data_3HOU
# 
_entry.id   3HOU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HOU         
NDB   NA0030       
RCSB  RCSB053398   
WWPDB D_1000053398 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3HOV . unspecified 
PDB 3HOW . unspecified 
PDB 3HOX . unspecified 
PDB 3HOY . unspecified 
PDB 3HOZ . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3HOU 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-03 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sydow, J.F.'    1 
'Brueckner, F.'  2 
'Cheung, A.C.M.' 3 
'Damsma, G.E.'   4 
'Dengl, S.'      5 
'Lehmann, E.'    6 
'Vassylyev, D.'  7 
'Cramer, P.'     8 
# 
_citation.id                        primary 
_citation.title                     
'Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            34 
_citation.page_first                710 
_citation.page_last                 721 
_citation.year                      2009 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19560423 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2009.06.002 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sydow, J.F.'    1 
primary 'Brueckner, F.'  2 
primary 'Cheung, A.C.M.' 3 
primary 'Damsma, G.E.'   4 
primary 'Dengl, S.'      5 
primary 'Lehmann, E.'    6 
primary 'Vassylyev, D.'  7 
primary 'Cramer, P.'     8 
# 
_cell.entry_id           3HOU 
_cell.length_a           394.264 
_cell.length_b           221.614 
_cell.length_c           283.446 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.90 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HOU 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                                               191821.578 2  
2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                                               138937.297 2  
2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                                               35330.457  2  
2.7.7.6 ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB4'                                               25451.191  2  
2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1'                                25117.094  2  
2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2'                                17931.834  2  
2.7.7.6 ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB7'                                               19081.053  2  
2.7.7.6 ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3'                                16525.363  2  
2.7.7.6 ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                                               14308.161  2  
2.7.7.6 ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5'                                8290.732   2  
2.7.7.6 ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'                                              13633.493  2  
2.7.7.6 ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4'                                7729.969   2  
2.7.7.6 ? ? ? 
13 polymer     syn "5'-D(*AP*GP*CP*TP*CP*A*AP*GP*TP*AP*GP*TP*TP*AP*TP*GP*CP*CP*(BRU)P*GP*GP*TP*CP*AP*TP*T)-3'" 8058.032   2  ? ? ? 
? 
14 polymer     syn "5'-D(*A*AP*CP*TP*AP*CP*TP*TP*GP*AP*GP*CP*T)-3'"                                            3950.598   2  ? ? ? 
? 
15 polymer     syn "5'-R(*UP*GP*CP*AP*UP*U*UP*CP*GP*AP*CP*CP*AP*GP*GP*CP*U)-3'"                                5380.222   2  ? ? ? 
? 
16 non-polymer syn 'ZINC ION'                                                                                  65.409     16 ? ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit B1, RNA polymerase II subunit 1, DNA-directed RNA polymerase III largest subunit, RNA polymerase II subunit B220
;
2  'RNA polymerase II subunit 2, DNA-directed RNA polymerase II 140 kDa polypeptide, B150' 
3  'RNA polymerase II subunit B3, RNA polymerase II subunit 3, DNA-directed RNA polymerase II 45 kDa polypeptide, B44.5' 
4  'RNA polymerase II subunit B4, DNA-directed RNA polymerase II 32 kDa polypeptide, B32' 
5  'RNA polymerases I, II, and III subunit ABC1, DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide, ABC27' 
6  'RNA polymerases I, II, and III subunit ABC2, DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide, ABC23' 
7  'RNA polymerase II subunit B7, B16' 
8  
'RNA polymerases I, II, and III subunit ABC3, DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide, ABC14.5, ABC14.4' 
9  
'RNA polymerase II subunit B9, DNA-directed RNA polymerase II subunit 9, DNA-directed RNA polymerase II 14.2 kDa polypeptide, B12.6' 
10 
'RNA polymerases I, II, and III subunit ABC5, DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide, ABC10-beta, ABC8' 
11 'RNA polymerase II subunit B11, DNA-directed RNA polymerase II 13.6 kDa polypeptide, B13.6' 
12 'RNA polymerases I, II, and III subunit ABC4, ABC10-alpha' 
13 'TEMPLATE DNA' 
14 'NONTEMPLATE DNA' 
15 'PRODUCT RNA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A,M ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B,N ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C,O ? 
4  'polypeptide(L)'        no no  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D,P ? 
5  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E,Q ? 
6  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F,R ? 
7  'polypeptide(L)'        no no  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G,S ? 
8  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H,T ? 
9  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I,U ? 
10 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J,V ? 
11 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K,W ? 
12 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L,X ? 
13 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DG)(DT)(DT)(DA)(DT)(DG)(DC)(DC)(BRU)
(DG)(DG)(DT)(DC)(DA)(DT)(DT)
;
AGCTCAAGTAGTTATGCCUGGTCATT 1,4 ? 
14 polydeoxyribonucleotide no no  '(DA)(DA)(DC)(DT)(DA)(DC)(DT)(DT)(DG)(DA)(DG)(DC)(DT)' AACTACTTGAGCT 2,5 ? 
15 polyribonucleotide      no no  UGCAUUUCGACCAGGCU UGCAUUUCGACCAGGCU 3,6 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    DA  n 
13 2    DG  n 
13 3    DC  n 
13 4    DT  n 
13 5    DC  n 
13 6    DA  n 
13 7    DA  n 
13 8    DG  n 
13 9    DT  n 
13 10   DA  n 
13 11   DG  n 
13 12   DT  n 
13 13   DT  n 
13 14   DA  n 
13 15   DT  n 
13 16   DG  n 
13 17   DC  n 
13 18   DC  n 
13 19   BRU n 
13 20   DG  n 
13 21   DG  n 
13 22   DT  n 
13 23   DC  n 
13 24   DA  n 
13 25   DT  n 
13 26   DT  n 
14 1    DA  n 
14 2    DA  n 
14 3    DC  n 
14 4    DT  n 
14 5    DA  n 
14 6    DC  n 
14 7    DT  n 
14 8    DT  n 
14 9    DG  n 
14 10   DA  n 
14 11   DG  n 
14 12   DC  n 
14 13   DT  n 
15 1    U   n 
15 2    G   n 
15 3    C   n 
15 4    A   n 
15 5    U   n 
15 6    U   n 
15 7    U   n 
15 8    C   n 
15 9    G   n 
15 10   A   n 
15 11   C   n 
15 12   C   n 
15 13   A   n 
15 14   G   n 
15 15   G   n 
15 16   C   n 
15 17   U   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  P04050 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 ? 
2  UNP RPB2_YEAST  P08518 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 ? 
3  UNP RPB3_YEAST  P16370 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 ? 
4  UNP RPB4_YEAST  P20433 4  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
1 ? 
5  UNP RPAB1_YEAST P20434 5  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 ? 
6  UNP RPAB2_YEAST P20435 6  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 ? 
7  UNP RPB7_YEAST  P34087 7  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
1 ? 
8  UNP RPAB3_YEAST P20436 8  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 ? 
9  UNP RPB9_YEAST  P27999 9  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 ? 
10 UNP RPAB5_YEAST P22139 10 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 ? 
11 UNP RPB11_YEAST P38902 11 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 ? 
12 UNP RPAB4_YEAST P40422 12 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 ? 
13 PDB 3HOU        3HOU   13 ? ? ? 
14 PDB 3HOU        3HOU   14 ? ? ? 
15 PDB 3HOU        3HOU   15 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3HOU A 1 ? 1733 ? P04050 1  ? 1733 ? 1  1733 
2  2  3HOU B 1 ? 1224 ? P08518 1  ? 1224 ? 1  1224 
3  3  3HOU C 1 ? 318  ? P16370 1  ? 318  ? 1  318  
4  4  3HOU D 1 ? 221  ? P20433 1  ? 221  ? 1  221  
5  5  3HOU E 1 ? 215  ? P20434 1  ? 215  ? 1  215  
6  6  3HOU F 1 ? 155  ? P20435 1  ? 155  ? 1  155  
7  7  3HOU G 1 ? 171  ? P34087 1  ? 171  ? 1  171  
8  8  3HOU H 1 ? 146  ? P20436 1  ? 146  ? 1  146  
9  9  3HOU I 1 ? 122  ? P27999 1  ? 122  ? 1  122  
10 10 3HOU J 1 ? 70   ? P22139 1  ? 70   ? 1  70   
11 11 3HOU K 1 ? 120  ? P38902 1  ? 120  ? 1  120  
12 12 3HOU L 1 ? 70   ? P40422 1  ? 70   ? 1  70   
13 1  3HOU M 1 ? 1733 ? P04050 1  ? 1733 ? 1  1733 
14 2  3HOU N 1 ? 1224 ? P08518 1  ? 1224 ? 1  1224 
15 3  3HOU O 1 ? 318  ? P16370 1  ? 318  ? 1  318  
16 4  3HOU P 1 ? 221  ? P20433 1  ? 221  ? 1  221  
17 5  3HOU Q 1 ? 215  ? P20434 1  ? 215  ? 1  215  
18 6  3HOU R 1 ? 155  ? P20435 1  ? 155  ? 1  155  
19 7  3HOU S 1 ? 171  ? P34087 1  ? 171  ? 1  171  
20 8  3HOU T 1 ? 146  ? P20436 1  ? 146  ? 1  146  
21 9  3HOU U 1 ? 122  ? P27999 1  ? 122  ? 1  122  
22 10 3HOU V 1 ? 70   ? P22139 1  ? 70   ? 1  70   
23 11 3HOU W 1 ? 120  ? P38902 1  ? 120  ? 1  120  
24 12 3HOU X 1 ? 70   ? P40422 1  ? 70   ? 1  70   
25 13 3HOU 1 1 ? 26   ? 3HOU   5  ? 30   ? 5  30   
26 13 3HOU 4 1 ? 26   ? 3HOU   5  ? 30   ? 5  30   
27 14 3HOU 2 1 ? 13   ? 3HOU   0  ? 12   ? 0  12   
28 14 3HOU 5 1 ? 13   ? 3HOU   0  ? 12   ? 0  12   
29 15 3HOU 3 1 ? 17   ? 3HOU   -6 ? 10   ? -6 10   
30 15 3HOU 6 1 ? 17   ? 3HOU   -6 ? 10   ? -6 10   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                 ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                 ? 'Zn 2'              65.409  
# 
_exptl.entry_id          3HOU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.82 
_exptl_crystal.density_percent_sol   78.88 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
;200mM ammonium acetate, 300mM SODIUM ACETATE, 50mM Hepes pH 7.0, 4-6% PEG 6000, 5mM TCEP, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2007-04-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9189 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9189 
# 
_reflns.entry_id                     3HOU 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            3.2 
_reflns.number_obs                   372166 
_reflns.number_all                   372166 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        20.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3HOU 
_refine.ls_number_reflns_obs                     372166 
_refine.ls_number_reflns_all                     372166 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40 
_refine.ls_d_res_high                            3.2 
_refine.ls_percent_reflns_obs                    95.6 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1Y1W 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        62218 
_refine_hist.pdbx_number_atoms_nucleic_acid   1430 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               63664 
_refine_hist.d_res_high                       3.2 
_refine_hist.d_res_low                        40 
# 
_struct.entry_id                  3HOU 
_struct.title                     'Complete RNA polymerase II elongation complex I with a T-U mismatch' 
_struct.pdbx_descriptor           'RNA polymerase II (E.C.2.7.7.6)/DNA/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HOU 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION,TRANSFERASE/DNA/RNA HYBRID' 
_struct_keywords.text            
;RNA POLYMERASE II, METAL-BINDING, TRANSCRIPTION BUBBLE, ELONGATION COMPLEX, TRANSCRIPTION, DNA-RNA MISMATCH, DNA-binding, DNA-directed RNA polymerase, Isopeptide bond, Magnesium, Nucleotidyltransferase, Nucleus, Phosphoprotein, Transferase, Ubl conjugation, Zinc, Zinc-finger, Polymorphism, Cytoplasm, DNA damage, DNA repair, mRNA processing, TRANSFERASE-DNA-RNA HYBRID COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 1  ? 
Q  N N 2  ? 
R  N N 3  ? 
S  N N 4  ? 
T  N N 5  ? 
U  N N 6  ? 
V  N N 7  ? 
W  N N 8  ? 
X  N N 9  ? 
Y  N N 10 ? 
Z  N N 11 ? 
AA N N 12 ? 
BA N N 13 ? 
CA N N 14 ? 
DA N N 15 ? 
EA N N 16 ? 
FA N N 16 ? 
GA N N 16 ? 
HA N N 16 ? 
IA N N 16 ? 
JA N N 16 ? 
KA N N 16 ? 
LA N N 16 ? 
MA N N 16 ? 
NA N N 16 ? 
OA N N 16 ? 
PA N N 16 ? 
QA N N 16 ? 
RA N N 16 ? 
SA N N 16 ? 
TA N N 16 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   MET A 41   ? GLN A 45   ? MET A 41   GLN A 45   5 ? 5  
HELX_P HELX_P3   3   PHE A 95   ? GLU A 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P4   4   ASN A 119  ? ILE A 128  ? ASN A 119  ILE A 128  1 ? 10 
HELX_P HELX_P5   5   ASP A 130  ? LYS A 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P6   6   SER A 203  ? ILE A 214  ? SER A 203  ILE A 214  1 ? 12 
HELX_P HELX_P7   7   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P8   8   ARG A 230  ? ILE A 235  ? ARG A 230  ILE A 235  5 ? 6  
HELX_P HELX_P9   9   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P10  10  ASP A 260  ? HIS A 281  ? ASP A 260  HIS A 281  1 ? 22 
HELX_P HELX_P11  11  PRO A 285  ? TYR A 303  ? PRO A 285  TYR A 303  1 ? 19 
HELX_P HELX_P12  12  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P13  13  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P14  14  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P15  15  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P16  16  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P17  17  ASN A 471  ? SER A 473  ? ASN A 471  SER A 473  5 ? 3  
HELX_P HELX_P18  18  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P19  19  SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P20  20  ALA A 506  ? ILE A 511  ? ALA A 506  ILE A 511  1 ? 6  
HELX_P HELX_P21  21  VAL A 524  ? LEU A 534  ? VAL A 524  LEU A 534  1 ? 11 
HELX_P HELX_P22  22  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P23  23  GLY A 574  ? ILE A 582  ? GLY A 574  ILE A 582  1 ? 9  
HELX_P HELX_P24  24  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P25  25  GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P26  26  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P27  27  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P28  28  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P29  29  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P30  30  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P31  31  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P32  32  SER A 793  ? GLY A 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P33  33  THR A 809  ? ALA A 844  ? THR A 809  ALA A 844  1 ? 36 
HELX_P HELX_P34  34  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P35  35  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P36  36  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P37  37  LEU A 913  ? SER A 917  ? LEU A 913  SER A 917  5 ? 5  
HELX_P HELX_P38  38  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P39  39  ASN A 959  ? PHE A 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P40  40  THR A 982  ? GLU A 995  ? THR A 982  GLU A 995  1 ? 14 
HELX_P HELX_P41  41  ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P42  42  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P43  43  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P44  44  MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P45  45  GLY A 1097 ? VAL A 1107 ? GLY A 1097 VAL A 1107 1 ? 11 
HELX_P HELX_P46  46  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P47  47  LEU A 1143 ? VAL A 1146 ? LEU A 1143 VAL A 1146 1 ? 4  
HELX_P HELX_P48  48  ASP A 1166 ? HIS A 1173 ? ASP A 1166 HIS A 1173 1 ? 8  
HELX_P HELX_P49  49  ALA A 1200 ? LYS A 1205 ? ALA A 1200 LYS A 1205 1 ? 6  
HELX_P HELX_P50  50  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P51  51  GLU A 1255 ? LYS A 1261 ? GLU A 1255 LYS A 1261 1 ? 7  
HELX_P HELX_P52  52  LYS A 1261 ? GLU A 1269 ? LYS A 1261 GLU A 1269 1 ? 9  
HELX_P HELX_P53  53  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P54  54  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P55  55  GLY A 1340 ? ASP A 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P56  56  TYR A 1365 ? THR A 1377 ? TYR A 1365 THR A 1377 1 ? 13 
HELX_P HELX_P57  57  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P58  58  GLY A 1395 ? CYS A 1400 ? GLY A 1395 CYS A 1400 1 ? 6  
HELX_P HELX_P59  59  GLU A 1404 ? SER A 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P60  60  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P61  61  ILE A 1436 ? GLY A 1439 ? ILE A 1436 GLY A 1439 5 ? 4  
HELX_P HELX_P62  62  GLU A 1448 ? TYR A 1453 ? GLU A 1448 TYR A 1453 1 ? 6  
HELX_P HELX_P63  63  THR B 26   ? LYS B 41   ? THR B 26   LYS B 41   1 ? 16 
HELX_P HELX_P64  64  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P65  65  TYR B 57   ? ILE B 63   ? TYR B 57   ILE B 63   1 ? 7  
HELX_P HELX_P66  66  TYR B 113  ? ASN B 121  ? TYR B 113  ASN B 121  1 ? 9  
HELX_P HELX_P67  67  CYS B 179  ? GLU B 183  ? CYS B 179  GLU B 183  5 ? 5  
HELX_P HELX_P68  68  THR B 185  ? LYS B 191  ? THR B 185  LYS B 191  1 ? 7  
HELX_P HELX_P69  69  ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P70  70  GLU B 296  ? CYS B 302  ? GLU B 296  CYS B 302  1 ? 7  
HELX_P HELX_P71  71  ASP B 307  ? PHE B 322  ? ASP B 307  PHE B 322  1 ? 16 
HELX_P HELX_P72  72  ASP B 326  ? PHE B 333  ? ASP B 326  PHE B 333  1 ? 8  
HELX_P HELX_P73  73  GLU B 346  ? LYS B 358  ? GLU B 346  LYS B 358  1 ? 13 
HELX_P HELX_P74  74  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P75  75  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P76  76  LEU B 408  ? GLN B 433  ? LEU B 408  GLN B 433  1 ? 26 
HELX_P HELX_P77  77  LYS B 451  ? GLY B 464  ? LYS B 451  GLY B 464  1 ? 14 
HELX_P HELX_P78  78  THR B 487  ? ARG B 496  ? THR B 487  ARG B 496  1 ? 10 
HELX_P HELX_P79  79  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P80  80  PRO B 565  ? TYR B 569  ? PRO B 565  TYR B 569  5 ? 5  
HELX_P HELX_P81  81  ASN B 592  ? ARG B 605  ? ASN B 592  ARG B 605  1 ? 14 
HELX_P HELX_P82  82  ARG B 654  ? LYS B 660  ? ARG B 654  LYS B 660  1 ? 7  
HELX_P HELX_P83  83  LYS B 660  ? GLN B 667  ? LYS B 660  GLN B 667  1 ? 8  
HELX_P HELX_P84  84  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P85  85  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P86  86  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P87  87  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P88  88  PHE B 758  ? ASN B 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P89  89  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P90  90  LEU B 782  ? ARG B 788  ? LEU B 782  ARG B 788  5 ? 7  
HELX_P HELX_P91  91  ALA B 808  ? LYS B 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P92  92  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P93  93  ASN B 1013 ? ILE B 1017 ? ASN B 1013 ILE B 1017 5 ? 5  
HELX_P HELX_P94  94  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P95  95  THR B 1051 ? GLU B 1061 ? THR B 1051 GLU B 1061 1 ? 11 
HELX_P HELX_P96  96  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P97  97  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P98  98  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P99  99  PRO B 1197 ? MET B 1210 ? PRO B 1197 MET B 1210 1 ? 14 
HELX_P HELX_P100 100 ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P101 101 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P102 102 SER C 74   ? LEU C 80   ? SER C 74   LEU C 80   5 ? 7  
HELX_P HELX_P103 103 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P104 104 ILE C 163  ? GLY C 171  ? ILE C 163  GLY C 171  5 ? 9  
HELX_P HELX_P105 105 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P106 106 SER C 204  ? GLU C 208  ? SER C 204  GLU C 208  5 ? 5  
HELX_P HELX_P107 107 ASP C 241  ? MET C 265  ? ASP C 241  MET C 265  1 ? 25 
HELX_P HELX_P108 108 GLY D 30   ? GLN D 34   ? GLY D 30   GLN D 34   5 ? 5  
HELX_P HELX_P109 109 SER D 53   ? SER D 73   ? SER D 53   SER D 73   1 ? 21 
HELX_P HELX_P110 110 ARG D 119  ? THR D 134  ? ARG D 119  THR D 134  1 ? 16 
HELX_P HELX_P111 111 ASN D 138  ? PHE D 151  ? ASN D 138  PHE D 151  1 ? 14 
HELX_P HELX_P112 112 ASP D 156  ? LYS D 168  ? ASP D 156  LYS D 168  1 ? 13 
HELX_P HELX_P113 113 HIS D 173  ? LEU D 183  ? HIS D 173  LEU D 183  1 ? 11 
HELX_P HELX_P114 114 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P115 115 SER D 203  ? GLU D 218  ? SER D 203  GLU D 218  1 ? 16 
HELX_P HELX_P116 116 ASN E 5    ? ARG E 26   ? ASN E 5    ARG E 26   1 ? 22 
HELX_P HELX_P117 117 PRO E 38   ? ALA E 44   ? PRO E 38   ALA E 44   1 ? 7  
HELX_P HELX_P118 118 GLN E 54   ? MET E 58   ? GLN E 54   MET E 58   5 ? 5  
HELX_P HELX_P119 119 THR E 65   ? PHE E 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P120 120 GLY E 89   ? ASN E 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P121 121 ALA E 120  ? VAL E 124  ? ALA E 120  VAL E 124  5 ? 5  
HELX_P HELX_P122 122 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P123 123 SER E 157  ? TYR E 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P124 124 LYS E 171  ? LEU E 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P125 125 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P126 126 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P127 127 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P128 128 MET G 22   ? GLU G 35   ? MET G 22   GLU G 35   1 ? 14 
HELX_P HELX_P129 129 ASP G 50   ? ILE G 54   ? ASP G 50   ILE G 54   5 ? 5  
HELX_P HELX_P130 130 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P131 131 GLN H 83   ? ARG H 87   ? GLN H 83   ARG H 87   5 ? 5  
HELX_P HELX_P132 132 ASP J 16   ? GLU J 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P133 133 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P134 134 ARG J 43   ? HIS J 53   ? ARG J 43   HIS J 53   1 ? 11 
HELX_P HELX_P135 135 LEU J 56   ? ARG J 62   ? LEU J 56   ARG J 62   1 ? 7  
HELX_P HELX_P136 136 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P137 137 ASP K 39   ? LEU K 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P138 138 ASP K 82   ? LEU K 111  ? ASP K 82   LEU K 111  1 ? 30 
HELX_P HELX_P139 139 SER P 23   ? SER P 31   ? SER M 23   SER M 31   1 ? 9  
HELX_P HELX_P140 140 MET P 41   ? GLN P 45   ? MET M 41   GLN M 45   5 ? 5  
HELX_P HELX_P141 141 PHE P 95   ? GLU P 104  ? PHE M 95   GLU M 104  1 ? 10 
HELX_P HELX_P142 142 ASN P 119  ? ILE P 128  ? ASN M 119  ILE M 128  1 ? 10 
HELX_P HELX_P143 143 ASP P 130  ? LYS P 143  ? ASP M 130  LYS M 143  1 ? 14 
HELX_P HELX_P144 144 SER P 203  ? HIS P 213  ? SER M 203  HIS M 213  1 ? 11 
HELX_P HELX_P145 145 SER P 215  ? LEU P 222  ? SER M 215  LEU M 222  1 ? 8  
HELX_P HELX_P146 146 ARG P 230  ? ILE P 235  ? ARG M 230  ILE M 235  5 ? 6  
HELX_P HELX_P147 147 PRO P 243  ? ARG P 247  ? PRO M 243  ARG M 247  5 ? 5  
HELX_P HELX_P148 148 ASP P 260  ? HIS P 281  ? ASP M 260  HIS M 281  1 ? 22 
HELX_P HELX_P149 149 PRO P 285  ? TYR P 303  ? PRO M 285  TYR M 303  1 ? 19 
HELX_P HELX_P150 150 SER P 324  ? LYS P 330  ? SER M 324  LYS M 330  1 ? 7  
HELX_P HELX_P151 151 GLY P 334  ? LEU P 340  ? GLY M 334  LEU M 340  1 ? 7  
HELX_P HELX_P152 152 LYS P 368  ? LYS P 372  ? LYS M 368  LYS M 372  1 ? 5  
HELX_P HELX_P153 153 ASN P 384  ? GLY P 395  ? ASN M 384  GLY M 395  1 ? 12 
HELX_P HELX_P154 154 HIS P 451  ? MET P 453  ? HIS M 451  MET M 453  5 ? 3  
HELX_P HELX_P155 155 ASN P 471  ? SER P 473  ? ASN M 471  SER M 473  5 ? 3  
HELX_P HELX_P156 156 VAL P 474  ? ASN P 479  ? VAL M 474  ASN M 479  1 ? 6  
HELX_P HELX_P157 157 SER P 494  ? CYS P 505  ? SER M 494  CYS M 505  1 ? 12 
HELX_P HELX_P158 158 ALA P 506  ? ILE P 511  ? ALA M 506  ILE M 511  1 ? 6  
HELX_P HELX_P159 159 VAL P 524  ? LEU P 534  ? VAL M 524  LEU M 534  1 ? 11 
HELX_P HELX_P160 160 LEU P 543  ? VAL P 553  ? LEU M 543  VAL M 553  1 ? 11 
HELX_P HELX_P161 161 GLY P 574  ? ILE P 582  ? GLY M 574  ILE M 582  1 ? 9  
HELX_P HELX_P162 162 GLU P 618  ? GLY P 623  ? GLU M 618  GLY M 623  1 ? 6  
HELX_P HELX_P163 163 GLY P 628  ? GLY P 638  ? GLY M 628  GLY M 638  1 ? 11 
HELX_P HELX_P164 164 GLY P 638  ? GLY P 661  ? GLY M 638  GLY M 661  1 ? 24 
HELX_P HELX_P165 165 GLY P 665  ? ILE P 670  ? GLY M 665  ILE M 670  5 ? 6  
HELX_P HELX_P166 166 ASP P 672  ? ALA P 699  ? ASP M 672  ALA M 699  1 ? 28 
HELX_P HELX_P167 167 THR P 709  ? LEU P 737  ? THR M 709  LEU M 737  1 ? 29 
HELX_P HELX_P168 168 ASN P 741  ? GLY P 750  ? ASN M 741  GLY M 750  1 ? 10 
HELX_P HELX_P169 169 SER P 754  ? ALA P 763  ? SER M 754  ALA M 763  1 ? 10 
HELX_P HELX_P170 170 SER P 793  ? GLY P 798  ? SER M 793  GLY M 798  1 ? 6  
HELX_P HELX_P171 171 THR P 809  ? ALA P 844  ? THR M 809  ALA M 844  1 ? 36 
HELX_P HELX_P172 172 ILE P 867  ? ASP P 871  ? ILE M 867  ASP M 871  5 ? 5  
HELX_P HELX_P173 173 ASP P 874  ? ALA P 876  ? ASP M 874  ALA M 876  5 ? 3  
HELX_P HELX_P174 174 SER P 889  ? ARG P 898  ? SER M 889  ARG M 898  1 ? 10 
HELX_P HELX_P175 175 LEU P 913  ? SER P 917  ? LEU M 913  SER M 917  5 ? 5  
HELX_P HELX_P176 176 ASP P 922  ? PHE P 947  ? ASP M 922  PHE M 947  1 ? 26 
HELX_P HELX_P177 177 ASN P 959  ? PHE P 971  ? ASN M 959  PHE M 971  1 ? 13 
HELX_P HELX_P178 178 THR P 982  ? GLU P 995  ? THR M 982  GLU M 995  1 ? 14 
HELX_P HELX_P179 179 ASN P 1004 ? LEU P 1026 ? ASN M 1004 LEU M 1026 1 ? 23 
HELX_P HELX_P180 180 ALA P 1027 ? GLU P 1034 ? ALA M 1027 GLU M 1034 1 ? 8  
HELX_P HELX_P181 181 THR P 1038 ? VAL P 1057 ? THR M 1038 VAL M 1057 1 ? 20 
HELX_P HELX_P182 182 MET P 1063 ? GLN P 1078 ? MET M 1063 GLN M 1078 1 ? 16 
HELX_P HELX_P183 183 GLY P 1097 ? VAL P 1107 ? GLY M 1097 VAL M 1107 1 ? 11 
HELX_P HELX_P184 184 ASP P 1127 ? GLU P 1139 ? ASP M 1127 GLU M 1139 1 ? 13 
HELX_P HELX_P185 185 LEU P 1143 ? VAL P 1146 ? LEU M 1143 VAL M 1146 1 ? 4  
HELX_P HELX_P186 186 ASP P 1166 ? HIS P 1173 ? ASP M 1166 HIS M 1173 1 ? 8  
HELX_P HELX_P187 187 ALA P 1200 ? LYS P 1205 ? ALA M 1200 LYS M 1205 1 ? 6  
HELX_P HELX_P188 188 THR P 1208 ? LYS P 1221 ? THR M 1208 LYS M 1221 1 ? 14 
HELX_P HELX_P189 189 GLU P 1255 ? LYS P 1261 ? GLU M 1255 LYS M 1261 1 ? 7  
HELX_P HELX_P190 190 LYS P 1261 ? GLU P 1269 ? LYS M 1261 GLU M 1269 1 ? 9  
HELX_P HELX_P191 191 ASN P 1312 ? MET P 1317 ? ASN M 1312 MET M 1317 1 ? 6  
HELX_P HELX_P192 192 SER P 1331 ? GLY P 1340 ? SER M 1331 GLY M 1340 1 ? 10 
HELX_P HELX_P193 193 GLY P 1340 ? SER P 1358 ? GLY M 1340 SER M 1358 1 ? 19 
HELX_P HELX_P194 194 TYR P 1365 ? THR P 1377 ? TYR M 1365 THR M 1377 1 ? 13 
HELX_P HELX_P195 195 GLY P 1388 ? SER P 1392 ? GLY M 1388 SER M 1392 5 ? 5  
HELX_P HELX_P196 196 GLY P 1395 ? CYS P 1400 ? GLY M 1395 CYS M 1400 1 ? 6  
HELX_P HELX_P197 197 GLU P 1404 ? SER P 1415 ? GLU M 1404 SER M 1415 1 ? 12 
HELX_P HELX_P198 198 GLY P 1423 ? GLY P 1431 ? GLY M 1423 GLY M 1431 1 ? 9  
HELX_P HELX_P199 199 ILE P 1436 ? GLY P 1439 ? ILE M 1436 GLY M 1439 5 ? 4  
HELX_P HELX_P200 200 GLU P 1448 ? TYR P 1453 ? GLU M 1448 TYR M 1453 1 ? 6  
HELX_P HELX_P201 201 THR Q 26   ? LYS Q 41   ? THR N 26   LYS N 41   1 ? 16 
HELX_P HELX_P202 202 VAL Q 44   ? TYR Q 57   ? VAL N 44   TYR N 57   1 ? 14 
HELX_P HELX_P203 203 TYR Q 57   ? ILE Q 63   ? TYR N 57   ILE N 63   1 ? 7  
HELX_P HELX_P204 204 TYR Q 113  ? ASN Q 121  ? TYR N 113  ASN N 121  1 ? 9  
HELX_P HELX_P205 205 CYS Q 179  ? GLU Q 183  ? CYS N 179  GLU N 183  5 ? 5  
HELX_P HELX_P206 206 THR Q 185  ? LYS Q 191  ? THR N 185  LYS N 191  1 ? 7  
HELX_P HELX_P207 207 ILE Q 282  ? LEU Q 289  ? ILE N 282  LEU N 289  1 ? 8  
HELX_P HELX_P208 208 GLU Q 296  ? CYS Q 302  ? GLU N 296  CYS N 302  1 ? 7  
HELX_P HELX_P209 209 ASP Q 307  ? PHE Q 322  ? ASP N 307  PHE N 322  1 ? 16 
HELX_P HELX_P210 210 ASP Q 326  ? PHE Q 333  ? ASP N 326  PHE N 333  1 ? 8  
HELX_P HELX_P211 211 GLU Q 346  ? LYS Q 358  ? GLU N 346  LYS N 358  1 ? 13 
HELX_P HELX_P212 212 PHE Q 370  ? LEU Q 390  ? PHE N 370  LEU N 390  1 ? 21 
HELX_P HELX_P213 213 HIS Q 400  ? GLY Q 402  ? HIS N 400  GLY N 402  5 ? 3  
HELX_P HELX_P214 214 LEU Q 408  ? GLN Q 433  ? LEU N 408  GLN N 433  1 ? 26 
HELX_P HELX_P215 215 LYS Q 451  ? GLY Q 464  ? LYS N 451  GLY N 464  1 ? 14 
HELX_P HELX_P216 216 THR Q 487  ? ARG Q 496  ? THR N 487  ARG N 496  1 ? 10 
HELX_P HELX_P217 217 PRO Q 551  ? GLU Q 560  ? PRO N 551  GLU N 560  1 ? 10 
HELX_P HELX_P218 218 PRO Q 565  ? TYR Q 569  ? PRO N 565  TYR N 569  5 ? 5  
HELX_P HELX_P219 219 ASN Q 592  ? ARG Q 605  ? ASN N 592  ARG N 605  1 ? 14 
HELX_P HELX_P220 220 ARG Q 654  ? LYS Q 660  ? ARG N 654  LYS N 660  1 ? 7  
HELX_P HELX_P221 221 LYS Q 660  ? GLN Q 667  ? LYS N 660  GLN N 667  1 ? 8  
HELX_P HELX_P222 222 THR Q 680  ? GLU Q 687  ? THR N 680  GLU N 687  1 ? 8  
HELX_P HELX_P223 223 ALA Q 695  ? GLU Q 699  ? ALA N 695  GLU N 699  1 ? 5  
HELX_P HELX_P224 224 HIS Q 744  ? LEU Q 749  ? HIS N 744  LEU N 749  5 ? 6  
HELX_P HELX_P225 225 ALA Q 752  ? ILE Q 756  ? ALA N 752  ILE N 756  5 ? 5  
HELX_P HELX_P226 226 PHE Q 758  ? ASN Q 762  ? PHE N 758  ASN N 762  5 ? 5  
HELX_P HELX_P227 227 GLN Q 763  ? GLY Q 774  ? GLN N 763  GLY N 774  1 ? 12 
HELX_P HELX_P228 228 LEU Q 782  ? ARG Q 788  ? LEU N 782  ARG N 788  5 ? 7  
HELX_P HELX_P229 229 ALA Q 808  ? LYS Q 813  ? ALA N 808  LYS N 813  1 ? 6  
HELX_P HELX_P230 230 GLN Q 843  ? ARG Q 848  ? GLN N 843  ARG N 848  1 ? 6  
HELX_P HELX_P231 231 ASN Q 1013 ? ILE Q 1017 ? ASN N 1013 ILE N 1017 5 ? 5  
HELX_P HELX_P232 232 THR Q 1022 ? GLY Q 1039 ? THR N 1022 GLY N 1039 1 ? 18 
HELX_P HELX_P233 233 THR Q 1051 ? GLU Q 1061 ? THR N 1051 GLU N 1061 1 ? 11 
HELX_P HELX_P234 234 MET Q 1098 ? LYS Q 1102 ? MET N 1098 LYS N 1102 5 ? 5  
HELX_P HELX_P235 235 GLY Q 1131 ? GLY Q 1142 ? GLY N 1131 GLY N 1142 1 ? 12 
HELX_P HELX_P236 236 ALA Q 1143 ? MET Q 1152 ? ALA N 1143 MET N 1152 1 ? 10 
HELX_P HELX_P237 237 PRO Q 1197 ? MET Q 1210 ? PRO N 1197 MET N 1210 1 ? 14 
HELX_P HELX_P238 238 ASP R 26   ? GLU R 40   ? ASP O 26   GLU O 40   1 ? 15 
HELX_P HELX_P239 239 ALA R 59   ? ILE R 70   ? ALA O 59   ILE O 70   1 ? 12 
HELX_P HELX_P240 240 ASP R 76   ? LEU R 80   ? ASP O 76   LEU O 80   5 ? 5  
HELX_P HELX_P241 241 LYS R 116  ? LEU R 118  ? LYS O 116  LEU O 118  5 ? 3  
HELX_P HELX_P242 242 ILE R 163  ? GLY R 171  ? ILE O 163  GLY O 171  5 ? 9  
HELX_P HELX_P243 243 ASP R 196  ? TRP R 201  ? ASP O 196  TRP O 201  1 ? 6  
HELX_P HELX_P244 244 SER R 204  ? GLU R 208  ? SER O 204  GLU O 208  5 ? 5  
HELX_P HELX_P245 245 ASP R 241  ? MET R 265  ? ASP O 241  MET O 265  1 ? 25 
HELX_P HELX_P246 246 GLY S 30   ? GLN S 34   ? GLY P 30   GLN P 34   5 ? 5  
HELX_P HELX_P247 247 SER S 53   ? SER S 73   ? SER P 53   SER P 73   1 ? 21 
HELX_P HELX_P248 248 ARG S 119  ? THR S 134  ? ARG P 119  THR P 134  1 ? 16 
HELX_P HELX_P249 249 ASN S 138  ? PHE S 151  ? ASN P 138  PHE P 151  1 ? 14 
HELX_P HELX_P250 250 ASP S 156  ? LYS S 168  ? ASP P 156  LYS P 168  1 ? 13 
HELX_P HELX_P251 251 HIS S 173  ? LEU S 183  ? HIS P 173  LEU P 183  1 ? 11 
HELX_P HELX_P252 252 THR S 187  ? ILE S 195  ? THR P 187  ILE P 195  1 ? 9  
HELX_P HELX_P253 253 SER S 203  ? GLU S 218  ? SER P 203  GLU P 218  1 ? 16 
HELX_P HELX_P254 254 ASN T 5    ? ARG T 26   ? ASN Q 5    ARG Q 26   1 ? 22 
HELX_P HELX_P255 255 PRO T 38   ? ALA T 44   ? PRO Q 38   ALA Q 44   1 ? 7  
HELX_P HELX_P256 256 GLN T 54   ? MET T 58   ? GLN Q 54   MET Q 58   5 ? 5  
HELX_P HELX_P257 257 THR T 65   ? PHE T 72   ? THR Q 65   PHE Q 72   1 ? 8  
HELX_P HELX_P258 258 GLY T 89   ? ASN T 104  ? GLY Q 89   ASN Q 104  1 ? 16 
HELX_P HELX_P259 259 ALA T 120  ? VAL T 124  ? ALA Q 120  VAL Q 124  5 ? 5  
HELX_P HELX_P260 260 ASN T 143  ? HIS T 147  ? ASN Q 143  HIS Q 147  5 ? 5  
HELX_P HELX_P261 261 SER T 157  ? TYR T 168  ? SER Q 157  TYR Q 168  1 ? 12 
HELX_P HELX_P262 262 LYS T 171  ? LEU T 175  ? LYS Q 171  LEU Q 175  5 ? 5  
HELX_P HELX_P263 263 ASP T 182  ? LEU T 188  ? ASP Q 182  LEU Q 188  1 ? 7  
HELX_P HELX_P264 264 THR U 86   ? MET U 103  ? THR R 86   MET R 103  1 ? 18 
HELX_P HELX_P265 265 ASP U 116  ? GLU U 127  ? ASP R 116  GLU R 127  1 ? 12 
HELX_P HELX_P266 266 MET V 22   ? GLU V 35   ? MET S 22   GLU S 35   1 ? 14 
HELX_P HELX_P267 267 ASP V 50   ? ILE V 54   ? ASP S 50   ILE S 54   5 ? 5  
HELX_P HELX_P268 268 HIS V 113  ? MET V 115  ? HIS S 113  MET S 115  5 ? 3  
HELX_P HELX_P269 269 GLN W 83   ? ARG W 87   ? GLN T 83   ARG T 87   5 ? 5  
HELX_P HELX_P270 270 ASP Y 16   ? GLU Y 27   ? ASP V 16   GLU V 27   1 ? 12 
HELX_P HELX_P271 271 ASP Y 31   ? LEU Y 39   ? ASP V 31   LEU V 39   1 ? 9  
HELX_P HELX_P272 272 ARG Y 43   ? HIS Y 53   ? ARG V 43   HIS V 53   1 ? 11 
HELX_P HELX_P273 273 LEU Y 56   ? ARG Y 62   ? LEU V 56   ARG V 62   1 ? 7  
HELX_P HELX_P274 274 ASP Z 5    ? PHE Z 10   ? ASP W 5    PHE W 10   5 ? 6  
HELX_P HELX_P275 275 ASP Z 39   ? LEU Z 50   ? ASP W 39   LEU W 50   1 ? 12 
HELX_P HELX_P276 276 ASP Z 82   ? LEU Z 111  ? ASP W 82   LEU W 111  1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? I  CYS 78   SG    ? ? ? 1_555 I  CYS 103 SG ? ? I CYS 78   I CYS 103  1_555 ? ? ? ? ? ? ?            2.780 ? 
disulf2  disulf ? ? L  CYS 31   SG    ? ? ? 1_555 L  CYS 34  SG ? ? L CYS 31   L CYS 34   1_555 ? ? ? ? ? ? ?            2.931 ? 
disulf3  disulf ? ? X  CYS 78   SG    ? ? ? 1_555 X  CYS 103 SG ? ? U CYS 78   U CYS 103  1_555 ? ? ? ? ? ? ?            2.833 ? 
covale1  covale ? ? M  DC  18   "O3'" ? ? ? 1_555 M  BRU 19  P  ? ? 1 DC  22   1 BRU 23   1_555 ? ? ? ? ? ? ?            1.618 ? 
covale2  covale ? ? M  BRU 19   "O3'" ? ? ? 1_555 M  DG  20  P  ? ? 1 BRU 23   1 DG  24   1_555 ? ? ? ? ? ? ?            1.607 ? 
covale3  covale ? ? BA DC  18   "O3'" ? ? ? 1_555 BA BRU 19  P  ? ? 4 DC  22   4 BRU 23   1_555 ? ? ? ? ? ? ?            1.625 ? 
covale4  covale ? ? BA BRU 19   "O3'" ? ? ? 1_555 BA DG  20  P  ? ? 4 BRU 23   4 DG  24   1_555 ? ? ? ? ? ? ?            1.608 ? 
metalc1  metalc ? ? A  CYS 67   SG    ? ? ? 1_555 FA ZN  .   ZN ? ? A CYS 67   A ZN  9985 1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc2  metalc ? ? A  CYS 70   SG    ? ? ? 1_555 FA ZN  .   ZN ? ? A CYS 70   A ZN  9985 1_555 ? ? ? ? ? ? ?            2.193 ? 
metalc3  metalc ? ? A  CYS 77   SG    ? ? ? 1_555 FA ZN  .   ZN ? ? A CYS 77   A ZN  9985 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc4  metalc ? ? A  HIS 80   NE2   ? ? ? 1_555 FA ZN  .   ZN ? ? A HIS 80   A ZN  9985 1_555 ? ? ? ? ? ? ?            2.183 ? 
metalc5  metalc ? ? A  CYS 107  SG    ? ? ? 1_555 EA ZN  .   ZN ? ? A CYS 107  A ZN  9984 1_555 ? ? ? ? ? ? ?            2.525 ? 
metalc6  metalc ? ? A  CYS 110  SG    ? ? ? 1_555 EA ZN  .   ZN ? ? A CYS 110  A ZN  9984 1_555 ? ? ? ? ? ? ?            2.344 ? 
metalc7  metalc ? ? A  CYS 148  SG    ? ? ? 1_555 EA ZN  .   ZN ? ? A CYS 148  A ZN  9984 1_555 ? ? ? ? ? ? ?            2.610 ? 
metalc8  metalc ? ? A  CYS 167  SG    ? ? ? 1_555 EA ZN  .   ZN ? ? A CYS 167  A ZN  9984 1_555 ? ? ? ? ? ? ?            2.653 ? 
metalc9  metalc ? ? B  CYS 1163 SG    ? ? ? 1_555 GA ZN  .   ZN ? ? B CYS 1163 B ZN  9986 1_555 ? ? ? ? ? ? ?            2.639 ? 
metalc10 metalc ? ? B  CYS 1166 SG    ? ? ? 1_555 GA ZN  .   ZN ? ? B CYS 1166 B ZN  9986 1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc11 metalc ? ? B  CYS 1182 SG    ? ? ? 1_555 GA ZN  .   ZN ? ? B CYS 1182 B ZN  9986 1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc12 metalc ? ? B  CYS 1185 SG    ? ? ? 1_555 GA ZN  .   ZN ? ? B CYS 1185 B ZN  9986 1_555 ? ? ? ? ? ? ?            2.557 ? 
metalc13 metalc ? ? C  CYS 86   SG    ? ? ? 1_555 HA ZN  .   ZN ? ? C CYS 86   C ZN  9987 1_555 ? ? ? ? ? ? ?            2.180 ? 
metalc14 metalc ? ? C  CYS 88   SG    ? ? ? 1_555 HA ZN  .   ZN ? ? C CYS 88   C ZN  9987 1_555 ? ? ? ? ? ? ?            2.438 ? 
metalc15 metalc ? ? C  CYS 92   SG    ? ? ? 1_555 HA ZN  .   ZN ? ? C CYS 92   C ZN  9987 1_555 ? ? ? ? ? ? ?            2.415 ? 
metalc16 metalc ? ? C  CYS 95   SG    ? ? ? 1_555 HA ZN  .   ZN ? ? C CYS 95   C ZN  9987 1_555 ? ? ? ? ? ? ?            2.254 ? 
metalc17 metalc ? ? I  CYS 7    SG    ? ? ? 1_555 IA ZN  .   ZN ? ? I CYS 7    I ZN  9988 1_555 ? ? ? ? ? ? ?            2.475 ? 
metalc18 metalc ? ? I  CYS 10   SG    ? ? ? 1_555 IA ZN  .   ZN ? ? I CYS 10   I ZN  9988 1_555 ? ? ? ? ? ? ?            2.197 ? 
metalc19 metalc ? ? I  CYS 29   SG    ? ? ? 1_555 IA ZN  .   ZN ? ? I CYS 29   I ZN  9988 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc20 metalc ? ? I  CYS 32   SG    ? ? ? 1_555 IA ZN  .   ZN ? ? I CYS 32   I ZN  9988 1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc21 metalc ? ? I  CYS 75   SG    ? ? ? 1_555 JA ZN  .   ZN ? ? I CYS 75   I ZN  9989 1_555 ? ? ? ? ? ? ?            2.492 ? 
metalc22 metalc ? ? I  CYS 78   SG    ? ? ? 1_555 JA ZN  .   ZN ? ? I CYS 78   I ZN  9989 1_555 ? ? ? ? ? ? ?            2.858 ? 
metalc23 metalc ? ? I  CYS 106  SG    ? ? ? 1_555 JA ZN  .   ZN ? ? I CYS 106  I ZN  9989 1_555 ? ? ? ? ? ? ?            2.516 ? 
metalc24 metalc ? ? J  CYS 7    SG    ? ? ? 1_555 KA ZN  .   ZN ? ? J CYS 7    J ZN  9990 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc25 metalc ? ? J  CYS 10   SG    ? ? ? 1_555 KA ZN  .   ZN ? ? J CYS 10   J ZN  9990 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc26 metalc ? ? J  CYS 45   SG    ? ? ? 1_555 KA ZN  .   ZN ? ? J CYS 45   J ZN  9990 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc27 metalc ? ? J  CYS 46   SG    ? ? ? 1_555 KA ZN  .   ZN ? ? J CYS 46   J ZN  9990 1_555 ? ? ? ? ? ? ?            2.439 ? 
metalc28 metalc ? ? L  CYS 31   SG    ? ? ? 1_555 LA ZN  .   ZN ? ? L CYS 31   L ZN  9991 1_555 ? ? ? ? ? ? ?            2.687 ? 
metalc29 metalc ? ? L  CYS 34   SG    ? ? ? 1_555 LA ZN  .   ZN ? ? L CYS 34   L ZN  9991 1_555 ? ? ? ? ? ? ?            2.296 ? 
metalc30 metalc ? ? L  CYS 48   SG    ? ? ? 1_555 LA ZN  .   ZN ? ? L CYS 48   L ZN  9991 1_555 ? ? ? ? ? ? ?            2.612 ? 
metalc31 metalc ? ? P  CYS 67   SG    ? ? ? 1_555 NA ZN  .   ZN ? ? M CYS 67   M ZN  9993 1_555 ? ? ? ? ? ? ?            2.262 ? 
metalc32 metalc ? ? P  CYS 70   SG    ? ? ? 1_555 NA ZN  .   ZN ? ? M CYS 70   M ZN  9993 1_555 ? ? ? ? ? ? ?            2.225 ? 
metalc33 metalc ? ? P  CYS 77   SG    ? ? ? 1_555 NA ZN  .   ZN ? ? M CYS 77   M ZN  9993 1_555 ? ? ? ? ? ? ?            2.228 ? 
metalc34 metalc ? ? P  HIS 80   NE2   ? ? ? 1_555 NA ZN  .   ZN ? ? M HIS 80   M ZN  9993 1_555 ? ? ? ? ? ? ?            2.214 ? 
metalc35 metalc ? ? P  CYS 107  SG    ? ? ? 1_555 MA ZN  .   ZN ? ? M CYS 107  M ZN  9992 1_555 ? ? ? ? ? ? ?            2.661 ? 
metalc36 metalc ? ? P  CYS 110  SG    ? ? ? 1_555 MA ZN  .   ZN ? ? M CYS 110  M ZN  9992 1_555 ? ? ? ? ? ? ?            2.416 ? 
metalc37 metalc ? ? P  CYS 148  SG    ? ? ? 1_555 MA ZN  .   ZN ? ? M CYS 148  M ZN  9992 1_555 ? ? ? ? ? ? ?            2.655 ? 
metalc38 metalc ? ? P  CYS 167  SG    ? ? ? 1_555 MA ZN  .   ZN ? ? M CYS 167  M ZN  9992 1_555 ? ? ? ? ? ? ?            2.624 ? 
metalc39 metalc ? ? Q  CYS 1163 SG    ? ? ? 1_555 OA ZN  .   ZN ? ? N CYS 1163 N ZN  9994 1_555 ? ? ? ? ? ? ?            2.460 ? 
metalc40 metalc ? ? Q  CYS 1166 SG    ? ? ? 1_555 OA ZN  .   ZN ? ? N CYS 1166 N ZN  9994 1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc41 metalc ? ? Q  CYS 1182 SG    ? ? ? 1_555 OA ZN  .   ZN ? ? N CYS 1182 N ZN  9994 1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc42 metalc ? ? Q  CYS 1185 SG    ? ? ? 1_555 OA ZN  .   ZN ? ? N CYS 1185 N ZN  9994 1_555 ? ? ? ? ? ? ?            2.576 ? 
metalc43 metalc ? ? R  CYS 86   SG    ? ? ? 1_555 PA ZN  .   ZN ? ? O CYS 86   O ZN  9995 1_555 ? ? ? ? ? ? ?            2.114 ? 
metalc44 metalc ? ? R  CYS 88   SG    ? ? ? 1_555 PA ZN  .   ZN ? ? O CYS 88   O ZN  9995 1_555 ? ? ? ? ? ? ?            2.395 ? 
metalc45 metalc ? ? R  CYS 92   SG    ? ? ? 1_555 PA ZN  .   ZN ? ? O CYS 92   O ZN  9995 1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc46 metalc ? ? R  CYS 95   SG    ? ? ? 1_555 PA ZN  .   ZN ? ? O CYS 95   O ZN  9995 1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc47 metalc ? ? X  CYS 7    SG    ? ? ? 1_555 QA ZN  .   ZN ? ? U CYS 7    U ZN  9996 1_555 ? ? ? ? ? ? ?            2.239 ? 
metalc48 metalc ? ? X  CYS 10   SG    ? ? ? 1_555 QA ZN  .   ZN ? ? U CYS 10   U ZN  9996 1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc49 metalc ? ? X  CYS 29   SG    ? ? ? 1_555 QA ZN  .   ZN ? ? U CYS 29   U ZN  9996 1_555 ? ? ? ? ? ? ?            2.481 ? 
metalc50 metalc ? ? X  CYS 32   SG    ? ? ? 1_555 QA ZN  .   ZN ? ? U CYS 32   U ZN  9996 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc51 metalc ? ? X  CYS 75   SG    ? ? ? 1_555 RA ZN  .   ZN ? ? U CYS 75   U ZN  9997 1_555 ? ? ? ? ? ? ?            2.496 ? 
metalc52 metalc ? ? X  CYS 78   SG    ? ? ? 1_555 RA ZN  .   ZN ? ? U CYS 78   U ZN  9997 1_555 ? ? ? ? ? ? ?            2.938 ? 
metalc53 metalc ? ? X  CYS 106  SG    ? ? ? 1_555 RA ZN  .   ZN ? ? U CYS 106  U ZN  9997 1_555 ? ? ? ? ? ? ?            2.538 ? 
metalc54 metalc ? ? Y  CYS 7    SG    ? ? ? 1_555 SA ZN  .   ZN ? ? V CYS 7    V ZN  9998 1_555 ? ? ? ? ? ? ?            2.379 ? 
metalc55 metalc ? ? Y  CYS 10   SG    ? ? ? 1_555 SA ZN  .   ZN ? ? V CYS 10   V ZN  9998 1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc56 metalc ? ? Y  CYS 45   SG    ? ? ? 1_555 SA ZN  .   ZN ? ? V CYS 45   V ZN  9998 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc57 metalc ? ? Y  CYS 46   SG    ? ? ? 1_555 SA ZN  .   ZN ? ? V CYS 46   V ZN  9998 1_555 ? ? ? ? ? ? ?            2.552 ? 
metalc58 metalc ? ? AA CYS 31   SG    ? ? ? 1_555 TA ZN  .   ZN ? ? X CYS 31   X ZN  9999 1_555 ? ? ? ? ? ? ?            2.625 ? 
metalc59 metalc ? ? AA CYS 34   SG    ? ? ? 1_555 TA ZN  .   ZN ? ? X CYS 34   X ZN  9999 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc60 metalc ? ? AA CYS 48   SG    ? ? ? 1_555 TA ZN  .   ZN ? ? X CYS 48   X ZN  9999 1_555 ? ? ? ? ? ? ?            2.504 ? 
hydrog1  hydrog ? ? BA DA  7    N1    ? ? ? 1_555 CA DT  7   N3 ? ? 4 DA  11   5 DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? BA DA  7    N6    ? ? ? 1_555 CA DT  7   O4 ? ? 4 DA  11   5 DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? BA DG  8    N1    ? ? ? 1_555 CA DC  6   N3 ? ? 4 DG  12   5 DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? BA DG  8    N2    ? ? ? 1_555 CA DC  6   O2 ? ? 4 DG  12   5 DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? BA DG  8    O6    ? ? ? 1_555 CA DC  6   N4 ? ? 4 DG  12   5 DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? BA DT  9    N3    ? ? ? 1_555 CA DA  5   N1 ? ? 4 DT  13   5 DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? BA DT  9    O4    ? ? ? 1_555 CA DA  5   N6 ? ? 4 DT  13   5 DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? BA DA  10   N1    ? ? ? 1_555 CA DT  4   N3 ? ? 4 DA  14   5 DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? BA DA  10   N6    ? ? ? 1_555 CA DT  4   O4 ? ? 4 DA  14   5 DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? BA DG  11   N1    ? ? ? 1_555 CA DC  3   N3 ? ? 4 DG  15   5 DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? BA DG  11   N2    ? ? ? 1_555 CA DC  3   O2 ? ? 4 DG  15   5 DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? BA DG  11   O6    ? ? ? 1_555 CA DC  3   N4 ? ? 4 DG  15   5 DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? BA DT  12   N3    ? ? ? 1_555 CA DA  2   N1 ? ? 4 DT  16   5 DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? BA DT  12   O4    ? ? ? 1_555 CA DA  2   N6 ? ? 4 DT  16   5 DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? BA DT  13   N3    ? ? ? 1_555 CA DA  2   N1 ? ? 4 DT  17   5 DA  1    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog16 hydrog ? ? BA DT  15   N3    ? ? ? 1_555 DA U   17  O2 ? ? 4 DT  19   6 U   10   1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     ? 
hydrog17 hydrog ? ? BA DT  15   O4    ? ? ? 1_555 DA U   17  N3 ? ? 4 DT  19   6 U   10   1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     ? 
hydrog18 hydrog ? ? BA DG  16   N1    ? ? ? 1_555 DA C   16  N3 ? ? 4 DG  20   6 C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? BA DG  16   N2    ? ? ? 1_555 DA C   16  O2 ? ? 4 DG  20   6 C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? BA DG  16   O6    ? ? ? 1_555 DA C   16  N4 ? ? 4 DG  20   6 C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? BA DC  17   N3    ? ? ? 1_555 DA G   15  N1 ? ? 4 DC  21   6 G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? BA DC  17   N4    ? ? ? 1_555 DA G   15  O6 ? ? 4 DC  21   6 G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? BA DC  17   O2    ? ? ? 1_555 DA G   15  N2 ? ? 4 DC  21   6 G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? BA DC  18   N3    ? ? ? 1_555 DA G   14  N1 ? ? 4 DC  22   6 G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? BA DC  18   N4    ? ? ? 1_555 DA G   14  O6 ? ? 4 DC  22   6 G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? BA DC  18   O2    ? ? ? 1_555 DA G   14  N2 ? ? 4 DC  22   6 G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? BA BRU 19   N3    ? ? ? 1_555 DA A   13  N1 ? ? 4 BRU 23   6 A   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? BA BRU 19   O4    ? ? ? 1_555 DA A   13  N6 ? ? 4 BRU 23   6 A   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? BA DG  20   N1    ? ? ? 1_555 DA C   12  N3 ? ? 4 DG  24   6 C   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? BA DG  20   N2    ? ? ? 1_555 DA C   12  O2 ? ? 4 DG  24   6 C   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? BA DG  20   O6    ? ? ? 1_555 DA C   12  N4 ? ? 4 DG  24   6 C   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? BA DG  21   N1    ? ? ? 1_555 DA C   11  N3 ? ? 4 DG  25   6 C   4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? BA DG  21   N2    ? ? ? 1_555 DA C   11  O2 ? ? 4 DG  25   6 C   4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? BA DG  21   O6    ? ? ? 1_555 DA C   11  N4 ? ? 4 DG  25   6 C   4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? BA DT  22   N3    ? ? ? 1_555 DA A   10  N1 ? ? 4 DT  26   6 A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? BA DT  22   O4    ? ? ? 1_555 DA A   10  N6 ? ? 4 DT  26   6 A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? BA DC  23   N3    ? ? ? 1_555 DA G   9   N1 ? ? 4 DC  27   6 G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? BA DC  23   N4    ? ? ? 1_555 DA G   9   O6 ? ? 4 DC  27   6 G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? BA DC  23   O2    ? ? ? 1_555 DA G   9   N2 ? ? 4 DC  27   6 G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? M  DA  7    N1    ? ? ? 1_555 N  DT  7   N3 ? ? 1 DA  11   2 DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? M  DA  7    N6    ? ? ? 1_555 N  DT  7   O4 ? ? 1 DA  11   2 DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? M  DG  8    N1    ? ? ? 1_555 N  DC  6   N3 ? ? 1 DG  12   2 DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? M  DG  8    N2    ? ? ? 1_555 N  DC  6   O2 ? ? 1 DG  12   2 DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? M  DG  8    O6    ? ? ? 1_555 N  DC  6   N4 ? ? 1 DG  12   2 DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? M  DT  9    N3    ? ? ? 1_555 N  DA  5   N1 ? ? 1 DT  13   2 DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? M  DT  9    O4    ? ? ? 1_555 N  DA  5   N6 ? ? 1 DT  13   2 DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? M  DA  10   N1    ? ? ? 1_555 N  DT  4   N3 ? ? 1 DA  14   2 DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? M  DA  10   N6    ? ? ? 1_555 N  DT  4   O4 ? ? 1 DA  14   2 DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? M  DG  11   N1    ? ? ? 1_555 N  DC  3   N3 ? ? 1 DG  15   2 DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? M  DG  11   N2    ? ? ? 1_555 N  DC  3   O2 ? ? 1 DG  15   2 DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? M  DG  11   O6    ? ? ? 1_555 N  DC  3   N4 ? ? 1 DG  15   2 DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? M  DT  12   N3    ? ? ? 1_555 N  DA  2   N1 ? ? 1 DT  16   2 DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? M  DT  12   O4    ? ? ? 1_555 N  DA  2   N6 ? ? 1 DT  16   2 DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? M  DT  13   N3    ? ? ? 1_555 N  DA  2   N1 ? ? 1 DT  17   2 DA  1    1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? 
hydrog55 hydrog ? ? M  DT  15   N3    ? ? ? 1_555 O  U   17  O2 ? ? 1 DT  19   3 U   10   1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     ? 
hydrog56 hydrog ? ? M  DT  15   O4    ? ? ? 1_555 O  U   17  N3 ? ? 1 DT  19   3 U   10   1_555 ? ? ? ? ? ? TYPE_16_PAIR ?     ? 
hydrog57 hydrog ? ? M  DG  16   N1    ? ? ? 1_555 O  C   16  N3 ? ? 1 DG  20   3 C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? M  DG  16   N2    ? ? ? 1_555 O  C   16  O2 ? ? 1 DG  20   3 C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? M  DG  16   O6    ? ? ? 1_555 O  C   16  N4 ? ? 1 DG  20   3 C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? M  DC  17   N3    ? ? ? 1_555 O  G   15  N1 ? ? 1 DC  21   3 G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? M  DC  17   N4    ? ? ? 1_555 O  G   15  O6 ? ? 1 DC  21   3 G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? M  DC  17   O2    ? ? ? 1_555 O  G   15  N2 ? ? 1 DC  21   3 G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? M  DC  18   N3    ? ? ? 1_555 O  G   14  N1 ? ? 1 DC  22   3 G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? M  DC  18   N4    ? ? ? 1_555 O  G   14  O6 ? ? 1 DC  22   3 G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? M  DC  18   O2    ? ? ? 1_555 O  G   14  N2 ? ? 1 DC  22   3 G   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? M  BRU 19   N3    ? ? ? 1_555 O  A   13  N1 ? ? 1 BRU 23   3 A   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ? ? M  BRU 19   O4    ? ? ? 1_555 O  A   13  N6 ? ? 1 BRU 23   3 A   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ? ? M  DG  20   N1    ? ? ? 1_555 O  C   12  N3 ? ? 1 DG  24   3 C   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ? ? M  DG  20   N2    ? ? ? 1_555 O  C   12  O2 ? ? 1 DG  24   3 C   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70 hydrog ? ? M  DG  20   O6    ? ? ? 1_555 O  C   12  N4 ? ? 1 DG  24   3 C   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71 hydrog ? ? M  DG  21   N1    ? ? ? 1_555 O  C   11  N3 ? ? 1 DG  25   3 C   4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72 hydrog ? ? M  DG  21   N2    ? ? ? 1_555 O  C   11  O2 ? ? 1 DG  25   3 C   4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73 hydrog ? ? M  DG  21   O6    ? ? ? 1_555 O  C   11  N4 ? ? 1 DG  25   3 C   4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74 hydrog ? ? M  DT  22   N3    ? ? ? 1_555 O  A   10  N1 ? ? 1 DT  26   3 A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75 hydrog ? ? M  DT  22   O4    ? ? ? 1_555 O  A   10  N6 ? ? 1 DT  26   3 A   3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76 hydrog ? ? M  DC  23   N3    ? ? ? 1_555 O  G   9   N1 ? ? 1 DC  27   3 G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77 hydrog ? ? M  DC  23   N4    ? ? ? 1_555 O  G   9   O6 ? ? 1 DC  27   3 G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78 hydrog ? ? M  DC  23   O2    ? ? ? 1_555 O  G   9   N2 ? ? 1 DC  27   3 G   2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 0.62  
2 PRO 128 E . ? PRO 128 E PRO 129 E ? PRO 129 E 1 0.58  
3 ASN 126 G . ? ASN 126 G PRO 127 G ? PRO 127 G 1 -0.16 
4 GLN 447 P . ? GLN 447 M PRO 448 P ? PRO 448 M 1 -0.31 
5 PRO 128 T . ? PRO 128 Q PRO 129 T ? PRO 129 Q 1 0.23  
6 ASN 126 V . ? ASN 126 S PRO 127 V ? PRO 127 S 1 -0.30 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 2 ? 
F  ? 8 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 3 ? 
K  ? 2 ? 
L  ? 3 ? 
M  ? 2 ? 
N  ? 4 ? 
O  ? 2 ? 
P  ? 5 ? 
Q  ? 2 ? 
R  ? 6 ? 
S  ? 7 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 4 ? 
X  ? 5 ? 
Y  ? 3 ? 
Z  ? 4 ? 
AA ? 5 ? 
AB ? 5 ? 
AC ? 2 ? 
AD ? 6 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 3 ? 
AJ ? 4 ? 
AK ? 2 ? 
AL ? 2 ? 
AM ? 4 ? 
AN ? 3 ? 
AO ? 7 ? 
AP ? 2 ? 
AQ ? 9 ? 
AR ? 3 ? 
AS ? 2 ? 
AT ? 4 ? 
AU ? 3 ? 
AV ? 2 ? 
AW ? 2 ? 
AX ? 3 ? 
AY ? 2 ? 
AZ ? 8 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 2 ? 
BD ? 3 ? 
BE ? 2 ? 
BF ? 3 ? 
BG ? 2 ? 
BH ? 4 ? 
BI ? 2 ? 
BJ ? 5 ? 
BK ? 2 ? 
BL ? 6 ? 
BM ? 7 ? 
BN ? 3 ? 
BO ? 2 ? 
BP ? 3 ? 
BQ ? 4 ? 
BR ? 5 ? 
BS ? 3 ? 
BT ? 4 ? 
BU ? 5 ? 
BV ? 5 ? 
BW ? 4 ? 
BX ? 2 ? 
BY ? 7 ? 
BZ ? 2 ? 
CA ? 2 ? 
CB ? 2 ? 
CC ? 3 ? 
CD ? 3 ? 
CE ? 4 ? 
CF ? 2 ? 
CG ? 2 ? 
CH ? 4 ? 
CI ? 3 ? 
CJ ? 7 ? 
CK ? 2 ? 
CL ? 9 ? 
CM ? 3 ? 
CN ? 2 ? 
