789 84.113  1.00 61.56  ? 36   DA  H N7    1 
ATOM   8491 C  C5    . DA  H 3 8   ? 49.116  -31.781 83.553  1.00 61.40  ? 36   DA  H C5    1 
ATOM   8492 C  C6    . DA  H 3 8   ? 48.846  -33.104 83.119  1.00 61.03  ? 36   DA  H C6    1 
ATOM   8493 N  N6    . DA  H 3 8   ? 47.643  -33.681 83.190  1.00 60.59  ? 36   DA  H N6    1 
ATOM   8494 N  N1    . DA  H 3 8   ? 49.867  -33.825 82.604  1.00 60.98  ? 36   DA  H N1    1 
ATOM   8495 C  C2    . DA  H 3 8   ? 51.078  -33.256 82.527  1.00 61.31  ? 36   DA  H C2    1 
ATOM   8496 N  N3    . DA  H 3 8   ? 51.453  -32.030 82.902  1.00 61.53  ? 36   DA  H N3    1 
ATOM   8497 C  C4    . DA  H 3 8   ? 50.419  -31.334 83.411  1.00 61.71  ? 36   DA  H C4    1 
ATOM   8498 P  P     . DT  H 3 9   ? 54.564  -28.114 81.799  1.00 65.82  ? 37   DT  H P     1 
ATOM   8499 O  OP1   . DT  H 3 9   ? 55.986  -27.704 81.716  1.00 65.85  ? 37   DT  H OP1   1 
ATOM   8500 O  OP2   . DT  H 3 9   ? 53.655  -27.854 80.648  1.00 65.39  ? 37   DT  H OP2   1 
ATOM   8501 O  "O5'" . DT  H 3 9   ? 54.539  -29.676 82.187  1.00 65.76  ? 37   DT  H "O5'" 1 
ATOM   8502 C  "C5'" . DT  H 3 9   ? 55.542  -30.593 81.724  1.00 65.21  ? 37   DT  H "C5'" 1 
ATOM   8503 C  "C4'" . DT  H 3 9   ? 55.100  -31.307 80.454  1.00 64.78  ? 37   DT  H "C4'" 1 
ATOM   8504 O  "O4'" . DT  H 3 9   ? 53.714  -31.713 80.586  1.00 64.39  ? 37   DT  H "O4'" 1 
ATOM   8505 C  "C3'" . DT  H 3 9   ? 55.190  -30.486 79.161  1.00 64.51  ? 37   DT  H "C3'" 1 
ATOM   8506 O  "O3'" . DT  H 3 9   ? 56.096  -31.103 78.220  1.00 64.81  ? 37   DT  H "O3'" 1 
ATOM   8507 C  "C2'" . DT  H 3 9   ? 53.744  -30.359 78.688  1.00 64.08  ? 37   DT  H "C2'" 1 
ATOM   8508 C  "C1'" . DT  H 3 9   ? 53.115  -31.594 79.319  1.00 63.85  ? 37   DT  H "C1'" 1 
ATOM   8509 N  N1    . DT  H 3 9   ? 51.634  -31.538 79.453  1.00 63.44  ? 37   DT  H N1    1 
ATOM   8510 C  C2    . DT  H 3 9   ? 50.905  -32.703 79.274  1.00 63.26  ? 37   DT  H C2    1 
ATOM   8511 O  O2    . DT  H 3 9   ? 51.403  -33.790 79.025  1.00 63.33  ? 37   DT  H O2    1 
ATOM   8512 N  N3    . DT  H 3 9   ? 49.547  -32.549 79.411  1.00 62.96  ? 37   DT  H N3    1 
ATOM   8513 C  C4    . DT  H 3 9   ? 48.868  -31.374 79.694  1.00 62.90  ? 37   DT  H C4    1 
ATOM   8514 O  O4    . DT  H 3 9   ? 47.646  -31.361 79.790  1.00 62.82  ? 37   DT  H O4    1 
ATOM   8515 C  C5    . DT  H 3 9   ? 49.692  -30.190 79.865  1.00 62.92  ? 37   DT  H C5    1 
ATOM   8516 C  C7    . DT  H 3 9   ? 49.085  -28.851 80.175  1.00 62.70  ? 37   DT  H C7    1 
ATOM   8517 C  C6    . DT  H 3 9   ? 51.019  -30.329 79.739  1.00 63.05  ? 37   DT  H C6    1 
ATOM   8518 P  P     . DT  H 3 10  ? 55.726  -32.036 76.962  1.00 65.35  ? 38   DT  H P     1 
ATOM   8519 O  OP1   . DT  H 3 10  ? 57.019  -32.385 76.336  1.00 65.24  ? 38   DT  H OP1   1 
ATOM   8520 O  OP2   . DT  H 3 10  ? 54.686  -31.368 76.148  1.00 65.40  ? 38   DT  H OP2   1 
ATOM   8521 O  "O5'" . DT  H 3 10  ? 55.094  -33.382 77.563  1.00 65.82  ? 38   DT  H "O5'" 1 
ATOM   8522 C  "C5'" . DT  H 3 10  ? 55.493  -34.665 77.051  1.00 66.43  ? 38   DT  H "C5'" 1 
ATOM   8523 C  "C4'" . DT  H 3 10  ? 54.608  -35.134 75.907  1.00 66.96  ? 38   DT  H "C4'" 1 
ATOM   8524 O  "O4'" . DT  H 3 10  ? 53.235  -34.813 76.232  1.00 66.66  ? 38   DT  H "O4'" 1 
ATOM   8525 C  "C3'" . DT  H 3 10  ? 54.883  -34.505 74.533  1.00 67.78  ? 38   DT  H "C3'" 1 
ATOM   8526 O  "O3'" . DT  H 3 10  ? 55.280  -35.468 73.516  1.00 69.67  ? 38   DT  H "O3'" 1 
ATOM   8527 C  "C2'" . DT  H 3 10  ? 53.607  -33.740 74.183  1.00 67.11  ? 38   DT  H "C2'" 1 
ATOM   8528 C  "C1'" . DT  H 3 10  ? 52.571  -34.462 75.041  1.00 66.44  ? 38   DT  H "C1'" 1 
ATOM   8529 N  N1    . DT  H 3 10  ? 51.340  -33.688 75.380  1.00 65.79  ? 38   DT  H N1    1 
ATOM   8530 C  C2    . DT  H 3 10  ? 50.155  -34.380 75.563  1.00 65.40  ? 38   DT  H C2    1 
ATOM   8531 O  O2    . DT  H 3 10  ? 50.053  -35.593 75.466  1.00 64.76  ? 38   DT  H O2    1 
ATOM   8532 N  N3    . DT  H 3 10  ? 49.076  -33.586 75.870  1.00 65.53  ? 38   DT  H N3    1 
ATOM   8533 C  C4    . DT  H 3 10  ? 49.064  -32.205 76.006  1.00 65.67  ? 38   DT  H C4    1 
ATOM   8534 O  O4    . DT  H 3 10  ? 48.034  -31.598 76.283  1.00 65.81  ? 38   DT  H O4    1 
ATOM   8535 C  C5    . DT  H 3 10  ? 50.335  -31.541 75.799  1.00 65.67  ? 38   DT  H C5    1 
ATOM   8536 C  C7    . DT  H 3 10  ? 50.461  -30.047 75.915  1.00 65.37  ? 38   DT  H C7    1 
ATOM   8537 C  C6    . DT  H 3 10  ? 51.397  -32.308 75.502  1.00 65.76  ? 38   DT  H C6    1 
ATOM   8538 P  P     . DT  H 3 11  ? 54.395  -36.657 72.875  1.00 71.16  ? 39   DT  H P     1 
ATOM   8539 O  OP1   . DT  H 3 11  ? 53.531  -37.250 73.919  1.00 71.23  ? 39   DT  H OP1   1 
ATOM   8540 O  OP2   . DT  H 3 11  ? 55.331  -37.541 72.145  1.00 71.16  ? 39   DT  H OP2   1 
ATOM   8541 O  "O5'" . DT  H 3 11  ? 53.484  -35.946 71.769  1.00 71.63  ? 39   DT  H "O5'" 1 
ATOM   8542 C  "C5'" . DT  H 3 11  ? 52.898  -36.741 70.740  1.00 72.85  ? 39   DT  H "C5'" 1 
ATOM   8543 C  "C4'" . DT  H 3 11  ? 51.749  -37.589 71.269  1.00 73.88  ? 39   DT  H "C4'" 1 
ATOM   8544 O  "O4'" . DT  H 3 11  ? 51.055  -36.856 72.311  1.00 73.63  ? 39   DT  H "O4'" 1 
ATOM   8545 C  "C3'" . DT  H 3 11  ? 50.690  -37.948 70.234  1.00 75.06  ? 39   DT  H "C3'" 1 
ATOM   8546 O  "O3'" . DT  H 3 11  ? 50.073  -39.216 70.504  1.00 76.96  ? 39   DT  H "O3'" 1 
ATOM   8547 C  "C2'" . DT  H 3 11  ? 49.693  -36.808 70.381  1.00 74.57  ? 39   DT  H "C2'" 1 
ATOM   8548 C  "C1'" . DT  H 3 11  ? 49.772  -36.462 71.861  1.00 73.82  ? 39   DT  H "C1'" 1 
ATOM   8549 N  N1    . DT  H 3 11  ? 49.537  -35.002 72.114  1.00 73.51  ? 39   DT  H N1    1 
ATOM   8550 C  C2    . DT  H 3 11  ? 48.310  -34.607 72.615  1.00 73.24  ? 39   DT  H C2    1 
ATOM   8551 O  O2    . DT  H 3 11  ? 47.407  -35.383 72.871  1.00 72.91  ? 39   DT  H O2    1 
ATOM   8552 N  N3    . DT  H 3 11  ? 48.177  -33.251 72.812  1.00 73.22  ? 39   DT  H N3    1 
ATOM   8553 C  C4    . DT  H 3 11  ? 49.125  -32.270 72.560  1.00 73.28  ? 39   DT  H C4    1 
ATOM   8554 O  O4    . DT  H 3 11  ? 48.893  -31.083 72.781  1.00 73.12  ? 39   DT  H O4    1 
ATOM   8555 C  C5    . DT  H 3 11  ? 50.389  -32.746 72.030  1.00 73.38  ? 39   DT  H C5    1 
ATOM   8556 C  C7    . DT  H 3 11  ? 51.506  -31.790 71.714  1.00 73.15  ? 39   DT  H C7    1 
ATOM   8557 C  C6    . DT  H 3 11  ? 50.529  -34.071 71.834  1.00 73.50  ? 39   DT  H C6    1 
ATOM   8558 P  P     . DC  H 3 12  ? 49.200  -39.983 69.390  1.00 78.28  ? 40   DC  H P     1 
ATOM   8559 O  OP1   . DC  H 3 12  ? 49.964  -41.185 68.988  1.00 78.31  ? 40   DC  H OP1   1 
ATOM   8560 O  OP2   . DC  H 3 12  ? 48.749  -39.015 68.362  1.00 77.84  ? 40   DC  H OP2   1 
ATOM   8561 O  "O5'" . DC  H 3 12  ? 47.916  -40.464 70.217  1.00 79.31  ? 40   DC  H "O5'" 1 
ATOM   8562 C  "C5'" . DC  H 3 12  ? 46.818  -41.081 69.552  1.00 80.85  ? 40   DC  H "C5'" 1 
ATOM   8563 C  "C4'" . DC  H 3 12  ? 45.719  -40.075 69.250  1.00 82.10  ? 40   DC  H "C4'" 1 
ATOM   8564 O  "O4'" . DC  H 3 12  ? 46.107  -38.736 69.653  1.00 82.14  ? 40   DC  H "O4'" 1 
ATOM   8565 C  "C3'" . DC  H 3 12  ? 45.340  -39.972 67.775  1.00 83.04  ? 40   DC  H "C3'" 1 
ATOM   8566 O  "O3'" . DC  H 3 12  ? 44.012  -40.507 67.630  1.00 84.81  ? 40   DC  H "O3'" 1 
ATOM   8567 C  "C2'" . DC  H 3 12  ? 45.522  -38.486 67.435  1.00 82.59  ? 40   DC  H "C2'" 1 
ATOM   8568 C  "C1'" . DC  H 3 12  ? 45.421  -37.837 68.813  1.00 82.00  ? 40   DC  H "C1'" 1 
ATOM   8569 N  N1    . DC  H 3 12  ? 46.000  -36.454 68.966  1.00 81.39  ? 40   DC  H N1    1 
ATOM   8570 C  C2    . DC  H 3 12  ? 45.311  -35.490 69.731  1.00 80.84  ? 40   DC  H C2    1 
ATOM   8571 O  O2    . DC  H 3 12  ? 44.232  -35.773 70.271  1.00 80.20  ? 40   DC  H O2    1 
ATOM   8572 N  N3    . DC  H 3 12  ? 45.854  -34.248 69.857  1.00 80.75  ? 40   DC  H N3    1 
ATOM   8573 C  C4    . DC  H 3 12  ? 47.019  -33.954 69.265  1.00 80.96  ? 40   DC  H C4    1 
ATOM   8574 N  N4    . DC  H 3 12  ? 47.506  -32.718 69.420  1.00 80.92  ? 40   DC  H N4    1 
ATOM   8575 C  C5    . DC  H 3 12  ? 47.733  -34.914 68.482  1.00 81.02  ? 40   DC  H C5    1 
ATOM   8576 C  C6    . DC  H 3 12  ? 47.192  -36.136 68.364  1.00 81.20  ? 40   DC  H C6    1 
ATOM   8577 P  P     . DA  H 3 13  ? 42.709  -39.717 67.120  1.00 86.35  ? 41   DA  H P     1 
ATOM   8578 O  OP1   . DA  H 3 13  ? 41.589  -40.685 67.200  1.00 86.46  ? 41   DA  H OP1   1 
ATOM   8579 O  OP2   . DA  H 3 13  ? 43.024  -39.093 65.812  1.00 86.31  ? 41   DA  H OP2   1 
ATOM   8580 O  "O5'" . DA  H 3 13  ? 42.470  -38.553 68.200  1.00 86.86  ? 41   DA  H "O5'" 1 
ATOM   8581 C  "C5'" . DA  H 3 13  ? 41.236  -38.447 68.917  1.00 87.94  ? 41   DA  H "C5'" 1 
ATOM   8582 C  "C4'" . DA  H 3 13  ? 40.290  -37.387 68.351  1.00 88.70  ? 41   DA  H "C4'" 1 
ATOM   8583 O  "O4'" . DA  H 3 13  ? 40.940  -36.097 68.220  1.00 89.20  ? 41   DA  H "O4'" 1 
ATOM   8584 C  "C3'" . DA  H 3 13  ? 39.668  -37.648 66.985  1.00 88.84  ? 41   DA  H "C3'" 1 
ATOM   8585 O  "O3'" . DA  H 3 13  ? 38.406  -37.037 67.014  1.00 89.19  ? 41   DA  H "O3'" 1 
ATOM   8586 C  "C2'" . DA  H 3 13  ? 40.585  -36.900 66.024  1.00 88.91  ? 41   DA  H "C2'" 1 
ATOM   8587 C  "C1'" . DA  H 3 13  ? 40.971  -35.688 66.866  1.00 89.29  ? 41   DA  H "C1'" 1 
ATOM   8588 N  N9    . DA  H 3 13  ? 42.326  -35.199 66.665  1.00 89.92  ? 41   DA  H N9    1 
ATOM   8589 C  C8    . DA  H 3 13  ? 43.431  -35.919 66.296  1.00 90.11  ? 41   DA  H C8    1 
ATOM   8590 N  N7    . DA  H 3 13  ? 44.529  -35.206 66.215  1.00 90.23  ? 41   DA  H N7    1 
ATOM   8591 C  C5    . DA  H 3 13  ? 44.119  -33.928 66.565  1.00 90.27  ? 41   DA  H C5    1 
ATOM   8592 C  C6    . DA  H 3 13  ? 44.810  -32.699 66.676  1.00 90.17  ? 41   DA  H C6    1 
ATOM   8593 N  N6    . DA  H 3 13  ? 46.117  -32.560 66.433  1.00 89.97  ? 41   DA  H N6    1 
ATOM   8594 N  N1    . DA  H 3 13  ? 44.098  -31.612 67.051  1.00 90.23  ? 41   DA  H N1    1 
ATOM   8595 C  C2    . DA  H 3 13  ? 42.783  -31.743 67.289  1.00 90.41  ? 41   DA  H C2    1 
ATOM   8596 N  N3    . DA  H 3 13  ? 42.026  -32.842 67.225  1.00 90.35  ? 41   DA  H N3    1 
ATOM   8597 C  C4    . DA  H 3 13  ? 42.761  -33.908 66.851  1.00 90.25  ? 41   DA  H C4    1 
ATOM   8598 P  P     . DT  H 3 14  ? 37.257  -37.460 65.998  1.00 89.86  ? 42   DT  H P     1 
ATOM   8599 O  OP1   . DT  H 3 14  ? 36.842  -38.838 66.341  1.00 89.50  ? 42   DT  H OP1   1 
ATOM   8600 O  OP2   . DT  H 3 14  ? 37.718  -37.156 64.622  1.00 90.11  ? 42   DT  H OP2   1 
ATOM   8601 O  "O5'" . DT  H 3 14  ? 36.090  -36.430 66.399  1.00 90.41  ? 42   DT  H "O5'" 1 
ATOM   8602 C  "C5'" . DT  H 3 14  ? 35.693  -35.383 65.517  1.00 90.98  ? 42   DT  H "C5'" 1 
ATOM   8603 C  "C4'" . DT  H 3 14  ? 36.260  -34.029 65.919  1.00 91.50  ? 42   DT  H "C4'" 1 
ATOM   8604 O  "O4'" . DT  H 3 14  ? 37.721  -34.008 65.872  1.00 91.47  ? 42   DT  H "O4'" 1 
ATOM   8605 C  "C3'" . DT  H 3 14  ? 35.801  -32.910 64.989  1.00 91.98  ? 42   DT  H "C3'" 1 
ATOM   8606 O  "O3'" . DT  H 3 14  ? 35.354  -31.772 65.723  1.00 92.97  ? 42   DT  H "O3'" 1 
ATOM   8607 C  "C2'" . DT  H 3 14  ? 37.057  -32.587 64.191  1.00 91.51  ? 42   DT  H "C2'" 1 
ATOM   8608 C  "C1'" . DT  H 3 14  ? 38.107  -32.781 65.274  1.00 91.08  ? 42   DT  H "C1'" 1 
ATOM   8609 N  N1    . DT  H 3 14  ? 39.522  -32.755 64.740  1.00 90.31  ? 42   DT  H N1    1 
ATOM   8610 C  C2    . DT  H 3 14  ? 40.289  -31.612 64.912  1.00 89.68  ? 42   DT  H C2    1 
ATOM   8611 O  O2    . DT  H 3 14  ? 39.909  -30.612 65.494  1.00 89.25  ? 42   DT  H O2    1 
ATOM   8612 N  N3    . DT  H 3 14  ? 41.554  -31.678 64.380  1.00 89.44  ? 42   DT  H N3    1 
ATOM   8613 C  C4    . DT  H 3 14  ? 42.124  -32.743 63.699  1.00 89.54  ? 42   DT  H C4    1 
ATOM   8614 O  O4    . DT  H 3 14  ? 43.273  -32.695 63.264  1.00 89.24  ? 42   DT  H O4    1 
ATOM   8615 C  C5    . DT  H 3 14  ? 41.274  -33.905 63.541  1.00 89.72  ? 42   DT  H C5    1 
ATOM   8616 C  C7    . DT  H 3 14  ? 41.770  -35.128 62.820  1.00 89.32  ? 42   DT  H C7    1 
ATOM   8617 C  C6    . DT  H 3 14  ? 40.032  -33.849 64.056  1.00 90.13  ? 42   DT  H C6    1 
ATOM   8618 P  P     . DA  H 3 15  ? 34.201  -30.837 65.109  1.00 93.88  ? 43   DA  H P     1 
ATOM   8619 O  OP1   . DA  H 3 15  ? 32.924  -31.560 65.298  1.00 94.23  ? 43   DA  H OP1   1 
ATOM   8620 O  OP2   . DA  H 3 15  ? 34.591  -30.413 63.738  1.00 93.73  ? 43   DA  H OP2   1 
ATOM   8621 O  "O5'" . DA  H 3 15  ? 34.209  -29.563 66.089  1.00 92.99  ? 43   DA  H "O5'" 1 
ATOM   8622 C  "C5'" . DA  H 3 15  ? 33.721  -28.289 65.661  1.00 91.46  ? 43   DA  H "C5'" 1 
ATOM   8623 C  "C4'" . DA  H 3 15  ? 34.873  -27.359 65.310  1.00 90.36  ? 43   DA  H "C4'" 1 
ATOM   8624 O  "O4'" . DA  H 3 15  ? 36.089  -28.098 64.996  1.00 90.08  ? 43   DA  H "O4'" 1 
ATOM   8625 C  "C3'" . DA  H 3 15  ? 34.631  -26.465 64.102  1.00 89.71  ? 43   DA  H "C3'" 1 
ATOM   8626 O  "O3'" . DA  H 3 15  ? 35.216  -25.202 64.378  1.00 89.25  ? 43   DA  H "O3'" 1 
ATOM   8627 C  "C2'" . DA  H 3 15  ? 35.395  -27.185 62.998  1.00 89.48  ? 43   DA  H "C2'" 1 
ATOM   8628 C  "C1'" . DA  H 3 15  ? 36.628  -27.563 63.806  1.00 89.50  ? 43   DA  H "C1'" 1 
ATOM   8629 N  N9    . DA  H 3 15  ? 37.533  -28.503 63.146  1.00 89.18  ? 43   DA  H N9    1 
ATOM   8630 C  C8    . DA  H 3 15  ? 37.241  -29.731 62.620  1.00 89.01  ? 43   DA  H C8    1 
ATOM   8631 N  N7    . DA  H 3 15  ? 38.269  -30.342 62.082  1.00 88.93  ? 43   DA  H N7    1 
ATOM   8632 C  C5    . DA  H 3 15  ? 39.313  -29.451 62.261  1.00 88.93  ? 43   DA  H C5    1 
ATOM   8633 C  C6    . DA  H 3 15  ? 40.682  -29.494 61.911  1.00 88.76  ? 43   DA  H C6    1 
ATOM   8634 N  N6    . DA  H 3 15  ? 41.251  -30.523 61.278  1.00 88.43  ? 43   DA  H N6    1 
ATOM   8635 N  N1    . DA  H 3 15  ? 41.447  -28.428 62.235  1.00 88.72  ? 43   DA  H N1    1 
ATOM   8636 C  C2    . DA  H 3 15  ? 40.887  -27.388 62.873  1.00 88.86  ? 43   DA  H C2    1 
ATOM   8637 N  N3    . DA  H 3 15  ? 39.617  -27.234 63.253  1.00 88.97  ? 43   DA  H N3    1 