CO ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? parallel      
F  6 7 ? anti-parallel 
F  7 8 ? parallel      
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
S  4 5 ? anti-parallel 
S  5 6 ? anti-parallel 
S  6 7 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? parallel      
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? parallel      
AD 1 2 ? anti-parallel 
AD 2 3 ? parallel      
AD 3 4 ? anti-parallel 
AD 4 5 ? parallel      
AD 5 6 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? parallel      
AM 3 4 ? parallel      
AN 1 2 ? parallel      
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? parallel      
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AO 6 7 ? anti-parallel 
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AQ 6 7 ? anti-parallel 
AQ 7 8 ? anti-parallel 
AQ 8 9 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AV 1 2 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
AZ 4 5 ? anti-parallel 
AZ 5 6 ? parallel      
AZ 6 7 ? anti-parallel 
AZ 7 8 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BJ 4 5 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BL 5 6 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BM 4 5 ? anti-parallel 
BM 5 6 ? anti-parallel 
BM 6 7 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BQ 2 3 ? parallel      
BQ 3 4 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BR 4 5 ? anti-parallel 
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BT 1 2 ? anti-parallel 
BT 2 3 ? anti-parallel 
BT 3 4 ? parallel      
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BU 3 4 ? parallel      
BU 4 5 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BV 4 5 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? parallel      
BY 1 2 ? anti-parallel 
BY 2 3 ? parallel      
BY 3 4 ? anti-parallel 
BY 4 5 ? parallel      
BY 5 6 ? anti-parallel 
BY 6 7 ? anti-parallel 
BZ 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CB 1 2 ? anti-parallel 
CC 1 2 ? anti-parallel 
CC 2 3 ? anti-parallel 
CD 1 2 ? anti-parallel 
CD 2 3 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CE 3 4 ? anti-parallel 
CF 1 2 ? anti-parallel 
CG 1 2 ? anti-parallel 
CH 1 2 ? anti-parallel 
CH 2 3 ? parallel      
CH 3 4 ? parallel      
CI 1 2 ? parallel      
CI 2 3 ? anti-parallel 
CJ 1 2 ? anti-parallel 
CJ 2 3 ? anti-parallel 
CJ 3 4 ? parallel      
CJ 4 5 ? anti-parallel 
CJ 5 6 ? anti-parallel 
CJ 6 7 ? anti-parallel 
CK 1 2 ? anti-parallel 
CL 1 2 ? anti-parallel 
CL 2 3 ? anti-parallel 
CL 3 4 ? anti-parallel 
CL 4 5 ? anti-parallel 
CL 5 6 ? anti-parallel 
CL 6 7 ? anti-parallel 
CL 7 8 ? anti-parallel 
CL 8 9 ? anti-parallel 
CM 1 2 ? anti-parallel 
CM 2 3 ? anti-parallel 
CN 1 2 ? anti-parallel 
CO 1 2 ? anti-parallel 
CO 2 3 ? anti-parallel 
CO 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 LEU A  1418 ? ASP A  1419 ? LEU A 1418 ASP A 1419 
A  2 GLU A  16   ? LEU A  21   ? GLU A 16   LEU A 21   
A  3 ILE B  1212 ? TYR B  1217 ? ILE B 1212 TYR B 1217 
B  1 GLY A  82   ? VAL A  90   ? GLY A 82   VAL A 90   
B  2 LEU A  236  ? VAL A  241  ? LEU A 236  VAL A 241  
C  1 ASP A  151  ? PRO A  153  ? ASP A 151  PRO A 153  
C  2 LEU A  161  ? SER A  163  ? LEU A 161  SER A 163  
D  1 THR A  173  ? ASP A  177  ? THR A 173  ASP A 177  
D  2 LYS A  180  ? SER A  184  ? LYS A 180  SER A 184  
D  3 LEU A  199  ? LEU A  202  ? LEU A 199  LEU A 202  
E  1 LYS A  343  ? VAL A  345  ? LYS A 343  VAL A 345  
E  2 LEU B  1128 ? PHE B  1130 ? LEU B 1128 PHE B 1130 
F  1 HIS B  1104 ? ARG B  1106 ? HIS B 1104 ARG B 1106 
F  2 SER A  348  ? GLY A  355  ? SER A 348  GLY A 355  
F  3 GLU A  486  ? HIS A  490  ? GLU A 486  HIS A 490  
F  4 PRO A  441  ? ASN A  445  ? PRO A 441  ASN A 445  
F  5 MET A  455  ? ILE A  463  ? MET A 455  ILE A 463  
F  6 GLN A  363  ? PRO A  367  ? GLN A 363  PRO A 367  
F  7 PHE A  468  ? LEU A  470  ? PHE A 468  LEU A 470  
F  8 SER A  348  ? GLY A  355  ? SER A 348  GLY A 355  
G  1 THR A  375  ? VAL A  379  ? THR A 375  VAL A 379  
G  2 LYS A  431  ? HIS A  435  ? LYS A 431  HIS A 435  
G  3 ALA A  402  ? ARG A  407  ? ALA A 402  ARG A 407  
G  4 ASP A  411  ? ASP A  414  ? ASP A 411  ASP A 414  
H  1 VAL A  512  ? SER A  513  ? VAL A 512  SER A 513  
H  2 LYS A  518  ? PRO A  519  ? LYS A 518  PRO A 519  
I  1 PHE A  540  ? GLU A  542  ? PHE A 540  GLU A 542  
I  2 LEU A  571  ? SER A  573  ? LEU A 571  SER A 573  
J  1 LEU A  588  ? GLN A  589  ? LEU A 588  GLN A 589  
J  2 LEU A  606  ? ILE A  608  ? LEU A 606  ILE A 608  
J  3 GLN A  611  ? PHE A  614  ? GLN A 611  PHE A 614  
K  1 GLY A  766  ? GLN A  767  ? GLY A 766  GLN A 767  
K  2 PHE A  799  ? VAL A  800  ? PHE A 799  VAL A 800  
L  1 MET A  849  ? VAL A  850  ? MET A 849  VAL A 850  
L  2 THR A  856  ? ARG A  857  ? THR A 856  ARG A 857  
L  3 VAL A  863  ? GLN A  865  ? VAL A 863  GLN A 865  
M  1 ILE A  878  ? SER A  882  ? ILE A 878  SER A 882  
M  2 ASN A  953  ? PRO A  957  ? ASN A 953  PRO A 957  
N  1 VAL A  1283 ? TYR A  1287 ? VAL A 1283 TYR A 1287 
N  2 GLU A  1303 ? GLU A  1307 ? GLU A 1303 GLU A 1307 
N  3 LEU A  1116 ? TYR A  1119 ? LEU A 1116 TYR A 1119 
N  4 TYR A  1328 ? THR A  1329 ? TYR A 1328 THR A 1329 
O  1 THR A  1141 ? THR A  1142 ? THR A 1141 THR A 1142 
O  2 THR A  1272 ? ARG A  1274 ? THR A 1272 ARG A 1274 
P  1 VAL A  1226 ? TRP A  1228 ? VAL A 1226 TRP A 1228 
P  2 ILE A  1237 ? CYS A  1240 ? ILE A 1237 CYS A 1240 
P  3 TRP A  1191 ? LEU A  1197 ? TRP A 1191 LEU A 1197 
P  4 THR A  1147 ? TYR A  1154 ? THR A 1147 TYR A 1154 
P  5 LEU I  42   ? ARG I  45   ? LEU I 42   ARG I 45   
Q  1 LYS A  1290 ? PRO A  1292 ? LYS A 1290 PRO A 1292 
Q  2 TYR A  1298 ? LYS A  1300 ? TYR A 1298 LYS A 1300 
R  1 PHE F  143  ? SER F  147  ? PHE F 143  SER F 147  
R  2 LEU F  132  ? TYR F  137  ? LEU F 132  TYR F 137  
R  3 PHE A  1441 ? ILE A  1445 ? PHE A 1441 ILE A 1445 
R  4 GLY G  59   ? ILE G  61   ? GLY G 59   ILE G 61   
R  5 ALA G  68   ? PHE G  79   ? ALA G 68   PHE G 79   
R  6 PHE G  3    ? LEU G  13   ? PHE G 3    LEU G 13   
S  1 PHE F  143  ? SER F  147  ? PHE F 143  SER F 147  
S  2 LEU F  132  ? TYR F  137  ? LEU F 132  TYR F 137  
S  3 PHE A  1441 ? ILE A  1445 ? PHE A 1441 ILE A 1445 
S  4 GLY G  59   ? ILE G  61   ? GLY G 59   ILE G 61   
S  5 ALA G  68   ? PHE G  79   ? ALA G 68   PHE G 79   
S  6 GLY G  43   ? VAL G  48   ? GLY G 43   VAL G 48   
S  7 CYS G  38   ? THR G  39   ? CYS G 38   THR G 39   
T  1 SER B  91   ? VAL B  97   ? SER B 91   VAL B 97   
T  2 GLY B  127  ? LYS B  133  ? GLY B 127  LYS B 133  
T  3 VAL B  165  ? ARG B  169  ? VAL B 165  ARG B 169  
U  1 VAL B  102  ? ASN B  103  ? VAL B 102  ASN B 103  
U  2 THR B  109  ? HIS B  110  ? THR B 109  HIS B 110  
V  1 PHE B  203  ? ILE B  205  ? PHE B 203  ILE B 205  
V  2 SER B  208  ? VAL B  211  ? SER B 208  VAL B 211  
V  3 GLN B  481  ? VAL B  482  ? GLN B 481  VAL B 482  
W  1 LYS B  404  ? ASP B  407  ? LYS B 404  ASP B 407  
W  2 ALA B  214  ? SER B  218  ? ALA B 214  SER B 218  
W  3 ARG B  497  ? ASN B  499  ? ARG B 497  ASN B 499  
W  4 LYS B  537  ? ASN B  538  ? LYS B 537  ASN B 538  
X  1 VAL B  223  ? LYS B  227  ? VAL B 223  LYS B 227  
X  2 HIS B  236  ? SER B  242  ? HIS B 236  SER B 242  
X  3 SER B  252  ? VAL B  256  ? SER B 252  VAL B 256  
X  4 LYS B  270  ? THR B  272  ? LYS B 270  THR B 272  
X  5 ILE B  280  ? PRO B  281  ? ILE B 280  PRO B 281  
Y  1 CYS B  544  ? ILE B  545  ? CYS B 544  ILE B 545  
Y  2 VAL B  633  ? ILE B  639  ? VAL B 633  ILE B 639  
Y  3 VAL B  690  ? ASP B  694  ? VAL B 690  ASP B 694  
Z  1 CYS B  544  ? ILE B  545  ? CYS B 544  ILE B 545  
Z  2 VAL B  633  ? ILE B  639  ? VAL B 633  ILE B 639  
Z  3 HIS B  740  ? CYS B  741  ? HIS B 740  CYS B 741  
Z  4 ILE B  703  ? ALA B  704  ? ILE B 703  ALA B 704  
AA 1 MET B  563  ? GLU B  564  ? MET B 563  GLU B 564  
AA 2 TRP B  586  ? HIS B  590  ? TRP B 586  HIS B 590  
AA 3 THR B  578  ? VAL B  582  ? THR B 578  VAL B 582  
AA 4 GLU B  623  ? PHE B  627  ? GLU B 623  PHE B 627  
AA 5 SER B  614  ? ASP B  618  ? SER B 614  ASP B 618  
AB 1 ALA B  793  ? LEU B  796  ? ALA B 793  LEU B 796  
AB 2 SER B  853  ? GLN B  862  ? SER B 853  GLN B 862  
AB 3 LEU B  961  ? LYS B  972  ? LEU B 961  LYS B 972  
AB 4 GLY B  947  ? ASN B  957  ? GLY B 947  ASN B 957  
AB 5 ARG B  904  ? VAL B  905  ? ARG B 904  VAL B 905  
AC 1 GLY B  804  ? THR B  805  ? GLY B 804  THR B 805  
AC 2 GLY B  1042 ? ASP B  1043 ? GLY B 1042 ASP B 1043 
AD 1 LYS B  979  ? ALA B  981  ? LYS B 979  ALA B 981  
AD 2 LYS B  987  ? TYR B  994  ? LYS B 987  TYR B 994  
AD 3 SER B  838  ? ASN B  842  ? SER B 838  ASN B 842  
AD 4 LEU B  1010 ? ILE B  1012 ? LEU B 1010 ILE B 1012 
AD 5 GLN B  821  ? ILE B  827  ? GLN B 821  ILE B 827  
AD 6 PRO B  1089 ? TYR B  1092 ? PRO B 1089 TYR B 1092 
AE 1 VAL B  910  ? ILE B  912  ? VAL B 910  ILE B 912  
AE 2 THR B  939  ? PRO B  940  ? THR B 939  PRO B 940  
AF 1 THR B  915  ? THR B  916  ? THR B 915  THR B 916  
AF 2 ARG B  935  ? ASP B  936  ? ARG B 935  ASP B 936  
AG 1 GLU B  1070 ? TYR B  1073 ? GLU B 1070 TYR B 1073 
AG 2 LYS B  1080 ? ILE B  1085 ? LYS B 1080 ILE B 1085 
AH 1 PHE B  1158 ? CYS B  1163 ? PHE B 1158 CYS B 1163 
AH 2 ILE B  1191 ? ILE B  1196 ? ILE B 1191 ILE B 1196 
AI 1 ASN C  17   ? LEU C  22   ? ASN C 17   LEU C 22   
AI 2 PHE C  228  ? GLU C  233  ? PHE C 228  GLU C 233  
AI 3 ILE C  176  ? GLU C  179  ? ILE C 176  GLU C 179  
AJ 1 SER C  96   ? PHE C  104  ? SER C 96   PHE C 104  
AJ 2 GLU C  152  ? GLY C  162  ? GLU C 152  GLY C 162  
AJ 3 THR C  43   ? ASN C  54   ? THR C 43   ASN C 54   
AJ 4 VAL L  65   ? PHE L  67   ? VAL L 65   PHE L 67   
AK 1 THR C  111  ? TYR C  114  ? THR C 111  TYR C 114  
AK 2 LEU C  143  ? LEU C  147  ? LEU C 143  LEU C 147  
AL 1 LYS D  36   ? ILE D  38   ? LYS D 36   ILE D 38   
AL 2 GLU D  44   ? GLU D  46   ? GLU D 44   GLU D 46   
AM 1 PHE E  60   ? ALA E  62   ? PHE E 60   ALA E 62   
AM 2 LEU E  78   ? GLU E  81   ? LEU E 78   GLU E 81   
AM 3 THR E  107  ? TYR E  112  ? THR E 107  TYR E 112  
AM 4 THR E  131  ? ASN E  136  ? THR E 131  ASN E 136  
AN 1 ARG E  177  ? ILE E  178  ? ARG E 177  ILE E 178  
AN 2 GLY E  206  ? CYS E  214  ? GLY E 206  CYS E 214  
AN 3 VAL E  195  ? SER E  202  ? VAL E 195  SER E 202  
AO 1 GLY G  169  ? ALA G  170  ? GLY G 169  ALA G 170  
AO 2 ARG G  142  ? SER G  152  ? ARG G 142  SER G 152  
AO 3 ILE G  157  ? SER G  162  ? ILE G 157  SER G 162  
AO 4 LYS G  107  ? THR G  111  ? LYS G 107  THR G 111  
AO 5 GLY G  98   ? GLN G  102  ? GLY G 98   GLN G 102  
AO 6 GLU G  85   ? CYS G  94   ? GLU G 85   CYS G 94   
AO 7 ARG G  142  ? SER G  152  ? ARG G 142  SER G 152  
AP 1 SER G  129  ? GLN G  131  ? SER G 129  GLN G 131  
AP 2 VAL G  136  ? THR G  138  ? VAL G 136  THR G 138  
AQ 1 VAL H  96   ? TYR H  98   ? VAL H 96   TYR H 98   
AQ 2 TYR H  141  ? ARG H  145  ? TYR H 141  ARG H 145  
AQ 3 SER H  54   ? THR H  58   ? SER H 54   THR H 58   
AQ 4 ASP H  7    ? ASP H  16   ? ASP H 7    ASP H 16   
AQ 5 CYS H  24   ? SER H  30   ? CYS H 24   SER H 30   
AQ 6 LYS H  37   ? ILE H  42   ? LYS H 37   ILE H 42   
AQ 7 LEU H  121  ? GLY H  127  ? LEU H 121  GLY H 127  
AQ 8 ILE H  112  ? PHE H  118  ? ILE H 112  PHE H 118  
AQ 9 THR H  100  ? GLU H  106  ? THR H 100  GLU H 106  
AR 1 TYR I  15   ? ASP I  19   ? TYR I 15   ASP I 19   
AR 2 ARG I  24   ? GLU I  28   ? ARG I 24   GLU I 28   
AR 3 VAL I  35   ? GLU I  37   ? VAL I 35   GLU I 37   
AS 1 PHE I  100  ? VAL I  102  ? PHE I 100  VAL I 102  
AS 2 ILE I  109  ? THR I  111  ? ILE I 109  THR I 111  
AT 1 ILE K  21   ? PRO K  23   ? ILE K 21   PRO K 23   
AT 2 ALA K  30   ? GLU K  36   ? ALA K 30   GLU K 36   
AT 3 ARG K  70   ? THR K  77   ? ARG K 70   THR K 77   
AT 4 VAL K  56   ? LYS K  62   ? VAL K 56   LYS K 62   
AU 1 LEU P  1418 ? ASP P  1419 ? LEU M 1418 ASP M 1419 
AU 2 GLU P  16   ? LEU P  21   ? GLU M 16   LEU M 21   
AU 3 ILE Q  1212 ? TYR Q  1217 ? ILE N 1212 TYR N 1217 
AV 1 GLY P  82   ? VAL P  90   ? GLY M 82   VAL M 90   
AV 2 LEU P  236  ? VAL P  241  ? LEU M 236  VAL M 241  
AW 1 ASP P  151  ? PRO P  153  ? ASP M 151  PRO M 153  
AW 2 LEU P  161  ? SER P  163  ? LEU M 161  SER M 163  
AX 1 THR P  173  ? ASP P  177  ? THR M 173  ASP M 177  
AX 2 LYS P  180  ? SER P  184  ? LYS M 180  SER M 184  
AX 3 LEU P  199  ? LEU P  202  ? LEU M 199  LEU M 202  
AY 1 LYS P  343  ? VAL P  345  ? LYS M 343  VAL M 345  
AY 2 LEU Q  1128 ? PHE Q  1130 ? LEU N 1128 PHE N 1130 
AZ 1 HIS Q  1104 ? ARG Q  1106 ? HIS N 1104 ARG N 1106 
AZ 2 SER P  348  ? GLY P  355  ? SER M 348  GLY M 355  
AZ 3 GLU P  486  ? HIS P  490  ? GLU M 486  HIS M 490  
AZ 4 PRO P  441  ? ASN P  445  ? PRO M 441  ASN M 445  
AZ 5 MET P  455  ? ILE P  463  ? MET M 455  ILE M 463  
AZ 6 GLN P  363  ? PRO P  367  ? GLN M 363  PRO M 367  
AZ 7 PHE P  468  ? LEU P  470  ? PHE M 468  LEU M 470  
AZ 8 SER P  348  ? GLY P  355  ? SER M 348  GLY M 355  
BA 1 THR P  375  ? VAL P  379  ? THR M 375  VAL M 379  
BA 2 LYS P  431  ? HIS P  435  ? LYS M 431  HIS M 435  
BA 3 ALA P  402  ? ARG P  407  ? ALA M 402  ARG M 407  
BA 4 ASP P  411  ? ASP P  414  ? ASP M 411  ASP M 414  
BB 1 VAL P  512  ? SER P  513  ? VAL M 512  SER M 513  
BB 2 LYS P  518  ? PRO P  519  ? LYS M 518  PRO M 519  
BC 1 PHE P  540  ? GLU P  542  ? PHE M 540  GLU M 542  
BC 2 LEU P  571  ? SER P  573  ? LEU M 571  SER M 573  
BD 1 LEU P  588  ? GLN P  589  ? LEU M 588  GLN M 589  
BD 2 LEU P  606  ? ILE P  608  ? LEU M 606  ILE M 608  
BD 3 GLN P  611  ? PHE P  614  ? GLN M 611  PHE M 614  
BE 1 GLY P  766  ? GLN P  767  ? GLY M 766  GLN M 767  
BE 2 PHE P  799  ? VAL P  800  ? PHE M 799  VAL M 800  
BF 1 MET P  849  ? VAL P  850  ? MET M 849  VAL M 850  
BF 2 THR P  856  ? ARG P  857  ? THR M 856  ARG M 857  
BF 3 VAL P  863  ? GLN P  865  ? VAL M 863  GLN M 865  
BG 1 ILE P  878  ? SER P  882  ? ILE M 878  SER M 882  
BG 2 ASN P  953  ? PRO P  957  ? ASN M 953  PRO M 957  
BH 1 VAL P  1283 ? TYR P  1287 ? VAL M 1283 TYR M 1287 
BH 2 GLU P  1303 ? GLU P  1307 ? GLU M 1303 GLU M 1307 
BH 3 LEU P  1116 ? TYR P  1119 ? LEU M 1116 TYR M 1119 
BH 4 TYR P  1328 ? THR P  1329 ? TYR M 1328 THR M 1329 
BI 1 THR P  1141 ? THR P  1142 ? THR M 1141 THR M 1142 
BI 2 THR P  1272 ? ARG P  1274 ? THR M 1272 ARG M 1274 
BJ 1 VAL P  1226 ? TRP P  1228 ? VAL M 1226 TRP M 1228 
BJ 2 ILE P  1237 ? CYS P  1240 ? ILE M 1237 CYS M 1240 
BJ 3 TRP P  1191 ? LEU P  1197 ? TRP M 1191 LEU M 1197 
BJ 4 THR P  1147 ? TYR P  1154 ? THR M 1147 TYR M 1154 
BJ 5 LEU X  42   ? ARG X  45   ? LEU U 42   ARG U 45   
BK 1 LYS P  1290 ? PRO P  1292 ? LYS M 1290 PRO M 1292 
BK 2 TYR P  1298 ? LYS P  1300 ? TYR M 1298 LYS M 1300 
BL 1 PHE U  143  ? SER U  147  ? PHE R 143  SER R 147  
BL 2 LEU U  132  ? TYR U  137  ? LEU R 132  TYR R 137  
BL 3 PHE P  1441 ? ILE P  1445 ? PHE M 1441 ILE M 1445 
BL 4 GLY V  59   ? ILE V  61   ? GLY S 59   ILE S 61   
BL 5 ALA V  68   ? PHE V  79   ? ALA S 68   PHE S 79   
BL 6 PHE V  3    ? LEU V  13   ? PHE S 3    LEU S 13   
BM 1 PHE U  143  ? SER U  147  ? PHE R 143  SER R 147  
BM 2 LEU U  132  ? TYR U  137  ? LEU R 132  TYR R 137  
BM 3 PHE P  1441 ? ILE P  1445 ? PHE M 1441 ILE M 1445 
BM 4 GLY V  59   ? ILE V  61   ? GLY S 59   ILE S 61   
BM 5 ALA V  68   ? PHE V  79   ? ALA S 68   PHE S 79   
BM 6 GLY V  43   ? VAL V  48   ? GLY S 43   VAL S 48   
BM 7 CYS V  38   ? THR V  39   ? CYS S 38   THR S 39   
BN 1 SER Q  91   ? VAL Q  97   ? SER N 91   VAL N 97   
BN 2 GLY Q  127  ? LYS Q  133  ? GLY N 127  LYS N 133  
BN 3 VAL Q  165  ? ARG Q  169  ? VAL N 165  ARG N 169  
BO 1 VAL Q  102  ? ASN Q  103  ? VAL N 102  ASN N 103  
BO 2 THR Q  109  ? HIS Q  110  ? THR N 109  HIS N 110  
BP 1 PHE Q  203  ? ILE Q  205  ? PHE N 203  ILE N 205  
BP 2 SER Q  208  ? VAL Q  211  ? SER N 208  VAL N 211  
BP 3 GLN Q  481  ? VAL Q  482  ? GLN N 481  VAL N 482  
BQ 1 LYS Q  404  ? ASP Q  407  ? LYS N 404  ASP N 407  
BQ 2 ALA Q  214  ? SER Q  218  ? ALA N 214  SER N 218  
BQ 3 ARG Q  497  ? ASN Q  499  ? ARG N 497  ASN N 499  
BQ 4 LYS Q  537  ? ASN Q  538  ? LYS N 537  ASN N 538  
BR 1 VAL Q  223  ? LYS Q  227  ? VAL N 223  LYS N 227  
BR 2 HIS Q  236  ? SER Q  242  ? HIS N 236  SER N 242  
BR 3 SER Q  252  ? VAL Q  256  ? SER N 252  VAL N 256  
BR 4 LYS Q  270  ? THR Q  272  ? LYS N 270  THR N 272  
BR 5 ILE Q  280  ? PRO Q  281  ? ILE N 280  PRO N 281  
BS 1 CYS Q  544  ? ILE Q  545  ? CYS N 544  ILE N 545  
BS 2 VAL Q  633  ? ILE Q  639  ? VAL N 633  ILE N 639  
BS 3 VAL Q  690  ? ASP Q  694  ? VAL N 690  ASP N 694  
BT 1 CYS Q  544  ? ILE Q  545  ? CYS N 544  ILE N 545  
BT 2 VAL Q  633  ? ILE Q  639  ? VAL N 633  ILE N 639  
BT 3 HIS Q  740  ? CYS Q  741  ? HIS N 740  CYS N 741  
BT 4 ILE Q  703  ? ALA Q  704  ? ILE N 703  ALA N 704  
BU 1 MET Q  563  ? GLU Q  564  ? MET N 563  GLU N 564  
BU 2 TRP Q  586  ? HIS Q  590  ? TRP N 586  HIS N 590  
BU 3 THR Q  578  ? VAL Q  582  ? THR N 578  VAL N 582  
BU 4 GLU Q  623  ? PHE Q  627  ? GLU N 623  PHE N 627  
BU 5 SER Q  614  ? ASP Q  618  ? SER N 614  ASP N 618  
BV 1 ALA Q  793  ? LEU Q  796  ? ALA N 793  LEU N 796  
BV 2 SER Q  853  ? GLN Q  862  ? SER N 853  GLN N 862  
BV 3 PHE Q  963  ? LYS Q  972  ? PHE N 963  LYS N 972  
BV 4 GLY Q  947  ? GLN Q  951  ? GLY N 947  GLN N 951  
BV 5 ARG Q  904  ? VAL Q  905  ? ARG N 904  VAL N 905  
BW 1 ALA Q  793  ? LEU Q  796  ? ALA N 793  LEU N 796  
BW 2 SER Q  853  ? GLN Q  862  ? SER N 853  GLN N 862  
BW 3 PHE Q  963  ? LYS Q  972  ? PHE N 963  LYS N 972  
BW 4 VAL Q  954  ? THR Q  955  ? VAL N 954  THR N 955  
BX 1 GLY Q  804  ? THR Q  805  ? GLY N 804  THR N 805  
BX 2 GLY Q  1042 ? ASP Q  1043 ? GLY N 1042 ASP N 1043 
BY 1 LYS Q  979  ? ALA Q  981  ? LYS N 979  ALA N 981  
BY 2 LYS Q  987  ? TYR Q  994  ? LYS N 987  TYR N 994  
BY 3 SER Q  838  ? ASN Q  842  ? SER N 838  ASN N 842  
BY 4 LEU Q  1010 ? ILE Q  1012 ? LEU N 1010 ILE N 1012 
BY 5 GLN Q  821  ? ILE Q  827  ? GLN N 821  ILE N 827  
BY 6 LYS Q  1080 ? TYR Q  1092 ? LYS N 1080 TYR N 1092 
BY 7 GLU Q  1070 ? TYR Q  1073 ? GLU N 1070 TYR N 1073 
BZ 1 VAL Q  910  ? ILE Q  912  ? VAL N 910  ILE N 912  
BZ 2 THR Q  939  ? PRO Q  940  ? THR N 939  PRO N 940  
CA 1 THR Q  915  ? THR Q  916  ? THR N 915  THR N 916  
CA 2 ARG Q  935  ? ASP Q  936  ? ARG N 935  ASP N 936  
CB 1 PHE Q  1158 ? CYS Q  1163 ? PHE N 1158 CYS N 1163 
CB 2 ILE Q  1191 ? ILE Q  1196 ? ILE N 1191 ILE N 1196 
CC 1 ASN R  17   ? LEU R  22   ? ASN O 17   LEU O 22   
CC 2 PHE R  228  ? GLU R  233  ? PHE O 228  GLU O 233  
CC 3 ILE R  176  ? GLU R  177  ? ILE O 176  GLU O 177  
CD 1 THR R  53   ? ASN R  54   ? THR O 53   ASN O 54   
CD 2 GLU R  152  ? GLY R  162  ? GLU O 152  GLY O 162  
CD 3 SER R  96   ? PHE R  104  ? SER O 96   PHE O 104  
CE 1 THR R  53   ? ASN R  54   ? THR O 53   ASN O 54   
CE 2 GLU R  152  ? GLY R  162  ? GLU O 152  GLY O 162  
CE 3 THR R  43   ? VAL R  51   ? THR O 43   VAL O 51   
CE 4 VAL AA 65   ? PHE AA 67   ? VAL X 65   PHE X 67   
CF 1 THR R  111  ? TYR R  114  ? THR O 111  TYR O 114  
CF 2 LEU R  143  ? LEU R  147  ? LEU O 143  LEU O 147  
CG 1 LYS S  36   ? ILE S  38   ? LYS P 36   ILE P 38   
CG 2 GLU S  44   ? GLU S  46   ? GLU P 44   GLU P 46   
CH 1 PHE T  60   ? ALA T  62   ? PHE Q 60   ALA Q 62   
CH 2 LEU T  78   ? GLU T  81   ? LEU Q 78   GLU Q 81   
CH 3 THR T  107  ? TYR T  112  ? THR Q 107  TYR Q 112  
CH 4 THR T  131  ? ASN T  136  ? THR Q 131  ASN Q 136  
CI 1 ARG T  177  ? ILE T  178  ? ARG Q 177  ILE Q 178  
CI 2 GLY T  206  ? CYS T  214  ? GLY Q 206  CYS Q 214  
CI 3 VAL T  195  ? SER T  202  ? VAL Q 195  SER Q 202  
CJ 1 GLY V  169  ? ALA V  170  ? GLY S 169  ALA S 170  
CJ 2 ARG V  142  ? SER V  152  ? ARG S 142  SER S 152  
CJ 3 ILE V  157  ? SER V  162  ? ILE S 157  SER S 162  
CJ 4 LYS V  107  ? THR V  111  ? LYS S 107  THR S 111  
CJ 5 GLY V  98   ? GLN V  102  ? GLY S 98   GLN S 102  
CJ 6 GLU V  85   ? CYS V  94   ? GLU S 85   CYS S 94   
CJ 7 ARG V  142  ? SER V  152  ? ARG S 142  SER S 152  
CK 1 SER V  129  ? GLN V  131  ? SER S 129  GLN S 131  
CK 2 VAL V  136  ? THR V  138  ? VAL S 136  THR S 138  
CL 1 VAL W  96   ? TYR W  98   ? VAL T 96   TYR T 98   
CL 2 TYR W  141  ? ARG W  145  ? TYR T 141  ARG T 145  
CL 3 SER W  54   ? THR W  58   ? SER T 54   THR T 58   
CL 4 ASP W  7    ? ASP W  16   ? ASP T 7    ASP T 16   
CL 5 VAL W  23   ? SER W  30   ? VAL T 23   SER T 30   
CL 6 LYS W  37   ? ASN W  43   ? LYS T 37   ASN T 43   
CL 7 LEU W  121  ? GLY W  127  ? LEU T 121  GLY T 127  
CL 8 ILE W  112  ? PHE W  118  ? ILE T 112  PHE T 118  
CL 9 THR W  100  ? GLU W  106  ? THR T 100  GLU T 106  
CM 1 TYR X  15   ? ASP X  19   ? TYR U 15   ASP U 19   
CM 2 ARG X  24   ? GLU X  28   ? ARG U 24   GLU U 28   
CM 3 VAL X  35   ? GLU X  37   ? VAL U 35   GLU U 37   
CN 1 PHE X  100  ? VAL X  102  ? PHE U 100  VAL U 102  
CN 2 ILE X  109  ? THR X  111  ? ILE U 109  THR U 111  
CO 1 ILE Z  21   ? PRO Z  23   ? ILE W 21   PRO W 23   
CO 2 ALA Z  30   ? GLU Z  36   ? ALA W 30   GLU W 36   
CO 3 ARG Z  70   ? THR Z  77   ? ARG W 70   THR W 77   
CO 4 VAL Z  56   ? LYS Z  62   ? VAL W 56   LYS W 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ASP A 1419 ? O ASP A 1419 N VAL A  17   ? N VAL A 17   
A  2 3 N GLU A 16   ? N GLU A 16   O TYR B  1217 ? O TYR B 1217 
B  1 2 N GLY A 82   ? N GLY A 82   O VAL A  241  ? O VAL A 241  
C  1 2 N VAL A 152  ? N VAL A 152  O VAL A  162  ? O VAL A 162  
D  1 2 N ASP A 177  ? N ASP A 177  O LYS A  180  ? O LYS A 180  
D  2 3 N LEU A 181  ? N LEU A 181  O LEU A  202  ? O LEU A 202  
E  1 2 N LYS A 343  ? N LYS A 343  O PHE B  1130 ? O PHE B 1130 
F  1 2 O HIS B 1104 ? O HIS B 1104 N ARG A  350  ? N ARG A 350  
F  2 3 N ALA A 349  ? N ALA A 349  O LEU A  489  ? O LEU A 489  
F  3 4 O ASN A 488  ? O ASN A 488  N ASN A  445  ? N ASN A 445  
F  4 5 N VAL A 442  ? N VAL A 442  O HIS A  458  ? O HIS A 458  
F  5 6 O ILE A 463  ? O ILE A 463  N VAL A  366  ? N VAL A 366  
F  6 7 N GLY A 365  ? N GLY A 365  O ARG A  469  ? O ARG A 469  
F  7 8 O PHE A 468  ? O PHE A 468  N SER A  354  ? N SER A 354  
G  1 2 N TYR A 376  ? N TYR A 376  O ARG A  434  ? O ARG A 434  
G  2 3 O LYS A 431  ? O LYS A 431  N ILE A  406  ? N ILE A 406  
G  3 4 N VAL A 405  ? N VAL A 405  O ILE A  413  ? O ILE A 413  
H  1 2 N SER A 513  ? N SER A 513  O LYS A  518  ? O LYS A 518  
I  1 2 N ILE A 541  ? N ILE A 541  O TRP A  572  ? O TRP A 572  
J  1 2 N LEU A 588  ? N LEU A 588  O ILE A  607  ? O ILE A 607  
J  2 3 N LEU A 606  ? N LEU A 606  O ILE A  613  ? O ILE A 613  
K  1 2 N GLY A 766  ? N GLY A 766  O VAL A  800  ? O VAL A 800  
L  1 2 N MET A 849  ? N MET A 849  O ARG A  857  ? O ARG A 857  
L  2 3 N THR A 856  ? N THR A 856  O GLN A  865  ? O GLN A 865  
M  1 2 N GLU A 879  ? N GLU A 879  O LEU A  956  ? O LEU A 956  
N  1 2 N MET A 1285 ? N MET A 1285 O VAL A  1305 ? O VAL A 1305 
N  2 3 O LEU A 1306 ? O LEU A 1306 N VAL A  1118 ? N VAL A 1118 
N  3 4 N THR A 1117 ? N THR A 1117 O TYR A  1328 ? O TYR A 1328 
O  1 2 N THR A 1141 ? N THR A 1141 O LEU A  1273 ? O LEU A 1273 
P  1 2 N ILE A 1227 ? N ILE A 1227 O ARG A  1239 ? O ARG A 1239 
P  2 3 O CYS A 1240 ? O CYS A 1240 N LEU A  1193 ? N LEU A 1193 
P  3 4 O LEU A 1192 ? O LEU A 1192 N TYR A  1153 ? N TYR A 1153 
P  4 5 N ILE A 1152 ? N ILE A 1152 O TYR I  44   ? O TYR I 44   
Q  1 2 N VAL A 1291 ? N VAL A 1291 O VAL A  1299 ? O VAL A 1299 
R  1 2 O TRP F 146  ? O TRP F 146  N ILE F  134  ? N ILE F 134  
R  2 3 O VAL F 133  ? O VAL F 133  N MET A  1444 ? N MET A 1444 
R  3 4 N VAL A 1443 ? N VAL A 1443 O ILE G  61   ? O ILE G 61   
R  4 5 N ARG G 60   ? N ARG G 60   O GLU G  69   ? O GLU G 69   
R  5 6 O PHE G 70   ? O PHE G 70   N ILE G  11   ? N ILE G 11   
S  1 2 O TRP F 146  ? O TRP F 146  N ILE F  134  ? N ILE F 134  
S  2 3 O VAL F 133  ? O VAL F 133  N MET A  1444 ? N MET A 1444 
S  3 4 N VAL A 1443 ? N VAL A 1443 O ILE G  61   ? O ILE G 61   
S  4 5 N ARG G 60   ? N ARG G 60   O GLU G  69   ? O GLU G 69   
S  5 6 O VAL G 77   ? O VAL G 77   N CYS G  47   ? N CYS G 47   
S  6 7 O GLY G 43   ? O GLY G 43   N THR G  39   ? N THR G 39   
T  1 2 N TYR B 96   ? N TYR B 96   O PHE B  129  ? O PHE B 129  
T  2 3 N LEU B 128  ? N LEU B 128  O ILE B  167  ? O ILE B 167  
U  1 2 N VAL B 102  ? N VAL B 102  O HIS B  110  ? O HIS B 110  
V  1 2 N PHE B 203  ? N PHE B 203  O LYS B  210  ? O LYS B 210  
V  2 3 N VAL B 211  ? N VAL B 211  O GLN B  481  ? O GLN B 481  
W  1 2 O ARG B 405  ? O ARG B 405  N ARG B  217  ? N ARG B 217  
W  2 3 N ALA B 214  ? N ALA B 214  O ASN B  499  ? O ASN B 499  
W  3 4 N THR B 498  ? N THR B 498  O LYS B  537  ? O LYS B 537  
X  1 2 N GLN B 224  ? N GLN B 224  O GLU B  239  ? O GLU B 239  
X  2 3 N ILE B 240  ? N ILE B 240  O LEU B  254  ? O LEU B 254  
X  3 4 N GLN B 255  ? N GLN B 255  O THR B  272  ? O THR B 272  
X  4 5 N ALA B 271  ? N ALA B 271  O ILE B  280  ? O ILE B 280  
Y  1 2 N CYS B 544  ? N CYS B 544  O TYR B  634  ? O TYR B 634  
Y  2 3 N LEU B 637  ? N LEU B 637  O GLU B  691  ? O GLU B 691  
Z  1 2 N CYS B 544  ? N CYS B 544  O TYR B  634  ? O TYR B 634  
Z  2 3 N PHE B 638  ? N PHE B 638  O CYS B  741  ? O CYS B 741  
Z  3 4 O HIS B 740  ? O HIS B 740  N ALA B  704  ? N ALA B 704  
AA 1 2 N GLU B 564  ? N GLU B 564  O VAL B  589  ? O VAL B 589  
AA 2 3 O HIS B 587  ? O HIS B 587  N VAL B  580  ? N VAL B 580  
AA 3 4 N PHE B 581  ? N PHE B 581  O LEU B  624  ? O LEU B 624  
AA 4 5 O PHE B 627  ? O PHE B 627  N SER B  614  ? N SER B 614  
AB 1 2 N ILE B 795  ? N ILE B 795  O LEU B  854  ? O LEU B 854  
AB 2 3 N ASP B 861  ? N ASP B 861  O VAL B  964  ? O VAL B 964  
AB 3 4 O PHE B 963  ? O PHE B 963  N THR B  955  ? N THR B 955  
AB 4 5 O GLY B 947  ? O GLY B 947  N VAL B  905  ? N VAL B 905  
AC 1 2 N THR B 805  ? N THR B 805  O GLY B  1042 ? O GLY B 1042 
AD 1 2 N PHE B 980  ? N PHE B 980  O GLY B  988  ? O GLY B 988  
AD 2 3 O THR B 989  ? O THR B 989  N MET B  839  ? N MET B 839  
AD 3 4 N ILE B 840  ? N ILE B 840  O ILE B  1011 ? O ILE B 1011 
AD 4 5 O ILE B 1012 ? O ILE B 1012 N ALA B  826  ? N ALA B 826  
AD 5 6 N GLN B 821  ? N GLN B 821  O TYR B  1092 ? O TYR B 1092 
AE 1 2 N ILE B 911  ? N ILE B 911  O THR B  939  ? O THR B 939  
AF 1 2 N THR B 916  ? N THR B 916  O ARG B  935  ? O ARG B 935  
AG 1 2 N GLU B 1070 ? N GLU B 1070 O ILE B  1085 ? O ILE B 1085 
AH 1 2 N VAL B 1160 ? N VAL B 1160 O ILE B  1194 ? O ILE B 1194 
AI 1 2 N LEU C 22   ? N LEU C 22   O PHE C  228  ? O PHE C 228  
AI 2 3 O ASN C 231  ? O ASN C 231  N GLU C  177  ? N GLU C 177  
AJ 1 2 N LEU C 99   ? N LEU C 99   O CYS C  157  ? O CYS C 157  
AJ 2 3 O LYS C 154  ? O LYS C 154  N THR C  53   ? N THR C 53   
AJ 3 4 N VAL C 51   ? N VAL C 51   O VAL L  65   ? O VAL L 65   
AK 1 2 N VAL C 113  ? N VAL C 113  O CYS C  145  ? O CYS C 145  
AL 1 2 N GLN D 37   ? N GLN D 37   O GLU D  45   ? O GLU D 45   
AM 1 2 N PHE E 60   ? N PHE E 60   O VAL E  80   ? O VAL E 80   
AM 2 3 N GLU E 81   ? N GLU E 81   O ILE E  109  ? O ILE E 109  
AM 3 4 N GLY E 108  ? N GLY E 108  O GLU E  133  ? O GLU E 133  
AN 1 2 N ILE E 178  ? N ILE E 178  O ILE E  213  ? O ILE E 213  
AN 2 3 O SER E 210  ? O SER E 210  N ILE E  198  ? N ILE E 198  
AO 1 2 O GLY G 169  ? O GLY G 169  N ARG G  144  ? N ARG G 144  
AO 2 3 N ILE G 151  ? N ILE G 151  O HIS G  158  ? O HIS G 158  
AO 3 4 O GLY G 161  ? O GLY G 161  N PHE G  109  ? N PHE G 109  
AO 4 5 O VAL G 108  ? O VAL G 108  N VAL G  101  ? N VAL G 101  
AO 5 6 O GLN G 102  ? O GLN G 102  N THR G  90   ? N THR G 90   
AO 6 7 N VAL G 87   ? N VAL G 87   O VAL G  145  ? O VAL G 145  
AP 1 2 N TYR G 130  ? N TYR G 130  O ILE G  137  ? O ILE G 137  
AQ 1 2 N MET H 97   ? N MET H 97   O LEU H  142  ? O LEU H 142  
AQ 2 3 O ARG H 145  ? O ARG H 145  N THR H  56   ? N THR H 56   
AQ 3 4 O VAL H 57   ? O VAL H 57   N ASP H  8    ? N ASP H 8    
AQ 4 5 N ASP H 16   ? N ASP H 16   O ARG H  25   ? O ARG H 25   
AQ 5 6 N ILE H 26   ? N ILE H 26   O LEU H  40   ? O LEU H 40   
AQ 6 7 N THR H 39   ? N THR H 39   O ARG H  124  ? O ARG H 124  
AQ 7 8 O LEU H 121  ? O LEU H 121  N PHE H  118  ? N PHE H 118  
AQ 8 9 O SER H 117  ? O SER H 117  N THR H  100  ? N THR H 100  
AR 1 2 N ARG I 17   ? N ARG I 17   O LEU I  26   ? O LEU I 26   
AR 2 3 N PHE I 27   ? N PHE I 27   O GLU I  36   ? O GLU I 36   
AS 1 2 N PHE I 101  ? N PHE I 101  O PHE I  110  ? O PHE I 110  
AT 1 2 N ASP K 22   ? N ASP K 22   O VAL K  32   ? O VAL K 32   
AT 2 3 N PHE K 35   ? N PHE K 35   O PHE K  71   ? O PHE K 71   
AT 3 4 O GLN K 76   ? O GLN K 76   N PHE K  58   ? N PHE K 58   
AU 1 2 O ASP P 1419 ? O ASP M 1419 N VAL P  17   ? N VAL M 17   
AU 2 3 N GLU P 16   ? N GLU M 16   O TYR Q  1217 ? O TYR N 1217 
AV 1 2 N GLY P 82   ? N GLY M 82   O VAL P  241  ? O VAL M 241  
AW 1 2 N VAL P 152  ? N VAL M 152  O VAL P  162  ? O VAL M 162  
AX 1 2 N ASP P 177  ? N ASP M 177  O LYS P  180  ? O LYS M 180  
AX 2 3 N LEU P 181  ? N LEU M 181  O LEU P  202  ? O LEU M 202  
AY 1 2 N LYS P 343  ? N LYS M 343  O PHE Q  1130 ? O PHE N 1130 
AZ 1 2 O HIS Q 1104 ? O HIS N 1104 N ARG P  350  ? N ARG M 350  
AZ 2 3 N ALA P 349  ? N ALA M 349  O LEU P  489  ? O LEU M 489  
AZ 3 4 O ASN P 488  ? O ASN M 488  N ASN P  445  ? N ASN M 445  
AZ 4 5 N PHE P 444  ? N PHE M 444  O MET P  456  ? O MET M 456  
AZ 5 6 O ILE P 463  ? O ILE M 463  N VAL P  366  ? N VAL M 366  
AZ 6 7 N GLY P 365  ? N GLY M 365  O ARG P  469  ? O ARG M 469  
AZ 7 8 O PHE P 468  ? O PHE M 468  N SER P  354  ? N SER M 354  
BA 1 2 N TYR P 376  ? N TYR M 376  O ARG P  434  ? O ARG M 434  
BA 2 3 O LYS P 431  ? O LYS M 431  N ILE P  406  ? N ILE M 406  
BA 3 4 N VAL P 405  ? N VAL M 405  O ILE P  413  ? O ILE M 413  
BB 1 2 N SER P 513  ? N SER M 513  O LYS P  518  ? O LYS M 518  
BC 1 2 N ILE P 541  ? N ILE M 541  O TRP P  572  ? O TRP M 572  
BD 1 2 N LEU P 588  ? N LEU M 588  O ILE P  607  ? O ILE M 607  
BD 2 3 N LEU P 606  ? N LEU M 606  O ILE P  613  ? O ILE M 613  
BE 1 2 N GLY P 766  ? N GLY M 766  O VAL P  800  ? O VAL M 800  
BF 1 2 N MET P 849  ? N MET M 849  O ARG P  857  ? O ARG M 857  
BF 2 3 N THR P 856  ? N THR M 856  O GLN P  865  ? O GLN M 865  
BG 1 2 N GLU P 879  ? N GLU M 879  O LEU P  956  ? O LEU M 956  
BH 1 2 N MET P 1285 ? N MET M 1285 O VAL P  1305 ? O VAL M 1305 
BH 2 3 O LEU P 1306 ? O LEU M 1306 N VAL P  1118 ? N VAL M 1118 
BH 3 4 N THR P 1117 ? N THR M 1117 O TYR P  1328 ? O TYR M 1328 
BI 1 2 N THR P 1141 ? N THR M 1141 O LEU P  1273 ? O LEU M 1273 
BJ 1 2 N ILE P 1227 ? N ILE M 1227 O ARG P  1239 ? O ARG M 1239 
BJ 2 3 O CYS P 1240 ? O CYS M 1240 N LEU P  1193 ? N LEU M 1193 
BJ 3 4 O LEU P 1192 ? O LEU M 1192 N TYR P  1153 ? N TYR M 1153 
BJ 4 5 N ILE P 1152 ? N ILE M 1152 O TYR X  44   ? O TYR U 44   
BK 1 2 N VAL P 1291 ? N VAL M 1291 O VAL P  1299 ? O VAL M 1299 
BL 1 2 O TRP U 146  ? O TRP R 146  N ILE U  134  ? N ILE R 134  
BL 2 3 O VAL U 133  ? O VAL R 133  N MET P  1444 ? N MET M 1444 
BL 3 4 N VAL P 1443 ? N VAL M 1443 O ILE V  61   ? O ILE S 61   
BL 4 5 N ARG V 60   ? N ARG S 60   O GLU V  69   ? O GLU S 69   
BL 5 6 O PHE V 70   ? O PHE S 70   N ILE V  11   ? N ILE S 11   
BM 1 2 O TRP U 146  ? O TRP R 146  N ILE U  134  ? N ILE R 134  
BM 2 3 O VAL U 133  ? O VAL R 133  N MET P  1444 ? N MET M 1444 
BM 3 4 N VAL P 1443 ? N VAL M 1443 O ILE V  61   ? O ILE S 61   
BM 4 5 N ARG V 60   ? N ARG S 60   O GLU V  69   ? O GLU S 69   
BM 5 6 O VAL V 77   ? O VAL S 77   N CYS V  47   ? N CYS S 47   
BM 6 7 O GLY V 43   ? O GLY S 43   N THR V  39   ? N THR S 39   
BN 1 2 N TYR Q 96   ? N TYR N 96   O PHE Q  129  ? O PHE N 129  
BN 2 3 N LEU Q 128  ? N LEU N 128  O ILE Q  167  ? O ILE N 167  
BO 1 2 N VAL Q 102  ? N VAL N 102  O HIS Q  110  ? O HIS N 110  
BP 1 2 N PHE Q 203  ? N PHE N 203  O LYS Q  210  ? O LYS N 210  
BP 2 3 N VAL Q 211  ? N VAL N 211  O GLN Q  481  ? O GLN N 481  
BQ 1 2 O ARG Q 405  ? O ARG N 405  N ARG Q  217  ? N ARG N 217  
BQ 2 3 N ALA Q 214  ? N ALA N 214  O ASN Q  499  ? O ASN N 499  
BQ 3 4 N THR Q 498  ? N THR N 498  O LYS Q  537  ? O LYS N 537  
BR 1 2 N GLN Q 224  ? N GLN N 224  O GLU Q  239  ? O GLU N 239  
BR 2 3 N ILE Q 240  ? N ILE N 240  O LEU Q  254  ? O LEU N 254  
BR 3 4 N GLN Q 255  ? N GLN N 255  O THR Q  272  ? O THR N 272  
BR 4 5 N ALA Q 271  ? N ALA N 271  O ILE Q  280  ? O ILE N 280  
BS 1 2 N CYS Q 544  ? N CYS N 544  O TYR Q  634  ? O TYR N 634  
BS 2 3 N LEU Q 637  ? N LEU N 637  O GLU Q  691  ? O GLU N 691  
BT 1 2 N CYS Q 544  ? N CYS N 544  O TYR Q  634  ? O TYR N 634  
BT 2 3 N PHE Q 638  ? N PHE N 638  O CYS Q  741  ? O CYS N 741  
BT 3 4 O HIS Q 740  ? O HIS N 740  N ALA Q  704  ? N ALA N 704  
BU 1 2 N GLU Q 564  ? N GLU N 564  O VAL Q  589  ? O VAL N 589  
BU 2 3 O HIS Q 587  ? O HIS N 587  N VAL Q  580  ? N VAL N 580  
BU 3 4 N PHE Q 581  ? N PHE N 581  O LEU Q  624  ? O LEU N 624  
BU 4 5 O PHE Q 627  ? O PHE N 627  N SER Q  614  ? N SER N 614  
BV 1 2 N ILE Q 795  ? N ILE N 795  O LEU Q  854  ? O LEU N 854  
BV 2 3 N ASP Q 861  ? N ASP N 861  O VAL Q  964  ? O VAL N 964  
BV 3 4 O ARG Q 967  ? O ARG N 967  N ASP Q  950  ? N ASP N 950  
BV 4 5 O GLY Q 947  ? O GLY N 947  N VAL Q  905  ? N VAL N 905  
BW 1 2 N ILE Q 795  ? N ILE N 795  O LEU Q  854  ? O LEU N 854  
BW 2 3 N ASP Q 861  ? N ASP N 861  O VAL Q  964  ? O VAL N 964  
BW 3 4 O PHE Q 963  ? O PHE N 963  N THR Q  955  ? N THR N 955  
BX 1 2 N THR Q 805  ? N THR N 805  O GLY Q  1042 ? O GLY N 1042 
BY 1 2 N PHE Q 980  ? N PHE N 980  O GLY Q  988  ? O GLY N 988  
BY 2 3 O THR Q 989  ? O THR N 989  N MET Q  839  ? N MET N 839  
BY 3 4 N ILE Q 840  ? N ILE N 840  O ILE Q  1011 ? O ILE N 1011 
BY 4 5 O ILE Q 1012 ? O ILE N 1012 N ALA Q  826  ? N ALA N 826  
BY 5 6 N GLN Q 821  ? N GLN N 821  O TYR Q  1092 ? O TYR N 1092 
BY 6 7 O ILE Q 1085 ? O ILE N 1085 N GLU Q  1070 ? N GLU N 1070 
BZ 1 2 N ILE Q 911  ? N ILE N 911  O THR Q  939  ? O THR N 939  
CA 1 2 N THR Q 916  ? N THR N 916  O ARG Q  935  ? O ARG N 935  
CB 1 2 N VAL Q 1160 ? N VAL N 1160 O ILE Q  1194 ? O ILE N 1194 
CC 1 2 N LEU R 22   ? N LEU O 22   O PHE R  228  ? O PHE O 228  
CC 2 3 O ASN R 231  ? O ASN O 231  N GLU R  177  ? N GLU O 177  
CD 1 2 N THR R 53   ? N THR O 53   O LYS R  154  ? O LYS O 154  
CD 2 3 O CYS R 157  ? O CYS O 157  N LEU R  99   ? N LEU O 99   
CE 1 2 N THR R 53   ? N THR O 53   O LYS R  154  ? O LYS O 154  
CE 2 3 O LYS R 160  ? O LYS O 160  N ALA R  45   ? N ALA O 45   
CE 3 4 N VAL R 51   ? N VAL O 51   O VAL AA 65   ? O VAL X 65   
CF 1 2 N VAL R 113  ? N VAL O 113  O CYS R  145  ? O CYS O 145  
CG 1 2 N GLN S 37   ? N GLN P 37   O GLU S  45   ? O GLU P 45   
CH 1 2 N PHE T 60   ? N PHE Q 60   O VAL T  80   ? O VAL Q 80   
CH 2 3 N GLU T 81   ? N GLU Q 81   O ILE T  109  ? O ILE Q 109  
CH 3 4 N GLY T 108  ? N GLY Q 108  O GLU T  133  ? O GLU Q 133  
CI 1 2 N ILE T 178  ? N ILE Q 178  O ILE T  213  ? O ILE Q 213  
CI 2 3 O SER T 210  ? O SER Q 210  N ILE T  198  ? N ILE Q 198  
CJ 1 2 O GLY V 169  ? O GLY S 169  N ARG V  144  ? N ARG S 144  
CJ 2 3 N ILE V 151  ? N ILE S 151  O HIS V  158  ? O HIS S 158  
CJ 3 4 O GLY V 161  ? O GLY S 161  N PHE V  109  ? N PHE S 109  
CJ 4 5 O VAL V 108  ? O VAL S 108  N VAL V  101  ? N VAL S 101  
CJ 5 6 O GLN V 102  ? O GLN S 102  N THR V  90   ? N THR S 90   
CJ 6 7 N VAL V 87   ? N VAL S 87   O VAL V  145  ? O VAL S 145  
CK 1 2 N TYR V 130  ? N TYR S 130  O ILE V  137  ? O ILE S 137  
CL 1 2 N MET W 97   ? N MET T 97   O LEU W  142  ? O LEU T 142  
CL 2 3 O ARG W 145  ? O ARG T 145  N THR W  56   ? N THR T 56   
CL 3 4 O VAL W 57   ? O VAL T 57   N ASP W  8    ? N ASP T 8    
CL 4 5 N ASP W 16   ? N ASP T 16   O ARG W  25   ? O ARG T 25   
CL 5 6 N ILE W 26   ? N ILE T 26   O LEU W  40   ? O LEU T 40   
CL 6 7 N THR W 39   ? N THR T 39   O ARG W  124  ? O ARG T 124  
CL 7 8 O LEU W 121  ? O LEU T 121  N PHE W  118  ? N PHE T 118  
CL 8 9 O SER W 117  ? O SER T 117  N THR W  100  ? N THR T 100  
CM 1 2 N ARG X 17   ? N ARG U 17   O LEU X  26   ? O LEU U 26   
CM 2 3 N PHE X 27   ? N PHE U 27   O GLU X  36   ? O GLU U 36   
CN 1 2 N PHE X 101  ? N PHE U 101  O PHE X  110  ? O PHE U 110  
CO 1 2 N ASP Z 22   ? N ASP W 22   O VAL Z  32   ? O VAL W 32   
CO 2 3 N PHE Z 35   ? N PHE W 35   O PHE Z  71   ? O PHE W 71   
CO 3 4 O GLN Z 76   ? O GLN W 76   N PHE Z  58   ? N PHE W 58   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 9984' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 9985' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 9986' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 9987' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 9988' 
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN I 9989' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 9990' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 9991' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN M 9992' 
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN M 9993' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN N 9994' 
BC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN O 9995' 
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN U 9996' 
BC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN U 9997' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN V 9998' 
BC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN X 9999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A  107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 CYS A  110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A  148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A  167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4 CYS A  67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4 CYS A  70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4 CYS A  77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4 HIS A  80   ? HIS A 80   . ? 1_555 ? 