ATOM   8638 C  C4    . DA  H 3 15  ? 38.876  -28.310 62.918  1.00 89.06  ? 43   DA  H C4    1 
ATOM   8639 P  P     . DC  H 3 16  ? 34.721  -23.870 63.643  1.00 89.04  ? 44   DC  H P     1 
ATOM   8640 O  OP1   . DC  H 3 16  ? 35.367  -22.728 64.330  1.00 88.98  ? 44   DC  H OP1   1 
ATOM   8641 O  OP2   . DC  H 3 16  ? 33.244  -23.929 63.535  1.00 89.25  ? 44   DC  H OP2   1 
ATOM   8642 O  "O5'" . DC  H 3 16  ? 35.326  -23.996 62.166  1.00 88.15  ? 44   DC  H "O5'" 1 
ATOM   8643 C  "C5'" . DC  H 3 16  ? 35.708  -22.834 61.438  1.00 86.45  ? 44   DC  H "C5'" 1 
ATOM   8644 C  "C4'" . DC  H 3 16  ? 37.211  -22.630 61.492  1.00 85.38  ? 44   DC  H "C4'" 1 
ATOM   8645 O  "O4'" . DC  H 3 16  ? 37.889  -23.816 61.997  1.00 85.01  ? 44   DC  H "O4'" 1 
ATOM   8646 C  "C3'" . DC  H 3 16  ? 37.854  -22.406 60.133  1.00 84.86  ? 44   DC  H "C3'" 1 
ATOM   8647 O  "O3'" . DC  H 3 16  ? 37.629  -21.081 59.593  1.00 84.20  ? 44   DC  H "O3'" 1 
ATOM   8648 C  "C2'" . DC  H 3 16  ? 39.308  -22.740 60.458  1.00 84.82  ? 44   DC  H "C2'" 1 
ATOM   8649 C  "C1'" . DC  H 3 16  ? 39.129  -23.987 61.319  1.00 84.69  ? 44   DC  H "C1'" 1 
ATOM   8650 N  N1    . DC  H 3 16  ? 39.176  -25.298 60.535  1.00 84.19  ? 44   DC  H N1    1 
ATOM   8651 C  C2    . DC  H 3 16  ? 40.354  -25.699 59.865  1.00 83.79  ? 44   DC  H C2    1 
ATOM   8652 O  O2    . DC  H 3 16  ? 41.369  -24.985 59.908  1.00 83.77  ? 44   DC  H O2    1 
ATOM   8653 N  N3    . DC  H 3 16  ? 40.356  -26.879 59.178  1.00 83.16  ? 44   DC  H N3    1 
ATOM   8654 C  C4    . DC  H 3 16  ? 39.260  -27.647 59.138  1.00 82.74  ? 44   DC  H C4    1 
ATOM   8655 N  N4    . DC  H 3 16  ? 39.310  -28.794 58.456  1.00 82.08  ? 44   DC  H N4    1 
ATOM   8656 C  C5    . DC  H 3 16  ? 38.057  -27.266 59.803  1.00 83.10  ? 44   DC  H C5    1 
ATOM   8657 C  C6    . DC  H 3 16  ? 38.064  -26.104 60.477  1.00 83.81  ? 44   DC  H C6    1 
ATOM   8658 P  P     . DT  H 3 17  ? 38.099  -19.689 60.250  1.00 83.76  ? 45   DT  H P     1 
ATOM   8659 O  OP1   . DT  H 3 17  ? 37.472  -19.604 61.588  1.00 83.73  ? 45   DT  H OP1   1 
ATOM   8660 O  OP2   . DT  H 3 17  ? 37.813  -18.613 59.273  1.00 83.79  ? 45   DT  H OP2   1 
ATOM   8661 O  "O5'" . DT  H 3 17  ? 39.693  -19.844 60.411  1.00 83.03  ? 45   DT  H "O5'" 1 
ATOM   8662 C  "C5'" . DT  H 3 17  ? 40.628  -19.028 59.696  1.00 81.64  ? 45   DT  H "C5'" 1 
ATOM   8663 C  "C4'" . DT  H 3 17  ? 41.073  -19.656 58.380  1.00 80.99  ? 45   DT  H "C4'" 1 
ATOM   8664 O  "O4'" . DT  H 3 17  ? 40.836  -21.092 58.333  1.00 80.66  ? 45   DT  H "O4'" 1 
ATOM   8665 C  "C3'" . DT  H 3 17  ? 40.403  -19.086 57.114  1.00 80.61  ? 45   DT  H "C3'" 1 
ATOM   8666 O  "O3'" . DT  H 3 17  ? 41.278  -18.313 56.249  1.00 80.15  ? 45   DT  H "O3'" 1 
ATOM   8667 C  "C2'" . DT  H 3 17  ? 39.879  -20.317 56.372  1.00 80.32  ? 45   DT  H "C2'" 1 
ATOM   8668 C  "C1'" . DT  H 3 17  ? 40.780  -21.403 56.954  1.00 80.16  ? 45   DT  H "C1'" 1 
ATOM   8669 N  N1    . DT  H 3 17  ? 40.350  -22.824 56.671  1.00 79.47  ? 45   DT  H N1    1 
ATOM   8670 C  C2    . DT  H 3 17  ? 41.251  -23.697 56.078  1.00 79.07  ? 45   DT  H C2    1 
ATOM   8671 O  O2    . DT  H 3 17  ? 42.390  -23.394 55.772  1.00 78.83  ? 45   DT  H O2    1 
ATOM   8672 N  N3    . DT  H 3 17  ? 40.771  -24.963 55.847  1.00 78.76  ? 45   DT  H N3    1 
ATOM   8673 C  C4    . DT  H 3 17  ? 39.503  -25.436 56.137  1.00 78.75  ? 45   DT  H C4    1 
ATOM   8674 O  O4    . DT  H 3 17  ? 39.185  -26.593 55.882  1.00 78.63  ? 45   DT  H O4    1 
ATOM   8675 C  C5    . DT  H 3 17  ? 38.604  -24.477 56.749  1.00 78.83  ? 45   DT  H C5    1 
ATOM   8676 C  C7    . DT  H 3 17  ? 37.196  -24.847 57.116  1.00 78.60  ? 45   DT  H C7    1 
ATOM   8677 C  C6    . DT  H 3 17  ? 39.065  -23.237 56.978  1.00 79.07  ? 45   DT  H C6    1 
ATOM   8678 P  P     . DT  H 3 18  ? 42.882  -18.233 56.368  1.00 79.71  ? 46   DT  H P     1 
ATOM   8679 O  OP1   . DT  H 3 18  ? 43.428  -19.607 56.317  1.00 79.62  ? 46   DT  H OP1   1 
ATOM   8680 O  OP2   . DT  H 3 18  ? 43.209  -17.361 57.525  1.00 79.69  ? 46   DT  H OP2   1 
ATOM   8681 O  "O5'" . DT  H 3 18  ? 43.318  -17.439 55.036  1.00 78.77  ? 46   DT  H "O5'" 1 
ATOM   8682 C  "C5'" . DT  H 3 18  ? 43.069  -17.929 53.707  1.00 76.88  ? 46   DT  H "C5'" 1 
ATOM   8683 C  "C4'" . DT  H 3 18  ? 44.129  -18.938 53.276  1.00 75.37  ? 46   DT  H "C4'" 1 
ATOM   8684 O  "O4'" . DT  H 3 18  ? 43.724  -20.279 53.681  1.00 75.29  ? 46   DT  H "O4'" 1 
ATOM   8685 C  "C3'" . DT  H 3 18  ? 44.422  -19.017 51.782  1.00 74.14  ? 46   DT  H "C3'" 1 
ATOM   8686 O  "O3'" . DT  H 3 18  ? 45.820  -19.278 51.609  1.00 72.38  ? 46   DT  H "O3'" 1 
ATOM   8687 C  "C2'" . DT  H 3 18  ? 43.538  -20.187 51.351  1.00 74.60  ? 46   DT  H "C2'" 1 
ATOM   8688 C  "C1'" . DT  H 3 18  ? 43.642  -21.128 52.552  1.00 74.88  ? 46   DT  H "C1'" 1 
ATOM   8689 N  N1    . DT  H 3 18  ? 42.489  -22.112 52.682  1.00 74.54  ? 46   DT  H N1    1 
ATOM   8690 C  C2    . DT  H 3 18  ? 42.743  -23.477 52.687  1.00 74.30  ? 46   DT  H C2    1 
ATOM   8691 O  O2    . DT  H 3 18  ? 43.859  -23.965 52.606  1.00 74.44  ? 46   DT  H O2    1 
ATOM   8692 N  N3    . DT  H 3 18  ? 41.623  -24.269 52.798  1.00 73.91  ? 46   DT  H N3    1 
ATOM   8693 C  C4    . DT  H 3 18  ? 40.306  -23.851 52.896  1.00 73.49  ? 46   DT  H C4    1 
ATOM   8694 O  O4    . DT  H 3 18  ? 39.383  -24.651 52.995  1.00 73.07  ? 46   DT  H O4    1 
ATOM   8695 C  C5    . DT  H 3 18  ? 40.101  -22.419 52.885  1.00 73.55  ? 46   DT  H C5    1 
ATOM   8696 C  C7    . DT  H 3 18  ? 38.721  -21.831 52.988  1.00 73.24  ? 46   DT  H C7    1 
ATOM   8697 C  C6    . DT  H 3 18  ? 41.187  -21.635 52.778  1.00 74.05  ? 46   DT  H C6    1 
ATOM   8698 P  P     . DG  H 3 19  ? 46.447  -19.943 50.291  1.00 71.12  ? 47   DG  H P     1 
ATOM   8699 O  OP1   . DG  H 3 19  ? 47.853  -19.496 50.198  1.00 71.16  ? 47   DG  H OP1   1 
ATOM   8700 O  OP2   . DG  H 3 19  ? 45.536  -19.676 49.158  1.00 71.03  ? 47   DG  H OP2   1 
ATOM   8701 O  "O5'" . DG  H 3 19  ? 46.437  -21.515 50.602  1.00 69.86  ? 47   DG  H "O5'" 1 
ATOM   8702 C  "C5'" . DG  H 3 19  ? 47.218  -22.409 49.809  1.00 68.19  ? 47   DG  H "C5'" 1 
ATOM   8703 C  "C4'" . DG  H 3 19  ? 46.371  -23.266 48.879  1.00 67.18  ? 47   DG  H "C4'" 1 
ATOM   8704 O  "O4'" . DG  H 3 19  ? 45.107  -23.634 49.487  1.00 67.24  ? 47   DG  H "O4'" 1 
ATOM   8705 C  "C3'" . DG  H 3 19  ? 45.937  -22.628 47.560  1.00 66.39  ? 47   DG  H "C3'" 1 
ATOM   8706 O  "O3'" . DG  H 3 19  ? 46.921  -22.684 46.500  1.00 65.06  ? 47   DG  H "O3'" 1 
ATOM   8707 C  "C2'" . DG  H 3 19  ? 44.664  -23.390 47.194  1.00 66.77  ? 47   DG  H "C2'" 1 
ATOM   8708 C  "C1'" . DG  H 3 19  ? 44.347  -24.209 48.443  1.00 67.18  ? 47   DG  H "C1'" 1 
ATOM   8709 N  N9    . DG  H 3 19  ? 42.910  -24.245 48.735  1.00 67.45  ? 47   DG  H N9    1 
ATOM   8710 C  C8    . DG  H 3 19  ? 42.125  -23.268 49.299  1.00 67.28  ? 47   DG  H C8    1 
ATOM   8711 N  N7    . DG  H 3 19  ? 40.869  -23.608 49.411  1.00 67.26  ? 47   DG  H N7    1 
ATOM   8712 C  C5    . DG  H 3 19  ? 40.809  -24.891 48.880  1.00 67.51  ? 47   DG  H C5    1 
ATOM   8713 C  C6    . DG  H 3 19  ? 39.715  -25.788 48.723  1.00 67.57  ? 47   DG  H C6    1 
ATOM   8714 O  O6    . DG  H 3 19  ? 38.529  -25.624 49.035  1.00 67.16  ? 47   DG  H O6    1 
ATOM   8715 N  N1    . DG  H 3 19  ? 40.091  -26.997 48.131  1.00 67.97  ? 47   DG  H N1    1 
ATOM   8716 C  C2    . DG  H 3 19  ? 41.376  -27.307 47.735  1.00 68.28  ? 47   DG  H C2    1 
ATOM   8717 N  N2    . DG  H 3 19  ? 41.570  -28.517 47.185  1.00 68.34  ? 47   DG  H N2    1 
ATOM   8718 N  N3    . DG  H 3 19  ? 42.407  -26.477 47.881  1.00 68.26  ? 47   DG  H N3    1 
ATOM   8719 C  C4    . DG  H 3 19  ? 42.058  -25.292 48.455  1.00 67.73  ? 47   DG  H C4    1 
ATOM   8720 P  P     . DT  H 3 20  ? 47.678  -23.995 45.948  1.00 63.98  ? 48   DT  H P     1 
ATOM   8721 O  OP1   . DT  H 3 20  ? 48.214  -24.753 47.105  1.00 63.69  ? 48   DT  H OP1   1 
ATOM   8722 O  OP2   . DT  H 3 20  ? 48.599  -23.528 44.887  1.00 63.60  ? 48   DT  H OP2   1 
ATOM   8723 O  "O5'" . DT  H 3 20  ? 46.562  -24.898 45.240  1.00 62.23  ? 48   DT  H "O5'" 1 
ATOM   8724 C  "C5'" . DT  H 3 20  ? 46.955  -26.197 44.786  1.00 59.55  ? 48   DT  H "C5'" 1 
ATOM   8725 C  "C4'" . DT  H 3 20  ? 45.800  -27.019 44.245  1.00 57.27  ? 48   DT  H "C4'" 1 
ATOM   8726 O  "O4'" . DT  H 3 20  ? 44.557  -26.663 44.904  1.00 57.18  ? 48   DT  H "O4'" 1 
ATOM   8727 C  "C3'" . DT  H 3 20  ? 45.572  -26.869 42.745  1.00 55.53  ? 48   DT  H "C3'" 1 
ATOM   8728 O  "O3'" . DT  H 3 20  ? 45.658  -28.167 42.139  1.00 52.52  ? 48   DT  H "O3'" 1 
ATOM   8729 C  "C2'" . DT  H 3 20  ? 44.193  -26.213 42.657  1.00 56.22  ? 48   DT  H "C2'" 1 
ATOM   8730 C  "C1'" . DT  H 3 20  ? 43.528  -26.690 43.941  1.00 57.00  ? 48   DT  H "C1'" 1 
ATOM   8731 N  N1    . DT  H 3 20  ? 42.387  -25.831 44.407  1.00 57.45  ? 48   DT  H N1    1 
ATOM   8732 C  C2    . DT  H 3 20  ? 41.151  -26.408 44.681  1.00 57.56  ? 48   DT  H C2    1 
ATOM   8733 O  O2    . DT  H 3 20  ? 40.899  -27.599 44.577  1.00 57.38  ? 48   DT  H O2    1 
ATOM   8734 N  N3    . DT  H 3 20  ? 40.191  -25.518 45.102  1.00 57.65  ? 48   DT  H N3    1 
ATOM   8735 C  C4    . DT  H 3 20  ? 40.335  -24.147 45.267  1.00 57.76  ? 48   DT  H C4    1 
ATOM   8736 O  O4    . DT  H 3 20  ? 39.402  -23.450 45.645  1.00 57.63  ? 48   DT  H O4    1 
ATOM   8737 C  C5    . DT  H 3 20  ? 41.643  -23.604 44.963  1.00 57.87  ? 48   DT  H C5    1 
ATOM   8738 C  C7    . DT  H 3 20  ? 41.923  -22.131 45.100  1.00 57.86  ? 48   DT  H C7    1 
ATOM   8739 C  C6    . DT  H 3 20  ? 42.591  -24.464 44.553  1.00 57.69  ? 48   DT  H C6    1 
ATOM   8740 P  P     . DA  H 3 21  ? 44.906  -28.579 40.782  1.00 50.46  ? 49   DA  H P     1 
ATOM   8741 O  OP1   . DA  H 3 21  ? 45.665  -29.686 40.158  1.00 50.60  ? 49   DA  H OP1   1 
ATOM   8742 O  OP2   . DA  H 3 21  ? 44.629  -27.364 39.971  1.00 50.06  ? 49   DA  H OP2   1 
ATOM   8743 O  "O5'" . DA  H 3 21  ? 43.545  -29.173 41.387  1.00 48.06  ? 49   DA  H "O5'" 1 
ATOM   8744 C  "C5'" . DA  H 3 21  ? 42.916  -30.334 40.835  1.00 43.98  ? 49   DA  H "C5'" 1 
ATOM   8745 C  "C4'" . DA  H 3 21  ? 41.583  -29.968 40.201  1.00 40.62  ? 49   DA  H "C4'" 1 
ATOM   8746 O  "O4'" . DA  H 3 21  ? 40.873  -29.013 41.037  1.00 39.85  ? 49   DA  H "O4'" 1 
ATOM   8747 C  "C3'" . DA  H 3 21  ? 41.673  -29.314 38.825  1.00 38.82  ? 49   DA  H "C3'" 1 
ATOM   8748 O  "O3'" . DA  H 3 21  ? 40.545  -29.658 38.052  1.00 36.73  ? 49   DA  H "O3'" 1 
ATOM   8749 C  "C2'" . DA  H 3 21  ? 41.551  -27.840 39.173  1.00 38.74  ? 49   DA  H "C2'" 1 
ATOM   8750 C  "C1'" . DA  H 3 21  ? 40.436  -27.963 40.203  1.00 38.79  ? 49   DA  H "C1'" 1 
ATOM   8751 N  N9    . DA  H 3 21  ? 40.123  -26.738 40.939  1.00 38.28  ? 49   DA  H N9    1 
ATOM   8752 C  C8    . DA  H 3 21  ? 40.976  -25.715 41.258  1.00 37.91  ? 49   DA  H C8    1 
ATOM   8753 N  N7    . DA  H 3 21  ? 40.401  -24.731 41.906  1.00 37.78  ? 49   DA  H N7    1 
ATOM   8754 C  C5    . DA  H 3 21  ? 39.079  -25.131 42.014  1.00 37.80  ? 49   DA  H C5    1 
ATOM   8755 C  C6    . DA  H 3 21  ? 37.943  -24.529 42.595  1.00 37.72  ? 49   DA  H C6    1 
ATOM   8756 N  N6    . DA  H 3 21  ? 37.996  -23.341 43.200  1.00 37.94  ? 49   DA  H N6    1 
ATOM   8757 N  N1    . DA  H 3 21  ? 36.759  -25.184 42.533  1.00 37.65  ? 49   DA  H N1    1 
ATOM   8758 C  C2    . DA  H 3 21  ? 36.720  -26.378 41.930  1.00 37.69  ? 49   DA  H C2    1 
ATOM   8759 N  N3    . DA  H 3 21  ? 37.721  -27.043 41.345  1.00 37.85  ? 49   DA  H N3    1 
ATOM   8760 C  C4    . DA  H 3 21  ? 38.886  -26.366 41.424  1.00 37.96  ? 49   DA  H C4    1 
ATOM   8761 P  P     . DC  H 3 22  ? 40.442  -30.981 37.170  1.00 34.85  ? 50   DC  H P     1 
ATOM   8762 O  OP1   . DC  H 3 22  ? 40.854  -32.138 38.002  1.00 34.58  ? 50   DC  H OP1   1 
ATOM   8763 O  OP2   . DC  H 3 22  ? 41.103  -30.693 35.878  1.00 34.23  ? 50   DC  H OP2   1 
ATOM   8764 O  "O5'" . DC  H 3 22  ? 38.857  -31.071 36.911  1.00 33.70  ? 50   DC  H "O5'" 1 
ATOM   8765 C  "C5'" . DC  H 3 22  ? 37.912  -31.165 38.010  1.00 31.16  ? 50   DC  H "C5'" 1 
ATOM   8766 C  "C4'" . DC  H 3 22  ? 36.642  -30.327 37.824  1.00 28.52  ? 50   DC  H "C4'" 1 
ATOM   8767 O  "O4'" . DC  H 3 22  ? 36.689  -29.100 38.611  1.00 27.52  ? 50   DC  H "O4'" 1 
ATOM   8768 C  "C3'" . DC  H 3 22  ? 36.336  -29.907 36.385  1.00 27.28  ? 50   DC  H "C3'" 1 
ATOM   8769 O  "O3'" . DC  H 3 22  ? 34.996  -30.290 36.049  1.00 25.58  ? 50   DC  H "O3'" 1 
ATOM   8770 C  "C2'" . DC  H 3 22  ? 36.544  -28.394 36.413  1.00 27.13  ? 50   DC  H "C2'" 1 
ATOM   8771 C  "C1'" . DC  H 3 22  ? 36.107  -28.074 37.835  1.00 27.08  ? 50   DC  H "C1'" 1 
ATOM   8772 N  N1    . DC  H 3 22  ? 36.489  -26.693 38.312  1.00 26.70  ? 50   DC  H N1    1 
ATOM   8773 C  C2    . DC  H 3 22  ? 35.503  -25.860 38.891  1.00 26.69  ? 50   DC  H C2    1 
ATOM   8774 O  O2    . DC  H 3 22  ? 34.332  -26.249 39.023  1.00 26.77  ? 50   DC  H O2    1 
ATOM   8775 N  N3    . DC  H 3 22  ? 35.852  -24.615 39.303  1.00 26.47  ? 50   DC  H N3    1 
ATOM   8776 C  C4    . DC  H 3 22  ? 37.110  -24.193 39.164  1.00 26.26  ? 50   DC  H C4    1 
ATOM   8777 N  N4    . DC  H 3 22  ? 37.374  -22.960 39.599  1.00 26.02  ? 50   DC  H N4    1 
ATOM   8778 C  C5    . DC  H 3 22  ? 38.130  -25.010 38.572  1.00 26.10  ? 50   DC  H C5    1 
ATOM   8779 C  C6    . DC  H 3 22  ? 37.778  -26.240 38.163  1.00 26.21  ? 50   DC  H C6    1 
ATOM   8780 P  P     . DA  H 3 23  ? 34.327  -30.017 34.612  1.00 23.77  ? 51   DA  H P     1 
ATOM   8781 O  OP1   . DA  H 3 23  ? 33.669  -31.258 34.156  1.00 23.83  ? 51   DA  H OP1   1 
ATOM   8782 O  OP2   . DA  H 3 23  ? 35.279  -29.319 33.722  1.00 23.63  ? 51   DA  H OP2   1 
ATOM   8783 O  "O5'" . DA  H 3 23  ? 33.177  -28.995 35.008  1.00 22.48  ? 51   DA  H "O5'" 1 
ATOM   8784 C  "C5'" . DA  H 3 23  ? 32.285  -29.316 36.071  1.00 20.26  ? 51   DA  H "C5'" 1 
ATOM   8785 C  "C4'" . DA  H 3 23  ? 31.353  -28.143 36.259  1.00 18.32  ? 51   DA  H "C4'" 1 
ATOM   8786 O  "O4'" . DA  H 3 23  ? 32.093  -27.092 36.921  1.00 18.20  ? 51   DA  H "O4'" 1 
ATOM   8787 C  "C3'" . DA  H 3 23  ? 30.871  -27.567 34.937  1.00 16.21  ? 51   DA  H "C3'" 1 
ATOM   8788 O  "O3'" . DA  H 3 23  ? 29.500  -27.831 34.784  1.00 12.93  ? 51   DA  H "O3'" 1 
ATOM   8789 C  "C2'" . DA  H 3 23  ? 31.167  -26.070 35.009  1.00 17.04  ? 51   DA  H "C2'" 1 
ATOM   8790 C  "C1'" . DA  H 3 23  ? 31.691  -25.842 36.416  1.00 17.81  ? 51   DA  H "C1'" 1 
ATOM   8791 N  N9    . DA  H 3 23  ? 32.851  -24.960 36.475  1.00 18.09  ? 51   DA  H N9    1 
ATOM   8792 C  C8    . DA  H 3 23  ? 34.130  -25.222 36.065  1.00 18.12  ? 51   DA  H C8    1 
ATOM   8793 N  N7    . DA  H 3 23  ? 34.961  -24.224 36.253  1.00 18.30  ? 51   DA  H N7    1 
ATOM   8794 C  C5    . DA  H 3 23  ? 34.168  -23.244 36.824  1.00 18.64  ? 51   DA  H C5    1 
ATOM   8795 C  C6    . DA  H 3 23  ? 34.438  -21.933 37.270  1.00 19.00  ? 51   DA  H C6    1 
ATOM   8796 N  N6    . DA  H 3 23  ? 35.644  -21.363 37.203  1.00 19.18  ? 51   DA  H N6    1 
ATOM   8797 N  N1    . DA  H 3 23  ? 33.410  -21.222 37.787  1.00 19.12  ? 51   DA  H N1    1 
ATOM   8798 C  C2    . DA  H 3 23  ? 32.190  -21.777 37.855  1.00 18.93  ? 51   DA  H C2    1 
ATOM   8799 N  N3    . DA  H 3 23  ? 31.817  -22.997 37.471  1.00 18.69  ? 51   DA  H N3    1 
ATOM   8800 C  C4    . DA  H 3 23  ? 32.862  -23.680 36.964  1.00 18.45  ? 51   DA  H C4    1 
ATOM   8801 P  P     . DC  H 3 24  ? 28.722  -27.126 33.588  1.00 11.08  ? 52   DC  H P     1 
ATOM   8802 O  OP1   . DC  H 3 24  ? 27.423  -27.812 33.429  1.00 11.31  ? 52   DC  H OP1   1 
ATOM   8803 O  OP2   . DC  H 3 24  ? 29.625  -27.029 32.419  1.00 10.74  ? 52   DC  H OP2   1 
ATOM   8804 O  "O5'" . DC  H 3 24  ? 28.492  -25.668 34.201  1.00 8.96   ? 52   DC  H "O5'" 1 
ATOM   8805 C  "C5'" . DC  H 3 24  ? 27.210  -25.082 34.244  1.00 6.85   ? 52   DC  H "C5'" 1 
ATOM   8806 C  "C4'" . DC  H 3 24  ? 27.412  -23.610 34.016  1.00 5.66   ? 52   DC  H "C4'" 1 
ATOM   8807 O  "O4'" . DC  H 3 24  ? 28.740  -23.345 34.496  1.00 4.82   ? 52   DC  H "O4'" 1 
ATOM   8808 C  "C3'" . DC  H 3 24  ? 27.491  -23.193 32.555  1.00 5.46   ? 52   DC  H "C3'" 1 
ATOM   8809 O  "O3'" . DC  H 3 24  ? 26.198  -22.909 31.964  1.00 5.79   ? 52   DC  H "O3'" 1 
ATOM   8810 C  "C2'" . DC  H 3 24  ? 28.410  -21.984 32.622  1.00 5.39   ? 52   DC  H "C2'" 1 
ATOM   8811 C  "C1'" . DC  H 3 24  ? 29.129  -22.113 33.954  1.00 5.63   ? 52   DC  H "C1'" 1 
ATOM   8812 N  N1    . DC  H 3 24  ? 30.618  -22.034 33.838  1.00 6.92   ? 52   DC  H N1    1 
ATOM   8813 C  C2    . DC  H 3 24  ? 31.291  -20.952 34.423  1.00 7.75   ? 52   DC  H C2    1 
ATOM   8814 O  O2    . DC  H 3 24  ? 30.622  -20.109 35.017  1.00 8.92   ? 52   DC  H O2    1 
ATOM   8815 N  N3    . DC  H 3 24  ? 32.644  -20.844 34.333  1.00 7.94   ? 52   DC  H N3    1 
ATOM   8816 C  C4    . DC  H 3 24  ? 33.336  -21.778 33.679  1.00 8.53   ? 52   DC  H C4    1 
ATOM   8817 N  N4    . DC  H 3 24  ? 34.667  -21.645 33.605  1.00 8.17   ? 52   DC  H N4    1 
ATOM   8818 C  C5    . DC  H 3 24  ? 32.674  -22.893 33.067  1.00 8.97   ? 52   DC  H C5    1 
ATOM   8819 C  C6    . DC  H 3 24  ? 31.333  -22.983 33.166  1.00 8.06   ? 52   DC  H C6    1 
ATOM   8820 P  P     . DC  H 3 25  ? 25.482  -21.475 31.870  1.00 5.87   ? 53   DC  H P     1 
ATOM   8821 O  OP1   . DC  H 3 25  ? 25.500  -20.847 33.190  1.00 6.31   ? 53   DC  H OP1   1 
ATOM   8822 O  OP2   . DC  H 3 25  ? 24.210  -21.639 31.145  1.00 6.39   ? 53   DC  H OP2   1 
ATOM   8823 O  "O5'" . DC  H 3 25  ? 26.410  -20.569 30.969  1.00 10.00  ? 53   DC  H "O5'" 1 
ATOM   8824 C  "C5'" . DC  H 3 25  ? 25.963  -19.258 30.682  1.00 15.59  ? 53   DC  H "C5'" 1 
ATOM   8825 C  "C4'" . DC  H 3 25  ? 26.519  -18.227 31.645  1.00 19.45  ? 53   DC  H "C4'" 1 
ATOM   8826 O  "O4'" . DC  H 3 25  ? 27.645  -18.789 32.350  1.00 19.80  ? 53   DC  H "O4'" 1 
ATOM   8827 C  "C3'" . DC  H 3 25  ? 27.029  -16.983 30.940  1.00 23.07  ? 53   DC  H "C3'" 1 
ATOM   8828 O  "O3'" . DC  H 3 25  ? 26.068  -15.948 31.111  1.00 28.92  ? 53   DC  H "O3'" 1 
ATOM   8829 C  "C2'" . DC  H 3 25  ? 28.381  -16.649 31.582  1.00 21.62  ? 53   DC  H "C2'" 1 
ATOM   8830 C  "C1'" . DC  H 3 25  ? 28.773  -17.932 32.297  1.00 20.20  ? 53   DC  H "C1'" 1 
ATOM   8831 N  N1    . DC  H 3 25  ? 29.958  -18.693 31.754  1.00 19.57  ? 53   DC  H N1    1 
ATOM   8832 C  C2    . DC  H 3 25  ? 31.238  -18.320 32.142  1.00 19.52  ? 53   DC  H C2    1 
ATOM   8833 O  O2    . DC  H 3 25  ? 31.342  -17.351 32.889  1.00 20.53  ? 53   DC  H O2    1 
ATOM   8834 N  N3    . DC  H 3 25  ? 32.323  -19.011 31.692  1.00 19.16  ? 53   DC  H N3    1 
ATOM   8835 C  C4    . DC  H 3 25  ? 32.169  -20.058 30.879  1.00 18.98  ? 53   DC  H C4    1 
ATOM   8836 N  N4    . DC  H 3 25  ? 33.251  -20.719 30.448  1.00 18.31  ? 53   DC  H N4    1 
ATOM   8837 C  C5    . DC  H 3 25  ? 30.867  -20.467 30.474  1.00 19.55  ? 53   DC  H C5    1 
ATOM   8838 C  C6    . DC  H 3 25  ? 29.813  -19.769 30.930  1.00 19.76  ? 53   DC  H C6    1 
ATOM   8839 P  P     . DT  H 3 26  ? 25.701  -14.915 29.930  1.00 34.74  ? 54   DT  H P     1 
ATOM   8840 O  OP1   . DT  H 3 26  ? 24.714  -14.054 30.636  1.00 34.81  ? 54   DT  H OP1   1 
ATOM   8841 O  OP2   . DT  H 3 26  ? 25.332  -15.637 28.680  1.00 34.53  ? 54   DT  H OP2   1 
ATOM   8842 O  "O5'" . DT  H 3 26  ? 27.035  -14.055 29.603  1.00 37.08  ? 54   DT  H "O5'" 1 
ATOM   8843 C  "C5'" . DT  H 3 26  ? 27.814  -14.151 28.383  1.00 40.06  ? 54   DT  H "C5'" 1 
ATOM   8844 C  "C4'" . DT  H 3 26  ? 29.288  -14.445 28.660  1.00 43.06  ? 54   DT  H "C4'" 1 
ATOM   8845 O  "O4'" . DT  H 3 26  ? 29.486  -15.881 28.706  1.00 44.36  ? 54   DT  H "O4'" 1 
ATOM   8846 C  "C3'" . DT  H 3 26  ? 30.307  -13.935 27.642  1.00 44.38  ? 54   DT  H "C3'" 1 
ATOM   8847 O  "O3'" . DT  H 3 26  ? 31.262  -13.081 28.251  1.00 45.84  ? 54   DT  H "O3'" 1 
ATOM   8848 C  "C2'" . DT  H 3 26  ? 31.027  -15.180 27.126  1.00 44.70  ? 54   DT  H "C2'" 1 
ATOM   8849 C  "C1'" . DT  H 3 26  ? 30.757  -16.226 28.194  1.00 44.65  ? 54   DT  H "C1'" 1 
ATOM   8850 N  N1    . DT  H 3 26  ? 30.719  -17.629 27.639  1.00 44.93  ? 54   DT  H N1    1 
ATOM   8851 C  C2    . DT  H 3 26  ? 31.891  -18.350 27.484  1.00 44.69  ? 54   DT  H C2    1 
ATOM   8852 O  O2    . DT  H 3 26  ? 32.993  -17.926 27.770  1.00 44.47  ? 54   DT  H O2    1 
ATOM   8853 N  N3    . DT  H 3 26  ? 31.726  -19.611 26.965  1.00 44.87  ? 54   DT  H N3    1 
ATOM   8854 C  C4    . DT  H 3 26  ? 30.536  -20.213 26.588  1.00 45.32  ? 54   DT  H C4    1 
ATOM   8855 O  O4    . DT  H 3 26  ? 30.515  -21.351 26.133  1.00 45.61  ? 54   DT  H O4    1 
ATOM   8856 C  C5    . DT  H 3 26  ? 29.343  -19.411 26.773  1.00 45.40  ? 54   DT  H C5    1 
ATOM   8857 C  C7    . DT  H 3 26  ? 27.978  -19.929 26.420  1.00 45.12  ? 54   DT  H C7    1 
ATOM   8858 C  C6    . DT  H 3 26  ? 29.496  -18.178 27.278  1.00 45.36  ? 54   DT  H C6    1 
ATOM   8859 P  P     . DG  H 3 27  ? 31.737  -11.730 27.536  1.00 47.49  ? 55   DG  H P     1 
ATOM   8860 O  OP1   . DG  H 3 27  ? 31.826  -10.739 28.620  1.00 47.91  ? 55   DG  H OP1   1 
ATOM   8861 O  OP2   . DG  H 3 27  ? 30.873  -11.429 26.372  1.00 47.38  ? 55   DG  H OP2   1 
ATOM   8862 O  "O5'" . DG  H 3 27  ? 33.223  -12.034 27.011  1.00 49.16  ? 55   DG  H "O5'" 1 
ATOM   8863 C  "C5'" . DG  H 3 27  ? 33.511  -13.190 26.244  1.00 51.85  ? 55   DG  H "C5'" 1 
ATOM   8864 C  "C4'" . DG  H 3 27  ? 34.188  -12.922 24.907  1.00 54.24  ? 55   DG  H "C4'" 1 
ATOM   8865 O  "O4'" . DG  H 3 27  ? 33.853  -14.002 24.009  1.00 54.46  ? 55   DG  H "O4'" 1 
ATOM   8866 C  "C3'" . DG  H 3 27  ? 33.907  -11.641 24.123  1.00 56.51  ? 55   DG  H "C3'" 1 
ATOM   8867 O  "O3'" . DG  H 3 27  ? 35.137  -11.261 23.467  1.00 60.40  ? 55   DG  H "O3'" 1 
ATOM   8868 C  "C2'" . DG  H 3 27  ? 32.798  -12.051 23.145  1.00 55.42  ? 55   DG  H "C2'" 1 
ATOM   8869 C  "C1'" . DG  H 3 27  ? 33.024  -13.556 22.944  1.00 54.31  ? 55   DG  H "C1'" 1 
ATOM   8870 N  N9    . DG  H 3 27  ? 31.827  -14.421 22.900  1.00 52.91  ? 55   DG  H N9    1 
ATOM   8871 C  C8    . DG  H 3 27  ? 30.572  -14.099 22.438  1.00 52.41  ? 55   DG  H C8    1 
ATOM   8872 N  N7    . DG  H 3 27  ? 29.715  -15.078 22.520  1.00 51.71  ? 55   DG  H N7    1 
ATOM   8873 C  C5    . DG  H 3 27  ? 30.437  -16.126 23.067  1.00 51.12  ? 55   DG  H C5    1 
ATOM   8874 C  C6    . DG  H 3 27  ? 30.041  -17.446 23.390  1.00 50.68  ? 55   DG  H C6    1 
ATOM   8875 O  O6    . DG  H 3 27  ? 28.930  -17.963 23.251  1.00 50.54  ? 55   DG  H O6    1 
ATOM   8876 N  N1    . DG  H 3 27  ? 31.077  -18.205 23.926  1.00 50.69  ? 55   DG  H N1    1 
ATOM   8877 C  C2    . DG  H 3 27  ? 32.351  -17.732 24.128  1.00 51.17  ? 55   DG  H C2    1 
ATOM   8878 N  N2    . DG  H 3 27  ? 33.245  -18.581 24.652  1.00 51.25  ? 55   DG  H N2    1 
ATOM   8879 N  N3    . DG  H 3 27  ? 32.730  -16.497 23.832  1.00 51.58  ? 55   DG  H N3    1 
ATOM   8880 C  C4    . DG  H 3 27  ? 31.734  -15.742 23.304  1.00 51.78  ? 55   DG  H C4    1 
ATOM   8881 P  P     . DA  H 3 28  ? 35.520  -9.761  23.017  1.00 63.78  ? 56   DA  H P     1 
ATOM   8882 O  OP1   . DA  H 3 28  ? 35.145  -8.814  24.093  1.00 63.76  ? 56   DA  H OP1   1 
ATOM   8883 O  OP2   . DA  H 3 28  ? 34.950  -9.583  21.656  1.00 63.23  ? 56   DA  H OP2   1 
ATOM   8884 O  "O5'" . DA  H 3 28  ? 37.140  -9.774  22.974  1.00 65.87  ? 56   DA  H "O5'" 1 
ATOM   8885 C  "C5'" . DA  H 3 28  ? 37.943  -8.574  22.724  1.00 69.13  ? 56   DA  H "C5'" 1 
ATOM   8886 C  "C4'" . DA  H 3 28  ? 39.452  -8.794  22.504  1.00 71.11  ? 56   DA  H "C4'" 1 
ATOM   8887 O  "O4'" . DA  H 3 28  ? 39.811  -10.180 22.790  1.00 72.23  ? 56   DA  H "O4'" 1 
ATOM   8888 C  "C3'" . DA  H 3 28  ? 39.987  -8.505  21.082  1.00 71.51  ? 56   DA  H "C3'" 1 
ATOM   8889 O  "O3'" . DA  H 3 28  ? 40.664  -7.259  20.931  1.00 70.82  ? 56   DA  H "O3'" 1 
ATOM   8890 C  "C2'" . DA  H 3 28  ? 40.965  -9.649  20.829  1.00 72.36  ? 56   DA  H "C2'" 1 
ATOM   8891 C  "C1'" . DA  H 3 28  ? 40.281  -10.785 21.590  1.00 73.31  ? 56   DA  H "C1'" 1 
ATOM   8892 N  N9    . DA  H 3 28  ? 39.190  -11.459 20.844  1.00 74.18  ? 56   DA  H N9    1 
ATOM   8893 C  C8    . DA  H 3 28  ? 38.317  -10.899 19.939  1.00 73.82  ? 56   DA  H C8    1 
ATOM   8894 N  N7    . DA  H 3 28  ? 37.450  -11.738 19.431  1.00 74.10  ? 56   DA  H N7    1 
ATOM   8895 C  C5    . DA  H 3 28  ? 37.764  -12.947 20.027  1.00 74.42  ? 56   DA  H C5    1 
ATOM   8896 C  C6    . DA  H 3 28  ? 37.207  -14.243 19.904  1.00 74.51  ? 56   DA  H C6    1 
ATOM   8897 N  N6    . DA  H 3 28  ? 36.173  -14.536 19.102  1.00 74.36  ? 56   DA  H N6    1 
ATOM   8898 N  N1    . DA  H 3 28  ? 37.761  -15.232 20.645  1.00 74.82  ? 56   DA  H N1    1 
ATOM   8899 C  C2    . DA  H 3 28  ? 38.800  -14.953 21.455  1.00 75.07  ? 56   DA  H C2    1 
ATOM   8900 N  N3    . DA  H 3 28  ? 39.404  -13.776 21.655  1.00 75.10  ? 56   DA  H N3    1 
ATOM   8901 C  C4    . DA  H 3 28  ? 38.837  -12.800 20.903  1.00 74.66  ? 56   DA  H C4    1 
HETATM 8902 MN MN    . MN  I 4 .   ? 53.256  -4.782  22.328  1.00 89.19  ? 1001 MN  A MN    1 
HETATM 8903 S  S     . SO4 J 5 .   ? 45.801  -28.580 -21.890 1.00 130.27 ? 346  SO4 B S     1 
HETATM 8904 O  O1    . SO4 J 5 .   ? 47.177  -29.066 -21.928 1.00 130.49 ? 346  SO4 B O1    1 
HETATM 8905 O  O2    . SO4 J 5 .   ? 44.928  -29.637 -21.379 1.00 129.78 ? 346  SO4 B O2    1 
HETATM 8906 O  O3    . SO4 J 5 .   ? 45.747  -27.413 -21.012 1.00 130.07 ? 346  SO4 B O3    1 
HETATM 8907 O  O4    . SO4 J 5 .   ? 45.384  -28.200 -23.240 1.00 129.98 ? 346  SO4 B O4    1 
HETATM 8908 S  S     . SO4 K 5 .   ? 5.008   5.115   -10.301 1.00 123.74 ? 1    SO4 D S     1 
HETATM 8909 O  O1    . SO4 K 5 .   ? 5.201   6.388   -10.996 1.00 123.32 ? 1    SO4 D O1    1 
HETATM 8910 O  O2    . SO4 K 5 .   ? 5.959   4.125   -10.812 1.00 123.49 ? 1    SO4 D O2    1 
HETATM 8911 O  O3    . SO4 K 5 .   ? 5.214   5.335   -8.870  1.00 124.02 ? 1    SO4 D O3    1 
HETATM 8912 O  O4    . SO4 K 5 .   ? 3.647   4.616   -10.497 1.00 123.66 ? 1    SO4 D O4    1 
HETATM 8913 O  O     . HOH L 6 .   ? 33.711  -14.261 12.288  1.00 31.80  ? 346  HOH A O     1 
HETATM 8914 O  O     . HOH M 6 .   ? 35.076  -7.598  11.718  1.00 22.94  ? 347  HOH B O     1 
HETATM 8915 O  O     . HOH M 6 .   ? -2.314  -17.606 24.689  1.00 22.23  ? 348  HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   PHE 4   4   ?   ?   ?   A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  CYS 18  18  18  CYS CYS A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  HIS 29  29  29  HIS HIS A . n 
A 1 30  ARG 30  30  30  ARG ARG A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  THR 45  45  45  THR THR A . n 
A 1 46  CYS 46  46  46  CYS CYS A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  TRP 49  49  49  TRP TRP A . n 
A 1 50  PHE 50  50  50  PHE PHE A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  HIS 65  65  65  HIS HIS A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  GLN 78  78  78  GLN GLN A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  GLN 87  87  87  GLN GLN A . n 
A 1 88  THR 88  88  88  THR THR A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 SER 104 104 104 SER SER A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 MET 110 110 110 MET MET A . n 
A 1 111 GLY 111 111 111 GLY GLY A . n 
A 1 112 LYS 112 112 112 LYS LYS A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 TRP 119 119 119 TRP TRP A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 HIS 122 122 122 HIS HIS A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 MET 129 129 129 MET MET A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 CYS 136 136 136 CYS CYS A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 LYS 144 144 144 LYS LYS A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 GLU 157 157 157 GLU GLU A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 TRP 159 159 159 TRP TRP A . n 