9  AC3 4 CYS B  1163 ? CYS B 1163 . ? 1_555 ? 
10 AC3 4 CYS B  1166 ? CYS B 1166 . ? 1_555 ? 
11 AC3 4 CYS B  1182 ? CYS B 1182 . ? 1_555 ? 
12 AC3 4 CYS B  1185 ? CYS B 1185 . ? 1_555 ? 
13 AC4 4 CYS C  86   ? CYS C 86   . ? 1_555 ? 
14 AC4 4 CYS C  88   ? CYS C 88   . ? 1_555 ? 
15 AC4 4 CYS C  92   ? CYS C 92   . ? 1_555 ? 
16 AC4 4 CYS C  95   ? CYS C 95   . ? 1_555 ? 
17 AC5 4 CYS I  7    ? CYS I 7    . ? 1_555 ? 
18 AC5 4 CYS I  10   ? CYS I 10   . ? 1_555 ? 
19 AC5 4 CYS I  29   ? CYS I 29   . ? 1_555 ? 
20 AC5 4 CYS I  32   ? CYS I 32   . ? 1_555 ? 
21 AC6 5 CYS I  75   ? CYS I 75   . ? 1_555 ? 
22 AC6 5 CYS I  78   ? CYS I 78   . ? 1_555 ? 
23 AC6 5 CYS I  103  ? CYS I 103  . ? 1_555 ? 
24 AC6 5 CYS I  106  ? CYS I 106  . ? 1_555 ? 
25 AC6 5 HIS I  108  ? HIS I 108  . ? 1_555 ? 
26 AC7 4 CYS J  7    ? CYS J 7    . ? 1_555 ? 
27 AC7 4 CYS J  10   ? CYS J 10   . ? 1_555 ? 
28 AC7 4 CYS J  45   ? CYS J 45   . ? 1_555 ? 
29 AC7 4 CYS J  46   ? CYS J 46   . ? 1_555 ? 
30 AC8 4 CYS L  31   ? CYS L 31   . ? 1_555 ? 
31 AC8 4 CYS L  34   ? CYS L 34   . ? 1_555 ? 
32 AC8 4 CYS L  48   ? CYS L 48   . ? 1_555 ? 
33 AC8 4 CYS L  51   ? CYS L 51   . ? 1_555 ? 
34 AC9 4 CYS P  107  ? CYS M 107  . ? 1_555 ? 
35 AC9 4 CYS P  110  ? CYS M 110  . ? 1_555 ? 
36 AC9 4 CYS P  148  ? CYS M 148  . ? 1_555 ? 
37 AC9 4 CYS P  167  ? CYS M 167  . ? 1_555 ? 
38 BC1 4 CYS P  67   ? CYS M 67   . ? 1_555 ? 
39 BC1 4 CYS P  70   ? CYS M 70   . ? 1_555 ? 
40 BC1 4 CYS P  77   ? CYS M 77   . ? 1_555 ? 
41 BC1 4 HIS P  80   ? HIS M 80   . ? 1_555 ? 
42 BC2 4 CYS Q  1163 ? CYS N 1163 . ? 1_555 ? 
43 BC2 4 CYS Q  1166 ? CYS N 1166 . ? 1_555 ? 
44 BC2 4 CYS Q  1182 ? CYS N 1182 . ? 1_555 ? 
45 BC2 4 CYS Q  1185 ? CYS N 1185 . ? 1_555 ? 
46 BC3 4 CYS R  86   ? CYS O 86   . ? 1_555 ? 
47 BC3 4 CYS R  88   ? CYS O 88   . ? 1_555 ? 
48 BC3 4 CYS R  92   ? CYS O 92   . ? 1_555 ? 
49 BC3 4 CYS R  95   ? CYS O 95   . ? 1_555 ? 
50 BC4 4 CYS X  7    ? CYS U 7    . ? 1_555 ? 
51 BC4 4 CYS X  10   ? CYS U 10   . ? 1_555 ? 
52 BC4 4 CYS X  29   ? CYS U 29   . ? 1_555 ? 
53 BC4 4 CYS X  32   ? CYS U 32   . ? 1_555 ? 
54 BC5 5 CYS X  75   ? CYS U 75   . ? 1_555 ? 
55 BC5 5 CYS X  78   ? CYS U 78   . ? 1_555 ? 
56 BC5 5 CYS X  103  ? CYS U 103  . ? 1_555 ? 
57 BC5 5 CYS X  106  ? CYS U 106  . ? 1_555 ? 
58 BC5 5 HIS X  108  ? HIS U 108  . ? 1_555 ? 
59 BC6 4 CYS Y  7    ? CYS V 7    . ? 1_555 ? 
60 BC6 4 CYS Y  10   ? CYS V 10   . ? 1_555 ? 
61 BC6 4 CYS Y  45   ? CYS V 45   . ? 1_555 ? 
62 BC6 4 CYS Y  46   ? CYS V 46   . ? 1_555 ? 
63 BC7 4 CYS AA 31   ? CYS X 31   . ? 1_555 ? 
64 BC7 4 CYS AA 34   ? CYS X 34   . ? 1_555 ? 
65 BC7 4 CYS AA 48   ? CYS X 48   . ? 1_555 ? 
66 BC7 4 CYS AA 51   ? CYS X 51   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3HOU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3HOU 
_atom_sites.fract_transf_matrix[1][1]   0.002536 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000040 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004512 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003528 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . VAL A  1  2    ? 26.329  -114.291 115.687 1.00 92.20  ? 2    VAL A N     1 
ATOM   2     C  CA    . VAL A  1  2    ? 25.644  -112.974 115.909 1.00 92.36  ? 2    VAL A CA    1 
ATOM   3     C  C     . VAL A  1  2    ? 25.966  -111.982 114.770 1.00 91.47  ? 2    VAL A C     1 
ATOM   4     O  O     . VAL A  1  2    ? 26.865  -112.228 113.947 1.00 93.62  ? 2    VAL A O     1 
ATOM   5     C  CB    . VAL A  1  2    ? 26.014  -112.359 117.303 1.00 93.09  ? 2    VAL A CB    1 
ATOM   6     C  CG1   . VAL A  1  2    ? 27.333  -111.630 117.240 1.00 93.58  ? 2    VAL A CG1   1 
ATOM   7     C  CG2   . VAL A  1  2    ? 24.892  -111.420 117.776 1.00 93.03  ? 2    VAL A CG2   1 
ATOM   8     N  N     . GLY A  1  3    ? 25.254  -110.855 114.735 1.00 87.83  ? 3    GLY A N     1 
ATOM   9     C  CA    . GLY A  1  3    ? 25.424  -109.912 113.642 1.00 81.12  ? 3    GLY A CA    1 
ATOM   10    C  C     . GLY A  1  3    ? 24.290  -110.385 112.745 1.00 77.35  ? 3    GLY A C     1 
ATOM   11    O  O     . GLY A  1  3    ? 24.270  -110.103 111.546 1.00 76.43  ? 3    GLY A O     1 
ATOM   12    N  N     . GLN A  1  4    ? 23.379  -111.134 113.399 1.00 72.93  ? 4    GLN A N     1 
ATOM   13    C  CA    . GLN A  1  4    ? 22.140  -111.798 112.926 1.00 67.99  ? 4    GLN A CA    1 
ATOM   14    C  C     . GLN A  1  4    ? 21.708  -111.922 111.462 1.00 66.17  ? 4    GLN A C     1 
ATOM   15    O  O     . GLN A  1  4    ? 22.347  -111.411 110.546 1.00 66.94  ? 4    GLN A O     1 
ATOM   16    C  CB    . GLN A  1  4    ? 20.957  -111.231 113.691 1.00 67.18  ? 4    GLN A CB    1 
ATOM   17    C  CG    . GLN A  1  4    ? 21.180  -111.110 115.155 1.00 67.82  ? 4    GLN A CG    1 
ATOM   18    C  CD    . GLN A  1  4    ? 20.191  -110.155 115.776 1.00 69.65  ? 4    GLN A CD    1 
ATOM   19    O  OE1   . GLN A  1  4    ? 18.992  -110.437 115.838 1.00 70.18  ? 4    GLN A OE1   1 
ATOM   20    N  NE2   . GLN A  1  4    ? 20.684  -109.006 116.231 1.00 70.65  ? 4    GLN A NE2   1 
ATOM   21    N  N     . GLN A  1  5    ? 20.580  -112.605 111.272 1.00 62.85  ? 5    GLN A N     1 
ATOM   22    C  CA    . GLN A  1  5    ? 19.981  -112.862 109.958 1.00 59.14  ? 5    GLN A CA    1 
ATOM   23    C  C     . GLN A  1  5    ? 20.799  -113.866 109.146 1.00 54.83  ? 5    GLN A C     1 
ATOM   24    O  O     . GLN A  1  5    ? 22.023  -113.860 109.174 1.00 54.15  ? 5    GLN A O     1 
ATOM   25    C  CB    . GLN A  1  5    ? 19.808  -111.568 109.160 1.00 61.39  ? 5    GLN A CB    1 
ATOM   26    C  CG    . GLN A  1  5    ? 18.810  -111.714 108.013 1.00 64.95  ? 5    GLN A CG    1 
ATOM   27    C  CD    . GLN A  1  5    ? 18.662  -110.449 107.169 1.00 67.21  ? 5    GLN A CD    1 
ATOM   28    O  OE1   . GLN A  1  5    ? 19.124  -109.371 107.555 1.00 68.99  ? 5    GLN A OE1   1 
ATOM   29    N  NE2   . GLN A  1  5    ? 18.001  -110.576 106.013 1.00 67.71  ? 5    GLN A NE2   1 
ATOM   30    N  N     . TYR A  1  6    ? 20.114  -114.729 108.412 1.00 50.46  ? 6    TYR A N     1 
ATOM   31    C  CA    . TYR A  1  6    ? 20.791  -115.749 107.631 1.00 47.01  ? 6    TYR A CA    1 
ATOM   32    C  C     . TYR A  1  6    ? 21.524  -115.259 106.424 1.00 43.70  ? 6    TYR A C     1 
ATOM   33    O  O     . TYR A  1  6    ? 21.075  -114.339 105.760 1.00 44.52  ? 6    TYR A O     1 
ATOM   34    C  CB    . TYR A  1  6    ? 19.803  -116.787 107.138 1.00 48.86  ? 6    TYR A CB    1 
ATOM   35    C  CG    . TYR A  1  6    ? 20.429  -117.826 106.234 1.00 50.04  ? 6    TYR A CG    1 
ATOM   36    C  CD1   . TYR A  1  6    ? 21.563  -118.524 106.637 1.00 52.32  ? 6    TYR A CD1   1 
ATOM   37    C  CD2   . TYR A  1  6    ? 19.854  -118.161 105.012 1.00 50.09  ? 6    TYR A CD2   1 
ATOM   38    C  CE1   . TYR A  1  6    ? 22.106  -119.535 105.854 1.00 53.02  ? 6    TYR A CE1   1 
ATOM   39    C  CE2   . TYR A  1  6    ? 20.389  -119.176 104.220 1.00 51.46  ? 6    TYR A CE2   1 
ATOM   40    C  CZ    . TYR A  1  6    ? 21.515  -119.857 104.654 1.00 52.28  ? 6    TYR A CZ    1 
ATOM   41    O  OH    . TYR A  1  6    ? 22.052  -120.884 103.919 1.00 53.41  ? 6    TYR A OH    1 
ATOM   42    N  N     . SER A  1  7    ? 22.647  -115.900 106.132 1.00 39.64  ? 7    SER A N     1 
ATOM   43    C  CA    . SER A  1  7    ? 23.423  -115.571 104.955 1.00 36.84  ? 7    SER A CA    1 
ATOM   44    C  C     . SER A  1  7    ? 23.806  -116.868 104.295 1.00 36.17  ? 7    SER A C     1 
ATOM   45    O  O     . SER A  1  7    ? 24.304  -117.788 104.939 1.00 34.91  ? 7    SER A O     1 
ATOM   46    C  CB    . SER A  1  7    ? 24.687  -114.794 105.292 1.00 36.57  ? 7    SER A CB    1 
ATOM   47    O  OG    . SER A  1  7    ? 25.388  -114.487 104.096 1.00 33.16  ? 7    SER A OG    1 
ATOM   48    N  N     . SER A  1  8    ? 23.568  -116.935 102.997 1.00 35.62  ? 8    SER A N     1 
ATOM   49    C  CA    . SER A  1  8    ? 23.866  -118.132 102.243 1.00 35.40  ? 8    SER A CA    1 
ATOM   50    C  C     . SER A  1  8    ? 25.350  -118.296 101.990 1.00 34.84  ? 8    SER A C     1 
ATOM   51    O  O     . SER A  1  8    ? 25.788  -119.334 101.509 1.00 35.61  ? 8    SER A O     1 
ATOM   52    C  CB    . SER A  1  8    ? 23.147  -118.089 100.905 1.00 37.64  ? 8    SER A CB    1 
ATOM   53    O  OG    . SER A  1  8    ? 23.718  -117.095 100.072 1.00 42.57  ? 8    SER A OG    1 
ATOM   54    N  N     . ALA A  1  9    ? 26.135  -117.280 102.305 1.00 33.11  ? 9    ALA A N     1 
ATOM   55    C  CA    . ALA A  1  9    ? 27.564  -117.381 102.058 1.00 32.04  ? 9    ALA A CA    1 
ATOM   56    C  C     . ALA A  1  9    ? 28.271  -118.421 102.914 1.00 30.71  ? 9    ALA A C     1 
ATOM   57    O  O     . ALA A  1  9    ? 28.127  -118.455 104.135 1.00 31.21  ? 9    ALA A O     1 
ATOM   58    C  CB    . ALA A  1  9    ? 28.226  -116.027 102.252 1.00 33.27  ? 9    ALA A CB    1 
ATOM   59    N  N     . PRO A  1  10   ? 29.049  -119.293 102.277 1.00 28.67  ? 10   PRO A N     1 
ATOM   60    C  CA    . PRO A  1  10   ? 29.773  -120.318 103.025 1.00 28.51  ? 10   PRO A CA    1 
ATOM   61    C  C     . PRO A  1  10   ? 30.565  -119.656 104.150 1.00 26.85  ? 10   PRO A C     1 
ATOM   62    O  O     . PRO A  1  10   ? 31.146  -118.595 103.952 1.00 27.59  ? 10   PRO A O     1 
ATOM   63    C  CB    . PRO A  1  10   ? 30.666  -120.946 101.957 1.00 28.67  ? 10   PRO A CB    1 
ATOM   64    C  CG    . PRO A  1  10   ? 30.819  -119.848 100.951 1.00 28.31  ? 10   PRO A CG    1 
ATOM   65    C  CD    . PRO A  1  10   ? 29.433  -119.312 100.863 1.00 28.16  ? 10   PRO A CD    1 
ATOM   66    N  N     . LEU A  1  11   ? 30.586  -120.277 105.324 1.00 25.13  ? 11   LEU A N     1 
ATOM   67    C  CA    . LEU A  1  11   ? 31.296  -119.711 106.473 1.00 24.78  ? 11   LEU A CA    1 
ATOM   68    C  C     . LEU A  1  11   ? 32.611  -120.399 106.832 1.00 25.50  ? 11   LEU A C     1 
ATOM   69    O  O     . LEU A  1  11   ? 32.629  -121.576 107.184 1.00 25.14  ? 11   LEU A O     1 
ATOM   70    C  CB    . LEU A  1  11   ? 30.368  -119.726 107.687 1.00 22.81  ? 11   LEU A CB    1 
ATOM   71    C  CG    . LEU A  1  11   ? 30.873  -119.482 109.109 1.00 19.77  ? 11   LEU A CG    1 
ATOM   72    C  CD1   . LEU A  1  11   ? 29.884  -118.605 109.815 1.00 21.19  ? 11   LEU A CD1   1 
ATOM   73    C  CD2   . LEU A  1  11   ? 31.023  -120.769 109.867 1.00 16.96  ? 11   LEU A CD2   1 
ATOM   74    N  N     . ARG A  1  12   ? 33.717  -119.670 106.751 1.00 27.28  ? 12   ARG A N     1 
ATOM   75    C  CA    . ARG A  1  12   ? 35.004  -120.267 107.100 1.00 30.87  ? 12   ARG A CA    1 
ATOM   76    C  C     . ARG A  1  12   ? 35.769  -119.428 108.101 1.00 30.29  ? 12   ARG A C     1 
ATOM   77    O  O     . ARG A  1  12   ? 35.353  -118.326 108.459 1.00 31.71  ? 12   ARG A O     1 
ATOM   78    C  CB    . ARG A  1  12   ? 35.881  -120.458 105.870 1.00 33.98  ? 12   ARG A CB    1 
ATOM   79    C  CG    . ARG A  1  12   ? 35.260  -121.281 104.800 1.00 39.30  ? 12   ARG A CG    1 
ATOM   80    C  CD    . ARG A  1  12   ? 36.233  -121.436 103.685 1.00 44.72  ? 12   ARG A CD    1 
ATOM   81    N  NE    . ARG A  1  12   ? 35.565  -121.814 102.449 1.00 50.63  ? 12   ARG A NE    1 
ATOM   82    C  CZ    . ARG A  1  12   ? 36.185  -121.931 101.279 1.00 52.60  ? 12   ARG A CZ    1 
ATOM   83    N  NH1   . ARG A  1  12   ? 37.492  -121.696 101.199 1.00 53.60  ? 12   ARG A NH1   1 
ATOM   84    N  NH2   . ARG A  1  12   ? 35.504  -122.281 100.190 1.00 53.51  ? 12   ARG A NH2   1 
ATOM   85    N  N     . THR A  1  13   ? 36.899  -119.954 108.548 1.00 28.98  ? 13   THR A N     1 
ATOM   86    C  CA    . THR A  1  13   ? 37.720  -119.247 109.510 1.00 29.01  ? 13   THR A CA    1 
ATOM   87    C  C     . THR A  1  13   ? 38.899  -118.619 108.795 1.00 27.69  ? 13   THR A C     1 
ATOM   88    O  O     . THR A  1  13   ? 39.206  -119.012 107.675 1.00 28.44  ? 13   THR A O     1 
ATOM   89    C  CB    . THR A  1  13   ? 38.219  -120.200 110.623 1.00 29.17  ? 13   THR A CB    1 
ATOM   90    O  OG1   . THR A  1  13   ? 38.700  -121.424 110.052 1.00 29.69  ? 13   THR A OG1   1 
ATOM   91    C  CG2   . THR A  1  13   ? 37.088  -120.510 111.584 1.00 31.12  ? 13   THR A CG2   1 
ATOM   92    N  N     . VAL A  1  14   ? 39.539  -117.634 109.425 1.00 25.62  ? 14   VAL A N     1 
ATOM   93    C  CA    . VAL A  1  14   ? 40.688  -116.978 108.823 1.00 24.13  ? 14   VAL A CA    1 
ATOM   94    C  C     . VAL A  1  14   ? 41.869  -117.897 109.036 1.00 25.60  ? 14   VAL A C     1 
ATOM   95    O  O     . VAL A  1  14   ? 42.138  -118.296 110.161 1.00 25.07  ? 14   VAL A O     1 
ATOM   96    C  CB    . VAL A  1  14   ? 41.004  -115.620 109.475 1.00 22.00  ? 14   VAL A CB    1 
ATOM   97    C  CG1   . VAL A  1  14   ? 42.418  -115.241 109.149 1.00 22.07  ? 14   VAL A CG1   1 
ATOM   98    C  CG2   . VAL A  1  14   ? 40.070  -114.535 108.966 1.00 19.08  ? 14   VAL A CG2   1 
ATOM   99    N  N     . LYS A  1  15   ? 42.563  -118.231 107.950 1.00 28.12  ? 15   LYS A N     1 
ATOM   100   C  CA    . LYS A  1  15   ? 43.718  -119.126 107.997 1.00 29.75  ? 15   LYS A CA    1 
ATOM   101   C  C     . LYS A  1  15   ? 45.004  -118.340 107.924 1.00 30.78  ? 15   LYS A C     1 
ATOM   102   O  O     . LYS A  1  15   ? 45.985  -118.685 108.575 1.00 32.92  ? 15   LYS A O     1 
ATOM   103   C  CB    . LYS A  1  15   ? 43.672  -120.121 106.843 1.00 30.93  ? 15   LYS A CB    1 
ATOM   104   C  CG    . LYS A  1  15   ? 42.482  -121.057 106.890 1.00 32.98  ? 15   LYS A CG    1 
ATOM   105   C  CD    . LYS A  1  15   ? 42.667  -122.045 107.991 1.00 37.40  ? 15   LYS A CD    1 
ATOM   106   C  CE    . LYS A  1  15   ? 41.433  -122.883 108.198 1.00 40.55  ? 15   LYS A CE    1 
ATOM   107   N  NZ    . LYS A  1  15   ? 41.643  -123.786 109.390 1.00 44.33  ? 15   LYS A NZ    1 
ATOM   108   N  N     . GLU A  1  16   ? 45.012  -117.289 107.116 1.00 31.50  ? 16   GLU A N     1 
ATOM   109   C  CA    . GLU A  1  16   ? 46.202  -116.458 107.013 1.00 32.06  ? 16   GLU A CA    1 
ATOM   110   C  C     . GLU A  1  16   ? 45.779  -115.014 106.910 1.00 31.64  ? 16   GLU A C     1 
ATOM   111   O  O     . GLU A  1  16   ? 44.642  -114.713 106.544 1.00 32.21  ? 16   GLU A O     1 
ATOM   112   C  CB    . GLU A  1  16   ? 47.012  -116.766 105.761 1.00 32.29  ? 16   GLU A CB    1 
ATOM   113   C  CG    . GLU A  1  16   ? 47.121  -118.187 105.372 1.00 33.75  ? 16   GLU A CG    1 
ATOM   114   C  CD    . GLU A  1  16   ? 47.857  -118.321 104.066 1.00 36.26  ? 16   GLU A CD    1 
ATOM   115   O  OE1   . GLU A  1  16   ? 47.423  -117.693 103.060 1.00 36.01  ? 16   GLU A OE1   1 
ATOM   116   O  OE2   . GLU A  1  16   ? 48.871  -119.054 104.055 1.00 38.00  ? 16   GLU A OE2   1 
ATOM   117   N  N     . VAL A  1  17   ? 46.716  -114.128 107.210 1.00 30.47  ? 17   VAL A N     1 
ATOM   118   C  CA    . VAL A  1  17   ? 46.478  -112.703 107.114 1.00 29.29  ? 17   VAL A CA    1 
ATOM   119   C  C     . VAL A  1  17   ? 47.587  -112.162 106.193 1.00 28.65  ? 17   VAL A C     1 
ATOM   120   O  O     . VAL A  1  17   ? 48.774  -112.250 106.512 1.00 27.73  ? 17   VAL A O     1 
ATOM   121   C  CB    . VAL A  1  17   ? 46.521  -112.064 108.531 1.00 28.84  ? 17   VAL A CB    1 
ATOM   122   C  CG1   . VAL A  1  17   ? 46.286  -110.583 108.457 1.00 28.15  ? 17   VAL A CG1   1 
ATOM   123   C  CG2   . VAL A  1  17   ? 45.472  -112.714 109.414 1.00 25.79  ? 17   VAL A CG2   1 
ATOM   124   N  N     . GLN A  1  18   ? 47.198  -111.652 105.028 1.00 27.86  ? 18   GLN A N     1 
ATOM   125   C  CA    . GLN A  1  18   ? 48.167  -111.108 104.075 1.00 29.53  ? 18   GLN A CA    1 
ATOM   126   C  C     . GLN A  1  18   ? 48.225  -109.599 104.265 1.00 31.82  ? 18   GLN A C     1 
ATOM   127   O  O     . GLN A  1  18   ? 47.257  -108.901 103.961 1.00 31.87  ? 18   GLN A O     1 
ATOM   128   C  CB    . GLN A  1  18   ? 47.735  -111.373 102.628 1.00 28.96  ? 18   GLN A CB    1 
ATOM   129   C  CG    . GLN A  1  18   ? 48.758  -112.074 101.702 1.00 27.88  ? 18   GLN A CG    1 
ATOM   130   C  CD    . GLN A  1  18   ? 50.166  -111.524 101.793 1.00 27.98  ? 18   GLN A CD    1 
ATOM   131   O  OE1   . GLN A  1  18   ? 50.373  -110.345 102.065 1.00 26.64  ? 18   GLN A OE1   1 
ATOM   132   N  NE2   . GLN A  1  18   ? 51.146  -112.384 101.545 1.00 27.60  ? 18   GLN A NE2   1 
ATOM   133   N  N     . PHE A  1  19   ? 49.343  -109.086 104.767 1.00 32.62  ? 19   PHE A N     1 
ATOM   134   C  CA    . PHE A  1  19   ? 49.462  -107.648 104.942 1.00 32.58  ? 19   PHE A CA    1 
ATOM   135   C  C     . PHE A  1  19   ? 50.023  -107.010 103.666 1.00 34.56  ? 19   PHE A C     1 
ATOM   136   O  O     . PHE A  1  19   ? 50.708  -107.665 102.883 1.00 35.03  ? 19   PHE A O     1 
ATOM   137   C  CB    . PHE A  1  19   ? 50.352  -107.330 106.137 1.00 29.66  ? 19   PHE A CB    1 
ATOM   138   C  CG    . PHE A  1  19   ? 49.705  -107.602 107.451 1.00 27.78  ? 19   PHE A CG    1 
ATOM   139   C  CD1   . PHE A  1  19   ? 49.919  -108.794 108.113 1.00 28.00  ? 19   PHE A CD1   1 
ATOM   140   C  CD2   . PHE A  1  19   ? 48.878  -106.661 108.034 1.00 28.25  ? 19   PHE A CD2   1 
ATOM   141   C  CE1   . PHE A  1  19   ? 49.318  -109.051 109.345 1.00 27.07  ? 19   PHE A CE1   1 
ATOM   142   C  CE2   . PHE A  1  19   ? 48.275  -106.908 109.261 1.00 27.83  ? 19   PHE A CE2   1 
ATOM   143   C  CZ    . PHE A  1  19   ? 48.501  -108.110 109.916 1.00 27.24  ? 19   PHE A CZ    1 
ATOM   144   N  N     . GLY A  1  20   ? 49.717  -105.737 103.452 1.00 35.99  ? 20   GLY A N     1 
ATOM   145   C  CA    . GLY A  1  20   ? 50.199  -105.052 102.270 1.00 37.89  ? 20   GLY A CA    1 
ATOM   146   C  C     . GLY A  1  20   ? 49.831  -103.583 102.300 1.00 39.70  ? 20   GLY A C     1 
ATOM   147   O  O     . GLY A  1  20   ? 49.382  -103.074 103.329 1.00 41.01  ? 20   GLY A O     1 
ATOM   148   N  N     . LEU A  1  21   ? 50.013  -102.898 101.175 1.00 39.79  ? 21   LEU A N     1 
ATOM   149   C  CA    . LEU A  1  21   ? 49.691  -101.479 101.086 1.00 39.77  ? 21   LEU A CA    1 
ATOM   150   C  C     . LEU A  1  21   ? 48.644  -101.238 100.002 1.00 40.39  ? 21   LEU A C     1 
ATOM   151   O  O     . LEU A  1  21   ? 48.541  -101.995 99.045  1.00 41.35  ? 21   LEU A O     1 
ATOM   152   C  CB    . LEU A  1  21   ? 50.959  -100.683 100.793 1.00 39.10  ? 21   LEU A CB    1 
ATOM   153   C  CG    . LEU A  1  21   ? 52.086  -100.992 101.778 1.00 39.06  ? 21   LEU A CG    1 
ATOM   154   C  CD1   . LEU A  1  21   ? 53.265  -100.106 101.488 1.00 39.15  ? 21   LEU A CD1   1 
ATOM   155   C  CD2   . LEU A  1  21   ? 51.607  -100.776 103.201 1.00 38.45  ? 21   LEU A CD2   1 
ATOM   156   N  N     . PHE A  1  22   ? 47.856  -100.185 100.159 1.00 40.35  ? 22   PHE A N     1 
ATOM   157   C  CA    . PHE A  1  22   ? 46.821  -99.878  99.189  1.00 40.66  ? 22   PHE A CA    1 
ATOM   158   C  C     . PHE A  1  22   ? 47.344  -99.155  97.966  1.00 41.47  ? 22   PHE A C     1 
ATOM   159   O  O     . PHE A  1  22   ? 48.051  -98.161  98.077  1.00 41.65  ? 22   PHE A O     1 
ATOM   160   C  CB    . PHE A  1  22   ? 45.745  -99.014  99.831  1.00 40.36  ? 22   PHE A CB    1 
ATOM   161   C  CG    . PHE A  1  22   ? 44.556  -99.777  100.304 1.00 40.88  ? 22   PHE A CG    1 
ATOM   162   C  CD1   . PHE A  1  22   ? 44.149  -99.699  101.633 1.00 42.19  ? 22   PHE A CD1   1 
ATOM   163   C  CD2   . PHE A  1  22   ? 43.815  -100.548 99.417  1.00 40.65  ? 22   PHE A CD2   1 
ATOM   164   C  CE1   . PHE A  1  22   ? 43.010  -100.381 102.077 1.00 42.40  ? 22   PHE A CE1   1 
ATOM   165   C  CE2   . PHE A  1  22   ? 42.684  -101.231 99.839  1.00 40.50  ? 22   PHE A CE2   1 
ATOM   166   C  CZ    . PHE A  1  22   ? 42.276  -101.149 101.175 1.00 42.77  ? 22   PHE A CZ    1 
ATOM   167   N  N     . SER A  1  23   ? 47.005  -99.662  96.791  1.00 42.85  ? 23   SER A N     1 
ATOM   168   C  CA    . SER A  1  23   ? 47.409  -99.002  95.558  1.00 44.09  ? 23   SER A CA    1 
ATOM   169   C  C     . SER A  1  23   ? 46.318  -97.967  95.367  1.00 43.40  ? 23   SER A C     1 
ATOM   170   O  O     . SER A  1  23   ? 45.143  -98.240  95.635  1.00 43.18  ? 23   SER A O     1 
ATOM   171   C  CB    . SER A  1  23   ? 47.352  -99.958  94.385  1.00 46.22  ? 23   SER A CB    1 
ATOM   172   O  OG    . SER A  1  23   ? 45.998  -100.212 94.049  1.00 49.94  ? 23   SER A OG    1 
ATOM   173   N  N     . PRO A  1  24   ? 46.675  -96.774  94.883  1.00 42.71  ? 24   PRO A N     1 
ATOM   174   C  CA    . PRO A  1  24   ? 45.604  -95.795  94.717  1.00 43.32  ? 24   PRO A CA    1 
ATOM   175   C  C     . PRO A  1  24   ? 44.485  -96.362  93.856  1.00 44.47  ? 24   PRO A C     1 
ATOM   176   O  O     . PRO A  1  24   ? 43.316  -96.002  94.012  1.00 44.80  ? 24   PRO A O     1 
ATOM   177   C  CB    . PRO A  1  24   ? 46.320  -94.601  94.093  1.00 42.65  ? 24   PRO A CB    1 
ATOM   178   C  CG    . PRO A  1  24   ? 47.421  -95.235  93.327  1.00 42.66  ? 24   PRO A CG    1 
ATOM   179   C  CD    . PRO A  1  24   ? 47.915  -96.330  94.232  1.00 42.15  ? 24   PRO A CD    1 
ATOM   180   N  N     . GLU A  1  25   ? 44.841  -97.284  92.970  1.00 44.70  ? 25   GLU A N     1 
ATOM   181   C  CA    . GLU A  1  25   ? 43.849  -97.884  92.095  1.00 45.08  ? 25   GLU A CA    1 
ATOM   182   C  C     . GLU A  1  25   ? 42.804  -98.642  92.889  1.00 44.39  ? 25   GLU A C     1 
ATOM   183   O  O     . GLU A  1  25   ? 41.603  -98.416  92.730  1.00 44.19  ? 25   GLU A O     1 
ATOM   184   C  CB    . GLU A  1  25   ? 44.510  -98.836  91.101  1.00 46.78  ? 25   GLU A CB    1 
ATOM   185   C  CG    . GLU A  1  25   ? 45.386  -98.157  90.069  1.00 50.27  ? 25   GLU A CG    1 
ATOM   186   C  CD    . GLU A  1  25   ? 46.676  -97.621  90.649  1.00 52.00  ? 25   GLU A CD    1 
ATOM   187   O  OE1   . GLU A  1  25   ? 47.522  -98.425  91.098  1.00 53.14  ? 25   GLU A OE1   1 
ATOM   188   O  OE2   . GLU A  1  25   ? 46.842  -96.387  90.651  1.00 54.23  ? 25   GLU A OE2   1 
ATOM   189   N  N     . GLU A  1  26   ? 43.266  -99.542  93.749  1.00 43.69  ? 26   GLU A N     1 
ATOM   190   C  CA    . GLU A  1  26   ? 42.354  -100.347 94.547  1.00 42.30  ? 26   GLU A CA    1 
ATOM   191   C  C     . GLU A  1  26   ? 41.469  -99.440  95.394  1.00 41.31  ? 26   GLU A C     1 
ATOM   192   O  O     . GLU A  1  26   ? 40.241  -99.580  95.394  1.00 40.68  ? 26   GLU A O     1 
ATOM   193   C  CB    . GLU A  1  26   ? 43.142  -101.342 95.420  1.00 42.33  ? 26   GLU A CB    1 
ATOM   194   C  CG    . GLU A  1  26   ? 42.263  -102.288 96.235  1.00 42.84  ? 26   GLU A CG    1 
ATOM   195   C  CD    . GLU A  1  26   ? 43.001  -103.507 96.787  1.00 43.31  ? 26   GLU A CD    1 
ATOM   196   O  OE1   . GLU A  1  26   ? 44.250  -103.500 96.856  1.00 43.24  ? 26   GLU A OE1   1 
ATOM   197   O  OE2   . GLU A  1  26   ? 42.312  -104.475 97.168  1.00 43.03  ? 26   GLU A OE2   1 
ATOM   198   N  N     . VAL A  1  27   ? 42.089  -98.492  96.092  1.00 39.84  ? 27   VAL A N     1 
ATOM   199   C  CA    . VAL A  1  27   ? 41.335  -97.580  96.932  1.00 38.31  ? 27   VAL A CA    1 
ATOM   200   C  C     . VAL A  1  27   ? 40.165  -97.036  96.134  1.00 39.47  ? 27   VAL A C     1 
ATOM   201   O  O     . VAL A  1  27   ? 39.034  -96.989  96.605  1.00 38.17  ? 27   VAL A O     1 
ATOM   202   C  CB    . VAL A  1  27   ? 42.216  -96.430  97.415  1.00 35.85  ? 27   VAL A CB    1 
ATOM   203   C  CG1   . VAL A  1  27   ? 41.434  -95.521  98.336  1.00 33.10  ? 27   VAL A CG1   1 
ATOM   204   C  CG2   . VAL A  1  27   ? 43.430  -96.993  98.122  1.00 34.44  ? 27   VAL A CG2   1 
ATOM   205   N  N     . ARG A  1  28   ? 40.439  -96.652  94.899  1.00 42.34  ? 28   ARG A N     1 
ATOM   206   C  CA    . ARG A  1  28   ? 39.399  -96.116  94.037  1.00 45.40  ? 28   ARG A CA    1 
ATOM   207   C  C     . ARG A  1  28   ? 38.396  -97.227  93.715  1.00 45.04  ? 28   ARG A C     1 
ATOM   208   O  O     . ARG A  1  28   ? 37.184  -96.999  93.686  1.00 45.56  ? 28   ARG A O     1 
ATOM   209   C  CB    . ARG A  1  28   ? 40.036  -95.567  92.753  1.00 49.02  ? 28   ARG A CB    1 
ATOM   210   C  CG    . ARG A  1  28   ? 39.410  -94.294  92.183  1.00 54.14  ? 28   ARG A CG    1 
ATOM   211   C  CD    . ARG A  1  28   ? 40.418  -93.526  91.311  1.00 59.19  ? 28   ARG A CD    1 
ATOM   212   N  NE    . ARG A  1  28   ? 41.600  -93.091  92.067  1.00 63.00  ? 28   ARG A NE    1 
ATOM   213   C  CZ    . ARG A  1  28   ? 42.643  -92.445  91.540  1.00 65.56  ? 28   ARG A CZ    1 
ATOM   214   N  NH1   . ARG A  1  28   ? 42.655  -92.154  90.242  1.00 67.31  ? 28   ARG A NH1   1 
ATOM   215   N  NH2   . ARG A  1  28   ? 43.674  -92.082  92.307  1.00 65.65  ? 28   ARG A NH2   1 
ATOM   216   N  N     . ALA A  1  29   ? 38.908  -98.434  93.492  1.00 44.31  ? 29   ALA A N     1 
ATOM   217   C  CA    . ALA A  1  29   ? 38.070  -99.587  93.157  1.00 43.46  ? 29   ALA A CA    1 
ATOM   218   C  C     . ALA A  1  29   ? 37.019  -99.903  94.222  1.00 42.77  ? 29   ALA A C     1 
ATOM   219   O  O     . ALA A  1  29   ? 35.820  -99.998  93.922  1.00 42.33  ? 29   ALA A O     1 
ATOM   220   C  CB    . ALA A  1  29   ? 38.942  -100.790 92.931  1.00 43.86  ? 29   ALA A CB    1 
ATOM   221   N  N     . ILE A  1  30   ? 37.496  -100.068 95.455  1.00 40.84  ? 30   ILE A N     1 
ATOM   222   C  CA    . ILE A  1  30   ? 36.676  -100.363 96.625  1.00 38.56  ? 30   ILE A CA    1 
ATOM   223   C  C     . ILE A  1  30   ? 35.608  -99.310  96.905  1.00 38.54  ? 30   ILE A C     1 
ATOM   224   O  O     . ILE A  1  30   ? 34.451  -99.638  97.179  1.00 38.64  ? 30   ILE A O     1 
ATOM   225   C  CB    . ILE A  1  30   ? 37.528  -100.393 97.874  1.00 37.14  ? 30   ILE A CB    1 
ATOM   226   C  CG1   . ILE A  1  30   ? 38.571  -101.476 97.788  1.00 36.67  ? 30   ILE A CG1   1 
ATOM   227   C  CG2   . ILE A  1  30   ? 36.674  -100.630 99.071  1.00 39.45  ? 30   ILE A CG2   1 
ATOM   228   C  CD1   . ILE A  1  30   ? 39.494  -101.427 98.963  1.00 36.78  ? 30   ILE A CD1   1 
ATOM   229   N  N     . SER A  1  31   ? 36.028  -98.046  96.864  1.00 37.71  ? 31   SER A N     1 
ATOM   230   C  CA    . SER A  1  31   ? 35.172  -96.885  97.148  1.00 37.85  ? 31   SER A CA    1 
ATOM   231   C  C     . SER A  1  31   ? 33.757  -96.875  96.597  1.00 37.41  ? 31   SER A C     1 
ATOM   232   O  O     . SER A  1  31   ? 33.532  -97.046  95.398  1.00 39.68  ? 31   SER A O     1 
ATOM   233   C  CB    . SER A  1  31   ? 35.863  -95.589  96.707  1.00 37.49  ? 31   SER A CB    1 
ATOM   234   O  OG    . SER A  1  31   ? 35.063  -94.460  97.041  1.00 35.45  ? 31   SER A OG    1 
ATOM   235   N  N     . VAL A  1  32   ? 32.805  -96.630  97.485  1.00 36.47  ? 32   VAL A N     1 
ATOM   236   C  CA    . VAL A  1  32   ? 31.410  -96.595  97.099  1.00 36.43  ? 32   VAL A CA    1 
ATOM   237   C  C     . VAL A  1  32   ? 30.980  -95.158  96.953  1.00 35.71  ? 32   VAL A C     1 
ATOM   238   O  O     . VAL A  1  32   ? 29.856  -94.893  96.530  1.00 34.95  ? 32   VAL A O     1 
ATOM   239   C  CB    . VAL A  1  32   ? 30.485  -97.290  98.169  1.00 38.20  ? 32   VAL A CB    1 
ATOM   240   C  CG1   . VAL A  1  32   ? 31.104  -98.620  98.606  1.00 40.34  ? 32   VAL A CG1   1 
ATOM   241   C  CG2   . VAL A  1  32   ? 30.249  -96.381  99.384  1.00 37.01  ? 32   VAL A CG2   1 
ATOM   242   N  N     . ALA A  1  33   ? 31.881  -94.236  97.295  1.00 35.15  ? 33   ALA A N     1 
ATOM   243   C  CA    . ALA A  1  33   ? 31.564  -92.814  97.248  1.00 35.57  ? 33   ALA A CA    1 
ATOM   244   C  C     . ALA A  1  33   ? 32.735  -91.901  96.971  1.00 35.55  ? 33   ALA A C     1 
ATOM   245   O  O     . ALA A  1  33   ? 33.842  -92.090  97.477  1.00 35.53  ? 33   ALA A O     1 
ATOM   246   C  CB    . ALA A  1  33   ? 30.896  -92.391  98.542  1.00 38.03  ? 33   ALA A CB    1 
ATOM   247   N  N     . LYS A  1  34   ? 32.431  -90.869  96.194  1.00 35.93  ? 34   LYS A N     1 
ATOM   248   C  CA    . LYS A  1  34   ? 33.386  -89.874  95.736  1.00 35.27  ? 34   LYS A CA    1 
ATOM   249   C  C     . LYS A  1  34   ? 33.894  -88.959  96.865  1.00 37.62  ? 34   LYS A C     1 
ATOM   250   O  O     . LYS A  1  34   ? 35.096  -88.836  97.033  1.00 40.40  ? 34   LYS A O     1 
ATOM   251   C  CB    . LYS A  1  34   ? 32.739  -89.111  94.554  1.00 31.46  ? 34   LYS A CB    1 
ATOM   252   C  CG    . LYS A  1  34   ? 31.417  -89.838  93.905  1.00 25.05  ? 34   LYS A CG    1 
ATOM   253   C  CD    . LYS A  1  34   ? 31.619  -91.234  93.191  1.00 15.64  ? 34   LYS A CD    1 
ATOM   254   C  CE    . LYS A  1  34   ? 30.312  -91.901  92.969  1.00 5.38   ? 34   LYS A CE    1 
ATOM   255   N  NZ    . LYS A  1  34   ? 29.346  -90.839  92.754  1.00 1.00   ? 34   LYS A NZ    1 
ATOM   256   N  N     . ILE A  1  35   ? 33.011  -88.336  97.648  1.00 39.78  ? 35   ILE A N     1 
ATOM   257   C  CA    . ILE A  1  35   ? 33.434  -87.477  98.783  1.00 41.31  ? 35   ILE A CA    1 
ATOM   258   C  C     . ILE A  1  35   ? 34.203  -86.216  98.444  1.00 42.18  ? 35   ILE A C     1 
ATOM   259   O  O     . ILE A  1  35   ? 35.439  -86.207  98.459  1.00 39.10  ? 35   ILE A O     1 
ATOM   260   C  CB    . ILE A  1  35   ? 34.298  -88.250  99.790  1.00 41.04  ? 35   ILE A CB    1 
ATOM   261   C  CG1   . ILE A  1  35   ? 33.501  -89.412  100.347 1.00 40.69  ? 35   ILE A CG1   1 
ATOM   262   C  CG2   . ILE A  1  35   ? 34.737  -87.341  100.927 1.00 38.63  ? 35   ILE A CG2   1 
ATOM   263   C  CD1   . ILE A  1  35   ? 34.326  -90.284  101.203 1.00 45.17  ? 35   ILE A CD1   1 
ATOM   264   N  N     . ARG A  1  36   ? 33.457  -85.142  98.213  1.00 45.03  ? 36   ARG A N     1 
ATOM   265   C  CA    . ARG A  1  36   ? 34.047  -83.873  97.829  1.00 49.23  ? 36   ARG A CA    1 
ATOM   266   C  C     . ARG A  1  36   ? 33.834  -82.716  98.793  1.00 51.15  ? 36   ARG A C     1 
ATOM   267   O  O     . ARG A  1  36   ? 34.704  -81.848  98.931  1.00 51.41  ? 36   ARG A O     1 
ATOM   268   C  CB    . ARG A  1  36   ? 33.509  -83.494  96.454  1.00 51.16  ? 36   ARG A CB    1 
ATOM   269   C  CG    . ARG A  1  36   ? 33.935  -84.477  95.367  1.00 53.91  ? 36   ARG A CG    1 
ATOM   270   C  CD    . ARG A  1  36   ? 32.982  -84.524  94.172  1.00 55.46  ? 36   ARG A CD    1 
ATOM   271   N  NE    . ARG A  1  36   ? 31.895  -85.482  94.365  1.00 56.21  ? 36   ARG A NE    1 
ATOM   272   C  CZ    . ARG A  1  36   ? 31.428  -86.277  93.405  1.00 57.83  ? 36   ARG A CZ    1 
ATOM   273   N  NH1   . ARG A  1  36   ? 31.958  -86.226  92.183  1.00 58.49  ? 36   ARG A NH1   1 
ATOM   274   N  NH2   . ARG A  1  36   ? 30.438  -87.129  93.663  1.00 57.69  ? 36   ARG A NH2   1 
ATOM   275   N  N     . PHE A  1  37   ? 32.685  -82.717  99.460  1.00 52.84  ? 37   PHE A N     1 
ATOM   276   C  CA    . PHE A  1  37   ? 32.309  -81.657  100.394 1.00 54.74  ? 37   PHE A CA    1 
ATOM   277   C  C     . PHE A  1  37   ? 32.741  -81.943  101.833 1.00 55.80  ? 37   PHE A C     1 
ATOM   278   O  O     . PHE A  1  37   ? 32.563  -83.051  102.331 1.00 57.20  ? 37   PHE A O     1 
ATOM   279   C  CB    . PHE A  1  37   ? 30.794  -81.483  100.348 1.00 56.14  ? 37   PHE A CB    1 
ATOM   280   C  CG    . PHE A  1  37   ? 30.240  -81.350  98.957  1.00 58.14  ? 37   PHE A CG    1 
ATOM   281   C  CD1   . PHE A  1  37   ? 30.718  -82.147  97.922  1.00 56.76  ? 37   PHE A CD1   1 
ATOM   282   C  CD2   . PHE A  1  37   ? 29.229  -80.424  98.682  1.00 60.58  ? 37   PHE A CD2   1 
ATOM   283   C  CE1   . PHE A  1  37   ? 30.214  -82.028  96.652  1.00 57.40  ? 37   PHE A CE1   1 
ATOM   284   C  CE2   . PHE A  1  37   ? 28.710  -80.296  97.399  1.00 59.98  ? 37   PHE A CE2   1 
ATOM   285   C  CZ    . PHE A  1  37   ? 29.206  -81.101  96.383  1.00 59.23  ? 37   PHE A CZ    1 
ATOM   286   N  N     . PRO A  1  38   ? 33.311  -80.949  102.529 1.00 55.98  ? 38   PRO A N     1 
ATOM   287   C  CA    . PRO A  1  38   ? 33.708  -81.260  103.898 1.00 56.24  ? 38   PRO A CA    1 
ATOM   288   C  C     . PRO A  1  38   ? 32.551  -81.218  104.876 1.00 56.94  ? 38   PRO A C     1 
ATOM   289   O  O     . PRO A  1  38   ? 32.749  -81.465  106.055 1.00 57.97  ? 38   PRO A O     1 
ATOM   290   C  CB    . PRO A  1  38   ? 34.771  -80.207  104.194 1.00 55.71  ? 38   PRO A CB    1 
ATOM   291   C  CG    . PRO A  1  38   ? 34.265  -79.041  103.460 1.00 56.13  ? 38   PRO A CG    1 
ATOM   292   C  CD    . PRO A  1  38   ? 33.826  -79.631  102.128 1.00 56.13  ? 38   PRO A CD    1 
ATOM   293   N  N     . GLU A  1  39   ? 31.348  -80.912  104.398 1.00 57.80  ? 39   GLU A N     1 
ATOM   294   C  CA    . GLU A  1  39   ? 30.188  -80.852  105.286 1.00 60.13  ? 39   GLU A CA    1 
ATOM   295   C  C     . GLU A  1  39   ? 29.771  -82.221  105.789 1.00 61.22  ? 39   GLU A C     1 
ATOM   296   O  O     . GLU A  1  39   ? 29.981  -83.227  105.115 1.00 60.13  ? 39   GLU A O     1 
ATOM   297   C  CB    . GLU A  1  39   ? 28.987  -80.208  104.590 1.00 61.53  ? 39   GLU A CB    1 
ATOM   298   C  CG    . GLU A  1  39   ? 29.097  -78.710  104.400 1.00 64.96  ? 39   GLU A CG    1 
ATOM   299   C  CD    . GLU A  1  39   ? 30.076  -78.326  103.309 1.00 66.79  ? 39   GLU A CD    1 
ATOM   300   O  OE1   . GLU A  1  39   ? 29.688  -78.368  102.117 1.00 68.31  ? 39   GLU A OE1   1 
ATOM   301   O  OE2   . GLU A  1  39   ? 31.233  -77.993  103.645 1.00 66.61  ? 39   GLU A OE2   1 
ATOM   302   N  N     . THR A  1  40   ? 29.187  -82.258  106.983 1.00 63.82  ? 40   THR A N     1 
ATOM   303   C  CA    . THR A  1  40   ? 28.727  -83.518  107.548 1.00 66.28  ? 40   THR A CA    1 
ATOM   304   C  C     . THR A  1  40   ? 27.508  -83.833  106.746 1.00 68.96  ? 40   THR A C     1 
ATOM   305   O  O     . THR A  1  40   ? 27.444  -84.844  106.050 1.00 69.07  ? 40   THR A O     1 
ATOM   306   C  CB    . THR A  1  40   ? 28.286  -83.393  109.014 1.00 65.86  ? 40   THR A CB    1 
ATOM   307   O  OG1   . THR A  1  40   ? 29.385  -82.929  109.802 1.00 66.95  ? 40   THR A OG1   1 
ATOM   308   C  CG2   . THR A  1  40   ? 27.822  -84.744  109.550 1.00 63.29  ? 40   THR A CG2   1 
ATOM   309   N  N     . MET A  1  41   ? 26.534  -82.940  106.829 1.00 72.43  ? 41   MET A N     1 
ATOM   310   C  CA    . MET A  1  41   ? 25.318  -83.166  106.091 1.00 77.69  ? 41   MET A CA    1 
ATOM   311   C  C     . MET A  1  41   ? 24.378  -82.000  105.919 1.00 80.90  ? 41   MET A C     1 
ATOM   312   O  O     . MET A  1  41   ? 24.670  -81.067  105.167 1.00 80.38  ? 41   MET A O     1 
ATOM   313   C  CB    . MET A  1  41   ? 24.564  -84.351  106.695 1.00 77.80  ? 41   MET A CB    1 
ATOM   314   C  CG    . MET A  1  41   ? 24.837  -84.652  108.169 1.00 77.79  ? 41   MET A CG    1 
ATOM   315   S  SD    . MET A  1  41   ? 23.732  -83.884  109.356 1.00 74.92  ? 41   MET A SD    1 
ATOM   316   C  CE    . MET A  1  41   ? 24.931  -83.439  110.675 1.00 75.67  ? 41   MET A CE    1 
ATOM   317   N  N     . ASP A  1  42   ? 23.250  -82.068  106.626 1.00 86.04  ? 42   ASP A N     1 
ATOM   318   C  CA    . ASP A  1  42   ? 22.204  -81.053  106.529 1.00 91.61  ? 42   ASP A CA    1 
ATOM   319   C  C     . ASP A  1  42   ? 22.248  -80.530  105.096 1.00 94.25  ? 42   ASP A C     1 
ATOM   320   O  O     . ASP A  1  42   ? 22.960  -79.569  104.789 1.00 94.41  ? 42   ASP A O     1 
ATOM   321   C  CB    . ASP A  1  42   ? 22.395  -79.893  107.547 1.00 91.12  ? 42   ASP A CB    1 
ATOM   322   C  CG    . ASP A  1  42   ? 21.488  -80.023  108.804 1.00 90.40  ? 42   ASP A CG    1 
ATOM   323   O  OD1   . ASP A  1  42   ? 20.317  -80.458  108.689 1.00 88.88  ? 42   ASP A OD1   1 
ATOM   324   O  OD2   . ASP A  1  42   ? 21.946  -79.662  109.914 1.00 89.77  ? 42   ASP A OD2   1 
ATOM   325   N  N     . GLU A  1  43   ? 21.528  -81.220  104.215 1.00 98.05  ? 43   GLU A N     1 
ATOM   326   C  CA    . GLU A  1  43   ? 21.446  -80.823  102.817 1.00 102.20 ? 43   GLU A CA    1 
ATOM   327   C  C     . GLU A  1  43   ? 20.957  -79.369  102.809 1.00 103.52 ? 43   GLU A C     1 
ATOM   328   O  O     . GLU A  1  43   ? 19.785  -79.088  102.531 1.00 104.17 ? 43   GLU A O     1 
ATOM   329   C  CB    . GLU A  1  43   ? 20.476  -81.756  102.054 1.00 104.13 ? 43   GLU A CB    1 
ATOM   330   C  CG    . GLU A  1  43   ? 19.159  -82.112  102.786 1.00 105.89 ? 43   GLU A CG    1 
ATOM   331   C  CD    . GLU A  1  43   ? 18.267  -83.098  102.010 1.00 106.76 ? 43   GLU A CD    1 
ATOM   332   O  OE1   . GLU A  1  43   ? 17.822  -82.760  100.885 1.00 106.45 ? 43   GLU A OE1   1 
ATOM   333   O  OE2   . GLU A  1  43   ? 18.011  -84.209  102.534 1.00 106.75 ? 43   GLU A OE2   1 
ATOM   334   N  N     . THR A  1  44   ? 21.878  -78.458  103.130 1.00 104.37 ? 44   THR A N     1 
ATOM   335   C  CA    . THR A  1  44   ? 21.609  -77.022  103.218 1.00 104.43 ? 44   THR A CA    1 
ATOM   336   C  C     . THR A  1  44   ? 20.782  -76.755  104.494 1.00 104.15 ? 44   THR A C     1 
ATOM   337   O  O     . THR A  1  44   ? 19.814  -75.990  104.464 1.00 104.91 ? 44   THR A O     1 
ATOM   338   C  CB    . THR A  1  44   ? 20.828  -76.501  101.958 1.00 105.06 ? 44   THR A CB    1 
ATOM   339   O  OG1   . THR A  1  44   ? 21.411  -77.049  100.765 1.00 105.11 ? 44   THR A OG1   1 
ATOM   340   C  CG2   . THR A  1  44   ? 20.877  -74.965  101.878 1.00 104.48 ? 44   THR A CG2   1 
ATOM   341   N  N     . GLN A  1  45   ? 21.174  -77.399  105.599 1.00 102.63 ? 45   GLN A N     1 
ATOM   342   C  CA    . GLN A  1  45   ? 20.506  -77.271  106.906 1.00 101.07 ? 45   GLN A CA    1 
ATOM   343   C  C     . GLN A  1  45   ? 19.385  -78.300  107.138 1.00 99.08  ? 45   GLN A C     1 
ATOM   344   O  O     . GLN A  1  45   ? 18.907  -78.477  108.261 1.00 98.83  ? 45   GLN A O     1 
ATOM   345   C  CB    . GLN A  1  45   ? 19.931  -75.857  107.099 1.00 102.37 ? 45   GLN A CB    1 
ATOM   346   C  CG    . GLN A  1  45   ? 20.948  -74.715  107.205 1.00 102.99 ? 45   GLN A CG    1 
ATOM   347   C  CD    . GLN A  1  45   ? 20.273  -73.343  107.332 1.00 103.47 ? 45   GLN A CD    1 
ATOM   348   O  OE1   . GLN A  1  45   ? 19.384  -73.144  108.171 1.00 103.05 ? 45   GLN A OE1   1 
ATOM   349   N  NE2   . GLN A  1  45   ? 20.699  -72.395  106.502 1.00 103.31 ? 45   GLN A NE2   1 
ATOM   350   N  N     . THR A  1  46   ? 18.960  -78.971  106.079 1.00 96.68  ? 46   THR A N     1 
ATOM   351   C  CA    . THR A  1  46   ? 17.908  -79.972  106.200 1.00 95.27  ? 46   THR A CA    1 
ATOM   352   C  C     . THR A  1  46   ? 18.519  -81.238  106.782 1.00 93.63  ? 46   THR A C     1 
ATOM   353   O  O     . THR A  1  46   ? 19.407  -81.813  106.163 1.00 94.63  ? 46   THR A O     1 
ATOM   354   C  CB    . THR A  1  46   ? 17.339  -80.334  104.824 1.00 95.77  ? 46   THR A CB    1 
ATOM   355   O  OG1   . THR A  1  46   ? 17.017  -79.134  104.110 1.00 96.23  ? 46   THR A OG1   1 
ATOM   356   C  CG2   . THR A  1  46   ? 16.097  -81.213  104.971 1.00 96.22  ? 46   THR A CG2   1 
ATOM   357   N  N     . ARG A  1  47   ? 18.054  -81.683  107.948 1.00 90.79  ? 47   ARG A N     1 
ATOM   358   C  CA    . ARG A  1  47   ? 18.603  -82.899  108.557 1.00 87.86  ? 47   ARG A CA    1 
ATOM   359   C  C     . ARG A  1  47   ? 18.580  -84.119  107.618 1.00 84.82  ? 47   ARG A C     1 
ATOM   360   O  O     . ARG A  1  47   ? 17.522  -84.697  107.359 1.00 84.75  ? 47   ARG A O     1 
ATOM   361   C  CB    . ARG A  1  47   ? 17.841  -83.229  109.836 1.00 90.08  ? 47   ARG A CB    1 
ATOM   362   C  CG    . ARG A  1  47   ? 17.974  -82.177  110.936 1.00 93.92  ? 47   ARG A CG    1 
ATOM   363   C  CD    . ARG A  1  47   ? 17.080  -82.527  112.129 1.00 97.16  ? 47   ARG A CD    1 
ATOM   364   N  NE    . ARG A  1  47   ? 17.373  -83.858  112.675 1.00 100.67 ? 47   ARG A NE    1 
ATOM   365   C  CZ    . ARG A  1  47   ? 16.449  -84.769  112.988 1.00 101.66 ? 47   ARG A CZ    1 
ATOM   366   N  NH1   . ARG A  1  47   ? 15.159  -84.499  112.807 1.00 102.13 ? 47   ARG A NH1   1 
ATOM   367   N  NH2   . ARG A  1  47   ? 16.813  -85.951  113.485 1.00 101.33 ? 47   ARG A NH2   1 
ATOM   368   N  N     . ALA A  1  48   ? 19.760  -84.490  107.116 1.00 80.32  ? 48   ALA A N     1 
ATOM   369   C  CA    . ALA A  1  48   ? 19.962  -85.624  106.204 1.00 75.07  ? 48   ALA A CA    1 
ATOM   370   C  C     . ALA A  1  48   ? 21.475  -85.758  106.063 1.00 72.00  ? 48   ALA A C     1 
ATOM   371   O  O     . ALA A  1  48   ? 22.187  -85.592  107.043 1.00 71.33  ? 48   ALA A O     1 
ATOM   372   C  CB    . ALA A  1  48   ? 19.325  -85.347  104.852 1.00 73.67  ? 48   ALA A CB    1 
ATOM   373   N  N     . LYS A  1  49   ? 21.973  -86.051  104.868 1.00 68.86  ? 49   LYS A N     1 
ATOM   374   C  CA    . LYS A  1  49   ? 23.421  -86.175  104.666 1.00 66.25  ? 49   LYS A CA    1 
ATOM   375   C  C     . LYS A  1  49   ? 23.774  -85.643  103.287 1.00 63.28  ? 49   LYS A C     1 
ATOM   376   O  O     . LYS A  1  49   ? 23.084  -85.959  102.332 1.00 63.43  ? 49   LYS A O     1 
ATOM   377   C  CB    . LYS A  1  49   ? 23.870  -87.637  104.752 1.00 68.60  ? 49   LYS A CB    1 
ATOM   378   C  CG    . LYS A  1  49   ? 23.402  -88.445  105.981 1.00 71.82  ? 49   LYS A CG    1 
ATOM   379   C  CD    . LYS A  1  49   ? 23.996  -89.891  105.958 1.00 72.82  ? 49   LYS A CD    1 
ATOM   380   C  CE    . LYS A  1  49   ? 23.371  -90.851  106.996 1.00 73.34  ? 49   LYS A CE    1 
ATOM   381   N  NZ    . LYS A  1  49   ? 23.862  -92.267  106.871 1.00 71.57  ? 49   LYS A NZ    1 
ATOM   382   N  N     . ILE A  1  50   ? 24.829  -84.846  103.150 1.00 59.77  ? 50   ILE A N     1 
ATOM   383   C  CA    . ILE A  1  50   ? 25.148  -84.342  101.814 1.00 57.87  ? 50   ILE A CA    1 
ATOM   384   C  C     . ILE A  1  50   ? 25.965  -85.398  101.067 1.00 55.01  ? 50   ILE A C     1 
ATOM   385   O  O     . ILE A  1  50   ? 26.747  -86.113  101.705 1.00 55.76  ? 50   ILE A O     1 
ATOM   386   C  CB    . ILE A  1  50   ? 25.937  -82.965  101.862 1.00 59.77  ? 50   ILE A CB    1 
ATOM   387   C  CG1   . ILE A  1  50   ? 25.010  -81.835  102.351 1.00 61.29  ? 50   ILE A CG1   1 
ATOM   388   C  CG2   . ILE A  1  50   ? 26.457  -82.575  100.456 1.00 59.31  ? 50   ILE A CG2   1 
ATOM   389   C  CD1   . ILE A  1  50   ? 25.592  -80.404  102.190 1.00 61.49  ? 50   ILE A CD1   1 
ATOM   390   N  N     . GLY A  1  51   ? 25.764  -85.514  99.743  1.00 50.23  ? 51   GLY A N     1 
ATOM   391   C  CA    . GLY A  1  51   ? 26.519  -86.468  98.948  1.00 45.25  ? 51   GLY A CA    1 
ATOM   392   C  C     . GLY A  1  51   ? 28.016  -86.161  99.015  1.00 44.37  ? 51   GLY A C     1 
ATOM   393   O  O     . GLY A  1  51   ? 28.763  -86.501  98.123  1.00 44.25  ? 51   GLY A O     1 
ATOM   394   N  N     . GLY A  1  52   ? 28.468  -85.526  100.091 1.00 43.71  ? 52   GLY A N     1 
ATOM   395   C  CA    . GLY A  1  52   ? 29.871  -85.169  100.239 1.00 42.24  ? 52   GLY A CA    1 
ATOM   396   C  C     . GLY A  1  52   ? 30.633  -85.931  101.314 1.00 42.76  ? 52   GLY A C     1 
ATOM   397   O  O     . GLY A  1  52   ? 31.517  -86.707  100.963 1.00 44.97  ? 52   GLY A O     1 
ATOM   398   N  N     . LEU A  1  53   ? 30.371  -85.709  102.609 1.00 41.74  ? 53   LEU A N     1 
ATOM   399   C  CA    . LEU A  1  53   ? 31.094  -86.497  103.621 1.00 40.42  ? 53   LEU A CA    1 
ATOM   400   C  C     . LEU A  1  53   ? 30.121  -87.495  104.203 1.00 41.43  ? 53   LEU A C     1 
ATOM   401   O  O     . LEU A  1  53   ? 29.004  -87.628  103.681 1.00 42.52  ? 53   LEU A O     1 
ATOM   402   C  CB    . LEU A  1  53   ? 31.756  -85.653  104.724 1.00 36.47  ? 53   LEU A CB    1 
ATOM   403   C  CG    . LEU A  1  53   ? 33.104  -86.307  105.121 1.00 33.24  ? 53   LEU A CG    1 
ATOM   404   C  CD1   . LEU A  1  53   ? 34.088  -85.325  105.743 1.00 29.69  ? 53   LEU A CD1   1 
ATOM   405   C  CD2   . LEU A  1  53   ? 32.832  -87.444  106.063 1.00 31.96  ? 53   LEU A CD2   1 
ATOM   406   N  N     . ASN A  1  54   ? 30.509  -88.167  105.284 1.00 40.89  ? 54   ASN A N     1 
ATOM   407   C  CA    . ASN A  1  54   ? 29.693  -89.242  105.835 1.00 41.87  ? 54   ASN A CA    1 
ATOM   408   C  C     . ASN A  1  54   ? 28.249  -89.461  105.240 1.00 41.61  ? 54   ASN A C     1 
ATOM   409   O  O     . ASN A  1  54   ? 27.264  -88.751  105.478 1.00 40.02  ? 54   ASN A O     1 
ATOM   410   C  CB    . ASN A  1  54   ? 29.800  -89.268  107.381 1.00 42.27  ? 54   ASN A CB    1 
ATOM   411   C  CG    . ASN A  1  54   ? 28.810  -88.397  108.074 1.00 45.66  ? 54   ASN A CG    1 
ATOM   412   O  OD1   . ASN A  1  54   ? 27.605  -88.618  107.992 1.00 48.11  ? 54   ASN A OD1   1 
ATOM   413   N  ND2   . ASN A  1  54   ? 29.309  -87.406  108.802 1.00 47.79  ? 54   ASN A ND2   1 
ATOM   414   N  N     . ASP A  1  55   ? 28.275  -90.488  104.388 1.00 41.17  ? 55   ASP A N     1 
ATOM   415   C  CA    . ASP A  1  55   ? 27.289  -91.127  103.518 1.00 39.86  ? 55   ASP A CA    1 
ATOM   416   C  C     . ASP A  1  55   ? 26.902  -90.551  102.238 1.00 42.47  ? 55   ASP A C     1 
ATOM   417   O  O     . ASP A  1  55   ? 25.781  -90.087  102.057 1.00 40.57  ? 55   ASP A O     1 
ATOM   418   C  CB    . ASP A  1  55   ? 25.952  -91.563  104.089 1.00 37.41  ? 55   ASP A CB    1 
ATOM   419   C  CG    . ASP A  1  55   ? 25.066  -92.253  102.967 1.00 32.03  ? 55   ASP A CG    1 
ATOM   420   O  OD1   . ASP A  1  55   ? 25.429  -93.369  102.457 1.00 20.41  ? 55   ASP A OD1   1 
ATOM   421   O  OD2   . ASP A  1  55   ? 24.035  -91.638  102.576 1.00 25.19  ? 55   ASP A OD2   1 
ATOM   422   N  N     . PRO A  1  56   ? 27.850  -90.517  101.327 1.00 47.47  ? 56   PRO A N     1 
ATOM   423   C  CA    . PRO A  1  56   ? 27.524  -90.009  100.000 1.00 50.04  ? 56   PRO A CA    1 
ATOM   424   C  C     . PRO A  1  56   ? 27.233  -91.392  99.378  1.00 52.36  ? 56   PRO A C     1 
ATOM   425   O  O     . PRO A  1  56   ? 27.294  -91.558  98.154  1.00 52.68  ? 56   PRO A O     1 
ATOM   426   C  CB    . PRO A  1  56   ? 28.837  -89.408  99.521  1.00 50.94  ? 56   PRO A CB    1 
ATOM   427   C  CG    . PRO A  1  56   ? 29.532  -89.029  100.840 1.00 51.42  ? 56   PRO A CG    1 
ATOM   428   C  CD    . PRO A  1  56   ? 29.258  -90.251  101.664 1.00 48.96  ? 56   PRO A CD    1 
ATOM   429   N  N     . ARG A  1  57   ? 26.960  -92.356  100.299 1.00 54.42  ? 57   ARG A N     1 
ATOM   430   C  CA    . ARG A  1  57   ? 26.634  -93.797  100.095 1.00 54.04  ? 57   ARG A CA    1 
ATOM   431   C  C     . ARG A  1  57   ? 27.377  -94.798  101.047 1.00 53.92  ? 57   ARG A C     1 
ATOM   432   O  O     . ARG A  1  57   ? 27.238  -96.014  100.882 1.00 53.45  ? 57   ARG A O     1 
ATOM   433   C  CB    . ARG A  1  57   ? 26.881  -94.223  98.630  1.00 54.32  ? 57   ARG A CB    1 
ATOM   434   C  CG    . ARG A  1  57   ? 25.888  -93.656  97.599  1.00 53.29  ? 57   ARG A CG    1 
ATOM   435   C  CD    . ARG A  1  57   ? 26.447  -93.724  96.183  1.00 53.72  ? 57   ARG A CD    1 
ATOM   436   N  NE    . ARG A  1  57   ? 26.764  -92.417  95.580  1.00 55.29  ? 57   ARG A NE    1 
ATOM   437   C  CZ    . ARG A  1  57   ? 27.960  -91.822  95.602  1.00 56.53  ? 57   ARG A CZ    1 
ATOM   438   N  NH1   . ARG A  1  57   ? 28.978  -92.401  96.210  1.00 57.57  ? 57   ARG A NH1   1 
ATOM   439   N  NH2   . ARG A  1  57   ? 28.161  -90.664  94.979  1.00 56.24  ? 57   ARG A NH2   1 
ATOM   440   N  N     . LEU A  1  58   ? 28.162  -94.303  102.019 1.00 53.73  ? 58   LEU A N     1 
ATOM   441   C  CA    . LEU A  1  58   ? 28.912  -95.176  102.962 1.00 51.63  ? 58   LEU A CA    1 
ATOM   442   C  C     . LEU A  1  58   ? 27.864  -95.723  103.871 1.00 52.66  ? 58   LEU A C     1 
ATOM   443   O  O     . LEU A  1  58   ? 26.701  -95.741  103.487 1.00 55.47  ? 58   LEU A O     1 
ATOM   444   C  CB    . LEU A  1  58   ? 29.878  -94.388  103.841 1.00 48.92  ? 58   LEU A CB    1 
ATOM   445   C  CG    . LEU A  1  58   ? 30.584  -93.174  103.256 1.00 47.70  ? 58   LEU A CG    1 
ATOM   446   C  CD1   . LEU A  1  58   ? 31.312  -92.465  104.359 1.00 47.27  ? 58   LEU A CD1   1 
ATOM   447   C  CD2   . LEU A  1  58   ? 31.549  -93.595  102.163 1.00 48.40  ? 58   LEU A CD2   1 
ATOM   448   N  N     . GLY A  1  59   ? 28.245  -96.131  105.079 1.00 51.15  ? 59   GLY A N     1 
ATOM   449   C  CA    . GLY A  1  59   ? 27.244  -96.640  106.010 1.00 51.44  ? 59   GLY A CA    1 
ATOM   450   C  C     . GLY A  1  59   ? 26.077  -95.681  106.314 1.00 52.11  ? 59   GLY A C     1 
ATOM   451   O  O     . GLY A  1  59   ? 25.801  -94.751  105.566 1.00 51.71  ? 59   GLY A O     1 
ATOM   452   N  N     . SER A  1  60   ? 25.379  -95.889  107.424 1.00 53.23  ? 60   SER A N     1 
ATOM   453   C  CA    . SER A  1  60   ? 24.264  -95.015  107.766 1.00 55.08  ? 60   SER A CA    1 
ATOM   454   C  C     . SER A  1  60   ? 24.341  -94.371  109.146 1.00 57.48  ? 60   SER A C     1 
ATOM   455   O  O     . SER A  1  60   ? 25.312  -94.529  109.880 1.00 58.26  ? 60   SER A O     1 
ATOM   456   C  CB    . SER A  1  60   ? 22.966  -95.798  107.680 1.00 54.61  ? 60   SER A CB    1 
ATOM   457   O  OG    . SER A  1  60   ? 21.881  -95.029  108.161 1.00 54.28  ? 60   SER A OG    1 
ATOM   458   N  N     . ILE A  1  61   ? 23.294  -93.621  109.475 1.00 59.39  ? 61   ILE A N     1 
ATOM   459   C  CA    . ILE A  1  61   ? 23.147  -92.967  110.771 1.00 60.94  ? 61   ILE A CA    1 
ATOM   460   C  C     . ILE A  1  61   ? 21.670  -93.213  111.143 1.00 64.98  ? 61   ILE A C     1 
ATOM   461   O  O     . ILE A  1  61   ? 21.223  -94.358  111.233 1.00 66.02  ? 61   ILE A O     1 
ATOM   462   C  CB    . ILE A  1  61   ? 23.421  -91.460  110.669 1.00 56.40  ? 61   ILE A CB    1 
ATOM   463   C  CG1   . ILE A  1  61   ? 24.767  -91.231  110.000 1.00 52.64  ? 61   ILE A CG1   1 
ATOM   464   C  CG2   . ILE A  1  61   ? 23.433  -90.838  112.054 1.00 55.62  ? 61   ILE A CG2   1 
ATOM   465   C  CD1   . ILE A  1  61   ? 25.003  -89.804  109.646 1.00 50.12  ? 61   ILE A CD1   1 
ATOM   466   N  N     . ASP A  1  62   ? 20.927  -92.138  111.355 1.00 68.42  ? 62   ASP A N     1 
ATOM   467   C  CA    . ASP A  1  62   ? 19.492  -92.173  111.664 1.00 72.32  ? 62   ASP A CA    1 
ATOM   468   C  C     . ASP A  1  62   ? 18.778  -93.551  111.619 1.00 73.23  ? 62   ASP A C     1 
ATOM   469   O  O     . ASP A  1  62   ? 17.913  -93.721  110.764 1.00 74.82  ? 62   ASP A O     1 
ATOM   470   C  CB    . ASP A  1  62   ? 18.808  -91.212  110.663 1.00 75.48  ? 62   ASP A CB    1 
ATOM   471   C  CG    . ASP A  1  62   ? 17.392  -90.797  111.068 1.00 79.06  ? 62   ASP A CG    1 
ATOM   472   O  OD1   . ASP A  1  62   ? 16.512  -91.674  111.253 1.00 81.51  ? 62   ASP A OD1   1 
ATOM   473   O  OD2   . ASP A  1  62   ? 17.159  -89.568  111.183 1.00 81.00  ? 62   ASP A OD2   1 
ATOM   474   N  N     . ARG A  1  63   ? 19.084  -94.502  112.517 1.00 73.29  ? 63   ARG A N     1 
ATOM   475   C  CA    . ARG A  1  63   ? 18.421  -95.829  112.490 1.00 74.10  ? 63   ARG A CA    1 
ATOM   476   C  C     . ARG A  1  63   ? 17.539  -95.914  111.242 1.00 73.73  ? 63   ARG A C     1 
ATOM   477   O  O     . ARG A  1  63   ? 16.299  -95.864  111.314 1.00 71.89  ? 63   ARG A O     1 
ATOM   478   C  CB    . ARG A  1  63   ? 17.540  -96.041  113.717 1.00 77.87  ? 63   ARG A CB    1 
ATOM   479   C  CG    . ARG A  1  63   ? 18.243  -96.134  115.070 1.00 83.23  ? 63   ARG A CG    1 
ATOM   480   C  CD    . ARG A  1  63   ? 17.165  -96.249  116.181 1.00 87.84  ? 63   ARG A CD    1 
ATOM   481   N  NE    . ARG A  1  63   ? 17.661  -96.143  117.559 1.00 91.81  ? 63   ARG A NE    1 
ATOM   482   C  CZ    . ARG A  1  63   ? 16.876  -96.107  118.641 1.00 93.56  ? 63   ARG A CZ    1 
ATOM   483   N  NH1   . ARG A  1  63   ? 15.553  -96.167  118.507 1.00 93.96  ? 63   ARG A NH1   1 
ATOM   484   N  NH2   . ARG A  1  63   ? 17.407  -96.005  119.860 1.00 93.78  ? 63   ARG A NH2   1 
ATOM   485   N  N     . ASN A  1  64   ? 18.215  -96.023  110.098 1.00 73.47  ? 64   ASN A N     1 
ATOM   486   C  CA    . ASN A  1  64   ? 17.591  -96.047  108.778 1.00 71.05  ? 64   ASN A CA    1 
ATOM   487   C  C     . ASN A  1  64   ? 18.236  -97.029  107.803 1.00 70.78  ? 64   ASN A C     1 
ATOM   488   O  O     . ASN A  1  64   ? 19.270  -96.728  107.196 1.00 69.36  ? 64   ASN A O     1 
ATOM   489   C  CB    . ASN A  1  64   ? 17.686  -94.661  108.186 1.00 69.76  ? 64   ASN A CB    1 
ATOM   490   C  CG    . ASN A  1  64   ? 16.502  -94.320  107.401 1.00 69.49  ? 64   ASN A CG    1 
ATOM   491   O  OD1   . ASN A  1  64   ? 15.443  -94.930  107.578 1.00 69.34  ? 64   ASN A OD1   1 
ATOM   492   N  ND2   . ASN A  1  64   ? 16.637  -93.329  106.526 1.00 69.19  ? 64   ASN A ND2   1 
ATOM   493   N  N     . LEU A  1  65   ? 17.604  -98.189  107.648 1.00 70.88  ? 65   LEU A N     1 
ATOM   494   C  CA    . LEU A  1  65   ? 18.092  -99.244  106.763 1.00 70.08  ? 65   LEU A CA    1 
ATOM   495   C  C     . LEU A  1  65   ? 18.869  -98.668  105.591 1.00 69.15  ? 65   LEU A C     1 
ATOM   496   O  O     . LEU A  1  65   ? 19.892  -99.229  105.189 1.00 69.52  ? 65   LEU A O     1 
ATOM   497   C  CB    . LEU A  1  65   ? 16.917  -100.101 106.250 1.00 70.03  ? 65   LEU A CB    1 
ATOM   498   C  CG    . LEU A  1  65   ? 16.244  -101.130 107.182 1.00 69.64  ? 65   LEU A CG    1 
ATOM   499   C  CD1   . LEU A  1  65   ? 14.841  -101.489 106.688 1.00 69.20  ? 65   LEU A CD1   1 
ATOM   500   C  CD2   . LEU A  1  65   ? 17.114  -102.371 107.260 1.00 69.27  ? 65   LEU A CD2   1 
ATOM   501   N  N     . LYS A  1  66   ? 18.396  -97.540  105.062 1.00 68.60  ? 66   LYS A N     1 
ATOM   502   C  CA    . LYS A  1  66   ? 19.061  -96.907  103.926 1.00 69.96  ? 66   LYS A CA    1 
ATOM   503   C  C     . LYS A  1  66   ? 20.562  -97.210  104.002 1.00 67.17  ? 66   LYS A C     1 
ATOM   504   O  O     . LYS A  1  66   ? 21.147  -97.290  105.084 1.00 66.15  ? 66   LYS A O     1 
ATOM   505   C  CB    . LYS A  1  66   ? 18.816  -95.379  103.913 1.00 71.36  ? 66   LYS A CB    1 
ATOM   506   C  CG    . LYS A  1  66   ? 18.796  -94.705  102.490 1.00 73.00  ? 66   LYS A CG    1 
ATOM   507   C  CD    . LYS A  1  66   ? 20.045  -95.054  101.653 1.00 73.74  ? 66   LYS A CD    1 
ATOM   508   C  CE    . LYS A  1  66   ? 20.091  -94.407  100.273 1.00 72.26  ? 66   LYS A CE    1 
ATOM   509   N  NZ    . LYS A  1  66   ? 21.319  -94.869  99.553  1.00 70.93  ? 66   LYS A NZ    1 
ATOM   510   N  N     . CYS A  1  67   ? 21.171  -97.396  102.840 1.00 64.47  ? 67   CYS A N     1 
ATOM   511   C  CA    . CYS A  1  67   ? 22.574  -97.702  102.779 1.00 63.58  ? 67   CYS A CA    1 
ATOM   512   C  C     . CYS A  1  67   ? 22.891  -98.172  101.369 1.00 65.89  ? 67   CYS A C     1 
ATOM   513   O  O     . CYS A  1  67   ? 23.400  -99.286  101.198 1.00 68.23  ? 67   CYS A O     1 
ATOM   514   C  CB    . CYS A  1  67   ? 22.885  -98.805  103.790 1.00 58.29  ? 67   CYS A CB    1 