A 1 160 ILE 160 160 160 ILE ILE A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 VAL 163 163 163 VAL VAL A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 THR 181 181 181 THR THR A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 ARG 183 183 183 ARG ARG A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 LYS 189 189 189 LYS LYS A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 CYS 194 194 194 CYS CYS A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 TRP 196 196 196 TRP TRP A . n 
A 1 197 TRP 197 197 197 TRP TRP A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 GLN 199 199 199 GLN GLN A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 TYR 205 205 205 TYR TYR A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 PRO 210 210 210 PRO PRO A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 ARG 218 218 218 ARG ARG A . n 
A 1 219 TYR 219 219 219 TYR TYR A . n 
A 1 220 GLN 220 220 220 GLN GLN A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LEU 223 223 223 LEU LEU A . n 
A 1 224 ILE 224 224 224 ILE ILE A . n 
A 1 225 ASN 225 225 225 ASN ASN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 ASN 227 227 227 ASN ASN A . n 
A 1 228 ARG 228 228 228 ARG ARG A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 GLN 231 231 231 GLN GLN A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 GLN 238 238 ?   ?   ?   A . n 
A 1 239 LYS 239 239 ?   ?   ?   A . n 
A 1 240 ARG 240 240 ?   ?   ?   A . n 
A 1 241 GLN 241 241 241 GLN GLN A . n 
A 1 242 HIS 242 242 242 HIS HIS A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 PHE 246 246 246 PHE PHE A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 ALA 251 251 251 ALA ALA A . n 
A 1 252 PRO 252 252 252 PRO PRO A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 HIS 254 254 254 HIS HIS A . n 
A 1 255 THR 255 255 255 THR THR A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 ALA 258 258 258 ALA ALA A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ARG 260 260 260 ARG ARG A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 THR 262 262 262 THR THR A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ASN 267 267 267 ASN ASN A . n 
A 1 268 TRP 268 268 268 TRP TRP A . n 
A 1 269 GLU 269 269 269 GLU GLU A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 TYR 276 276 276 TYR TYR A . n 
A 1 277 SER 277 277 277 SER SER A . n 
A 1 278 PRO 278 278 278 PRO PRO A . n 
A 1 279 ASP 279 279 279 ASP ASP A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 PRO 282 282 282 PRO PRO A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 TYR 285 285 285 TYR TYR A . n 
A 1 286 HIS 286 286 286 HIS HIS A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ALA 289 289 289 ALA ALA A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 MET 291 291 291 MET MET A . n 
A 1 292 GLY 292 292 292 GLY GLY A . n 
A 1 293 HIS 293 293 293 HIS HIS A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 ARG 299 299 299 ARG ARG A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 TYR 303 303 303 TYR TYR A . n 
A 1 304 GLU 304 304 304 GLU GLU A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 LYS 307 307 307 LYS LYS A . n 
A 1 308 LYS 308 308 308 LYS LYS A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 TRP 313 313 313 TRP TRP A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 ALA 316 316 316 ALA ALA A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 ASP 318 318 318 ASP ASP A . n 
A 1 319 ASP 319 319 319 ASP ASP A . n 
A 1 320 GLU 320 320 320 GLU GLU A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 TYR 322 322 322 TYR TYR A . n 
A 1 323 TRP 323 323 323 TRP TRP A . n 
A 1 324 ARG 324 324 324 ARG ARG A . n 
A 1 325 GLY 325 325 325 GLY GLY A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 HIS 327 327 327 HIS HIS A . n 
A 1 328 LYS 328 328 328 LYS LYS A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 PRO 330 330 330 PRO PRO A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 ARG 332 332 332 ARG ARG A . n 
A 1 333 TRP 333 333 333 TRP TRP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 LYS 335 335 335 LYS LYS A . n 
A 1 336 CYS 336 336 336 CYS CYS A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 ALA 338 338 338 ALA ALA A . n 
A 1 339 SER 339 339 339 SER SER A . n 
A 1 340 ASP 340 340 340 ASP ASP A . n 
A 1 341 GLY 341 341 341 GLY GLY A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 TYR 343 343 343 TYR TYR A . n 
A 1 344 PHE 344 344 344 PHE PHE A . n 
A 1 345 GLU 345 345 345 GLU GLU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   ?   ?   ?   B . n 
B 1 4   PHE 4   4   ?   ?   ?   B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   ASN 7   7   7   ASN ASN B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   GLU 9   9   9   GLU GLU B . n 
B 1 10  GLN 10  10  10  GLN GLN B . n 
B 1 11  THR 11  11  11  THR THR B . n 
B 1 12  ARG 12  12  12  ARG ARG B . n 
B 1 13  THR 13  13  13  THR THR B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  LEU 15  15  15  LEU LEU B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  PHE 17  17  17  PHE PHE B . n 
B 1 18  CYS 18  18  18  CYS CYS B . n 
B 1 19  PHE 19  19  19  PHE PHE B . n 
B 1 20  HIS 20  20  20  HIS HIS B . n 
B 1 21  LEU 21  21  21  LEU LEU B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  ALA 26  26  26  ALA ALA B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  HIS 29  29  29  HIS HIS B . n 
B 1 30  ARG 30  30  30  ARG ARG B . n 
B 1 31  MET 31  31  31  MET MET B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  PHE 36  36  36  PHE PHE B . n 
B 1 37  GLY 37  37  37  GLY GLY B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  GLN 39  39  39  GLN GLN B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  THR 42  42  42  THR THR B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  THR 45  45  45  THR THR B . n 
B 1 46  CYS 46  46  46  CYS CYS B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  ARG 48  48  48  ARG ARG B . n 
B 1 49  TRP 49  49  49  TRP TRP B . n 
B 1 50  PHE 50  50  50  PHE PHE B . n 
B 1 51  GLN 51  51  51  GLN GLN B . n 
B 1 52  ARG 52  52  52  ARG ARG B . n 
B 1 53  PHE 53  53  53  PHE PHE B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  PHE 58  58  58  PHE PHE B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ASP 62  62  62  ASP ASP B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  HIS 65  65  65  HIS HIS B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  LYS 67  67  67  LYS LYS B . n 
B 1 68  PRO 68  68  68  PRO PRO B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  LYS 70  70  70  LYS LYS B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  GLU 76  76  76  GLU GLU B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  GLN 78  78  78  GLN GLN B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  GLU 83  83  83  GLU GLU B . n 
B 1 84  ASP 84  84  84  ASP ASP B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  GLN 87  87  87  GLN GLN B . n 
B 1 88  THR 88  88  88  THR THR B . n 
B 1 89  GLN 89  89  89  GLN GLN B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLN 91  91  91  GLN GLN B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  VAL 98  98  98  VAL VAL B . n 
B 1 99  SER 99  99  99  SER SER B . n 
B 1 100 GLN 100 100 100 GLN GLN B . n 
B 1 101 GLN 101 101 101 GLN GLN B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 SER 104 104 104 SER SER B . n 
B 1 105 ASN 105 105 105 ASN ASN B . n 
B 1 106 ARG 106 106 106 ARG ARG B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 ARG 108 108 108 ARG ARG B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 MET 110 110 110 MET MET B . n 
B 1 111 GLY 111 111 111 GLY GLY B . n 
B 1 112 LYS 112 112 112 LYS LYS B . n 
B 1 113 ILE 113 113 113 ILE ILE B . n 
B 1 114 GLN 114 114 114 GLN GLN B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 VAL 116 116 116 VAL VAL B . n 
B 1 117 GLY 117 117 117 GLY GLY B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 TRP 119 119 119 TRP TRP B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 PRO 121 121 121 PRO PRO B . n 
B 1 122 HIS 122 122 122 HIS HIS B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 LEU 124 124 124 LEU LEU B . n 
B 1 125 ASN 125 125 125 ASN ASN B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 ARG 127 127 127 ARG ARG B . n 
B 1 128 GLN 128 128 128 GLN GLN B . n 
B 1 129 MET 129 129 129 MET MET B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 LYS 133 133 133 LYS LYS B . n 
B 1 134 ASN 134 134 134 ASN ASN B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 CYS 136 136 136 CYS CYS B . n 
B 1 137 GLU 137 137 137 GLU GLU B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 LEU 139 139 139 LEU LEU B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 LYS 144 144 144 LYS LYS B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 LYS 146 146 146 LYS LYS B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 HIS 150 150 150 HIS HIS B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 THR 154 154 154 THR THR B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 ASP 156 156 156 ASP ASP B . n 
B 1 157 GLU 157 157 157 GLU GLU B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 TRP 159 159 159 TRP TRP B . n 
B 1 160 ILE 160 160 160 ILE ILE B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 PHE 162 162 162 PHE PHE B . n 
B 1 163 VAL 163 163 163 VAL VAL B . n 
B 1 164 ASN 164 164 164 ASN ASN B . n 
B 1 165 PRO 165 165 165 PRO PRO B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 ARG 167 167 167 ARG ARG B . n 
B 1 168 LYS 168 168 168 LYS LYS B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 TYR 171 171 171 TYR TYR B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 PRO 174 174 174 PRO PRO B . n 
B 1 175 GLY 175 175 175 GLY GLY B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 PRO 177 177 177 PRO PRO B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 THR 181 181 181 THR THR B . n 
B 1 182 ALA 182 182 182 ALA ALA B . n 
B 1 183 ARG 183 183 183 ARG ARG B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 ARG 186 186 186 ARG ARG B . n 
B 1 187 PHE 187 187 187 PHE PHE B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 LYS 189 189 189 LYS LYS B . n 
B 1 190 LYS 190 190 190 LYS LYS B . n 
B 1 191 THR 191 191 191 THR THR B . n 
B 1 192 MET 192 192 192 MET MET B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 CYS 194 194 194 CYS CYS B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 TRP 196 196 196 TRP TRP B . n 
B 1 197 TRP 197 197 197 TRP TRP B . n 
B 1 198 ASP 198 198 198 ASP ASP B . n 
B 1 199 GLN 199 199 199 GLN GLN B . n 
B 1 200 SER 200 200 200 SER SER B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 TYR 204 204 204 TYR TYR B . n 
B 1 205 TYR 205 205 205 TYR TYR B . n 
B 1 206 GLU 206 206 206 GLU GLU B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 LEU 208 208 208 LEU LEU B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 PRO 210 210 210 PRO PRO B . n 
B 1 211 GLY 211 211 211 GLY GLY B . n 
B 1 212 GLU 212 212 212 GLU GLU B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 VAL 214 214 214 VAL VAL B . n 
B 1 215 ASN 215 215 215 ASN ASN B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 ARG 218 218 218 ARG ARG B . n 
B 1 219 TYR 219 219 219 TYR TYR B . n 
B 1 220 GLN 220 220 220 GLN GLN B . n 
B 1 221 GLN 221 221 221 GLN GLN B . n 
B 1 222 GLN 222 222 222 GLN GLN B . n 
B 1 223 LEU 223 223 223 LEU LEU B . n 
B 1 224 ILE 224 224 224 ILE ILE B . n 
B 1 225 ASN 225 225 225 ASN ASN B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 ASN 227 227 227 ASN ASN B . n 
B 1 228 ARG 228 228 228 ARG ARG B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 GLN 231 231 231 GLN GLN B . n 
B 1 232 ARG 232 232 232 ARG ARG B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 ARG 234 234 234 ARG ARG B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 GLU 236 236 236 GLU GLU B . n 
B 1 237 TYR 237 237 237 TYR TYR B . n 
B 1 238 GLN 238 238 238 GLN GLN B . n 
B 1 239 LYS 239 239 239 LYS LYS B . n 
B 1 240 ARG 240 240 ?   ?   ?   B . n 
B 1 241 GLN 241 241 ?   ?   ?   B . n 
B 1 242 HIS 242 242 ?   ?   ?   B . n 
B 1 243 ARG 243 243 243 ARG ARG B . n 
B 1 244 VAL 244 244 244 VAL VAL B . n 
B 1 245 ILE 245 245 245 ILE ILE B . n 
B 1 246 PHE 246 246 246 PHE PHE B . n 
B 1 247 LEU 247 247 247 LEU LEU B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 ASP 249 249 249 ASP ASP B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 ALA 251 251 251 ALA ALA B . n 
B 1 252 PRO 252 252 252 PRO PRO B . n 
B 1 253 SER 253 253 253 SER SER B . n 
B 1 254 HIS 254 254 254 HIS HIS B . n 
B 1 255 THR 255 255 255 THR THR B . n 
B 1 256 ALA 256 256 256 ALA ALA B . n 
B 1 257 ARG 257 257 257 ARG ARG B . n 
B 1 258 ALA 258 258 258 ALA ALA B . n 
B 1 259 VAL 259 259 259 VAL VAL B . n 
B 1 260 ARG 260 260 260 ARG ARG B . n 
B 1 261 ASP 261 261 261 ASP ASP B . n 
B 1 262 THR 262 262 262 THR THR B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 THR 265 265 265 THR THR B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 ASN 267 267 267 ASN ASN B . n 
B 1 268 TRP 268 268 268 TRP TRP B . n 
B 1 269 GLU 269 269 269 GLU GLU B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 LEU 271 271 271 LEU LEU B . n 
B 1 272 PRO 272 272 272 PRO PRO B . n 
B 1 273 HIS 273 273 273 HIS HIS B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 ALA 275 275 275 ALA ALA B . n 
B 1 276 TYR 276 276 276 TYR TYR B . n 
B 1 277 SER 277 277 277 SER SER B . n 
B 1 278 PRO 278 278 278 PRO PRO B . n 
B 1 279 ASP 279 279 279 ASP ASP B . n 
B 1 280 LEU 280 280 280 LEU LEU B . n 
B 1 281 ALA 281 281 281 ALA ALA B . n 
B 1 282 PRO 282 282 282 PRO PRO B . n 
B 1 283 SER 283 283 283 SER SER B . n 
B 1 284 ASP 284 284 284 ASP ASP B . n 
B 1 285 TYR 285 285 285 TYR TYR B . n 
B 1 286 HIS 286 286 286 HIS HIS B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 PHE 288 288 288 PHE PHE B . n 
B 1 289 ALA 289 289 289 ALA ALA B . n 
B 1 290 SER 290 290 290 SER SER B . n 
B 1 291 MET 291 291 291 MET MET B . n 