ATOM   515   S  SG    . CYS A  1  67   ? 24.549  -99.433  103.716 1.00 47.91  ? 67   CYS A SG    1 
ATOM   516   N  N     . GLN A  1  68   ? 22.639  -97.339  100.356 1.00 65.75  ? 68   GLN A N     1 
ATOM   517   C  CA    . GLN A  1  68   ? 22.903  -97.791  98.986  1.00 68.76  ? 68   GLN A CA    1 
ATOM   518   C  C     . GLN A  1  68   ? 22.468  -99.286  98.885  1.00 74.50  ? 68   GLN A C     1 
ATOM   519   O  O     . GLN A  1  68   ? 23.311  -100.213 98.803  1.00 74.13  ? 68   GLN A O     1 
ATOM   520   C  CB    . GLN A  1  68   ? 24.394  -97.614  98.628  1.00 64.92  ? 68   GLN A CB    1 
ATOM   521   C  CG    . GLN A  1  68   ? 25.380  -98.008  99.713  1.00 57.71  ? 68   GLN A CG    1 
ATOM   522   C  CD    . GLN A  1  68   ? 25.913  -99.413  99.564  1.00 54.03  ? 68   GLN A CD    1 
ATOM   523   O  OE1   . GLN A  1  68   ? 25.190  -100.407 99.690  1.00 48.07  ? 68   GLN A OE1   1 
ATOM   524   N  NE2   . GLN A  1  68   ? 27.201  -99.502  99.296  1.00 53.82  ? 68   GLN A NE2   1 
ATOM   525   N  N     . THR A  1  69   ? 21.134  -99.479  98.901  1.00 77.62  ? 69   THR A N     1 
ATOM   526   C  CA    . THR A  1  69   ? 20.416  -100.786 98.868  1.00 78.10  ? 69   THR A CA    1 
ATOM   527   C  C     . THR A  1  69   ? 20.842  -101.756 99.986  1.00 75.71  ? 69   THR A C     1 
ATOM   528   O  O     . THR A  1  69   ? 19.976  -102.255 100.708 1.00 75.73  ? 69   THR A O     1 
ATOM   529   C  CB    . THR A  1  69   ? 20.507  -101.534 97.469  1.00 79.92  ? 69   THR A CB    1 
ATOM   530   O  OG1   . THR A  1  69   ? 19.939  -100.711 96.433  1.00 81.42  ? 69   THR A OG1   1 
ATOM   531   C  CG2   . THR A  1  69   ? 19.718  -102.871 97.521  1.00 79.61  ? 69   THR A CG2   1 
ATOM   532   N  N     . CYS A  1  70   ? 22.153  -102.015 100.110 1.00 72.21  ? 70   CYS A N     1 
ATOM   533   C  CA    . CYS A  1  70   ? 22.710  -102.887 101.138 1.00 68.59  ? 70   CYS A CA    1 
ATOM   534   C  C     . CYS A  1  70   ? 21.693  -103.051 102.267 1.00 69.89  ? 70   CYS A C     1 
ATOM   535   O  O     . CYS A  1  70   ? 21.488  -104.152 102.774 1.00 71.04  ? 70   CYS A O     1 
ATOM   536   C  CB    . CYS A  1  70   ? 24.015  -102.270 101.646 1.00 65.14  ? 70   CYS A CB    1 
ATOM   537   S  SG    . CYS A  1  70   ? 24.522  -102.661 103.345 1.00 58.14  ? 70   CYS A SG    1 
ATOM   538   N  N     . GLN A  1  71   ? 21.038  -101.945 102.625 1.00 70.79  ? 71   GLN A N     1 
ATOM   539   C  CA    . GLN A  1  71   ? 20.020  -101.933 103.666 1.00 71.26  ? 71   GLN A CA    1 
ATOM   540   C  C     . GLN A  1  71   ? 20.510  -102.580 104.941 1.00 70.38  ? 71   GLN A C     1 
ATOM   541   O  O     . GLN A  1  71   ? 21.439  -102.107 105.596 1.00 69.31  ? 71   GLN A O     1 
ATOM   542   C  CB    . GLN A  1  71   ? 18.759  -102.666 103.192 1.00 73.84  ? 71   GLN A CB    1 
ATOM   543   C  CG    . GLN A  1  71   ? 17.794  -101.824 102.338 1.00 80.14  ? 71   GLN A CG    1 
ATOM   544   C  CD    . GLN A  1  71   ? 16.706  -101.092 103.155 1.00 83.20  ? 71   GLN A CD    1 
ATOM   545   O  OE1   . GLN A  1  71   ? 15.902  -101.720 103.857 1.00 84.46  ? 71   GLN A OE1   1 
ATOM   546   N  NE2   . GLN A  1  71   ? 16.677  -99.760  103.050 1.00 84.56  ? 71   GLN A NE2   1 
ATOM   547   N  N     . GLU A  1  72   ? 19.857  -103.671 105.296 1.00 69.12  ? 72   GLU A N     1 
ATOM   548   C  CA    . GLU A  1  72   ? 20.220  -104.396 106.488 1.00 68.32  ? 72   GLU A CA    1 
ATOM   549   C  C     . GLU A  1  72   ? 20.134  -103.495 107.734 1.00 66.88  ? 72   GLU A C     1 
ATOM   550   O  O     . GLU A  1  72   ? 19.769  -103.960 108.818 1.00 68.24  ? 72   GLU A O     1 
ATOM   551   C  CB    . GLU A  1  72   ? 21.636  -104.966 106.321 1.00 68.28  ? 72   GLU A CB    1 
ATOM   552   C  CG    . GLU A  1  72   ? 21.868  -105.824 105.060 1.00 67.01  ? 72   GLU A CG    1 
ATOM   553   C  CD    . GLU A  1  72   ? 20.870  -106.962 104.901 1.00 67.19  ? 72   GLU A CD    1 
ATOM   554   O  OE1   . GLU A  1  72   ? 20.363  -107.468 105.924 1.00 65.94  ? 72   GLU A OE1   1 
ATOM   555   O  OE2   . GLU A  1  72   ? 20.604  -107.360 103.745 1.00 66.85  ? 72   GLU A OE2   1 
ATOM   556   N  N     . GLY A  1  73   ? 20.447  -102.212 107.591 1.00 63.90  ? 73   GLY A N     1 
ATOM   557   C  CA    . GLY A  1  73   ? 20.378  -101.342 108.744 1.00 61.99  ? 73   GLY A CA    1 
ATOM   558   C  C     . GLY A  1  73   ? 21.632  -101.505 109.573 1.00 60.74  ? 73   GLY A C     1 
ATOM   559   O  O     . GLY A  1  73   ? 22.257  -102.560 109.573 1.00 60.28  ? 73   GLY A O     1 
ATOM   560   N  N     . MET A  1  74   ? 21.977  -100.457 110.304 1.00 59.72  ? 74   MET A N     1 
ATOM   561   C  CA    . MET A  1  74   ? 23.186  -100.413 111.117 1.00 57.59  ? 74   MET A CA    1 
ATOM   562   C  C     . MET A  1  74   ? 23.779  -101.650 111.752 1.00 55.69  ? 74   MET A C     1 
ATOM   563   O  O     . MET A  1  74   ? 24.992  -101.830 111.694 1.00 55.97  ? 74   MET A O     1 
ATOM   564   C  CB    . MET A  1  74   ? 23.036  -99.336  112.167 1.00 59.02  ? 74   MET A CB    1 
ATOM   565   C  CG    . MET A  1  74   ? 23.003  -97.979  111.529 1.00 61.30  ? 74   MET A CG    1 
ATOM   566   S  SD    . MET A  1  74   ? 22.868  -96.798  112.786 1.00 63.83  ? 74   MET A SD    1 
ATOM   567   C  CE    . MET A  1  74   ? 21.121  -97.158  113.357 1.00 64.05  ? 74   MET A CE    1 
ATOM   568   N  N     . ASN A  1  75   ? 22.980  -102.494 112.386 1.00 53.30  ? 75   ASN A N     1 
ATOM   569   C  CA    . ASN A  1  75   ? 23.583  -103.679 112.971 1.00 51.23  ? 75   ASN A CA    1 
ATOM   570   C  C     . ASN A  1  75   ? 23.514  -104.771 111.941 1.00 47.54  ? 75   ASN A C     1 
ATOM   571   O  O     . ASN A  1  75   ? 22.534  -105.511 111.871 1.00 47.22  ? 75   ASN A O     1 
ATOM   572   C  CB    . ASN A  1  75   ? 22.859  -104.124 114.241 1.00 55.70  ? 75   ASN A CB    1 
ATOM   573   C  CG    . ASN A  1  75   ? 23.362  -105.472 114.755 1.00 59.24  ? 75   ASN A CG    1 
ATOM   574   O  OD1   . ASN A  1  75   ? 22.566  -106.330 115.153 1.00 61.02  ? 75   ASN A OD1   1 
ATOM   575   N  ND2   . ASN A  1  75   ? 24.687  -105.662 114.755 1.00 60.60  ? 75   ASN A ND2   1 
ATOM   576   N  N     . GLU A  1  76   ? 24.564  -104.837 111.134 1.00 44.01  ? 76   GLU A N     1 
ATOM   577   C  CA    . GLU A  1  76   ? 24.714  -105.816 110.059 1.00 40.87  ? 76   GLU A CA    1 
ATOM   578   C  C     . GLU A  1  76   ? 25.586  -105.185 108.988 1.00 36.94  ? 76   GLU A C     1 
ATOM   579   O  O     . GLU A  1  76   ? 26.479  -105.820 108.415 1.00 39.47  ? 76   GLU A O     1 
ATOM   580   C  CB    . GLU A  1  76   ? 23.368  -106.190 109.450 1.00 40.01  ? 76   GLU A CB    1 
ATOM   581   C  CG    . GLU A  1  76   ? 23.480  -107.009 108.176 1.00 40.67  ? 76   GLU A CG    1 
ATOM   582   C  CD    . GLU A  1  76   ? 24.127  -108.374 108.376 1.00 41.79  ? 76   GLU A CD    1 
ATOM   583   O  OE1   . GLU A  1  76   ? 23.494  -109.229 109.030 1.00 41.53  ? 76   GLU A OE1   1 
ATOM   584   O  OE2   . GLU A  1  76   ? 25.259  -108.595 107.875 1.00 42.38  ? 76   GLU A OE2   1 
ATOM   585   N  N     . CYS A  1  77   ? 25.317  -103.917 108.724 1.00 33.32  ? 77   CYS A N     1 
ATOM   586   C  CA    . CYS A  1  77   ? 26.083  -103.183 107.746 1.00 31.13  ? 77   CYS A CA    1 
ATOM   587   C  C     . CYS A  1  77   ? 27.449  -102.799 108.257 1.00 29.46  ? 77   CYS A C     1 
ATOM   588   O  O     . CYS A  1  77   ? 27.575  -101.942 109.122 1.00 32.40  ? 77   CYS A O     1 
ATOM   589   C  CB    . CYS A  1  77   ? 25.365  -101.908 107.356 1.00 27.91  ? 77   CYS A CB    1 
ATOM   590   S  SG    . CYS A  1  77   ? 26.195  -101.070 106.027 1.00 37.34  ? 77   CYS A SG    1 
ATOM   591   N  N     . PRO A  1  78   ? 28.501  -103.434 107.749 1.00 29.32  ? 78   PRO A N     1 
ATOM   592   C  CA    . PRO A  1  78   ? 29.809  -103.018 108.257 1.00 31.08  ? 78   PRO A CA    1 
ATOM   593   C  C     . PRO A  1  78   ? 29.967  -101.670 107.574 1.00 34.33  ? 78   PRO A C     1 
ATOM   594   O  O     . PRO A  1  78   ? 29.078  -101.268 106.826 1.00 34.71  ? 78   PRO A O     1 
ATOM   595   C  CB    . PRO A  1  78   ? 30.739  -104.064 107.676 1.00 29.46  ? 78   PRO A CB    1 
ATOM   596   C  CG    . PRO A  1  78   ? 30.116  -104.307 106.334 1.00 28.60  ? 78   PRO A CG    1 
ATOM   597   C  CD    . PRO A  1  78   ? 28.637  -104.390 106.643 1.00 28.51  ? 78   PRO A CD    1 
ATOM   598   N  N     . GLY A  1  79   ? 31.055  -100.954 107.789 1.00 34.90  ? 79   GLY A N     1 
ATOM   599   C  CA    . GLY A  1  79   ? 31.144  -99.686  107.088 1.00 37.51  ? 79   GLY A CA    1 
ATOM   600   C  C     . GLY A  1  79   ? 31.365  -99.889  105.596 1.00 39.60  ? 79   GLY A C     1 
ATOM   601   O  O     . GLY A  1  79   ? 31.489  -101.012 105.115 1.00 40.45  ? 79   GLY A O     1 
ATOM   602   N  N     . HIS A  1  80   ? 31.404  -98.804  104.842 1.00 40.51  ? 80   HIS A N     1 
ATOM   603   C  CA    . HIS A  1  80   ? 31.663  -98.905  103.416 1.00 39.66  ? 80   HIS A CA    1 
ATOM   604   C  C     . HIS A  1  80   ? 32.651  -97.831  103.113 1.00 41.07  ? 80   HIS A C     1 
ATOM   605   O  O     . HIS A  1  80   ? 32.396  -96.666  103.423 1.00 42.35  ? 80   HIS A O     1 
ATOM   606   C  CB    . HIS A  1  80   ? 30.399  -98.666  102.630 1.00 40.40  ? 80   HIS A CB    1 
ATOM   607   C  CG    . HIS A  1  80   ? 29.509  -99.857  102.585 1.00 40.47  ? 80   HIS A CG    1 
ATOM   608   N  ND1   . HIS A  1  80   ? 29.915  -101.056 102.044 1.00 40.10  ? 80   HIS A ND1   1 
ATOM   609   C  CD2   . HIS A  1  80   ? 28.248  -100.049 103.040 1.00 39.71  ? 80   HIS A CD2   1 
ATOM   610   C  CE1   . HIS A  1  80   ? 28.939  -101.936 102.170 1.00 40.32  ? 80   HIS A CE1   1 
ATOM   611   N  NE2   . HIS A  1  80   ? 27.919  -101.351 102.772 1.00 39.66  ? 80   HIS A NE2   1 
ATOM   612   N  N     . PHE A  1  81   ? 33.778  -98.192  102.515 1.00 40.60  ? 81   PHE A N     1 
ATOM   613   C  CA    . PHE A  1  81   ? 34.768  -97.168  102.235 1.00 40.15  ? 81   PHE A CA    1 
ATOM   614   C  C     . PHE A  1  81   ? 34.448  -96.213  101.084 1.00 40.42  ? 81   PHE A C     1 
ATOM   615   O  O     . PHE A  1  81   ? 33.673  -96.528  100.178 1.00 40.42  ? 81   PHE A O     1 
ATOM   616   C  CB    . PHE A  1  81   ? 36.146  -97.798  102.031 1.00 38.83  ? 81   PHE A CB    1 
ATOM   617   C  CG    . PHE A  1  81   ? 36.900  -98.011  103.310 1.00 36.78  ? 81   PHE A CG    1 
ATOM   618   C  CD1   . PHE A  1  81   ? 36.614  -99.090  104.131 1.00 37.04  ? 81   PHE A CD1   1 
ATOM   619   C  CD2   . PHE A  1  81   ? 37.888  -97.119  103.706 1.00 35.43  ? 81   PHE A CD2   1 
ATOM   620   C  CE1   . PHE A  1  81   ? 37.304  -99.284  105.331 1.00 35.56  ? 81   PHE A CE1   1 
ATOM   621   C  CE2   . PHE A  1  81   ? 38.578  -97.307  104.899 1.00 34.69  ? 81   PHE A CE2   1 
ATOM   622   C  CZ    . PHE A  1  81   ? 38.284  -98.391  105.710 1.00 34.73  ? 81   PHE A CZ    1 
ATOM   623   N  N     . GLY A  1  82   ? 35.030  -95.021  101.172 1.00 39.72  ? 82   GLY A N     1 
ATOM   624   C  CA    . GLY A  1  82   ? 34.861  -94.005  100.156 1.00 38.80  ? 82   GLY A CA    1 
ATOM   625   C  C     . GLY A  1  82   ? 36.275  -93.535  99.905  1.00 38.88  ? 82   GLY A C     1 
ATOM   626   O  O     . GLY A  1  82   ? 37.218  -94.159  100.394 1.00 38.95  ? 82   GLY A O     1 
ATOM   627   N  N     . HIS A  1  83   ? 36.451  -92.450  99.162  1.00 39.03  ? 83   HIS A N     1 
ATOM   628   C  CA    . HIS A  1  83   ? 37.801  -91.979  98.920  1.00 39.16  ? 83   HIS A CA    1 
ATOM   629   C  C     . HIS A  1  83   ? 37.908  -90.478  98.674  1.00 39.50  ? 83   HIS A C     1 
ATOM   630   O  O     . HIS A  1  83   ? 36.910  -89.755  98.651  1.00 39.22  ? 83   HIS A O     1 
ATOM   631   C  CB    . HIS A  1  83   ? 38.403  -92.725  97.743  1.00 39.10  ? 83   HIS A CB    1 
ATOM   632   C  CG    . HIS A  1  83   ? 37.866  -92.280  96.425  1.00 39.18  ? 83   HIS A CG    1 
ATOM   633   N  ND1   . HIS A  1  83   ? 38.676  -92.039  95.336  1.00 39.59  ? 83   HIS A ND1   1 
ATOM   634   C  CD2   . HIS A  1  83   ? 36.603  -91.998  96.029  1.00 38.94  ? 83   HIS A CD2   1 
ATOM   635   C  CE1   . HIS A  1  83   ? 37.935  -91.623  94.324  1.00 40.50  ? 83   HIS A CE1   1 
ATOM   636   N  NE2   . HIS A  1  83   ? 36.673  -91.589  94.719  1.00 40.66  ? 83   HIS A NE2   1 
ATOM   637   N  N     . ILE A  1  84   ? 39.147  -90.032  98.489  1.00 40.03  ? 84   ILE A N     1 
ATOM   638   C  CA    . ILE A  1  84   ? 39.481  -88.633  98.253  1.00 40.97  ? 84   ILE A CA    1 
ATOM   639   C  C     . ILE A  1  84   ? 40.674  -88.572  97.302  1.00 43.72  ? 84   ILE A C     1 
ATOM   640   O  O     . ILE A  1  84   ? 41.778  -88.965  97.678  1.00 44.50  ? 84   ILE A O     1 
ATOM   641   C  CB    . ILE A  1  84   ? 39.894  -87.939  99.574  1.00 38.72  ? 84   ILE A CB    1 
ATOM   642   C  CG1   . ILE A  1  84   ? 38.660  -87.522  100.364 1.00 37.79  ? 84   ILE A CG1   1 
ATOM   643   C  CG2   . ILE A  1  84   ? 40.783  -86.752  99.289  1.00 37.25  ? 84   ILE A CG2   1 
ATOM   644   C  CD1   . ILE A  1  84   ? 38.991  -87.058  101.754 1.00 36.14  ? 84   ILE A CD1   1 
ATOM   645   N  N     . ASP A  1  85   ? 40.468  -88.105  96.072  1.00 45.69  ? 85   ASP A N     1 
ATOM   646   C  CA    . ASP A  1  85   ? 41.590  -87.991  95.148  1.00 47.87  ? 85   ASP A CA    1 
ATOM   647   C  C     . ASP A  1  85   ? 42.334  -86.770  95.706  1.00 48.97  ? 85   ASP A C     1 
ATOM   648   O  O     . ASP A  1  85   ? 41.784  -85.667  95.721  1.00 50.54  ? 85   ASP A O     1 
ATOM   649   C  CB    . ASP A  1  85   ? 41.111  -87.694  93.708  1.00 51.13  ? 85   ASP A CB    1 
ATOM   650   C  CG    . ASP A  1  85   ? 40.179  -88.781  93.123  1.00 53.09  ? 85   ASP A CG    1 
ATOM   651   O  OD1   . ASP A  1  85   ? 40.619  -89.939  92.946  1.00 54.13  ? 85   ASP A OD1   1 
ATOM   652   O  OD2   . ASP A  1  85   ? 39.001  -88.465  92.821  1.00 53.32  ? 85   ASP A OD2   1 
ATOM   653   N  N     . LEU A  1  86   ? 43.561  -86.948  96.190  1.00 48.92  ? 86   LEU A N     1 
ATOM   654   C  CA    . LEU A  1  86   ? 44.300  -85.808  96.741  1.00 48.82  ? 86   LEU A CA    1 
ATOM   655   C  C     . LEU A  1  86   ? 44.768  -84.865  95.645  1.00 49.80  ? 86   LEU A C     1 
ATOM   656   O  O     . LEU A  1  86   ? 44.713  -85.195  94.462  1.00 50.66  ? 86   LEU A O     1 
ATOM   657   C  CB    . LEU A  1  86   ? 45.507  -86.277  97.556  1.00 46.32  ? 86   LEU A CB    1 
ATOM   658   C  CG    . LEU A  1  86   ? 45.188  -87.072  98.823  1.00 44.81  ? 86   LEU A CG    1 
ATOM   659   C  CD1   . LEU A  1  86   ? 46.487  -87.474  99.503  1.00 43.49  ? 86   LEU A CD1   1 
ATOM   660   C  CD2   . LEU A  1  86   ? 44.317  -86.247  99.746  1.00 42.36  ? 86   LEU A CD2   1 
ATOM   661   N  N     . ALA A  1  87   ? 45.222  -83.682  96.039  1.00 50.97  ? 87   ALA A N     1 
ATOM   662   C  CA    . ALA A  1  87   ? 45.699  -82.706  95.070  1.00 50.96  ? 87   ALA A CA    1 
ATOM   663   C  C     . ALA A  1  87   ? 47.127  -83.040  94.651  1.00 50.46  ? 87   ALA A C     1 
ATOM   664   O  O     . ALA A  1  87   ? 47.477  -82.932  93.483  1.00 51.62  ? 87   ALA A O     1 
ATOM   665   C  CB    . ALA A  1  87   ? 45.638  -81.305  95.659  1.00 51.72  ? 87   ALA A CB    1 
ATOM   666   N  N     . LYS A  1  88   ? 47.957  -83.447  95.600  1.00 49.36  ? 88   LYS A N     1 
ATOM   667   C  CA    . LYS A  1  88   ? 49.330  -83.790  95.272  1.00 48.44  ? 88   LYS A CA    1 
ATOM   668   C  C     . LYS A  1  88   ? 49.833  -84.885  96.188  1.00 47.12  ? 88   LYS A C     1 
ATOM   669   O  O     . LYS A  1  88   ? 49.516  -84.919  97.372  1.00 46.85  ? 88   LYS A O     1 
ATOM   670   C  CB    . LYS A  1  88   ? 50.240  -82.563  95.378  1.00 49.86  ? 88   LYS A CB    1 
ATOM   671   C  CG    . LYS A  1  88   ? 49.846  -81.404  94.459  1.00 52.88  ? 88   LYS A CG    1 
ATOM   672   C  CD    . LYS A  1  88   ? 50.996  -80.403  94.226  1.00 55.55  ? 88   LYS A CD    1 
ATOM   673   C  CE    . LYS A  1  88   ? 52.085  -80.972  93.294  1.00 56.78  ? 88   LYS A CE    1 
ATOM   674   N  NZ    . LYS A  1  88   ? 53.260  -80.058  93.090  1.00 56.26  ? 88   LYS A NZ    1 
ATOM   675   N  N     . PRO A  1  89   ? 50.633  -85.803  95.647  1.00 46.05  ? 89   PRO A N     1 
ATOM   676   C  CA    . PRO A  1  89   ? 51.150  -86.890  96.472  1.00 44.88  ? 89   PRO A CA    1 
ATOM   677   C  C     . PRO A  1  89   ? 51.798  -86.387  97.743  1.00 43.68  ? 89   PRO A C     1 
ATOM   678   O  O     . PRO A  1  89   ? 52.539  -85.414  97.727  1.00 42.27  ? 89   PRO A O     1 
ATOM   679   C  CB    . PRO A  1  89   ? 52.133  -87.588  95.542  1.00 45.52  ? 89   PRO A CB    1 
ATOM   680   C  CG    . PRO A  1  89   ? 52.597  -86.476  94.653  1.00 45.77  ? 89   PRO A CG    1 
ATOM   681   C  CD    . PRO A  1  89   ? 51.303  -85.774  94.340  1.00 46.15  ? 89   PRO A CD    1 
ATOM   682   N  N     . VAL A  1  90   ? 51.493  -87.064  98.842  1.00 43.86  ? 90   VAL A N     1 
ATOM   683   C  CA    . VAL A  1  90   ? 52.030  -86.731  100.156 1.00 44.57  ? 90   VAL A CA    1 
ATOM   684   C  C     . VAL A  1  90   ? 52.586  -87.987  100.799 1.00 44.38  ? 90   VAL A C     1 
ATOM   685   O  O     . VAL A  1  90   ? 52.166  -89.095  100.471 1.00 44.94  ? 90   VAL A O     1 
ATOM   686   C  CB    . VAL A  1  90   ? 50.946  -86.177  101.068 1.00 45.16  ? 90   VAL A CB    1 
ATOM   687   C  CG1   . VAL A  1  90   ? 50.631  -84.755  100.686 1.00 46.39  ? 90   VAL A CG1   1 
ATOM   688   C  CG2   . VAL A  1  90   ? 49.699  -87.025  100.956 1.00 46.96  ? 90   VAL A CG2   1 
ATOM   689   N  N     . PHE A  1  91   ? 53.529  -87.830  101.714 1.00 43.85  ? 91   PHE A N     1 
ATOM   690   C  CA    . PHE A  1  91   ? 54.099  -89.003  102.352 1.00 44.91  ? 91   PHE A CA    1 
ATOM   691   C  C     . PHE A  1  91   ? 53.072  -89.626  103.269 1.00 44.72  ? 91   PHE A C     1 
ATOM   692   O  O     . PHE A  1  91   ? 52.007  -89.057  103.485 1.00 46.53  ? 91   PHE A O     1 
ATOM   693   C  CB    . PHE A  1  91   ? 55.334  -88.642  103.179 1.00 45.97  ? 91   PHE A CB    1 
ATOM   694   C  CG    . PHE A  1  91   ? 56.514  -88.217  102.361 1.00 47.27  ? 91   PHE A CG    1 
ATOM   695   C  CD1   . PHE A  1  91   ? 56.590  -88.523  101.005 1.00 47.83  ? 91   PHE A CD1   1 
ATOM   696   C  CD2   . PHE A  1  91   ? 57.568  -87.537  102.954 1.00 47.21  ? 91   PHE A CD2   1 
ATOM   697   C  CE1   . PHE A  1  91   ? 57.702  -88.156  100.252 1.00 48.20  ? 91   PHE A CE1   1 
ATOM   698   C  CE2   . PHE A  1  91   ? 58.684  -87.167  102.211 1.00 47.89  ? 91   PHE A CE2   1 
ATOM   699   C  CZ    . PHE A  1  91   ? 58.753  -87.478  100.857 1.00 48.15  ? 91   PHE A CZ    1 
ATOM   700   N  N     . HIS A  1  92   ? 53.395  -90.802  103.792 1.00 43.11  ? 92   HIS A N     1 
ATOM   701   C  CA    . HIS A  1  92   ? 52.538  -91.494  104.734 1.00 41.60  ? 92   HIS A CA    1 
ATOM   702   C  C     . HIS A  1  92   ? 53.344  -91.356  106.009 1.00 39.97  ? 92   HIS A C     1 
ATOM   703   O  O     . HIS A  1  92   ? 54.383  -91.981  106.147 1.00 38.98  ? 92   HIS A O     1 
ATOM   704   C  CB    . HIS A  1  92   ? 52.392  -92.970  104.354 1.00 43.41  ? 92   HIS A CB    1 
ATOM   705   C  CG    . HIS A  1  92   ? 51.565  -93.764  105.320 1.00 44.74  ? 92   HIS A CG    1 
ATOM   706   N  ND1   . HIS A  1  92   ? 51.940  -93.967  106.632 1.00 44.65  ? 92   HIS A ND1   1 
ATOM   707   C  CD2   . HIS A  1  92   ? 50.367  -94.377  105.173 1.00 44.67  ? 92   HIS A CD2   1 
ATOM   708   C  CE1   . HIS A  1  92   ? 51.008  -94.668  107.252 1.00 44.03  ? 92   HIS A CE1   1 
ATOM   709   N  NE2   . HIS A  1  92   ? 50.041  -94.929  106.389 1.00 44.91  ? 92   HIS A NE2   1 
ATOM   710   N  N     . VAL A  1  93   ? 52.881  -90.510  106.919 1.00 38.96  ? 93   VAL A N     1 
ATOM   711   C  CA    . VAL A  1  93   ? 53.583  -90.269  108.178 1.00 38.93  ? 93   VAL A CA    1 
ATOM   712   C  C     . VAL A  1  93   ? 54.417  -91.442  108.660 1.00 38.66  ? 93   VAL A C     1 
ATOM   713   O  O     . VAL A  1  93   ? 55.560  -91.267  109.064 1.00 37.58  ? 93   VAL A O     1 
ATOM   714   C  CB    . VAL A  1  93   ? 52.605  -89.928  109.325 1.00 39.28  ? 93   VAL A CB    1 
ATOM   715   C  CG1   . VAL A  1  93   ? 52.974  -88.598  109.945 1.00 38.99  ? 93   VAL A CG1   1 
ATOM   716   C  CG2   . VAL A  1  93   ? 51.181  -89.910  108.810 1.00 40.50  ? 93   VAL A CG2   1 
ATOM   717   N  N     . GLY A  1  94   ? 53.833  -92.637  108.602 1.00 39.19  ? 94   GLY A N     1 
ATOM   718   C  CA    . GLY A  1  94   ? 54.493  -93.837  109.090 1.00 39.98  ? 94   GLY A CA    1 
ATOM   719   C  C     . GLY A  1  94   ? 55.599  -94.455  108.271 1.00 41.18  ? 94   GLY A C     1 
ATOM   720   O  O     . GLY A  1  94   ? 56.343  -95.292  108.778 1.00 40.79  ? 94   GLY A O     1 
ATOM   721   N  N     . PHE A  1  95   ? 55.721  -94.044  107.014 1.00 42.83  ? 95   PHE A N     1 
ATOM   722   C  CA    . PHE A  1  95   ? 56.743  -94.593  106.129 1.00 43.57  ? 95   PHE A CA    1 
ATOM   723   C  C     . PHE A  1  95   ? 57.902  -93.663  105.839 1.00 44.07  ? 95   PHE A C     1 
ATOM   724   O  O     . PHE A  1  95   ? 58.951  -94.111  105.405 1.00 45.08  ? 95   PHE A O     1 
ATOM   725   C  CB    . PHE A  1  95   ? 56.097  -95.031  104.821 1.00 42.97  ? 95   PHE A CB    1 
ATOM   726   C  CG    . PHE A  1  95   ? 55.155  -96.170  104.988 1.00 42.89  ? 95   PHE A CG    1 
ATOM   727   C  CD1   . PHE A  1  95   ? 53.978  -96.226  104.266 1.00 43.20  ? 95   PHE A CD1   1 
ATOM   728   C  CD2   . PHE A  1  95   ? 55.438  -97.184  105.895 1.00 42.35  ? 95   PHE A CD2   1 
ATOM   729   C  CE1   . PHE A  1  95   ? 53.095  -97.278  104.451 1.00 44.26  ? 95   PHE A CE1   1 
ATOM   730   C  CE2   . PHE A  1  95   ? 54.559  -98.243  106.088 1.00 42.25  ? 95   PHE A CE2   1 
ATOM   731   C  CZ    . PHE A  1  95   ? 53.388  -98.294  105.370 1.00 43.22  ? 95   PHE A CZ    1 
ATOM   732   N  N     . ILE A  1  96   ? 57.708  -92.371  106.072 1.00 44.59  ? 96   ILE A N     1 
ATOM   733   C  CA    . ILE A  1  96   ? 58.754  -91.380  105.842 1.00 44.44  ? 96   ILE A CA    1 
ATOM   734   C  C     . ILE A  1  96   ? 60.142  -91.994  106.025 1.00 44.76  ? 96   ILE A C     1 
ATOM   735   O  O     . ILE A  1  96   ? 60.974  -91.943  105.118 1.00 44.93  ? 96   ILE A O     1 
ATOM   736   C  CB    . ILE A  1  96   ? 58.564  -90.175  106.800 1.00 43.78  ? 96   ILE A CB    1 
ATOM   737   C  CG1   . ILE A  1  96   ? 57.558  -89.195  106.195 1.00 42.43  ? 96   ILE A CG1   1 
ATOM   738   C  CG2   . ILE A  1  96   ? 59.893  -89.515  107.113 1.00 42.39  ? 96   ILE A CG2   1 
ATOM   739   C  CD1   . ILE A  1  96   ? 57.123  -88.133  107.154 1.00 42.03  ? 96   ILE A CD1   1 
ATOM   740   N  N     . ALA A  1  97   ? 60.371  -92.595  107.188 1.00 44.95  ? 97   ALA A N     1 
ATOM   741   C  CA    . ALA A  1  97   ? 61.647  -93.230  107.493 1.00 45.40  ? 97   ALA A CA    1 
ATOM   742   C  C     . ALA A  1  97   ? 62.098  -94.190  106.399 1.00 45.53  ? 97   ALA A C     1 
ATOM   743   O  O     . ALA A  1  97   ? 63.219  -94.091  105.915 1.00 45.27  ? 97   ALA A O     1 
ATOM   744   C  CB    . ALA A  1  97   ? 61.551  -93.972  108.811 1.00 46.27  ? 97   ALA A CB    1 
ATOM   745   N  N     . LYS A  1  98   ? 61.233  -95.129  106.023 1.00 46.72  ? 98   LYS A N     1 
ATOM   746   C  CA    . LYS A  1  98   ? 61.574  -96.091  104.977 1.00 48.31  ? 98   LYS A CA    1 
ATOM   747   C  C     . LYS A  1  98   ? 61.695  -95.382  103.631 1.00 48.82  ? 98   LYS A C     1 
ATOM   748   O  O     . LYS A  1  98   ? 62.648  -95.613  102.889 1.00 49.11  ? 98   LYS A O     1 
ATOM   749   C  CB    . LYS A  1  98   ? 60.528  -97.212  104.880 1.00 48.74  ? 98   LYS A CB    1 
ATOM   750   C  CG    . LYS A  1  98   ? 61.137  -98.526  104.409 1.00 49.93  ? 98   LYS A CG    1 
ATOM   751   C  CD    . LYS A  1  98   ? 60.165  -99.679  104.422 1.00 51.69  ? 98   LYS A CD    1 
ATOM   752   C  CE    . LYS A  1  98   ? 60.924  -101.006 104.486 1.00 53.14  ? 98   LYS A CE    1 
ATOM   753   N  NZ    . LYS A  1  98   ? 60.026  -102.194 104.347 1.00 53.72  ? 98   LYS A NZ    1 
ATOM   754   N  N     . ILE A  1  99   ? 60.722  -94.526  103.319 1.00 49.20  ? 99   ILE A N     1 
ATOM   755   C  CA    . ILE A  1  99   ? 60.735  -93.764  102.079 1.00 48.01  ? 99   ILE A CA    1 
ATOM   756   C  C     . ILE A  1  99   ? 62.127  -93.180  101.915 1.00 48.83  ? 99   ILE A C     1 
ATOM   757   O  O     . ILE A  1  99   ? 62.753  -93.318  100.860 1.00 49.85  ? 99   ILE A O     1 
ATOM   758   C  CB    . ILE A  1  99   ? 59.716  -92.624  102.123 1.00 46.20  ? 99   ILE A CB    1 
ATOM   759   C  CG1   . ILE A  1  99   ? 58.302  -93.188  102.004 1.00 45.48  ? 99   ILE A CG1   1 
ATOM   760   C  CG2   . ILE A  1  99   ? 60.008  -91.637  101.028 1.00 47.88  ? 99   ILE A CG2   1 
ATOM   761   C  CD1   . ILE A  1  99   ? 57.269  -92.184  101.531 1.00 44.06  ? 99   ILE A CD1   1 
ATOM   762   N  N     . LYS A  1  100  ? 62.608  -92.532  102.971 1.00 48.73  ? 100  LYS A N     1 
ATOM   763   C  CA    . LYS A  1  100  ? 63.945  -91.954  102.974 1.00 49.06  ? 100  LYS A CA    1 
ATOM   764   C  C     . LYS A  1  100  ? 65.004  -93.033  102.747 1.00 49.00  ? 100  LYS A C     1 
ATOM   765   O  O     . LYS A  1  100  ? 65.776  -92.948  101.799 1.00 49.77  ? 100  LYS A O     1 
ATOM   766   C  CB    . LYS A  1  100  ? 64.227  -91.255  104.305 1.00 49.35  ? 100  LYS A CB    1 
ATOM   767   C  CG    . LYS A  1  100  ? 65.649  -90.771  104.423 1.00 48.71  ? 100  LYS A CG    1 
ATOM   768   C  CD    . LYS A  1  100  ? 65.919  -90.039  105.701 1.00 48.43  ? 100  LYS A CD    1 
ATOM   769   C  CE    . LYS A  1  100  ? 67.324  -89.502  105.653 1.00 49.85  ? 100  LYS A CE    1 
ATOM   770   N  NZ    . LYS A  1  100  ? 67.802  -89.063  106.983 1.00 53.30  ? 100  LYS A NZ    1 
ATOM   771   N  N     . LYS A  1  101  ? 65.047  -94.042  103.614 1.00 49.16  ? 101  LYS A N     1 
ATOM   772   C  CA    . LYS A  1  101  ? 66.025  -95.115  103.466 1.00 49.77  ? 101  LYS A CA    1 
ATOM   773   C  C     . LYS A  1  101  ? 66.001  -95.786  102.098 1.00 50.86  ? 101  LYS A C     1 
ATOM   774   O  O     . LYS A  1  101  ? 67.020  -96.308  101.663 1.00 51.17  ? 101  LYS A O     1 
ATOM   775   C  CB    . LYS A  1  101  ? 65.850  -96.184  104.549 1.00 49.06  ? 101  LYS A CB    1 
ATOM   776   C  CG    . LYS A  1  101  ? 66.487  -95.830  105.875 1.00 48.50  ? 101  LYS A CG    1 
ATOM   777   C  CD    . LYS A  1  101  ? 66.570  -97.025  106.805 1.00 47.75  ? 101  LYS A CD    1 
ATOM   778   C  CE    . LYS A  1  101  ? 67.362  -96.651  108.050 1.00 49.73  ? 101  LYS A CE    1 
ATOM   779   N  NZ    . LYS A  1  101  ? 67.572  -97.766  109.020 1.00 50.19  ? 101  LYS A NZ    1 
ATOM   780   N  N     . VAL A  1  102  ? 64.857  -95.793  101.417 1.00 52.53  ? 102  VAL A N     1 
ATOM   781   C  CA    . VAL A  1  102  ? 64.809  -96.412  100.096 1.00 54.20  ? 102  VAL A CA    1 
ATOM   782   C  C     . VAL A  1  102  ? 65.515  -95.503  99.101  1.00 56.35  ? 102  VAL A C     1 
ATOM   783   O  O     . VAL A  1  102  ? 66.177  -95.988  98.190  1.00 57.62  ? 102  VAL A O     1 
ATOM   784   C  CB    . VAL A  1  102  ? 63.364  -96.675  99.592  1.00 53.59  ? 102  VAL A CB    1 
ATOM   785   C  CG1   . VAL A  1  102  ? 63.409  -97.298  98.193  1.00 52.36  ? 102  VAL A CG1   1 
ATOM   786   C  CG2   . VAL A  1  102  ? 62.644  -97.624  100.529 1.00 53.17  ? 102  VAL A CG2   1 
ATOM   787   N  N     . CYS A  1  103  ? 65.379  -94.189  99.272  1.00 58.16  ? 103  CYS A N     1 
ATOM   788   C  CA    . CYS A  1  103  ? 66.046  -93.235  98.381  1.00 59.99  ? 103  CYS A CA    1 
ATOM   789   C  C     . CYS A  1  103  ? 67.550  -93.418  98.497  1.00 61.13  ? 103  CYS A C     1 
ATOM   790   O  O     . CYS A  1  103  ? 68.270  -93.463  97.503  1.00 61.79  ? 103  CYS A O     1 
ATOM   791   C  CB    . CYS A  1  103  ? 65.709  -91.791  98.760  1.00 59.53  ? 103  CYS A CB    1 
ATOM   792   S  SG    . CYS A  1  103  ? 63.990  -91.328  98.560  1.00 60.43  ? 103  CYS A SG    1 
ATOM   793   N  N     . GLU A  1  104  ? 68.015  -93.523  99.731  1.00 62.77  ? 104  GLU A N     1 
ATOM   794   C  CA    . GLU A  1  104  ? 69.425  -93.695  100.004 1.00 65.80  ? 104  GLU A CA    1 
ATOM   795   C  C     . GLU A  1  104  ? 69.965  -95.031  99.467  1.00 68.73  ? 104  GLU A C     1 
ATOM   796   O  O     . GLU A  1  104  ? 71.159  -95.317  99.601  1.00 70.62  ? 104  GLU A O     1 
ATOM   797   C  CB    . GLU A  1  104  ? 69.643  -93.579  101.511 1.00 64.59  ? 104  GLU A CB    1 
ATOM   798   C  CG    . GLU A  1  104  ? 68.872  -92.414  102.115 1.00 64.46  ? 104  GLU A CG    1 
ATOM   799   C  CD    . GLU A  1  104  ? 69.040  -92.294  103.623 1.00 65.59  ? 104  GLU A CD    1 
ATOM   800   O  OE1   . GLU A  1  104  ? 68.824  -93.301  104.335 1.00 65.45  ? 104  GLU A OE1   1 
ATOM   801   O  OE2   . GLU A  1  104  ? 69.377  -91.185  104.100 1.00 65.73  ? 104  GLU A OE2   1 
ATOM   802   N  N     . CYS A  1  105  ? 69.092  -95.833  98.850  1.00 70.49  ? 105  CYS A N     1 
ATOM   803   C  CA    . CYS A  1  105  ? 69.468  -97.141  98.290  1.00 71.91  ? 105  CYS A CA    1 
ATOM   804   C  C     . CYS A  1  105  ? 69.381  -97.160  96.766  1.00 72.84  ? 105  CYS A C     1 
ATOM   805   O  O     . CYS A  1  105  ? 70.040  -97.956  96.094  1.00 72.89  ? 105  CYS A O     1 
ATOM   806   C  CB    . CYS A  1  105  ? 68.559  -98.250  98.847  1.00 71.57  ? 105  CYS A CB    1 
ATOM   807   S  SG    . CYS A  1  105  ? 68.938  -98.824  100.532 1.00 72.21  ? 105  CYS A SG    1 
ATOM   808   N  N     . VAL A  1  106  ? 68.542  -96.287  96.229  1.00 74.15  ? 106  VAL A N     1 
ATOM   809   C  CA    . VAL A  1  106  ? 68.357  -96.192  94.795  1.00 75.88  ? 106  VAL A CA    1 
ATOM   810   C  C     . VAL A  1  106  ? 68.976  -94.884  94.342  1.00 77.85  ? 106  VAL A C     1 
ATOM   811   O  O     . VAL A  1  106  ? 69.316  -94.027  95.162  1.00 77.46  ? 106  VAL A O     1 
ATOM   812   C  CB    . VAL A  1  106  ? 66.860  -96.154  94.416  1.00 75.47  ? 106  VAL A CB    1 
ATOM   813   C  CG1   . VAL A  1  106  ? 66.693  -96.310  92.912  1.00 75.32  ? 106  VAL A CG1   1 
ATOM   814   C  CG2   . VAL A  1  106  ? 66.105  -97.227  95.159  1.00 75.74  ? 106  VAL A CG2   1 
ATOM   815   N  N     . CYS A  1  107  ? 69.118  -94.738  93.031  1.00 80.43  ? 107  CYS A N     1 
ATOM   816   C  CA    . CYS A  1  107  ? 69.672  -93.525  92.454  1.00 82.13  ? 107  CYS A CA    1 
ATOM   817   C  C     . CYS A  1  107  ? 68.526  -92.688  91.948  1.00 82.35  ? 107  CYS A C     1 
ATOM   818   O  O     . CYS A  1  107  ? 67.701  -93.173  91.172  1.00 82.29  ? 107  CYS A O     1 
ATOM   819   C  CB    . CYS A  1  107  ? 70.605  -93.845  91.278  1.00 83.58  ? 107  CYS A CB    1 
ATOM   820   S  SG    . CYS A  1  107  ? 71.272  -92.373  90.411  1.00 85.98  ? 107  CYS A SG    1 
ATOM   821   N  N     . MET A  1  108  ? 68.461  -91.438  92.391  1.00 82.77  ? 108  MET A N     1 
ATOM   822   C  CA    . MET A  1  108  ? 67.408  -90.563  91.918  1.00 83.36  ? 108  MET A CA    1 
ATOM   823   C  C     . MET A  1  108  ? 67.674  -90.432  90.419  1.00 84.55  ? 108  MET A C     1 
ATOM   824   O  O     . MET A  1  108  ? 68.658  -90.974  89.902  1.00 84.69  ? 108  MET A O     1 
ATOM   825   C  CB    . MET A  1  108  ? 67.484  -89.202  92.616  1.00 82.29  ? 108  MET A CB    1 
ATOM   826   C  CG    . MET A  1  108  ? 67.664  -89.286  94.144  1.00 82.46  ? 108  MET A CG    1 
ATOM   827   S  SD    . MET A  1  108  ? 66.593  -90.466  95.062  1.00 82.39  ? 108  MET A SD    1 
ATOM   828   C  CE    . MET A  1  108  ? 65.388  -89.396  95.823  1.00 80.43  ? 108  MET A CE    1 
ATOM   829   N  N     . HIS A  1  109  ? 66.800  -89.741  89.709  1.00 85.52  ? 109  HIS A N     1 
ATOM   830   C  CA    . HIS A  1  109  ? 66.980  -89.576  88.271  1.00 86.47  ? 109  HIS A CA    1 
ATOM   831   C  C     . HIS A  1  109  ? 66.809  -90.854  87.419  1.00 85.52  ? 109  HIS A C     1 
ATOM   832   O  O     . HIS A  1  109  ? 66.120  -90.807  86.391  1.00 86.21  ? 109  HIS A O     1 
ATOM   833   C  CB    . HIS A  1  109  ? 68.345  -88.940  87.973  1.00 88.17  ? 109  HIS A CB    1 
ATOM   834   C  CG    . HIS A  1  109  ? 68.551  -88.631  86.524  1.00 90.54  ? 109  HIS A CG    1 
ATOM   835   N  ND1   . HIS A  1  109  ? 68.769  -89.611  85.578  1.00 91.67  ? 109  HIS A ND1   1 
ATOM   836   C  CD2   . HIS A  1  109  ? 68.506  -87.460  85.846  1.00 91.41  ? 109  HIS A CD2   1 
ATOM   837   C  CE1   . HIS A  1  109  ? 68.846  -89.058  84.381  1.00 92.02  ? 109  HIS A CE1   1 
ATOM   838   N  NE2   . HIS A  1  109  ? 68.689  -87.753  84.515  1.00 92.48  ? 109  HIS A NE2   1 
ATOM   839   N  N     . CYS A  1  110  ? 67.417  -91.979  87.809  1.00 83.22  ? 110  CYS A N     1 
ATOM   840   C  CA    . CYS A  1  110  ? 67.260  -93.205  87.011  1.00 81.84  ? 110  CYS A CA    1 
ATOM   841   C  C     . CYS A  1  110  ? 66.507  -94.352  87.713  1.00 80.53  ? 110  CYS A C     1 
ATOM   842   O  O     . CYS A  1  110  ? 65.827  -95.159  87.063  1.00 79.27  ? 110  CYS A O     1 
ATOM   843   C  CB    . CYS A  1  110  ? 68.627  -93.684  86.486  1.00 82.09  ? 110  CYS A CB    1 
ATOM   844   S  SG    . CYS A  1  110  ? 69.573  -94.881  87.481  1.00 81.78  ? 110  CYS A SG    1 
ATOM   845   N  N     . GLY A  1  111  ? 66.632  -94.419  89.036  1.00 79.71  ? 111  GLY A N     1 
ATOM   846   C  CA    . GLY A  1  111  ? 65.930  -95.437  89.801  1.00 78.02  ? 111  GLY A CA    1 
ATOM   847   C  C     . GLY A  1  111  ? 66.455  -96.848  89.691  1.00 76.69  ? 111  GLY A C     1 
ATOM   848   O  O     . GLY A  1  111  ? 65.710  -97.786  89.416  1.00 76.86  ? 111  GLY A O     1 
ATOM   849   N  N     . LYS A  1  112  ? 67.744  -97.005  89.922  1.00 75.70  ? 112  LYS A N     1 
ATOM   850   C  CA    . LYS A  1  112  ? 68.360  -98.313  89.853  1.00 75.49  ? 112  LYS A CA    1 
ATOM   851   C  C     . LYS A  1  112  ? 69.176  -98.436  91.130  1.00 74.95  ? 112  LYS A C     1 
ATOM   852   O  O     . LYS A  1  112  ? 69.577  -97.427  91.711  1.00 74.73  ? 112  LYS A O     1 
ATOM   853   C  CB    . LYS A  1  112  ? 69.251  -98.387  88.608  1.00 76.35  ? 112  LYS A CB    1 
ATOM   854   C  CG    . LYS A  1  112  ? 69.985  -99.708  88.391  1.00 77.73  ? 112  LYS A CG    1 
ATOM   855   C  CD    . LYS A  1  112  ? 70.985  -99.582  87.238  1.00 77.90  ? 112  LYS A CD    1 
ATOM   856   C  CE    . LYS A  1  112  ? 71.995  -100.732 87.206  1.00 78.14  ? 112  LYS A CE    1 
ATOM   857   N  NZ    . LYS A  1  112  ? 71.386  -102.017 86.767  1.00 78.27  ? 112  LYS A NZ    1 
ATOM   858   N  N     . LEU A  1  113  ? 69.405  -99.660  91.587  1.00 74.71  ? 113  LEU A N     1 
ATOM   859   C  CA    . LEU A  1  113  ? 70.178  -99.857  92.808  1.00 74.97  ? 113  LEU A CA    1 
ATOM   860   C  C     . LEU A  1  113  ? 71.600  -99.319  92.676  1.00 75.52  ? 113  LEU A C     1 
ATOM   861   O  O     . LEU A  1  113  ? 72.188  -99.339  91.588  1.00 75.89  ? 113  LEU A O     1 
ATOM   862   C  CB    . LEU A  1  113  ? 70.223  -101.340 93.174  1.00 73.56  ? 113  LEU A CB    1 
ATOM   863   C  CG    . LEU A  1  113  ? 69.318  -101.801 94.315  1.00 71.91  ? 113  LEU A CG    1 
ATOM   864   C  CD1   . LEU A  1  113  ? 69.583  -103.272 94.578  1.00 72.03  ? 113  LEU A CD1   1 
ATOM   865   C  CD2   . LEU A  1  113  ? 69.590  -100.979 95.571  1.00 71.07  ? 113  LEU A CD2   1 
ATOM   866   N  N     . LEU A  1  114  ? 72.153  -98.852  93.791  1.00 75.62  ? 114  LEU A N     1 
ATOM   867   C  CA    . LEU A  1  114  ? 73.504  -98.299  93.799  1.00 76.17  ? 114  LEU A CA    1 
ATOM   868   C  C     . LEU A  1  114  ? 74.608  -99.342  93.981  1.00 76.80  ? 114  LEU A C     1 
ATOM   869   O  O     . LEU A  1  114  ? 75.771  -98.993  94.180  1.00 77.20  ? 114  LEU A O     1 
ATOM   870   C  CB    . LEU A  1  114  ? 73.628  -97.227  94.887  1.00 75.32  ? 114  LEU A CB    1 
ATOM   871   C  CG    . LEU A  1  114  ? 72.588  -96.106  94.848  1.00 75.18  ? 114  LEU A CG    1 
ATOM   872   C  CD1   . LEU A  1  114  ? 72.941  -95.034  95.877  1.00 74.71  ? 114  LEU A CD1   1 
ATOM   873   C  CD2   . LEU A  1  114  ? 72.534  -95.515  93.451  1.00 74.18  ? 114  LEU A CD2   1 
ATOM   874   N  N     . LEU A  1  115  ? 74.246  -100.618 93.921  1.00 77.17  ? 115  LEU A N     1 
ATOM   875   C  CA    . LEU A  1  115  ? 75.226  -101.691 94.059  1.00 78.22  ? 115  LEU A CA    1 
ATOM   876   C  C     . LEU A  1  115  ? 74.676  -102.951 93.412  1.00 79.85  ? 115  LEU A C     1 
ATOM   877   O  O     . LEU A  1  115  ? 73.552  -103.362 93.692  1.00 80.12  ? 115  LEU A O     1 
ATOM   878   C  CB    . LEU A  1  115  ? 75.552  -101.957 95.535  1.00 77.41  ? 115  LEU A CB    1 
ATOM   879   C  CG    . LEU A  1  115  ? 76.354  -100.910 96.325  1.00 76.73  ? 115  LEU A CG    1 
ATOM   880   C  CD1   . LEU A  1  115  ? 76.544  -101.384 97.764  1.00 76.51  ? 115  LEU A CD1   1 
ATOM   881   C  CD2   . LEU A  1  115  ? 77.703  -100.677 95.672  1.00 75.57  ? 115  LEU A CD2   1 
ATOM   882   N  N     . ASP A  1  116  ? 75.471  -103.552 92.534  1.00 81.51  ? 116  ASP A N     1 
ATOM   883   C  CA    . ASP A  1  116  ? 75.070  -104.760 91.831  1.00 82.65  ? 116  ASP A CA    1 
ATOM   884   C  C     . ASP A  1  116  ? 75.804  -105.945 92.409  1.00 84.10  ? 116  ASP A C     1 
ATOM   885   O  O     . ASP A  1  116  ? 76.438  -105.853 93.462  1.00 84.48  ? 116  ASP A O     1 
ATOM   886   C  CB    . ASP A  1  116  ? 75.424  -104.657 90.347  1.00 82.64  ? 116  ASP A CB    1 
ATOM   887   C  CG    . ASP A  1  116  ? 74.705  -103.527 89.653  1.00 83.63  ? 116  ASP A CG    1 
ATOM   888   O  OD1   . ASP A  1  116  ? 73.470  -103.610 89.505  1.00 84.56  ? 116  ASP A OD1   1 
ATOM   889   O  OD2   . ASP A  1  116  ? 75.372  -102.550 89.255  1.00 84.01  ? 116  ASP A OD2   1 
ATOM   890   N  N     . GLU A  1  117  ? 75.708  -107.062 91.700  1.00 85.62  ? 117  GLU A N     1 
ATOM   891   C  CA    . GLU A  1  117  ? 76.391  -108.285 92.084  1.00 86.61  ? 117  GLU A CA    1 
ATOM   892   C  C     . GLU A  1  117  ? 77.852  -107.941 91.818  1.00 86.01  ? 117  GLU A C     1 
ATOM   893   O  O     . GLU A  1  117  ? 78.775  -108.597 92.311  1.00 85.96  ? 117  GLU A O     1 
ATOM   894   C  CB    . GLU A  1  117  ? 75.948  -109.442 91.180  1.00 88.24  ? 117  GLU A CB    1 
ATOM   895   C  CG    . GLU A  1  117  ? 74.424  -109.545 90.956  1.00 90.32  ? 117  GLU A CG    1 
ATOM   896   C  CD    . GLU A  1  117  ? 73.861  -108.461 90.029  1.00 91.99  ? 117  GLU A CD    1 
ATOM   897   O  OE1   . GLU A  1  117  ? 74.355  -108.324 88.881  1.00 92.84  ? 117  GLU A OE1   1 
ATOM   898   O  OE2   . GLU A  1  117  ? 72.915  -107.752 90.448  1.00 92.34  ? 117  GLU A OE2   1 
ATOM   899   N  N     . HIS A  1  118  ? 78.035  -106.888 91.024  1.00 85.17  ? 118  HIS A N     1 
ATOM   900   C  CA    . HIS A  1  118  ? 79.353  -106.406 90.667  1.00 84.37  ? 118  HIS A CA    1 
ATOM   901   C  C     . HIS A  1  118  ? 80.117  -106.077 91.937  1.00 83.67  ? 118  HIS A C     1 
ATOM   902   O  O     . HIS A  1  118  ? 81.340  -106.205 91.985  1.00 83.69  ? 118  HIS A O     1 
ATOM   903   C  CB    . HIS A  1  118  ? 79.222  -105.219 89.714  1.00 83.14  ? 118  HIS A CB    1 
ATOM   904   C  CG    . HIS A  1  118  ? 78.611  -105.596 88.398  1.00 82.67  ? 118  HIS A CG    1 
ATOM   905   N  ND1   . HIS A  1  118  ? 79.107  -106.619 87.618  1.00 82.08  ? 118  HIS A ND1   1 
ATOM   906   C  CD2   . HIS A  1  118  ? 77.528  -105.117 87.740  1.00 83.03  ? 118  HIS A CD2   1 
ATOM   907   C  CE1   . HIS A  1  118  ? 78.357  -106.754 86.539  1.00 81.97  ? 118  HIS A CE1   1 
ATOM   908   N  NE2   . HIS A  1  118  ? 77.391  -105.855 86.588  1.00 81.97  ? 118  HIS A NE2   1 
ATOM   909   N  N     . ASN A  1  119  ? 79.408  -105.655 92.974  1.00 83.09  ? 119  ASN A N     1 
ATOM   910   C  CA    . ASN A  1  119  ? 80.094  -105.434 94.228  1.00 83.36  ? 119  ASN A CA    1 
ATOM   911   C  C     . ASN A  1  119  ? 79.856  -106.737 94.971  1.00 83.84  ? 119  ASN A C     1 
ATOM   912   O  O     . ASN A  1  119  ? 78.746  -107.266 94.968  1.00 83.26  ? 119  ASN A O     1 
ATOM   913   C  CB    . ASN A  1  119  ? 79.501  -104.289 95.031  1.00 82.65  ? 119  ASN A CB    1 
ATOM   914   C  CG    . ASN A  1  119  ? 80.211  -104.104 96.359  1.00 82.13  ? 119  ASN A CG    1 
ATOM   915   O  OD1   . ASN A  1  119  ? 80.414  -105.063 97.111  1.00 80.89  ? 119  ASN A OD1   1 
ATOM   916   N  ND2   . ASN A  1  119  ? 80.598  -102.872 96.655  1.00 82.31  ? 119  ASN A ND2   1 
ATOM   917   N  N     . GLU A  1  120  ? 80.896  -107.264 95.597  1.00 85.15  ? 120  GLU A N     1 
ATOM   918   C  CA    . GLU A  1  120  ? 80.760  -108.516 96.317  1.00 86.94  ? 120  GLU A CA    1 
ATOM   919   C  C     . GLU A  1  120  ? 80.117  -108.346 97.688  1.00 87.52  ? 120  GLU A C     1 
ATOM   920   O  O     . GLU A  1  120  ? 79.213  -109.102 98.047  1.00 87.97  ? 120  GLU A O     1 
ATOM   921   C  CB    . GLU A  1  120  ? 82.124  -109.193 96.456  1.00 88.75  ? 120  GLU A CB    1 
ATOM   922   C  CG    . GLU A  1  120  ? 82.119  -110.423 97.361  1.00 91.93  ? 120  GLU A CG    1 
ATOM   923   C  CD    . GLU A  1  120  ? 83.402  -111.235 97.254  1.00 94.12  ? 120  GLU A CD    1 
ATOM   924   O  OE1   . GLU A  1  120  ? 84.500  -110.627 97.260  1.00 94.80  ? 120  GLU A OE1   1 
ATOM   925   O  OE2   . GLU A  1  120  ? 83.310  -112.483 97.169  1.00 95.04  ? 120  GLU A OE2   1 
ATOM   926   N  N     . LEU A  1  121  ? 80.576  -107.363 98.459  1.00 86.98  ? 121  LEU A N     1 
ATOM   927   C  CA    . LEU A  1  121  ? 80.010  -107.133 99.782  1.00 86.18  ? 121  LEU A CA    1 
ATOM   928   C  C     . LEU A  1  121  ? 78.493  -106.962 99.646  1.00 86.74  ? 121  LEU A C     1 
ATOM   929   O  O     . LEU A  1  121  ? 77.735  -107.136 100.609 1.00 86.68  ? 121  LEU A O     1 
ATOM   930   C  CB    . LEU A  1  121  ? 80.637  -105.891 100.410 1.00 85.70  ? 121  LEU A CB    1 
ATOM   931   C  CG    . LEU A  1  121  ? 81.147  -106.106 101.834 1.00 85.67  ? 121  LEU A CG    1 
ATOM   932   C  CD1   . LEU A  1  121  ? 81.792  -104.832 102.340 1.00 85.62  ? 121  LEU A CD1   1 
ATOM   933   C  CD2   . LEU A  1  121  ? 79.997  -106.516 102.739 1.00 85.99  ? 121  LEU A CD2   1 
ATOM   934   N  N     . MET A  1  122  ? 78.063  -106.624 98.432  1.00 86.23  ? 122  MET A N     1 
ATOM   935   C  CA    . MET A  1  122  ? 76.649  -106.447 98.120  1.00 85.61  ? 122  MET A CA    1 
ATOM   936   C  C     . MET A  1  122  ? 76.021  -107.817 97.888  1.00 85.62  ? 122  MET A C     1 
ATOM   937   O  O     . MET A  1  122  ? 74.984  -108.141 98.466  1.00 85.68  ? 122  MET A O     1 
ATOM   938   C  CB    . MET A  1  122  ? 76.486  -105.587 96.864  1.00 85.41  ? 122  MET A CB    1 
ATOM   939   C  CG    . MET A  1  122  ? 75.049  -105.448 96.376  1.00 84.91  ? 122  MET A CG    1 
ATOM   940   S  SD    . MET A  1  122  ? 73.986  -104.498 97.483  1.00 85.39  ? 122  MET A SD    1 
ATOM   941   C  CE    . MET A  1  122  ? 72.459  -104.413 96.502  1.00 84.03  ? 122  MET A CE    1 
ATOM   942   N  N     . ARG A  1  123  ? 76.657  -108.615 97.034  1.00 85.46  ? 123  ARG A N     1 
ATOM   943   C  CA    . ARG A  1  123  ? 76.173  -109.960 96.736  1.00 85.40  ? 123  ARG A CA    1 
ATOM   944   C  C     . ARG A  1  123  ? 75.910  -110.682 98.053  1.00 84.45  ? 123  ARG A C     1 
ATOM   945   O  O     . ARG A  1  123  ? 74.887  -111.348 98.207  1.00 84.35  ? 123  ARG A O     1 
ATOM   946   C  CB    . ARG A  1  123  ? 77.222  -110.735 95.932  1.00 86.21  ? 123  ARG A CB    1 
ATOM   947   C  CG    . ARG A  1  123  ? 76.808  -111.142 94.521  1.00 86.04  ? 123  ARG A CG    1 
ATOM   948   C  CD    . ARG A  1  123  ? 77.941  -111.918 93.845  1.00 87.40  ? 123  ARG A CD    1 
ATOM   949   N  NE    . ARG A  1  123  ? 79.134  -111.097 93.607  1.00 88.39  ? 123  ARG A NE    1 
ATOM   950   C  CZ    . ARG A  1  123  ? 80.373  -111.432 93.973  1.00 88.41  ? 123  ARG A CZ    1 
ATOM   951   N  NH1   . ARG A  1  123  ? 80.603  -112.578 94.607  1.00 87.89  ? 123  ARG A NH1   1 
ATOM   952   N  NH2   . ARG A  1  123  ? 81.390  -110.623 93.692  1.00 87.67  ? 123  ARG A NH2   1 
ATOM   953   N  N     . GLN A  1  124  ? 76.842  -110.534 98.996  1.00 83.81  ? 124  GLN A N     1 
ATOM   954   C  CA    . GLN A  1  124  ? 76.741  -111.160 100.315 1.00 83.50  ? 124  GLN A CA    1 
ATOM   955   C  C     . GLN A  1  124  ? 75.430  -110.770 100.991 1.00 81.66  ? 124  GLN A C     1 
ATOM   956   O  O     . GLN A  1  124  ? 74.760  -111.599 101.616 1.00 80.99  ? 124  GLN A O     1 
ATOM   957   C  CB    . GLN A  1  124  ? 77.913  -110.726 101.197 1.00 84.70  ? 124  GLN A CB    1 
ATOM   958   C  CG    . GLN A  1  124  ? 77.976  -111.457 102.529 1.00 87.24  ? 124  GLN A CG    1 
ATOM   959   C  CD    . GLN A  1  124  ? 78.889  -110.774 103.538 1.00 88.63  ? 124  GLN A CD    1 
ATOM   960   O  OE1   . GLN A  1  124  ? 80.068  -110.533 103.269 1.00 88.96  ? 124  GLN A OE1   1 
ATOM   961   N  NE2   . GLN A  1  124  ? 78.344  -110.463 104.710 1.00 89.69  ? 124  GLN A NE2   1 
ATOM   962   N  N     . ALA A  1  125  ? 75.080  -109.495 100.872 1.00 79.58  ? 125  ALA A N     1 
ATOM   963   C  CA    . ALA A  1  125  ? 73.842  -109.008 101.442 1.00 78.06  ? 125  ALA A CA    1 
ATOM   964   C  C     . ALA A  1  125  ? 72.680  -109.580 100.617 1.00 77.27  ? 125  ALA A C     1 
ATOM   965   O  O     . ALA A  1  125  ? 71.774  -110.215 101.160 1.00 77.45  ? 125  ALA A O     1 
ATOM   966   C  CB    . ALA A  1  125  ? 73.827  -107.485 101.414 1.00 77.65  ? 125  ALA A CB    1 
ATOM   967   N  N     . LEU A  1  126  ? 72.731  -109.375 99.301  1.00 75.74  ? 126  LEU A N     1 
ATOM   968   C  CA    . LEU A  1  126  ? 71.696  -109.850 98.383  1.00 74.05  ? 126  LEU A CA    1 
ATOM   969   C  C     . LEU A  1  126  ? 71.340  -111.319 98.538  1.00 73.87  ? 126  LEU A C     1 
ATOM   970   O  O     . LEU A  1  126  ? 70.352  -111.784 97.980  1.00 73.50  ? 126  LEU A O     1 
ATOM   971   C  CB    . LEU A  1  126  ? 72.123  -109.580 96.945  1.00 73.77  ? 126  LEU A CB    1 
ATOM   972   C  CG    . LEU A  1  126  ? 72.010  -108.104 96.563  1.00 74.14  ? 126  LEU A CG    1 
ATOM   973   C  CD1   . LEU A  1  126  ? 72.829  -107.787 95.320  1.00 74.21  ? 126  LEU A CD1   1 
ATOM   974   C  CD2   . LEU A  1  126  ? 70.540  -107.781 96.347  1.00 74.96  ? 126  LEU A CD2   1 
ATOM   975   N  N     . ALA A  1  127  ? 72.147  -112.050 99.294  1.00 73.64  ? 127  ALA A N     1 
ATOM   976   C  CA    . ALA A  1  127  ? 71.890  -113.461 99.519  1.00 73.57  ? 127  ALA A CA    1 
ATOM   977   C  C     . ALA A  1  127  ? 71.072  -113.628 100.787 1.00 74.19  ? 127  ALA A C     1 
ATOM   978   O  O     . ALA A  1  127  ? 70.255  -114.546 100.879 1.00 75.09  ? 127  ALA A O     1 
ATOM   979   C  CB    . ALA A  1  127  ? 73.186  -114.205 99.647  1.00 73.93  ? 127  ALA A CB    1 
ATOM   980   N  N     . ILE A  1  128  ? 71.306  -112.742 101.759 1.00 73.49  ? 128  ILE A N     1 
ATOM   981   C  CA    . ILE A  1  128  ? 70.594  -112.751 103.040 1.00 72.15  ? 128  ILE A CA    1 
ATOM   982   C  C     . ILE A  1  128  ? 69.096  -112.938 102.833 1.00 71.90  ? 128  ILE A C     1 
ATOM   983   O  O     . ILE A  1  128  ? 68.399  -112.003 102.428 1.00 71.65  ? 128  ILE A O     1 
ATOM   984   C  CB    . ILE A  1  128  ? 70.800  -111.421 103.808 1.00 71.26  ? 128  ILE A CB    1 
ATOM   985   C  CG1   . ILE A  1  128  ? 72.242  -111.310 104.295 1.00 71.04  ? 128  ILE A CG1   1 
ATOM   986   C  CG2   . ILE A  1  128  ? 69.829  -111.329 104.977 1.00 71.63  ? 128  ILE A CG2   1 
ATOM   987   C  CD1   . ILE A  1  128  ? 72.534  -110.005 105.000 1.00 70.59  ? 128  ILE A CD1   1 
ATOM   988   N  N     . LYS A  1  129  ? 68.605  -114.145 103.104 1.00 71.57  ? 129  LYS A N     1 
ATOM   989   C  CA    . LYS A  1  129  ? 67.185  -114.418 102.951 1.00 71.43  ? 129  LYS A CA    1 
ATOM   990   C  C     . LYS A  1  129  ? 66.482  -113.929 104.195 1.00 70.68  ? 129  LYS A C     1 
ATOM   991   O  O     . LYS A  1  129  ? 66.753  -114.399 105.297 1.00 71.74  ? 129  LYS A O     1 
ATOM   992   C  CB    . LYS A  1  129  ? 66.940  -115.910 102.737 1.00 72.25  ? 129  LYS A CB    1 
ATOM   993   C  CG    . LYS A  1  129  ? 67.343  -116.357 101.340 1.00 74.11  ? 129  LYS A CG    1 
ATOM   994   C  CD    . LYS A  1  129  ? 66.822  -117.737 100.996 1.00 75.03  ? 129  LYS A CD    1 
ATOM   995   C  CE    . LYS A  1  129  ? 67.124  -118.076 99.545  1.00 75.61  ? 129  LYS A CE    1 
ATOM   996   N  NZ    . LYS A  1  129  ? 66.508  -119.369 99.134  1.00 76.64  ? 129  LYS A NZ    1 
ATOM   997   N  N     . ASP A  1  130  ? 65.594  -112.964 104.001 1.00 68.93  ? 130  ASP A N     1 
ATOM   998   C  CA    . ASP A  1  130  ? 64.840  -112.352 105.076 1.00 67.80  ? 130  ASP A CA    1 
ATOM   999   C  C     . ASP A  1  130  ? 64.768  -110.871 104.782 1.00 66.98  ? 130  ASP A C     1 
ATOM   1000  O  O     . ASP A  1  130  ? 65.704  -110.124 105.075 1.00 66.93  ? 130  ASP A O     1 
ATOM   1001  C  CB    . ASP A  1  130  ? 65.519  -112.556 106.427 1.00 68.29  ? 130  ASP A CB    1 
ATOM   1002  C  CG    . ASP A  1  130  ? 64.879  -111.741 107.511 1.00 69.80  ? 130  ASP A CG    1 
ATOM   1003  O  OD1   . ASP A  1  130  ? 63.636  -111.827 107.668 1.00 69.89  ? 130  ASP A OD1   1 
ATOM   1004  O  OD2   . ASP A  1  130  ? 65.621  -111.012 108.203 1.00 70.61  ? 130  ASP A OD2   1 
ATOM   1005  N  N     . SER A  1  131  ? 63.655  -110.461 104.188 1.00 65.96  ? 131  SER A N     1 
ATOM   1006  C  CA    . SER A  1  131  ? 63.420  -109.068 103.833 1.00 65.25  ? 131  SER A CA    1 
ATOM   1007  C  C     . SER A  1  131  ? 64.050  -108.142 104.861 1.00 64.18  ? 131  SER A C     1 
ATOM   1008  O  O     . SER A  1  131  ? 65.049  -107.471 104.593 1.00 64.86  ? 131  SER A O     1 
ATOM   1009  C  CB    . SER A  1  131  ? 61.919  -108.813 103.779 1.00 65.87  ? 131  SER A CB    1 
ATOM   1010  O  OG    . SER A  1  131  ? 61.256  -109.970 103.297 1.00 67.75  ? 131  SER A OG    1 
ATOM   1011  N  N     . LYS A  1  132  ? 63.447  -108.134 106.043 1.00 62.41  ? 132  LYS A N     1 
ATOM   1012  C  CA    . LYS A  1  132  ? 63.880  -107.317 107.171 1.00 60.17  ? 132  LYS A CA    1 
ATOM   1013  C  C     . LYS A  1  132  ? 65.392  -107.082 107.251 1.00 58.70  ? 132  LYS A C     1 
ATOM   1014  O  O     . LYS A  1  132  ? 65.854  -105.949 107.165 1.00 57.30  ? 132  LYS A O     1 
ATOM   1015  C  CB    . LYS A  1  132  ? 63.383  -107.964 108.472 1.00 59.96  ? 132  LYS A CB    1 
ATOM   1016  C  CG    . LYS A  1  132  ? 61.879  -108.286 108.502 1.00 57.38  ? 132  LYS A CG    1 
ATOM   1017  C  CD    . LYS A  1  132  ? 61.045  -107.059 108.814 1.00 55.42  ? 132  LYS A CD    1 
ATOM   1018  C  CE    . LYS A  1  132  ? 59.566  -107.401 108.883 1.00 55.26  ? 132  LYS A CE    1 
ATOM   1019  N  NZ    . LYS A  1  132  ? 58.967  -107.723 107.558 1.00 54.98  ? 132  LYS A NZ    1 
ATOM   1020  N  N     . LYS A  1  133  ? 66.157  -108.156 107.412 1.00 58.29  ? 133  LYS A N     1 
ATOM   1021  C  CA    . LYS A  1  133  ? 67.610  -108.057 107.525 1.00 58.43  ? 133  LYS A CA    1 
ATOM   1022  C  C     . LYS A  1  133  ? 68.353  -107.788 106.220 1.00 57.31  ? 133  LYS A C     1 
ATOM   1023  O  O     . LYS A  1  133  ? 69.416  -107.164 106.223 1.00 57.10  ? 133  LYS A O     1 
ATOM   1024  C  CB    . LYS A  1  133  ? 68.161  -109.325 108.172 1.00 59.89  ? 133  LYS A CB    1 
ATOM   1025  C  CG    . LYS A  1  133  ? 67.877  -109.400 109.657 1.00 61.61  ? 133  LYS A CG    1 
ATOM   1026  C  CD    . LYS A  1  133  ? 68.189  -110.772 110.213 1.00 62.10  ? 133  LYS A CD    1 
ATOM   1027  C  CE    . LYS A  1  133  ? 67.822  -110.842 111.679 1.00 62.59  ? 133  LYS A CE    1 
ATOM   1028  N  NZ    . LYS A  1  133  ? 67.796  -112.245 112.160 1.00 63.64  ? 133  LYS A NZ    1 
ATOM   1029  N  N     . ARG A  1  134  ? 67.806  -108.276 105.114 1.00 55.40  ? 134  ARG A N     1 
ATOM   1030  C  CA    . ARG A  1  134  ? 68.422  -108.064 103.821 1.00 53.98  ? 134  ARG A CA    1 
ATOM   1031  C  C     . ARG A  1  134  ? 68.423  -106.572 103.582 1.00 54.74  ? 134  ARG A C     1 
ATOM   1032  O  O     . ARG A  1  134  ? 69.473  -105.946 103.460 1.00 55.72  ? 134  ARG A O     1 
ATOM   1033  C  CB    . ARG A  1  134  ? 67.605  -108.741 102.740 1.00 52.29  ? 134  ARG A CB    1 
ATOM   1034  C  CG    . ARG A  1  134  ? 68.176  -108.604 101.363 1.00 50.37  ? 134  ARG A CG    1 
ATOM   1035  C  CD    . ARG A  1  134  ? 67.107  -108.916 100.358 1.00 50.67  ? 134  ARG A CD    1 
ATOM   1036  N  NE    . ARG A  1  134  ? 66.462  -110.193 100.631 1.00 51.37  ? 134  ARG A NE    1 
ATOM   1037  C  CZ    . ARG A  1  134  ? 65.185  -110.453 100.356 1.00 52.42  ? 134  ARG A CZ    1 
ATOM   1038  N  NH1   . ARG A  1  134  ? 64.423  -109.520 99.804  1.00 51.48  ? 134  ARG A NH1   1 
ATOM   1039  N  NH2   . ARG A  1  134  ? 64.662  -111.642 100.637 1.00 53.37  ? 134  ARG A NH2   1 
ATOM   1040  N  N     . PHE A  1  135  ? 67.228  -106.001 103.519 1.00 55.47  ? 135  PHE A N     1 
ATOM   1041  C  CA    . PHE A  1  135  ? 67.084  -104.568 103.301 1.00 56.52  ? 135  PHE A CA    1 
ATOM   1042  C  C     . PHE A  1  135  ? 67.907  -103.797 104.331 1.00 56.97  ? 135  PHE A C     1 
ATOM   1043  O  O     . PHE A  1  135  ? 68.317  -102.664 104.096 1.00 56.86  ? 135  PHE A O     1 
ATOM   1044  C  CB    . PHE A  1  135  ? 65.614  -104.166 103.412 1.00 54.99  ? 135  PHE A CB    1 
ATOM   1045  C  CG    . PHE A  1  135  ? 65.392  -102.688 103.381 1.00 53.92  ? 135  PHE A CG    1 
ATOM   1046  C  CD1   . PHE A  1  135  ? 65.205  -102.027 102.178 1.00 53.98  ? 135  PHE A CD1   1 
ATOM   1047  C  CD2   . PHE A  1  135  ? 65.379  -101.955 104.559 1.00 52.61  ? 135  PHE A CD2   1 
ATOM   1048  C  CE1   . PHE A  1  135  ? 65.005  -100.653 102.148 1.00 53.57  ? 135  PHE A CE1   1 
ATOM   1049  C  CE2   . PHE A  1  135  ? 65.182  -100.589 104.539 1.00 52.75  ? 135  PHE A CE2   1 
ATOM   1050  C  CZ    . PHE A  1  135  ? 64.992  -99.934  103.331 1.00 52.68  ? 135  PHE A CZ    1 
ATOM   1051  N  N     . ALA A  1  136  ? 68.142  -104.424 105.476 1.00 58.13  ? 136  ALA A N     1 
ATOM   1052  C  CA    . ALA A  1  136  ? 68.913  -103.798 106.539 1.00 59.44  ? 136  ALA A CA    1 
ATOM   1053  C  C     . ALA A  1  136  ? 70.351  -103.655 106.095 1.00 60.06  ? 136  ALA A C     1 
ATOM   1054  O  O     . ALA A  1  136  ? 71.005  -102.654 106.376 1.00 60.14  ? 136  ALA A O     1 
ATOM   1055  C  CB    . ALA A  1  136  ? 68.847  -104.642 107.797 1.00 60.55  ? 136  ALA A CB    1 
ATOM   1056  N  N     . ALA A  1  137  ? 70.848  -104.677 105.414 1.00 61.08  ? 137  ALA A N     1 
ATOM   1057  C  CA    . ALA A  1  137  ? 72.216  -104.658 104.930 1.00 61.89  ? 137  ALA A CA    1 
ATOM   1058  C  C     . ALA A  1  137  ? 72.267  -103.733 103.728 1.00 62.14  ? 137  ALA A C     1 
ATOM   1059  O  O     . ALA A  1  137  ? 72.835  -102.640 103.797 1.00 61.86  ? 137  ALA A O     1 
ATOM   1060  C  CB    . ALA A  1  137  ? 72.656  -106.066 104.536 1.00 61.90  ? 137  ALA A CB    1 