B 1 292 GLY 292 292 292 GLY GLY B . n 
B 1 293 HIS 293 293 293 HIS HIS B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 GLU 297 297 297 GLU GLU B . n 
B 1 298 GLN 298 298 298 GLN GLN B . n 
B 1 299 ARG 299 299 299 ARG ARG B . n 
B 1 300 PHE 300 300 300 PHE PHE B . n 
B 1 301 ASP 301 301 301 ASP ASP B . n 
B 1 302 SER 302 302 302 SER SER B . n 
B 1 303 TYR 303 303 303 TYR TYR B . n 
B 1 304 GLU 304 304 304 GLU GLU B . n 
B 1 305 SER 305 305 305 SER SER B . n 
B 1 306 VAL 306 306 306 VAL VAL B . n 
B 1 307 LYS 307 307 307 LYS LYS B . n 
B 1 308 LYS 308 308 308 LYS LYS B . n 
B 1 309 TRP 309 309 309 TRP TRP B . n 
B 1 310 LEU 310 310 310 LEU LEU B . n 
B 1 311 ASP 311 311 311 ASP ASP B . n 
B 1 312 GLU 312 312 312 GLU GLU B . n 
B 1 313 TRP 313 313 313 TRP TRP B . n 
B 1 314 PHE 314 314 314 PHE PHE B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 ALA 316 316 316 ALA ALA B . n 
B 1 317 LYS 317 317 317 LYS LYS B . n 
B 1 318 ASP 318 318 318 ASP ASP B . n 
B 1 319 ASP 319 319 319 ASP ASP B . n 
B 1 320 GLU 320 320 320 GLU GLU B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 TYR 322 322 322 TYR TYR B . n 
B 1 323 TRP 323 323 323 TRP TRP B . n 
B 1 324 ARG 324 324 324 ARG ARG B . n 
B 1 325 GLY 325 325 325 GLY GLY B . n 
B 1 326 ILE 326 326 326 ILE ILE B . n 
B 1 327 HIS 327 327 327 HIS HIS B . n 
B 1 328 LYS 328 328 328 LYS LYS B . n 
B 1 329 LEU 329 329 329 LEU LEU B . n 
B 1 330 PRO 330 330 330 PRO PRO B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 ARG 332 332 332 ARG ARG B . n 
B 1 333 TRP 333 333 333 TRP TRP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 LYS 335 335 335 LYS LYS B . n 
B 1 336 CYS 336 336 336 CYS CYS B . n 
B 1 337 VAL 337 337 337 VAL VAL B . n 
B 1 338 ALA 338 338 338 ALA ALA B . n 
B 1 339 SER 339 339 339 SER SER B . n 
B 1 340 ASP 340 340 340 ASP ASP B . n 
B 1 341 GLY 341 341 341 GLY GLY B . n 
B 1 342 LYS 342 342 342 LYS LYS B . n 
B 1 343 TYR 343 343 343 TYR TYR B . n 
B 1 344 PHE 344 344 344 PHE PHE B . n 
B 1 345 GLU 345 345 345 GLU GLU B . n 
C 2 1   DG  1   4   4   DG  DG  C . n 
C 2 2   DG  2   5   5   DG  DG  C . n 
C 2 3   DT  3   6   6   DT  DT  C . n 
C 2 4   DG  4   7   7   DG  DG  C . n 
C 2 5   DT  5   8   8   DT  DT  C . n 
C 2 6   DA  6   9   9   DA  DA  C . n 
C 2 7   DC  7   10  10  DC  DC  C . n 
C 2 8   DA  8   11  11  DA  DA  C . n 
C 2 9   DA  9   12  12  DA  DA  C . n 
C 2 10  DG  10  13  13  DG  DG  C . n 
C 2 11  DT  11  14  14  DT  DT  C . n 
C 2 12  DA  12  15  15  DA  DA  C . n 
C 2 13  5IU 13  16  16  5IU 5IU C . n 
C 2 14  DG  14  17  17  DG  DG  C . n 
C 2 15  DA  15  18  18  DA  DA  C . n 
C 2 16  DA  16  19  19  DA  DA  C . n 
C 2 17  DA  17  20  20  DA  DA  C . n 
C 2 18  DT  18  21  21  DT  DT  C . n 
C 2 19  DG  19  22  22  DG  DG  C . n 
C 2 20  DT  20  23  23  DT  DT  C . n 
C 2 21  DC  21  24  24  DC  DC  C . n 
C 2 22  DG  22  25  25  DG  DG  C . n 
C 2 23  DT  23  26  26  DT  DT  C . n 
C 2 24  DT  24  27  27  DT  DT  C . n 
C 2 25  DT  25  28  28  DT  DT  C . n 
D 3 1   DA  1   29  29  DA  DA  D . n 
D 3 2   DA  2   30  30  DA  DA  D . n 
D 3 3   DA  3   31  31  DA  DA  D . n 
D 3 4   DC  4   32  32  DC  DC  D . n 
D 3 5   DG  5   33  33  DG  DG  D . n 
D 3 6   DA  6   34  34  DA  DA  D . n 
D 3 7   DC  7   35  35  DC  DC  D . n 
D 3 8   DA  8   36  36  DA  DA  D . n 
D 3 9   DT  9   37  37  DT  DT  D . n 
D 3 10  DT  10  38  38  DT  DT  D . n 
D 3 11  DT  11  39  39  DT  DT  D . n 
D 3 12  DC  12  40  40  DC  DC  D . n 
D 3 13  DA  13  41  41  DA  DA  D . n 
D 3 14  DT  14  42  42  DT  DT  D . n 
D 3 15  DA  15  43  43  DA  DA  D . n 
D 3 16  DC  16  44  44  DC  DC  D . n 
D 3 17  DT  17  45  45  DT  DT  D . n 
D 3 18  DT  18  46  46  DT  DT  D . n 
D 3 19  DG  19  47  47  DG  DG  D . n 
D 3 20  DT  20  48  48  DT  DT  D . n 
D 3 21  DA  21  49  49  DA  DA  D . n 
D 3 22  DC  22  50  50  DC  DC  D . n 
D 3 23  DA  23  51  51  DA  DA  D . n 
D 3 24  DC  24  52  52  DC  DC  D . n 
D 3 25  DC  25  53  53  DC  DC  D . n 
D 3 26  DT  26  54  54  DT  DT  D . n 
D 3 27  DG  27  55  55  DG  DG  D . n 
D 3 28  DA  28  56  56  DA  DA  D . n 
E 2 1   DG  1   4   4   DG  DG  E . n 
E 2 2   DG  2   5   5   DG  DG  E . n 
E 2 3   DT  3   6   6   DT  DT  E . n 
E 2 4   DG  4   7   7   DG  DG  E . n 
E 2 5   DT  5   8   8   DT  DT  E . n 
E 2 6   DA  6   9   9   DA  DA  E . n 
E 2 7   DC  7   10  10  DC  DC  E . n 
E 2 8   DA  8   11  11  DA  DA  E . n 
E 2 9   DA  9   12  12  DA  DA  E . n 
E 2 10  DG  10  13  13  DG  DG  E . n 
E 2 11  DT  11  14  14  DT  DT  E . n 
E 2 12  DA  12  15  15  DA  DA  E . n 
E 2 13  5IU 13  16  16  5IU 5IU E . n 
E 2 14  DG  14  17  17  DG  DG  E . n 
E 2 15  DA  15  18  18  DA  DA  E . n 
E 2 16  DA  16  19  19  DA  DA  E . n 
E 2 17  DA  17  20  20  DA  DA  E . n 
E 2 18  DT  18  21  21  DT  DT  E . n 
E 2 19  DG  19  22  22  DG  DG  E . n 
E 2 20  DT  20  23  23  DT  DT  E . n 
E 2 21  DC  21  24  24  DC  DC  E . n 
E 2 22  DG  22  25  25  DG  DG  E . n 
E 2 23  DT  23  26  26  DT  DT  E . n 
E 2 24  DT  24  27  27  DT  DT  E . n 
E 2 25  DT  25  28  28  DT  DT  E . n 
F 3 1   DA  1   29  29  DA  DA  F . n 
F 3 2   DA  2   30  30  DA  DA  F . n 
F 3 3   DA  3   31  31  DA  DA  F . n 
F 3 4   DC  4   32  32  DC  DC  F . n 
F 3 5   DG  5   33  33  DG  DG  F . n 
F 3 6   DA  6   34  34  DA  DA  F . n 
F 3 7   DC  7   35  35  DC  DC  F . n 
F 3 8   DA  8   36  36  DA  DA  F . n 
F 3 9   DT  9   37  37  DT  DT  F . n 
F 3 10  DT  10  38  38  DT  DT  F . n 
F 3 11  DT  11  39  39  DT  DT  F . n 
F 3 12  DC  12  40  40  DC  DC  F . n 
F 3 13  DA  13  41  41  DA  DA  F . n 
F 3 14  DT  14  42  42  DT  DT  F . n 
F 3 15  DA  15  43  43  DA  DA  F . n 
F 3 16  DC  16  44  44  DC  DC  F . n 
F 3 17  DT  17  45  45  DT  DT  F . n 
F 3 18  DT  18  46  46  DT  DT  F . n 
F 3 19  DG  19  47  47  DG  DG  F . n 
F 3 20  DT  20  48  48  DT  DT  F . n 
F 3 21  DA  21  49  49  DA  DA  F . n 
F 3 22  DC  22  50  50  DC  DC  F . n 
F 3 23  DA  23  51  51  DA  DA  F . n 
F 3 24  DC  24  52  52  DC  DC  F . n 
F 3 25  DC  25  53  53  DC  DC  F . n 
F 3 26  DT  26  54  54  DT  DT  F . n 
F 3 27  DG  27  55  55  DG  DG  F . n 
F 3 28  DA  28  56  56  DA  DA  F . n 
G 2 1   DG  1   4   4   DG  DG  G . n 
G 2 2   DG  2   5   5   DG  DG  G . n 
G 2 3   DT  3   6   6   DT  DT  G . n 
G 2 4   DG  4   7   7   DG  DG  G . n 
G 2 5   DT  5   8   8   DT  DT  G . n 
G 2 6   DA  6   9   9   DA  DA  G . n 
G 2 7   DC  7   10  10  DC  DC  G . n 
G 2 8   DA  8   11  11  DA  DA  G . n 
G 2 9   DA  9   12  12  DA  DA  G . n 
G 2 10  DG  10  13  13  DG  DG  G . n 
G 2 11  DT  11  14  14  DT  DT  G . n 
G 2 12  DA  12  15  15  DA  DA  G . n 
G 2 13  5IU 13  16  16  5IU 5IU G . n 
G 2 14  DG  14  17  17  DG  DG  G . n 
G 2 15  DA  15  18  18  DA  DA  G . n 
G 2 16  DA  16  19  19  DA  DA  G . n 
G 2 17  DA  17  20  20  DA  DA  G . n 
G 2 18  DT  18  21  21  DT  DT  G . n 
G 2 19  DG  19  22  22  DG  DG  G . n 
G 2 20  DT  20  23  23  DT  DT  G . n 
G 2 21  DC  21  24  24  DC  DC  G . n 
G 2 22  DG  22  25  25  DG  DG  G . n 
G 2 23  DT  23  26  26  DT  DT  G . n 
G 2 24  DT  24  27  27  DT  DT  G . n 
G 2 25  DT  25  28  28  DT  DT  G . n 
H 3 1   DA  1   29  29  DA  DA  H . n 
H 3 2   DA  2   30  30  DA  DA  H . n 
H 3 3   DA  3   31  31  DA  DA  H . n 
H 3 4   DC  4   32  32  DC  DC  H . n 
H 3 5   DG  5   33  33  DG  DG  H . n 
H 3 6   DA  6   34  34  DA  DA  H . n 
H 3 7   DC  7   35  35  DC  DC  H . n 
H 3 8   DA  8   36  36  DA  DA  H . n 
H 3 9   DT  9   37  37  DT  DT  H . n 
H 3 10  DT  10  38  38  DT  DT  H . n 
H 3 11  DT  11  39  39  DT  DT  H . n 
H 3 12  DC  12  40  40  DC  DC  H . n 
H 3 13  DA  13  41  41  DA  DA  H . n 
H 3 14  DT  14  42  42  DT  DT  H . n 
H 3 15  DA  15  43  43  DA  DA  H . n 
H 3 16  DC  16  44  44  DC  DC  H . n 
H 3 17  DT  17  45  45  DT  DT  H . n 
H 3 18  DT  18  46  46  DT  DT  H . n 
H 3 19  DG  19  47  47  DG  DG  H . n 
H 3 20  DT  20  48  48  DT  DT  H . n 
H 3 21  DA  21  49  49  DA  DA  H . n 
H 3 22  DC  22  50  50  DC  DC  H . n 
H 3 23  DA  23  51  51  DA  DA  H . n 
H 3 24  DC  24  52  52  DC  DC  H . n 
H 3 25  DC  25  53  53  DC  DC  H . n 
H 3 26  DT  26  54  54  DT  DT  H . n 
H 3 27  DG  27  55  55  DG  DG  H . n 
H 3 28  DA  28  56  56  DA  DA  H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 4 MN  1 1001 1001 MN  MN  A . 
J 5 SO4 1 346  346  SO4 SO4 B . 
K 5 SO4 1 1    1    SO4 SO4 D . 
L 6 HOH 1 346  346  HOH HOH A . 
M 6 HOH 1 347  347  HOH HOH B . 
M 6 HOH 2 348  348  HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C 5IU 13 C 5IU 16 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
2 E 5IU 13 E 5IU 16 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
3 G 5IU 13 G 5IU 16 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 28690 ? 
1 MORE         -134  ? 
1 'SSA (A^2)'  54560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD2 ? A ASP 156 ? A ASP 156 ? 1_555 MN ? I MN . ? A MN 1001 ? 1_555 OD2   ? A ASP 249 ? A ASP 249 ? 1_555 83.3  ? 
2 OD2 ? A ASP 156 ? A ASP 156 ? 1_555 MN ? I MN . ? A MN 1001 ? 1_555 "O3'" ? G DT  25  ? G DT  28  ? 1_555 99.0  ? 
3 OD2 ? A ASP 249 ? A ASP 249 ? 1_555 MN ? I MN . ? A MN 1001 ? 1_555 "O3'" ? G DT  25  ? G DT  28  ? 1_555 122.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2013-10-16 
4 'Structure model' 1 3 2019-12-25 
5 'Structure model' 1 4 2021-11-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Derived calculations'      
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Source and taxonomy'       
7 5 'Structure model' 'Database references'       
8 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' ndb_struct_conf_na           
2  4 'Structure model' ndb_struct_na_base_pair      
3  4 'Structure model' ndb_struct_na_base_pair_step 
4  4 'Structure model' pdbx_entity_src_syn          
5  4 'Structure model' pdbx_struct_conn_angle       
6  4 'Structure model' reflns                       
7  4 'Structure model' struct_conn                  
8  4 'Structure model' struct_conn_type             
9  5 'Structure model' database_2                   
10 5 'Structure model' struct_conn                  
11 5 'Structure model' struct_conn_type             
12 5 'Structure model' struct_ref_seq_dif           
13 5 'Structure model' struct_site                  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_entity_src_syn.details'             
2  4 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id'    
3  4 'Structure model' '_pdbx_entity_src_syn.organism_scientific' 
4  4 'Structure model' '_reflns.pdbx_Rmerge_I_obs'                
5  5 'Structure model' '_database_2.pdbx_DOI'                     
6  5 'Structure model' '_database_2.pdbx_database_accession'      
7  5 'Structure model' '_struct_conn.conn_type_id'                
8  5 'Structure model' '_struct_conn.id'                          
9  5 'Structure model' '_struct_conn.pdbx_dist_value'             
10 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'      
11 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'          
12 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'          
13 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'           
14 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'         
15 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'         
16 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'         
17 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'          
18 5 'Structure model' '_struct_conn.ptnr1_symmetry'              
19 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'          
20 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'          
21 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'           
22 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'         
23 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'         
24 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'         
25 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'          
26 5 'Structure model' '_struct_conn.ptnr2_symmetry'              
27 5 'Structure model' '_struct_conn_type.id'                     
28 5 'Structure model' '_struct_ref_seq_dif.details'              
29 5 'Structure model' '_struct_site.pdbx_auth_asym_id'           
30 5 'Structure model' '_struct_site.pdbx_auth_comp_id'           
31 5 'Structure model' '_struct_site.pdbx_auth_seq_id'            
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 29.4765 -10.9686 -3.0177 0.0445 0.0416 0.0100 0.0236 -0.0021 -0.0045 0.7102 0.6919 0.7481 0.1348  
0.1099 -0.0717 0.1455 0.0266 -0.0283 -0.0014 -0.0923 -0.0284 -0.0600 -0.0282 -0.0532 
'X-RAY DIFFRACTION' 2 ? refined 42.9149 -29.8021 64.7664 0.9081 1.5726 0.2249 0.0209 -0.2950 0.1245  0.7752 1.9972 8.8144 -1.1091 
2.4823 -3.9072 0.2231 0.5534 -0.1200 0.0730  -0.2449 0.1030  -0.2081 1.8889  0.0218  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 5  ? ? A 345 ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 B 5  ? ? B 345 ? ? ? ? 
'X-RAY DIFFRACTION' 3 1 C 4  ? ? C 28  ? ? ? ? 
'X-RAY DIFFRACTION' 4 1 D 29 ? ? D 56  ? ? ? ? 
'X-RAY DIFFRACTION' 5 1 E 4  ? ? E 28  ? ? ? ? 
'X-RAY DIFFRACTION' 6 1 F 29 ? ? F 56  ? ? ? ? 
'X-RAY DIFFRACTION' 7 2 G 4  ? ? G 28  ? ? ? ? 
'X-RAY DIFFRACTION' 8 2 H 29 ? ? H 56  ? ? ? ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOSFLM      .        ?               package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk    'data reduction'  
http://www.mrc-lmb.cam.ac.uk/harry/mosflm/   ?          ? 
2 SCALA       .        ?               other   'Phil R. Evans'      pre@mrc-lmb.cam.ac.uk       'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html   Fortran_77 ? 
3 PHASER      .        ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      5.5.0072 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.005    'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
6 ADSC        Quantum  ?               ?       ?                    ?                           'data collection' ? ?          ? 