ATOM   1061  N  N     . ILE A  1  138  ? 71.653  -104.184 102.636 1.00 62.22  ? 138  ILE A N     1 
ATOM   1062  C  CA    . ILE A  1  138  ? 71.599  -103.436 101.393 1.00 62.51  ? 138  ILE A CA    1 
ATOM   1063  C  C     . ILE A  1  138  ? 71.679  -101.924 101.614 1.00 64.05  ? 138  ILE A C     1 
ATOM   1064  O  O     . ILE A  1  138  ? 72.425  -101.234 100.918 1.00 64.42  ? 138  ILE A O     1 
ATOM   1065  C  CB    . ILE A  1  138  ? 70.326  -103.790 100.641 1.00 61.59  ? 138  ILE A CB    1 
ATOM   1066  C  CG1   . ILE A  1  138  ? 70.301  -105.301 100.415 1.00 60.67  ? 138  ILE A CG1   1 
ATOM   1067  C  CG2   . ILE A  1  138  ? 70.267  -103.050 99.321  1.00 62.27  ? 138  ILE A CG2   1 
ATOM   1068  C  CD1   . ILE A  1  138  ? 69.061  -105.799 99.719  1.00 60.62  ? 138  ILE A CD1   1 
ATOM   1069  N  N     . TRP A  1  139  ? 70.927  -101.416 102.589 1.00 64.89  ? 139  TRP A N     1 
ATOM   1070  C  CA    . TRP A  1  139  ? 70.937  -99.987  102.904 1.00 65.41  ? 139  TRP A CA    1 
ATOM   1071  C  C     . TRP A  1  139  ? 72.292  -99.577  103.448 1.00 66.70  ? 139  TRP A C     1 
ATOM   1072  O  O     . TRP A  1  139  ? 73.047  -98.861  102.792 1.00 67.59  ? 139  TRP A O     1 
ATOM   1073  C  CB    . TRP A  1  139  ? 69.886  -99.665  103.954 1.00 64.41  ? 139  TRP A CB    1 
ATOM   1074  C  CG    . TRP A  1  139  ? 69.846  -98.225  104.360 1.00 62.64  ? 139  TRP A CG    1 
ATOM   1075  C  CD1   . TRP A  1  139  ? 69.337  -97.187  103.638 1.00 62.61  ? 139  TRP A CD1   1 
ATOM   1076  C  CD2   . TRP A  1  139  ? 70.266  -97.674  105.614 1.00 61.53  ? 139  TRP A CD2   1 
ATOM   1077  N  NE1   . TRP A  1  139  ? 69.403  -96.024  104.366 1.00 62.69  ? 139  TRP A NE1   1 
ATOM   1078  C  CE2   . TRP A  1  139  ? 69.969  -96.294  105.584 1.00 61.73  ? 139  TRP A CE2   1 
ATOM   1079  C  CE3   . TRP A  1  139  ? 70.860  -98.213  106.761 1.00 60.65  ? 139  TRP A CE3   1 
ATOM   1080  C  CZ2   . TRP A  1  139  ? 70.243  -95.444  106.660 1.00 60.71  ? 139  TRP A CZ2   1 
ATOM   1081  C  CZ3   . TRP A  1  139  ? 71.132  -97.369  107.831 1.00 60.26  ? 139  TRP A CZ3   1 
ATOM   1082  C  CH2   . TRP A  1  139  ? 70.823  -95.999  107.771 1.00 60.51  ? 139  TRP A CH2   1 
ATOM   1083  N  N     . THR A  1  140  ? 72.592  -100.025 104.660 1.00 67.81  ? 140  THR A N     1 
ATOM   1084  C  CA    . THR A  1  140  ? 73.868  -99.701  105.279 1.00 70.04  ? 140  THR A CA    1 
ATOM   1085  C  C     . THR A  1  140  ? 74.976  -99.792  104.226 1.00 71.17  ? 140  THR A C     1 
ATOM   1086  O  O     . THR A  1  140  ? 75.901  -98.972  104.212 1.00 71.22  ? 140  THR A O     1 
ATOM   1087  C  CB    . THR A  1  140  ? 74.187  -100.669 106.448 1.00 69.88  ? 140  THR A CB    1 
ATOM   1088  O  OG1   . THR A  1  140  ? 73.139  -100.603 107.421 1.00 70.84  ? 140  THR A OG1   1 
ATOM   1089  C  CG2   . THR A  1  140  ? 75.497  -100.293 107.121 1.00 68.89  ? 140  THR A CG2   1 
ATOM   1090  N  N     . LEU A  1  141  ? 74.859  -100.773 103.331 1.00 72.00  ? 141  LEU A N     1 
ATOM   1091  C  CA    . LEU A  1  141  ? 75.851  -100.976 102.278 1.00 72.50  ? 141  LEU A CA    1 
ATOM   1092  C  C     . LEU A  1  141  ? 75.937  -99.806  101.316 1.00 73.02  ? 141  LEU A C     1 
ATOM   1093  O  O     . LEU A  1  141  ? 76.935  -99.095  101.289 1.00 73.75  ? 141  LEU A O     1 
ATOM   1094  C  CB    . LEU A  1  141  ? 75.551  -102.241 101.468 1.00 72.36  ? 141  LEU A CB    1 
ATOM   1095  C  CG    . LEU A  1  141  ? 76.700  -103.249 101.337 1.00 72.15  ? 141  LEU A CG    1 
ATOM   1096  C  CD1   . LEU A  1  141  ? 76.400  -104.202 100.199 1.00 71.18  ? 141  LEU A CD1   1 
ATOM   1097  C  CD2   . LEU A  1  141  ? 78.008  -102.530 101.083 1.00 71.97  ? 141  LEU A CD2   1 
ATOM   1098  N  N     . CYS A  1  142  ? 74.892  -99.600  100.528 1.00 73.14  ? 142  CYS A N     1 
ATOM   1099  C  CA    . CYS A  1  142  ? 74.921  -98.522  99.556  1.00 74.22  ? 142  CYS A CA    1 
ATOM   1100  C  C     . CYS A  1  142  ? 74.284  -97.195  99.957  1.00 74.75  ? 142  CYS A C     1 
ATOM   1101  O  O     . CYS A  1  142  ? 73.784  -96.458  99.098  1.00 75.04  ? 142  CYS A O     1 
ATOM   1102  C  CB    . CYS A  1  142  ? 74.316  -99.001  98.236  1.00 75.18  ? 142  CYS A CB    1 
ATOM   1103  S  SG    . CYS A  1  142  ? 72.610  -99.572  98.336  1.00 76.59  ? 142  CYS A SG    1 
ATOM   1104  N  N     . LYS A  1  143  ? 74.292  -96.878  101.247 1.00 74.55  ? 143  LYS A N     1 
ATOM   1105  C  CA    . LYS A  1  143  ? 73.730  -95.603  101.674 1.00 74.50  ? 143  LYS A CA    1 
ATOM   1106  C  C     . LYS A  1  143  ? 74.828  -94.585  101.408 1.00 75.32  ? 143  LYS A C     1 
ATOM   1107  O  O     . LYS A  1  143  ? 74.562  -93.457  100.985 1.00 74.73  ? 143  LYS A O     1 
ATOM   1108  C  CB    . LYS A  1  143  ? 73.373  -95.640  103.158 1.00 73.18  ? 143  LYS A CB    1 
ATOM   1109  C  CG    . LYS A  1  143  ? 74.481  -96.153  104.047 1.00 72.38  ? 143  LYS A CG    1 
ATOM   1110  C  CD    . LYS A  1  143  ? 74.063  -96.091  105.505 1.00 72.31  ? 143  LYS A CD    1 
ATOM   1111  C  CE    . LYS A  1  143  ? 75.141  -96.646  106.428 1.00 72.17  ? 143  LYS A CE    1 
ATOM   1112  N  NZ    . LYS A  1  143  ? 74.778  -96.516  107.873 1.00 71.63  ? 143  LYS A NZ    1 
ATOM   1113  N  N     . THR A  1  144  ? 76.064  -95.032  101.636 1.00 76.00  ? 144  THR A N     1 
ATOM   1114  C  CA    . THR A  1  144  ? 77.276  -94.243  101.442 1.00 76.23  ? 144  THR A CA    1 
ATOM   1115  C  C     . THR A  1  144  ? 77.599  -94.046  99.969  1.00 77.14  ? 144  THR A C     1 
ATOM   1116  O  O     . THR A  1  144  ? 77.985  -92.955  99.559  1.00 77.79  ? 144  THR A O     1 
ATOM   1117  C  CB    . THR A  1  144  ? 78.481  -94.928  102.091 1.00 75.78  ? 144  THR A CB    1 
ATOM   1118  O  OG1   . THR A  1  144  ? 78.386  -94.808  103.513 1.00 76.00  ? 144  THR A OG1   1 
ATOM   1119  C  CG2   . THR A  1  144  ? 79.776  -94.301  101.613 1.00 76.16  ? 144  THR A CG2   1 
ATOM   1120  N  N     . LYS A  1  145  ? 77.473  -95.109  99.182  1.00 77.97  ? 145  LYS A N     1 
ATOM   1121  C  CA    . LYS A  1  145  ? 77.738  -95.031  97.747  1.00 79.75  ? 145  LYS A CA    1 
ATOM   1122  C  C     . LYS A  1  145  ? 76.958  -93.820  97.248  1.00 80.65  ? 145  LYS A C     1 
ATOM   1123  O  O     . LYS A  1  145  ? 75.732  -93.895  97.118  1.00 81.15  ? 145  LYS A O     1 
ATOM   1124  C  CB    . LYS A  1  145  ? 77.209  -96.288  97.046  1.00 80.65  ? 145  LYS A CB    1 
ATOM   1125  C  CG    . LYS A  1  145  ? 77.964  -96.749  95.785  1.00 80.95  ? 145  LYS A CG    1 
ATOM   1126  C  CD    . LYS A  1  145  ? 78.314  -95.625  94.814  1.00 80.49  ? 145  LYS A CD    1 
ATOM   1127  C  CE    . LYS A  1  145  ? 79.604  -94.919  95.240  1.00 80.92  ? 145  LYS A CE    1 
ATOM   1128  N  NZ    . LYS A  1  145  ? 80.703  -95.884  95.571  1.00 79.28  ? 145  LYS A NZ    1 
ATOM   1129  N  N     . MET A  1  146  ? 77.647  -92.712  96.967  1.00 81.49  ? 146  MET A N     1 
ATOM   1130  C  CA    . MET A  1  146  ? 76.949  -91.507  96.523  1.00 82.45  ? 146  MET A CA    1 
ATOM   1131  C  C     . MET A  1  146  ? 77.145  -91.028  95.094  1.00 82.86  ? 146  MET A C     1 
ATOM   1132  O  O     . MET A  1  146  ? 77.200  -89.829  94.823  1.00 82.44  ? 146  MET A O     1 
ATOM   1133  C  CB    . MET A  1  146  ? 77.211  -90.374  97.510  1.00 81.81  ? 146  MET A CB    1 
ATOM   1134  C  CG    . MET A  1  146  ? 76.409  -90.570  98.775  1.00 82.71  ? 146  MET A CG    1 
ATOM   1135  S  SD    . MET A  1  146  ? 76.849  -89.512  100.146 1.00 86.13  ? 146  MET A SD    1 
ATOM   1136  C  CE    . MET A  1  146  ? 77.845  -90.651  101.201 1.00 83.97  ? 146  MET A CE    1 
ATOM   1137  N  N     . VAL A  1  147  ? 77.211  -91.991  94.183  1.00 83.86  ? 147  VAL A N     1 
ATOM   1138  C  CA    . VAL A  1  147  ? 77.347  -91.734  92.758  1.00 84.86  ? 147  VAL A CA    1 
ATOM   1139  C  C     . VAL A  1  147  ? 76.816  -92.955  92.028  1.00 85.16  ? 147  VAL A C     1 
ATOM   1140  O  O     . VAL A  1  147  ? 77.148  -94.093  92.371  1.00 84.81  ? 147  VAL A O     1 
ATOM   1141  C  CB    . VAL A  1  147  ? 78.806  -91.516  92.345  1.00 85.90  ? 147  VAL A CB    1 
ATOM   1142  C  CG1   . VAL A  1  147  ? 78.931  -91.613  90.826  1.00 86.04  ? 147  VAL A CG1   1 
ATOM   1143  C  CG2   . VAL A  1  147  ? 79.280  -90.150  92.823  1.00 87.07  ? 147  VAL A CG2   1 
ATOM   1144  N  N     . CYS A  1  148  ? 75.981  -92.716  91.028  1.00 85.63  ? 148  CYS A N     1 
ATOM   1145  C  CA    . CYS A  1  148  ? 75.399  -93.801  90.257  1.00 86.79  ? 148  CYS A CA    1 
ATOM   1146  C  C     . CYS A  1  148  ? 76.420  -94.317  89.253  1.00 89.12  ? 148  CYS A C     1 
ATOM   1147  O  O     . CYS A  1  148  ? 76.243  -94.160  88.043  1.00 89.39  ? 148  CYS A O     1 
ATOM   1148  C  CB    . CYS A  1  148  ? 74.154  -93.296  89.530  1.00 85.40  ? 148  CYS A CB    1 
ATOM   1149  S  SG    . CYS A  1  148  ? 73.219  -94.566  88.672  1.00 83.19  ? 148  CYS A SG    1 
ATOM   1150  N  N     . GLU A  1  149  ? 77.484  -94.936  89.763  1.00 91.76  ? 149  GLU A N     1 
ATOM   1151  C  CA    . GLU A  1  149  ? 78.569  -95.471  88.934  1.00 94.69  ? 149  GLU A CA    1 
ATOM   1152  C  C     . GLU A  1  149  ? 78.063  -96.149  87.662  1.00 96.23  ? 149  GLU A C     1 
ATOM   1153  O  O     . GLU A  1  149  ? 77.153  -96.983  87.715  1.00 96.58  ? 149  GLU A O     1 
ATOM   1154  C  CB    . GLU A  1  149  ? 79.394  -96.465  89.743  1.00 96.06  ? 149  GLU A CB    1 
ATOM   1155  C  CG    . GLU A  1  149  ? 79.622  -96.025  91.174  1.00 99.06  ? 149  GLU A CG    1 
ATOM   1156  C  CD    . GLU A  1  149  ? 80.377  -97.059  91.994  1.00 100.78 ? 149  GLU A CD    1 
ATOM   1157  O  OE1   . GLU A  1  149  ? 80.124  -98.276  91.819  1.00 101.32 ? 149  GLU A OE1   1 
ATOM   1158  O  OE2   . GLU A  1  149  ? 81.214  -96.649  92.828  1.00 101.62 ? 149  GLU A OE2   1 
ATOM   1159  N  N     . THR A  1  150  ? 78.660  -95.790  86.524  1.00 97.39  ? 150  THR A N     1 
ATOM   1160  C  CA    . THR A  1  150  ? 78.265  -96.353  85.233  1.00 98.10  ? 150  THR A CA    1 
ATOM   1161  C  C     . THR A  1  150  ? 79.147  -97.514  84.819  1.00 99.40  ? 150  THR A C     1 
ATOM   1162  O  O     . THR A  1  150  ? 78.790  -98.275  83.915  1.00 99.63  ? 150  THR A O     1 
ATOM   1163  C  CB    . THR A  1  150  ? 78.342  -95.309  84.113  1.00 97.25  ? 150  THR A CB    1 
ATOM   1164  O  OG1   . THR A  1  150  ? 77.550  -94.175  84.472  1.00 97.46  ? 150  THR A OG1   1 
ATOM   1165  C  CG2   . THR A  1  150  ? 77.827  -95.892  82.794  1.00 95.94  ? 150  THR A CG2   1 
ATOM   1166  N  N     . ASP A  1  151  ? 80.298  -97.648  85.474  1.00 100.65 ? 151  ASP A N     1 
ATOM   1167  C  CA    . ASP A  1  151  ? 81.224  -98.720  85.141  1.00 101.93 ? 151  ASP A CA    1 
ATOM   1168  C  C     . ASP A  1  151  ? 82.048  -99.193  86.337  1.00 102.45 ? 151  ASP A C     1 
ATOM   1169  O  O     . ASP A  1  151  ? 82.593  -98.393  87.110  1.00 101.97 ? 151  ASP A O     1 
ATOM   1170  C  CB    . ASP A  1  151  ? 82.117  -98.253  83.994  1.00 103.17 ? 151  ASP A CB    1 
ATOM   1171  C  CG    . ASP A  1  151  ? 81.307  -97.806  82.779  1.00 104.09 ? 151  ASP A CG    1 
ATOM   1172  O  OD1   . ASP A  1  151  ? 80.739  -98.677  82.089  1.00 104.71 ? 151  ASP A OD1   1 
ATOM   1173  O  OD2   . ASP A  1  151  ? 81.219  -96.584  82.523  1.00 104.57 ? 151  ASP A OD2   1 
ATOM   1174  N  N     . VAL A  1  152  ? 82.138  -100.513 86.466  1.00 103.37 ? 152  VAL A N     1 
ATOM   1175  C  CA    . VAL A  1  152  ? 82.831  -101.140 87.582  1.00 104.79 ? 152  VAL A CA    1 
ATOM   1176  C  C     . VAL A  1  152  ? 83.776  -102.278 87.171  1.00 105.30 ? 152  VAL A C     1 
ATOM   1177  O  O     . VAL A  1  152  ? 83.493  -103.029 86.234  1.00 104.22 ? 152  VAL A O     1 
ATOM   1178  C  CB    . VAL A  1  152  ? 81.775  -101.698 88.581  1.00 105.04 ? 152  VAL A CB    1 
ATOM   1179  C  CG1   . VAL A  1  152  ? 82.447  -102.373 89.761  1.00 105.70 ? 152  VAL A CG1   1 
ATOM   1180  C  CG2   . VAL A  1  152  ? 80.860  -100.571 89.049  1.00 105.00 ? 152  VAL A CG2   1 
ATOM   1181  N  N     . PRO A  1  153  ? 84.919  -102.413 87.873  1.00 106.63 ? 153  PRO A N     1 
ATOM   1182  C  CA    . PRO A  1  153  ? 85.888  -103.473 87.569  1.00 108.28 ? 153  PRO A CA    1 
ATOM   1183  C  C     . PRO A  1  153  ? 85.318  -104.870 87.837  1.00 109.99 ? 153  PRO A C     1 
ATOM   1184  O  O     . PRO A  1  153  ? 85.279  -105.311 88.991  1.00 109.91 ? 153  PRO A O     1 
ATOM   1185  C  CB    . PRO A  1  153  ? 87.067  -103.141 88.494  1.00 107.86 ? 153  PRO A CB    1 
ATOM   1186  C  CG    . PRO A  1  153  ? 86.410  -102.424 89.651  1.00 106.74 ? 153  PRO A CG    1 
ATOM   1187  C  CD    . PRO A  1  153  ? 85.436  -101.523 88.931  1.00 106.55 ? 153  PRO A CD    1 
ATOM   1188  N  N     . SER A  1  154  ? 84.881  -105.557 86.776  1.00 111.91 ? 154  SER A N     1 
ATOM   1189  C  CA    . SER A  1  154  ? 84.310  -106.908 86.896  1.00 113.71 ? 154  SER A CA    1 
ATOM   1190  C  C     . SER A  1  154  ? 85.191  -107.855 87.724  1.00 115.16 ? 154  SER A C     1 
ATOM   1191  O  O     . SER A  1  154  ? 86.300  -107.479 88.137  1.00 115.51 ? 154  SER A O     1 
ATOM   1192  C  CB    . SER A  1  154  ? 84.052  -107.510 85.501  1.00 113.20 ? 154  SER A CB    1 
ATOM   1193  O  OG    . SER A  1  154  ? 85.143  -107.301 84.617  1.00 112.08 ? 154  SER A OG    1 
ATOM   1194  N  N     . GLU A  1  155  ? 84.700  -109.074 87.974  1.00 116.69 ? 155  GLU A N     1 
ATOM   1195  C  CA    . GLU A  1  155  ? 85.461  -110.050 88.766  1.00 118.33 ? 155  GLU A CA    1 
ATOM   1196  C  C     . GLU A  1  155  ? 86.631  -110.668 87.997  1.00 119.02 ? 155  GLU A C     1 
ATOM   1197  O  O     . GLU A  1  155  ? 86.807  -111.891 87.967  1.00 119.40 ? 155  GLU A O     1 
ATOM   1198  C  CB    . GLU A  1  155  ? 84.548  -111.166 89.303  1.00 118.64 ? 155  GLU A CB    1 
ATOM   1199  C  CG    . GLU A  1  155  ? 83.605  -110.725 90.416  1.00 118.82 ? 155  GLU A CG    1 
ATOM   1200  C  CD    . GLU A  1  155  ? 82.288  -110.192 89.885  1.00 119.47 ? 155  GLU A CD    1 
ATOM   1201  O  OE1   . GLU A  1  155  ? 82.302  -109.367 88.940  1.00 119.04 ? 155  GLU A OE1   1 
ATOM   1202  O  OE2   . GLU A  1  155  ? 81.235  -110.602 90.421  1.00 119.97 ? 155  GLU A OE2   1 
ATOM   1203  N  N     . ASP A  1  156  ? 87.427  -109.796 87.382  1.00 119.69 ? 156  ASP A N     1 
ATOM   1204  C  CA    . ASP A  1  156  ? 88.606  -110.181 86.611  1.00 119.35 ? 156  ASP A CA    1 
ATOM   1205  C  C     . ASP A  1  156  ? 89.736  -109.330 87.202  1.00 119.15 ? 156  ASP A C     1 
ATOM   1206  O  O     . ASP A  1  156  ? 90.285  -109.643 88.265  1.00 119.18 ? 156  ASP A O     1 
ATOM   1207  C  CB    . ASP A  1  156  ? 88.402  -109.840 85.122  1.00 118.86 ? 156  ASP A CB    1 
ATOM   1208  C  CG    . ASP A  1  156  ? 87.102  -110.405 84.554  1.00 118.76 ? 156  ASP A CG    1 
ATOM   1209  O  OD1   . ASP A  1  156  ? 87.011  -111.640 84.375  1.00 118.83 ? 156  ASP A OD1   1 
ATOM   1210  O  OD2   . ASP A  1  156  ? 86.169  -109.613 84.290  1.00 118.43 ? 156  ASP A OD2   1 
ATOM   1211  N  N     . ASP A  1  157  ? 90.063  -108.240 86.518  1.00 118.60 ? 157  ASP A N     1 
ATOM   1212  C  CA    . ASP A  1  157  ? 91.098  -107.341 86.991  1.00 117.93 ? 157  ASP A CA    1 
ATOM   1213  C  C     . ASP A  1  157  ? 90.514  -105.952 87.187  1.00 118.03 ? 157  ASP A C     1 
ATOM   1214  O  O     . ASP A  1  157  ? 89.552  -105.566 86.515  1.00 117.74 ? 157  ASP A O     1 
ATOM   1215  C  CB    . ASP A  1  157  ? 92.278  -107.281 85.999  1.00 117.40 ? 157  ASP A CB    1 
ATOM   1216  C  CG    . ASP A  1  157  ? 91.838  -107.342 84.540  1.00 117.35 ? 157  ASP A CG    1 
ATOM   1217  O  OD1   . ASP A  1  157  ? 91.242  -108.364 84.135  1.00 117.45 ? 157  ASP A OD1   1 
ATOM   1218  O  OD2   . ASP A  1  157  ? 92.098  -106.376 83.789  1.00 116.47 ? 157  ASP A OD2   1 
ATOM   1219  N  N     . PRO A  1  158  ? 91.050  -105.199 88.157  1.00 118.27 ? 158  PRO A N     1 
ATOM   1220  C  CA    . PRO A  1  158  ? 90.532  -103.845 88.371  1.00 118.20 ? 158  PRO A CA    1 
ATOM   1221  C  C     . PRO A  1  158  ? 90.995  -102.968 87.190  1.00 118.24 ? 158  PRO A C     1 
ATOM   1222  O  O     . PRO A  1  158  ? 90.754  -101.756 87.153  1.00 118.41 ? 158  PRO A O     1 
ATOM   1223  C  CB    . PRO A  1  158  ? 91.157  -103.442 89.713  1.00 118.09 ? 158  PRO A CB    1 
ATOM   1224  C  CG    . PRO A  1  158  ? 92.417  -104.275 89.782  1.00 117.95 ? 158  PRO A CG    1 
ATOM   1225  C  CD    . PRO A  1  158  ? 91.951  -105.606 89.252  1.00 117.98 ? 158  PRO A CD    1 
ATOM   1226  N  N     . THR A  1  159  ? 91.655  -103.619 86.227  1.00 117.92 ? 159  THR A N     1 
ATOM   1227  C  CA    . THR A  1  159  ? 92.177  -102.981 85.013  1.00 117.26 ? 159  THR A CA    1 
ATOM   1228  C  C     . THR A  1  159  ? 91.054  -102.659 84.025  1.00 116.17 ? 159  THR A C     1 
ATOM   1229  O  O     . THR A  1  159  ? 90.790  -101.489 83.732  1.00 116.34 ? 159  THR A O     1 
ATOM   1230  C  CB    . THR A  1  159  ? 93.198  -103.898 84.288  1.00 117.63 ? 159  THR A CB    1 
ATOM   1231  O  OG1   . THR A  1  159  ? 94.252  -104.247 85.195  1.00 118.21 ? 159  THR A OG1   1 
ATOM   1232  C  CG2   . THR A  1  159  ? 93.784  -103.196 83.049  1.00 117.60 ? 159  THR A CG2   1 
ATOM   1233  N  N     . GLN A  1  160  ? 90.408  -103.699 83.498  1.00 114.44 ? 160  GLN A N     1 
ATOM   1234  C  CA    . GLN A  1  160  ? 89.308  -103.503 82.559  1.00 112.82 ? 160  GLN A CA    1 
ATOM   1235  C  C     . GLN A  1  160  ? 87.952  -103.390 83.283  1.00 111.08 ? 160  GLN A C     1 
ATOM   1236  O  O     . GLN A  1  160  ? 87.395  -104.380 83.779  1.00 110.53 ? 160  GLN A O     1 
ATOM   1237  C  CB    . GLN A  1  160  ? 89.292  -104.625 81.503  1.00 113.32 ? 160  GLN A CB    1 
ATOM   1238  C  CG    . GLN A  1  160  ? 90.100  -105.866 81.850  1.00 114.81 ? 160  GLN A CG    1 
ATOM   1239  C  CD    . GLN A  1  160  ? 89.305  -106.891 82.652  1.00 116.09 ? 160  GLN A CD    1 
ATOM   1240  O  OE1   . GLN A  1  160  ? 88.828  -106.612 83.758  1.00 116.59 ? 160  GLN A OE1   1 
ATOM   1241  N  NE2   . GLN A  1  160  ? 89.159  -108.090 82.092  1.00 116.31 ? 160  GLN A NE2   1 
ATOM   1242  N  N     . LEU A  1  161  ? 87.442  -102.158 83.346  1.00 109.09 ? 161  LEU A N     1 
ATOM   1243  C  CA    . LEU A  1  161  ? 86.169  -101.860 84.005  1.00 106.99 ? 161  LEU A CA    1 
ATOM   1244  C  C     . LEU A  1  161  ? 84.977  -102.074 83.060  1.00 105.44 ? 161  LEU A C     1 
ATOM   1245  O  O     . LEU A  1  161  ? 84.971  -101.569 81.928  1.00 104.53 ? 161  LEU A O     1 
ATOM   1246  C  CB    . LEU A  1  161  ? 86.165  -100.410 84.529  1.00 106.33 ? 161  LEU A CB    1 
ATOM   1247  C  CG    . LEU A  1  161  ? 87.366  -99.848  85.314  1.00 105.63 ? 161  LEU A CG    1 
ATOM   1248  C  CD1   . LEU A  1  161  ? 86.903  -98.615  86.068  1.00 105.48 ? 161  LEU A CD1   1 
ATOM   1249  C  CD2   . LEU A  1  161  ? 87.925  -100.859 86.301  1.00 105.27 ? 161  LEU A CD2   1 
ATOM   1250  N  N     . VAL A  1  162  ? 83.973  -102.817 83.536  1.00 103.90 ? 162  VAL A N     1 
ATOM   1251  C  CA    . VAL A  1  162  ? 82.779  -103.110 82.739  1.00 101.88 ? 162  VAL A CA    1 
ATOM   1252  C  C     . VAL A  1  162  ? 81.622  -102.127 82.977  1.00 100.78 ? 162  VAL A C     1 
ATOM   1253  O  O     . VAL A  1  162  ? 81.613  -101.374 83.956  1.00 99.55  ? 162  VAL A O     1 
ATOM   1254  C  CB    . VAL A  1  162  ? 82.281  -104.547 82.992  1.00 101.06 ? 162  VAL A CB    1 
ATOM   1255  C  CG1   . VAL A  1  162  ? 81.466  -105.024 81.794  1.00 99.91  ? 162  VAL A CG1   1 
ATOM   1256  C  CG2   . VAL A  1  162  ? 83.462  -105.466 83.244  1.00 99.81  ? 162  VAL A CG2   1 
ATOM   1257  N  N     . SER A  1  163  ? 80.646  -102.154 82.070  1.00 100.14 ? 163  SER A N     1 
ATOM   1258  C  CA    . SER A  1  163  ? 79.492  -101.254 82.119  1.00 100.40 ? 163  SER A CA    1 
ATOM   1259  C  C     . SER A  1  163  ? 78.174  -101.873 82.589  1.00 100.45 ? 163  SER A C     1 
ATOM   1260  O  O     . SER A  1  163  ? 77.873  -103.026 82.281  1.00 100.95 ? 163  SER A O     1 
ATOM   1261  C  CB    . SER A  1  163  ? 79.259  -100.644 80.737  1.00 100.61 ? 163  SER A CB    1 
ATOM   1262  O  OG    . SER A  1  163  ? 78.772  -101.627 79.837  1.00 100.34 ? 163  SER A OG    1 
ATOM   1263  N  N     . ARG A  1  164  ? 77.384  -101.072 83.307  1.00 99.64  ? 164  ARG A N     1 
ATOM   1264  C  CA    . ARG A  1  164  ? 76.080  -101.479 83.842  1.00 98.31  ? 164  ARG A CA    1 
ATOM   1265  C  C     . ARG A  1  164  ? 75.076  -100.371 83.522  1.00 98.46  ? 164  ARG A C     1 
ATOM   1266  O  O     . ARG A  1  164  ? 74.904  -100.000 82.358  1.00 99.19  ? 164  ARG A O     1 
ATOM   1267  C  CB    . ARG A  1  164  ? 76.177  -101.665 85.361  1.00 96.93  ? 164  ARG A CB    1 
ATOM   1268  C  CG    . ARG A  1  164  ? 76.784  -100.448 86.059  1.00 95.33  ? 164  ARG A CG    1 
ATOM   1269  C  CD    . ARG A  1  164  ? 77.042  -100.668 87.537  1.00 94.73  ? 164  ARG A CD    1 
ATOM   1270  N  NE    . ARG A  1  164  ? 76.124  -99.901  88.377  1.00 94.66  ? 164  ARG A NE    1 
ATOM   1271  C  CZ    . ARG A  1  164  ? 76.263  -99.745  89.691  1.00 94.20  ? 164  ARG A CZ    1 
ATOM   1272  N  NH1   . ARG A  1  164  ? 77.288  -100.304 90.321  1.00 93.47  ? 164  ARG A NH1   1 
ATOM   1273  N  NH2   . ARG A  1  164  ? 75.381  -99.027  90.374  1.00 93.09  ? 164  ARG A NH2   1 
ATOM   1274  N  N     . GLY A  1  165  ? 74.417  -99.848  84.556  1.00 97.89  ? 165  GLY A N     1 
ATOM   1275  C  CA    . GLY A  1  165  ? 73.461  -98.768  84.364  1.00 97.10  ? 165  GLY A CA    1 
ATOM   1276  C  C     . GLY A  1  165  ? 74.207  -97.452  84.220  1.00 97.09  ? 165  GLY A C     1 
ATOM   1277  O  O     . GLY A  1  165  ? 75.291  -97.280  84.792  1.00 97.25  ? 165  GLY A O     1 
ATOM   1278  N  N     . GLY A  1  166  ? 73.634  -96.515  83.471  1.00 96.49  ? 166  GLY A N     1 
ATOM   1279  C  CA    . GLY A  1  166  ? 74.304  -95.241  83.260  1.00 96.18  ? 166  GLY A CA    1 
ATOM   1280  C  C     . GLY A  1  166  ? 74.121  -94.136  84.290  1.00 95.63  ? 166  GLY A C     1 
ATOM   1281  O  O     . GLY A  1  166  ? 74.065  -94.385  85.496  1.00 95.18  ? 166  GLY A O     1 
ATOM   1282  N  N     . CYS A  1  167  ? 74.058  -92.902  83.785  1.00 95.52  ? 167  CYS A N     1 
ATOM   1283  C  CA    . CYS A  1  167  ? 73.882  -91.679  84.575  1.00 94.88  ? 167  CYS A CA    1 
ATOM   1284  C  C     . CYS A  1  167  ? 74.585  -91.645  85.934  1.00 93.51  ? 167  CYS A C     1 
ATOM   1285  O  O     . CYS A  1  167  ? 74.034  -92.084  86.943  1.00 93.78  ? 167  CYS A O     1 
ATOM   1286  C  CB    . CYS A  1  167  ? 72.385  -91.395  84.753  1.00 95.80  ? 167  CYS A CB    1 
ATOM   1287  S  SG    . CYS A  1  167  ? 71.415  -92.782  85.424  1.00 98.18  ? 167  CYS A SG    1 
ATOM   1288  N  N     . GLY A  1  168  ? 75.794  -91.095  85.956  1.00 91.87  ? 168  GLY A N     1 
ATOM   1289  C  CA    . GLY A  1  168  ? 76.550  -91.019  87.191  1.00 90.68  ? 168  GLY A CA    1 
ATOM   1290  C  C     . GLY A  1  168  ? 76.153  -89.878  88.109  1.00 89.95  ? 168  GLY A C     1 
ATOM   1291  O  O     . GLY A  1  168  ? 76.840  -89.625  89.103  1.00 90.28  ? 168  GLY A O     1 
ATOM   1292  N  N     . ASN A  1  169  ? 75.053  -89.195  87.790  1.00 88.60  ? 169  ASN A N     1 
ATOM   1293  C  CA    . ASN A  1  169  ? 74.569  -88.073  88.601  1.00 87.01  ? 169  ASN A CA    1 
ATOM   1294  C  C     . ASN A  1  169  ? 74.957  -88.271  90.063  1.00 85.56  ? 169  ASN A C     1 
ATOM   1295  O  O     . ASN A  1  169  ? 74.737  -89.337  90.638  1.00 85.83  ? 169  ASN A O     1 
ATOM   1296  C  CB    . ASN A  1  169  ? 73.041  -87.956  88.525  1.00 87.35  ? 169  ASN A CB    1 
ATOM   1297  C  CG    . ASN A  1  169  ? 72.500  -88.110  87.114  1.00 87.61  ? 169  ASN A CG    1 
ATOM   1298  O  OD1   . ASN A  1  169  ? 72.864  -87.360  86.205  1.00 87.94  ? 169  ASN A OD1   1 
ATOM   1299  N  ND2   . ASN A  1  169  ? 71.609  -89.084  86.929  1.00 86.69  ? 169  ASN A ND2   1 
ATOM   1300  N  N     . THR A  1  170  ? 75.541  -87.254  90.672  1.00 83.75  ? 170  THR A N     1 
ATOM   1301  C  CA    . THR A  1  170  ? 75.923  -87.391  92.062  1.00 82.98  ? 170  THR A CA    1 
ATOM   1302  C  C     . THR A  1  170  ? 74.672  -87.639  92.894  1.00 81.28  ? 170  THR A C     1 
ATOM   1303  O  O     . THR A  1  170  ? 73.570  -87.219  92.526  1.00 80.29  ? 170  THR A O     1 
ATOM   1304  C  CB    . THR A  1  170  ? 76.655  -86.129  92.566  1.00 84.10  ? 170  THR A CB    1 
ATOM   1305  O  OG1   . THR A  1  170  ? 77.936  -86.045  91.931  1.00 85.21  ? 170  THR A OG1   1 
ATOM   1306  C  CG2   . THR A  1  170  ? 76.852  -86.175  94.085  1.00 84.74  ? 170  THR A CG2   1 
ATOM   1307  N  N     . GLN A  1  171  ? 74.852  -88.331  94.014  1.00 79.76  ? 171  GLN A N     1 
ATOM   1308  C  CA    . GLN A  1  171  ? 73.751  -88.655  94.906  1.00 77.72  ? 171  GLN A CA    1 
ATOM   1309  C  C     . GLN A  1  171  ? 73.651  -87.719  96.097  1.00 75.97  ? 171  GLN A C     1 
ATOM   1310  O  O     . GLN A  1  171  ? 74.603  -87.563  96.864  1.00 75.32  ? 171  GLN A O     1 
ATOM   1311  C  CB    . GLN A  1  171  ? 73.901  -90.091  95.383  1.00 78.28  ? 171  GLN A CB    1 
ATOM   1312  C  CG    . GLN A  1  171  ? 73.862  -91.082  94.237  1.00 78.26  ? 171  GLN A CG    1 
ATOM   1313  C  CD    . GLN A  1  171  ? 72.509  -91.118  93.554  1.00 78.24  ? 171  GLN A CD    1 
ATOM   1314  O  OE1   . GLN A  1  171  ? 71.997  -90.097  93.090  1.00 78.12  ? 171  GLN A OE1   1 
ATOM   1315  N  NE2   . GLN A  1  171  ? 71.922  -92.299  93.492  1.00 78.48  ? 171  GLN A NE2   1 
ATOM   1316  N  N     . PRO A  1  172  ? 72.477  -87.092  96.272  1.00 74.60  ? 172  PRO A N     1 
ATOM   1317  C  CA    . PRO A  1  172  ? 72.242  -86.160  97.376  1.00 74.34  ? 172  PRO A CA    1 
ATOM   1318  C  C     . PRO A  1  172  ? 72.351  -86.820  98.721  1.00 73.93  ? 172  PRO A C     1 
ATOM   1319  O  O     . PRO A  1  172  ? 71.868  -87.926  98.915  1.00 74.19  ? 172  PRO A O     1 
ATOM   1320  C  CB    . PRO A  1  172  ? 70.823  -85.670  97.125  1.00 73.47  ? 172  PRO A CB    1 
ATOM   1321  C  CG    . PRO A  1  172  ? 70.180  -86.850  96.501  1.00 73.62  ? 172  PRO A CG    1 
ATOM   1322  C  CD    . PRO A  1  172  ? 71.231  -87.331  95.524  1.00 73.92  ? 172  PRO A CD    1 
ATOM   1323  N  N     . THR A  1  173  ? 73.005  -86.152  99.653  1.00 73.92  ? 173  THR A N     1 
ATOM   1324  C  CA    . THR A  1  173  ? 73.093  -86.696  100.989 1.00 74.58  ? 173  THR A CA    1 
ATOM   1325  C  C     . THR A  1  173  ? 71.734  -86.259  101.557 1.00 74.37  ? 173  THR A C     1 
ATOM   1326  O  O     . THR A  1  173  ? 71.432  -85.063  101.586 1.00 74.96  ? 173  THR A O     1 
ATOM   1327  C  CB    . THR A  1  173  ? 74.288  -86.066  101.754 1.00 75.22  ? 173  THR A CB    1 
ATOM   1328  O  OG1   . THR A  1  173  ? 74.989  -87.097  102.464 1.00 75.93  ? 173  THR A OG1   1 
ATOM   1329  C  CG2   . THR A  1  173  ? 73.819  -84.979  102.737 1.00 74.64  ? 173  THR A CG2   1 
ATOM   1330  N  N     . ILE A  1  174  ? 70.897  -87.211  101.968 1.00 73.35  ? 174  ILE A N     1 
ATOM   1331  C  CA    . ILE A  1  174  ? 69.575  -86.848  102.470 1.00 71.96  ? 174  ILE A CA    1 
ATOM   1332  C  C     . ILE A  1  174  ? 69.417  -86.811  103.979 1.00 72.50  ? 174  ILE A C     1 
ATOM   1333  O  O     . ILE A  1  174  ? 69.973  -87.643  104.706 1.00 72.20  ? 174  ILE A O     1 
ATOM   1334  C  CB    . ILE A  1  174  ? 68.471  -87.778  101.926 1.00 70.57  ? 174  ILE A CB    1 
ATOM   1335  C  CG1   . ILE A  1  174  ? 68.551  -87.876  100.403 1.00 69.54  ? 174  ILE A CG1   1 
ATOM   1336  C  CG2   . ILE A  1  174  ? 67.111  -87.218  102.310 1.00 69.93  ? 174  ILE A CG2   1 
ATOM   1337  C  CD1   . ILE A  1  174  ? 67.520  -88.804  99.785  1.00 67.97  ? 174  ILE A CD1   1 
ATOM   1338  N  N     . ARG A  1  175  ? 68.644  -85.825  104.428 1.00 72.68  ? 175  ARG A N     1 
ATOM   1339  C  CA    . ARG A  1  175  ? 68.336  -85.635  105.836 1.00 73.12  ? 175  ARG A CA    1 
ATOM   1340  C  C     . ARG A  1  175  ? 66.858  -85.290  105.936 1.00 72.80  ? 175  ARG A C     1 
ATOM   1341  O  O     . ARG A  1  175  ? 66.247  -84.810  104.978 1.00 72.88  ? 175  ARG A O     1 
ATOM   1342  C  CB    . ARG A  1  175  ? 69.194  -84.522  106.448 1.00 74.92  ? 175  ARG A CB    1 
ATOM   1343  C  CG    . ARG A  1  175  ? 68.993  -83.128  105.852 1.00 78.85  ? 175  ARG A CG    1 
ATOM   1344  C  CD    . ARG A  1  175  ? 70.167  -82.209  106.216 1.00 81.49  ? 175  ARG A CD    1 
ATOM   1345  N  NE    . ARG A  1  175  ? 71.445  -82.859  105.906 1.00 83.72  ? 175  ARG A NE    1 
ATOM   1346  C  CZ    . ARG A  1  175  ? 72.645  -82.330  106.129 1.00 83.91  ? 175  ARG A CZ    1 
ATOM   1347  N  NH1   . ARG A  1  175  ? 72.755  -81.124  106.668 1.00 84.62  ? 175  ARG A NH1   1 
ATOM   1348  N  NH2   . ARG A  1  175  ? 73.737  -83.018  105.822 1.00 83.73  ? 175  ARG A NH2   1 
ATOM   1349  N  N     . LYS A  1  176  ? 66.284  -85.547  107.100 1.00 72.40  ? 176  LYS A N     1 
ATOM   1350  C  CA    . LYS A  1  176  ? 64.872  -85.298  107.317 1.00 71.98  ? 176  LYS A CA    1 
ATOM   1351  C  C     . LYS A  1  176  ? 64.611  -83.973  108.008 1.00 71.05  ? 176  LYS A C     1 
ATOM   1352  O  O     . LYS A  1  176  ? 65.324  -83.600  108.932 1.00 70.56  ? 176  LYS A O     1 
ATOM   1353  C  CB    . LYS A  1  176  ? 64.282  -86.442  108.161 1.00 72.44  ? 176  LYS A CB    1 
ATOM   1354  C  CG    . LYS A  1  176  ? 62.816  -86.255  108.595 1.00 71.96  ? 176  LYS A CG    1 
ATOM   1355  C  CD    . LYS A  1  176  ? 62.352  -87.319  109.602 1.00 69.85  ? 176  LYS A CD    1 
ATOM   1356  C  CE    . LYS A  1  176  ? 60.914  -87.061  110.041 1.00 69.67  ? 176  LYS A CE    1 
ATOM   1357  N  NZ    . LYS A  1  176  ? 60.375  -88.085  110.984 1.00 69.50  ? 176  LYS A NZ    1 
ATOM   1358  N  N     . ASP A  1  177  ? 63.589  -83.264  107.544 1.00 70.82  ? 177  ASP A N     1 
ATOM   1359  C  CA    . ASP A  1  177  ? 63.178  -82.003  108.158 1.00 71.64  ? 177  ASP A CA    1 
ATOM   1360  C  C     . ASP A  1  177  ? 61.656  -82.055  108.242 1.00 70.00  ? 177  ASP A C     1 
ATOM   1361  O  O     . ASP A  1  177  ? 60.966  -81.984  107.219 1.00 70.15  ? 177  ASP A O     1 
ATOM   1362  C  CB    . ASP A  1  177  ? 63.620  -80.787  107.318 1.00 75.21  ? 177  ASP A CB    1 
ATOM   1363  C  CG    . ASP A  1  177  ? 63.170  -79.433  107.928 1.00 77.67  ? 177  ASP A CG    1 
ATOM   1364  O  OD1   . ASP A  1  177  ? 61.950  -79.248  108.150 1.00 79.07  ? 177  ASP A OD1   1 
ATOM   1365  O  OD2   . ASP A  1  177  ? 64.032  -78.551  108.176 1.00 78.34  ? 177  ASP A OD2   1 
ATOM   1366  N  N     . GLY A  1  178  ? 61.134  -82.188  109.459 1.00 67.53  ? 178  GLY A N     1 
ATOM   1367  C  CA    . GLY A  1  178  ? 59.695  -82.264  109.623 1.00 63.81  ? 178  GLY A CA    1 
ATOM   1368  C  C     . GLY A  1  178  ? 59.173  -83.364  108.723 1.00 60.87  ? 178  GLY A C     1 
ATOM   1369  O  O     . GLY A  1  178  ? 59.694  -84.474  108.727 1.00 59.70  ? 178  GLY A O     1 
ATOM   1370  N  N     . LEU A  1  179  ? 58.157  -83.063  107.934 1.00 58.19  ? 179  LEU A N     1 
ATOM   1371  C  CA    . LEU A  1  179  ? 57.612  -84.067  107.050 1.00 56.65  ? 179  LEU A CA    1 
ATOM   1372  C  C     . LEU A  1  179  ? 58.195  -83.874  105.653 1.00 58.33  ? 179  LEU A C     1 
ATOM   1373  O  O     . LEU A  1  179  ? 57.580  -84.257  104.647 1.00 58.69  ? 179  LEU A O     1 
ATOM   1374  C  CB    . LEU A  1  179  ? 56.092  -83.944  107.019 1.00 54.48  ? 179  LEU A CB    1 
ATOM   1375  C  CG    . LEU A  1  179  ? 55.404  -83.713  108.367 1.00 52.02  ? 179  LEU A CG    1 
ATOM   1376  C  CD1   . LEU A  1  179  ? 53.935  -84.055  108.224 1.00 50.33  ? 179  LEU A CD1   1 
ATOM   1377  C  CD2   . LEU A  1  179  ? 56.030  -84.562  109.446 1.00 50.18  ? 179  LEU A CD2   1 
ATOM   1378  N  N     . LYS A  1  180  ? 59.388  -83.283  105.598 1.00 59.10  ? 180  LYS A N     1 
ATOM   1379  C  CA    . LYS A  1  180  ? 60.064  -83.005  104.330 1.00 59.22  ? 180  LYS A CA    1 
ATOM   1380  C  C     . LYS A  1  180  ? 61.422  -83.683  104.242 1.00 59.69  ? 180  LYS A C     1 
ATOM   1381  O  O     . LYS A  1  180  ? 62.175  -83.759  105.218 1.00 59.16  ? 180  LYS A O     1 
ATOM   1382  C  CB    . LYS A  1  180  ? 60.282  -81.496  104.147 1.00 59.96  ? 180  LYS A CB    1 
ATOM   1383  C  CG    . LYS A  1  180  ? 59.042  -80.615  104.213 1.00 62.45  ? 180  LYS A CG    1 
ATOM   1384  C  CD    . LYS A  1  180  ? 58.191  -80.716  102.954 1.00 64.95  ? 180  LYS A CD    1 
ATOM   1385  C  CE    . LYS A  1  180  ? 56.908  -79.893  103.092 1.00 67.05  ? 180  LYS A CE    1 
ATOM   1386  N  NZ    . LYS A  1  180  ? 56.077  -79.892  101.846 1.00 68.71  ? 180  LYS A NZ    1 
ATOM   1387  N  N     . LEU A  1  181  ? 61.739  -84.169  103.056 1.00 60.46  ? 181  LEU A N     1 
ATOM   1388  C  CA    . LEU A  1  181  ? 63.020  -84.805  102.846 1.00 61.71  ? 181  LEU A CA    1 
ATOM   1389  C  C     . LEU A  1  181  ? 63.879  -83.828  102.070 1.00 63.27  ? 181  LEU A C     1 
ATOM   1390  O  O     . LEU A  1  181  ? 63.455  -83.304  101.035 1.00 64.05  ? 181  LEU A O     1 
ATOM   1391  C  CB    . LEU A  1  181  ? 62.840  -86.107  102.073 1.00 61.11  ? 181  LEU A CB    1 
ATOM   1392  C  CG    . LEU A  1  181  ? 62.353  -87.229  102.990 1.00 59.63  ? 181  LEU A CG    1 
ATOM   1393  C  CD1   . LEU A  1  181  ? 62.163  -88.522  102.216 1.00 59.24  ? 181  LEU A CD1   1 
ATOM   1394  C  CD2   . LEU A  1  181  ? 63.372  -87.409  104.106 1.00 59.15  ? 181  LEU A CD2   1 
ATOM   1395  N  N     . VAL A  1  182  ? 65.081  -83.571  102.575 1.00 64.12  ? 182  VAL A N     1 
ATOM   1396  C  CA    . VAL A  1  182  ? 65.979  -82.638  101.916 1.00 64.74  ? 182  VAL A CA    1 
ATOM   1397  C  C     . VAL A  1  182  ? 67.354  -83.232  101.618 1.00 66.71  ? 182  VAL A C     1 
ATOM   1398  O  O     . VAL A  1  182  ? 67.894  -84.018  102.402 1.00 65.95  ? 182  VAL A O     1 
ATOM   1399  C  CB    . VAL A  1  182  ? 66.118  -81.352  102.757 1.00 62.79  ? 182  VAL A CB    1 
ATOM   1400  C  CG1   . VAL A  1  182  ? 67.532  -81.215  103.338 1.00 61.18  ? 182  VAL A CG1   1 
ATOM   1401  C  CG2   . VAL A  1  182  ? 65.750  -80.169  101.899 1.00 62.03  ? 182  VAL A CG2   1 
ATOM   1402  N  N     . GLY A  1  183  ? 67.907  -82.855  100.469 1.00 69.28  ? 183  GLY A N     1 
ATOM   1403  C  CA    . GLY A  1  183  ? 69.213  -83.351  100.072 1.00 72.57  ? 183  GLY A CA    1 
ATOM   1404  C  C     . GLY A  1  183  ? 70.187  -82.252  99.674  1.00 74.56  ? 183  GLY A C     1 
ATOM   1405  O  O     . GLY A  1  183  ? 69.782  -81.117  99.416  1.00 74.14  ? 183  GLY A O     1 
ATOM   1406  N  N     . SER A  1  184  ? 71.476  -82.593  99.629  1.00 76.46  ? 184  SER A N     1 
ATOM   1407  C  CA    . SER A  1  184  ? 72.529  -81.651  99.256  1.00 77.73  ? 184  SER A CA    1 
ATOM   1408  C  C     . SER A  1  184  ? 73.614  -82.367  98.463  1.00 79.07  ? 184  SER A C     1 
ATOM   1409  O  O     . SER A  1  184  ? 74.516  -82.977  99.038  1.00 79.45  ? 184  SER A O     1 
ATOM   1410  C  CB    . SER A  1  184  ? 73.145  -81.006  100.503 1.00 77.60  ? 184  SER A CB    1 
ATOM   1411  O  OG    . SER A  1  184  ? 73.757  -81.971  101.341 1.00 78.60  ? 184  SER A OG    1 
ATOM   1412  N  N     . TRP A  1  185  ? 73.511  -82.291  97.140  1.00 80.53  ? 185  TRP A N     1 
ATOM   1413  C  CA    . TRP A  1  185  ? 74.476  -82.920  96.238  1.00 82.11  ? 185  TRP A CA    1 
ATOM   1414  C  C     . TRP A  1  185  ? 75.800  -82.130  96.230  1.00 83.78  ? 185  TRP A C     1 
ATOM   1415  O  O     . TRP A  1  185  ? 75.875  -81.017  95.692  1.00 84.43  ? 185  TRP A O     1 
ATOM   1416  C  CB    . TRP A  1  185  ? 73.920  -82.957  94.808  1.00 81.70  ? 185  TRP A CB    1 
ATOM   1417  C  CG    . TRP A  1  185  ? 72.555  -83.575  94.625  1.00 81.15  ? 185  TRP A CG    1 
ATOM   1418  C  CD1   . TRP A  1  185  ? 72.249  -84.659  93.848  1.00 81.28  ? 185  TRP A CD1   1 
ATOM   1419  C  CD2   . TRP A  1  185  ? 71.304  -83.088  95.135  1.00 80.94  ? 185  TRP A CD2   1 
ATOM   1420  N  NE1   . TRP A  1  185  ? 70.892  -84.871  93.836  1.00 81.38  ? 185  TRP A NE1   1 
ATOM   1421  C  CE2   . TRP A  1  185  ? 70.287  -83.922  94.617  1.00 81.00  ? 185  TRP A CE2   1 
ATOM   1422  C  CE3   . TRP A  1  185  ? 70.943  -82.027  95.977  1.00 80.68  ? 185  TRP A CE3   1 
ATOM   1423  C  CZ2   . TRP A  1  185  ? 68.935  -83.728  94.913  1.00 80.64  ? 185  TRP A CZ2   1 
ATOM   1424  C  CZ3   . TRP A  1  185  ? 69.596  -81.836  96.270  1.00 80.23  ? 185  TRP A CZ3   1 
ATOM   1425  C  CH2   . TRP A  1  185  ? 68.610  -82.684  95.739  1.00 80.38  ? 185  TRP A CH2   1 
ATOM   1426  N  N     . LYS A  1  186  ? 76.844  -82.700  96.819  1.00 84.15  ? 186  LYS A N     1 
ATOM   1427  C  CA    . LYS A  1  186  ? 78.133  -82.024  96.863  1.00 84.14  ? 186  LYS A CA    1 
ATOM   1428  C  C     . LYS A  1  186  ? 79.018  -82.521  95.729  1.00 83.56  ? 186  LYS A C     1 
ATOM   1429  O  O     . LYS A  1  186  ? 78.645  -82.424  94.559  1.00 82.57  ? 186  LYS A O     1 
ATOM   1430  C  CB    . LYS A  1  186  ? 78.806  -82.268  98.221  1.00 85.36  ? 186  LYS A CB    1 
ATOM   1431  C  CG    . LYS A  1  186  ? 80.203  -81.664  98.370  1.00 85.84  ? 186  LYS A CG    1 
ATOM   1432  C  CD    . LYS A  1  186  ? 80.757  -81.867  99.783  1.00 85.77  ? 186  LYS A CD    1 
ATOM   1433  C  CE    . LYS A  1  186  ? 79.937  -81.116  100.827 1.00 85.38  ? 186  LYS A CE    1 
ATOM   1434  N  NZ    . LYS A  1  186  ? 79.921  -79.651  100.551 1.00 85.74  ? 186  LYS A NZ    1 
ATOM   1435  N  N     . ASP A  1  195  ? 83.123  -75.686  94.757  1.00 117.16 ? 195  ASP A N     1 
ATOM   1436  C  CA    . ASP A  1  195  ? 83.069  -75.997  96.187  1.00 117.62 ? 195  ASP A CA    1 
ATOM   1437  C  C     . ASP A  1  195  ? 81.703  -75.652  96.808  1.00 117.49 ? 195  ASP A C     1 
ATOM   1438  O  O     . ASP A  1  195  ? 80.934  -74.858  96.239  1.00 117.79 ? 195  ASP A O     1 
ATOM   1439  C  CB    . ASP A  1  195  ? 84.181  -75.248  96.939  1.00 118.13 ? 195  ASP A CB    1 
ATOM   1440  C  CG    . ASP A  1  195  ? 85.574  -75.597  96.432  1.00 118.81 ? 195  ASP A CG    1 
ATOM   1441  O  OD1   . ASP A  1  195  ? 85.906  -76.801  96.381  1.00 119.11 ? 195  ASP A OD1   1 
ATOM   1442  O  OD2   . ASP A  1  195  ? 86.339  -74.666  96.090  1.00 119.27 ? 195  ASP A OD2   1 
ATOM   1443  N  N     . GLU A  1  196  ? 81.414  -76.259  97.967  1.00 116.18 ? 196  GLU A N     1 
ATOM   1444  C  CA    . GLU A  1  196  ? 80.153  -76.051  98.697  1.00 114.10 ? 196  GLU A CA    1 
ATOM   1445  C  C     . GLU A  1  196  ? 78.988  -76.872  98.100  1.00 112.78 ? 196  GLU A C     1 
ATOM   1446  O  O     . GLU A  1  196  ? 78.888  -77.036  96.876  1.00 113.57 ? 196  GLU A O     1 
ATOM   1447  C  CB    . GLU A  1  196  ? 79.803  -74.561  98.703  1.00 114.57 ? 196  GLU A CB    1 
ATOM   1448  C  CG    . GLU A  1  196  ? 78.533  -74.210  99.427  1.00 115.11 ? 196  GLU A CG    1 
ATOM   1449  C  CD    . GLU A  1  196  ? 77.904  -72.962  98.863  1.00 116.12 ? 196  GLU A CD    1 
ATOM   1450  O  OE1   . GLU A  1  196  ? 77.458  -73.003  97.695  1.00 116.74 ? 196  GLU A OE1   1 
ATOM   1451  O  OE2   . GLU A  1  196  ? 77.867  -71.939  99.581  1.00 116.74 ? 196  GLU A OE2   1 
ATOM   1452  N  N     . PRO A  1  197  ? 78.086  -77.392  98.959  1.00 110.48 ? 197  PRO A N     1 
ATOM   1453  C  CA    . PRO A  1  197  ? 76.936  -78.196  98.516  1.00 107.70 ? 197  PRO A CA    1 
ATOM   1454  C  C     . PRO A  1  197  ? 75.872  -77.449  97.700  1.00 105.67 ? 197  PRO A C     1 
ATOM   1455  O  O     . PRO A  1  197  ? 76.044  -76.273  97.359  1.00 105.44 ? 197  PRO A O     1 
ATOM   1456  C  CB    . PRO A  1  197  ? 76.384  -78.741  99.831  1.00 108.26 ? 197  PRO A CB    1 
ATOM   1457  C  CG    . PRO A  1  197  ? 76.641  -77.599  100.778 1.00 108.35 ? 197  PRO A CG    1 
ATOM   1458  C  CD    . PRO A  1  197  ? 78.066  -77.222  100.426 1.00 109.27 ? 197  PRO A CD    1 
ATOM   1459  N  N     . GLU A  1  198  ? 74.773  -78.144  97.400  1.00 103.15 ? 198  GLU A N     1 
ATOM   1460  C  CA    . GLU A  1  198  ? 73.666  -77.578  96.621  1.00 100.24 ? 198  GLU A CA    1 
ATOM   1461  C  C     . GLU A  1  198  ? 72.298  -77.907  97.230  1.00 97.86  ? 198  GLU A C     1 
ATOM   1462  O  O     . GLU A  1  198  ? 71.438  -78.487  96.561  1.00 97.64  ? 198  GLU A O     1 
ATOM   1463  C  CB    . GLU A  1  198  ? 73.730  -78.118  95.197  1.00 100.08 ? 198  GLU A CB    1 
ATOM   1464  C  CG    . GLU A  1  198  ? 73.066  -77.265  94.157  1.00 100.67 ? 198  GLU A CG    1 
ATOM   1465  C  CD    . GLU A  1  198  ? 73.649  -77.530  92.784  1.00 101.60 ? 198  GLU A CD    1 
ATOM   1466  O  OE1   . GLU A  1  198  ? 73.512  -78.673  92.296  1.00 101.72 ? 198  GLU A OE1   1 
ATOM   1467  O  OE2   . GLU A  1  198  ? 74.257  -76.603  92.201  1.00 101.68 ? 198  GLU A OE2   1 
ATOM   1468  N  N     . LEU A  1  199  ? 72.108  -77.519  98.491  1.00 94.90  ? 199  LEU A N     1 
ATOM   1469  C  CA    . LEU A  1  199  ? 70.871  -77.770  99.228  1.00 92.06  ? 199  LEU A CA    1 
ATOM   1470  C  C     . LEU A  1  199  ? 69.581  -77.514  98.451  1.00 90.66  ? 199  LEU A C     1 
ATOM   1471  O  O     . LEU A  1  199  ? 69.387  -76.440  97.881  1.00 90.49  ? 199  LEU A O     1 
ATOM   1472  C  CB    . LEU A  1  199  ? 70.877  -76.948  100.515 1.00 91.11  ? 199  LEU A CB    1 
ATOM   1473  C  CG    . LEU A  1  199  ? 71.955  -77.447  101.477 1.00 90.64  ? 199  LEU A CG    1 
ATOM   1474  C  CD1   . LEU A  1  199  ? 72.563  -76.285  102.236 1.00 90.27  ? 199  LEU A CD1   1 
ATOM   1475  C  CD2   . LEU A  1  199  ? 71.349  -78.494  102.409 1.00 90.62  ? 199  LEU A CD2   1 
ATOM   1476  N  N     . ARG A  1  200  ? 68.709  -78.523  98.434  1.00 88.89  ? 200  ARG A N     1 
ATOM   1477  C  CA    . ARG A  1  200  ? 67.415  -78.450  97.750  1.00 86.12  ? 200  ARG A CA    1 
ATOM   1478  C  C     . ARG A  1  200  ? 66.424  -79.493  98.303  1.00 84.17  ? 200  ARG A C     1 
ATOM   1479  O  O     . ARG A  1  200  ? 66.805  -80.615  98.665  1.00 83.82  ? 200  ARG A O     1 
ATOM   1480  C  CB    . ARG A  1  200  ? 67.612  -78.615  96.232  1.00 85.70  ? 200  ARG A CB    1 
ATOM   1481  C  CG    . ARG A  1  200  ? 67.004  -79.852  95.619  1.00 85.01  ? 200  ARG A CG    1 
ATOM   1482  C  CD    . ARG A  1  200  ? 65.984  -79.501  94.554  1.00 85.11  ? 200  ARG A CD    1 
ATOM   1483  N  NE    . ARG A  1  200  ? 65.616  -80.687  93.796  1.00 85.84  ? 200  ARG A NE    1 
ATOM   1484  C  CZ    . ARG A  1  200  ? 66.437  -81.315  92.960  1.00 86.74  ? 200  ARG A CZ    1 
ATOM   1485  N  NH1   . ARG A  1  200  ? 67.673  -80.864  92.763  1.00 86.83  ? 200  ARG A NH1   1 
ATOM   1486  N  NH2   . ARG A  1  200  ? 66.030  -82.411  92.338  1.00 87.18  ? 200  ARG A NH2   1 
ATOM   1487  N  N     . VAL A  1  201  ? 65.154  -79.106  98.373  1.00 81.34  ? 201  VAL A N     1 
ATOM   1488  C  CA    . VAL A  1  201  ? 64.106  -79.976  98.895  1.00 78.61  ? 201  VAL A CA    1 
ATOM   1489  C  C     . VAL A  1  201  ? 63.615  -81.031  97.911  1.00 76.67  ? 201  VAL A C     1 
ATOM   1490  O  O     . VAL A  1  201  ? 63.316  -80.726  96.755  1.00 76.73  ? 201  VAL A O     1 
ATOM   1491  C  CB    . VAL A  1  201  ? 62.897  -79.154  99.340  1.00 78.48  ? 201  VAL A CB    1 
ATOM   1492  C  CG1   . VAL A  1  201  ? 61.826  -80.071  99.888  1.00 77.91  ? 201  VAL A CG1   1 
ATOM   1493  C  CG2   . VAL A  1  201  ? 63.327  -78.144  100.379 1.00 78.74  ? 201  VAL A CG2   1 
ATOM   1494  N  N     . LEU A  1  202  ? 63.527  -82.272  98.386  1.00 74.10  ? 202  LEU A N     1 
ATOM   1495  C  CA    . LEU A  1  202  ? 63.059  -83.388  97.571  1.00 71.13  ? 202  LEU A CA    1 
ATOM   1496  C  C     . LEU A  1  202  ? 61.541  -83.393  97.551  1.00 69.38  ? 202  LEU A C     1 
ATOM   1497  O  O     . LEU A  1  202  ? 60.906  -83.695  98.561  1.00 68.76  ? 202  LEU A O     1 
ATOM   1498  C  CB    . LEU A  1  202  ? 63.568  -84.713  98.140  1.00 70.50  ? 202  LEU A CB    1 
ATOM   1499  C  CG    . LEU A  1  202  ? 65.061  -84.975  97.947  1.00 70.26  ? 202  LEU A CG    1 
ATOM   1500  C  CD1   . LEU A  1  202  ? 65.481  -86.233  98.686  1.00 69.75  ? 202  LEU A CD1   1 
ATOM   1501  C  CD2   . LEU A  1  202  ? 65.345  -85.104  96.464  1.00 69.94  ? 202  LEU A CD2   1 
ATOM   1502  N  N     . SER A  1  203  ? 60.967  -83.058  96.397  1.00 67.84  ? 203  SER A N     1 
ATOM   1503  C  CA    . SER A  1  203  ? 59.518  -83.005  96.237  1.00 67.03  ? 203  SER A CA    1 
ATOM   1504  C  C     . SER A  1  203  ? 58.914  -84.390  96.258  1.00 67.19  ? 203  SER A C     1 
ATOM   1505  O  O     . SER A  1  203  ? 59.570  -85.373  95.923  1.00 67.74  ? 203  SER A O     1 
ATOM   1506  C  CB    . SER A  1  203  ? 59.133  -82.331  94.918  1.00 66.86  ? 203  SER A CB    1 
ATOM   1507  O  OG    . SER A  1  203  ? 59.048  -83.264  93.851  1.00 65.12  ? 203  SER A OG    1 
ATOM   1508  N  N     . THR A  1  204  ? 57.649  -84.465  96.638  1.00 66.39  ? 204  THR A N     1 
ATOM   1509  C  CA    . THR A  1  204  ? 56.981  -85.744  96.697  1.00 65.05  ? 204  THR A CA    1 
ATOM   1510  C  C     . THR A  1  204  ? 56.809  -86.308  95.297  1.00 65.18  ? 204  THR A C     1 
ATOM   1511  O  O     . THR A  1  204  ? 57.260  -87.414  95.020  1.00 64.68  ? 204  THR A O     1 
ATOM   1512  C  CB    . THR A  1  204  ? 55.628  -85.605  97.379  1.00 64.46  ? 204  THR A CB    1 
ATOM   1513  O  OG1   . THR A  1  204  ? 55.826  -85.171  98.726  1.00 64.05  ? 204  THR A OG1   1 
ATOM   1514  C  CG2   . THR A  1  204  ? 54.919  -86.917  97.404  1.00 64.64  ? 204  THR A CG2   1 
ATOM   1515  N  N     . GLU A  1  205  ? 56.179  -85.538  94.414  1.00 65.88  ? 205  GLU A N     1 
ATOM   1516  C  CA    . GLU A  1  205  ? 55.943  -85.973  93.037  1.00 67.20  ? 205  GLU A CA    1 
ATOM   1517  C  C     . GLU A  1  205  ? 57.239  -86.502  92.444  1.00 66.70  ? 205  GLU A C     1 
ATOM   1518  O  O     . GLU A  1  205  ? 57.240  -87.369  91.566  1.00 65.79  ? 205  GLU A O     1 
ATOM   1519  C  CB    . GLU A  1  205  ? 55.430  -84.805  92.192  1.00 69.59  ? 205  GLU A CB    1 
ATOM   1520  C  CG    . GLU A  1  205  ? 54.396  -83.925  92.892  1.00 74.04  ? 205  GLU A CG    1 
ATOM   1521  C  CD    . GLU A  1  205  ? 55.009  -83.041  93.984  1.00 76.64  ? 205  GLU A CD    1 
ATOM   1522  O  OE1   . GLU A  1  205  ? 55.937  -82.273  93.657  1.00 79.13  ? 205  GLU A OE1   1 
ATOM   1523  O  OE2   . GLU A  1  205  ? 54.572  -83.103  95.160  1.00 77.02  ? 205  GLU A OE2   1 
ATOM   1524  N  N     . GLU A  1  206  ? 58.342  -85.961  92.948  1.00 66.79  ? 206  GLU A N     1 
ATOM   1525  C  CA    . GLU A  1  206  ? 59.689  -86.332  92.526  1.00 66.51  ? 206  GLU A CA    1 
ATOM   1526  C  C     . GLU A  1  206  ? 60.065  -87.718  93.052  1.00 64.99  ? 206  GLU A C     1 
ATOM   1527  O  O     . GLU A  1  206  ? 60.424  -88.608  92.270  1.00 64.27  ? 206  GLU A O     1 
ATOM   1528  C  CB    . GLU A  1  206  ? 60.678  -85.271  93.038  1.00 68.35  ? 206  GLU A CB    1 
ATOM   1529  C  CG    . GLU A  1  206  ? 62.155  -85.665  93.058  1.00 70.89  ? 206  GLU A CG    1 
ATOM   1530  C  CD    . GLU A  1  206  ? 63.038  -84.614  93.750  1.00 72.43  ? 206  GLU A CD    1 
ATOM   1531  O  OE1   . GLU A  1  206  ? 62.697  -84.192  94.879  1.00 72.22  ? 206  GLU A OE1   1 
ATOM   1532  O  OE2   . GLU A  1  206  ? 64.078  -84.216  93.173  1.00 72.84  ? 206  GLU A OE2   1 
ATOM   1533  N  N     . ILE A  1  207  ? 59.967  -87.885  94.376  1.00 63.43  ? 207  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  207  ? 60.293  -89.146  95.058  1.00 61.15  ? 207  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  207  ? 59.390  -90.257  94.551  1.00 60.02  ? 207  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  207  ? 59.815  -91.399  94.374  1.00 59.39  ? 207  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  207  ? 60.050  -89.078  96.582  1.00 60.22  ? 207  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  207  ? 60.385  -87.692  97.134  1.00 58.83  ? 207  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  207  ? 60.866  -90.158  97.263  1.00 59.67  ? 207  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  207  ? 61.675  -87.608  97.916  1.00 58.29  ? 207  ILE A CD1   1 
ATOM   1541  N  N     . LEU A  1  208  ? 58.126  -89.910  94.350  1.00 58.82  ? 208  LEU A N     1 
ATOM   1542  C  CA    . LEU A  1  208  ? 57.147  -90.860  93.867  1.00 57.95  ? 208  LEU A CA    1 
ATOM   1543  C  C     . LEU A  1  208  ? 57.636  -91.419  92.536  1.00 58.75  ? 208  LEU A C     1 
ATOM   1544  O  O     . LEU A  1  208  ? 57.790  -92.632  92.385  1.00 58.15  ? 208  LEU A O     1 
ATOM   1545  C  CB    . LEU A  1  208  ? 55.793  -90.167  93.681  1.00 55.49  ? 208  LEU A CB    1 
ATOM   1546  C  CG    . LEU A  1  208  ? 54.525  -91.012  93.548  1.00 53.36  ? 208  LEU A CG    1 
ATOM   1547  C  CD1   . LEU A  1  208  ? 53.409  -90.130  93.043  1.00 51.84  ? 208  LEU A CD1   1 
ATOM   1548  C  CD2   . LEU A  1  208  ? 54.731  -92.149  92.583  1.00 53.25  ? 208  LEU A CD2   1 
ATOM   1549  N  N     . ASN A  1  209  ? 57.903  -90.535  91.579  1.00 59.49  ? 209  ASN A N     1 
ATOM   1550  C  CA    . ASN A  1  209  ? 58.343  -90.994  90.275  1.00 60.73  ? 209  ASN A CA    1 
ATOM   1551  C  C     . ASN A  1  209  ? 59.579  -91.877  90.340  1.00 60.94  ? 209  ASN A C     1 
ATOM   1552  O  O     . ASN A  1  209  ? 59.634  -92.913  89.679  1.00 61.32  ? 209  ASN A O     1 
ATOM   1553  C  CB    . ASN A  1  209  ? 58.587  -89.816  89.330  1.00 61.84  ? 209  ASN A CB    1 
ATOM   1554  C  CG    . ASN A  1  209  ? 58.796  -90.263  87.882  1.00 63.19  ? 209  ASN A CG    1 
ATOM   1555  O  OD1   . ASN A  1  209  ? 59.895  -90.653  87.494  1.00 64.34  ? 209  ASN A OD1   1 
ATOM   1556  N  ND2   . ASN A  1  209  ? 57.730  -90.225  87.087  1.00 62.90  ? 209  ASN A ND2   1 
ATOM   1557  N  N     . ILE A  1  210  ? 60.573  -91.496  91.128  1.00 60.79  ? 210  ILE A N     1 
ATOM   1558  C  CA    . ILE A  1  210  ? 61.757  -92.340  91.203  1.00 61.44  ? 210  ILE A CA    1 
ATOM   1559  C  C     . ILE A  1  210  ? 61.369  -93.741  91.681  1.00 61.62  ? 210  ILE A C     1 
ATOM   1560  O  O     . ILE A  1  210  ? 61.800  -94.736  91.101  1.00 62.07  ? 210  ILE A O     1 
ATOM   1561  C  CB    . ILE A  1  210  ? 62.834  -91.757  92.150  1.00 61.96  ? 210  ILE A CB    1 
ATOM   1562  C  CG1   . ILE A  1  210  ? 63.287  -90.387  91.652  1.00 62.28  ? 210  ILE A CG1   1 
ATOM   1563  C  CG2   . ILE A  1  210  ? 64.044  -92.684  92.208  1.00 60.60  ? 210  ILE A CG2   1 
ATOM   1564  C  CD1   . ILE A  1  210  ? 64.419  -89.800  92.460  1.00 62.54  ? 210  ILE A CD1   1 
ATOM   1565  N  N     . PHE A  1  211  ? 60.547  -93.821  92.725  1.00 61.45  ? 211  PHE A N     1 
ATOM   1566  C  CA    . PHE A  1  211  ? 60.120  -95.120  93.241  1.00 61.11  ? 211  PHE A CA    1 
ATOM   1567  C  C     . PHE A  1  211  ? 59.384  -95.916  92.171  1.00 60.75  ? 211  PHE A C     1 
ATOM   1568  O  O     . PHE A  1  211  ? 59.610  -97.120  92.015  1.00 61.10  ? 211  PHE A O     1 
ATOM   1569  C  CB    . PHE A  1  211  ? 59.208  -94.958  94.460  1.00 61.32  ? 211  PHE A CB    1 
ATOM   1570  C  CG    . PHE A  1  211  ? 59.930  -94.569  95.713  1.00 61.48  ? 211  PHE A CG    1 
ATOM   1571  C  CD1   . PHE A  1  211  ? 61.119  -95.190  96.069  1.00 62.14  ? 211  PHE A CD1   1 
ATOM   1572  C  CD2   . PHE A  1  211  ? 59.414  -93.595  96.550  1.00 62.23  ? 211  PHE A CD2   1 
ATOM   1573  C  CE1   . PHE A  1  211  ? 61.782  -94.845  97.243  1.00 62.60  ? 211  PHE A CE1   1 
ATOM   1574  C  CE2   . PHE A  1  211  ? 60.070  -93.245  97.729  1.00 62.67  ? 211  PHE A CE2   1 
ATOM   1575  C  CZ    . PHE A  1  211  ? 61.258  -93.873  98.075  1.00 62.10  ? 211  PHE A CZ    1 
ATOM   1576  N  N     . LYS A  1  212  ? 58.494  -95.244  91.443  1.00 59.76  ? 212  LYS A N     1 
ATOM   1577  C  CA    . LYS A  1  212  ? 57.735  -95.895  90.385  1.00 58.51  ? 212  LYS A CA    1 
ATOM   1578  C  C     . LYS A  1  212  ? 58.684  -96.500  89.375  1.00 58.44  ? 212  LYS A C     1 
ATOM   1579  O  O     . LYS A  1  212  ? 58.395  -97.540  88.797  1.00 58.53  ? 212  LYS A O     1 
ATOM   1580  C  CB    . LYS A  1  212  ? 56.809  -94.902  89.682  1.00 57.93  ? 212  LYS A CB    1 
ATOM   1581  C  CG    . LYS A  1  212  ? 55.455  -94.747  90.357  1.00 58.98  ? 212  LYS A CG    1 
ATOM   1582  C  CD    . LYS A  1  212  ? 54.473  -93.893  89.543  1.00 58.71  ? 212  LYS A CD    1 
ATOM   1583  C  CE    . LYS A  1  212  ? 53.065  -93.928  90.156  1.00 58.66  ? 212  LYS A CE    1 
ATOM   1584  N  NZ    . LYS A  1  212  ? 52.066  -93.092  89.431  1.00 57.77  ? 212  LYS A NZ    1 
ATOM   1585  N  N     . HIS A  1  213  ? 59.823  -95.847  89.173  1.00 58.77  ? 213  HIS A N     1 
ATOM   1586  C  CA    . HIS A  1  213  ? 60.808  -96.338  88.222  1.00 59.38  ? 213  HIS A CA    1 
ATOM   1587  C  C     . HIS A  1  213  ? 61.718  -97.423  88.794  1.00 58.37  ? 213  HIS A C     1 
ATOM   1588  O  O     . HIS A  1  213  ? 62.496  -98.013  88.056  1.00 59.39  ? 213  HIS A O     1 
ATOM   1589  C  CB    . HIS A  1  213  ? 61.680  -95.191  87.670  1.00 61.95  ? 213  HIS A CB    1 
ATOM   1590  C  CG    . HIS A  1  213  ? 61.032  -94.373  86.585  1.00 64.23  ? 213  HIS A CG    1 
ATOM   1591  N  ND1   . HIS A  1  213  ? 60.160  -94.907  85.657  1.00 64.57  ? 213  HIS A ND1   1 
ATOM   1592  C  CD2   . HIS A  1  213  ? 61.178  -93.066  86.249  1.00 64.49  ? 213  HIS A CD2   1 
ATOM   1593  C  CE1   . HIS A  1  213  ? 59.796  -93.966  84.802  1.00 64.69  ? 213  HIS A CE1   1 
ATOM   1594  N  NE2   . HIS A  1  213  ? 60.400  -92.840  85.139  1.00 64.92  ? 213  HIS A NE2   1 
ATOM   1595  N  N     . ILE A  1  214  ? 61.645  -97.692  90.093  1.00 57.04  ? 214  ILE A N     1 
ATOM   1596  C  CA    . ILE A  1  214  ? 62.494  -98.739  90.652  1.00 55.51  ? 214  ILE A CA    1 
ATOM   1597  C  C     . ILE A  1  214  ? 62.071  -100.052 90.008  1.00 56.21  ? 214  ILE A C     1 
ATOM   1598  O  O     . ILE A  1  214  ? 60.878  -100.322 89.874  1.00 54.75  ? 214  ILE A O     1 
ATOM   1599  C  CB    . ILE A  1  214  ? 62.346  -98.858  92.169  1.00 53.60  ? 214  ILE A CB    1 
ATOM   1600  C  CG1   . ILE A  1  214  ? 62.766  -97.546  92.836  1.00 51.52  ? 214  ILE A CG1   1 
ATOM   1601  C  CG2   . ILE A  1  214  ? 63.194  -100.017 92.662  1.00 51.75  ? 214  ILE A CG2   1 
ATOM   1602  C  CD1   . ILE A  1  214  ? 62.756  -97.582  94.342  1.00 50.81  ? 214  ILE A CD1   1 
ATOM   1603  N  N     . SER A  1  215  ? 63.050  -100.859 89.603  1.00 58.06  ? 215  SER A N     1 
ATOM   1604  C  CA    . SER A  1  215  ? 62.768  -102.132 88.929  1.00 59.27  ? 215  SER A CA    1 
ATOM   1605  C  C     . SER A  1  215  ? 62.169  -103.164 89.860  1.00 59.39  ? 215  SER A C     1 