# 
_pdbx_entry_details.entry_id                 3HOT 
_pdbx_entry_details.sequence_details         'THESE RESIDUES WERE BASED ON THE NUCLEOTIDE SEQUENCE EMBL:X78906.' 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD    B GLU 126 ? ? OE2   B GLU 126 ? ? 1.340 1.252 0.088  0.011 N 
2 1 P     C DG  4   ? ? OP3   C DG  4   ? ? 1.495 1.607 -0.112 0.012 N 
3 1 "O3'" D DT  46  ? ? "C3'" D DT  46  ? ? 1.372 1.419 -0.047 0.006 N 
4 1 P     E DG  4   ? ? OP3   E DG  4   ? ? 1.493 1.607 -0.114 0.012 N 
5 1 P     G DG  4   ? ? OP3   G DG  4   ? ? 1.482 1.607 -0.125 0.012 N 
6 1 "O3'" G DG  25  ? ? "C3'" G DG  25  ? ? 1.375 1.419 -0.044 0.006 N 
7 1 "O3'" H DA  29  ? ? "C3'" H DA  29  ? ? 1.383 1.419 -0.036 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 CA    A CYS 336 ? ? CB    A CYS 336 ? ? SG    A CYS 336 ? ? 121.91 114.20 7.71   1.10 N 
2   1 CA    B LEU 77  ? ? CB    B LEU 77  ? ? CG    B LEU 77  ? ? 132.16 115.30 16.86  2.30 N 
3   1 OP1   C DG  4   ? ? P     C DG  4   ? ? OP2   C DG  4   ? ? 106.30 119.60 -13.30 1.50 N 
4   1 "O4'" C DG  5   ? ? "C1'" C DG  5   ? ? N9    C DG  5   ? ? 111.57 108.30 3.27   0.30 N 
5   1 "C3'" C DT  8   ? ? "O3'" C DT  8   ? ? P     C DA  9   ? ? 128.83 119.70 9.13   1.20 Y 
6   1 "O4'" C DC  10  ? ? "C1'" C DC  10  ? ? N1    C DC  10  ? ? 111.59 108.30 3.29   0.30 N 
7   1 "O4'" C DA  11  ? ? "C1'" C DA  11  ? ? N9    C DA  11  ? ? 110.58 108.30 2.28   0.30 N 
8   1 "O4'" C DA  12  ? ? "C4'" C DA  12  ? ? "C3'" C DA  12  ? ? 101.32 104.50 -3.18  0.40 N 
9   1 "O4'" C DA  12  ? ? "C1'" C DA  12  ? ? N9    C DA  12  ? ? 110.66 108.30 2.36   0.30 N 
10  1 "O4'" C DG  13  ? ? "C4'" C DG  13  ? ? "C3'" C DG  13  ? ? 98.35  104.50 -6.15  0.40 N 
11  1 "C1'" C DG  13  ? ? "O4'" C DG  13  ? ? "C4'" C DG  13  ? ? 103.35 110.10 -6.75  1.00 N 
12  1 "O4'" C DG  13  ? ? "C1'" C DG  13  ? ? N9    C DG  13  ? ? 113.46 108.30 5.16   0.30 N 
13  1 "O4'" C DT  14  ? ? "C1'" C DT  14  ? ? N1    C DT  14  ? ? 111.05 108.30 2.75   0.30 N 
14  1 "O4'" C DG  17  ? ? "C1'" C DG  17  ? ? N9    C DG  17  ? ? 114.01 108.30 5.71   0.30 N 
15  1 "O4'" C DT  26  ? ? "C1'" C DT  26  ? ? N1    C DT  26  ? ? 112.19 108.30 3.89   0.30 N 
16  1 "O4'" C DT  28  ? ? "C1'" C DT  28  ? ? N1    C DT  28  ? ? 110.89 108.30 2.59   0.30 N 
17  1 "O4'" D DA  31  ? ? "C1'" D DA  31  ? ? N9    D DA  31  ? ? 112.45 108.30 4.15   0.30 N 
18  1 "O4'" D DC  32  ? ? "C1'" D DC  32  ? ? N1    D DC  32  ? ? 113.07 108.30 4.77   0.30 N 
19  1 "O4'" D DG  33  ? ? "C4'" D DG  33  ? ? "C3'" D DG  33  ? ? 101.30 104.50 -3.20  0.40 N 
20  1 "C3'" D DG  33  ? ? "C2'" D DG  33  ? ? "C1'" D DG  33  ? ? 96.73  102.40 -5.67  0.80 N 
21  1 "O4'" D DA  34  ? ? "C1'" D DA  34  ? ? N9    D DA  34  ? ? 113.43 108.30 5.13   0.30 N 
22  1 "O4'" D DC  35  ? ? "C1'" D DC  35  ? ? N1    D DC  35  ? ? 113.34 108.30 5.04   0.30 N 
23  1 "O4'" D DA  36  ? ? "C1'" D DA  36  ? ? N9    D DA  36  ? ? 110.54 108.30 2.24   0.30 N 
24  1 "C3'" D DT  38  ? ? "O3'" D DT  38  ? ? P     D DT  39  ? ? 127.50 119.70 7.80   1.20 Y 
25  1 "C3'" D DT  39  ? ? "O3'" D DT  39  ? ? P     D DC  40  ? ? 127.64 119.70 7.94   1.20 Y 
26  1 "C3'" D DC  40  ? ? "C2'" D DC  40  ? ? "C1'" D DC  40  ? ? 96.79  102.40 -5.61  0.80 N 
27  1 "C3'" D DA  41  ? ? "O3'" D DA  41  ? ? P     D DT  42  ? ? 128.05 119.70 8.35   1.20 Y 
28  1 "O4'" D DT  42  ? ? "C4'" D DT  42  ? ? "C3'" D DT  42  ? ? 101.87 104.50 -2.63  0.40 N 
29  1 "O4'" D DT  42  ? ? "C1'" D DT  42  ? ? N1    D DT  42  ? ? 110.82 108.30 2.52   0.30 N 
30  1 "C3'" D DT  42  ? ? "O3'" D DT  42  ? ? P     D DA  43  ? ? 128.17 119.70 8.47   1.20 Y 
31  1 "O4'" D DC  44  ? ? "C4'" D DC  44  ? ? "C3'" D DC  44  ? ? 100.65 104.50 -3.85  0.40 N 
32  1 "C3'" D DT  46  ? ? "C2'" D DT  46  ? ? "C1'" D DT  46  ? ? 97.58  102.40 -4.82  0.80 N 
33  1 "O4'" D DT  48  ? ? "C1'" D DT  48  ? ? N1    D DT  48  ? ? 112.12 108.30 3.82   0.30 N 
34  1 "O4'" D DA  49  ? ? "C4'" D DA  49  ? ? "C3'" D DA  49  ? ? 101.75 104.50 -2.75  0.40 N 
35  1 "O4'" D DA  49  ? ? "C1'" D DA  49  ? ? N9    D DA  49  ? ? 110.12 108.30 1.82   0.30 N 
36  1 "C3'" D DC  50  ? ? "C2'" D DC  50  ? ? "C1'" D DC  50  ? ? 94.76  102.40 -7.64  0.80 N 
37  1 "O4'" D DC  50  ? ? "C1'" D DC  50  ? ? N1    D DC  50  ? ? 110.98 108.30 2.68   0.30 N 
38  1 "C3'" D DC  52  ? ? "C2'" D DC  52  ? ? "C1'" D DC  52  ? ? 97.31  102.40 -5.09  0.80 N 
39  1 "O4'" D DC  52  ? ? "C1'" D DC  52  ? ? N1    D DC  52  ? ? 113.01 108.30 4.71   0.30 N 
40  1 "C3'" D DC  52  ? ? "O3'" D DC  52  ? ? P     D DC  53  ? ? 127.43 119.70 7.73   1.20 Y 
41  1 "O4'" D DC  53  ? ? "C1'" D DC  53  ? ? N1    D DC  53  ? ? 111.04 108.30 2.74   0.30 N 
42  1 "C3'" D DT  54  ? ? "O3'" D DT  54  ? ? P     D DG  55  ? ? 127.44 119.70 7.74   1.20 Y 
43  1 OP1   E DG  4   ? ? P     E DG  4   ? ? OP2   E DG  4   ? ? 86.07  119.60 -33.53 1.50 N 
44  1 "O5'" E DG  4   ? ? P     E DG  4   ? ? OP2   E DG  4   ? ? 92.04  105.70 -13.66 0.90 N 
45  1 "O4'" E DG  4   ? ? "C1'" E DG  4   ? ? "C2'" E DG  4   ? ? 100.96 105.90 -4.94  0.80 N 
46  1 "O4'" E DG  4   ? ? "C1'" E DG  4   ? ? N9    E DG  4   ? ? 102.99 108.00 -5.01  0.70 N 
47  1 "C3'" E DG  5   ? ? "O3'" E DG  5   ? ? P     E DT  6   ? ? 128.06 119.70 8.36   1.20 Y 
48  1 "C3'" E DT  6   ? ? "C2'" E DT  6   ? ? "C1'" E DT  6   ? ? 96.51  102.40 -5.89  0.80 N 
49  1 "C3'" E DG  7   ? ? "C2'" E DG  7   ? ? "C1'" E DG  7   ? ? 96.85  102.40 -5.55  0.80 N 
50  1 "O5'" E DC  10  ? ? "C5'" E DC  10  ? ? "C4'" E DC  10  ? ? 103.56 109.40 -5.84  0.80 N 
51  1 "C3'" E DC  10  ? ? "C2'" E DC  10  ? ? "C1'" E DC  10  ? ? 97.53  102.40 -4.87  0.80 N 
52  1 "C3'" E DG  13  ? ? "C2'" E DG  13  ? ? "C1'" E DG  13  ? ? 96.73  102.40 -5.67  0.80 N 
53  1 "O4'" E DG  13  ? ? "C1'" E DG  13  ? ? N9    E DG  13  ? ? 111.02 108.30 2.72   0.30 N 
54  1 "O4'" E DA  15  ? ? "C1'" E DA  15  ? ? N9    E DA  15  ? ? 110.17 108.30 1.87   0.30 N 
55  1 "C3'" E DG  17  ? ? "C2'" E DG  17  ? ? "C1'" E DG  17  ? ? 97.42  102.40 -4.98  0.80 N 
56  1 "O4'" E DG  17  ? ? "C1'" E DG  17  ? ? N9    E DG  17  ? ? 110.74 108.30 2.44   0.30 N 
57  1 "C3'" E DA  18  ? ? "C2'" E DA  18  ? ? "C1'" E DA  18  ? ? 97.01  102.40 -5.39  0.80 N 
58  1 "O4'" E DA  19  ? ? "C1'" E DA  19  ? ? N9    E DA  19  ? ? 103.02 108.00 -4.98  0.70 N 
59  1 "C1'" E DT  21  ? ? "O4'" E DT  21  ? ? "C4'" E DT  21  ? ? 102.96 110.10 -7.14  1.00 N 
60  1 "C3'" E DT  21  ? ? "C2'" E DT  21  ? ? "C1'" E DT  21  ? ? 96.72  102.40 -5.68  0.80 N 
61  1 "O4'" E DT  21  ? ? "C1'" E DT  21  ? ? N1    E DT  21  ? ? 111.50 108.30 3.20   0.30 N 
62  1 "O4'" E DT  23  ? ? "C1'" E DT  23  ? ? N1    E DT  23  ? ? 112.92 108.30 4.62   0.30 N 
63  1 "O4'" E DG  25  ? ? "C1'" E DG  25  ? ? N9    E DG  25  ? ? 115.06 108.30 6.76   0.30 N 
64  1 "C3'" E DG  25  ? ? "O3'" E DG  25  ? ? P     E DT  26  ? ? 128.72 119.70 9.02   1.20 Y 
65  1 "O4'" E DT  26  ? ? "C1'" E DT  26  ? ? N1    E DT  26  ? ? 113.06 108.30 4.76   0.30 N 
66  1 "O4'" F DA  30  ? ? "C1'" F DA  30  ? ? N9    F DA  30  ? ? 110.15 108.30 1.85   0.30 N 
67  1 "O4'" F DA  31  ? ? "C4'" F DA  31  ? ? "C3'" F DA  31  ? ? 101.10 104.50 -3.40  0.40 N 
68  1 "C4'" F DA  31  ? ? "C3'" F DA  31  ? ? "C2'" F DA  31  ? ? 96.98  102.20 -5.22  0.70 N 
69  1 "O4'" F DA  31  ? ? "C1'" F DA  31  ? ? N9    F DA  31  ? ? 112.20 108.30 3.90   0.30 N 
70  1 "C3'" F DA  31  ? ? "O3'" F DA  31  ? ? P     F DC  32  ? ? 129.85 119.70 10.15  1.20 Y 
71  1 "O4'" F DA  34  ? ? "C1'" F DA  34  ? ? N9    F DA  34  ? ? 111.29 108.30 2.99   0.30 N 
72  1 "O4'" F DC  35  ? ? "C1'" F DC  35  ? ? N1    F DC  35  ? ? 113.44 108.30 5.14   0.30 N 
73  1 "C3'" F DA  36  ? ? "C2'" F DA  36  ? ? "C1'" F DA  36  ? ? 97.15  102.40 -5.25  0.80 N 
74  1 "C3'" F DT  37  ? ? "O3'" F DT  37  ? ? P     F DT  38  ? ? 127.08 119.70 7.38   1.20 Y 
75  1 "C3'" F DT  38  ? ? "O3'" F DT  38  ? ? P     F DT  39  ? ? 128.89 119.70 9.19   1.20 Y 
76  1 "O4'" F DT  39  ? ? "C1'" F DT  39  ? ? N1    F DT  39  ? ? 111.91 108.30 3.61   0.30 N 
77  1 "C3'" F DC  40  ? ? "O3'" F DC  40  ? ? P     F DA  41  ? ? 128.94 119.70 9.24   1.20 Y 
78  1 "C3'" F DT  42  ? ? "O3'" F DT  42  ? ? P     F DA  43  ? ? 131.00 119.70 11.30  1.20 Y 
79  1 C6    F DT  45  ? ? C5    F DT  45  ? ? C7    F DT  45  ? ? 119.03 122.90 -3.87  0.60 N 
80  1 "O4'" F DT  46  ? ? "C1'" F DT  46  ? ? N1    F DT  46  ? ? 112.50 108.30 4.20   0.30 N 
81  1 "O4'" F DG  47  ? ? "C1'" F DG  47  ? ? N9    F DG  47  ? ? 111.29 108.30 2.99   0.30 N 
82  1 "O4'" F DT  48  ? ? "C4'" F DT  48  ? ? "C3'" F DT  48  ? ? 99.93  104.50 -4.57  0.40 N 
83  1 "C1'" F DC  50  ? ? "O4'" F DC  50  ? ? "C4'" F DC  50  ? ? 102.91 110.10 -7.19  1.00 N 
84  1 "O4'" F DC  50  ? ? "C1'" F DC  50  ? ? N1    F DC  50  ? ? 110.35 108.30 2.05   0.30 N 
85  1 "O4'" F DC  52  ? ? "C1'" F DC  52  ? ? N1    F DC  52  ? ? 111.24 108.30 2.94   0.30 N 
86  1 "C5'" F DC  53  ? ? "C4'" F DC  53  ? ? "O4'" F DC  53  ? ? 117.93 109.80 8.13   1.10 N 
87  1 "C3'" F DC  53  ? ? "C2'" F DC  53  ? ? "C1'" F DC  53  ? ? 97.16  102.40 -5.24  0.80 N 
88  1 "O4'" F DC  53  ? ? "C1'" F DC  53  ? ? N1    F DC  53  ? ? 114.87 108.30 6.57   0.30 N 
89  1 "O4'" F DT  54  ? ? "C1'" F DT  54  ? ? N1    F DT  54  ? ? 110.25 108.30 1.95   0.30 N 
90  1 "O4'" F DG  55  ? ? "C1'" F DG  55  ? ? N9    F DG  55  ? ? 101.45 108.00 -6.55  0.70 N 
91  1 OP1   G DG  4   ? ? P     G DG  4   ? ? OP2   G DG  4   ? ? 106.88 119.60 -12.72 1.50 N 
92  1 "O4'" G DG  4   ? ? "C1'" G DG  4   ? ? N9    G DG  4   ? ? 111.57 108.30 3.27   0.30 N 
93  1 "O4'" G DG  5   ? ? "C1'" G DG  5   ? ? N9    G DG  5   ? ? 112.99 108.30 4.69   0.30 N 
94  1 "O4'" G DT  6   ? ? "C1'" G DT  6   ? ? N1    G DT  6   ? ? 111.04 108.30 2.74   0.30 N 
95  1 "C3'" G DT  8   ? ? "C2'" G DT  8   ? ? "C1'" G DT  8   ? ? 96.61  102.40 -5.79  0.80 N 
96  1 "O4'" G DT  8   ? ? "C1'" G DT  8   ? ? "C2'" G DT  8   ? ? 100.91 105.90 -4.99  0.80 N 
97  1 "O4'" G DA  9   ? ? "C1'" G DA  9   ? ? N9    G DA  9   ? ? 113.22 108.30 4.92   0.30 N 
98  1 "O4'" G DA  12  ? ? "C1'" G DA  12  ? ? N9    G DA  12  ? ? 111.72 108.30 3.42   0.30 N 
99  1 "O4'" G DT  14  ? ? "C1'" G DT  14  ? ? N1    G DT  14  ? ? 110.96 108.30 2.66   0.30 N 
100 1 "C3'" G DA  18  ? ? "C2'" G DA  18  ? ? "C1'" G DA  18  ? ? 97.52  102.40 -4.88  0.80 N 
101 1 "O4'" G DA  18  ? ? "C1'" G DA  18  ? ? N9    G DA  18  ? ? 111.78 108.30 3.48   0.30 N 
102 1 "O4'" G DA  19  ? ? "C1'" G DA  19  ? ? N9    G DA  19  ? ? 110.96 108.30 2.66   0.30 N 
103 1 "O4'" G DT  21  ? ? "C1'" G DT  21  ? ? N1    G DT  21  ? ? 114.56 108.30 6.26   0.30 N 
104 1 "C3'" G DT  23  ? ? "C2'" G DT  23  ? ? "C1'" G DT  23  ? ? 96.80  102.40 -5.60  0.80 N 
105 1 "O4'" G DT  23  ? ? "C1'" G DT  23  ? ? N1    G DT  23  ? ? 110.79 108.30 2.49   0.30 N 
106 1 "C1'" G DT  27  ? ? "O4'" G DT  27  ? ? "C4'" G DT  27  ? ? 103.90 110.10 -6.20  1.00 N 
107 1 "C4'" H DA  30  ? ? "C3'" H DA  30  ? ? "C2'" H DA  30  ? ? 97.53  102.20 -4.67  0.70 N 
108 1 "O4'" H DA  30  ? ? "C1'" H DA  30  ? ? N9    H DA  30  ? ? 111.86 108.30 3.56   0.30 N 
109 1 "O4'" H DA  31  ? ? "C1'" H DA  31  ? ? N9    H DA  31  ? ? 111.72 108.30 3.42   0.30 N 
110 1 "C1'" H DC  32  ? ? "O4'" H DC  32  ? ? "C4'" H DC  32  ? ? 103.98 110.10 -6.12  1.00 N 
111 1 "O4'" H DC  32  ? ? "C1'" H DC  32  ? ? N1    H DC  32  ? ? 110.78 108.30 2.48   0.30 N 
112 1 "O4'" H DG  33  ? ? "C1'" H DG  33  ? ? N9    H DG  33  ? ? 110.32 108.30 2.02   0.30 N 
113 1 "O4'" H DA  34  ? ? "C1'" H DA  34  ? ? N9    H DA  34  ? ? 110.11 108.30 1.81   0.30 N 
114 1 "O4'" H DC  35  ? ? "C1'" H DC  35  ? ? N1    H DC  35  ? ? 111.54 108.30 3.24   0.30 N 
115 1 "O4'" H DA  36  ? ? "C1'" H DA  36  ? ? N9    H DA  36  ? ? 111.60 108.30 3.30   0.30 N 
116 1 "O4'" H DT  37  ? ? "C1'" H DT  37  ? ? N1    H DT  37  ? ? 110.24 108.30 1.94   0.30 N 
117 1 "C3'" H DT  37  ? ? "O3'" H DT  37  ? ? P     H DT  38  ? ? 127.78 119.70 8.08   1.20 Y 
118 1 "C3'" H DT  38  ? ? "O3'" H DT  38  ? ? P     H DT  39  ? ? 127.94 119.70 8.24   1.20 Y 
119 1 "O4'" H DT  39  ? ? "C1'" H DT  39  ? ? N1    H DT  39  ? ? 111.05 108.30 2.75   0.30 N 
120 1 "O4'" H DT  42  ? ? "C1'" H DT  42  ? ? N1    H DT  42  ? ? 114.72 108.30 6.42   0.30 N 
121 1 "O4'" H DA  43  ? ? "C1'" H DA  43  ? ? N9    H DA  43  ? ? 111.91 108.30 3.61   0.30 N 
122 1 "O4'" H DC  44  ? ? "C1'" H DC  44  ? ? N1    H DC  44  ? ? 111.97 108.30 3.67   0.30 N 
123 1 "O4'" H DT  45  ? ? "C1'" H DT  45  ? ? N1    H DT  45  ? ? 113.61 108.30 5.31   0.30 N 
124 1 "O4'" H DT  46  ? ? "C1'" H DT  46  ? ? N1    H DT  46  ? ? 111.33 108.30 3.03   0.30 N 
125 1 "O4'" H DG  47  ? ? "C1'" H DG  47  ? ? N9    H DG  47  ? ? 112.93 108.30 4.63   0.30 N 
126 1 "C3'" H DG  47  ? ? "O3'" H DG  47  ? ? P     H DT  48  ? ? 126.99 119.70 7.29   1.20 Y 
127 1 "O4'" H DA  49  ? ? "C1'" H DA  49  ? ? N9    H DA  49  ? ? 113.09 108.30 4.79   0.30 N 