ATOM   1606  O  O     . SER A  1  215  ? 62.435  -103.152 91.059  1.00 59.80  ? 215  SER A O     1 
ATOM   1607  C  CB    . SER A  1  215  ? 64.039  -102.708 88.308  1.00 59.38  ? 215  SER A CB    1 
ATOM   1608  O  OG    . SER A  1  215  ? 64.927  -103.153 89.313  1.00 59.76  ? 215  SER A OG    1 
ATOM   1609  N  N     . VAL A  1  216  ? 61.379  -104.070 89.291  1.00 59.76  ? 216  VAL A N     1 
ATOM   1610  C  CA    . VAL A  1  216  ? 60.713  -105.116 90.065  1.00 59.48  ? 216  VAL A CA    1 
ATOM   1611  C  C     . VAL A  1  216  ? 61.687  -105.990 90.861  1.00 59.39  ? 216  VAL A C     1 
ATOM   1612  O  O     . VAL A  1  216  ? 61.384  -106.409 91.975  1.00 58.04  ? 216  VAL A O     1 
ATOM   1613  C  CB    . VAL A  1  216  ? 59.854  -106.021 89.148  1.00 58.69  ? 216  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A  1  216  ? 58.837  -106.775 89.973  1.00 56.59  ? 216  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A  1  216  ? 59.155  -105.186 88.083  1.00 58.10  ? 216  VAL A CG2   1 
ATOM   1616  N  N     . LYS A  1  217  ? 62.852  -106.274 90.293  1.00 60.93  ? 217  LYS A N     1 
ATOM   1617  C  CA    . LYS A  1  217  ? 63.824  -107.089 91.005  1.00 63.59  ? 217  LYS A CA    1 
ATOM   1618  C  C     . LYS A  1  217  ? 64.426  -106.266 92.117  1.00 64.17  ? 217  LYS A C     1 
ATOM   1619  O  O     . LYS A  1  217  ? 64.677  -106.774 93.209  1.00 64.83  ? 217  LYS A O     1 
ATOM   1620  C  CB    . LYS A  1  217  ? 64.931  -107.595 90.072  1.00 65.19  ? 217  LYS A CB    1 
ATOM   1621  C  CG    . LYS A  1  217  ? 64.485  -108.747 89.184  1.00 67.52  ? 217  LYS A CG    1 
ATOM   1622  C  CD    . LYS A  1  217  ? 65.652  -109.605 88.726  1.00 69.23  ? 217  LYS A CD    1 
ATOM   1623  C  CE    . LYS A  1  217  ? 65.141  -110.907 88.105  1.00 70.81  ? 217  LYS A CE    1 
ATOM   1624  N  NZ    . LYS A  1  217  ? 66.240  -111.815 87.661  1.00 71.84  ? 217  LYS A NZ    1 
ATOM   1625  N  N     . ASP A  1  218  ? 64.657  -104.988 91.836  1.00 64.89  ? 218  ASP A N     1 
ATOM   1626  C  CA    . ASP A  1  218  ? 65.213  -104.095 92.841  1.00 66.02  ? 218  ASP A CA    1 
ATOM   1627  C  C     . ASP A  1  218  ? 64.211  -104.016 94.008  1.00 65.49  ? 218  ASP A C     1 
ATOM   1628  O  O     . ASP A  1  218  ? 64.611  -104.042 95.179  1.00 64.32  ? 218  ASP A O     1 
ATOM   1629  C  CB    . ASP A  1  218  ? 65.491  -102.701 92.237  1.00 67.89  ? 218  ASP A CB    1 
ATOM   1630  C  CG    . ASP A  1  218  ? 66.846  -102.624 91.479  1.00 68.75  ? 218  ASP A CG    1 
ATOM   1631  O  OD1   . ASP A  1  218  ? 67.834  -103.276 91.914  1.00 67.41  ? 218  ASP A OD1   1 
ATOM   1632  O  OD2   . ASP A  1  218  ? 66.919  -101.883 90.464  1.00 68.66  ? 218  ASP A OD2   1 
ATOM   1633  N  N     . PHE A  1  219  ? 62.918  -103.926 93.671  1.00 65.52  ? 219  PHE A N     1 
ATOM   1634  C  CA    . PHE A  1  219  ? 61.817  -103.891 94.653  1.00 64.10  ? 219  PHE A CA    1 
ATOM   1635  C  C     . PHE A  1  219  ? 62.218  -104.859 95.720  1.00 63.64  ? 219  PHE A C     1 
ATOM   1636  O  O     . PHE A  1  219  ? 62.697  -104.532 96.807  1.00 64.14  ? 219  PHE A O     1 
ATOM   1637  C  CB    . PHE A  1  219  ? 60.541  -104.514 94.084  1.00 62.93  ? 219  PHE A CB    1 
ATOM   1638  C  CG    . PHE A  1  219  ? 59.560  -103.551 93.548  1.00 62.51  ? 219  PHE A CG    1 
ATOM   1639  C  CD1   . PHE A  1  219  ? 58.375  -104.024 92.996  1.00 62.23  ? 219  PHE A CD1   1 
ATOM   1640  C  CD2   . PHE A  1  219  ? 59.801  -102.185 93.574  1.00 63.55  ? 219  PHE A CD2   1 
ATOM   1641  C  CE1   . PHE A  1  219  ? 57.433  -103.154 92.469  1.00 64.00  ? 219  PHE A CE1   1 
ATOM   1642  C  CE2   . PHE A  1  219  ? 58.864  -101.289 93.048  1.00 65.75  ? 219  PHE A CE2   1 
ATOM   1643  C  CZ    . PHE A  1  219  ? 57.672  -101.776 92.492  1.00 65.42  ? 219  PHE A CZ    1 
ATOM   1644  N  N     . THR A  1  220  ? 61.967  -106.090 95.322  1.00 62.05  ? 220  THR A N     1 
ATOM   1645  C  CA    . THR A  1  220  ? 62.196  -107.276 96.071  1.00 61.43  ? 220  THR A CA    1 
ATOM   1646  C  C     . THR A  1  220  ? 63.534  -107.356 96.795  1.00 62.37  ? 220  THR A C     1 
ATOM   1647  O  O     . THR A  1  220  ? 63.558  -107.540 98.010  1.00 63.99  ? 220  THR A O     1 
ATOM   1648  C  CB    . THR A  1  220  ? 61.986  -108.413 95.126  1.00 60.16  ? 220  THR A CB    1 
ATOM   1649  O  OG1   . THR A  1  220  ? 60.680  -108.266 94.552  1.00 57.21  ? 220  THR A OG1   1 
ATOM   1650  C  CG2   . THR A  1  220  ? 62.097  -109.728 95.829  1.00 61.68  ? 220  THR A CG2   1 
ATOM   1651  N  N     . SER A  1  221  ? 64.649  -107.225 96.092  1.00 62.11  ? 221  SER A N     1 
ATOM   1652  C  CA    . SER A  1  221  ? 65.923  -107.286 96.798  1.00 62.36  ? 221  SER A CA    1 
ATOM   1653  C  C     . SER A  1  221  ? 65.851  -106.327 98.002  1.00 61.94  ? 221  SER A C     1 
ATOM   1654  O  O     . SER A  1  221  ? 66.473  -106.557 99.041  1.00 61.48  ? 221  SER A O     1 
ATOM   1655  C  CB    . SER A  1  221  ? 67.068  -106.911 95.854  1.00 63.17  ? 221  SER A CB    1 
ATOM   1656  O  OG    . SER A  1  221  ? 66.573  -106.310 94.670  1.00 64.53  ? 221  SER A OG    1 
ATOM   1657  N  N     . LEU A  1  222  ? 65.064  -105.262 97.853  1.00 61.39  ? 222  LEU A N     1 
ATOM   1658  C  CA    . LEU A  1  222  ? 64.873  -104.275 98.915  1.00 60.74  ? 222  LEU A CA    1 
ATOM   1659  C  C     . LEU A  1  222  ? 63.640  -104.616 99.743  1.00 60.48  ? 222  LEU A C     1 
ATOM   1660  O  O     . LEU A  1  222  ? 62.841  -103.742 100.057 1.00 60.76  ? 222  LEU A O     1 
ATOM   1661  C  CB    . LEU A  1  222  ? 64.696  -102.869 98.330  1.00 60.04  ? 222  LEU A CB    1 
ATOM   1662  C  CG    . LEU A  1  222  ? 65.919  -102.020 97.991  1.00 59.55  ? 222  LEU A CG    1 
ATOM   1663  C  CD1   . LEU A  1  222  ? 65.450  -100.717 97.377  1.00 58.15  ? 222  LEU A CD1   1 
ATOM   1664  C  CD2   . LEU A  1  222  ? 66.747  -101.758 99.248  1.00 59.25  ? 222  LEU A CD2   1 
ATOM   1665  N  N     . GLY A  1  223  ? 63.488  -105.895 100.070 1.00 60.54  ? 223  GLY A N     1 
ATOM   1666  C  CA    . GLY A  1  223  ? 62.370  -106.375 100.876 1.00 59.60  ? 223  GLY A CA    1 
ATOM   1667  C  C     . GLY A  1  223  ? 60.921  -106.018 100.565 1.00 58.15  ? 223  GLY A C     1 
ATOM   1668  O  O     . GLY A  1  223  ? 60.078  -106.111 101.459 1.00 58.00  ? 223  GLY A O     1 
ATOM   1669  N  N     . PHE A  1  224  ? 60.603  -105.625 99.335  1.00 56.42  ? 224  PHE A N     1 
ATOM   1670  C  CA    . PHE A  1  224  ? 59.222  -105.273 99.029  1.00 55.49  ? 224  PHE A CA    1 
ATOM   1671  C  C     . PHE A  1  224  ? 58.460  -106.392 98.356  1.00 55.24  ? 224  PHE A C     1 
ATOM   1672  O  O     . PHE A  1  224  ? 58.869  -107.549 98.436  1.00 55.96  ? 224  PHE A O     1 
ATOM   1673  C  CB    . PHE A  1  224  ? 59.154  -103.998 98.189  1.00 55.59  ? 224  PHE A CB    1 
ATOM   1674  C  CG    . PHE A  1  224  ? 59.244  -102.734 99.009  1.00 56.07  ? 224  PHE A CG    1 
ATOM   1675  C  CD1   . PHE A  1  224  ? 60.440  -102.359 99.611  1.00 56.05  ? 224  PHE A CD1   1 
ATOM   1676  C  CD2   . PHE A  1  224  ? 58.126  -101.934 99.205  1.00 56.22  ? 224  PHE A CD2   1 
ATOM   1677  C  CE1   . PHE A  1  224  ? 60.521  -101.207 100.398 1.00 55.49  ? 224  PHE A CE1   1 
ATOM   1678  C  CE2   . PHE A  1  224  ? 58.200  -100.783 99.989  1.00 55.88  ? 224  PHE A CE2   1 
ATOM   1679  C  CZ    . PHE A  1  224  ? 59.400  -100.422 100.586 1.00 55.27  ? 224  PHE A CZ    1 
ATOM   1680  N  N     . ASN A  1  225  ? 57.353  -106.056 97.699  1.00 54.41  ? 225  ASN A N     1 
ATOM   1681  C  CA    . ASN A  1  225  ? 56.525  -107.068 97.046  1.00 54.19  ? 225  ASN A CA    1 
ATOM   1682  C  C     . ASN A  1  225  ? 55.678  -106.563 95.882  1.00 54.69  ? 225  ASN A C     1 
ATOM   1683  O  O     . ASN A  1  225  ? 54.765  -105.756 96.064  1.00 55.54  ? 225  ASN A O     1 
ATOM   1684  C  CB    . ASN A  1  225  ? 55.590  -107.701 98.063  1.00 54.25  ? 225  ASN A CB    1 
ATOM   1685  C  CG    . ASN A  1  225  ? 54.778  -108.828 97.473  1.00 54.13  ? 225  ASN A CG    1 
ATOM   1686  O  OD1   . ASN A  1  225  ? 55.029  -109.992 97.767  1.00 54.52  ? 225  ASN A OD1   1 
ATOM   1687  N  ND2   . ASN A  1  225  ? 53.805  -108.494 96.626  1.00 52.54  ? 225  ASN A ND2   1 
ATOM   1688  N  N     . GLU A  1  226  ? 55.962  -107.094 94.700  1.00 53.99  ? 226  GLU A N     1 
ATOM   1689  C  CA    . GLU A  1  226  ? 55.283  -106.743 93.458  1.00 52.54  ? 226  GLU A CA    1 
ATOM   1690  C  C     . GLU A  1  226  ? 53.759  -106.707 93.467  1.00 50.87  ? 226  GLU A C     1 
ATOM   1691  O  O     . GLU A  1  226  ? 53.154  -105.907 92.757  1.00 50.89  ? 226  GLU A O     1 
ATOM   1692  C  CB    . GLU A  1  226  ? 55.730  -107.713 92.379  1.00 54.33  ? 226  GLU A CB    1 
ATOM   1693  C  CG    . GLU A  1  226  ? 55.132  -107.477 91.022  1.00 57.56  ? 226  GLU A CG    1 
ATOM   1694  C  CD    . GLU A  1  226  ? 55.256  -108.709 90.144  1.00 60.22  ? 226  GLU A CD    1 
ATOM   1695  O  OE1   . GLU A  1  226  ? 56.345  -109.330 90.133  1.00 60.52  ? 226  GLU A OE1   1 
ATOM   1696  O  OE2   . GLU A  1  226  ? 54.263  -109.057 89.468  1.00 61.56  ? 226  GLU A OE2   1 
ATOM   1697  N  N     . VAL A  1  227  ? 53.130  -107.567 94.255  1.00 49.04  ? 227  VAL A N     1 
ATOM   1698  C  CA    . VAL A  1  227  ? 51.675  -107.616 94.267  1.00 47.99  ? 227  VAL A CA    1 
ATOM   1699  C  C     . VAL A  1  227  ? 50.986  -106.926 95.417  1.00 48.14  ? 227  VAL A C     1 
ATOM   1700  O  O     . VAL A  1  227  ? 49.932  -106.310 95.242  1.00 47.17  ? 227  VAL A O     1 
ATOM   1701  C  CB    . VAL A  1  227  ? 51.181  -109.042 94.305  1.00 47.39  ? 227  VAL A CB    1 
ATOM   1702  C  CG1   . VAL A  1  227  ? 49.712  -109.076 93.961  1.00 46.93  ? 227  VAL A CG1   1 
ATOM   1703  C  CG2   . VAL A  1  227  ? 51.999  -109.894 93.372  1.00 47.80  ? 227  VAL A CG2   1 
ATOM   1704  N  N     . PHE A  1  228  ? 51.584  -107.051 96.595  1.00 48.80  ? 228  PHE A N     1 
ATOM   1705  C  CA    . PHE A  1  228  ? 51.014  -106.497 97.815  1.00 48.97  ? 228  PHE A CA    1 
ATOM   1706  C  C     . PHE A  1  228  ? 51.581  -105.208 98.412  1.00 49.99  ? 228  PHE A C     1 
ATOM   1707  O  O     . PHE A  1  228  ? 50.868  -104.543 99.169  1.00 51.74  ? 228  PHE A O     1 
ATOM   1708  C  CB    . PHE A  1  228  ? 51.008  -107.570 98.895  1.00 47.23  ? 228  PHE A CB    1 
ATOM   1709  C  CG    . PHE A  1  228  ? 50.207  -108.779 98.538  1.00 45.52  ? 228  PHE A CG    1 
ATOM   1710  C  CD1   . PHE A  1  228  ? 50.797  -110.031 98.511  1.00 43.66  ? 228  PHE A CD1   1 
ATOM   1711  C  CD2   . PHE A  1  228  ? 48.856  -108.670 98.254  1.00 45.37  ? 228  PHE A CD2   1 
ATOM   1712  C  CE1   . PHE A  1  228  ? 50.058  -111.147 98.210  1.00 42.15  ? 228  PHE A CE1   1 
ATOM   1713  C  CE2   . PHE A  1  228  ? 48.108  -109.790 97.949  1.00 43.79  ? 228  PHE A CE2   1 
ATOM   1714  C  CZ    . PHE A  1  228  ? 48.713  -111.028 97.930  1.00 42.84  ? 228  PHE A CZ    1 
ATOM   1715  N  N     . SER A  1  229  ? 52.836  -104.854 98.128  1.00 48.98  ? 229  SER A N     1 
ATOM   1716  C  CA    . SER A  1  229  ? 53.368  -103.601 98.673  1.00 48.47  ? 229  SER A CA    1 
ATOM   1717  C  C     . SER A  1  229  ? 54.579  -103.033 97.947  1.00 48.37  ? 229  SER A C     1 
ATOM   1718  O  O     . SER A  1  229  ? 55.710  -103.162 98.409  1.00 48.97  ? 229  SER A O     1 
ATOM   1719  C  CB    . SER A  1  229  ? 53.707  -103.749 100.153 1.00 47.50  ? 229  SER A CB    1 
ATOM   1720  O  OG    . SER A  1  229  ? 54.856  -104.546 100.311 1.00 47.73  ? 229  SER A OG    1 
ATOM   1721  N  N     . ARG A  1  230  ? 54.336  -102.385 96.814  1.00 47.73  ? 230  ARG A N     1 
ATOM   1722  C  CA    . ARG A  1  230  ? 55.415  -101.788 96.053  1.00 46.86  ? 230  ARG A CA    1 
ATOM   1723  C  C     . ARG A  1  230  ? 55.709  -100.391 96.566  1.00 46.00  ? 230  ARG A C     1 
ATOM   1724  O  O     . ARG A  1  230  ? 54.798  -99.590  96.775  1.00 46.94  ? 230  ARG A O     1 
ATOM   1725  C  CB    . ARG A  1  230  ? 55.050  -101.712 94.578  1.00 48.42  ? 230  ARG A CB    1 
ATOM   1726  C  CG    . ARG A  1  230  ? 53.668  -102.161 94.259  1.00 50.71  ? 230  ARG A CG    1 
ATOM   1727  C  CD    . ARG A  1  230  ? 53.434  -101.958 92.798  1.00 54.68  ? 230  ARG A CD    1 
ATOM   1728  N  NE    . ARG A  1  230  ? 54.312  -102.802 91.995  1.00 58.48  ? 230  ARG A NE    1 
ATOM   1729  C  CZ    . ARG A  1  230  ? 54.609  -102.560 90.723  1.00 59.66  ? 230  ARG A CZ    1 
ATOM   1730  N  NH1   . ARG A  1  230  ? 54.102  -101.489 90.119  1.00 60.96  ? 230  ARG A NH1   1 
ATOM   1731  N  NH2   . ARG A  1  230  ? 55.388  -103.400 90.050  1.00 59.98  ? 230  ARG A NH2   1 
ATOM   1732  N  N     . PRO A  1  231  ? 56.992  -100.074 96.753  1.00 44.21  ? 231  PRO A N     1 
ATOM   1733  C  CA    . PRO A  1  231  ? 57.473  -98.787  97.240  1.00 43.58  ? 231  PRO A CA    1 
ATOM   1734  C  C     . PRO A  1  231  ? 56.570  -97.588  96.978  1.00 43.10  ? 231  PRO A C     1 
ATOM   1735  O  O     . PRO A  1  231  ? 56.153  -96.914  97.911  1.00 41.98  ? 231  PRO A O     1 
ATOM   1736  C  CB    . PRO A  1  231  ? 58.815  -98.661  96.546  1.00 43.77  ? 231  PRO A CB    1 
ATOM   1737  C  CG    . PRO A  1  231  ? 59.313  -100.035 96.631  1.00 43.33  ? 231  PRO A CG    1 
ATOM   1738  C  CD    . PRO A  1  231  ? 58.118  -100.867 96.238  1.00 44.07  ? 231  PRO A CD    1 
ATOM   1739  N  N     . GLU A  1  232  ? 56.261  -97.325  95.713  1.00 43.45  ? 232  GLU A N     1 
ATOM   1740  C  CA    . GLU A  1  232  ? 55.443  -96.168  95.382  1.00 44.71  ? 232  GLU A CA    1 
ATOM   1741  C  C     . GLU A  1  232  ? 54.210  -96.013  96.247  1.00 45.39  ? 232  GLU A C     1 
ATOM   1742  O  O     . GLU A  1  232  ? 53.768  -94.894  96.504  1.00 46.01  ? 232  GLU A O     1 
ATOM   1743  C  CB    . GLU A  1  232  ? 55.024  -96.169  93.900  1.00 44.55  ? 232  GLU A CB    1 
ATOM   1744  C  CG    . GLU A  1  232  ? 54.268  -97.381  93.429  1.00 45.61  ? 232  GLU A CG    1 
ATOM   1745  C  CD    . GLU A  1  232  ? 55.119  -98.274  92.546  1.00 48.06  ? 232  GLU A CD    1 
ATOM   1746  O  OE1   . GLU A  1  232  ? 56.223  -98.685  92.986  1.00 47.08  ? 232  GLU A OE1   1 
ATOM   1747  O  OE2   . GLU A  1  232  ? 54.678  -98.564  91.409  1.00 48.74  ? 232  GLU A OE2   1 
ATOM   1748  N  N     . TRP A  1  233  ? 53.657  -97.119  96.720  1.00 45.15  ? 233  TRP A N     1 
ATOM   1749  C  CA    . TRP A  1  233  ? 52.448  -97.022  97.520  1.00 45.10  ? 233  TRP A CA    1 
ATOM   1750  C  C     . TRP A  1  233  ? 52.591  -96.411  98.900  1.00 44.27  ? 233  TRP A C     1 
ATOM   1751  O  O     . TRP A  1  233  ? 51.590  -96.191  99.581  1.00 44.33  ? 233  TRP A O     1 
ATOM   1752  C  CB    . TRP A  1  233  ? 51.795  -98.382  97.635  1.00 47.17  ? 233  TRP A CB    1 
ATOM   1753  C  CG    . TRP A  1  233  ? 51.280  -98.868  96.344  1.00 49.10  ? 233  TRP A CG    1 
ATOM   1754  C  CD1   . TRP A  1  233  ? 50.830  -98.112  95.303  1.00 49.41  ? 233  TRP A CD1   1 
ATOM   1755  C  CD2   . TRP A  1  233  ? 51.070  -100.226 95.978  1.00 50.22  ? 233  TRP A CD2   1 
ATOM   1756  N  NE1   . TRP A  1  233  ? 50.346  -98.919  94.309  1.00 49.79  ? 233  TRP A NE1   1 
ATOM   1757  C  CE2   . TRP A  1  233  ? 50.482  -100.225 94.698  1.00 50.21  ? 233  TRP A CE2   1 
ATOM   1758  C  CE3   . TRP A  1  233  ? 51.316  -101.449 96.610  1.00 51.15  ? 233  TRP A CE3   1 
ATOM   1759  C  CZ2   . TRP A  1  233  ? 50.135  -101.401 94.035  1.00 51.45  ? 233  TRP A CZ2   1 
ATOM   1760  C  CZ3   . TRP A  1  233  ? 50.968  -102.625 95.951  1.00 52.13  ? 233  TRP A CZ3   1 
ATOM   1761  C  CH2   . TRP A  1  233  ? 50.384  -102.590 94.676  1.00 52.54  ? 233  TRP A CH2   1 
ATOM   1762  N  N     . MET A  1  234  ? 53.822  -96.148  99.326  1.00 42.16  ? 234  MET A N     1 
ATOM   1763  C  CA    . MET A  1  234  ? 54.025  -95.526  100.621 1.00 40.08  ? 234  MET A CA    1 
ATOM   1764  C  C     . MET A  1  234  ? 53.635  -94.061  100.461 1.00 40.37  ? 234  MET A C     1 
ATOM   1765  O  O     . MET A  1  234  ? 53.409  -93.350  101.436 1.00 42.35  ? 234  MET A O     1 
ATOM   1766  C  CB    . MET A  1  234  ? 55.479  -95.639  101.054 1.00 37.66  ? 234  MET A CB    1 
ATOM   1767  C  CG    . MET A  1  234  ? 55.861  -97.022  101.455 1.00 37.55  ? 234  MET A CG    1 
ATOM   1768  S  SD    . MET A  1  234  ? 57.589  -97.147  101.902 1.00 43.14  ? 234  MET A SD    1 
ATOM   1769  C  CE    . MET A  1  234  ? 58.287  -97.408  100.297 1.00 40.92  ? 234  MET A CE    1 
ATOM   1770  N  N     . ILE A  1  235  ? 53.534  -93.616  99.215  1.00 39.13  ? 235  ILE A N     1 
ATOM   1771  C  CA    . ILE A  1  235  ? 53.174  -92.233  98.934  1.00 37.84  ? 235  ILE A CA    1 
ATOM   1772  C  C     . ILE A  1  235  ? 51.688  -92.130  98.617  1.00 37.42  ? 235  ILE A C     1 
ATOM   1773  O  O     . ILE A  1  235  ? 51.228  -92.587  97.579  1.00 38.62  ? 235  ILE A O     1 
ATOM   1774  C  CB    . ILE A  1  235  ? 54.026  -91.688  97.769  1.00 36.79  ? 235  ILE A CB    1 
ATOM   1775  C  CG1   . ILE A  1  235  ? 55.478  -91.523  98.240  1.00 35.74  ? 235  ILE A CG1   1 
ATOM   1776  C  CG2   . ILE A  1  235  ? 53.469  -90.368  97.293  1.00 36.53  ? 235  ILE A CG2   1 
ATOM   1777  C  CD1   . ILE A  1  235  ? 56.465  -91.250  97.151  1.00 34.89  ? 235  ILE A CD1   1 
ATOM   1778  N  N     . LEU A  1  236  ? 50.936  -91.516  99.515  1.00 36.26  ? 236  LEU A N     1 
ATOM   1779  C  CA    . LEU A  1  236  ? 49.501  -91.407  99.328  1.00 36.55  ? 236  LEU A CA    1 
ATOM   1780  C  C     . LEU A  1  236  ? 49.053  -90.505  98.180  1.00 36.55  ? 236  LEU A C     1 
ATOM   1781  O  O     . LEU A  1  236  ? 49.424  -89.343  98.100  1.00 37.35  ? 236  LEU A O     1 
ATOM   1782  C  CB    . LEU A  1  236  ? 48.865  -90.965  100.645 1.00 36.48  ? 236  LEU A CB    1 
ATOM   1783  C  CG    . LEU A  1  236  ? 49.486  -91.615  101.898 1.00 37.13  ? 236  LEU A CG    1 
ATOM   1784  C  CD1   . LEU A  1  236  ? 48.659  -91.244  103.114 1.00 37.37  ? 236  LEU A CD1   1 
ATOM   1785  C  CD2   . LEU A  1  236  ? 49.551  -93.129  101.763 1.00 36.63  ? 236  LEU A CD2   1 
ATOM   1786  N  N     . THR A  1  237  ? 48.245  -91.063  97.290  1.00 36.43  ? 237  THR A N     1 
ATOM   1787  C  CA    . THR A  1  237  ? 47.735  -90.330  96.147  1.00 37.04  ? 237  THR A CA    1 
ATOM   1788  C  C     . THR A  1  237  ? 46.239  -90.252  96.251  1.00 38.54  ? 237  THR A C     1 
ATOM   1789  O  O     . THR A  1  237  ? 45.639  -89.204  96.023  1.00 39.66  ? 237  THR A O     1 
ATOM   1790  C  CB    . THR A  1  237  ? 48.069  -91.044  94.856  1.00 36.97  ? 237  THR A CB    1 
ATOM   1791  O  OG1   . THR A  1  237  ? 49.462  -90.883  94.608  1.00 37.49  ? 237  THR A OG1   1 
ATOM   1792  C  CG2   . THR A  1  237  ? 47.237  -90.496  93.680  1.00 35.74  ? 237  THR A CG2   1 
ATOM   1793  N  N     . CYS A  1  238  ? 45.639  -91.393  96.563  1.00 39.05  ? 238  CYS A N     1 
ATOM   1794  C  CA    . CYS A  1  238  ? 44.198  -91.486  96.725  1.00 38.19  ? 238  CYS A CA    1 
ATOM   1795  C  C     . CYS A  1  238  ? 43.993  -91.957  98.150  1.00 36.99  ? 238  CYS A C     1 
ATOM   1796  O  O     . CYS A  1  238  ? 44.506  -93.006  98.533  1.00 38.04  ? 238  CYS A O     1 
ATOM   1797  C  CB    . CYS A  1  238  ? 43.614  -92.496  95.755  1.00 38.63  ? 238  CYS A CB    1 
ATOM   1798  S  SG    . CYS A  1  238  ? 41.845  -92.638  95.945  1.00 42.52  ? 238  CYS A SG    1 
ATOM   1799  N  N     . LEU A  1  239  ? 43.244  -91.184  98.928  1.00 34.38  ? 239  LEU A N     1 
ATOM   1800  C  CA    . LEU A  1  239  ? 43.026  -91.496  100.331 1.00 31.51  ? 239  LEU A CA    1 
ATOM   1801  C  C     . LEU A  1  239  ? 41.742  -92.230  100.664 1.00 30.60  ? 239  LEU A C     1 
ATOM   1802  O  O     . LEU A  1  239  ? 40.647  -91.769  100.340 1.00 30.91  ? 239  LEU A O     1 
ATOM   1803  C  CB    . LEU A  1  239  ? 43.069  -90.207  101.136 1.00 30.54  ? 239  LEU A CB    1 
ATOM   1804  C  CG    . LEU A  1  239  ? 43.424  -90.386  102.593 1.00 29.00  ? 239  LEU A CG    1 
ATOM   1805  C  CD1   . LEU A  1  239  ? 44.780  -91.048  102.677 1.00 29.01  ? 239  LEU A CD1   1 
ATOM   1806  C  CD2   . LEU A  1  239  ? 43.449  -89.041  103.269 1.00 28.86  ? 239  LEU A CD2   1 
ATOM   1807  N  N     . PRO A  1  240  ? 41.859  -93.385  101.334 1.00 28.83  ? 240  PRO A N     1 
ATOM   1808  C  CA    . PRO A  1  240  ? 40.690  -94.183  101.721 1.00 27.86  ? 240  PRO A CA    1 
ATOM   1809  C  C     . PRO A  1  240  ? 39.936  -93.504  102.874 1.00 26.94  ? 240  PRO A C     1 
ATOM   1810  O  O     . PRO A  1  240  ? 40.532  -93.170  103.910 1.00 28.34  ? 240  PRO A O     1 
ATOM   1811  C  CB    . PRO A  1  240  ? 41.309  -95.514  102.125 1.00 27.03  ? 240  PRO A CB    1 
ATOM   1812  C  CG    . PRO A  1  240  ? 42.628  -95.098  102.700 1.00 27.52  ? 240  PRO A CG    1 
ATOM   1813  C  CD    . PRO A  1  240  ? 43.111  -94.058  101.719 1.00 27.75  ? 240  PRO A CD    1 
ATOM   1814  N  N     . VAL A  1  241  ? 38.635  -93.299  102.686 1.00 23.82  ? 241  VAL A N     1 
ATOM   1815  C  CA    . VAL A  1  241  ? 37.795  -92.654  103.689 1.00 22.54  ? 241  VAL A CA    1 
ATOM   1816  C  C     . VAL A  1  241  ? 36.999  -93.644  104.525 1.00 22.18  ? 241  VAL A C     1 
ATOM   1817  O  O     . VAL A  1  241  ? 35.992  -94.172  104.046 1.00 23.64  ? 241  VAL A O     1 
ATOM   1818  C  CB    . VAL A  1  241  ? 36.779  -91.736  103.037 1.00 22.04  ? 241  VAL A CB    1 
ATOM   1819  C  CG1   . VAL A  1  241  ? 35.866  -91.156  104.106 1.00 21.22  ? 241  VAL A CG1   1 
ATOM   1820  C  CG2   . VAL A  1  241  ? 37.488  -90.651  102.257 1.00 22.06  ? 241  VAL A CG2   1 
ATOM   1821  N  N     . PRO A  1  242  ? 37.411  -93.886  105.790 1.00 21.24  ? 242  PRO A N     1 
ATOM   1822  C  CA    . PRO A  1  242  ? 36.716  -94.829  106.681 1.00 19.57  ? 242  PRO A CA    1 
ATOM   1823  C  C     . PRO A  1  242  ? 35.276  -94.409  106.939 1.00 20.37  ? 242  PRO A C     1 
ATOM   1824  O  O     . PRO A  1  242  ? 34.982  -93.227  107.159 1.00 21.29  ? 242  PRO A O     1 
ATOM   1825  C  CB    . PRO A  1  242  ? 37.580  -94.832  107.927 1.00 19.01  ? 242  PRO A CB    1 
ATOM   1826  C  CG    . PRO A  1  242  ? 38.136  -93.459  107.940 1.00 20.91  ? 242  PRO A CG    1 
ATOM   1827  C  CD    . PRO A  1  242  ? 38.499  -93.202  106.505 1.00 20.50  ? 242  PRO A CD    1 
ATOM   1828  N  N     . PRO A  1  243  ? 34.354  -95.383  106.905 1.00 18.94  ? 243  PRO A N     1 
ATOM   1829  C  CA    . PRO A  1  243  ? 32.910  -95.243  107.100 1.00 19.35  ? 243  PRO A CA    1 
ATOM   1830  C  C     . PRO A  1  243  ? 32.471  -94.896  108.492 1.00 20.91  ? 243  PRO A C     1 
ATOM   1831  O  O     . PRO A  1  243  ? 33.205  -95.113  109.452 1.00 23.39  ? 243  PRO A O     1 
ATOM   1832  C  CB    . PRO A  1  243  ? 32.380  -96.589  106.672 1.00 17.96  ? 243  PRO A CB    1 
ATOM   1833  C  CG    . PRO A  1  243  ? 33.437  -97.486  107.175 1.00 17.62  ? 243  PRO A CG    1 
ATOM   1834  C  CD    . PRO A  1  243  ? 34.723  -96.802  106.810 1.00 18.01  ? 243  PRO A CD    1 
ATOM   1835  N  N     . PRO A  1  244  ? 31.242  -94.372  108.619 1.00 22.64  ? 244  PRO A N     1 
ATOM   1836  C  CA    . PRO A  1  244  ? 30.596  -93.952  109.866 1.00 23.14  ? 244  PRO A CA    1 
ATOM   1837  C  C     . PRO A  1  244  ? 30.953  -94.782  111.089 1.00 23.43  ? 244  PRO A C     1 
ATOM   1838  O  O     . PRO A  1  244  ? 31.365  -94.245  112.108 1.00 25.66  ? 244  PRO A O     1 
ATOM   1839  C  CB    . PRO A  1  244  ? 29.122  -94.033  109.522 1.00 21.81  ? 244  PRO A CB    1 
ATOM   1840  C  CG    . PRO A  1  244  ? 29.126  -93.539  108.119 1.00 22.72  ? 244  PRO A CG    1 
ATOM   1841  C  CD    . PRO A  1  244  ? 30.286  -94.296  107.500 1.00 23.11  ? 244  PRO A CD    1 
ATOM   1842  N  N     . PRO A  1  245  ? 30.810  -96.102  111.006 1.00 22.58  ? 245  PRO A N     1 
ATOM   1843  C  CA    . PRO A  1  245  ? 31.135  -96.949  112.149 1.00 23.18  ? 245  PRO A CA    1 
ATOM   1844  C  C     . PRO A  1  245  ? 32.508  -96.676  112.748 1.00 24.62  ? 245  PRO A C     1 
ATOM   1845  O  O     . PRO A  1  245  ? 32.696  -96.800  113.959 1.00 26.99  ? 245  PRO A O     1 
ATOM   1846  C  CB    . PRO A  1  245  ? 31.042  -98.347  111.569 1.00 23.38  ? 245  PRO A CB    1 
ATOM   1847  C  CG    . PRO A  1  245  ? 29.969  -98.207  110.572 1.00 24.71  ? 245  PRO A CG    1 
ATOM   1848  C  CD    . PRO A  1  245  ? 30.326  -96.912  109.883 1.00 23.20  ? 245  PRO A CD    1 
ATOM   1849  N  N     . VAL A  1  246  ? 33.472  -96.314  111.912 1.00 23.65  ? 246  VAL A N     1 
ATOM   1850  C  CA    . VAL A  1  246  ? 34.808  -96.061  112.411 1.00 23.19  ? 246  VAL A CA    1 
ATOM   1851  C  C     . VAL A  1  246  ? 34.843  -94.754  113.182 1.00 25.50  ? 246  VAL A C     1 
ATOM   1852  O  O     . VAL A  1  246  ? 35.548  -94.643  114.182 1.00 24.91  ? 246  VAL A O     1 
ATOM   1853  C  CB    . VAL A  1  246  ? 35.832  -95.997  111.258 1.00 21.07  ? 246  VAL A CB    1 
ATOM   1854  C  CG1   . VAL A  1  246  ? 37.184  -95.650  111.791 1.00 19.66  ? 246  VAL A CG1   1 
ATOM   1855  C  CG2   . VAL A  1  246  ? 35.913  -97.318  110.560 1.00 20.01  ? 246  VAL A CG2   1 
ATOM   1856  N  N     . ARG A  1  247  ? 34.058  -93.782  112.715 1.00 28.63  ? 247  ARG A N     1 
ATOM   1857  C  CA    . ARG A  1  247  ? 33.982  -92.431  113.291 1.00 32.73  ? 247  ARG A CA    1 
ATOM   1858  C  C     . ARG A  1  247  ? 32.534  -92.006  113.578 1.00 35.66  ? 247  ARG A C     1 
ATOM   1859  O  O     . ARG A  1  247  ? 32.107  -90.904  113.209 1.00 35.76  ? 247  ARG A O     1 
ATOM   1860  C  CB    . ARG A  1  247  ? 34.611  -91.437  112.300 1.00 32.75  ? 247  ARG A CB    1 
ATOM   1861  C  CG    . ARG A  1  247  ? 33.969  -91.455  110.910 1.00 30.35  ? 247  ARG A CG    1 
ATOM   1862  C  CD    . ARG A  1  247  ? 34.815  -90.750  109.873 1.00 30.11  ? 247  ARG A CD    1 
ATOM   1863  N  NE    . ARG A  1  247  ? 34.307  -91.015  108.530 1.00 32.31  ? 247  ARG A NE    1 
ATOM   1864  C  CZ    . ARG A  1  247  ? 33.235  -90.434  107.997 1.00 33.99  ? 247  ARG A CZ    1 
ATOM   1865  N  NH1   . ARG A  1  247  ? 32.545  -89.535  108.687 1.00 35.30  ? 247  ARG A NH1   1 
ATOM   1866  N  NH2   . ARG A  1  247  ? 32.839  -90.760  106.774 1.00 32.89  ? 247  ARG A NH2   1 
ATOM   1867  N  N     . PRO A  1  248  ? 31.774  -92.860  114.277 1.00 38.81  ? 248  PRO A N     1 
ATOM   1868  C  CA    . PRO A  1  248  ? 30.375  -92.599  114.611 1.00 41.91  ? 248  PRO A CA    1 
ATOM   1869  C  C     . PRO A  1  248  ? 30.176  -91.324  115.369 1.00 46.92  ? 248  PRO A C     1 
ATOM   1870  O  O     . PRO A  1  248  ? 31.053  -90.898  116.111 1.00 47.36  ? 248  PRO A O     1 
ATOM   1871  C  CB    . PRO A  1  248  ? 30.000  -93.803  115.450 1.00 40.07  ? 248  PRO A CB    1 
ATOM   1872  C  CG    . PRO A  1  248  ? 31.235  -94.042  116.199 1.00 39.31  ? 248  PRO A CG    1 
ATOM   1873  C  CD    . PRO A  1  248  ? 32.297  -93.938  115.130 1.00 39.02  ? 248  PRO A CD    1 
ATOM   1874  N  N     . SER A  1  249  ? 29.008  -90.729  115.185 1.00 52.45  ? 249  SER A N     1 
ATOM   1875  C  CA    . SER A  1  249  ? 28.655  -89.500  115.870 1.00 58.93  ? 249  SER A CA    1 
ATOM   1876  C  C     . SER A  1  249  ? 28.212  -89.835  117.296 1.00 64.44  ? 249  SER A C     1 
ATOM   1877  O  O     . SER A  1  249  ? 28.652  -90.829  117.858 1.00 65.13  ? 249  SER A O     1 
ATOM   1878  C  CB    . SER A  1  249  ? 27.529  -88.812  115.113 1.00 58.55  ? 249  SER A CB    1 
ATOM   1879  O  OG    . SER A  1  249  ? 26.536  -89.754  114.770 1.00 59.90  ? 249  SER A OG    1 
ATOM   1880  N  N     . ILE A  1  250  ? 27.362  -88.987  117.871 1.00 71.24  ? 250  ILE A N     1 
ATOM   1881  C  CA    . ILE A  1  250  ? 26.795  -89.133  119.226 1.00 77.85  ? 250  ILE A CA    1 
ATOM   1882  C  C     . ILE A  1  250  ? 25.802  -87.981  119.421 1.00 83.25  ? 250  ILE A C     1 
ATOM   1883  O  O     . ILE A  1  250  ? 26.077  -87.017  120.155 1.00 83.75  ? 250  ILE A O     1 
ATOM   1884  C  CB    . ILE A  1  250  ? 27.869  -89.067  120.362 1.00 76.83  ? 250  ILE A CB    1 
ATOM   1885  C  CG1   . ILE A  1  250  ? 28.571  -90.418  120.491 1.00 76.31  ? 250  ILE A CG1   1 
ATOM   1886  C  CG2   . ILE A  1  250  ? 27.208  -88.740  121.718 1.00 77.27  ? 250  ILE A CG2   1 
ATOM   1887  C  CD1   . ILE A  1  250  ? 29.467  -90.527  121.685 1.00 76.73  ? 250  ILE A CD1   1 
ATOM   1888  N  N     . SER A  1  251  ? 24.654  -88.091  118.739 1.00 89.03  ? 251  SER A N     1 
ATOM   1889  C  CA    . SER A  1  251  ? 23.585  -87.080  118.778 1.00 93.70  ? 251  SER A CA    1 
ATOM   1890  C  C     . SER A  1  251  ? 22.857  -86.955  120.127 1.00 96.74  ? 251  SER A C     1 
ATOM   1891  O  O     . SER A  1  251  ? 22.886  -87.873  120.957 1.00 97.58  ? 251  SER A O     1 
ATOM   1892  C  CB    . SER A  1  251  ? 22.565  -87.341  117.645 1.00 93.34  ? 251  SER A CB    1 
ATOM   1893  O  OG    . SER A  1  251  ? 22.130  -88.693  117.594 1.00 92.84  ? 251  SER A OG    1 
ATOM   1894  N  N     . PHE A  1  252  ? 22.218  -85.805  120.341 1.00 99.73  ? 252  PHE A N     1 
ATOM   1895  C  CA    . PHE A  1  252  ? 21.482  -85.543  121.579 1.00 102.12 ? 252  PHE A CA    1 
ATOM   1896  C  C     . PHE A  1  252  ? 20.046  -85.167  121.196 1.00 103.00 ? 252  PHE A C     1 
ATOM   1897  O  O     . PHE A  1  252  ? 19.600  -84.030  121.374 1.00 101.52 ? 252  PHE A O     1 
ATOM   1898  C  CB    . PHE A  1  252  ? 22.185  -84.423  122.368 1.00 103.73 ? 252  PHE A CB    1 
ATOM   1899  C  CG    . PHE A  1  252  ? 23.704  -84.524  122.341 1.00 104.44 ? 252  PHE A CG    1 
ATOM   1900  C  CD1   . PHE A  1  252  ? 24.461  -83.698  121.498 1.00 104.17 ? 252  PHE A CD1   1 
ATOM   1901  C  CD2   . PHE A  1  252  ? 24.369  -85.486  123.115 1.00 104.83 ? 252  PHE A CD2   1 
ATOM   1902  C  CE1   . PHE A  1  252  ? 25.849  -83.827  121.423 1.00 103.84 ? 252  PHE A CE1   1 
ATOM   1903  C  CE2   . PHE A  1  252  ? 25.758  -85.625  123.046 1.00 104.65 ? 252  PHE A CE2   1 
ATOM   1904  C  CZ    . PHE A  1  252  ? 26.496  -84.792  122.197 1.00 104.55 ? 252  PHE A CZ    1 
ATOM   1905  N  N     . ASN A  1  253  ? 19.352  -86.168  120.653 1.00 104.75 ? 253  ASN A N     1 
ATOM   1906  C  CA    . ASN A  1  253  ? 17.971  -86.079  120.176 1.00 106.97 ? 253  ASN A CA    1 
ATOM   1907  C  C     . ASN A  1  253  ? 17.971  -85.552  118.728 1.00 108.84 ? 253  ASN A C     1 
ATOM   1908  O  O     . ASN A  1  253  ? 18.186  -86.309  117.771 1.00 109.10 ? 253  ASN A O     1 
ATOM   1909  C  CB    . ASN A  1  253  ? 17.134  -85.168  121.096 1.00 106.81 ? 253  ASN A CB    1 
ATOM   1910  C  CG    . ASN A  1  253  ? 15.620  -85.368  120.922 1.00 106.51 ? 253  ASN A CG    1 
ATOM   1911  O  OD1   . ASN A  1  253  ? 15.060  -85.098  119.854 1.00 106.65 ? 253  ASN A OD1   1 
ATOM   1912  N  ND2   . ASN A  1  253  ? 14.958  -85.837  121.980 1.00 105.39 ? 253  ASN A ND2   1 
ATOM   1913  N  N     . GLU A  1  254  ? 17.737  -84.254  118.573 1.00 110.37 ? 254  GLU A N     1 
ATOM   1914  C  CA    . GLU A  1  254  ? 17.718  -83.631  117.257 1.00 111.02 ? 254  GLU A CA    1 
ATOM   1915  C  C     . GLU A  1  254  ? 18.707  -82.483  117.195 1.00 111.34 ? 254  GLU A C     1 
ATOM   1916  O  O     . GLU A  1  254  ? 19.803  -82.558  117.759 1.00 111.55 ? 254  GLU A O     1 
ATOM   1917  C  CB    . GLU A  1  254  ? 16.327  -83.098  116.941 1.00 111.23 ? 254  GLU A CB    1 
ATOM   1918  C  CG    . GLU A  1  254  ? 15.410  -84.104  116.319 1.00 112.62 ? 254  GLU A CG    1 
ATOM   1919  C  CD    . GLU A  1  254  ? 14.050  -83.511  116.031 1.00 114.24 ? 254  GLU A CD    1 
ATOM   1920  O  OE1   . GLU A  1  254  ? 13.989  -82.427  115.403 1.00 114.59 ? 254  GLU A OE1   1 
ATOM   1921  O  OE2   . GLU A  1  254  ? 13.043  -84.132  116.430 1.00 115.50 ? 254  GLU A OE2   1 
ATOM   1922  N  N     . SER A  1  255  ? 18.285  -81.425  116.505 1.00 111.33 ? 255  SER A N     1 
ATOM   1923  C  CA    . SER A  1  255  ? 19.061  -80.200  116.307 1.00 111.17 ? 255  SER A CA    1 
ATOM   1924  C  C     . SER A  1  255  ? 20.228  -79.934  117.284 1.00 110.51 ? 255  SER A C     1 
ATOM   1925  O  O     . SER A  1  255  ? 20.108  -79.120  118.211 1.00 111.05 ? 255  SER A O     1 
ATOM   1926  C  CB    . SER A  1  255  ? 18.098  -79.000  116.294 1.00 111.41 ? 255  SER A CB    1 
ATOM   1927  O  OG    . SER A  1  255  ? 17.162  -79.070  117.360 1.00 111.78 ? 255  SER A OG    1 
ATOM   1928  N  N     . GLN A  1  256  ? 21.350  -80.625  117.052 1.00 108.72 ? 256  GLN A N     1 
ATOM   1929  C  CA    . GLN A  1  256  ? 22.588  -80.498  117.847 1.00 106.25 ? 256  GLN A CA    1 
ATOM   1930  C  C     . GLN A  1  256  ? 23.798  -80.981  117.009 1.00 103.42 ? 256  GLN A C     1 
ATOM   1931  O  O     . GLN A  1  256  ? 24.223  -80.276  116.086 1.00 103.94 ? 256  GLN A O     1 
ATOM   1932  C  CB    . GLN A  1  256  ? 22.483  -81.296  119.162 1.00 107.02 ? 256  GLN A CB    1 
ATOM   1933  C  CG    . GLN A  1  256  ? 21.524  -80.686  120.183 1.00 107.64 ? 256  GLN A CG    1 
ATOM   1934  C  CD    . GLN A  1  256  ? 21.599  -81.353  121.540 1.00 108.35 ? 256  GLN A CD    1 
ATOM   1935  O  OE1   . GLN A  1  256  ? 22.638  -81.313  122.209 1.00 108.45 ? 256  GLN A OE1   1 
ATOM   1936  N  NE2   . GLN A  1  256  ? 20.496  -81.971  121.959 1.00 108.25 ? 256  GLN A NE2   1 
ATOM   1937  N  N     . ARG A  1  257  ? 24.350  -82.158  117.334 1.00 99.00  ? 257  ARG A N     1 
ATOM   1938  C  CA    . ARG A  1  257  ? 25.480  -82.756  116.592 1.00 93.25  ? 257  ARG A CA    1 
ATOM   1939  C  C     . ARG A  1  257  ? 26.109  -83.895  117.389 1.00 87.51  ? 257  ARG A C     1 
ATOM   1940  O  O     . ARG A  1  257  ? 25.410  -84.643  118.071 1.00 86.62  ? 257  ARG A O     1 
ATOM   1941  C  CB    . ARG A  1  257  ? 26.572  -81.714  116.250 1.00 95.82  ? 257  ARG A CB    1 
ATOM   1942  C  CG    . ARG A  1  257  ? 27.241  -81.955  114.866 1.00 98.06  ? 257  ARG A CG    1 
ATOM   1943  C  CD    . ARG A  1  257  ? 28.381  -80.960  114.536 1.00 100.25 ? 257  ARG A CD    1 
ATOM   1944  N  NE    . ARG A  1  257  ? 28.784  -81.004  113.120 1.00 102.59 ? 257  ARG A NE    1 
ATOM   1945  C  CZ    . ARG A  1  257  ? 29.857  -80.394  112.606 1.00 103.23 ? 257  ARG A CZ    1 
ATOM   1946  N  NH1   . ARG A  1  257  ? 30.664  -79.682  113.383 1.00 103.39 ? 257  ARG A NH1   1 
ATOM   1947  N  NH2   . ARG A  1  257  ? 30.124  -80.488  111.305 1.00 103.10 ? 257  ARG A NH2   1 
ATOM   1948  N  N     . GLY A  1  258  ? 27.430  -84.014  117.291 1.00 81.02  ? 258  GLY A N     1 
ATOM   1949  C  CA    . GLY A  1  258  ? 28.153  -85.049  118.004 1.00 73.49  ? 258  GLY A CA    1 
ATOM   1950  C  C     . GLY A  1  258  ? 29.173  -85.747  117.127 1.00 68.66  ? 258  GLY A C     1 
ATOM   1951  O  O     . GLY A  1  258  ? 29.361  -86.947  117.247 1.00 68.93  ? 258  GLY A O     1 
ATOM   1952  N  N     . GLU A  1  259  ? 29.845  -85.006  116.253 1.00 63.81  ? 259  GLU A N     1 
ATOM   1953  C  CA    . GLU A  1  259  ? 30.827  -85.597  115.348 1.00 59.01  ? 259  GLU A CA    1 
ATOM   1954  C  C     . GLU A  1  259  ? 32.038  -86.201  116.012 1.00 56.34  ? 259  GLU A C     1 
ATOM   1955  O  O     . GLU A  1  259  ? 32.309  -85.917  117.165 1.00 55.80  ? 259  GLU A O     1 
ATOM   1956  C  CB    . GLU A  1  259  ? 31.289  -84.569  114.331 1.00 58.91  ? 259  GLU A CB    1 
ATOM   1957  C  CG    . GLU A  1  259  ? 30.251  -84.269  113.286 1.00 58.85  ? 259  GLU A CG    1 
ATOM   1958  C  CD    . GLU A  1  259  ? 29.571  -85.524  112.788 1.00 58.84  ? 259  GLU A CD    1 
ATOM   1959  O  OE1   . GLU A  1  259  ? 30.241  -86.584  112.773 1.00 58.03  ? 259  GLU A OE1   1 
ATOM   1960  O  OE2   . GLU A  1  259  ? 28.379  -85.442  112.407 1.00 58.69  ? 259  GLU A OE2   1 
ATOM   1961  N  N     . ASP A  1  260  ? 32.771  -87.028  115.269 1.00 53.41  ? 260  ASP A N     1 
ATOM   1962  C  CA    . ASP A  1  260  ? 33.967  -87.691  115.794 1.00 51.37  ? 260  ASP A CA    1 
ATOM   1963  C  C     . ASP A  1  260  ? 35.257  -86.991  115.354 1.00 49.46  ? 260  ASP A C     1 
ATOM   1964  O  O     . ASP A  1  260  ? 35.334  -86.428  114.266 1.00 48.62  ? 260  ASP A O     1 
ATOM   1965  C  CB    . ASP A  1  260  ? 33.987  -89.165  115.342 1.00 53.20  ? 260  ASP A CB    1 
ATOM   1966  C  CG    . ASP A  1  260  ? 35.044  -90.013  116.074 1.00 54.29  ? 260  ASP A CG    1 
ATOM   1967  O  OD1   . ASP A  1  260  ? 36.264  -89.826  115.847 1.00 55.17  ? 260  ASP A OD1   1 
ATOM   1968  O  OD2   . ASP A  1  260  ? 34.642  -90.877  116.883 1.00 54.32  ? 260  ASP A OD2   1 
ATOM   1969  N  N     . ASP A  1  261  ? 36.271  -87.031  116.210 1.00 47.98  ? 261  ASP A N     1 
ATOM   1970  C  CA    . ASP A  1  261  ? 37.545  -86.404  115.909 1.00 46.95  ? 261  ASP A CA    1 
ATOM   1971  C  C     . ASP A  1  261  ? 37.979  -86.682  114.502 1.00 45.19  ? 261  ASP A C     1 
ATOM   1972  O  O     . ASP A  1  261  ? 38.409  -85.777  113.794 1.00 45.39  ? 261  ASP A O     1 
ATOM   1973  C  CB    . ASP A  1  261  ? 38.637  -86.910  116.841 1.00 49.54  ? 261  ASP A CB    1 
ATOM   1974  C  CG    . ASP A  1  261  ? 38.782  -86.064  118.082 1.00 52.37  ? 261  ASP A CG    1 
ATOM   1975  O  OD1   . ASP A  1  261  ? 39.835  -86.176  118.748 1.00 53.75  ? 261  ASP A OD1   1 
ATOM   1976  O  OD2   . ASP A  1  261  ? 37.849  -85.291  118.393 1.00 54.78  ? 261  ASP A OD2   1 
ATOM   1977  N  N     . LEU A  1  262  ? 37.887  -87.949  114.111 1.00 43.21  ? 262  LEU A N     1 
ATOM   1978  C  CA    . LEU A  1  262  ? 38.293  -88.360  112.781 1.00 40.87  ? 262  LEU A CA    1 
ATOM   1979  C  C     . LEU A  1  262  ? 37.466  -87.687  111.723 1.00 39.70  ? 262  LEU A C     1 
ATOM   1980  O  O     . LEU A  1  262  ? 37.991  -87.283  110.692 1.00 40.20  ? 262  LEU A O     1 
ATOM   1981  C  CB    . LEU A  1  262  ? 38.189  -89.869  112.626 1.00 40.40  ? 262  LEU A CB    1 
ATOM   1982  C  CG    . LEU A  1  262  ? 39.388  -90.636  113.177 1.00 41.22  ? 262  LEU A CG    1 
ATOM   1983  C  CD1   . LEU A  1  262  ? 39.244  -92.101  112.802 1.00 41.21  ? 262  LEU A CD1   1 
ATOM   1984  C  CD2   . LEU A  1  262  ? 40.685  -90.077  112.596 1.00 39.82  ? 262  LEU A CD2   1 
ATOM   1985  N  N     . THR A  1  263  ? 36.171  -87.556  111.978 1.00 38.27  ? 263  THR A N     1 
ATOM   1986  C  CA    . THR A  1  263  ? 35.301  -86.911  111.017 1.00 37.07  ? 263  THR A CA    1 
ATOM   1987  C  C     . THR A  1  263  ? 35.765  -85.476  110.816 1.00 37.89  ? 263  THR A C     1 
ATOM   1988  O  O     . THR A  1  263  ? 35.605  -84.917  109.752 1.00 38.94  ? 263  THR A O     1 
ATOM   1989  C  CB    . THR A  1  263  ? 33.833  -86.926  111.461 1.00 35.62  ? 263  THR A CB    1 
ATOM   1990  O  OG1   . THR A  1  263  ? 33.408  -88.274  111.696 1.00 34.62  ? 263  THR A OG1   1 
ATOM   1991  C  CG2   . THR A  1  263  ? 32.970  -86.367  110.376 1.00 34.62  ? 263  THR A CG2   1 
ATOM   1992  N  N     . PHE A  1  264  ? 36.358  -84.868  111.828 1.00 40.28  ? 264  PHE A N     1 
ATOM   1993  C  CA    . PHE A  1  264  ? 36.841  -83.507  111.649 1.00 41.78  ? 264  PHE A CA    1 
ATOM   1994  C  C     . PHE A  1  264  ? 38.125  -83.500  110.830 1.00 41.28  ? 264  PHE A C     1 
ATOM   1995  O  O     . PHE A  1  264  ? 38.216  -82.756  109.862 1.00 40.99  ? 264  PHE A O     1 
ATOM   1996  C  CB    . PHE A  1  264  ? 37.092  -82.814  113.001 1.00 45.49  ? 264  PHE A CB    1 
ATOM   1997  C  CG    . PHE A  1  264  ? 35.833  -82.316  113.692 1.00 49.12  ? 264  PHE A CG    1 
ATOM   1998  C  CD1   . PHE A  1  264  ? 35.924  -81.537  114.850 1.00 51.32  ? 264  PHE A CD1   1 
ATOM   1999  C  CD2   . PHE A  1  264  ? 34.561  -82.646  113.210 1.00 49.72  ? 264  PHE A CD2   1 
ATOM   2000  C  CE1   . PHE A  1  264  ? 34.767  -81.104  115.515 1.00 52.21  ? 264  PHE A CE1   1 
ATOM   2001  C  CE2   . PHE A  1  264  ? 33.399  -82.217  113.870 1.00 49.14  ? 264  PHE A CE2   1 
ATOM   2002  C  CZ    . PHE A  1  264  ? 33.501  -81.450  115.017 1.00 51.19  ? 264  PHE A CZ    1 
ATOM   2003  N  N     . LYS A  1  265  ? 39.105  -84.333  111.197 1.00 41.48  ? 265  LYS A N     1 
ATOM   2004  C  CA    . LYS A  1  265  ? 40.373  -84.344  110.470 1.00 42.37  ? 265  LYS A CA    1 
ATOM   2005  C  C     . LYS A  1  265  ? 40.227  -84.702  109.017 1.00 42.75  ? 265  LYS A C     1 
ATOM   2006  O  O     . LYS A  1  265  ? 41.148  -84.497  108.220 1.00 42.94  ? 265  LYS A O     1 
ATOM   2007  C  CB    . LYS A  1  265  ? 41.420  -85.245  111.135 1.00 43.27  ? 265  LYS A CB    1 
ATOM   2008  C  CG    . LYS A  1  265  ? 42.605  -84.438  111.671 1.00 47.83  ? 265  LYS A CG    1 
ATOM   2009  C  CD    . LYS A  1  265  ? 42.182  -83.628  112.939 1.00 57.42  ? 265  LYS A CD    1 
ATOM   2010  C  CE    . LYS A  1  265  ? 40.912  -82.683  112.768 1.00 60.45  ? 265  LYS A CE    1 
ATOM   2011  N  NZ    . LYS A  1  265  ? 40.119  -82.232  114.010 1.00 60.08  ? 265  LYS A NZ    1 
ATOM   2012  N  N     . LEU A  1  266  ? 39.075  -85.242  108.651 1.00 42.63  ? 266  LEU A N     1 
ATOM   2013  C  CA    . LEU A  1  266  ? 38.881  -85.552  107.253 1.00 42.62  ? 266  LEU A CA    1 
ATOM   2014  C  C     . LEU A  1  266  ? 38.439  -84.223  106.676 1.00 42.43  ? 266  LEU A C     1 
ATOM   2015  O  O     . LEU A  1  266  ? 38.947  -83.789  105.649 1.00 43.48  ? 266  LEU A O     1 
ATOM   2016  C  CB    . LEU A  1  266  ? 37.844  -86.666  107.069 1.00 42.56  ? 266  LEU A CB    1 
ATOM   2017  C  CG    . LEU A  1  266  ? 38.422  -88.058  107.406 1.00 41.98  ? 266  LEU A CG    1 
ATOM   2018  C  CD1   . LEU A  1  266  ? 37.343  -89.114  107.325 1.00 42.89  ? 266  LEU A CD1   1 
ATOM   2019  C  CD2   . LEU A  1  266  ? 39.551  -88.402  106.447 1.00 40.90  ? 266  LEU A CD2   1 
ATOM   2020  N  N     . ALA A  1  267  ? 37.528  -83.553  107.369 1.00 41.51  ? 267  ALA A N     1 
ATOM   2021  C  CA    . ALA A  1  267  ? 37.079  -82.246  106.928 1.00 41.23  ? 267  ALA A CA    1 
ATOM   2022  C  C     . ALA A  1  267  ? 38.313  -81.359  106.728 1.00 41.35  ? 267  ALA A C     1 
ATOM   2023  O  O     . ALA A  1  267  ? 38.405  -80.628  105.750 1.00 41.43  ? 267  ALA A O     1 
ATOM   2024  C  CB    . ALA A  1  267  ? 36.169  -81.640  107.962 1.00 41.67  ? 267  ALA A CB    1 
ATOM   2025  N  N     . ASP A  1  268  ? 39.258  -81.416  107.660 1.00 41.77  ? 268  ASP A N     1 
ATOM   2026  C  CA    . ASP A  1  268  ? 40.482  -80.626  107.546 1.00 42.90  ? 268  ASP A CA    1 
ATOM   2027  C  C     . ASP A  1  268  ? 41.126  -80.954  106.221 1.00 42.59  ? 268  ASP A C     1 
ATOM   2028  O  O     . ASP A  1  268  ? 41.323  -80.087  105.381 1.00 44.08  ? 268  ASP A O     1 
ATOM   2029  C  CB    . ASP A  1  268  ? 41.479  -80.991  108.645 1.00 46.00  ? 268  ASP A CB    1 
ATOM   2030  C  CG    . ASP A  1  268  ? 41.139  -80.376  109.991 1.00 49.33  ? 268  ASP A CG    1 
ATOM   2031  O  OD1   . ASP A  1  268  ? 39.967  -79.976  110.178 1.00 51.47  ? 268  ASP A OD1   1 
ATOM   2032  O  OD2   . ASP A  1  268  ? 42.050  -80.309  110.863 1.00 50.26  ? 268  ASP A OD2   1 
ATOM   2033  N  N     . ILE A  1  269  ? 41.465  -82.225  106.060 1.00 41.51  ? 269  ILE A N     1 
ATOM   2034  C  CA    . ILE A  1  269  ? 42.090  -82.730  104.851 1.00 40.99  ? 269  ILE A CA    1 
ATOM   2035  C  C     . ILE A  1  269  ? 41.308  -82.309  103.612 1.00 41.15  ? 269  ILE A C     1 
ATOM   2036  O  O     . ILE A  1  269  ? 41.868  -81.808  102.640 1.00 39.72  ? 269  ILE A O     1 
ATOM   2037  C  CB    . ILE A  1  269  ? 42.177  -84.263  104.924 1.00 41.14  ? 269  ILE A CB    1 
ATOM   2038  C  CG1   . ILE A  1  269  ? 43.229  -84.649  105.959 1.00 40.58  ? 269  ILE A CG1   1 
ATOM   2039  C  CG2   . ILE A  1  269  ? 42.503  -84.850  103.569 1.00 40.53  ? 269  ILE A CG2   1 
ATOM   2040  C  CD1   . ILE A  1  269  ? 43.229  -86.104  106.288 1.00 41.16  ? 269  ILE A CD1   1 
ATOM   2041  N  N     . LEU A  1  270  ? 40.001  -82.512  103.665 1.00 42.15  ? 270  LEU A N     1 
ATOM   2042  C  CA    . LEU A  1  270  ? 39.129  -82.163  102.563 1.00 43.29  ? 270  LEU A CA    1 
ATOM   2043  C  C     . LEU A  1  270  ? 39.299  -80.694  102.243 1.00 43.99  ? 270  LEU A C     1 
ATOM   2044  O  O     . LEU A  1  270  ? 39.607  -80.337  101.119 1.00 45.90  ? 270  LEU A O     1 
ATOM   2045  C  CB    . LEU A  1  270  ? 37.686  -82.459  102.942 1.00 44.05  ? 270  LEU A CB    1 
ATOM   2046  C  CG    . LEU A  1  270  ? 36.792  -82.972  101.820 1.00 45.69  ? 270  LEU A CG    1 
ATOM   2047  C  CD1   . LEU A  1  270  ? 37.516  -84.048  101.034 1.00 46.18  ? 270  LEU A CD1   1 
ATOM   2048  C  CD2   . LEU A  1  270  ? 35.514  -83.539  102.418 1.00 46.29  ? 270  LEU A CD2   1 
ATOM   2049  N  N     . LYS A  1  271  ? 39.097  -79.841  103.236 1.00 45.07  ? 271  LYS A N     1 
ATOM   2050  C  CA    . LYS A  1  271  ? 39.259  -78.404  103.048 1.00 45.52  ? 271  LYS A CA    1 
ATOM   2051  C  C     . LYS A  1  271  ? 40.659  -78.146  102.502 1.00 44.42  ? 271  LYS A C     1 
ATOM   2052  O  O     . LYS A  1  271  ? 40.834  -77.615  101.405 1.00 43.54  ? 271  LYS A O     1 
ATOM   2053  C  CB    . LYS A  1  271  ? 39.084  -77.673  104.390 1.00 46.17  ? 271  LYS A CB    1 
ATOM   2054  C  CG    . LYS A  1  271  ? 37.675  -77.751  104.966 1.00 47.01  ? 271  LYS A CG    1 
ATOM   2055  C  CD    . LYS A  1  271  ? 37.630  -77.295  106.417 1.00 48.56  ? 271  LYS A CD    1 
ATOM   2056  C  CE    . LYS A  1  271  ? 36.210  -77.411  106.984 1.00 50.25  ? 271  LYS A CE    1 
ATOM   2057  N  NZ    . LYS A  1  271  ? 36.174  -77.557  108.480 1.00 50.55  ? 271  LYS A NZ    1 
ATOM   2058  N  N     . ALA A  1  272  ? 41.650  -78.548  103.284 1.00 44.83  ? 272  ALA A N     1 
ATOM   2059  C  CA    . ALA A  1  272  ? 43.049  -78.370  102.926 1.00 46.63  ? 272  ALA A CA    1 
ATOM   2060  C  C     . ALA A  1  272  ? 43.350  -78.776  101.492 1.00 46.52  ? 272  ALA A C     1 
ATOM   2061  O  O     . ALA A  1  272  ? 44.210  -78.178  100.839 1.00 45.89  ? 272  ALA A O     1 
ATOM   2062  C  CB    . ALA A  1  272  ? 43.944  -79.159  103.898 1.00 47.61  ? 272  ALA A CB    1 
ATOM   2063  N  N     . ASN A  1  273  ? 42.647  -79.795  101.010 1.00 47.49  ? 273  ASN A N     1 
ATOM   2064  C  CA    . ASN A  1  273  ? 42.854  -80.274  99.650  1.00 49.00  ? 273  ASN A CA    1 
ATOM   2065  C  C     . ASN A  1  273  ? 42.225  -79.295  98.674  1.00 50.57  ? 273  ASN A C     1 
ATOM   2066  O  O     . ASN A  1  273  ? 42.931  -78.697  97.861  1.00 51.61  ? 273  ASN A O     1 
ATOM   2067  C  CB    . ASN A  1  273  ? 42.240  -81.661  99.461  1.00 47.85  ? 273  ASN A CB    1 
ATOM   2068  C  CG    . ASN A  1  273  ? 42.969  -82.486  98.403  1.00 47.11  ? 273  ASN A CG    1 
ATOM   2069  O  OD1   . ASN A  1  273  ? 44.174  -82.727  98.513  1.00 46.85  ? 273  ASN A OD1   1 
ATOM   2070  N  ND2   . ASN A  1  273  ? 42.239  -82.931  97.384  1.00 45.15  ? 273  ASN A ND2   1 
ATOM   2071  N  N     . ILE A  1  274  ? 40.904  -79.127  98.758  1.00 52.45  ? 274  ILE A N     1 
ATOM   2072  C  CA    . ILE A  1  274  ? 40.182  -78.204  97.882  1.00 54.02  ? 274  ILE A CA    1 
ATOM   2073  C  C     . ILE A  1  274  ? 40.987  -76.914  97.718  1.00 57.16  ? 274  ILE A C     1 
ATOM   2074  O  O     . ILE A  1  274  ? 41.193  -76.434  96.595  1.00 58.25  ? 274  ILE A O     1 
ATOM   2075  C  CB    . ILE A  1  274  ? 38.799  -77.854  98.453  1.00 51.89  ? 274  ILE A CB    1 
ATOM   2076  C  CG1   . ILE A  1  274  ? 37.945  -79.109  98.563  1.00 51.91  ? 274  ILE A CG1   1 
ATOM   2077  C  CG2   . ILE A  1  274  ? 38.115  -76.861  97.567  1.00 52.00  ? 274  ILE A CG2   1 
ATOM   2078  C  CD1   . ILE A  1  274  ? 36.514  -78.834  98.954  1.00 52.56  ? 274  ILE A CD1   1 
ATOM   2079  N  N     . SER A  1  275  ? 41.450  -76.365  98.840  1.00 59.07  ? 275  SER A N     1 
ATOM   2080  C  CA    . SER A  1  275  ? 42.250  -75.146  98.819  1.00 60.52  ? 275  SER A CA    1 
ATOM   2081  C  C     . SER A  1  275  ? 43.400  -75.291  97.821  1.00 61.51  ? 275  SER A C     1 
ATOM   2082  O  O     . SER A  1  275  ? 43.479  -74.547  96.844  1.00 61.30  ? 275  SER A O     1 
ATOM   2083  C  CB    . SER A  1  275  ? 42.810  -74.861  100.213 1.00 60.62  ? 275  SER A CB    1 
ATOM   2084  O  OG    . SER A  1  275  ? 43.586  -73.678  100.218 1.00 60.91  ? 275  SER A OG    1 
ATOM   2085  N  N     . LEU A  1  276  ? 44.280  -76.260  98.065  1.00 63.01  ? 276  LEU A N     1 
ATOM   2086  C  CA    . LEU A  1  276  ? 45.423  -76.489  97.187  1.00 65.60  ? 276  LEU A CA    1 
ATOM   2087  C  C     . LEU A  1  276  ? 44.992  -76.507  95.727  1.00 68.42  ? 276  LEU A C     1 
ATOM   2088  O  O     . LEU A  1  276  ? 45.421  -75.669  94.932  1.00 70.02  ? 276  LEU A O     1 
ATOM   2089  C  CB    . LEU A  1  276  ? 46.116  -77.816  97.522  1.00 63.01  ? 276  LEU A CB    1 
ATOM   2090  C  CG    . LEU A  1  276  ? 47.481  -78.072  96.870  1.00 61.12  ? 276  LEU A CG    1 
ATOM   2091  C  CD1   . LEU A  1  276  ? 48.479  -77.064  97.394  1.00 61.00  ? 276  LEU A CD1   1 
ATOM   2092  C  CD2   . LEU A  1  276  ? 47.967  -79.471  97.178  1.00 60.23  ? 276  LEU A CD2   1 
ATOM   2093  N  N     . GLU A  1  277  ? 44.130  -77.454  95.381  1.00 70.95  ? 277  GLU A N     1 
ATOM   2094  C  CA    . GLU A  1  277  ? 43.660  -77.587  94.010  1.00 74.15  ? 277  GLU A CA    1 
ATOM   2095  C  C     . GLU A  1  277  ? 43.167  -76.288  93.346  1.00 75.17  ? 277  GLU A C     1 
ATOM   2096  O  O     . GLU A  1  277  ? 43.455  -76.032  92.167  1.00 76.39  ? 277  GLU A O     1 
ATOM   2097  C  CB    . GLU A  1  277  ? 42.563  -78.636  93.950  1.00 75.49  ? 277  GLU A CB    1 
ATOM   2098  C  CG    . GLU A  1  277  ? 42.070  -78.864  92.558  1.00 79.32  ? 277  GLU A CG    1 
ATOM   2099  C  CD    . GLU A  1  277  ? 40.649  -79.353  92.555  1.00 82.43  ? 277  GLU A CD    1 
ATOM   2100  O  OE1   . GLU A  1  277  ? 39.901  -78.989  93.497  1.00 83.68  ? 277  GLU A OE1   1 
ATOM   2101  O  OE2   . GLU A  1  277  ? 40.279  -80.081  91.607  1.00 83.95  ? 277  GLU A OE2   1 
ATOM   2102  N  N     . THR A  1  278  ? 42.422  -75.472  94.087  1.00 74.81  ? 278  THR A N     1 
ATOM   2103  C  CA    . THR A  1  278  ? 41.916  -74.223  93.527  1.00 74.18  ? 278  THR A CA    1 
ATOM   2104  C  C     . THR A  1  278  ? 43.040  -73.182  93.447  1.00 74.32  ? 278  THR A C     1 
ATOM   2105  O  O     . THR A  1  278  ? 42.792  -71.995  93.283  1.00 75.51  ? 278  THR A O     1 
ATOM   2106  C  CB    . THR A  1  278  ? 40.704  -73.696  94.364  1.00 73.33  ? 278  THR A CB    1 
ATOM   2107  O  OG1   . THR A  1  278  ? 39.657  -74.675  94.341  1.00 73.08  ? 278  THR A OG1   1 
ATOM   2108  C  CG2   . THR A  1  278  ? 40.147  -72.402  93.791  1.00 72.20  ? 278  THR A CG2   1 
ATOM   2109  N  N     . LEU A  1  279  ? 44.283  -73.633  93.562  1.00 73.83  ? 279  LEU A N     1 
ATOM   2110  C  CA    . LEU A  1  279  ? 45.424  -72.732  93.469  1.00 74.15  ? 279  LEU A CA    1 
ATOM   2111  C  C     . LEU A  1  279  ? 46.240  -73.184  92.280  1.00 75.98  ? 279  LEU A C     1 
ATOM   2112  O  O     . LEU A  1  279  ? 47.140  -72.488  91.830  1.00 76.58  ? 279  LEU A O     1 
ATOM   2113  C  CB    . LEU A  1  279  ? 46.295  -72.798  94.723  1.00 71.18  ? 279  LEU A CB    1 
ATOM   2114  C  CG    . LEU A  1  279  ? 45.724  -72.362  96.065  1.00 68.46  ? 279  LEU A CG    1 
ATOM   2115  C  CD1   . LEU A  1  279  ? 46.819  -72.432  97.106  1.00 67.90  ? 279  LEU A CD1   1 
ATOM   2116  C  CD2   . LEU A  1  279  ? 45.191  -70.961  95.967  1.00 66.80  ? 279  LEU A CD2   1 
ATOM   2117  N  N     . GLU A  1  280  ? 45.922  -74.370  91.780  1.00 78.51  ? 280  GLU A N     1 
ATOM   2118  C  CA    . GLU A  1  280  ? 46.621  -74.929  90.635  1.00 82.21  ? 280  GLU A CA    1 
ATOM   2119  C  C     . GLU A  1  280  ? 45.756  -74.767  89.404  1.00 84.16  ? 280  GLU A C     1 
ATOM   2120  O  O     . GLU A  1  280  ? 46.167  -75.069  88.287  1.00 84.02  ? 280  GLU A O     1 
ATOM   2121  C  CB    . GLU A  1  280  ? 46.934  -76.397  90.888  1.00 82.86  ? 280  GLU A CB    1 
ATOM   2122  C  CG    . GLU A  1  280  ? 47.945  -76.561  92.001  1.00 85.50  ? 280  GLU A CG    1 
ATOM   2123  C  CD    . GLU A  1  280  ? 47.861  -77.903  92.689  1.00 86.61  ? 280  GLU A CD    1 
ATOM   2124  O  OE1   . GLU A  1  280  ? 46.770  -78.238  93.202  1.00 86.62  ? 280  GLU A OE1   1 
ATOM   2125  O  OE2   . GLU A  1  280  ? 48.889  -78.614  92.727  1.00 87.42  ? 280  GLU A OE2   1 
ATOM   2126  N  N     . HIS A  1  281  ? 44.537  -74.294  89.625  1.00 86.77  ? 281  HIS A N     1 
ATOM   2127  C  CA    . HIS A  1  281  ? 43.609  -74.044  88.536  1.00 89.00  ? 281  HIS A CA    1 
ATOM   2128  C  C     . HIS A  1  281  ? 43.440  -72.533  88.541  1.00 89.50  ? 281  HIS A C     1 
ATOM   2129  O  O     . HIS A  1  281  ? 42.629  -71.981  87.800  1.00 89.42  ? 281  HIS A O     1 
ATOM   2130  C  CB    . HIS A  1  281  ? 42.258  -74.724  88.797  1.00 91.17  ? 281  HIS A CB    1 
ATOM   2131  C  CG    . HIS A  1  281  ? 41.311  -74.685  87.626  1.00 93.42  ? 281  HIS A CG    1 
ATOM   2132  N  ND1   . HIS A  1  281  ? 41.551  -75.360  86.444  1.00 94.09  ? 281  HIS A ND1   1 
ATOM   2133  C  CD2   . HIS A  1  281  ? 40.103  -74.086  87.475  1.00 93.57  ? 281  HIS A CD2   1 
ATOM   2134  C  CE1   . HIS A  1  281  ? 40.532  -75.181  85.620  1.00 94.24  ? 281  HIS A CE1   1 
ATOM   2135  N  NE2   . HIS A  1  281  ? 39.640  -74.413  86.222  1.00 94.39  ? 281  HIS A NE2   1 
ATOM   2136  N  N     . ASN A  1  282  ? 44.212  -71.871  89.398  1.00 90.05  ? 282  ASN A N     1 
ATOM   2137  C  CA    . ASN A  1  282  ? 44.153  -70.418  89.514  1.00 90.64  ? 282  ASN A CA    1 
ATOM   2138  C  C     . ASN A  1  282  ? 45.517  -69.756  89.421  1.00 91.11  ? 282  ASN A C     1 
ATOM   2139  O  O     . ASN A  1  282  ? 46.515  -70.386  89.030  1.00 90.14  ? 282  ASN A O     1 
ATOM   2140  C  CB    . ASN A  1  282  ? 43.514  -69.995  90.845  1.00 91.12  ? 282  ASN A CB    1 
ATOM   2141  C  CG    . ASN A  1  282  ? 42.016  -70.221  90.880  1.00 91.55  ? 282  ASN A CG    1 
ATOM   2142  O  OD1   . ASN A  1  282  ? 41.294  -69.546  91.620  1.00 91.70  ? 282  ASN A OD1   1 
ATOM   2143  N  ND2   . ASN A  1  282  ? 41.539  -71.180  90.090  1.00 91.60  ? 282  ASN A ND2   1 
ATOM   2144  N  N     . GLY A  1  283  ? 45.530  -68.470  89.779  1.00 91.28  ? 283  GLY A N     1 
ATOM   2145  C  CA    . GLY A  1  283  ? 46.756  -67.701  89.777  1.00 91.52  ? 283  GLY A CA    1 
ATOM   2146  C  C     . GLY A  1  283  ? 47.643  -68.448  90.739  1.00 91.70  ? 283  GLY A C     1 
ATOM   2147  O  O     . GLY A  1  283  ? 47.554  -68.260  91.952  1.00 92.27  ? 283  GLY A O     1 
ATOM   2148  N  N     . ALA A  1  284  ? 48.478  -69.320  90.188  1.00 90.95  ? 284  ALA A N     1 
ATOM   2149  C  CA    . ALA A  1  284  ? 49.365  -70.141  90.983  1.00 90.19  ? 284  ALA A CA    1 
ATOM   2150  C  C     . ALA A  1  284  ? 50.668  -69.459  91.349  1.00 90.05  ? 284  ALA A C     1 