128 1 "O4'" H DC  50  ? ? "C1'" H DC  50  ? ? N1    H DC  50  ? ? 112.75 108.30 4.45   0.30 N 
129 1 "O4'" H DC  52  ? ? "C1'" H DC  52  ? ? N1    H DC  52  ? ? 110.66 108.30 2.36   0.30 N 
130 1 "O4'" H DA  56  ? ? "C1'" H DA  56  ? ? N9    H DA  56  ? ? 111.97 108.30 3.67   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 20  ? ? -61.59  0.21    
2  1 VAL A 40  ? ? -171.64 132.99  
3  1 PRO A 41  ? ? -33.76  164.39  
4  1 ASP A 57  ? ? 178.33  162.72  
5  1 HIS A 65  ? ? -62.36  -171.13 
6  1 ALA A 75  ? ? -42.96  -15.80  
7  1 GLU A 83  ? ? -61.18  -75.26  
8  1 GLU A 97  ? ? 66.10   -10.76  
9  1 LYS A 146 ? ? -170.09 115.39  
10 1 ASP A 156 ? ? -149.57 -157.86 
11 1 PHE A 187 ? ? -107.60 50.06   
12 1 PRO A 210 ? ? -38.65  130.36  
13 1 GLU A 236 ? ? -149.54 43.99   
14 1 ASN A 250 ? ? -82.79  49.46   
15 1 ASN A 267 ? ? 25.17   83.22   
16 1 GLN B 39  ? ? -153.31 6.61    
17 1 SER B 55  ? ? -150.34 67.08   
18 1 PHE B 58  ? ? 15.65   56.89   
19 1 ASP B 59  ? ? -64.69  89.69   
20 1 ASP B 61  ? ? 179.52  159.54  
21 1 ALA B 75  ? ? -57.66  -5.31   
22 1 ASP B 85  ? ? -36.67  -39.52  
23 1 ALA B 93  ? ? -27.55  -52.19  
24 1 GLU B 97  ? ? 65.15   62.83   
25 1 PRO B 121 ? ? -39.16  -25.97  
26 1 HIS B 122 ? ? -172.15 145.20  
27 1 ASN B 134 ? ? -56.34  -70.06  
28 1 ASP B 173 ? ? -48.59  155.63  
29 1 ALA B 178 ? ? -76.88  -159.95 
30 1 GLN B 199 ? ? -54.63  -9.54   
31 1 PRO B 210 ? ? -39.13  136.72  
32 1 ASN B 250 ? ? -56.80  31.81   
33 1 ASP B 284 ? ? -68.62  -77.59  
34 1 ALA B 294 ? ? -63.71  10.04   
35 1 GLU B 297 ? ? 63.08   -9.74   
36 1 ASP B 319 ? ? -34.12  -35.32  
37 1 CYS B 336 ? ? -34.90  -35.00  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LEU A 266 ? ? ASN A 267 ? ? -148.67 
2 1 GLY B 111 ? ? LYS B 112 ? ? -146.84 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A PHE 4   ? A PHE 4   
5  1 Y 1 A GLN 238 ? A GLN 238 
6  1 Y 1 A LYS 239 ? A LYS 239 
7  1 Y 1 A ARG 240 ? A ARG 240 
8  1 Y 1 B MET 1   ? B MET 1   
9  1 Y 1 B SER 2   ? B SER 2   
10 1 Y 1 B SER 3   ? B SER 3   
11 1 Y 1 B PHE 4   ? B PHE 4   
12 1 Y 1 B ARG 240 ? B ARG 240 
13 1 Y 1 B GLN 241 ? B GLN 241 
14 1 Y 1 B HIS 242 ? B HIS 242 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3HOT 'double helix'        
3HOT 'a-form double helix' 
3HOT 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG  1  1_555 D DC 25 1_555 1.385  1.086  -0.812 -38.440 42.081  40.070  1  C_DG4:DC53_D   C 4  ? D 53 ? ?  1 
1 C DG  2  1_555 D DC 24 1_555 -0.758 -0.050 -0.456 -19.555 -9.957  6.025   2  C_DG5:DC52_D   C 5  ? D 52 ? 19 1 
1 C DT  3  1_555 D DA 23 1_555 0.541  0.100  -0.012 -2.885  -3.488  8.119   3  C_DT6:DA51_D   C 6  ? D 51 ? 20 1 
1 C DG  4  1_555 D DC 22 1_555 -0.141 -0.360 -0.750 -12.108 -4.317  -8.397  4  C_DG7:DC50_D   C 7  ? D 50 ? 19 1 
1 C DT  5  1_555 D DA 21 1_555 -0.118 -0.285 -0.005 2.040   1.522   4.558   5  C_DT8:DA49_D   C 8  ? D 49 ? 20 1 
1 C DA  6  1_555 D DT 20 1_555 0.727  -0.199 -0.361 1.506   -0.497  -0.857  6  C_DA9:DT48_D   C 9  ? D 48 ? 20 1 
1 C DC  7  1_555 D DG 19 1_555 0.193  -0.175 -0.268 9.127   -15.286 -7.384  7  C_DC10:DG47_D  C 10 ? D 47 ? 19 1 
1 C DA  8  1_555 D DT 18 1_555 0.899  -0.094 0.213  8.998   -1.599  8.177   8  C_DA11:DT46_D  C 11 ? D 46 ? 20 1 
1 C DA  9  1_555 D DT 17 1_555 -0.213 -0.456 0.993  20.432  -31.345 -0.628  9  C_DA12:DT45_D  C 12 ? D 45 ? 20 1 
1 C DG  10 1_555 D DC 16 1_555 -1.166 -0.759 0.954  -5.846  -22.308 -17.643 10 C_DG13:DC44_D  C 13 ? D 44 ? 19 1 
1 C DT  11 1_555 D DA 15 1_555 -1.241 0.175  1.016  -11.849 -6.298  -0.883  11 C_DT14:DA43_D  C 14 ? D 43 ? 20 1 
1 C DA  12 1_555 D DT 14 1_555 0.181  -0.016 0.836  -2.964  -14.168 8.779   12 C_DA15:DT42_D  C 15 ? D 42 ? 20 1 
1 C 5IU 13 1_555 D DA 13 1_555 1.527  0.081  0.034  -13.973 -20.748 7.479   13 C_5IU16:DA41_D C 16 ? D 41 ? 20 1 
1 C DG  14 1_555 D DC 12 1_555 0.611  -0.377 -0.794 -6.967  -5.533  -6.390  14 C_DG17:DC40_D  C 17 ? D 40 ? 19 1 
1 C DA  15 1_555 D DT 11 1_555 0.994  -0.148 -0.005 10.553  -13.368 -5.422  15 C_DA18:DT39_D  C 18 ? D 39 ? 20 1 
1 C DA  16 1_555 D DT 10 1_555 0.105  -0.264 -0.158 3.116   -17.523 -11.065 16 C_DA19:DT38_D  C 19 ? D 38 ? 20 1 
1 C DA  17 1_555 D DT 9  1_555 -0.527 -0.158 0.252  0.293   -11.597 4.536   17 C_DA20:DT37_D  C 20 ? D 37 ? 20 1 
1 C DT  18 1_555 D DA 8  1_555 0.826  0.294  0.552  -1.051  -8.126  8.818   18 C_DT21:DA36_D  C 21 ? D 36 ? ?  1 
1 C DG  19 1_555 D DC 7  1_555 -0.388 0.055  0.731  0.626   -17.206 7.139   19 C_DG22:DC35_D  C 22 ? D 35 ? 19 1 
1 C DT  20 1_555 D DA 6  1_555 -0.090 -0.076 -0.010 -1.948  -14.850 -5.556  20 C_DT23:DA34_D  C 23 ? D 34 ? 20 1 
1 C DC  21 1_555 D DG 5  1_555 1.091  0.092  -0.248 8.017   -13.546 2.114   21 C_DC24:DG33_D  C 24 ? D 33 ? 19 1 
1 C DG  22 1_555 D DC 4  1_555 0.095  -0.346 0.024  1.279   -15.492 -8.650  22 C_DG25:DC32_D  C 25 ? D 32 ? 19 1 
1 C DT  23 1_555 D DA 3  1_555 0.205  -0.310 0.377  -9.760  -14.409 -11.083 23 C_DT26:DA31_D  C 26 ? D 31 ? 20 1 
1 C DT  24 1_555 D DA 2  1_555 -0.057 0.227  0.486  -3.872  -7.836  6.904   24 C_DT27:DA30_D  C 27 ? D 30 ? 20 1 
1 C DT  25 1_555 D DA 1  1_555 0.564  0.003  -0.291 4.149   -7.653  14.082  25 C_DT28:DA29_D  C 28 ? D 29 ? 20 1 
1 E DG  1  1_555 F DC 25 1_555 1.400  0.267  0.570  -51.204 -7.638  2.789   26 E_DG4:DC53_F   E 4  ? F 53 ? 19 1 
1 E DG  2  1_555 F DC 24 1_555 -1.095 0.077  0.336  -8.317  -13.147 8.028   27 E_DG5:DC52_F   E 5  ? F 52 ? 19 1 
1 E DT  3  1_555 F DA 23 1_555 0.165  0.085  0.098  -4.924  -8.737  -7.064  28 E_DT6:DA51_F   E 6  ? F 51 ? 20 1 
1 E DG  4  1_555 F DC 22 1_555 -0.640 -0.419 0.064  0.622   9.977   -4.696  29 E_DG7:DC50_F   E 7  ? F 50 ? 19 1 
1 E DT  5  1_555 F DA 21 1_555 -0.205 -0.086 -0.263 12.824  -7.063  -7.308  30 E_DT8:DA49_F   E 8  ? F 49 ? 20 1 
1 E DA  6  1_555 F DT 20 1_555 -0.752 0.265  1.462  36.468  -9.593  12.126  31 E_DA9:DT48_F   E 9  ? F 48 ? ?  1 
1 E DC  7  1_555 F DG 19 1_555 -0.121 0.011  0.057  18.018  -20.138 -0.285  32 E_DC10:DG47_F  E 10 ? F 47 ? 19 1 
1 E DA  8  1_555 F DT 18 1_555 1.172  -0.119 0.731  14.967  -8.896  -0.725  33 E_DA11:DT46_F  E 11 ? F 46 ? 20 1 
1 E DA  9  1_555 F DT 17 1_555 -0.113 -0.194 0.654  19.563  -19.453 -0.361  34 E_DA12:DT45_F  E 12 ? F 45 ? 20 1 
1 E DG  10 1_555 F DC 16 1_555 -1.002 -0.420 -0.136 -3.744  -15.356 -12.864 35 E_DG13:DC44_F  E 13 ? F 44 ? 19 1 
1 E DT  11 1_555 F DA 15 1_555 -0.546 0.006  -0.104 -0.347  -8.066  1.818   36 E_DT14:DA43_F  E 14 ? F 43 ? 20 1 
1 E DA  12 1_555 F DT 14 1_555 -0.733 0.236  0.434  -4.856  -27.698 10.923  37 E_DA15:DT42_F  E 15 ? F 42 ? ?  1 
1 E DG  14 1_555 F DC 12 1_555 -0.148 -0.084 -0.321 -2.239  -3.973  0.972   38 E_DG17:DC40_F  E 17 ? F 40 ? 19 1 
1 E DA  15 1_555 F DT 11 1_555 0.310  -0.220 -0.001 16.234  -14.028 -6.738  39 E_DA18:DT39_F  E 18 ? F 39 ? 20 1 
1 E DA  16 1_555 F DT 10 1_555 0.157  -0.031 -0.087 8.816   -18.386 -4.880  40 E_DA19:DT38_F  E 19 ? F 38 ? 20 1 
1 E DA  17 1_555 F DT 9  1_555 -0.275 -0.114 0.634  13.910  -14.834 -7.390  41 E_DA20:DT37_F  E 20 ? F 37 ? 20 1 
1 E DT  18 1_555 F DA 8  1_555 -0.158 0.087  0.027  2.523   -7.161  -4.565  42 E_DT21:DA36_F  E 21 ? F 36 ? 20 1 
1 E DG  19 1_555 F DC 7  1_555 -0.574 -0.135 0.006  -16.817 -20.852 -1.120  43 E_DG22:DC35_F  E 22 ? F 35 ? 19 1 
1 E DT  20 1_555 F DA 6  1_555 -0.172 0.058  0.166  -6.527  -18.005 -9.186  44 E_DT23:DA34_F  E 23 ? F 34 ? 20 1 
1 E DC  21 1_555 F DG 5  1_555 -0.031 -0.234 0.328  1.517   -9.373  -7.027  45 E_DC24:DG33_F  E 24 ? F 33 ? 19 1 
1 E DG  22 1_555 F DC 4  1_555 -0.390 -0.131 0.580  8.643   -15.332 -8.218  46 E_DG25:DC32_F  E 25 ? F 32 ? 19 1 
1 E DT  23 1_555 F DA 3  1_555 -0.975 0.039  0.315  0.999   -22.001 3.044   47 E_DT26:DA31_F  E 26 ? F 31 ? 20 1 
1 E DT  24 1_555 F DA 2  1_555 0.265  -0.078 0.346  -6.322  -14.542 -2.228  48 E_DT27:DA30_F  E 27 ? F 30 ? 20 1 
1 E DT  25 1_555 F DA 1  1_555 0.251  0.040  0.397  -10.683 -11.666 7.613   49 E_DT28:DA29_F  E 28 ? F 29 ? 20 1 
1 G DG  1  1_555 H DC 25 1_555 0.268  1.285  0.054  -7.881  -34.852 48.586  50 G_DG4:DC53_H   G 4  ? H 53 ? ?  1 
1 G DG  2  1_555 H DC 24 1_555 -0.214 0.374  0.233  -13.796 -16.721 14.859  51 G_DG5:DC52_H   G 5  ? H 52 ? ?  1 
1 G DT  3  1_555 H DA 23 1_555 0.756  -0.382 0.073  5.820   0.332   3.604   52 G_DT6:DA51_H   G 6  ? H 51 ? 20 1 
1 G DG  4  1_555 H DC 22 1_555 1.182  0.305  -0.231 14.534  6.788   5.407   53 G_DG7:DC50_H   G 7  ? H 50 ? 19 1 
1 G DT  5  1_555 H DA 21 1_555 -1.145 0.203  -0.503 15.754  3.155   -16.552 54 G_DT8:DA49_H   G 8  ? H 49 ? 20 1 
1 G DA  6  1_555 H DT 20 1_555 -0.083 0.352  -0.028 0.277   -11.597 -6.707  55 G_DA9:DT48_H   G 9  ? H 48 ? 20 1 
1 G DC  7  1_555 H DG 19 1_555 2.082  -0.153 -0.377 24.515  -16.203 3.563   56 G_DC10:DG47_H  G 10 ? H 47 ? 19 1 
1 G DA  8  1_555 H DT 18 1_555 0.945  0.045  -0.636 -26.830 -31.045 -7.944  57 G_DA11:DT46_H  G 11 ? H 46 ? 20 1 
1 G DA  9  1_555 H DT 17 1_555 0.760  0.382  0.234  -4.684  -7.820  -8.730  58 G_DA12:DT45_H  G 12 ? H 45 ? 20 1 
1 G DG  10 1_555 H DC 16 1_555 0.593  0.445  0.355  0.135   -15.897 14.004  59 G_DG13:DC44_H  G 13 ? H 44 ? ?  1 
1 G 5IU 13 1_555 H DT 14 1_555 -2.430 -0.944 0.943  13.800  -24.677 22.132  60 G_5IU16:DT42_H G 16 ? H 42 ? ?  ? 
1 G DG  14 1_555 H DC 12 1_555 0.383  0.280  -0.242 -27.090 -30.902 8.970   61 G_DG17:DC40_H  G 17 ? H 40 ? 19 1 
1 G DA  15 1_555 H DT 11 1_555 -1.174 0.383  -0.268 -5.941  -20.970 3.008   62 G_DA18:DT39_H  G 18 ? H 39 ? ?  ? 
1 G DA  16 1_555 H DT 10 1_555 0.374  0.329  -0.189 -6.878  -15.782 -6.548  63 G_DA19:DT38_H  G 19 ? H 38 ? 20 1 
1 G DA  17 1_555 H DT 9  1_555 0.116  0.187  0.654  -7.756  -36.611 10.632  64 G_DA20:DT37_H  G 20 ? H 37 ? ?  1 
1 G DT  18 1_555 H DA 8  1_555 0.649  0.097  -0.030 -0.561  -13.680 -12.483 65 G_DT21:DA36_H  G 21 ? H 36 ? 20 1 
1 G DG  19 1_555 H DC 7  1_555 -1.193 -0.184 -0.164 -18.584 -6.881  4.342   66 G_DG22:DC35_H  G 22 ? H 35 ? 19 1 
1 G DT  20 1_555 H DA 6  1_555 -0.604 -0.134 0.462  -3.786  -7.144  -5.929  67 G_DT23:DA34_H  G 23 ? H 34 ? 20 1 
1 G DC  21 1_555 H DG 5  1_555 0.980  -0.104 0.866  -13.195 -13.094 5.241   68 G_DC24:DG33_H  G 24 ? H 33 ? 19 1 
1 G DG  22 1_555 H DC 4  1_555 0.804  -0.165 0.313  -24.801 -25.178 -6.778  69 G_DG25:DC32_H  G 25 ? H 32 ? 19 1 
1 G DT  23 1_555 H DA 3  1_555 -0.479 -0.515 1.510  -13.761 -42.086 -3.143  70 G_DT26:DA31_H  G 26 ? H 31 ? 20 1 
1 G DT  24 1_555 H DA 2  1_555 -0.998 -0.244 0.890  -6.330  -27.810 0.938   71 G_DT27:DA30_H  G 27 ? H 30 ? 20 1 
1 G DT  25 1_555 H DA 1  1_555 -0.254 0.301  0.341  24.721  -26.304 -4.829  72 G_DT28:DA29_H  G 28 ? H 29 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG  1  1_555 D DC 25 1_555 C DG  2  1_555 D DC 24 1_555 -1.924 -1.741 4.073 21.476  -22.966 19.685 1.183  6.709  2.160 -42.898 
-40.114 36.964 1  CC_DG4DG5:DC52DC53_DD    C 4  ? D 53 ? C 5  ? D 52 ? 
1 C DG  2  1_555 D DC 24 1_555 C DT  3  1_555 D DA 23 1_555 -0.251 -0.398 2.921 -3.816  4.794   35.840 -1.234 -0.071 2.857 7.721   
6.146   36.343 2  CC_DG5DT6:DA51DC52_DD    C 5  ? D 52 ? C 6  ? D 51 ? 
1 C DT  3  1_555 D DA 23 1_555 C DG  4  1_555 D DC 22 1_555 -0.067 0.111  3.514 6.833   4.736   34.324 -0.572 1.200  3.423 7.882   
-11.373 35.287 3  CC_DT6DG7:DC50DA51_DD    C 6  ? D 51 ? C 7  ? D 50 ? 
1 C DG  4  1_555 D DC 22 1_555 C DT  5  1_555 D DA 21 1_555 -0.016 -0.229 3.031 -5.300  0.324   26.724 -0.562 -1.196 2.975 0.693   
11.325  27.237 4  CC_DG7DT8:DA49DC50_DD    C 7  ? D 50 ? C 8  ? D 49 ? 
1 C DT  5  1_555 D DA 21 1_555 C DA  6  1_555 D DT 20 1_555 0.527  0.678  3.445 6.406   2.446   43.613 0.657  -0.058 3.516 3.269   
-8.560  44.123 5  CC_DT8DA9:DT48DA49_DD    C 8  ? D 49 ? C 9  ? D 48 ? 
1 C DA  6  1_555 D DT 20 1_555 C DC  7  1_555 D DG 19 1_555 -1.241 -0.537 2.988 -3.214  1.124   28.045 -1.344 1.847  3.084 2.309   
6.601   28.247 6  CC_DA9DC10:DG47DT48_DD   C 9  ? D 48 ? C 10 ? D 47 ? 
1 C DC  7  1_555 D DG 19 1_555 C DA  8  1_555 D DT 18 1_555 0.448  -0.508 3.286 -1.968  4.238   41.447 -1.158 -0.835 3.198 5.966   
2.770   41.698 7  CC_DC10DA11:DT46DG47_DD  C 10 ? D 47 ? C 11 ? D 46 ? 
1 C DA  8  1_555 D DT 18 1_555 C DA  9  1_555 D DT 17 1_555 0.148  -0.598 3.033 -2.934  -0.222  25.550 -1.285 -1.096 3.002 -0.500  
6.605   25.716 8  CC_DA11DA12:DT45DT46_DD  C 11 ? D 46 ? C 12 ? D 45 ? 
1 C DA  9  1_555 D DT 17 1_555 C DG  10 1_555 D DC 16 1_555 -0.142 -1.388 3.806 -2.122  0.266   32.001 -2.567 -0.187 3.796 0.481   
3.844   32.071 9  CC_DA12DG13:DC44DT45_DD  C 12 ? D 45 ? C 13 ? D 44 ? 
1 C DG  10 1_555 D DC 16 1_555 C DT  11 1_555 D DA 15 1_555 0.114  -1.342 3.307 3.119   3.996   31.181 -3.197 0.363  3.112 7.373   
-5.754  31.581 10 CC_DG13DT14:DA43DC44_DD  C 13 ? D 44 ? C 14 ? D 43 ? 
1 C DT  11 1_555 D DA 15 1_555 C DA  12 1_555 D DT 14 1_555 0.362  0.098  3.042 -0.411  -0.853  43.969 0.206  -0.520 3.036 -1.139  
0.549   43.979 11 CC_DT14DA15:DT42DA43_DD  C 14 ? D 43 ? C 15 ? D 42 ? 