ATOM   2151  O  O     . ALA A  1  284  ? 51.646  -69.602  90.622  1.00 89.33  ? 284  ALA A O     1 
ATOM   2152  C  CB    . ALA A  1  284  ? 49.660  -71.430  90.230  1.00 90.16  ? 284  ALA A CB    1 
ATOM   2153  N  N     . PRO A  1  285  ? 50.702  -68.686  92.459  1.00 90.34  ? 285  PRO A N     1 
ATOM   2154  C  CA    . PRO A  1  285  ? 51.989  -68.065  92.774  1.00 90.51  ? 285  PRO A CA    1 
ATOM   2155  C  C     . PRO A  1  285  ? 52.896  -69.220  93.178  1.00 91.81  ? 285  PRO A C     1 
ATOM   2156  O  O     . PRO A  1  285  ? 53.174  -69.431  94.355  1.00 91.43  ? 285  PRO A O     1 
ATOM   2157  C  CB    . PRO A  1  285  ? 51.653  -67.115  93.928  1.00 89.70  ? 285  PRO A CB    1 
ATOM   2158  C  CG    . PRO A  1  285  ? 50.512  -67.771  94.588  1.00 89.46  ? 285  PRO A CG    1 
ATOM   2159  C  CD    . PRO A  1  285  ? 49.679  -68.284  93.440  1.00 89.66  ? 285  PRO A CD    1 
ATOM   2160  N  N     . HIS A  1  286  ? 53.301  -69.973  92.153  1.00 94.00  ? 286  HIS A N     1 
ATOM   2161  C  CA    . HIS A  1  286  ? 54.162  -71.160  92.219  1.00 95.71  ? 286  HIS A CA    1 
ATOM   2162  C  C     . HIS A  1  286  ? 54.635  -71.625  93.601  1.00 95.35  ? 286  HIS A C     1 
ATOM   2163  O  O     . HIS A  1  286  ? 54.435  -72.783  93.979  1.00 95.78  ? 286  HIS A O     1 
ATOM   2164  C  CB    . HIS A  1  286  ? 55.388  -70.977  91.298  1.00 97.96  ? 286  HIS A CB    1 
ATOM   2165  C  CG    . HIS A  1  286  ? 55.048  -70.796  89.844  1.00 100.60 ? 286  HIS A CG    1 
ATOM   2166  N  ND1   . HIS A  1  286  ? 54.203  -71.648  89.159  1.00 102.10 ? 286  HIS A ND1   1 
ATOM   2167  C  CD2   . HIS A  1  286  ? 55.468  -69.880  88.936  1.00 101.42 ? 286  HIS A CD2   1 
ATOM   2168  C  CE1   . HIS A  1  286  ? 54.119  -71.265  87.896  1.00 102.23 ? 286  HIS A CE1   1 
ATOM   2169  N  NE2   . HIS A  1  286  ? 54.878  -70.195  87.734  1.00 102.18 ? 286  HIS A NE2   1 
ATOM   2170  N  N     . HIS A  1  287  ? 55.273  -70.734  94.350  1.00 94.67  ? 287  HIS A N     1 
ATOM   2171  C  CA    . HIS A  1  287  ? 55.766  -71.088  95.669  1.00 93.39  ? 287  HIS A CA    1 
ATOM   2172  C  C     . HIS A  1  287  ? 55.062  -70.333  96.782  1.00 90.75  ? 287  HIS A C     1 
ATOM   2173  O  O     . HIS A  1  287  ? 55.678  -69.704  97.645  1.00 89.23  ? 287  HIS A O     1 
ATOM   2174  C  CB    . HIS A  1  287  ? 57.285  -70.916  95.696  1.00 96.64  ? 287  HIS A CB    1 
ATOM   2175  C  CG    . HIS A  1  287  ? 57.999  -71.973  94.908  1.00 100.08 ? 287  HIS A CG    1 
ATOM   2176  N  ND1   . HIS A  1  287  ? 57.372  -72.706  93.919  1.00 101.30 ? 287  HIS A ND1   1 
ATOM   2177  C  CD2   . HIS A  1  287  ? 59.270  -72.438  94.972  1.00 101.50 ? 287  HIS A CD2   1 
ATOM   2178  C  CE1   . HIS A  1  287  ? 58.224  -73.579  93.411  1.00 102.20 ? 287  HIS A CE1   1 
ATOM   2179  N  NE2   . HIS A  1  287  ? 59.383  -73.437  94.032  1.00 103.03 ? 287  HIS A NE2   1 
ATOM   2180  N  N     . ALA A  1  288  ? 53.737  -70.429  96.704  1.00 88.54  ? 288  ALA A N     1 
ATOM   2181  C  CA    . ALA A  1  288  ? 52.770  -69.855  97.631  1.00 86.26  ? 288  ALA A CA    1 
ATOM   2182  C  C     . ALA A  1  288  ? 51.710  -70.951  97.644  1.00 84.31  ? 288  ALA A C     1 
ATOM   2183  O  O     . ALA A  1  288  ? 50.806  -70.987  98.481  1.00 82.77  ? 288  ALA A O     1 
ATOM   2184  C  CB    . ALA A  1  288  ? 52.203  -68.549  97.084  1.00 86.73  ? 288  ALA A CB    1 
ATOM   2185  N  N     . ILE A  1  289  ? 51.862  -71.845  96.672  1.00 83.26  ? 289  ILE A N     1 
ATOM   2186  C  CA    . ILE A  1  289  ? 51.010  -73.010  96.499  1.00 82.60  ? 289  ILE A CA    1 
ATOM   2187  C  C     . ILE A  1  289  ? 51.606  -74.027  97.442  1.00 82.39  ? 289  ILE A C     1 
ATOM   2188  O  O     . ILE A  1  289  ? 50.952  -74.512  98.356  1.00 82.57  ? 289  ILE A O     1 
ATOM   2189  C  CB    . ILE A  1  289  ? 51.116  -73.598  95.062  1.00 82.08  ? 289  ILE A CB    1 
ATOM   2190  C  CG1   . ILE A  1  289  ? 50.012  -73.040  94.170  1.00 81.64  ? 289  ILE A CG1   1 
ATOM   2191  C  CG2   . ILE A  1  289  ? 51.024  -75.127  95.101  1.00 81.09  ? 289  ILE A CG2   1 
ATOM   2192  C  CD1   . ILE A  1  289  ? 49.979  -73.682  92.797  1.00 80.88  ? 289  ILE A CD1   1 
ATOM   2193  N  N     . GLU A  1  290  ? 52.870  -74.340  97.189  1.00 82.21  ? 290  GLU A N     1 
ATOM   2194  C  CA    . GLU A  1  290  ? 53.622  -75.299  97.980  1.00 83.03  ? 290  GLU A CA    1 
ATOM   2195  C  C     . GLU A  1  290  ? 53.544  -74.968  99.471  1.00 82.26  ? 290  GLU A C     1 
ATOM   2196  O  O     . GLU A  1  290  ? 53.797  -75.811  100.334 1.00 81.92  ? 290  GLU A O     1 
ATOM   2197  C  CB    . GLU A  1  290  ? 55.072  -75.268  97.530  1.00 84.46  ? 290  GLU A CB    1 
ATOM   2198  C  CG    . GLU A  1  290  ? 55.614  -73.865  97.522  1.00 87.46  ? 290  GLU A CG    1 
ATOM   2199  C  CD    . GLU A  1  290  ? 57.109  -73.821  97.712  1.00 89.92  ? 290  GLU A CD    1 
ATOM   2200  O  OE1   . GLU A  1  290  ? 57.833  -74.337  96.829  1.00 90.69  ? 290  GLU A OE1   1 
ATOM   2201  O  OE2   . GLU A  1  290  ? 57.556  -73.274  98.751  1.00 91.33  ? 290  GLU A OE2   1 
ATOM   2202  N  N     . GLU A  1  291  ? 53.202  -73.726  99.766  1.00 81.20  ? 291  GLU A N     1 
ATOM   2203  C  CA    . GLU A  1  291  ? 53.096  -73.285  101.139 1.00 80.14  ? 291  GLU A CA    1 
ATOM   2204  C  C     . GLU A  1  291  ? 51.802  -73.877  101.698 1.00 78.06  ? 291  GLU A C     1 
ATOM   2205  O  O     . GLU A  1  291  ? 51.688  -74.131  102.895 1.00 77.51  ? 291  GLU A O     1 
ATOM   2206  C  CB    . GLU A  1  291  ? 53.108  -71.750  101.146 1.00 83.09  ? 291  GLU A CB    1 
ATOM   2207  C  CG    . GLU A  1  291  ? 54.096  -71.200  100.068 1.00 86.94  ? 291  GLU A CG    1 
ATOM   2208  C  CD    . GLU A  1  291  ? 54.390  -69.686  100.130 1.00 88.97  ? 291  GLU A CD    1 
ATOM   2209  O  OE1   . GLU A  1  291  ? 53.438  -68.876  100.237 1.00 90.25  ? 291  GLU A OE1   1 
ATOM   2210  O  OE2   . GLU A  1  291  ? 55.586  -69.310  100.042 1.00 89.19  ? 291  GLU A OE2   1 
ATOM   2211  N  N     . ALA A  1  292  ? 50.849  -74.133  100.802 1.00 75.97  ? 292  ALA A N     1 
ATOM   2212  C  CA    . ALA A  1  292  ? 49.546  -74.700  101.158 1.00 73.65  ? 292  ALA A CA    1 
ATOM   2213  C  C     . ALA A  1  292  ? 49.462  -76.195  100.838 1.00 72.05  ? 292  ALA A C     1 
ATOM   2214  O  O     . ALA A  1  292  ? 48.440  -76.842  101.085 1.00 71.05  ? 292  ALA A O     1 
ATOM   2215  C  CB    . ALA A  1  292  ? 48.428  -73.943  100.424 1.00 72.90  ? 292  ALA A CB    1 
ATOM   2216  N  N     . GLU A  1  293  ? 50.542  -76.732  100.279 1.00 71.36  ? 293  GLU A N     1 
ATOM   2217  C  CA    . GLU A  1  293  ? 50.613  -78.147  99.918  1.00 70.02  ? 293  GLU A CA    1 
ATOM   2218  C  C     . GLU A  1  293  ? 51.117  -78.891  101.131 1.00 66.79  ? 293  GLU A C     1 
ATOM   2219  O  O     . GLU A  1  293  ? 50.725  -80.016  101.394 1.00 66.03  ? 293  GLU A O     1 
ATOM   2220  C  CB    . GLU A  1  293  ? 51.591  -78.364  98.754  1.00 72.40  ? 293  GLU A CB    1 
ATOM   2221  C  CG    . GLU A  1  293  ? 51.573  -79.774  98.153  1.00 75.06  ? 293  GLU A CG    1 
ATOM   2222  C  CD    . GLU A  1  293  ? 52.736  -80.030  97.191  1.00 77.21  ? 293  GLU A CD    1 
ATOM   2223  O  OE1   . GLU A  1  293  ? 53.092  -79.105  96.424  1.00 77.95  ? 293  GLU A OE1   1 
ATOM   2224  O  OE2   . GLU A  1  293  ? 53.287  -81.160  97.194  1.00 77.44  ? 293  GLU A OE2   1 
ATOM   2225  N  N     . SER A  1  294  ? 52.009  -78.249  101.865 1.00 64.44  ? 294  SER A N     1 
ATOM   2226  C  CA    . SER A  1  294  ? 52.560  -78.846  103.063 1.00 62.56  ? 294  SER A CA    1 
ATOM   2227  C  C     . SER A  1  294  ? 51.510  -78.826  104.168 1.00 59.77  ? 294  SER A C     1 
ATOM   2228  O  O     . SER A  1  294  ? 51.664  -79.496  105.189 1.00 59.44  ? 294  SER A O     1 
ATOM   2229  C  CB    . SER A  1  294  ? 53.807  -78.084  103.498 1.00 64.33  ? 294  SER A CB    1 
ATOM   2230  O  OG    . SER A  1  294  ? 53.535  -76.695  103.556 1.00 67.61  ? 294  SER A OG    1 
ATOM   2231  N  N     . LEU A  1  295  ? 50.450  -78.045  103.982 1.00 55.97  ? 295  LEU A N     1 
ATOM   2232  C  CA    . LEU A  1  295  ? 49.390  -78.032  104.980 1.00 53.05  ? 295  LEU A CA    1 
ATOM   2233  C  C     . LEU A  1  295  ? 48.657  -79.374  104.869 1.00 52.99  ? 295  LEU A C     1 
ATOM   2234  O  O     . LEU A  1  295  ? 48.275  -79.975  105.876 1.00 53.42  ? 295  LEU A O     1 
ATOM   2235  C  CB    . LEU A  1  295  ? 48.385  -76.919  104.727 1.00 50.29  ? 295  LEU A CB    1 
ATOM   2236  C  CG    . LEU A  1  295  ? 47.212  -77.081  105.697 1.00 47.70  ? 295  LEU A CG    1 
ATOM   2237  C  CD1   . LEU A  1  295  ? 47.668  -76.673  107.083 1.00 47.49  ? 295  LEU A CD1   1 
ATOM   2238  C  CD2   . LEU A  1  295  ? 46.036  -76.260  105.262 1.00 46.01  ? 295  LEU A CD2   1 
ATOM   2239  N  N     . LEU A  1  296  ? 48.449  -79.819  103.629 1.00 51.50  ? 296  LEU A N     1 
ATOM   2240  C  CA    . LEU A  1  296  ? 47.782  -81.088  103.344 1.00 47.42  ? 296  LEU A CA    1 
ATOM   2241  C  C     . LEU A  1  296  ? 48.677  -82.167  103.910 1.00 46.93  ? 296  LEU A C     1 
ATOM   2242  O  O     . LEU A  1  296  ? 48.224  -83.016  104.659 1.00 48.27  ? 296  LEU A O     1 
ATOM   2243  C  CB    . LEU A  1  296  ? 47.632  -81.285  101.837 1.00 45.06  ? 296  LEU A CB    1 
ATOM   2244  C  CG    . LEU A  1  296  ? 46.879  -82.500  101.313 1.00 42.92  ? 296  LEU A CG    1 
ATOM   2245  C  CD1   . LEU A  1  296  ? 45.442  -82.421  101.754 1.00 42.96  ? 296  LEU A CD1   1 
ATOM   2246  C  CD2   . LEU A  1  296  ? 46.954  -82.529  99.795  1.00 41.37  ? 296  LEU A CD2   1 
ATOM   2247  N  N     . GLN A  1  297  ? 49.958  -82.120  103.563 1.00 45.73  ? 297  GLN A N     1 
ATOM   2248  C  CA    . GLN A  1  297  ? 50.899  -83.104  104.065 1.00 45.21  ? 297  GLN A CA    1 
ATOM   2249  C  C     . GLN A  1  297  ? 50.780  -83.184  105.568 1.00 45.39  ? 297  GLN A C     1 
ATOM   2250  O  O     . GLN A  1  297  ? 50.949  -84.257  106.144 1.00 46.68  ? 297  GLN A O     1 
ATOM   2251  C  CB    . GLN A  1  297  ? 52.330  -82.734  103.693 1.00 46.50  ? 297  GLN A CB    1 
ATOM   2252  C  CG    . GLN A  1  297  ? 53.402  -83.653  104.289 1.00 47.77  ? 297  GLN A CG    1 
ATOM   2253  C  CD    . GLN A  1  297  ? 53.262  -85.117  103.869 1.00 48.89  ? 297  GLN A CD    1 
ATOM   2254  O  OE1   . GLN A  1  297  ? 54.225  -85.883  103.933 1.00 49.64  ? 297  GLN A OE1   1 
ATOM   2255  N  NE2   . GLN A  1  297  ? 52.065  -85.511  103.452 1.00 47.92  ? 297  GLN A NE2   1 
ATOM   2256  N  N     . PHE A  1  298  ? 50.485  -82.050  106.202 1.00 44.03  ? 298  PHE A N     1 
ATOM   2257  C  CA    . PHE A  1  298  ? 50.330  -82.003  107.656 1.00 41.75  ? 298  PHE A CA    1 
ATOM   2258  C  C     . PHE A  1  298  ? 49.093  -82.771  108.108 1.00 41.55  ? 298  PHE A C     1 
ATOM   2259  O  O     . PHE A  1  298  ? 49.191  -83.729  108.861 1.00 40.79  ? 298  PHE A O     1 
ATOM   2260  C  CB    . PHE A  1  298  ? 50.214  -80.566  108.141 1.00 39.09  ? 298  PHE A CB    1 
ATOM   2261  C  CG    . PHE A  1  298  ? 50.062  -80.442  109.631 1.00 35.89  ? 298  PHE A CG    1 
ATOM   2262  C  CD1   . PHE A  1  298  ? 51.146  -80.659  110.473 1.00 33.34  ? 298  PHE A CD1   1 
ATOM   2263  C  CD2   . PHE A  1  298  ? 48.835  -80.097  110.193 1.00 34.63  ? 298  PHE A CD2   1 
ATOM   2264  C  CE1   . PHE A  1  298  ? 51.013  -80.531  111.846 1.00 31.90  ? 298  PHE A CE1   1 
ATOM   2265  C  CE2   . PHE A  1  298  ? 48.693  -79.967  111.573 1.00 31.81  ? 298  PHE A CE2   1 
ATOM   2266  C  CZ    . PHE A  1  298  ? 49.780  -80.183  112.396 1.00 31.48  ? 298  PHE A CZ    1 
ATOM   2267  N  N     . HIS A  1  299  ? 47.924  -82.345  107.655 1.00 42.11  ? 299  HIS A N     1 
ATOM   2268  C  CA    . HIS A  1  299  ? 46.701  -83.027  108.033 1.00 44.14  ? 299  HIS A CA    1 
ATOM   2269  C  C     . HIS A  1  299  ? 46.716  -84.505  107.671 1.00 43.67  ? 299  HIS A C     1 
ATOM   2270  O  O     . HIS A  1  299  ? 46.499  -85.350  108.528 1.00 45.41  ? 299  HIS A O     1 
ATOM   2271  C  CB    . HIS A  1  299  ? 45.494  -82.350  107.390 1.00 46.64  ? 299  HIS A CB    1 
ATOM   2272  C  CG    . HIS A  1  299  ? 45.156  -81.027  108.002 1.00 48.61  ? 299  HIS A CG    1 
ATOM   2273  N  ND1   . HIS A  1  299  ? 44.229  -80.166  107.454 1.00 49.46  ? 299  HIS A ND1   1 
ATOM   2274  C  CD2   . HIS A  1  299  ? 45.622  -80.420  109.119 1.00 48.20  ? 299  HIS A CD2   1 
ATOM   2275  C  CE1   . HIS A  1  299  ? 44.140  -79.084  108.207 1.00 49.47  ? 299  HIS A CE1   1 
ATOM   2276  N  NE2   . HIS A  1  299  ? 44.975  -79.214  109.222 1.00 49.35  ? 299  HIS A NE2   1 
ATOM   2277  N  N     . VAL A  1  300  ? 46.968  -84.837  106.412 1.00 42.42  ? 300  VAL A N     1 
ATOM   2278  C  CA    . VAL A  1  300  ? 46.986  -86.244  106.032 1.00 40.44  ? 300  VAL A CA    1 
ATOM   2279  C  C     . VAL A  1  300  ? 48.008  -87.027  106.858 1.00 40.17  ? 300  VAL A C     1 
ATOM   2280  O  O     . VAL A  1  300  ? 47.961  -88.254  106.899 1.00 41.83  ? 300  VAL A O     1 
ATOM   2281  C  CB    . VAL A  1  300  ? 47.244  -86.422  104.508 1.00 39.31  ? 300  VAL A CB    1 
ATOM   2282  C  CG1   . VAL A  1  300  ? 47.653  -87.841  104.194 1.00 36.38  ? 300  VAL A CG1   1 
ATOM   2283  C  CG2   . VAL A  1  300  ? 45.976  -86.082  103.739 1.00 37.54  ? 300  VAL A CG2   1 
ATOM   2284  N  N     . ALA A  1  301  ? 48.921  -86.333  107.531 1.00 38.15  ? 301  ALA A N     1 
ATOM   2285  C  CA    . ALA A  1  301  ? 49.901  -87.029  108.366 1.00 37.46  ? 301  ALA A CA    1 
ATOM   2286  C  C     . ALA A  1  301  ? 49.351  -87.081  109.780 1.00 37.51  ? 301  ALA A C     1 
ATOM   2287  O  O     . ALA A  1  301  ? 49.389  -88.102  110.457 1.00 36.80  ? 301  ALA A O     1 
ATOM   2288  C  CB    . ALA A  1  301  ? 51.222  -86.292  108.359 1.00 35.93  ? 301  ALA A CB    1 
ATOM   2289  N  N     . THR A  1  302  ? 48.830  -85.937  110.196 1.00 38.83  ? 302  THR A N     1 
ATOM   2290  C  CA    . THR A  1  302  ? 48.238  -85.708  111.508 1.00 38.69  ? 302  THR A CA    1 
ATOM   2291  C  C     . THR A  1  302  ? 47.054  -86.642  111.826 1.00 39.78  ? 302  THR A C     1 
ATOM   2292  O  O     . THR A  1  302  ? 46.835  -87.002  112.986 1.00 40.16  ? 302  THR A O     1 
ATOM   2293  C  CB    . THR A  1  302  ? 47.800  -84.209  111.594 1.00 37.95  ? 302  THR A CB    1 
ATOM   2294  O  OG1   . THR A  1  302  ? 48.436  -83.613  112.722 1.00 37.30  ? 302  THR A OG1   1 
ATOM   2295  C  CG2   . THR A  1  302  ? 46.242  -84.042  111.681 1.00 37.86  ? 302  THR A CG2   1 
ATOM   2296  N  N     . TYR A  1  303  ? 46.308  -87.020  110.784 1.00 39.16  ? 303  TYR A N     1 
ATOM   2297  C  CA    . TYR A  1  303  ? 45.128  -87.881  110.873 1.00 37.42  ? 303  TYR A CA    1 
ATOM   2298  C  C     . TYR A  1  303  ? 45.500  -89.312  111.213 1.00 37.63  ? 303  TYR A C     1 
ATOM   2299  O  O     . TYR A  1  303  ? 44.767  -90.000  111.908 1.00 37.32  ? 303  TYR A O     1 
ATOM   2300  C  CB    . TYR A  1  303  ? 44.378  -87.790  109.540 1.00 36.80  ? 303  TYR A CB    1 
ATOM   2301  C  CG    . TYR A  1  303  ? 43.526  -88.964  109.079 1.00 36.09  ? 303  TYR A CG    1 
ATOM   2302  C  CD1   . TYR A  1  303  ? 42.278  -89.250  109.658 1.00 35.26  ? 303  TYR A CD1   1 
ATOM   2303  C  CD2   . TYR A  1  303  ? 43.922  -89.715  107.973 1.00 35.56  ? 303  TYR A CD2   1 
ATOM   2304  C  CE1   . TYR A  1  303  ? 41.447  -90.253  109.129 1.00 34.75  ? 303  TYR A CE1   1 
ATOM   2305  C  CE2   . TYR A  1  303  ? 43.114  -90.709  107.444 1.00 36.25  ? 303  TYR A CE2   1 
ATOM   2306  C  CZ    . TYR A  1  303  ? 41.881  -90.980  108.016 1.00 36.60  ? 303  TYR A CZ    1 
ATOM   2307  O  OH    . TYR A  1  303  ? 41.125  -91.994  107.453 1.00 37.09  ? 303  TYR A OH    1 
ATOM   2308  N  N     . MET A  1  304  ? 46.649  -89.760  110.737 1.00 38.55  ? 304  MET A N     1 
ATOM   2309  C  CA    . MET A  1  304  ? 47.078  -91.115  111.032 1.00 39.87  ? 304  MET A CA    1 
ATOM   2310  C  C     . MET A  1  304  ? 47.894  -91.083  112.316 1.00 41.33  ? 304  MET A C     1 
ATOM   2311  O  O     . MET A  1  304  ? 47.636  -91.851  113.231 1.00 41.80  ? 304  MET A O     1 
ATOM   2312  C  CB    . MET A  1  304  ? 47.857  -91.683  109.842 1.00 39.03  ? 304  MET A CB    1 
ATOM   2313  C  CG    . MET A  1  304  ? 46.996  -91.666  108.586 1.00 39.09  ? 304  MET A CG    1 
ATOM   2314  S  SD    . MET A  1  304  ? 47.635  -92.492  107.154 1.00 41.31  ? 304  MET A SD    1 
ATOM   2315  C  CE    . MET A  1  304  ? 48.891  -91.277  106.604 1.00 39.57  ? 304  MET A CE    1 
ATOM   2316  N  N     . ASP A  1  305  ? 48.871  -90.189  112.397 1.00 43.69  ? 305  ASP A N     1 
ATOM   2317  C  CA    . ASP A  1  305  ? 49.658  -90.052  113.619 1.00 45.23  ? 305  ASP A CA    1 
ATOM   2318  C  C     . ASP A  1  305  ? 49.672  -88.584  114.004 1.00 46.48  ? 305  ASP A C     1 
ATOM   2319  O  O     . ASP A  1  305  ? 49.808  -87.708  113.146 1.00 47.16  ? 305  ASP A O     1 
ATOM   2320  C  CB    . ASP A  1  305  ? 51.100  -90.520  113.449 1.00 44.84  ? 305  ASP A CB    1 
ATOM   2321  C  CG    . ASP A  1  305  ? 51.884  -90.431  114.751 1.00 45.49  ? 305  ASP A CG    1 
ATOM   2322  O  OD1   . ASP A  1  305  ? 51.758  -89.400  115.443 1.00 46.45  ? 305  ASP A OD1   1 
ATOM   2323  O  OD2   . ASP A  1  305  ? 52.623  -91.377  115.094 1.00 45.40  ? 305  ASP A OD2   1 
ATOM   2324  N  N     . ASN A  1  306  ? 49.540  -88.314  115.296 1.00 47.79  ? 306  ASN A N     1 
ATOM   2325  C  CA    . ASN A  1  306  ? 49.526  -86.945  115.761 1.00 49.23  ? 306  ASN A CA    1 
ATOM   2326  C  C     . ASN A  1  306  ? 50.358  -86.766  117.015 1.00 49.67  ? 306  ASN A C     1 
ATOM   2327  O  O     . ASN A  1  306  ? 50.115  -85.871  117.815 1.00 49.91  ? 306  ASN A O     1 
ATOM   2328  C  CB    . ASN A  1  306  ? 48.084  -86.510  115.999 1.00 49.34  ? 306  ASN A CB    1 
ATOM   2329  C  CG    . ASN A  1  306  ? 47.968  -85.049  116.350 1.00 50.18  ? 306  ASN A CG    1 
ATOM   2330  O  OD1   . ASN A  1  306  ? 48.685  -84.207  115.809 1.00 50.63  ? 306  ASN A OD1   1 
ATOM   2331  N  ND2   . ASN A  1  306  ? 47.048  -84.733  117.253 1.00 50.96  ? 306  ASN A ND2   1 
ATOM   2332  N  N     . ASP A  1  307  ? 51.354  -87.624  117.172 1.00 51.25  ? 307  ASP A N     1 
ATOM   2333  C  CA    . ASP A  1  307  ? 52.249  -87.565  118.320 1.00 53.76  ? 307  ASP A CA    1 
ATOM   2334  C  C     . ASP A  1  307  ? 53.668  -87.723  117.800 1.00 53.85  ? 307  ASP A C     1 
ATOM   2335  O  O     . ASP A  1  307  ? 54.437  -88.540  118.309 1.00 54.08  ? 307  ASP A O     1 
ATOM   2336  C  CB    . ASP A  1  307  ? 51.916  -88.690  119.299 1.00 56.08  ? 307  ASP A CB    1 
ATOM   2337  C  CG    . ASP A  1  307  ? 50.471  -88.648  119.746 1.00 59.46  ? 307  ASP A CG    1 
ATOM   2338  O  OD1   . ASP A  1  307  ? 50.234  -88.496  120.968 1.00 60.47  ? 307  ASP A OD1   1 
ATOM   2339  O  OD2   . ASP A  1  307  ? 49.575  -88.759  118.870 1.00 60.64  ? 307  ASP A OD2   1 
ATOM   2340  N  N     . ILE A  1  308  ? 53.995  -86.916  116.789 1.00 53.10  ? 308  ILE A N     1 
ATOM   2341  C  CA    . ILE A  1  308  ? 55.291  -86.927  116.114 1.00 52.58  ? 308  ILE A CA    1 
ATOM   2342  C  C     . ILE A  1  308  ? 56.421  -86.245  116.898 1.00 54.71  ? 308  ILE A C     1 
ATOM   2343  O  O     . ILE A  1  308  ? 56.280  -85.983  118.086 1.00 55.81  ? 308  ILE A O     1 
ATOM   2344  C  CB    . ILE A  1  308  ? 55.139  -86.269  114.731 1.00 49.45  ? 308  ILE A CB    1 
ATOM   2345  C  CG1   . ILE A  1  308  ? 53.814  -86.714  114.108 1.00 47.39  ? 308  ILE A CG1   1 
ATOM   2346  C  CG2   . ILE A  1  308  ? 56.290  -86.662  113.834 1.00 49.95  ? 308  ILE A CG2   1 
ATOM   2347  C  CD1   . ILE A  1  308  ? 53.598  -86.270  112.694 1.00 44.26  ? 308  ILE A CD1   1 
ATOM   2348  N  N     . ALA A  1  309  ? 57.551  -85.981  116.245 1.00 57.01  ? 309  ALA A N     1 
ATOM   2349  C  CA    . ALA A  1  309  ? 58.677  -85.308  116.898 1.00 59.21  ? 309  ALA A CA    1 
ATOM   2350  C  C     . ALA A  1  309  ? 58.628  -83.789  116.626 1.00 61.75  ? 309  ALA A C     1 
ATOM   2351  O  O     . ALA A  1  309  ? 58.912  -82.981  117.518 1.00 61.00  ? 309  ALA A O     1 
ATOM   2352  C  CB    . ALA A  1  309  ? 59.978  -85.889  116.405 1.00 58.87  ? 309  ALA A CB    1 
ATOM   2353  N  N     . GLY A  1  310  ? 58.277  -83.416  115.389 1.00 64.52  ? 310  GLY A N     1 
ATOM   2354  C  CA    . GLY A  1  310  ? 58.144  -82.013  115.009 1.00 66.39  ? 310  GLY A CA    1 
ATOM   2355  C  C     . GLY A  1  310  ? 56.909  -81.486  115.716 1.00 68.29  ? 310  GLY A C     1 
ATOM   2356  O  O     . GLY A  1  310  ? 55.803  -81.450  115.170 1.00 67.10  ? 310  GLY A O     1 
ATOM   2357  N  N     . GLN A  1  311  ? 57.139  -81.097  116.963 1.00 70.82  ? 311  GLN A N     1 
ATOM   2358  C  CA    . GLN A  1  311  ? 56.155  -80.584  117.913 1.00 74.28  ? 311  GLN A CA    1 
ATOM   2359  C  C     . GLN A  1  311  ? 54.734  -80.104  117.574 1.00 74.41  ? 311  GLN A C     1 
ATOM   2360  O  O     . GLN A  1  311  ? 53.817  -80.336  118.363 1.00 75.36  ? 311  GLN A O     1 
ATOM   2361  C  CB    . GLN A  1  311  ? 56.829  -79.517  118.784 1.00 77.02  ? 311  GLN A CB    1 
ATOM   2362  C  CG    . GLN A  1  311  ? 57.719  -80.099  119.888 1.00 80.39  ? 311  GLN A CG    1 
ATOM   2363  C  CD    . GLN A  1  311  ? 58.403  -79.027  120.736 1.00 82.45  ? 311  GLN A CD    1 
ATOM   2364  O  OE1   . GLN A  1  311  ? 59.304  -78.320  120.267 1.00 83.37  ? 311  GLN A OE1   1 
ATOM   2365  N  NE2   . GLN A  1  311  ? 57.971  -78.901  121.991 1.00 82.73  ? 311  GLN A NE2   1 
ATOM   2366  N  N     . PRO A  1  312  ? 54.522  -79.409  116.443 1.00 73.94  ? 312  PRO A N     1 
ATOM   2367  C  CA    . PRO A  1  312  ? 53.133  -78.987  116.201 1.00 73.27  ? 312  PRO A CA    1 
ATOM   2368  C  C     . PRO A  1  312  ? 52.156  -80.142  116.402 1.00 71.55  ? 312  PRO A C     1 
ATOM   2369  O  O     . PRO A  1  312  ? 51.914  -80.909  115.473 1.00 71.95  ? 312  PRO A O     1 
ATOM   2370  C  CB    . PRO A  1  312  ? 53.170  -78.513  114.753 1.00 74.03  ? 312  PRO A CB    1 
ATOM   2371  C  CG    . PRO A  1  312  ? 54.534  -77.903  114.653 1.00 74.62  ? 312  PRO A CG    1 
ATOM   2372  C  CD    . PRO A  1  312  ? 55.424  -78.888  115.399 1.00 74.41  ? 312  PRO A CD    1 
ATOM   2373  N  N     . GLN A  1  313  ? 51.583  -80.268  117.598 1.00 68.74  ? 313  GLN A N     1 
ATOM   2374  C  CA    . GLN A  1  313  ? 50.684  -81.384  117.842 1.00 66.30  ? 313  GLN A CA    1 
ATOM   2375  C  C     . GLN A  1  313  ? 49.239  -81.129  117.476 1.00 65.91  ? 313  GLN A C     1 
ATOM   2376  O  O     . GLN A  1  313  ? 48.345  -81.363  118.280 1.00 66.93  ? 313  GLN A O     1 
ATOM   2377  C  CB    . GLN A  1  313  ? 50.761  -81.843  119.297 1.00 64.28  ? 313  GLN A CB    1 
ATOM   2378  C  CG    . GLN A  1  313  ? 50.160  -83.225  119.480 1.00 61.94  ? 313  GLN A CG    1 
ATOM   2379  C  CD    . GLN A  1  313  ? 50.080  -83.652  120.919 1.00 61.20  ? 313  GLN A CD    1 
ATOM   2380  O  OE1   . GLN A  1  313  ? 49.628  -82.898  121.771 1.00 60.74  ? 313  GLN A OE1   1 
ATOM   2381  N  NE2   . GLN A  1  313  ? 50.503  -84.877  121.198 1.00 60.80  ? 313  GLN A NE2   1 
ATOM   2382  N  N     . ALA A  1  314  ? 49.017  -80.666  116.252 1.00 65.49  ? 314  ALA A N     1 
ATOM   2383  C  CA    . ALA A  1  314  ? 47.677  -80.383  115.745 1.00 65.75  ? 314  ALA A CA    1 
ATOM   2384  C  C     . ALA A  1  314  ? 46.568  -80.446  116.798 1.00 65.94  ? 314  ALA A C     1 
ATOM   2385  O  O     . ALA A  1  314  ? 45.760  -81.372  116.788 1.00 66.08  ? 314  ALA A O     1 
ATOM   2386  C  CB    . ALA A  1  314  ? 47.355  -81.342  114.607 1.00 64.76  ? 314  ALA A CB    1 
ATOM   2387  N  N     . LEU A  1  315  ? 46.527  -79.469  117.702 1.00 66.33  ? 315  LEU A N     1 
ATOM   2388  C  CA    . LEU A  1  315  ? 45.497  -79.449  118.737 1.00 66.74  ? 315  LEU A CA    1 
ATOM   2389  C  C     . LEU A  1  315  ? 44.179  -79.106  118.084 1.00 67.68  ? 315  LEU A C     1 
ATOM   2390  O  O     . LEU A  1  315  ? 44.160  -78.536  117.004 1.00 68.30  ? 315  LEU A O     1 
ATOM   2391  C  CB    . LEU A  1  315  ? 45.768  -78.371  119.779 1.00 65.63  ? 315  LEU A CB    1 
ATOM   2392  C  CG    . LEU A  1  315  ? 47.171  -78.014  120.234 1.00 66.37  ? 315  LEU A CG    1 
ATOM   2393  C  CD1   . LEU A  1  315  ? 47.042  -77.266  121.566 1.00 66.95  ? 315  LEU A CD1   1 
ATOM   2394  C  CD2   . LEU A  1  315  ? 48.023  -79.258  120.408 1.00 66.91  ? 315  LEU A CD2   1 
ATOM   2395  N  N     . GLN A  1  316  ? 43.071  -79.445  118.727 1.00 69.29  ? 316  GLN A N     1 
ATOM   2396  C  CA    . GLN A  1  316  ? 41.787  -79.086  118.157 1.00 71.74  ? 316  GLN A CA    1 
ATOM   2397  C  C     . GLN A  1  316  ? 41.231  -77.890  118.911 1.00 73.07  ? 316  GLN A C     1 
ATOM   2398  O  O     . GLN A  1  316  ? 41.658  -77.591  120.028 1.00 73.82  ? 316  GLN A O     1 
ATOM   2399  C  CB    . GLN A  1  316  ? 40.776  -80.225  118.240 1.00 72.86  ? 316  GLN A CB    1 
ATOM   2400  C  CG    . GLN A  1  316  ? 39.598  -79.979  117.305 1.00 75.73  ? 316  GLN A CG    1 
ATOM   2401  C  CD    . GLN A  1  316  ? 38.409  -80.844  117.607 1.00 77.69  ? 316  GLN A CD    1 
ATOM   2402  O  OE1   . GLN A  1  316  ? 38.536  -82.065  117.735 1.00 77.97  ? 316  GLN A OE1   1 
ATOM   2403  N  NE2   . GLN A  1  316  ? 37.232  -80.221  117.715 1.00 78.16  ? 316  GLN A NE2   1 
ATOM   2404  N  N     . LYS A  1  317  ? 40.294  -77.192  118.277 1.00 73.94  ? 317  LYS A N     1 
ATOM   2405  C  CA    . LYS A  1  317  ? 39.641  -76.040  118.878 1.00 73.47  ? 317  LYS A CA    1 
ATOM   2406  C  C     . LYS A  1  317  ? 39.389  -76.389  120.340 1.00 73.62  ? 317  LYS A C     1 
ATOM   2407  O  O     . LYS A  1  317  ? 38.567  -77.261  120.631 1.00 74.45  ? 317  LYS A O     1 
ATOM   2408  C  CB    . LYS A  1  317  ? 38.318  -75.781  118.143 1.00 73.93  ? 317  LYS A CB    1 
ATOM   2409  C  CG    . LYS A  1  317  ? 37.580  -77.075  117.708 1.00 74.94  ? 317  LYS A CG    1 
ATOM   2410  C  CD    . LYS A  1  317  ? 36.589  -76.834  116.548 1.00 75.43  ? 317  LYS A CD    1 
ATOM   2411  C  CE    . LYS A  1  317  ? 36.130  -78.137  115.862 1.00 73.77  ? 317  LYS A CE    1 
ATOM   2412  N  NZ    . LYS A  1  317  ? 35.348  -77.873  114.613 1.00 70.66  ? 317  LYS A NZ    1 
ATOM   2413  N  N     . SER A  1  318  ? 40.130  -75.739  121.238 1.00 72.17  ? 318  SER A N     1 
ATOM   2414  C  CA    . SER A  1  318  ? 40.027  -75.940  122.691 1.00 71.33  ? 318  SER A CA    1 
ATOM   2415  C  C     . SER A  1  318  ? 41.301  -76.513  123.295 1.00 71.40  ? 318  SER A C     1 
ATOM   2416  O  O     . SER A  1  318  ? 41.385  -76.695  124.510 1.00 71.97  ? 318  SER A O     1 
ATOM   2417  C  CB    . SER A  1  318  ? 38.875  -76.872  123.067 1.00 70.28  ? 318  SER A CB    1 
ATOM   2418  O  OG    . SER A  1  318  ? 39.224  -78.212  122.785 1.00 69.37  ? 318  SER A OG    1 
ATOM   2419  N  N     . GLY A  1  319  ? 42.283  -76.816  122.453 1.00 71.04  ? 319  GLY A N     1 
ATOM   2420  C  CA    . GLY A  1  319  ? 43.539  -77.346  122.961 1.00 70.24  ? 319  GLY A CA    1 
ATOM   2421  C  C     . GLY A  1  319  ? 43.683  -78.857  123.018 1.00 69.26  ? 319  GLY A C     1 
ATOM   2422  O  O     . GLY A  1  319  ? 44.807  -79.361  123.005 1.00 69.27  ? 319  GLY A O     1 
ATOM   2423  N  N     . ARG A  1  320  ? 42.569  -79.583  123.093 1.00 67.91  ? 320  ARG A N     1 
ATOM   2424  C  CA    . ARG A  1  320  ? 42.618  -81.047  123.140 1.00 66.55  ? 320  ARG A CA    1 
ATOM   2425  C  C     . ARG A  1  320  ? 43.232  -81.545  121.815 1.00 64.09  ? 320  ARG A C     1 
ATOM   2426  O  O     . ARG A  1  320  ? 42.704  -81.280  120.736 1.00 65.92  ? 320  ARG A O     1 
ATOM   2427  C  CB    . ARG A  1  320  ? 41.201  -81.605  123.355 1.00 68.84  ? 320  ARG A CB    1 
ATOM   2428  C  CG    . ARG A  1  320  ? 41.153  -83.022  123.942 1.00 72.31  ? 320  ARG A CG    1 
ATOM   2429  C  CD    . ARG A  1  320  ? 41.052  -84.129  122.873 1.00 75.90  ? 320  ARG A CD    1 
ATOM   2430  N  NE    . ARG A  1  320  ? 39.662  -84.485  122.555 1.00 78.04  ? 320  ARG A NE    1 
ATOM   2431  C  CZ    . ARG A  1  320  ? 38.936  -83.961  121.564 1.00 78.63  ? 320  ARG A CZ    1 
ATOM   2432  N  NH1   . ARG A  1  320  ? 39.444  -83.037  120.750 1.00 78.22  ? 320  ARG A NH1   1 
ATOM   2433  N  NH2   . ARG A  1  320  ? 37.681  -84.363  121.393 1.00 78.60  ? 320  ARG A NH2   1 
ATOM   2434  N  N     . PRO A  1  321  ? 44.359  -82.269  121.889 1.00 60.16  ? 321  PRO A N     1 
ATOM   2435  C  CA    . PRO A  1  321  ? 45.141  -82.841  120.790 1.00 58.00  ? 321  PRO A CA    1 
ATOM   2436  C  C     . PRO A  1  321  ? 44.504  -83.490  119.551 1.00 56.42  ? 321  PRO A C     1 
ATOM   2437  O  O     . PRO A  1  321  ? 45.002  -83.279  118.448 1.00 56.93  ? 321  PRO A O     1 
ATOM   2438  C  CB    . PRO A  1  321  ? 46.074  -83.796  121.513 1.00 57.98  ? 321  PRO A CB    1 
ATOM   2439  C  CG    . PRO A  1  321  ? 46.343  -83.081  122.756 1.00 58.76  ? 321  PRO A CG    1 
ATOM   2440  C  CD    . PRO A  1  321  ? 44.964  -82.645  123.174 1.00 59.85  ? 321  PRO A CD    1 
ATOM   2441  N  N     . VAL A  1  322  ? 43.440  -84.277  119.711 1.00 53.53  ? 322  VAL A N     1 
ATOM   2442  C  CA    . VAL A  1  322  ? 42.780  -84.964  118.577 1.00 50.47  ? 322  VAL A CA    1 
ATOM   2443  C  C     . VAL A  1  322  ? 43.400  -86.367  118.387 1.00 49.58  ? 322  VAL A C     1 
ATOM   2444  O  O     . VAL A  1  322  ? 44.566  -86.501  118.014 1.00 48.81  ? 322  VAL A O     1 
ATOM   2445  C  CB    . VAL A  1  322  ? 42.855  -84.117  117.222 1.00 47.40  ? 322  VAL A CB    1 
ATOM   2446  C  CG1   . VAL A  1  322  ? 44.020  -84.530  116.356 1.00 43.56  ? 322  VAL A CG1   1 
ATOM   2447  C  CG2   . VAL A  1  322  ? 41.576  -84.270  116.447 1.00 45.64  ? 322  VAL A CG2   1 
ATOM   2448  N  N     . LYS A  1  323  ? 42.621  -87.413  118.668 1.00 48.21  ? 323  LYS A N     1 
ATOM   2449  C  CA    . LYS A  1  323  ? 43.129  -88.779  118.552 1.00 47.52  ? 323  LYS A CA    1 
ATOM   2450  C  C     . LYS A  1  323  ? 43.445  -89.138  117.121 1.00 45.69  ? 323  LYS A C     1 
ATOM   2451  O  O     . LYS A  1  323  ? 42.588  -89.065  116.253 1.00 46.39  ? 323  LYS A O     1 
ATOM   2452  C  CB    . LYS A  1  323  ? 42.131  -89.831  119.075 1.00 49.46  ? 323  LYS A CB    1 
ATOM   2453  C  CG    . LYS A  1  323  ? 41.669  -89.693  120.518 1.00 53.18  ? 323  LYS A CG    1 
ATOM   2454  C  CD    . LYS A  1  323  ? 40.650  -88.549  120.649 1.00 57.28  ? 323  LYS A CD    1 
ATOM   2455  C  CE    . LYS A  1  323  ? 40.011  -88.454  122.043 1.00 58.91  ? 323  LYS A CE    1 
ATOM   2456  N  NZ    . LYS A  1  323  ? 39.009  -87.334  122.144 1.00 59.26  ? 323  LYS A NZ    1 
ATOM   2457  N  N     . SER A  1  324  ? 44.683  -89.534  116.880 1.00 43.18  ? 324  SER A N     1 
ATOM   2458  C  CA    . SER A  1  324  ? 45.101  -89.960  115.559 1.00 39.91  ? 324  SER A CA    1 
ATOM   2459  C  C     . SER A  1  324  ? 44.745  -91.440  115.514 1.00 37.56  ? 324  SER A C     1 
ATOM   2460  O  O     . SER A  1  324  ? 44.707  -92.090  116.546 1.00 38.56  ? 324  SER A O     1 
ATOM   2461  C  CB    . SER A  1  324  ? 46.610  -89.765  115.419 1.00 41.22  ? 324  SER A CB    1 
ATOM   2462  O  OG    . SER A  1  324  ? 47.261  -89.891  116.682 1.00 41.72  ? 324  SER A OG    1 
ATOM   2463  N  N     . ILE A  1  325  ? 44.467  -91.981  114.337 1.00 35.11  ? 325  ILE A N     1 
ATOM   2464  C  CA    . ILE A  1  325  ? 44.124  -93.399  114.236 1.00 31.25  ? 325  ILE A CA    1 
ATOM   2465  C  C     . ILE A  1  325  ? 45.137  -94.253  115.008 1.00 29.53  ? 325  ILE A C     1 
ATOM   2466  O  O     . ILE A  1  325  ? 44.772  -95.192  115.701 1.00 28.42  ? 325  ILE A O     1 
ATOM   2467  C  CB    . ILE A  1  325  ? 44.075  -93.856  112.754 1.00 29.85  ? 325  ILE A CB    1 
ATOM   2468  C  CG1   . ILE A  1  325  ? 42.950  -93.131  112.016 1.00 27.19  ? 325  ILE A CG1   1 
ATOM   2469  C  CG2   . ILE A  1  325  ? 43.845  -95.341  112.677 1.00 30.10  ? 325  ILE A CG2   1 
ATOM   2470  C  CD1   . ILE A  1  325  ? 42.748  -93.624  110.621 1.00 25.57  ? 325  ILE A CD1   1 
ATOM   2471  N  N     . ARG A  1  326  ? 46.412  -93.904  114.897 1.00 29.25  ? 326  ARG A N     1 
ATOM   2472  C  CA    . ARG A  1  326  ? 47.470  -94.634  115.583 1.00 29.62  ? 326  ARG A CA    1 
ATOM   2473  C  C     . ARG A  1  326  ? 47.286  -94.616  117.096 1.00 29.84  ? 326  ARG A C     1 
ATOM   2474  O  O     . ARG A  1  326  ? 47.705  -95.530  117.801 1.00 30.84  ? 326  ARG A O     1 
ATOM   2475  C  CB    . ARG A  1  326  ? 48.843  -94.044  115.241 1.00 30.03  ? 326  ARG A CB    1 
ATOM   2476  C  CG    . ARG A  1  326  ? 49.964  -94.611  116.094 1.00 31.93  ? 326  ARG A CG    1 
ATOM   2477  C  CD    . ARG A  1  326  ? 51.332  -94.179  115.611 1.00 35.04  ? 326  ARG A CD    1 
ATOM   2478  N  NE    . ARG A  1  326  ? 52.401  -94.635  116.502 1.00 36.81  ? 326  ARG A NE    1 
ATOM   2479  C  CZ    . ARG A  1  326  ? 52.633  -94.130  117.712 1.00 37.91  ? 326  ARG A CZ    1 
ATOM   2480  N  NH1   . ARG A  1  326  ? 51.874  -93.144  118.184 1.00 38.74  ? 326  ARG A NH1   1 
ATOM   2481  N  NH2   . ARG A  1  326  ? 53.621  -94.616  118.452 1.00 36.88  ? 326  ARG A NH2   1 
ATOM   2482  N  N     . ALA A  1  327  ? 46.674  -93.560  117.604 1.00 28.99  ? 327  ALA A N     1 
ATOM   2483  C  CA    . ALA A  1  327  ? 46.463  -93.463  119.034 1.00 27.48  ? 327  ALA A CA    1 
ATOM   2484  C  C     . ALA A  1  327  ? 45.502  -94.549  119.413 1.00 27.30  ? 327  ALA A C     1 
ATOM   2485  O  O     . ALA A  1  327  ? 45.684  -95.223  120.420 1.00 29.88  ? 327  ALA A O     1 
ATOM   2486  C  CB    . ALA A  1  327  ? 45.876  -92.109  119.398 1.00 27.06  ? 327  ALA A CB    1 
ATOM   2487  N  N     . ARG A  1  328  ? 44.482  -94.724  118.587 1.00 25.65  ? 328  ARG A N     1 
ATOM   2488  C  CA    . ARG A  1  328  ? 43.456  -95.710  118.854 1.00 24.59  ? 328  ARG A CA    1 
ATOM   2489  C  C     . ARG A  1  328  ? 43.979  -97.114  119.085 1.00 24.68  ? 328  ARG A C     1 
ATOM   2490  O  O     . ARG A  1  328  ? 43.377  -97.880  119.828 1.00 24.86  ? 328  ARG A O     1 
ATOM   2491  C  CB    . ARG A  1  328  ? 42.456  -95.762  117.705 1.00 26.22  ? 328  ARG A CB    1 
ATOM   2492  C  CG    . ARG A  1  328  ? 41.664  -94.488  117.428 1.00 25.25  ? 328  ARG A CG    1 
ATOM   2493  C  CD    . ARG A  1  328  ? 40.398  -94.872  116.680 1.00 24.09  ? 328  ARG A CD    1 
ATOM   2494  N  NE    . ARG A  1  328  ? 39.591  -93.725  116.297 1.00 26.05  ? 328  ARG A NE    1 
ATOM   2495  C  CZ    . ARG A  1  328  ? 38.405  -93.818  115.698 1.00 27.56  ? 328  ARG A CZ    1 
ATOM   2496  N  NH1   . ARG A  1  328  ? 37.885  -95.015  115.415 1.00 25.72  ? 328  ARG A NH1   1 
ATOM   2497  N  NH2   . ARG A  1  328  ? 37.741  -92.708  115.372 1.00 28.14  ? 328  ARG A NH2   1 
ATOM   2498  N  N     . LEU A  1  329  ? 45.098  -97.457  118.458 1.00 23.56  ? 329  LEU A N     1 
ATOM   2499  C  CA    . LEU A  1  329  ? 45.629  -98.805  118.588 1.00 23.21  ? 329  LEU A CA    1 
ATOM   2500  C  C     . LEU A  1  329  ? 46.738  -98.979  119.630 1.00 24.75  ? 329  LEU A C     1 
ATOM   2501  O  O     . LEU A  1  329  ? 47.012  -100.089 120.055 1.00 25.91  ? 329  LEU A O     1 
ATOM   2502  C  CB    . LEU A  1  329  ? 46.115  -99.287  117.212 1.00 18.56  ? 329  LEU A CB    1 
ATOM   2503  C  CG    . LEU A  1  329  ? 45.290  -98.834  115.997 1.00 16.74  ? 329  LEU A CG    1 
ATOM   2504  C  CD1   . LEU A  1  329  ? 45.875  -99.438  114.754 1.00 16.44  ? 329  LEU A CD1   1 
ATOM   2505  C  CD2   . LEU A  1  329  ? 43.844  -99.234  116.125 1.00 14.03  ? 329  LEU A CD2   1 
ATOM   2506  N  N     . LYS A  1  330  ? 47.352  -97.887  120.066 1.00 27.32  ? 330  LYS A N     1 
ATOM   2507  C  CA    . LYS A  1  330  ? 48.447  -97.942  121.038 1.00 29.47  ? 330  LYS A CA    1 
ATOM   2508  C  C     . LYS A  1  330  ? 48.117  -98.638  122.355 1.00 30.38  ? 330  LYS A C     1 
ATOM   2509  O  O     . LYS A  1  330  ? 47.066  -98.437  122.955 1.00 27.40  ? 330  LYS A O     1 
ATOM   2510  C  CB    . LYS A  1  330  ? 48.962  -96.526  121.298 1.00 33.24  ? 330  LYS A CB    1 
ATOM   2511  C  CG    . LYS A  1  330  ? 50.374  -96.454  121.829 1.00 35.21  ? 330  LYS A CG    1 
ATOM   2512  C  CD    . LYS A  1  330  ? 50.972  -95.080  121.554 1.00 37.28  ? 330  LYS A CD    1 
ATOM   2513  C  CE    . LYS A  1  330  ? 52.425  -95.010  122.033 1.00 40.42  ? 330  LYS A CE    1 
ATOM   2514  N  NZ    . LYS A  1  330  ? 53.208  -93.875  121.420 1.00 41.98  ? 330  LYS A NZ    1 
ATOM   2515  N  N     . GLY A  1  331  ? 49.069  -99.451  122.788 1.00 33.29  ? 331  GLY A N     1 
ATOM   2516  C  CA    . GLY A  1  331  ? 48.951  -100.268 123.993 1.00 38.11  ? 331  GLY A CA    1 
ATOM   2517  C  C     . GLY A  1  331  ? 48.091  -99.953  125.212 1.00 38.97  ? 331  GLY A C     1 
ATOM   2518  O  O     . GLY A  1  331  ? 47.986  -98.802  125.603 1.00 39.60  ? 331  GLY A O     1 
ATOM   2519  N  N     . LYS A  1  332  ? 47.541  -101.007 125.834 1.00 39.85  ? 332  LYS A N     1 
ATOM   2520  C  CA    . LYS A  1  332  ? 46.689  -100.928 127.028 1.00 39.56  ? 332  LYS A CA    1 
ATOM   2521  C  C     . LYS A  1  332  ? 45.623  -99.922  126.768 1.00 40.86  ? 332  LYS A C     1 
ATOM   2522  O  O     . LYS A  1  332  ? 45.931  -98.817  126.376 1.00 43.93  ? 332  LYS A O     1 
ATOM   2523  C  CB    . LYS A  1  332  ? 47.469  -100.476 128.240 1.00 38.47  ? 332  LYS A CB    1 
ATOM   2524  C  CG    . LYS A  1  332  ? 46.576  -100.295 129.430 1.00 40.96  ? 332  LYS A CG    1 
ATOM   2525  C  CD    . LYS A  1  332  ? 47.382  -99.957  130.647 1.00 45.07  ? 332  LYS A CD    1 
ATOM   2526  C  CE    . LYS A  1  332  ? 48.450  -101.014 130.879 1.00 46.85  ? 332  LYS A CE    1 
ATOM   2527  N  NZ    . LYS A  1  332  ? 49.383  -100.645 131.977 1.00 50.42  ? 332  LYS A NZ    1 
ATOM   2528  N  N     . GLU A  1  333  ? 44.366  -100.256 127.000 1.00 41.20  ? 333  GLU A N     1 
ATOM   2529  C  CA    . GLU A  1  333  ? 43.317  -99.282  126.693 1.00 41.45  ? 333  GLU A CA    1 
ATOM   2530  C  C     . GLU A  1  333  ? 43.249  -99.169  125.152 1.00 39.94  ? 333  GLU A C     1 
ATOM   2531  O  O     . GLU A  1  333  ? 42.237  -98.757  124.586 1.00 39.89  ? 333  GLU A O     1 
ATOM   2532  C  CB    . GLU A  1  333  ? 43.656  -97.890  127.251 1.00 44.13  ? 333  GLU A CB    1 
ATOM   2533  C  CG    . GLU A  1  333  ? 43.980  -97.793  128.734 1.00 50.76  ? 333  GLU A CG    1 
ATOM   2534  C  CD    . GLU A  1  333  ? 42.784  -97.350  129.589 1.00 55.08  ? 333  GLU A CD    1 
ATOM   2535  O  OE1   . GLU A  1  333  ? 41.980  -96.500  129.123 1.00 56.62  ? 333  GLU A OE1   1 
ATOM   2536  O  OE2   . GLU A  1  333  ? 42.659  -97.840  130.742 1.00 56.83  ? 333  GLU A OE2   1 
ATOM   2537  N  N     . GLY A  1  334  ? 44.334  -99.528  124.474 1.00 37.87  ? 334  GLY A N     1 
ATOM   2538  C  CA    . GLY A  1  334  ? 44.348  -99.440  123.029 1.00 34.93  ? 334  GLY A CA    1 
ATOM   2539  C  C     . GLY A  1  334  ? 43.327  -100.373 122.415 1.00 33.43  ? 334  GLY A C     1 
ATOM   2540  O  O     . GLY A  1  334  ? 42.619  -101.081 123.130 1.00 33.01  ? 334  GLY A O     1 
ATOM   2541  N  N     . ARG A  1  335  ? 43.248  -100.380 121.086 1.00 30.77  ? 335  ARG A N     1 
ATOM   2542  C  CA    . ARG A  1  335  ? 42.308  -101.250 120.394 1.00 26.39  ? 335  ARG A CA    1 
ATOM   2543  C  C     . ARG A  1  335  ? 42.756  -102.678 120.605 1.00 24.43  ? 335  ARG A C     1 
ATOM   2544  O  O     . ARG A  1  335  ? 42.011  -103.511 121.104 1.00 22.42  ? 335  ARG A O     1 
ATOM   2545  C  CB    . ARG A  1  335  ? 42.289  -100.935 118.894 1.00 26.93  ? 335  ARG A CB    1 
ATOM   2546  C  CG    . ARG A  1  335  ? 41.209  -101.672 118.116 1.00 25.70  ? 335  ARG A CG    1 
ATOM   2547  C  CD    . ARG A  1  335  ? 39.888  -101.543 118.854 1.00 26.63  ? 335  ARG A CD    1 
ATOM   2548  N  NE    . ARG A  1  335  ? 39.538  -100.146 119.110 1.00 26.07  ? 335  ARG A NE    1 
ATOM   2549  C  CZ    . ARG A  1  335  ? 39.201  -99.289  118.157 1.00 25.80  ? 335  ARG A CZ    1 
ATOM   2550  N  NH1   . ARG A  1  335  ? 39.169  -99.703  116.898 1.00 25.03  ? 335  ARG A NH1   1 
ATOM   2551  N  NH2   . ARG A  1  335  ? 38.905  -98.031  118.457 1.00 24.61  ? 335  ARG A NH2   1 
ATOM   2552  N  N     . ILE A  1  336  ? 44.003  -102.939 120.238 1.00 23.07  ? 336  ILE A N     1 
ATOM   2553  C  CA    . ILE A  1  336  ? 44.565  -104.267 120.356 1.00 21.25  ? 336  ILE A CA    1 
ATOM   2554  C  C     . ILE A  1  336  ? 44.530  -104.750 121.774 1.00 20.40  ? 336  ILE A C     1 
ATOM   2555  O  O     . ILE A  1  336  ? 43.739  -105.616 122.133 1.00 19.15  ? 336  ILE A O     1 
ATOM   2556  C  CB    . ILE A  1  336  ? 46.027  -104.308 119.860 1.00 20.37  ? 336  ILE A CB    1 
ATOM   2557  C  CG1   . ILE A  1  336  ? 46.057  -104.195 118.332 1.00 19.40  ? 336  ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A  1  336  ? 46.706  -105.598 120.298 1.00 18.65  ? 336  ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A  1  336  ? 45.297  -105.280 117.624 1.00 18.86  ? 336  ILE A CD1   1 
ATOM   2560  N  N     . ARG A  1  337  ? 45.393  -104.159 122.578 1.00 20.62  ? 337  ARG A N     1 
ATOM   2561  C  CA    . ARG A  1  337  ? 45.523  -104.544 123.960 1.00 21.29  ? 337  ARG A CA    1 
ATOM   2562  C  C     . ARG A  1  337  ? 44.303  -104.429 124.857 1.00 21.02  ? 337  ARG A C     1 
ATOM   2563  O  O     . ARG A  1  337  ? 44.129  -105.255 125.748 1.00 21.17  ? 337  ARG A O     1 
ATOM   2564  C  CB    . ARG A  1  337  ? 46.679  -103.777 124.574 1.00 21.73  ? 337  ARG A CB    1 
ATOM   2565  C  CG    . ARG A  1  337  ? 47.765  -104.693 125.020 1.00 22.35  ? 337  ARG A CG    1 
ATOM   2566  C  CD    . ARG A  1  337  ? 48.034  -104.505 126.470 1.00 22.99  ? 337  ARG A CD    1 
ATOM   2567  N  NE    . ARG A  1  337  ? 49.221  -103.697 126.684 1.00 24.99  ? 337  ARG A NE    1 
ATOM   2568  C  CZ    . ARG A  1  337  ? 49.772  -103.519 127.878 1.00 28.90  ? 337  ARG A CZ    1 
ATOM   2569  N  NH1   . ARG A  1  337  ? 49.225  -104.099 128.944 1.00 30.97  ? 337  ARG A NH1   1 
ATOM   2570  N  NH2   . ARG A  1  337  ? 50.869  -102.781 128.014 1.00 30.97  ? 337  ARG A NH2   1 
ATOM   2571  N  N     . GLY A  1  338  ? 43.460  -103.423 124.630 1.00 20.04  ? 338  GLY A N     1 
ATOM   2572  C  CA    . GLY A  1  338  ? 42.288  -103.243 125.475 1.00 20.88  ? 338  GLY A CA    1 
ATOM   2573  C  C     . GLY A  1  338  ? 40.908  -103.599 124.925 1.00 22.15  ? 338  GLY A C     1 
ATOM   2574  O  O     . GLY A  1  338  ? 39.896  -103.437 125.611 1.00 22.08  ? 338  GLY A O     1 
ATOM   2575  N  N     . ASN A  1  339  ? 40.852  -104.064 123.683 1.00 22.48  ? 339  ASN A N     1 
ATOM   2576  C  CA    . ASN A  1  339  ? 39.591  -104.460 123.073 1.00 19.70  ? 339  ASN A CA    1 
ATOM   2577  C  C     . ASN A  1  339  ? 39.660  -105.873 122.530 1.00 17.85  ? 339  ASN A C     1 
ATOM   2578  O  O     . ASN A  1  339  ? 38.641  -106.534 122.382 1.00 17.32  ? 339  ASN A O     1 
ATOM   2579  C  CB    . ASN A  1  339  ? 39.227  -103.504 121.955 1.00 21.00  ? 339  ASN A CB    1 
ATOM   2580  C  CG    . ASN A  1  339  ? 38.630  -102.241 122.477 1.00 22.76  ? 339  ASN A CG    1 
ATOM   2581  O  OD1   . ASN A  1  339  ? 37.748  -102.288 123.332 1.00 23.08  ? 339  ASN A OD1   1 
ATOM   2582  N  ND2   . ASN A  1  339  ? 39.089  -101.098 121.970 1.00 24.94  ? 339  ASN A ND2   1 
ATOM   2583  N  N     . LEU A  1  340  ? 40.867  -106.345 122.252 1.00 14.95  ? 340  LEU A N     1 
ATOM   2584  C  CA    . LEU A  1  340  ? 40.997  -107.670 121.720 1.00 15.15  ? 340  LEU A CA    1 
ATOM   2585  C  C     . LEU A  1  340  ? 41.727  -108.659 122.625 1.00 15.84  ? 340  LEU A C     1 
ATOM   2586  O  O     . LEU A  1  340  ? 41.221  -109.752 122.844 1.00 19.06  ? 340  LEU A O     1 
ATOM   2587  C  CB    . LEU A  1  340  ? 41.621  -107.589 120.323 1.00 13.53  ? 340  LEU A CB    1 
ATOM   2588  C  CG    . LEU A  1  340  ? 40.747  -106.825 119.314 1.00 10.54  ? 340  LEU A CG    1 
ATOM   2589  C  CD1   . LEU A  1  340  ? 41.613  -106.177 118.296 1.00 11.34  ? 340  LEU A CD1   1 
ATOM   2590  C  CD2   . LEU A  1  340  ? 39.769  -107.738 118.647 1.00 9.22   ? 340  LEU A CD2   1 
ATOM   2591  N  N     . MET A  1  341  ? 42.891  -108.322 123.166 1.00 16.05  ? 341  MET A N     1 
ATOM   2592  C  CA    . MET A  1  341  ? 43.554  -109.289 124.044 1.00 18.02  ? 341  MET A CA    1 
ATOM   2593  C  C     . MET A  1  341  ? 42.822  -109.334 125.377 1.00 18.01  ? 341  MET A C     1 
ATOM   2594  O  O     . MET A  1  341  ? 43.208  -110.050 126.288 1.00 17.32  ? 341  MET A O     1 
ATOM   2595  C  CB    . MET A  1  341  ? 45.015  -108.919 124.297 1.00 19.82  ? 341  MET A CB    1 
ATOM   2596  C  CG    . MET A  1  341  ? 45.852  -108.781 123.045 1.00 22.50  ? 341  MET A CG    1 
ATOM   2597  S  SD    . MET A  1  341  ? 45.737  -110.173 121.915 1.00 26.25  ? 341  MET A SD    1 
ATOM   2598  C  CE    . MET A  1  341  ? 46.912  -111.331 122.646 1.00 23.47  ? 341  MET A CE    1 
ATOM   2599  N  N     . GLY A  1  342  ? 41.760  -108.547 125.474 1.00 19.18  ? 342  GLY A N     1 
ATOM   2600  C  CA    . GLY A  1  342  ? 40.964  -108.487 126.685 1.00 20.96  ? 342  GLY A CA    1 
ATOM   2601  C  C     . GLY A  1  342  ? 39.778  -107.557 126.475 1.00 21.53  ? 342  GLY A C     1 
ATOM   2602  O  O     . GLY A  1  342  ? 39.894  -106.549 125.775 1.00 21.67  ? 342  GLY A O     1 
ATOM   2603  N  N     . LYS A  1  343  ? 38.634  -107.880 127.065 1.00 20.34  ? 343  LYS A N     1 
ATOM   2604  C  CA    . LYS A  1  343  ? 37.485  -107.022 126.889 1.00 21.15  ? 343  LYS A CA    1 
ATOM   2605  C  C     . LYS A  1  343  ? 36.466  -107.226 128.007 1.00 21.86  ? 343  LYS A C     1 
ATOM   2606  O  O     . LYS A  1  343  ? 36.581  -108.166 128.795 1.00 20.90  ? 343  LYS A O     1 
ATOM   2607  C  CB    . LYS A  1  343  ? 36.871  -107.273 125.501 1.00 19.21  ? 343  LYS A CB    1 
ATOM   2608  C  CG    . LYS A  1  343  ? 36.271  -108.626 125.311 1.00 18.98  ? 343  LYS A CG    1 
ATOM   2609  C  CD    . LYS A  1  343  ? 35.906  -108.879 123.870 1.00 22.30  ? 343  LYS A CD    1 
ATOM   2610  C  CE    . LYS A  1  343  ? 37.112  -109.402 123.056 1.00 25.74  ? 343  LYS A CE    1 
ATOM   2611  N  NZ    . LYS A  1  343  ? 36.770  -109.939 121.679 1.00 23.60  ? 343  LYS A NZ    1 
ATOM   2612  N  N     . ARG A  1  344  ? 35.496  -106.319 128.094 1.00 22.92  ? 344  ARG A N     1 
ATOM   2613  C  CA    . ARG A  1  344  ? 34.454  -106.409 129.106 1.00 24.53  ? 344  ARG A CA    1 
ATOM   2614  C  C     . ARG A  1  344  ? 33.505  -107.456 128.542 1.00 23.15  ? 344  ARG A C     1 
ATOM   2615  O  O     . ARG A  1  344  ? 33.407  -107.591 127.334 1.00 23.57  ? 344  ARG A O     1 
ATOM   2616  C  CB    . ARG A  1  344  ? 33.760  -105.050 129.262 1.00 29.70  ? 344  ARG A CB    1 
ATOM   2617  C  CG    . ARG A  1  344  ? 34.497  -103.864 128.565 1.00 36.74  ? 344  ARG A CG    1 
ATOM   2618  C  CD    . ARG A  1  344  ? 34.035  -102.445 129.059 1.00 40.74  ? 344  ARG A CD    1 
ATOM   2619  N  NE    . ARG A  1  344  ? 34.778  -101.965 130.235 1.00 44.87  ? 344  ARG A NE    1 
ATOM   2620  C  CZ    . ARG A  1  344  ? 34.736  -102.523 131.450 1.00 46.18  ? 344  ARG A CZ    1 
ATOM   2621  N  NH1   . ARG A  1  344  ? 33.974  -103.590 131.675 1.00 46.02  ? 344  ARG A NH1   1 
ATOM   2622  N  NH2   . ARG A  1  344  ? 35.483  -102.036 132.442 1.00 45.37  ? 344  ARG A NH2   1 
ATOM   2623  N  N     . VAL A  1  345  ? 32.791  -108.195 129.378 1.00 21.37  ? 345  VAL A N     1 
ATOM   2624  C  CA    . VAL A  1  345  ? 31.936  -109.238 128.831 1.00 19.95  ? 345  VAL A CA    1 
ATOM   2625  C  C     . VAL A  1  345  ? 30.583  -109.449 129.504 1.00 21.04  ? 345  VAL A C     1 
ATOM   2626  O  O     . VAL A  1  345  ? 30.397  -109.089 130.653 1.00 21.73  ? 345  VAL A O     1 
ATOM   2627  C  CB    . VAL A  1  345  ? 32.689  -110.553 128.878 1.00 17.90  ? 345  VAL A CB    1 
ATOM   2628  C  CG1   . VAL A  1  345  ? 34.127  -110.315 128.556 1.00 17.49  ? 345  VAL A CG1   1 
ATOM   2629  C  CG2   . VAL A  1  345  ? 32.597  -111.160 130.242 1.00 17.99  ? 345  VAL A CG2   1 
ATOM   2630  N  N     . ASP A  1  346  ? 29.641  -110.051 128.783 1.00 22.81  ? 346  ASP A N     1 
ATOM   2631  C  CA    . ASP A  1  346  ? 28.317  -110.346 129.337 1.00 25.15  ? 346  ASP A CA    1 
ATOM   2632  C  C     . ASP A  1  346  ? 28.427  -111.518 130.309 1.00 24.37  ? 346  ASP A C     1 
ATOM   2633  O  O     . ASP A  1  346  ? 29.459  -112.173 130.384 1.00 24.51  ? 346  ASP A O     1 
ATOM   2634  C  CB    . ASP A  1  346  ? 27.327  -110.732 128.227 1.00 29.32  ? 346  ASP A CB    1 
ATOM   2635  C  CG    . ASP A  1  346  ? 27.013  -109.573 127.271 1.00 34.24  ? 346  ASP A CG    1 
ATOM   2636  O  OD1   . ASP A  1  346  ? 26.851  -108.425 127.747 1.00 35.34  ? 346  ASP A OD1   1 
ATOM   2637  O  OD2   . ASP A  1  346  ? 26.904  -109.817 126.042 1.00 37.31  ? 346  ASP A OD2   1 
ATOM   2638  N  N     . PHE A  1  347  ? 27.356  -111.794 131.038 1.00 23.50  ? 347  PHE A N     1 
ATOM   2639  C  CA    . PHE A  1  347  ? 27.342  -112.905 131.992 1.00 22.88  ? 347  PHE A CA    1 
ATOM   2640  C  C     . PHE A  1  347  ? 28.513  -112.941 132.935 1.00 20.90  ? 347  PHE A C     1 
ATOM   2641  O  O     . PHE A  1  347  ? 29.272  -113.899 132.962 1.00 21.44  ? 347  PHE A O     1 
ATOM   2642  C  CB    . PHE A  1  347  ? 27.272  -114.246 131.265 1.00 23.95  ? 347  PHE A CB    1 
ATOM   2643  C  CG    . PHE A  1  347  ? 26.066  -114.386 130.391 1.00 26.07  ? 347  PHE A CG    1 
ATOM   2644  C  CD1   . PHE A  1  347  ? 26.097  -113.960 129.068 1.00 26.60  ? 347  PHE A CD1   1 
ATOM   2645  C  CD2   . PHE A  1  347  ? 24.877  -114.899 130.906 1.00 26.49  ? 347  PHE A CD2   1 
ATOM   2646  C  CE1   . PHE A  1  347  ? 24.962  -114.044 128.273 1.00 28.54  ? 347  PHE A CE1   1 
ATOM   2647  C  CE2   . PHE A  1  347  ? 23.736  -114.984 130.124 1.00 26.80  ? 347  PHE A CE2   1 
ATOM   2648  C  CZ    . PHE A  1  347  ? 23.774  -114.559 128.807 1.00 28.33  ? 347  PHE A CZ    1 
ATOM   2649  N  N     . SER A  1  348  ? 28.645  -111.899 133.728 1.00 18.72  ? 348  SER A N     1 
ATOM   2650  C  CA    . SER A  1  348  ? 29.724  -111.825 134.681 1.00 17.88  ? 348  SER A CA    1 
ATOM   2651  C  C     . SER A  1  348  ? 29.145  -111.128 135.894 1.00 17.31  ? 348  SER A C     1 
ATOM   2652  O  O     . SER A  1  348  ? 28.159  -110.411 135.770 1.00 17.84  ? 348  SER A O     1 
ATOM   2653  C  CB    . SER A  1  348  ? 30.843  -111.008 134.076 1.00 19.29  ? 348  SER A CB    1 
ATOM   2654  O  OG    . SER A  1  348  ? 30.314  -109.828 133.493 1.00 21.65  ? 348  SER A OG    1 
ATOM   2655  N  N     . ALA A  1  349  ? 29.739  -111.334 137.063 1.00 15.89  ? 349  ALA A N     1 
ATOM   2656  C  CA    . ALA A  1  349  ? 29.235  -110.712 138.286 1.00 15.13  ? 349  ALA A CA    1 
ATOM   2657  C  C     . ALA A  1  349  ? 30.353  -110.537 139.300 1.00 15.07  ? 349  ALA A C     1 
ATOM   2658  O  O     . ALA A  1  349  ? 31.304  -111.321 139.331 1.00 15.85  ? 349  ALA A O     1 
ATOM   2659  C  CB    . ALA A  1  349  ? 28.111  -111.559 138.884 1.00 13.82  ? 349  ALA A CB    1 
ATOM   2660  N  N     . ARG A  1  350  ? 30.213  -109.541 140.167 1.00 14.10  ? 350  ARG A N     1 
ATOM   2661  C  CA    . ARG A  1  350  ? 31.254  -109.257 141.136 1.00 14.26  ? 350  ARG A CA    1 
ATOM   2662  C  C     . ARG A  1  350  ? 30.753  -108.651 142.452 1.00 14.10  ? 350  ARG A C     1 
ATOM   2663  O  O     . ARG A  1  350  ? 29.867  -107.819 142.412 1.00 15.81  ? 350  ARG A O     1 
ATOM   2664  C  CB    . ARG A  1  350  ? 32.204  -108.308 140.436 1.00 14.07  ? 350  ARG A CB    1 
ATOM   2665  C  CG    . ARG A  1  350  ? 33.294  -107.754 141.244 1.00 16.12  ? 350  ARG A CG    1 
ATOM   2666  C  CD    . ARG A  1  350  ? 33.954  -106.651 140.454 1.00 18.36  ? 350  ARG A CD    1 
ATOM   2667  N  NE    . ARG A  1  350  ? 34.817  -105.882 141.331 1.00 21.21  ? 350  ARG A NE    1 
ATOM   2668  C  CZ    . ARG A  1  350  ? 36.078  -106.195 141.591 1.00 23.03  ? 350  ARG A CZ    1 
ATOM   2669  N  NH1   . ARG A  1  350  ? 36.638  -107.266 141.018 1.00 21.93  ? 350  ARG A NH1   1 
ATOM   2670  N  NH2   . ARG A  1  350  ? 36.762  -105.452 142.459 1.00 22.54  ? 350  ARG A NH2   1 
ATOM   2671  N  N     . THR A  1  351  ? 31.281  -109.081 143.604 1.00 14.04  ? 351  THR A N     1 
ATOM   2672  C  CA    . THR A  1  351  ? 30.914  -108.506 144.925 1.00 15.00  ? 351  THR A CA    1 
ATOM   2673  C  C     . THR A  1  351  ? 31.929  -108.868 145.984 1.00 16.08  ? 351  THR A C     1 
ATOM   2674  O  O     . THR A  1  351  ? 32.821  -109.677 145.763 1.00 18.24  ? 351  THR A O     1 
ATOM   2675  C  CB    . THR A  1  351  ? 29.567  -108.994 145.542 1.00 13.54  ? 351  THR A CB    1 
ATOM   2676  O  OG1   . THR A  1  351  ? 29.745  -110.284 146.123 1.00 13.37  ? 351  THR A OG1   1 
ATOM   2677  C  CG2   . THR A  1  351  ? 28.507  -109.088 144.535 1.00 17.54  ? 351  THR A CG2   1 
ATOM   2678  N  N     . VAL A  1  352  ? 31.766  -108.278 147.158 1.00 16.95  ? 352  VAL A N     1 
ATOM   2679  C  CA    . VAL A  1  352  ? 32.651  -108.559 148.275 1.00 17.55  ? 352  VAL A CA    1 
ATOM   2680  C  C     . VAL A  1  352  ? 32.609  -110.040 148.609 1.00 20.34  ? 352  VAL A C     1 
ATOM   2681  O  O     . VAL A  1  352  ? 31.580  -110.685 148.445 1.00 21.29  ? 352  VAL A O     1 
ATOM   2682  C  CB    . VAL A  1  352  ? 32.212  -107.825 149.505 1.00 14.42  ? 352  VAL A CB    1 
ATOM   2683  C  CG1   . VAL A  1  352  ? 33.150  -108.139 150.640 1.00 13.61  ? 352  VAL A CG1   1 
ATOM   2684  C  CG2   . VAL A  1  352  ? 32.164  -106.367 149.213 1.00 14.79  ? 352  VAL A CG2   1 
ATOM   2685  N  N     . ILE A  1  353  ? 33.721  -110.583 149.090 1.00 22.05  ? 353  ILE A N     1 
ATOM   2686  C  CA    . ILE A  1  353  ? 33.755  -112.001 149.451 1.00 22.33  ? 353  ILE A CA    1 
ATOM   2687  C  C     . ILE A  1  353  ? 33.981  -112.171 150.939 1.00 21.84  ? 353  ILE A C     1 
ATOM   2688  O  O     . ILE A  1  353  ? 34.474  -111.252 151.596 1.00 24.85  ? 353  ILE A O     1 
ATOM   2689  C  CB    . ILE A  1  353  ? 34.858  -112.745 148.666 1.00 20.92  ? 353  ILE A CB    1 
ATOM   2690  C  CG1   . ILE A  1  353  ? 36.263  -112.337 149.107 1.00 18.47  ? 353  ILE A CG1   1 
ATOM   2691  C  CG2   . ILE A  1  353  ? 34.753  -112.347 147.235 1.00 23.65  ? 353  ILE A CG2   1 
ATOM   2692  C  CD1   . ILE A  1  353  ? 37.331  -113.120 148.405 1.00 13.81  ? 353  ILE A CD1   1 
ATOM   2693  N  N     . SER A  1  354  ? 33.585  -113.320 151.475 1.00 20.48  ? 354  SER A N     1 
ATOM   2694  C  CA    . SER A  1  354  ? 33.784  -113.620 152.896 1.00 21.12  ? 354  SER A CA    1 
ATOM   2695  C  C     . SER A  1  354  ? 33.770  -115.130 153.036 1.00 21.43  ? 354  SER A C     1 