1 C DA  12 1_555 D DT 14 1_555 C 5IU 13 1_555 D DA 13 1_555 -0.209 -0.701 3.575 8.827   -0.658  38.808 -0.947 1.424  3.458 -0.976  
-13.079 39.766 12 CC_DA155IU16:DA41DT42_DD C 15 ? D 42 ? C 16 ? D 41 ? 
1 C 5IU 13 1_555 D DA 13 1_555 C DG  14 1_555 D DC 12 1_555 0.286  1.658  3.315 7.298   8.761   30.200 1.277  0.909  3.615 16.111  
-13.421 32.234 13 CC_5IU16DG17:DC40DA41_DD C 16 ? D 41 ? C 17 ? D 40 ? 
1 C DG  14 1_555 D DC 12 1_555 C DA  15 1_555 D DT 11 1_555 -0.612 1.038  2.894 -9.799  6.976   33.323 0.737  -0.358 3.095 11.701  
16.436  35.369 14 CC_DG17DA18:DT39DC40_DD  C 17 ? D 40 ? C 18 ? D 39 ? 
1 C DA  15 1_555 D DT 11 1_555 C DA  16 1_555 D DT 10 1_555 -0.372 -0.695 3.301 -1.638  0.126   32.819 -1.250 0.374  3.312 0.222   
2.896   32.859 15 CC_DA18DA19:DT38DT39_DD  C 18 ? D 39 ? C 19 ? D 38 ? 
1 C DA  16 1_555 D DT 10 1_555 C DA  17 1_555 D DT 9  1_555 0.705  -0.534 3.163 -1.168  -5.051  31.614 -0.078 -1.483 3.181 -9.194  
2.126   32.025 16 CC_DA19DA20:DT37DT38_DD  C 19 ? D 38 ? C 20 ? D 37 ? 
1 C DA  17 1_555 D DT 9  1_555 C DT  18 1_555 D DA 8  1_555 0.961  -0.796 3.214 -1.423  -0.933  44.191 -0.971 -1.407 3.199 -1.240  
1.891   44.222 17 CC_DA20DT21:DA36DT37_DD  C 20 ? D 37 ? C 21 ? D 36 ? 
1 C DT  18 1_555 D DA 8  1_555 C DG  19 1_555 D DC 7  1_555 -0.396 -0.666 2.774 -3.552  5.534   31.407 -2.040 0.182  2.649 10.085  
6.472   32.072 18 CC_DT21DG22:DC35DA36_DD  C 21 ? D 36 ? C 22 ? D 35 ? 
1 C DG  19 1_555 D DC 7  1_555 C DT  20 1_555 D DA 6  1_555 -0.972 -0.218 3.388 4.019   -3.209  37.523 0.085  2.026  3.278 -4.960  
-6.212  37.862 19 CC_DG22DT23:DA34DC35_DD  C 22 ? D 35 ? C 23 ? D 34 ? 
1 C DT  20 1_555 D DA 6  1_555 C DC  21 1_555 D DG 5  1_555 0.493  0.241  3.168 2.904   4.687   33.343 -0.329 -0.387 3.202 8.099   
-5.019  33.783 20 CC_DT23DC24:DG33DA34_DD  C 23 ? D 34 ? C 24 ? D 33 ? 
1 C DC  21 1_555 D DG 5  1_555 C DG  22 1_555 D DC 4  1_555 -0.209 0.495  3.550 -4.908  4.710   32.890 0.007  -0.524 3.578 8.210   
8.555   33.567 21 CC_DC24DG25:DC32DG33_DD  C 24 ? D 33 ? C 25 ? D 32 ? 
1 C DG  22 1_555 D DC 4  1_555 C DT  23 1_555 D DA 3  1_555 -0.338 -1.216 3.493 -3.437  -2.108  37.296 -1.593 0.039  3.570 -3.284  
5.355   37.506 22 CC_DG25DT26:DA31DC32_DD  C 25 ? D 32 ? C 26 ? D 31 ? 
1 C DT  23 1_555 D DA 3  1_555 C DT  24 1_555 D DA 2  1_555 0.346  -0.889 3.064 -0.233  -3.837  30.726 -0.959 -0.691 3.147 -7.206  
0.438   30.960 23 CC_DT26DT27:DA30DA31_DD  C 26 ? D 31 ? C 27 ? D 30 ? 
1 C DT  24 1_555 D DA 2  1_555 C DT  25 1_555 D DA 1  1_555 0.082  -0.252 2.971 8.220   0.443   39.084 -0.416 0.743  2.925 0.654   
-12.124 39.909 24 CC_DT27DT28:DA29DA30_DD  C 27 ? D 30 ? C 28 ? D 29 ? 
1 E DG  1  1_555 F DC 25 1_555 E DG  2  1_555 F DC 24 1_555 -0.264 -2.073 2.426 16.965  -1.529  19.716 -4.297 4.030  1.797 -3.695  
-41.009 26.000 25 EE_DG4DG5:DC52DC53_FF    E 4  ? F 53 ? E 5  ? F 52 ? 
1 E DG  2  1_555 F DC 24 1_555 E DT  3  1_555 F DA 23 1_555 -1.086 -0.603 3.150 -0.184  1.476   34.944 -1.217 1.781  3.129 2.457   
0.306   34.975 26 EE_DG5DT6:DA51DC52_FF    E 5  ? F 52 ? E 6  ? F 51 ? 
1 E DT  3  1_555 F DA 23 1_555 E DG  4  1_555 F DC 22 1_555 0.402  0.097  3.122 -2.728  -1.945  33.611 0.467  -1.111 3.071 -3.354  
4.703   33.773 27 EE_DT6DG7:DC50DA51_FF    E 6  ? F 51 ? E 7  ? F 50 ? 
1 E DG  4  1_555 F DC 22 1_555 E DT  5  1_555 F DA 21 1_555 -0.785 -0.705 3.086 4.061   4.425   30.122 -2.125 2.211  2.828 8.409   
-7.718  30.701 28 EE_DG7DT8:DA49DC50_FF    E 7  ? F 50 ? E 8  ? F 49 ? 
1 E DT  5  1_555 F DA 21 1_555 E DA  6  1_555 F DT 20 1_555 1.606  0.261  2.802 -10.587 -4.677  37.070 0.844  -3.440 2.230 -7.146  
16.175  38.774 29 EE_DT8DA9:DT48DA49_FF    E 8  ? F 49 ? E 9  ? F 48 ? 
1 E DA  6  1_555 F DT 20 1_555 E DC  7  1_555 F DG 19 1_555 -1.858 -1.004 3.745 3.740   0.582   32.256 -1.909 4.052  3.495 1.042   
-6.703  32.472 30 EE_DA9DC10:DG47DT48_FF   E 9  ? F 48 ? E 10 ? F 47 ? 
1 E DC  7  1_555 F DG 19 1_555 E DA  8  1_555 F DT 18 1_555 -0.065 -1.172 3.247 -7.248  1.299   45.752 -1.599 -0.527 3.189 1.658   
9.252   46.310 31 EE_DC10DA11:DT46DG47_FF  E 10 ? F 47 ? E 11 ? F 46 ? 
1 E DA  8  1_555 F DT 18 1_555 E DA  9  1_555 F DT 17 1_555 0.058  -0.562 3.070 1.729   0.675   26.059 -1.415 0.313  3.052 1.495   
-3.828  26.124 32 EE_DA11DA12:DT45DT46_FF  E 11 ? F 46 ? E 12 ? F 45 ? 
1 E DA  9  1_555 F DT 17 1_555 E DG  10 1_555 F DC 16 1_555 -0.519 -1.330 3.782 -1.037  2.488   31.987 -2.916 0.725  3.686 4.506   
1.877   32.097 33 EE_DA12DG13:DC44DT45_FF  E 12 ? F 45 ? E 13 ? F 44 ? 
1 E DG  10 1_555 F DC 16 1_555 E DT  11 1_555 F DA 15 1_555 0.017  -0.624 3.193 3.054   -3.470  33.673 -0.521 0.453  3.228 -5.956  
-5.240  33.980 34 EE_DG13DT14:DA43DC44_FF  E 13 ? F 44 ? E 14 ? F 43 ? 
1 E DT  11 1_555 F DA 15 1_555 E DA  12 1_555 F DT 14 1_555 0.488  0.412  3.569 -2.887  1.195   33.413 0.501  -1.360 3.528 2.073   
5.008   33.555 35 EE_DT14DA15:DT42DA43_FF  E 14 ? F 43 ? E 15 ? F 42 ? 
1 E DA  12 1_555 F DT 14 1_555 E DG  14 1_555 F DC 12 1_555 -0.639 0.970  6.714 6.010   14.508  69.684 -0.203 0.977  6.713 12.537  
-5.193  71.212 36 EE_DA15DG17:DC40DT42_FF  E 15 ? F 42 ? E 17 ? F 40 ? 
1 E DG  14 1_555 F DC 12 1_555 E DA  15 1_555 F DT 11 1_555 -0.770 1.172  2.855 -5.004  5.246   35.865 1.207  0.597  3.066 8.414   
8.025   36.567 37 EE_DG17DA18:DT39DC40_FF  E 17 ? F 40 ? E 18 ? F 39 ? 
1 E DA  15 1_555 F DT 11 1_555 E DA  16 1_555 F DT 10 1_555 -0.395 -0.288 3.421 -3.162  -3.190  37.482 -0.011 0.180  3.454 -4.943  
4.899   37.740 38 EE_DA18DA19:DT38DT39_FF  E 18 ? F 39 ? E 19 ? F 38 ? 
1 E DA  16 1_555 F DT 10 1_555 E DA  17 1_555 F DT 9  1_555 0.315  -0.462 2.947 -5.088  -8.048  38.013 0.189  -1.026 2.917 -12.125 
7.666   39.145 39 EE_DA19DA20:DT37DT38_FF  E 19 ? F 38 ? E 20 ? F 37 ? 
1 E DA  17 1_555 F DT 9  1_555 E DT  18 1_555 F DA 8  1_555 0.833  -1.294 3.546 3.964   0.080   29.249 -2.559 -0.708 3.621 0.158   
-7.804  29.511 40 EE_DA20DT21:DA36DT37_FF  E 20 ? F 37 ? E 21 ? F 36 ? 
1 E DT  18 1_555 F DA 8  1_555 E DG  19 1_555 F DC 7  1_555 0.084  -0.882 3.551 -1.060  5.643   37.517 -2.125 -0.273 3.384 8.711   
1.636   37.939 41 EE_DT21DG22:DC35DA36_FF  E 21 ? F 36 ? E 22 ? F 35 ? 
1 E DG  19 1_555 F DC 7  1_555 E DT  20 1_555 F DA 6  1_555 -0.846 -0.287 3.100 -3.490  -0.514  39.162 -0.368 0.860  3.164 -0.765  
5.194   39.314 42 EE_DG22DT23:DA34DC35_FF  E 22 ? F 35 ? E 23 ? F 34 ? 
1 E DT  20 1_555 F DA 6  1_555 E DC  21 1_555 F DG 5  1_555 0.225  -0.511 3.206 -0.653  4.433   29.541 -1.882 -0.568 3.092 8.632   
1.271   29.872 43 EE_DT23DC24:DG33DA34_FF  E 23 ? F 34 ? E 24 ? F 33 ? 
1 E DC  21 1_555 F DG 5  1_555 E DG  22 1_555 F DC 4  1_555 0.211  0.067  3.205 -4.343  -3.832  34.891 0.662  -0.972 3.133 -6.337  
7.182   35.354 44 EE_DC24DG25:DC32DG33_FF  E 24 ? F 33 ? E 25 ? F 32 ? 
1 E DG  22 1_555 F DC 4  1_555 E DT  23 1_555 F DA 3  1_555 0.567  -1.236 3.334 2.691   -2.010  29.811 -1.959 -0.520 3.444 -3.892  
-5.209  29.995 45 EE_DG25DT26:DA31DC32_FF  E 25 ? F 32 ? E 26 ? F 31 ? 
1 E DT  23 1_555 F DA 3  1_555 E DT  24 1_555 F DA 2  1_555 -0.610 -0.338 3.415 0.038   1.909   43.308 -0.652 0.830  3.397 2.585   
-0.051  43.348 46 EE_DT26DT27:DA30DA31_FF  E 26 ? F 31 ? E 27 ? F 30 ? 
1 E DT  24 1_555 F DA 2  1_555 E DT  25 1_555 F DA 1  1_555 0.311  -0.465 3.253 2.342   4.412   34.813 -1.421 -0.168 3.185 7.327   
-3.890  35.158 47 EE_DT27DT28:DA29DA30_FF  E 27 ? F 30 ? E 28 ? F 29 ? 
1 G DG  1  1_555 H DC 25 1_555 G DG  2  1_555 H DC 24 1_555 -0.935 0.048  3.102 -7.888  10.092  24.400 -2.369 0.036  3.038 22.041  
17.228  27.513 48 GG_DG4DG5:DC52DC53_HH    G 4  ? H 53 ? G 5  ? H 52 ? 
1 G DG  2  1_555 H DC 24 1_555 G DT  3  1_555 H DA 23 1_555 -0.100 -0.574 2.907 -0.063  11.456  29.797 -2.838 0.172  2.520 21.313  
0.117   31.877 49 GG_DG5DT6:DA51DC52_HH    G 5  ? H 52 ? G 6  ? H 51 ? 
1 G DT  3  1_555 H DA 23 1_555 G DG  4  1_555 H DC 22 1_555 -0.319 -0.103 3.004 3.941   6.794   38.243 -0.902 0.911  2.899 10.239  
-5.939  39.012 50 GG_DT6DG7:DC50DA51_HH    G 6  ? H 51 ? G 7  ? H 50 ? 
1 G DG  4  1_555 H DC 22 1_555 G DT  5  1_555 H DA 21 1_555 -0.973 -0.685 3.406 2.161   -3.979  20.079 -0.086 3.718  3.355 -11.227 
-6.097  20.578 51 GG_DG7DT8:DA49DC50_HH    G 7  ? H 50 ? G 8  ? H 49 ? 
1 G DT  5  1_555 H DA 21 1_555 G DA  6  1_555 H DT 20 1_555 0.135  -0.470 3.672 -4.749  14.155  36.747 -2.520 -0.812 3.242 21.401  
7.181   39.567 52 GG_DT8DA9:DT48DA49_HH    G 8  ? H 49 ? G 9  ? H 48 ? 
1 G DA  6  1_555 H DT 20 1_555 G DC  7  1_555 H DG 19 1_555 0.479  0.239  2.945 4.251   -5.851  47.144 0.719  -0.285 2.927 -7.265  
-5.279  47.664 53 GG_DA9DC10:DG47DT48_HH   G 9  ? H 48 ? G 10 ? H 47 ? 
1 G DC  7  1_555 H DG 19 1_555 G DA  8  1_555 H DT 18 1_555 -0.521 -1.224 4.667 2.333   5.438   28.813 -4.028 1.720  4.313 10.785  
-4.627  29.402 54 GG_DC10DA11:DT46DG47_HH  G 10 ? H 47 ? G 11 ? H 46 ? 
1 G DA  8  1_555 H DT 18 1_555 G DA  9  1_555 H DT 17 1_555 0.082  0.001  2.436 -4.654  -1.887  37.047 0.186  -0.583 2.405 -2.953  
7.284   37.374 55 GG_DA11DA12:DT45DT46_HH  G 11 ? H 46 ? G 12 ? H 45 ? 
1 G DA  9  1_555 H DT 17 1_555 G DG  10 1_555 H DC 16 1_555 0.701  -0.568 3.069 -2.304  4.530   33.240 -1.663 -1.558 2.914 7.861   
3.999   33.615 56 GG_DA12DG13:DC44DT45_HH  G 12 ? H 45 ? G 13 ? H 44 ? 
1 G DG  10 1_555 H DC 16 1_555 G 5IU 13 1_555 H DT 14 1_555 -1.750 -1.270 7.005 14.705  -4.377  84.767 -0.723 1.988  6.741 -3.223  
-10.830 85.885 57 GG_DG135IU16:DT42DC44_HH G 13 ? H 44 ? G 16 ? H 42 ? 
1 G 5IU 13 1_555 H DT 14 1_555 G DG  14 1_555 H DC 12 1_555 2.393  0.082  6.539 -6.075  3.149   63.177 -0.194 -2.798 6.307 2.997   
5.781   63.509 58 GG_5IU16DG17:DC40DT42_HH G 16 ? H 42 ? G 17 ? H 40 ? 
1 G DG  14 1_555 H DC 12 1_555 G DA  15 1_555 H DT 11 1_555 0.179  0.210  2.706 1.900   3.986   30.687 -0.247 -0.030 2.717 7.483   
-3.567  30.996 59 GG_DG17DA18:DT39DC40_HH  G 17 ? H 40 ? G 18 ? H 39 ? 
1 G DA  15 1_555 H DT 11 1_555 G DA  16 1_555 H DT 10 1_555 -0.914 -0.152 3.165 -2.385  0.134   43.434 -0.218 1.008  3.208 0.181   
3.219   43.496 60 GG_DA18DA19:DT38DT39_HH  G 18 ? H 39 ? G 19 ? H 38 ? 
1 G DA  16 1_555 H DT 10 1_555 G DA  17 1_555 H DT 9  1_555 0.411  -0.821 3.349 -1.171  -12.139 39.441 0.225  -0.718 3.432 -17.486 
1.687   41.212 61 GG_DA19DA20:DT37DT38_HH  G 19 ? H 38 ? G 20 ? H 37 ? 
1 G DA  17 1_555 H DT 9  1_555 G DT  18 1_555 H DA 8  1_555 0.296  -1.188 3.085 3.976   -0.957  29.685 -2.110 0.211  3.133 -1.857  
-7.715  29.959 62 GG_DA20DT21:DA36DT37_HH  G 20 ? H 37 ? G 21 ? H 36 ? 
1 G DT  18 1_555 H DA 8  1_555 G DG  19 1_555 H DC 7  1_555 1.218  -0.576 3.519 6.244   6.925   36.119 -1.905 -1.002 3.508 10.946  
-9.869  37.264 63 GG_DT21DG22:DC35DA36_HH  G 21 ? H 36 ? G 22 ? H 35 ? 
1 G DG  19 1_555 H DC 7  1_555 G DT  20 1_555 H DA 6  1_555 -0.776 -0.505 2.940 -5.910  0.510   30.463 -1.034 0.404  3.025 0.959   
11.115  31.022 64 GG_DG22DT23:DA34DC35_HH  G 22 ? H 35 ? G 23 ? H 34 ? 
1 G DT  20 1_555 H DA 6  1_555 G DC  21 1_555 H DG 5  1_555 1.269  -0.372 3.468 0.311   -0.619  41.148 -0.458 -1.769 3.482 -0.881  
-0.443  41.154 65 GG_DT23DC24:DG33DA34_HH  G 23 ? H 34 ? G 24 ? H 33 ? 
1 G DC  21 1_555 H DG 5  1_555 G DG  22 1_555 H DC 4  1_555 -0.433 0.071  3.541 5.135   7.620   40.439 -0.776 1.203  3.421 10.855  
-7.314  41.427 66 GG_DC24DG25:DC32DG33_HH  G 24 ? H 33 ? G 25 ? H 32 ? 
1 G DG  22 1_555 H DC 4  1_555 G DT  23 1_555 H DA 3  1_555 0.168  -1.460 2.968 -12.157 14.009  20.656 -5.672 -2.627 1.420 31.969  
27.743  27.695 67 GG_DG25DT26:DA31DC32_HH  G 25 ? H 32 ? G 26 ? H 31 ? 
1 G DT  23 1_555 H DA 3  1_555 G DT  24 1_555 H DA 2  1_555 -1.015 -0.801 2.879 -1.756  7.682   25.333 -3.485 1.815  2.591 17.000  
3.886   26.511 68 GG_DT26DT27:DA30DA31_HH  G 26 ? H 31 ? G 27 ? H 30 ? 
1 G DT  24 1_555 H DA 2  1_555 G DT  25 1_555 H DA 1  1_555 -0.427 -0.735 2.482 -3.530  -1.582  36.972 -0.991 0.308  2.539 -2.486  
5.548   37.167 69 GG_DT27DT28:DA29DA30_HH  G 27 ? H 30 ? G 28 ? H 29 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION' MN  
5 'SULFATE ION'        SO4 
6 water                HOH 
#