ATOM   2696  O  O     . SER A  1  354  ? 32.938  -115.801 152.447 1.00 23.59  ? 354  SER A O     1 
ATOM   2697  C  CB    . SER A  1  354  ? 32.716  -112.949 153.789 1.00 19.48  ? 354  SER A CB    1 
ATOM   2698  O  OG    . SER A  1  354  ? 31.390  -113.253 153.402 1.00 17.18  ? 354  SER A OG    1 
ATOM   2699  N  N     . GLY A  1  355  ? 34.722  -115.665 153.786 1.00 21.49  ? 355  GLY A N     1 
ATOM   2700  C  CA    . GLY A  1  355  ? 34.825  -117.104 153.940 1.00 21.18  ? 355  GLY A CA    1 
ATOM   2701  C  C     . GLY A  1  355  ? 33.638  -117.740 154.604 1.00 21.61  ? 355  GLY A C     1 
ATOM   2702  O  O     . GLY A  1  355  ? 32.873  -117.068 155.298 1.00 23.70  ? 355  GLY A O     1 
ATOM   2703  N  N     . ASP A  1  356  ? 33.489  -119.043 154.399 1.00 20.54  ? 356  ASP A N     1 
ATOM   2704  C  CA    . ASP A  1  356  ? 32.378  -119.777 154.984 1.00 21.67  ? 356  ASP A CA    1 
ATOM   2705  C  C     . ASP A  1  356  ? 32.829  -121.186 155.297 1.00 21.52  ? 356  ASP A C     1 
ATOM   2706  O  O     . ASP A  1  356  ? 32.860  -122.030 154.426 1.00 21.12  ? 356  ASP A O     1 
ATOM   2707  C  CB    . ASP A  1  356  ? 31.215  -119.813 154.006 1.00 22.36  ? 356  ASP A CB    1 
ATOM   2708  C  CG    . ASP A  1  356  ? 29.908  -120.163 154.672 1.00 23.60  ? 356  ASP A CG    1 
ATOM   2709  O  OD1   . ASP A  1  356  ? 29.790  -121.300 155.176 1.00 23.44  ? 356  ASP A OD1   1 
ATOM   2710  O  OD2   . ASP A  1  356  ? 29.005  -119.297 154.692 1.00 22.30  ? 356  ASP A OD2   1 
ATOM   2711  N  N     . PRO A  1  357  ? 33.166  -121.459 156.563 1.00 22.81  ? 357  PRO A N     1 
ATOM   2712  C  CA    . PRO A  1  357  ? 33.630  -122.775 157.004 1.00 23.32  ? 357  PRO A CA    1 
ATOM   2713  C  C     . PRO A  1  357  ? 32.612  -123.893 156.829 1.00 24.62  ? 357  PRO A C     1 
ATOM   2714  O  O     . PRO A  1  357  ? 32.742  -124.968 157.419 1.00 24.78  ? 357  PRO A O     1 
ATOM   2715  C  CB    . PRO A  1  357  ? 33.977  -122.533 158.457 1.00 22.80  ? 357  PRO A CB    1 
ATOM   2716  C  CG    . PRO A  1  357  ? 32.965  -121.518 158.858 1.00 22.11  ? 357  PRO A CG    1 
ATOM   2717  C  CD    . PRO A  1  357  ? 32.971  -120.562 157.713 1.00 21.88  ? 357  PRO A CD    1 
ATOM   2718  N  N     . ASN A  1  358  ? 31.603  -123.650 156.007 1.00 25.45  ? 358  ASN A N     1 
ATOM   2719  C  CA    . ASN A  1  358  ? 30.607  -124.673 155.792 1.00 26.26  ? 358  ASN A CA    1 
ATOM   2720  C  C     . ASN A  1  358  ? 30.357  -125.099 154.371 1.00 26.90  ? 358  ASN A C     1 
ATOM   2721  O  O     . ASN A  1  358  ? 29.499  -125.940 154.133 1.00 28.75  ? 358  ASN A O     1 
ATOM   2722  C  CB    . ASN A  1  358  ? 29.307  -124.275 156.449 1.00 27.41  ? 358  ASN A CB    1 
ATOM   2723  C  CG    . ASN A  1  358  ? 29.271  -124.677 157.883 1.00 28.02  ? 358  ASN A CG    1 
ATOM   2724  O  OD1   . ASN A  1  358  ? 29.337  -125.866 158.187 1.00 27.91  ? 358  ASN A OD1   1 
ATOM   2725  N  ND2   . ASN A  1  358  ? 29.183  -123.697 158.786 1.00 27.34  ? 358  ASN A ND2   1 
ATOM   2726  N  N     . LEU A  1  359  ? 31.093  -124.523 153.428 1.00 26.52  ? 359  LEU A N     1 
ATOM   2727  C  CA    . LEU A  1  359  ? 30.982  -124.918 152.023 1.00 25.87  ? 359  LEU A CA    1 
ATOM   2728  C  C     . LEU A  1  359  ? 32.100  -125.926 151.667 1.00 27.03  ? 359  LEU A C     1 
ATOM   2729  O  O     . LEU A  1  359  ? 33.141  -125.979 152.325 1.00 26.37  ? 359  LEU A O     1 
ATOM   2730  C  CB    . LEU A  1  359  ? 31.091  -123.696 151.115 1.00 21.99  ? 359  LEU A CB    1 
ATOM   2731  C  CG    . LEU A  1  359  ? 29.878  -122.793 151.152 1.00 18.89  ? 359  LEU A CG    1 
ATOM   2732  C  CD1   . LEU A  1  359  ? 30.009  -121.672 150.135 1.00 17.02  ? 359  LEU A CD1   1 
ATOM   2733  C  CD2   . LEU A  1  359  ? 28.671  -123.652 150.859 1.00 18.98  ? 359  LEU A CD2   1 
ATOM   2734  N  N     . GLU A  1  360  ? 31.889  -126.737 150.638 1.00 28.23  ? 360  GLU A N     1 
ATOM   2735  C  CA    . GLU A  1  360  ? 32.924  -127.683 150.265 1.00 29.86  ? 360  GLU A CA    1 
ATOM   2736  C  C     . GLU A  1  360  ? 34.014  -126.887 149.553 1.00 27.72  ? 360  GLU A C     1 
ATOM   2737  O  O     . GLU A  1  360  ? 33.737  -125.855 148.955 1.00 27.20  ? 360  GLU A O     1 
ATOM   2738  C  CB    . GLU A  1  360  ? 32.353  -128.789 149.363 1.00 35.07  ? 360  GLU A CB    1 
ATOM   2739  C  CG    . GLU A  1  360  ? 31.415  -129.794 150.075 1.00 42.16  ? 360  GLU A CG    1 
ATOM   2740  C  CD    . GLU A  1  360  ? 32.033  -130.433 151.342 1.00 46.88  ? 360  GLU A CD    1 
ATOM   2741  O  OE1   . GLU A  1  360  ? 33.113  -131.070 151.250 1.00 48.56  ? 360  GLU A OE1   1 
ATOM   2742  O  OE2   . GLU A  1  360  ? 31.431  -130.298 152.436 1.00 49.25  ? 360  GLU A OE2   1 
ATOM   2743  N  N     . LEU A  1  361  ? 35.253  -127.354 149.643 1.00 25.87  ? 361  LEU A N     1 
ATOM   2744  C  CA    . LEU A  1  361  ? 36.382  -126.672 149.024 1.00 25.00  ? 361  LEU A CA    1 
ATOM   2745  C  C     . LEU A  1  361  ? 36.025  -126.050 147.677 1.00 26.68  ? 361  LEU A C     1 
ATOM   2746  O  O     . LEU A  1  361  ? 36.291  -124.864 147.435 1.00 28.63  ? 361  LEU A O     1 
ATOM   2747  C  CB    . LEU A  1  361  ? 37.542  -127.654 148.832 1.00 23.25  ? 361  LEU A CB    1 
ATOM   2748  C  CG    . LEU A  1  361  ? 38.838  -127.217 148.134 1.00 23.21  ? 361  LEU A CG    1 
ATOM   2749  C  CD1   . LEU A  1  361  ? 39.655  -126.384 149.086 1.00 24.53  ? 361  LEU A CD1   1 
ATOM   2750  C  CD2   . LEU A  1  361  ? 39.655  -128.426 147.709 1.00 21.31  ? 361  LEU A CD2   1 
ATOM   2751  N  N     . ASP A  1  362  ? 35.394  -126.837 146.810 1.00 25.56  ? 362  ASP A N     1 
ATOM   2752  C  CA    . ASP A  1  362  ? 35.058  -126.359 145.478 1.00 25.13  ? 362  ASP A CA    1 
ATOM   2753  C  C     . ASP A  1  362  ? 33.706  -125.692 145.220 1.00 25.88  ? 362  ASP A C     1 
ATOM   2754  O  O     . ASP A  1  362  ? 33.336  -125.487 144.066 1.00 26.48  ? 362  ASP A O     1 
ATOM   2755  C  CB    . ASP A  1  362  ? 35.228  -127.487 144.478 1.00 25.99  ? 362  ASP A CB    1 
ATOM   2756  C  CG    . ASP A  1  362  ? 34.229  -128.583 144.685 1.00 28.42  ? 362  ASP A CG    1 
ATOM   2757  O  OD1   . ASP A  1  362  ? 34.113  -129.467 143.805 1.00 30.77  ? 362  ASP A OD1   1 
ATOM   2758  O  OD2   . ASP A  1  362  ? 33.561  -128.561 145.734 1.00 27.82  ? 362  ASP A OD2   1 
ATOM   2759  N  N     . GLN A  1  363  ? 32.949  -125.355 146.256 1.00 25.33  ? 363  GLN A N     1 
ATOM   2760  C  CA    . GLN A  1  363  ? 31.685  -124.678 146.012 1.00 23.53  ? 363  GLN A CA    1 
ATOM   2761  C  C     . GLN A  1  363  ? 31.987  -123.198 145.989 1.00 23.11  ? 363  GLN A C     1 
ATOM   2762  O  O     . GLN A  1  363  ? 33.142  -122.792 146.130 1.00 25.35  ? 363  GLN A O     1 
ATOM   2763  C  CB    . GLN A  1  363  ? 30.691  -124.958 147.116 1.00 23.99  ? 363  GLN A CB    1 
ATOM   2764  C  CG    . GLN A  1  363  ? 30.256  -126.385 147.184 1.00 27.37  ? 363  GLN A CG    1 
ATOM   2765  C  CD    . GLN A  1  363  ? 29.082  -126.555 148.110 1.00 30.25  ? 363  GLN A CD    1 
ATOM   2766  O  OE1   . GLN A  1  363  ? 29.232  -126.605 149.338 1.00 30.13  ? 363  GLN A OE1   1 
ATOM   2767  N  NE2   . GLN A  1  363  ? 27.888  -126.612 147.529 1.00 31.68  ? 363  GLN A NE2   1 
ATOM   2768  N  N     . VAL A  1  364  ? 30.950  -122.395 145.811 1.00 21.33  ? 364  VAL A N     1 
ATOM   2769  C  CA    . VAL A  1  364  ? 31.078  -120.944 145.791 1.00 19.23  ? 364  VAL A CA    1 
ATOM   2770  C  C     . VAL A  1  364  ? 29.703  -120.369 146.106 1.00 19.50  ? 364  VAL A C     1 
ATOM   2771  O  O     . VAL A  1  364  ? 28.788  -120.429 145.279 1.00 20.61  ? 364  VAL A O     1 
ATOM   2772  C  CB    . VAL A  1  364  ? 31.573  -120.431 144.417 1.00 16.39  ? 364  VAL A CB    1 
ATOM   2773  C  CG1   . VAL A  1  364  ? 30.750  -121.008 143.304 1.00 15.66  ? 364  VAL A CG1   1 
ATOM   2774  C  CG2   . VAL A  1  364  ? 31.494  -118.944 144.385 1.00 15.15  ? 364  VAL A CG2   1 
ATOM   2775  N  N     . GLY A  1  365  ? 29.547  -119.848 147.319 1.00 18.26  ? 365  GLY A N     1 
ATOM   2776  C  CA    . GLY A  1  365  ? 28.265  -119.291 147.709 1.00 17.82  ? 365  GLY A CA    1 
ATOM   2777  C  C     . GLY A  1  365  ? 27.863  -118.104 146.851 1.00 18.06  ? 365  GLY A C     1 
ATOM   2778  O  O     . GLY A  1  365  ? 28.554  -117.084 146.833 1.00 19.70  ? 365  GLY A O     1 
ATOM   2779  N  N     . VAL A  1  366  ? 26.749  -118.216 146.137 1.00 15.57  ? 366  VAL A N     1 
ATOM   2780  C  CA    . VAL A  1  366  ? 26.325  -117.118 145.285 1.00 13.00  ? 366  VAL A CA    1 
ATOM   2781  C  C     . VAL A  1  366  ? 25.062  -116.444 145.768 1.00 13.47  ? 366  VAL A C     1 
ATOM   2782  O  O     . VAL A  1  366  ? 24.028  -117.096 145.937 1.00 12.28  ? 366  VAL A O     1 
ATOM   2783  C  CB    . VAL A  1  366  ? 26.080  -117.568 143.830 1.00 10.92  ? 366  VAL A CB    1 
ATOM   2784  C  CG1   . VAL A  1  366  ? 25.389  -116.457 143.078 1.00 8.32   ? 366  VAL A CG1   1 
ATOM   2785  C  CG2   . VAL A  1  366  ? 27.398  -117.911 143.150 1.00 8.32   ? 366  VAL A CG2   1 
ATOM   2786  N  N     . PRO A  1  367  ? 25.132  -115.123 146.006 1.00 13.74  ? 367  PRO A N     1 
ATOM   2787  C  CA    . PRO A  1  367  ? 23.955  -114.389 146.466 1.00 14.65  ? 367  PRO A CA    1 
ATOM   2788  C  C     . PRO A  1  367  ? 22.775  -114.611 145.531 1.00 15.16  ? 367  PRO A C     1 
ATOM   2789  O  O     . PRO A  1  367  ? 22.898  -114.498 144.311 1.00 15.32  ? 367  PRO A O     1 
ATOM   2790  C  CB    . PRO A  1  367  ? 24.429  -112.920 146.508 1.00 14.13  ? 367  PRO A CB    1 
ATOM   2791  C  CG    . PRO A  1  367  ? 25.740  -112.891 145.780 1.00 13.44  ? 367  PRO A CG    1 
ATOM   2792  C  CD    . PRO A  1  367  ? 26.327  -114.267 146.040 1.00 14.47  ? 367  PRO A CD    1 
ATOM   2793  N  N     . LYS A  1  368  ? 21.636  -114.952 146.118 1.00 16.19  ? 368  LYS A N     1 
ATOM   2794  C  CA    . LYS A  1  368  ? 20.421  -115.197 145.358 1.00 16.74  ? 368  LYS A CA    1 
ATOM   2795  C  C     . LYS A  1  368  ? 20.150  -114.111 144.319 1.00 16.28  ? 368  LYS A C     1 
ATOM   2796  O  O     . LYS A  1  368  ? 19.813  -114.414 143.174 1.00 15.53  ? 368  LYS A O     1 
ATOM   2797  C  CB    . LYS A  1  368  ? 19.232  -115.326 146.316 1.00 18.33  ? 368  LYS A CB    1 
ATOM   2798  C  CG    . LYS A  1  368  ? 17.878  -115.045 145.693 1.00 21.51  ? 368  LYS A CG    1 
ATOM   2799  C  CD    . LYS A  1  368  ? 16.755  -115.595 146.552 1.00 25.67  ? 368  LYS A CD    1 
ATOM   2800  C  CE    . LYS A  1  368  ? 16.920  -117.112 146.702 1.00 30.09  ? 368  LYS A CE    1 
ATOM   2801  N  NZ    . LYS A  1  368  ? 15.824  -117.788 147.471 1.00 34.77  ? 368  LYS A NZ    1 
ATOM   2802  N  N     . SER A  1  369  ? 20.313  -112.850 144.706 1.00 15.85  ? 369  SER A N     1 
ATOM   2803  C  CA    . SER A  1  369  ? 20.047  -111.761 143.777 1.00 17.59  ? 369  SER A CA    1 
ATOM   2804  C  C     . SER A  1  369  ? 20.885  -111.926 142.496 1.00 18.20  ? 369  SER A C     1 
ATOM   2805  O  O     . SER A  1  369  ? 20.416  -111.658 141.379 1.00 18.64  ? 369  SER A O     1 
ATOM   2806  C  CB    . SER A  1  369  ? 20.321  -110.407 144.447 1.00 16.69  ? 369  SER A CB    1 
ATOM   2807  O  OG    . SER A  1  369  ? 21.686  -110.052 144.420 1.00 17.36  ? 369  SER A OG    1 
ATOM   2808  N  N     . ILE A  1  370  ? 22.119  -112.393 142.656 1.00 17.76  ? 370  ILE A N     1 
ATOM   2809  C  CA    . ILE A  1  370  ? 22.994  -112.598 141.513 1.00 15.61  ? 370  ILE A CA    1 
ATOM   2810  C  C     . ILE A  1  370  ? 22.569  -113.831 140.757 1.00 16.41  ? 370  ILE A C     1 
ATOM   2811  O  O     . ILE A  1  370  ? 22.657  -113.866 139.540 1.00 17.60  ? 370  ILE A O     1 
ATOM   2812  C  CB    . ILE A  1  370  ? 24.473  -112.766 141.925 1.00 11.77  ? 370  ILE A CB    1 
ATOM   2813  C  CG1   . ILE A  1  370  ? 25.073  -111.400 142.239 1.00 7.28   ? 370  ILE A CG1   1 
ATOM   2814  C  CG2   . ILE A  1  370  ? 25.247  -113.437 140.815 1.00 10.44  ? 370  ILE A CG2   1 
ATOM   2815  C  CD1   . ILE A  1  370  ? 26.530  -111.444 142.447 1.00 4.47   ? 370  ILE A CD1   1 
ATOM   2816  N  N     . ALA A  1  371  ? 22.109  -114.847 141.473 1.00 17.53  ? 371  ALA A N     1 
ATOM   2817  C  CA    . ALA A  1  371  ? 21.699  -116.070 140.809 1.00 18.26  ? 371  ALA A CA    1 
ATOM   2818  C  C     . ALA A  1  371  ? 20.562  -115.774 139.891 1.00 19.36  ? 371  ALA A C     1 
ATOM   2819  O  O     . ALA A  1  371  ? 20.423  -116.431 138.875 1.00 20.70  ? 371  ALA A O     1 
ATOM   2820  C  CB    . ALA A  1  371  ? 21.266  -117.098 141.807 1.00 18.26  ? 371  ALA A CB    1 
ATOM   2821  N  N     . LYS A  1  372  ? 19.757  -114.774 140.248 1.00 19.91  ? 372  LYS A N     1 
ATOM   2822  C  CA    . LYS A  1  372  ? 18.584  -114.417 139.461 1.00 20.29  ? 372  LYS A CA    1 
ATOM   2823  C  C     . LYS A  1  372  ? 18.810  -113.503 138.273 1.00 20.77  ? 372  LYS A C     1 
ATOM   2824  O  O     . LYS A  1  372  ? 17.882  -113.246 137.498 1.00 21.67  ? 372  LYS A O     1 
ATOM   2825  C  CB    . LYS A  1  372  ? 17.521  -113.791 140.358 1.00 20.93  ? 372  LYS A CB    1 
ATOM   2826  C  CG    . LYS A  1  372  ? 16.868  -114.746 141.353 1.00 21.86  ? 372  LYS A CG    1 
ATOM   2827  C  CD    . LYS A  1  372  ? 15.525  -114.181 141.814 1.00 22.52  ? 372  LYS A CD    1 
ATOM   2828  C  CE    . LYS A  1  372  ? 15.670  -112.795 142.455 1.00 23.74  ? 372  LYS A CE    1 
ATOM   2829  N  NZ    . LYS A  1  372  ? 14.366  -112.099 142.558 1.00 22.00  ? 372  LYS A NZ    1 
ATOM   2830  N  N     . THR A  1  373  ? 20.033  -113.008 138.139 1.00 20.89  ? 373  THR A N     1 
ATOM   2831  C  CA    . THR A  1  373  ? 20.406  -112.109 137.050 1.00 20.79  ? 373  THR A CA    1 
ATOM   2832  C  C     . THR A  1  373  ? 21.132  -112.895 135.977 1.00 20.22  ? 373  THR A C     1 
ATOM   2833  O  O     . THR A  1  373  ? 20.796  -112.820 134.792 1.00 21.09  ? 373  THR A O     1 
ATOM   2834  C  CB    . THR A  1  373  ? 21.379  -111.052 137.528 1.00 22.45  ? 373  THR A CB    1 
ATOM   2835  O  OG1   . THR A  1  373  ? 20.777  -110.267 138.567 1.00 24.72  ? 373  THR A OG1   1 
ATOM   2836  C  CG2   . THR A  1  373  ? 21.807  -110.193 136.370 1.00 23.12  ? 373  THR A CG2   1 
ATOM   2837  N  N     . LEU A  1  374  ? 22.157  -113.617 136.426 1.00 18.49  ? 374  LEU A N     1 
ATOM   2838  C  CA    . LEU A  1  374  ? 22.981  -114.460 135.584 1.00 17.51  ? 374  LEU A CA    1 
ATOM   2839  C  C     . LEU A  1  374  ? 22.129  -115.626 135.147 1.00 18.92  ? 374  LEU A C     1 
ATOM   2840  O  O     . LEU A  1  374  ? 21.469  -116.260 135.961 1.00 18.50  ? 374  LEU A O     1 
ATOM   2841  C  CB    . LEU A  1  374  ? 24.189  -114.964 136.364 1.00 15.66  ? 374  LEU A CB    1 
ATOM   2842  C  CG    . LEU A  1  374  ? 25.173  -113.838 136.656 1.00 16.47  ? 374  LEU A CG    1 
ATOM   2843  C  CD1   . LEU A  1  374  ? 26.078  -114.168 137.826 1.00 14.46  ? 374  LEU A CD1   1 
ATOM   2844  C  CD2   . LEU A  1  374  ? 25.964  -113.583 135.399 1.00 15.70  ? 374  LEU A CD2   1 
ATOM   2845  N  N     . THR A  1  375  ? 22.178  -115.925 133.855 1.00 20.42  ? 375  THR A N     1 
ATOM   2846  C  CA    . THR A  1  375  ? 21.381  -116.984 133.294 1.00 20.57  ? 375  THR A CA    1 
ATOM   2847  C  C     . THR A  1  375  ? 22.166  -118.018 132.447 1.00 20.27  ? 375  THR A C     1 
ATOM   2848  O  O     . THR A  1  375  ? 23.317  -117.815 132.112 1.00 20.57  ? 375  THR A O     1 
ATOM   2849  C  CB    . THR A  1  375  ? 20.291  -116.305 132.473 1.00 21.71  ? 375  THR A CB    1 
ATOM   2850  O  OG1   . THR A  1  375  ? 19.283  -117.257 132.140 1.00 28.35  ? 375  THR A OG1   1 
ATOM   2851  C  CG2   . THR A  1  375  ? 20.868  -115.695 131.211 1.00 21.15  ? 375  THR A CG2   1 
ATOM   2852  N  N     . TYR A  1  376  ? 21.551  -119.153 132.141 1.00 22.30  ? 376  TYR A N     1 
ATOM   2853  C  CA    . TYR A  1  376  ? 22.175  -120.177 131.296 1.00 22.69  ? 376  TYR A CA    1 
ATOM   2854  C  C     . TYR A  1  376  ? 21.184  -120.590 130.213 1.00 25.27  ? 376  TYR A C     1 
ATOM   2855  O  O     . TYR A  1  376  ? 20.015  -120.854 130.494 1.00 25.96  ? 376  TYR A O     1 
ATOM   2856  C  CB    . TYR A  1  376  ? 22.521  -121.424 132.080 1.00 22.10  ? 376  TYR A CB    1 
ATOM   2857  C  CG    . TYR A  1  376  ? 23.157  -122.504 131.229 1.00 21.99  ? 376  TYR A CG    1 
ATOM   2858  C  CD1   . TYR A  1  376  ? 24.533  -122.524 131.006 1.00 23.15  ? 376  TYR A CD1   1 
ATOM   2859  C  CD2   . TYR A  1  376  ? 22.395  -123.524 130.672 1.00 22.57  ? 376  TYR A CD2   1 
ATOM   2860  C  CE1   . TYR A  1  376  ? 25.137  -123.535 130.261 1.00 22.65  ? 376  TYR A CE1   1 
ATOM   2861  C  CE2   . TYR A  1  376  ? 22.992  -124.544 129.920 1.00 22.53  ? 376  TYR A CE2   1 
ATOM   2862  C  CZ    . TYR A  1  376  ? 24.362  -124.541 129.727 1.00 22.90  ? 376  TYR A CZ    1 
ATOM   2863  O  OH    . TYR A  1  376  ? 24.971  -125.550 129.029 1.00 23.11  ? 376  TYR A OH    1 
ATOM   2864  N  N     . PRO A  1  377  ? 21.638  -120.656 128.957 1.00 26.93  ? 377  PRO A N     1 
ATOM   2865  C  CA    . PRO A  1  377  ? 20.805  -121.036 127.812 1.00 27.55  ? 377  PRO A CA    1 
ATOM   2866  C  C     . PRO A  1  377  ? 20.713  -122.532 127.600 1.00 28.66  ? 377  PRO A C     1 
ATOM   2867  O  O     . PRO A  1  377  ? 21.497  -123.106 126.859 1.00 28.06  ? 377  PRO A O     1 
ATOM   2868  C  CB    . PRO A  1  377  ? 21.499  -120.351 126.659 1.00 27.41  ? 377  PRO A CB    1 
ATOM   2869  C  CG    . PRO A  1  377  ? 22.914  -120.494 127.051 1.00 27.90  ? 377  PRO A CG    1 
ATOM   2870  C  CD    . PRO A  1  377  ? 22.908  -120.085 128.493 1.00 27.19  ? 377  PRO A CD    1 
ATOM   2871  N  N     . GLU A  1  378  ? 19.737  -123.144 128.260 1.00 30.47  ? 378  GLU A N     1 
ATOM   2872  C  CA    . GLU A  1  378  ? 19.494  -124.580 128.191 1.00 30.71  ? 378  GLU A CA    1 
ATOM   2873  C  C     . GLU A  1  378  ? 18.586  -124.846 126.999 1.00 30.31  ? 378  GLU A C     1 
ATOM   2874  O  O     . GLU A  1  378  ? 17.732  -124.030 126.663 1.00 30.47  ? 378  GLU A O     1 
ATOM   2875  C  CB    . GLU A  1  378  ? 18.837  -125.025 129.495 1.00 31.86  ? 378  GLU A CB    1 
ATOM   2876  C  CG    . GLU A  1  378  ? 18.728  -126.508 129.718 1.00 35.41  ? 378  GLU A CG    1 
ATOM   2877  C  CD    . GLU A  1  378  ? 18.845  -126.834 131.197 1.00 38.57  ? 378  GLU A CD    1 
ATOM   2878  O  OE1   . GLU A  1  378  ? 18.155  -126.166 132.003 1.00 39.82  ? 378  GLU A OE1   1 
ATOM   2879  O  OE2   . GLU A  1  378  ? 19.632  -127.743 131.561 1.00 39.95  ? 378  GLU A OE2   1 
ATOM   2880  N  N     . VAL A  1  379  ? 18.777  -125.982 126.347 1.00 30.28  ? 379  VAL A N     1 
ATOM   2881  C  CA    . VAL A  1  379  ? 17.967  -126.305 125.183 1.00 30.34  ? 379  VAL A CA    1 
ATOM   2882  C  C     . VAL A  1  379  ? 16.872  -127.268 125.583 1.00 30.82  ? 379  VAL A C     1 
ATOM   2883  O  O     . VAL A  1  379  ? 17.116  -128.196 126.354 1.00 31.63  ? 379  VAL A O     1 
ATOM   2884  C  CB    . VAL A  1  379  ? 18.805  -126.949 124.080 1.00 28.75  ? 379  VAL A CB    1 
ATOM   2885  C  CG1   . VAL A  1  379  ? 17.987  -127.068 122.846 1.00 26.30  ? 379  VAL A CG1   1 
ATOM   2886  C  CG2   . VAL A  1  379  ? 20.043  -126.115 123.808 1.00 28.56  ? 379  VAL A CG2   1 
ATOM   2887  N  N     . VAL A  1  380  ? 15.670  -127.043 125.057 1.00 30.46  ? 380  VAL A N     1 
ATOM   2888  C  CA    . VAL A  1  380  ? 14.534  -127.889 125.378 1.00 30.99  ? 380  VAL A CA    1 
ATOM   2889  C  C     . VAL A  1  380  ? 14.697  -129.301 124.838 1.00 33.19  ? 380  VAL A C     1 
ATOM   2890  O  O     . VAL A  1  380  ? 14.695  -129.537 123.628 1.00 32.82  ? 380  VAL A O     1 
ATOM   2891  C  CB    . VAL A  1  380  ? 13.252  -127.313 124.832 1.00 29.30  ? 380  VAL A CB    1 
ATOM   2892  C  CG1   . VAL A  1  380  ? 12.102  -128.187 125.257 1.00 30.50  ? 380  VAL A CG1   1 
ATOM   2893  C  CG2   . VAL A  1  380  ? 13.073  -125.893 125.313 1.00 27.03  ? 380  VAL A CG2   1 
ATOM   2894  N  N     . THR A  1  381  ? 14.815  -130.242 125.764 1.00 35.49  ? 381  THR A N     1 
ATOM   2895  C  CA    . THR A  1  381  ? 15.015  -131.637 125.433 1.00 37.61  ? 381  THR A CA    1 
ATOM   2896  C  C     . THR A  1  381  ? 14.004  -132.482 126.169 1.00 38.72  ? 381  THR A C     1 
ATOM   2897  O  O     . THR A  1  381  ? 13.620  -132.159 127.293 1.00 40.74  ? 381  THR A O     1 
ATOM   2898  C  CB    . THR A  1  381  ? 16.395  -132.086 125.891 1.00 38.99  ? 381  THR A CB    1 
ATOM   2899  O  OG1   . THR A  1  381  ? 17.392  -131.235 125.308 1.00 42.06  ? 381  THR A OG1   1 
ATOM   2900  C  CG2   . THR A  1  381  ? 16.646  -133.512 125.492 1.00 40.50  ? 381  THR A CG2   1 
ATOM   2901  N  N     . PRO A  1  382  ? 13.548  -133.578 125.551 1.00 38.63  ? 382  PRO A N     1 
ATOM   2902  C  CA    . PRO A  1  382  ? 12.579  -134.390 126.283 1.00 38.41  ? 382  PRO A CA    1 
ATOM   2903  C  C     . PRO A  1  382  ? 13.086  -134.700 127.687 1.00 38.68  ? 382  PRO A C     1 
ATOM   2904  O  O     . PRO A  1  382  ? 12.311  -134.984 128.584 1.00 39.39  ? 382  PRO A O     1 
ATOM   2905  C  CB    . PRO A  1  382  ? 12.437  -135.627 125.401 1.00 37.19  ? 382  PRO A CB    1 
ATOM   2906  C  CG    . PRO A  1  382  ? 13.705  -135.629 124.578 1.00 36.20  ? 382  PRO A CG    1 
ATOM   2907  C  CD    . PRO A  1  382  ? 13.883  -134.196 124.261 1.00 37.14  ? 382  PRO A CD    1 
ATOM   2908  N  N     . TYR A  1  383  ? 14.394  -134.614 127.875 1.00 39.04  ? 383  TYR A N     1 
ATOM   2909  C  CA    . TYR A  1  383  ? 14.980  -134.875 129.173 1.00 40.88  ? 383  TYR A CA    1 
ATOM   2910  C  C     . TYR A  1  383  ? 14.617  -133.790 130.178 1.00 40.70  ? 383  TYR A C     1 
ATOM   2911  O  O     . TYR A  1  383  ? 14.504  -134.059 131.370 1.00 41.04  ? 383  TYR A O     1 
ATOM   2912  C  CB    . TYR A  1  383  ? 16.501  -134.915 129.077 1.00 45.13  ? 383  TYR A CB    1 
ATOM   2913  C  CG    . TYR A  1  383  ? 17.062  -135.771 127.967 1.00 49.76  ? 383  TYR A CG    1 
ATOM   2914  C  CD1   . TYR A  1  383  ? 18.335  -135.512 127.449 1.00 51.49  ? 383  TYR A CD1   1 
ATOM   2915  C  CD2   . TYR A  1  383  ? 16.339  -136.841 127.436 1.00 51.10  ? 383  TYR A CD2   1 
ATOM   2916  C  CE1   . TYR A  1  383  ? 18.872  -136.288 126.431 1.00 53.18  ? 383  TYR A CE1   1 
ATOM   2917  C  CE2   . TYR A  1  383  ? 16.872  -137.630 126.415 1.00 53.43  ? 383  TYR A CE2   1 
ATOM   2918  C  CZ    . TYR A  1  383  ? 18.140  -137.344 125.918 1.00 54.07  ? 383  TYR A CZ    1 
ATOM   2919  O  OH    . TYR A  1  383  ? 18.684  -138.107 124.909 1.00 55.86  ? 383  TYR A OH    1 
ATOM   2920  N  N     . ASN A  1  384  ? 14.438  -132.562 129.707 1.00 39.31  ? 384  ASN A N     1 
ATOM   2921  C  CA    . ASN A  1  384  ? 14.149  -131.459 130.617 1.00 37.63  ? 384  ASN A CA    1 
ATOM   2922  C  C     . ASN A  1  384  ? 12.910  -130.633 130.318 1.00 38.01  ? 384  ASN A C     1 
ATOM   2923  O  O     . ASN A  1  384  ? 12.691  -129.595 130.951 1.00 38.49  ? 384  ASN A O     1 
ATOM   2924  C  CB    . ASN A  1  384  ? 15.333  -130.514 130.633 1.00 35.84  ? 384  ASN A CB    1 
ATOM   2925  C  CG    . ASN A  1  384  ? 15.648  -129.984 129.260 1.00 34.41  ? 384  ASN A CG    1 
ATOM   2926  O  OD1   . ASN A  1  384  ? 14.750  -129.637 128.504 1.00 31.59  ? 384  ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A  1  384  ? 16.928  -129.913 128.929 1.00 36.42  ? 384  ASN A ND2   1 
ATOM   2928  N  N     . ILE A  1  385  ? 12.094  -131.067 129.370 1.00 37.84  ? 385  ILE A N     1 
ATOM   2929  C  CA    . ILE A  1  385  ? 10.926  -130.272 129.040 1.00 37.05  ? 385  ILE A CA    1 
ATOM   2930  C  C     . ILE A  1  385  ? 10.173  -129.884 130.280 1.00 37.42  ? 385  ILE A C     1 
ATOM   2931  O  O     . ILE A  1  385  ? 9.784   -128.734 130.433 1.00 35.99  ? 385  ILE A O     1 
ATOM   2932  C  CB    . ILE A  1  385  ? 9.974   -131.007 128.106 1.00 35.94  ? 385  ILE A CB    1 
ATOM   2933  C  CG1   . ILE A  1  385  ? 9.971   -130.331 126.725 1.00 33.70  ? 385  ILE A CG1   1 
ATOM   2934  C  CG2   . ILE A  1  385  ? 8.577   -130.997 128.698 1.00 36.17  ? 385  ILE A CG2   1 
ATOM   2935  C  CD1   . ILE A  1  385  ? 9.247   -129.004 126.670 1.00 28.91  ? 385  ILE A CD1   1 
ATOM   2936  N  N     . ASP A  1  386  ? 9.986   -130.853 131.171 1.00 39.94  ? 386  ASP A N     1 
ATOM   2937  C  CA    . ASP A  1  386  ? 9.250   -130.618 132.406 1.00 42.18  ? 386  ASP A CA    1 
ATOM   2938  C  C     . ASP A  1  386  ? 9.931   -129.634 133.341 1.00 42.11  ? 386  ASP A C     1 
ATOM   2939  O  O     . ASP A  1  386  ? 9.342   -128.603 133.702 1.00 42.27  ? 386  ASP A O     1 
ATOM   2940  C  CB    . ASP A  1  386  ? 9.018   -131.934 133.125 1.00 43.94  ? 386  ASP A CB    1 
ATOM   2941  C  CG    . ASP A  1  386  ? 8.405   -132.977 132.220 1.00 46.48  ? 386  ASP A CG    1 
ATOM   2942  O  OD1   . ASP A  1  386  ? 7.352   -132.698 131.605 1.00 47.45  ? 386  ASP A OD1   1 
ATOM   2943  O  OD2   . ASP A  1  386  ? 8.979   -134.080 132.120 1.00 49.29  ? 386  ASP A OD2   1 
ATOM   2944  N  N     . ARG A  1  387  ? 11.164  -129.936 133.735 1.00 40.98  ? 387  ARG A N     1 
ATOM   2945  C  CA    . ARG A  1  387  ? 11.860  -129.024 134.625 1.00 40.71  ? 387  ARG A CA    1 
ATOM   2946  C  C     . ARG A  1  387  ? 11.848  -127.603 134.078 1.00 38.71  ? 387  ARG A C     1 
ATOM   2947  O  O     . ARG A  1  387  ? 11.498  -126.662 134.788 1.00 38.67  ? 387  ARG A O     1 
ATOM   2948  C  CB    . ARG A  1  387  ? 13.302  -129.458 134.837 1.00 43.03  ? 387  ARG A CB    1 
ATOM   2949  C  CG    . ARG A  1  387  ? 14.093  -128.480 135.704 1.00 45.77  ? 387  ARG A CG    1 
ATOM   2950  C  CD    . ARG A  1  387  ? 15.460  -129.050 136.005 1.00 49.38  ? 387  ARG A CD    1 
ATOM   2951  N  NE    . ARG A  1  387  ? 16.090  -129.556 134.787 1.00 51.19  ? 387  ARG A NE    1 
ATOM   2952  C  CZ    . ARG A  1  387  ? 16.990  -128.888 134.078 1.00 52.04  ? 387  ARG A CZ    1 
ATOM   2953  N  NH1   . ARG A  1  387  ? 17.383  -127.674 134.468 1.00 52.25  ? 387  ARG A NH1   1 
ATOM   2954  N  NH2   . ARG A  1  387  ? 17.487  -129.435 132.975 1.00 51.60  ? 387  ARG A NH2   1 
ATOM   2955  N  N     . LEU A  1  388  ? 12.219  -127.458 132.811 1.00 36.32  ? 388  LEU A N     1 
ATOM   2956  C  CA    . LEU A  1  388  ? 12.268  -126.151 132.180 1.00 34.46  ? 388  LEU A CA    1 
ATOM   2957  C  C     . LEU A  1  388  ? 10.932  -125.427 132.131 1.00 33.40  ? 388  LEU A C     1 
ATOM   2958  O  O     . LEU A  1  388  ? 10.882  -124.218 132.352 1.00 32.50  ? 388  LEU A O     1 
ATOM   2959  C  CB    . LEU A  1  388  ? 12.806  -126.272 130.760 1.00 35.68  ? 388  LEU A CB    1 
ATOM   2960  C  CG    . LEU A  1  388  ? 14.242  -126.744 130.551 1.00 35.31  ? 388  LEU A CG    1 
ATOM   2961  C  CD1   . LEU A  1  388  ? 14.537  -126.795 129.064 1.00 34.69  ? 388  LEU A CD1   1 
ATOM   2962  C  CD2   . LEU A  1  388  ? 15.195  -125.807 131.241 1.00 34.95  ? 388  LEU A CD2   1 
ATOM   2963  N  N     . THR A  1  389  ? 9.853   -126.149 131.826 1.00 32.57  ? 389  THR A N     1 
ATOM   2964  C  CA    . THR A  1  389  ? 8.535   -125.519 131.743 1.00 30.81  ? 389  THR A CA    1 
ATOM   2965  C  C     . THR A  1  389  ? 8.170   -124.982 133.107 1.00 31.77  ? 389  THR A C     1 
ATOM   2966  O  O     . THR A  1  389  ? 7.534   -123.928 133.222 1.00 31.31  ? 389  THR A O     1 
ATOM   2967  C  CB    . THR A  1  389  ? 7.431   -126.493 131.321 1.00 28.03  ? 389  THR A CB    1 
ATOM   2968  O  OG1   . THR A  1  389  ? 7.904   -127.353 130.283 1.00 25.79  ? 389  THR A OG1   1 
ATOM   2969  C  CG2   . THR A  1  389  ? 6.253   -125.716 130.786 1.00 27.53  ? 389  THR A CG2   1 
ATOM   2970  N  N     . GLN A  1  390  ? 8.589   -125.720 134.135 1.00 32.24  ? 390  GLN A N     1 
ATOM   2971  C  CA    . GLN A  1  390  ? 8.329   -125.342 135.511 1.00 33.19  ? 390  GLN A CA    1 
ATOM   2972  C  C     . GLN A  1  390  ? 9.003   -124.018 135.836 1.00 32.78  ? 390  GLN A C     1 
ATOM   2973  O  O     . GLN A  1  390  ? 8.406   -123.136 136.456 1.00 33.30  ? 390  GLN A O     1 
ATOM   2974  C  CB    . GLN A  1  390  ? 8.831   -126.418 136.467 1.00 36.08  ? 390  GLN A CB    1 
ATOM   2975  C  CG    . GLN A  1  390  ? 8.393   -126.143 137.891 1.00 42.33  ? 390  GLN A CG    1 
ATOM   2976  C  CD    . GLN A  1  390  ? 6.933   -125.699 137.960 1.00 46.22  ? 390  GLN A CD    1 
ATOM   2977  O  OE1   . GLN A  1  390  ? 6.021   -126.481 137.679 1.00 49.03  ? 390  GLN A OE1   1 
ATOM   2978  N  NE2   . GLN A  1  390  ? 6.709   -124.433 138.314 1.00 47.69  ? 390  GLN A NE2   1 
ATOM   2979  N  N     . LEU A  1  391  ? 10.254  -123.890 135.416 1.00 31.03  ? 391  LEU A N     1 
ATOM   2980  C  CA    . LEU A  1  391  ? 11.009  -122.675 135.635 1.00 29.38  ? 391  LEU A CA    1 
ATOM   2981  C  C     . LEU A  1  391  ? 10.380  -121.527 134.852 1.00 31.33  ? 391  LEU A C     1 
ATOM   2982  O  O     . LEU A  1  391  ? 10.201  -120.436 135.389 1.00 32.52  ? 391  LEU A O     1 
ATOM   2983  C  CB    . LEU A  1  391  ? 12.446  -122.871 135.177 1.00 27.88  ? 391  LEU A CB    1 
ATOM   2984  C  CG    . LEU A  1  391  ? 13.229  -123.980 135.865 1.00 26.98  ? 391  LEU A CG    1 
ATOM   2985  C  CD1   . LEU A  1  391  ? 14.458  -124.343 135.066 1.00 26.51  ? 391  LEU A CD1   1 
ATOM   2986  C  CD2   . LEU A  1  391  ? 13.620  -123.509 137.243 1.00 28.93  ? 391  LEU A CD2   1 
ATOM   2987  N  N     . VAL A  1  392  ? 10.036  -121.762 133.585 1.00 32.19  ? 392  VAL A N     1 
ATOM   2988  C  CA    . VAL A  1  392  ? 9.446   -120.694 132.789 1.00 32.76  ? 392  VAL A CA    1 
ATOM   2989  C  C     . VAL A  1  392  ? 8.186   -120.232 133.480 1.00 35.54  ? 392  VAL A C     1 
ATOM   2990  O  O     . VAL A  1  392  ? 7.991   -119.038 133.713 1.00 35.61  ? 392  VAL A O     1 
ATOM   2991  C  CB    . VAL A  1  392  ? 9.089   -121.144 131.387 1.00 30.13  ? 392  VAL A CB    1 
ATOM   2992  C  CG1   . VAL A  1  392  ? 8.774   -119.944 130.545 1.00 28.06  ? 392  VAL A CG1   1 
ATOM   2993  C  CG2   . VAL A  1  392  ? 10.227  -121.884 130.788 1.00 30.31  ? 392  VAL A CG2   1 
ATOM   2994  N  N     . ARG A  1  393  ? 7.331   -121.187 133.821 1.00 38.61  ? 393  ARG A N     1 
ATOM   2995  C  CA    . ARG A  1  393  ? 6.088   -120.856 134.502 1.00 41.69  ? 393  ARG A CA    1 
ATOM   2996  C  C     . ARG A  1  393  ? 6.425   -120.219 135.839 1.00 39.98  ? 393  ARG A C     1 
ATOM   2997  O  O     . ARG A  1  393  ? 5.738   -119.310 136.296 1.00 40.49  ? 393  ARG A O     1 
ATOM   2998  C  CB    . ARG A  1  393  ? 5.245   -122.110 134.732 1.00 46.12  ? 393  ARG A CB    1 
ATOM   2999  C  CG    . ARG A  1  393  ? 3.804   -121.818 135.149 1.00 51.34  ? 393  ARG A CG    1 
ATOM   3000  C  CD    . ARG A  1  393  ? 3.056   -123.116 135.394 1.00 57.53  ? 393  ARG A CD    1 
ATOM   3001  N  NE    . ARG A  1  393  ? 3.013   -123.965 134.200 1.00 62.25  ? 393  ARG A NE    1 
ATOM   3002  C  CZ    . ARG A  1  393  ? 3.049   -125.300 134.219 1.00 64.13  ? 393  ARG A CZ    1 
ATOM   3003  N  NH1   . ARG A  1  393  ? 3.138   -125.959 135.374 1.00 63.73  ? 393  ARG A NH1   1 
ATOM   3004  N  NH2   . ARG A  1  393  ? 2.982   -125.979 133.075 1.00 64.87  ? 393  ARG A NH2   1 
ATOM   3005  N  N     . ASN A  1  394  ? 7.496   -120.697 136.458 1.00 38.18  ? 394  ASN A N     1 
ATOM   3006  C  CA    . ASN A  1  394  ? 7.929   -120.178 137.741 1.00 36.98  ? 394  ASN A CA    1 
ATOM   3007  C  C     . ASN A  1  394  ? 8.164   -118.671 137.716 1.00 35.79  ? 394  ASN A C     1 
ATOM   3008  O  O     . ASN A  1  394  ? 7.727   -117.956 138.614 1.00 35.77  ? 394  ASN A O     1 
ATOM   3009  C  CB    . ASN A  1  394  ? 9.189   -120.893 138.164 1.00 38.24  ? 394  ASN A CB    1 
ATOM   3010  C  CG    . ASN A  1  394  ? 9.089   -121.424 139.547 1.00 40.24  ? 394  ASN A CG    1 
ATOM   3011  O  OD1   . ASN A  1  394  ? 9.522   -120.780 140.508 1.00 42.28  ? 394  ASN A OD1   1 
ATOM   3012  N  ND2   . ASN A  1  394  ? 8.493   -122.605 139.677 1.00 41.56  ? 394  ASN A ND2   1 
ATOM   3013  N  N     . GLY A  1  395  ? 8.868   -118.182 136.704 1.00 34.06  ? 395  GLY A N     1 
ATOM   3014  C  CA    . GLY A  1  395  ? 9.070   -116.753 136.620 1.00 33.47  ? 395  GLY A CA    1 
ATOM   3015  C  C     . GLY A  1  395  ? 10.471  -116.249 136.830 1.00 33.66  ? 395  GLY A C     1 
ATOM   3016  O  O     . GLY A  1  395  ? 11.314  -116.956 137.368 1.00 33.26  ? 395  GLY A O     1 
ATOM   3017  N  N     . PRO A  1  396  ? 10.750  -115.013 136.393 1.00 33.76  ? 396  PRO A N     1 
ATOM   3018  C  CA    . PRO A  1  396  ? 12.064  -114.401 136.533 1.00 33.70  ? 396  PRO A CA    1 
ATOM   3019  C  C     . PRO A  1  396  ? 12.223  -113.741 137.891 1.00 36.12  ? 396  PRO A C     1 
ATOM   3020  O  O     . PRO A  1  396  ? 13.246  -113.115 138.165 1.00 37.13  ? 396  PRO A O     1 
ATOM   3021  C  CB    . PRO A  1  396  ? 12.079  -113.393 135.400 1.00 32.25  ? 396  PRO A CB    1 
ATOM   3022  C  CG    . PRO A  1  396  ? 10.699  -112.908 135.402 1.00 31.32  ? 396  PRO A CG    1 
ATOM   3023  C  CD    . PRO A  1  396  ? 9.903   -114.189 135.514 1.00 32.84  ? 396  PRO A CD    1 
ATOM   3024  N  N     . ASN A  1  397  ? 11.216  -113.874 138.747 1.00 37.79  ? 397  ASN A N     1 
ATOM   3025  C  CA    . ASN A  1  397  ? 11.314  -113.272 140.060 1.00 39.77  ? 397  ASN A CA    1 
ATOM   3026  C  C     . ASN A  1  397  ? 11.449  -114.257 141.192 1.00 41.19  ? 397  ASN A C     1 
ATOM   3027  O  O     . ASN A  1  397  ? 12.143  -113.974 142.161 1.00 42.67  ? 397  ASN A O     1 
ATOM   3028  C  CB    . ASN A  1  397  ? 10.149  -112.347 140.272 1.00 41.21  ? 397  ASN A CB    1 
ATOM   3029  C  CG    . ASN A  1  397  ? 10.268  -111.121 139.424 1.00 44.24  ? 397  ASN A CG    1 
ATOM   3030  O  OD1   . ASN A  1  397  ? 10.840  -111.175 138.332 1.00 44.98  ? 397  ASN A OD1   1 
ATOM   3031  N  ND2   . ASN A  1  397  ? 9.736   -110.000 139.905 1.00 46.72  ? 397  ASN A ND2   1 
ATOM   3032  N  N     . GLU A  1  398  ? 10.795  -115.408 141.090 1.00 42.06  ? 398  GLU A N     1 
ATOM   3033  C  CA    . GLU A  1  398  ? 10.938  -116.426 142.128 1.00 43.69  ? 398  GLU A CA    1 
ATOM   3034  C  C     . GLU A  1  398  ? 12.351  -116.920 141.911 1.00 41.93  ? 398  GLU A C     1 
ATOM   3035  O  O     . GLU A  1  398  ? 12.899  -116.649 140.855 1.00 41.13  ? 398  GLU A O     1 
ATOM   3036  C  CB    . GLU A  1  398  ? 9.982   -117.572 141.882 1.00 47.81  ? 398  GLU A CB    1 
ATOM   3037  C  CG    . GLU A  1  398  ? 8.559   -117.238 142.122 1.00 55.16  ? 398  GLU A CG    1 
ATOM   3038  C  CD    . GLU A  1  398  ? 7.765   -118.489 142.354 1.00 60.89  ? 398  GLU A CD    1 
ATOM   3039  O  OE1   . GLU A  1  398  ? 8.182   -119.274 143.248 1.00 63.30  ? 398  GLU A OE1   1 
ATOM   3040  O  OE2   . GLU A  1  398  ? 6.743   -118.686 141.647 1.00 64.62  ? 398  GLU A OE2   1 
ATOM   3041  N  N     . HIS A  1  399  ? 12.974  -117.634 142.851 1.00 41.23  ? 399  HIS A N     1 
ATOM   3042  C  CA    . HIS A  1  399  ? 14.323  -118.042 142.500 1.00 39.43  ? 399  HIS A CA    1 
ATOM   3043  C  C     . HIS A  1  399  ? 14.388  -119.066 141.382 1.00 38.76  ? 399  HIS A C     1 
ATOM   3044  O  O     . HIS A  1  399  ? 14.336  -118.670 140.209 1.00 42.18  ? 399  HIS A O     1 
ATOM   3045  C  CB    . HIS A  1  399  ? 15.197  -118.565 143.633 1.00 38.79  ? 399  HIS A CB    1 
ATOM   3046  C  CG    . HIS A  1  399  ? 16.503  -119.095 143.116 1.00 38.95  ? 399  HIS A CG    1 
ATOM   3047  N  ND1   . HIS A  1  399  ? 17.088  -118.590 141.967 1.00 37.52  ? 399  HIS A ND1   1 
ATOM   3048  C  CD2   . HIS A  1  399  ? 17.261  -120.153 143.487 1.00 38.34  ? 399  HIS A CD2   1 
ATOM   3049  C  CE1   . HIS A  1  399  ? 18.140  -119.321 141.648 1.00 35.77  ? 399  HIS A CE1   1 
ATOM   3050  N  NE2   . HIS A  1  399  ? 18.266  -120.276 142.553 1.00 38.08  ? 399  HIS A NE2   1 
ATOM   3051  N  N     . PRO A  1  400  ? 14.475  -120.384 141.699 1.00 34.49  ? 400  PRO A N     1 
ATOM   3052  C  CA    . PRO A  1  400  ? 14.557  -121.299 140.546 1.00 31.29  ? 400  PRO A CA    1 
ATOM   3053  C  C     . PRO A  1  400  ? 13.562  -120.911 139.440 1.00 31.06  ? 400  PRO A C     1 
ATOM   3054  O  O     . PRO A  1  400  ? 12.402  -121.305 139.479 1.00 32.27  ? 400  PRO A O     1 
ATOM   3055  C  CB    . PRO A  1  400  ? 14.264  -122.652 141.164 1.00 29.24  ? 400  PRO A CB    1 
ATOM   3056  C  CG    . PRO A  1  400  ? 14.661  -122.456 142.602 1.00 29.32  ? 400  PRO A CG    1 
ATOM   3057  C  CD    . PRO A  1  400  ? 14.115  -121.125 142.918 1.00 29.88  ? 400  PRO A CD    1 
ATOM   3058  N  N     . GLY A  1  401  ? 14.012  -120.115 138.470 1.00 28.76  ? 401  GLY A N     1 
ATOM   3059  C  CA    . GLY A  1  401  ? 13.122  -119.679 137.410 1.00 28.39  ? 401  GLY A CA    1 
ATOM   3060  C  C     . GLY A  1  401  ? 13.817  -119.426 136.087 1.00 28.07  ? 401  GLY A C     1 
ATOM   3061  O  O     . GLY A  1  401  ? 14.783  -120.098 135.753 1.00 28.88  ? 401  GLY A O     1 
ATOM   3062  N  N     . ALA A  1  402  ? 13.335  -118.447 135.332 1.00 27.08  ? 402  ALA A N     1 
ATOM   3063  C  CA    . ALA A  1  402  ? 13.940  -118.134 134.050 1.00 25.67  ? 402  ALA A CA    1 
ATOM   3064  C  C     . ALA A  1  402  ? 13.569  -116.730 133.582 1.00 24.78  ? 402  ALA A C     1 
ATOM   3065  O  O     . ALA A  1  402  ? 12.582  -116.157 134.032 1.00 26.06  ? 402  ALA A O     1 
ATOM   3066  C  CB    . ALA A  1  402  ? 13.516  -119.161 133.031 1.00 23.75  ? 402  ALA A CB    1 
ATOM   3067  N  N     . LYS A  1  403  ? 14.361  -116.176 132.675 1.00 24.41  ? 403  LYS A N     1 
ATOM   3068  C  CA    . LYS A  1  403  ? 14.095  -114.838 132.168 1.00 24.42  ? 403  LYS A CA    1 
ATOM   3069  C  C     . LYS A  1  403  ? 13.598  -114.837 130.727 1.00 22.87  ? 403  LYS A C     1 
ATOM   3070  O  O     . LYS A  1  403  ? 12.684  -114.103 130.386 1.00 22.39  ? 403  LYS A O     1 
ATOM   3071  C  CB    . LYS A  1  403  ? 15.359  -113.956 132.290 1.00 24.68  ? 403  LYS A CB    1 
ATOM   3072  C  CG    . LYS A  1  403  ? 15.875  -113.799 133.731 1.00 25.81  ? 403  LYS A CG    1 
ATOM   3073  C  CD    . LYS A  1  403  ? 17.271  -113.188 133.819 1.00 25.66  ? 403  LYS A CD    1 
ATOM   3074  C  CE    . LYS A  1  403  ? 17.277  -111.694 133.573 1.00 27.45  ? 403  LYS A CE    1 
ATOM   3075  N  NZ    . LYS A  1  403  ? 18.654  -111.153 133.811 1.00 28.81  ? 403  LYS A NZ    1 
ATOM   3076  N  N     . TYR A  1  404  ? 14.183  -115.669 129.885 1.00 23.39  ? 404  TYR A N     1 
ATOM   3077  C  CA    . TYR A  1  404  ? 13.786  -115.693 128.490 1.00 25.67  ? 404  TYR A CA    1 
ATOM   3078  C  C     . TYR A  1  404  ? 13.555  -117.060 127.893 1.00 28.06  ? 404  TYR A C     1 
ATOM   3079  O  O     . TYR A  1  404  ? 14.160  -118.047 128.315 1.00 30.49  ? 404  TYR A O     1 
ATOM   3080  C  CB    . TYR A  1  404  ? 14.847  -115.045 127.638 1.00 26.03  ? 404  TYR A CB    1 
ATOM   3081  C  CG    . TYR A  1  404  ? 15.059  -113.602 127.894 1.00 27.20  ? 404  TYR A CG    1 
ATOM   3082  C  CD1   . TYR A  1  404  ? 15.725  -113.172 129.017 1.00 29.41  ? 404  TYR A CD1   1 
ATOM   3083  C  CD2   . TYR A  1  404  ? 14.608  -112.657 126.990 1.00 29.14  ? 404  TYR A CD2   1 
ATOM   3084  C  CE1   . TYR A  1  404  ? 15.944  -111.818 129.233 1.00 32.41  ? 404  TYR A CE1   1 
ATOM   3085  C  CE2   . TYR A  1  404  ? 14.815  -111.315 127.187 1.00 30.44  ? 404  TYR A CE2   1 
ATOM   3086  C  CZ    . TYR A  1  404  ? 15.484  -110.892 128.308 1.00 31.66  ? 404  TYR A CZ    1 
ATOM   3087  O  OH    . TYR A  1  404  ? 15.690  -109.544 128.500 1.00 33.39  ? 404  TYR A OH    1 
ATOM   3088  N  N     . VAL A  1  405  ? 12.695  -117.104 126.883 1.00 27.64  ? 405  VAL A N     1 
ATOM   3089  C  CA    . VAL A  1  405  ? 12.422  -118.333 126.167 1.00 27.87  ? 405  VAL A CA    1 
ATOM   3090  C  C     . VAL A  1  405  ? 12.703  -117.920 124.740 1.00 30.81  ? 405  VAL A C     1 
ATOM   3091  O  O     . VAL A  1  405  ? 12.123  -116.961 124.264 1.00 31.25  ? 405  VAL A O     1 
ATOM   3092  C  CB    . VAL A  1  405  ? 10.962  -118.780 126.335 1.00 26.21  ? 405  VAL A CB    1 
ATOM   3093  C  CG1   . VAL A  1  405  ? 10.593  -119.767 125.246 1.00 25.09  ? 405  VAL A CG1   1 
ATOM   3094  C  CG2   . VAL A  1  405  ? 10.776  -119.423 127.706 1.00 23.97  ? 405  VAL A CG2   1 
ATOM   3095  N  N     . ILE A  1  406  ? 13.623  -118.607 124.072 1.00 34.30  ? 406  ILE A N     1 
ATOM   3096  C  CA    . ILE A  1  406  ? 13.969  -118.254 122.697 1.00 37.83  ? 406  ILE A CA    1 
ATOM   3097  C  C     . ILE A  1  406  ? 13.569  -119.328 121.721 1.00 40.73  ? 406  ILE A C     1 
ATOM   3098  O  O     . ILE A  1  406  ? 14.116  -120.435 121.748 1.00 40.62  ? 406  ILE A O     1 
ATOM   3099  C  CB    . ILE A  1  406  ? 15.457  -118.032 122.545 1.00 37.11  ? 406  ILE A CB    1 
ATOM   3100  C  CG1   . ILE A  1  406  ? 16.000  -117.392 123.826 1.00 38.07  ? 406  ILE A CG1   1 
ATOM   3101  C  CG2   . ILE A  1  406  ? 15.711  -117.152 121.316 1.00 36.15  ? 406  ILE A CG2   1 
ATOM   3102  C  CD1   . ILE A  1  406  ? 17.498  -117.111 123.821 1.00 39.48  ? 406  ILE A CD1   1 
ATOM   3103  N  N     . ARG A  1  407  ? 12.634  -118.985 120.841 1.00 44.66  ? 407  ARG A N     1 
ATOM   3104  C  CA    . ARG A  1  407  ? 12.123  -119.928 119.852 1.00 50.12  ? 407  ARG A CA    1 
ATOM   3105  C  C     . ARG A  1  407  ? 13.053  -120.197 118.686 1.00 54.28  ? 407  ARG A C     1 
ATOM   3106  O  O     . ARG A  1  407  ? 14.009  -119.454 118.453 1.00 54.84  ? 407  ARG A O     1 
ATOM   3107  C  CB    . ARG A  1  407  ? 10.791  -119.432 119.317 1.00 49.19  ? 407  ARG A CB    1 
ATOM   3108  C  CG    . ARG A  1  407  ? 9.765   -119.339 120.384 1.00 50.16  ? 407  ARG A CG    1 
ATOM   3109  C  CD    . ARG A  1  407  ? 8.978   -118.094 120.231 1.00 50.19  ? 407  ARG A CD    1 
ATOM   3110  N  NE    . ARG A  1  407  ? 8.171   -118.123 119.034 1.00 49.49  ? 407  ARG A NE    1 
ATOM   3111  C  CZ    . ARG A  1  407  ? 7.756   -117.024 118.435 1.00 51.76  ? 407  ARG A CZ    1 
ATOM   3112  N  NH1   . ARG A  1  407  ? 8.096   -115.846 118.948 1.00 52.52  ? 407  ARG A NH1   1 
ATOM   3113  N  NH2   . ARG A  1  407  ? 7.009   -117.099 117.341 1.00 52.92  ? 407  ARG A NH2   1 
ATOM   3114  N  N     . ASP A  1  408  ? 12.762  -121.275 117.959 1.00 59.20  ? 408  ASP A N     1 
ATOM   3115  C  CA    . ASP A  1  408  ? 13.545  -121.649 116.784 1.00 63.69  ? 408  ASP A CA    1 
ATOM   3116  C  C     . ASP A  1  408  ? 13.584  -120.447 115.843 1.00 65.94  ? 408  ASP A C     1 
ATOM   3117  O  O     . ASP A  1  408  ? 14.608  -120.169 115.213 1.00 66.53  ? 408  ASP A O     1 
ATOM   3118  C  CB    . ASP A  1  408  ? 12.925  -122.870 116.078 1.00 65.44  ? 408  ASP A CB    1 
ATOM   3119  C  CG    . ASP A  1  408  ? 11.386  -122.894 116.148 1.00 68.25  ? 408  ASP A CG    1 
ATOM   3120  O  OD1   . ASP A  1  408  ? 10.740  -121.896 115.750 1.00 69.23  ? 408  ASP A OD1   1 
ATOM   3121  O  OD2   . ASP A  1  408  ? 10.817  -123.922 116.594 1.00 68.73  ? 408  ASP A OD2   1 
ATOM   3122  N  N     . SER A  1  409  ? 12.461  -119.732 115.767 1.00 68.07  ? 409  SER A N     1 
ATOM   3123  C  CA    . SER A  1  409  ? 12.352  -118.536 114.933 1.00 69.41  ? 409  SER A CA    1 
ATOM   3124  C  C     . SER A  1  409  ? 12.994  -117.353 115.664 1.00 69.64  ? 409  SER A C     1 
ATOM   3125  O  O     . SER A  1  409  ? 12.305  -116.406 116.072 1.00 70.16  ? 409  SER A O     1 
ATOM   3126  C  CB    . SER A  1  409  ? 10.873  -118.239 114.589 1.00 70.48  ? 409  SER A CB    1 
ATOM   3127  O  OG    . SER A  1  409  ? 10.000  -118.372 115.703 1.00 70.84  ? 409  SER A OG    1 
ATOM   3128  N  N     . GLY A  1  410  ? 14.318  -117.445 115.826 1.00 68.88  ? 410  GLY A N     1 
ATOM   3129  C  CA    . GLY A  1  410  ? 15.116  -116.427 116.494 1.00 68.19  ? 410  GLY A CA    1 
ATOM   3130  C  C     . GLY A  1  410  ? 14.378  -115.191 116.980 1.00 68.59  ? 410  GLY A C     1 
ATOM   3131  O  O     . GLY A  1  410  ? 14.439  -114.125 116.354 1.00 69.32  ? 410  GLY A O     1 
ATOM   3132  N  N     . ASP A  1  411  ? 13.677  -115.335 118.103 1.00 67.13  ? 411  ASP A N     1 
ATOM   3133  C  CA    . ASP A  1  411  ? 12.924  -114.236 118.697 1.00 63.67  ? 411  ASP A CA    1 
ATOM   3134  C  C     . ASP A  1  411  ? 12.833  -114.487 120.202 1.00 60.47  ? 411  ASP A C     1 
ATOM   3135  O  O     . ASP A  1  411  ? 12.504  -115.600 120.625 1.00 60.77  ? 411  ASP A O     1 
ATOM   3136  C  CB    . ASP A  1  411  ? 11.529  -114.166 118.077 1.00 66.07  ? 411  ASP A CB    1 
ATOM   3137  C  CG    . ASP A  1  411  ? 10.786  -112.914 118.475 1.00 68.98  ? 411  ASP A CG    1 
ATOM   3138  O  OD1   . ASP A  1  411  ? 11.379  -111.815 118.327 1.00 69.82  ? 411  ASP A OD1   1 
ATOM   3139  O  OD2   . ASP A  1  411  ? 9.617   -113.030 118.926 1.00 69.19  ? 411  ASP A OD2   1 
ATOM   3140  N  N     . ARG A  1  412  ? 13.134  -113.463 121.000 1.00 55.06  ? 412  ARG A N     1 
ATOM   3141  C  CA    . ARG A  1  412  ? 13.111  -113.594 122.456 1.00 49.78  ? 412  ARG A CA    1 
ATOM   3142  C  C     . ARG A  1  412  ? 11.776  -113.297 123.095 1.00 46.24  ? 412  ARG A C     1 
ATOM   3143  O  O     . ARG A  1  412  ? 11.163  -112.279 122.815 1.00 47.92  ? 412  ARG A O     1 
ATOM   3144  C  CB    . ARG A  1  412  ? 14.174  -112.694 123.084 1.00 50.16  ? 412  ARG A CB    1 
ATOM   3145  C  CG    . ARG A  1  412  ? 15.531  -113.349 123.121 1.00 51.31  ? 412  ARG A CG    1 
ATOM   3146  C  CD    . ARG A  1  412  ? 16.643  -112.411 123.540 1.00 52.66  ? 412  ARG A CD    1 
ATOM   3147  N  NE    . ARG A  1  412  ? 17.931  -113.077 123.365 1.00 53.80  ? 412  ARG A NE    1 
ATOM   3148  C  CZ    . ARG A  1  412  ? 19.075  -112.455 123.091 1.00 54.87  ? 412  ARG A CZ    1 
ATOM   3149  N  NH1   . ARG A  1  412  ? 19.113  -111.130 122.959 1.00 55.04  ? 412  ARG A NH1   1 
ATOM   3150  N  NH2   . ARG A  1  412  ? 20.182  -113.169 122.931 1.00 55.19  ? 412  ARG A NH2   1 
ATOM   3151  N  N     . ILE A  1  413  ? 11.324  -114.194 123.957 1.00 40.86  ? 413  ILE A N     1 
ATOM   3152  C  CA    . ILE A  1  413  ? 10.064  -113.996 124.654 1.00 36.04  ? 413  ILE A CA    1 
ATOM   3153  C  C     . ILE A  1  413  ? 10.470  -113.505 126.023 1.00 34.39  ? 413  ILE A C     1 
ATOM   3154  O  O     . ILE A  1  413  ? 11.093  -114.244 126.780 1.00 34.82  ? 413  ILE A O     1 
ATOM   3155  C  CB    . ILE A  1  413  ? 9.300   -115.311 124.783 1.00 34.49  ? 413  ILE A CB    1 
ATOM   3156  C  CG1   . ILE A  1  413  ? 8.997   -115.852 123.389 1.00 33.79  ? 413  ILE A CG1   1 
ATOM   3157  C  CG2   . ILE A  1  413  ? 8.013   -115.105 125.540 1.00 32.58  ? 413  ILE A CG2   1 
ATOM   3158  C  CD1   . ILE A  1  413  ? 8.282   -117.174 123.397 1.00 34.79  ? 413  ILE A CD1   1 
ATOM   3159  N  N     . ASP A  1  414  ? 10.145  -112.258 126.346 1.00 31.77  ? 414  ASP A N     1 
ATOM   3160  C  CA    . ASP A  1  414  ? 10.545  -111.729 127.640 1.00 30.23  ? 414  ASP A CA    1 
ATOM   3161  C  C     . ASP A  1  414  ? 9.583   -112.089 128.737 1.00 28.75  ? 414  ASP A C     1 
ATOM   3162  O  O     . ASP A  1  414  ? 8.593   -111.401 128.944 1.00 29.39  ? 414  ASP A O     1 
ATOM   3163  C  CB    . ASP A  1  414  ? 10.683  -110.216 127.603 1.00 30.96  ? 414  ASP A CB    1 
ATOM   3164  C  CG    . ASP A  1  414  ? 11.486  -109.688 128.772 1.00 31.53  ? 414  ASP A CG    1 
ATOM   3165  O  OD1   . ASP A  1  414  ? 11.525  -110.381 129.816 1.00 31.58  ? 414  ASP A OD1   1 
ATOM   3166  O  OD2   . ASP A  1  414  ? 12.072  -108.589 128.644 1.00 30.50  ? 414  ASP A OD2   1 
ATOM   3167  N  N     . LEU A  1  415  ? 9.903   -113.156 129.456 1.00 26.98  ? 415  LEU A N     1 
ATOM   3168  C  CA    . LEU A  1  415  ? 9.074   -113.634 130.536 1.00 24.99  ? 415  LEU A CA    1 
ATOM   3169  C  C     . LEU A  1  415  ? 8.626   -112.626 131.567 1.00 26.26  ? 415  LEU A C     1 
ATOM   3170  O  O     . LEU A  1  415  ? 7.821   -112.957 132.418 1.00 27.60  ? 415  LEU A O     1 
ATOM   3171  C  CB    . LEU A  1  415  ? 9.765   -114.771 131.243 1.00 22.20  ? 415  LEU A CB    1 
ATOM   3172  C  CG    . LEU A  1  415  ? 9.772   -115.991 130.358 1.00 22.85  ? 415  LEU A CG    1 
ATOM   3173  C  CD1   . LEU A  1  415  ? 10.316  -117.158 131.152 1.00 26.12  ? 415  LEU A CD1   1 
ATOM   3174  C  CD2   . LEU A  1  415  ? 8.372   -116.285 129.881 1.00 21.38  ? 415  LEU A CD2   1 
ATOM   3175  N  N     . ARG A  1  416  ? 9.120   -111.404 131.539 1.00 27.05  ? 416  ARG A N     1 
ATOM   3176  C  CA    . ARG A  1  416  ? 8.623   -110.493 132.541 1.00 29.13  ? 416  ARG A CA    1 
ATOM   3177  C  C     . ARG A  1  416  ? 7.520   -109.585 132.049 1.00 29.16  ? 416  ARG A C     1 
ATOM   3178  O  O     . ARG A  1  416  ? 6.834   -108.966 132.854 1.00 29.48  ? 416  ARG A O     1 
ATOM   3179  C  CB    . ARG A  1  416  ? 9.761   -109.678 133.180 1.00 32.97  ? 416  ARG A CB    1 
ATOM   3180  C  CG    . ARG A  1  416  ? 10.879  -109.179 132.281 1.00 36.99  ? 416  ARG A CG    1 
ATOM   3181  C  CD    . ARG A  1  416  ? 12.068  -108.720 133.157 1.00 40.54  ? 416  ARG A CD    1 
ATOM   3182  N  NE    . ARG A  1  416  ? 13.267  -108.387 132.381 1.00 43.55  ? 416  ARG A NE    1 
ATOM   3183  C  CZ    . ARG A  1  416  ? 13.383  -107.314 131.599 1.00 43.41  ? 416  ARG A CZ    1 
ATOM   3184  N  NH1   . ARG A  1  416  ? 12.375  -106.462 131.484 1.00 43.13  ? 416  ARG A NH1   1 
ATOM   3185  N  NH2   . ARG A  1  416  ? 14.509  -107.086 130.935 1.00 43.02  ? 416  ARG A NH2   1 
ATOM   3186  N  N     . TYR A  1  417  ? 7.322   -109.535 130.735 1.00 29.65  ? 417  TYR A N     1 
ATOM   3187  C  CA    . TYR A  1  417  ? 6.299   -108.675 130.142 1.00 29.60  ? 417  TYR A CA    1 
ATOM   3188  C  C     . TYR A  1  417  ? 5.313   -109.418 129.269 1.00 29.52  ? 417  TYR A C     1 
ATOM   3189  O  O     . TYR A  1  417  ? 4.109   -109.171 129.331 1.00 30.48  ? 417  TYR A O     1 
ATOM   3190  C  CB    . TYR A  1  417  ? 6.969   -107.612 129.308 1.00 31.39  ? 417  TYR A CB    1 
ATOM   3191  C  CG    . TYR A  1  417  ? 7.929   -106.776 130.098 1.00 35.74  ? 417  TYR A CG    1 
ATOM   3192  C  CD1   . TYR A  1  417  ? 9.101   -106.287 129.524 1.00 37.06  ? 417  TYR A CD1   1 
ATOM   3193  C  CD2   . TYR A  1  417  ? 7.650   -106.438 131.416 1.00 37.23  ? 417  TYR A CD2   1 
ATOM   3194  C  CE1   . TYR A  1  417  ? 9.960   -105.481 130.240 1.00 38.29  ? 417  TYR A CE1   1 
ATOM   3195  C  CE2   . TYR A  1  417  ? 8.506   -105.635 132.140 1.00 38.51  ? 417  TYR A CE2   1 
ATOM   3196  C  CZ    . TYR A  1  417  ? 9.655   -105.160 131.551 1.00 38.66  ? 417  TYR A CZ    1 
ATOM   3197  O  OH    . TYR A  1  417  ? 10.487  -104.361 132.288 1.00 40.20  ? 417  TYR A OH    1 
ATOM   3198  N  N     . SER A  1  418  ? 5.836   -110.318 128.443 1.00 29.51  ? 418  SER A N     1 
ATOM   3199  C  CA    . SER A  1  418  ? 5.025   -111.115 127.538 1.00 28.77  ? 418  SER A CA    1 
ATOM   3200  C  C     . SER A  1  418  ? 3.672   -111.451 128.123 1.00 29.93  ? 418  SER A C     1 
ATOM   3201  O  O     . SER A  1  418  ? 3.574   -112.006 129.212 1.00 31.47  ? 418  SER A O     1 
ATOM   3202  C  CB    . SER A  1  418  ? 5.738   -112.413 127.202 1.00 27.45  ? 418  SER A CB    1 
ATOM   3203  O  OG    . SER A  1  418  ? 4.899   -113.259 126.443 1.00 25.32  ? 418  SER A OG    1 
ATOM   3204  N  N     . LYS A  1  419  ? 2.624   -111.111 127.391 1.00 30.51  ? 419  LYS A N     1 
ATOM   3205  C  CA    . LYS A  1  419  ? 1.276   -111.398 127.836 1.00 29.89  ? 419  LYS A CA    1 
ATOM   3206  C  C     . LYS A  1  419  ? 1.084   -112.908 127.908 1.00 29.74  ? 419  LYS A C     1 
ATOM   3207  O  O     . LYS A  1  419  ? 0.041   -113.375 128.320 1.00 31.48  ? 419  LYS A O     1 
ATOM   3208  C  CB    . LYS A  1  419  ? 0.250   -110.828 126.855 1.00 29.80  ? 419  LYS A CB    1 
ATOM   3209  C  CG    . LYS A  1  419  ? 0.113   -111.656 125.577 1.00 29.50  ? 419  LYS A CG    1 
ATOM   3210  C  CD    . LYS A  1  419  ? -1.063  -111.211 124.728 1.00 29.87  ? 419  LYS A CD    1 
ATOM   3211  C  CE    . LYS A  1  419  ? -0.894  -109.780 124.228 1.00 30.00  ? 419  LYS A CE    1 
ATOM   3212  N  NZ    . LYS A  1  419  ? 0.154   -109.666 123.175 1.00 30.21  ? 419  LYS A NZ    1 
ATOM   3213  N  N     . ARG A  1  420  ? 2.074   -113.685 127.502 1.00 29.13  ? 420  ARG A N     1 
ATOM   3214  C  CA    . ARG A  1  420  ? 1.903   -115.125 127.553 1.00 30.48  ? 420  ARG A CA    1 
ATOM   3215  C  C     . ARG A  1  420  ? 2.890   -115.801 128.475 1.00 33.14  ? 420  ARG A C     1 
ATOM   3216  O  O     . ARG A  1  420  ? 3.115   -117.005 128.378 1.00 33.17  ? 420  ARG A O     1 
ATOM   3217  C  CB    . ARG A  1  420  ? 2.020   -115.716 126.154 1.00 28.92  ? 420  ARG A CB    1 
ATOM   3218  C  CG    . ARG A  1  420  ? 1.029   -115.120 125.193 1.00 28.19  ? 420  ARG A CG    1 
ATOM   3219  C  CD    . ARG A  1  420  ? 0.899   -115.970 123.987 1.00 26.38  ? 420  ARG A CD    1 
ATOM   3220  N  NE    . ARG A  1  420  ? 0.750   -117.361 124.367 1.00 27.40  ? 420  ARG A NE    1 
ATOM   3221  C  CZ    . ARG A  1  420  ? 0.710   -118.356 123.489 1.00 30.77  ? 420  ARG A CZ    1 
ATOM   3222  N  NH1   . ARG A  1  420  ? 0.803   -118.094 122.189 1.00 32.09  ? 420  ARG A NH1   1 
ATOM   3223  N  NH2   . ARG A  1  420  ? 0.595   -119.614 123.900 1.00 31.41  ? 420  ARG A NH2   1 
ATOM   3224  N  N     . ALA A  1  421  ? 3.478   -115.024 129.375 1.00 35.83  ? 421  ALA A N     1 
ATOM   3225  C  CA    . ALA A  1  421  ? 4.450   -115.567 130.301 1.00 38.55  ? 421  ALA A CA    1 
ATOM   3226  C  C     . ALA A  1  421  ? 3.881   -116.791 130.989 1.00 41.38  ? 421  ALA A C     1 
ATOM   3227  O  O     . ALA A  1  421  ? 4.479   -117.864 130.949 1.00 42.77  ? 421  ALA A O     1 
ATOM   3228  C  CB    . ALA A  1  421  ? 4.827   -114.527 131.322 1.00 38.66  ? 421  ALA A CB    1 
ATOM   3229  N  N     . GLY A  1  422  ? 2.716   -116.630 131.610 1.00 43.28  ? 422  GLY A N     1 
ATOM   3230  C  CA    . GLY A  1  422  ? 2.096   -117.743 132.310 1.00 45.57  ? 422  GLY A CA    1 
ATOM   3231  C  C     . GLY A  1  422  ? 1.769   -118.892 131.382 1.00 47.30  ? 422  GLY A C     1 
ATOM   3232  O  O     . GLY A  1  422  ? 1.860   -120.059 131.758 1.00 47.74  ? 422  GLY A O     1 
ATOM   3233  N  N     . ASP A  1  423  ? 1.383   -118.541 130.161 1.00 49.30  ? 423  ASP A N     1 
ATOM   3234  C  CA    . ASP A  1  423  ? 1.033   -119.497 129.122 1.00 51.45  ? 423  ASP A CA    1 
ATOM   3235  C  C     . ASP A  1  423  ? 2.298   -120.254 128.706 1.00 52.01  ? 423  ASP A C     1 
ATOM   3236  O  O     . ASP A  1  423  ? 2.924   -120.929 129.524 1.00 55.63  ? 423  ASP A O     1 
ATOM   3237  C  CB    . ASP A  1  423  ? 0.480   -118.737 127.927 1.00 54.32  ? 423  ASP A CB    1 
ATOM   3238  C  CG    . ASP A  1  423  ? -0.388  -119.590 127.067 1.00 58.19  ? 423  ASP A CG    1 
ATOM   3239  O  OD1   . ASP A  1  423  ? 0.029   -120.737 126.793 1.00 60.37  ? 423  ASP A OD1   1 
ATOM   3240  O  OD2   . ASP A  1  423  ? -1.479  -119.116 126.667 1.00 60.34  ? 423  ASP A OD2   1 
ATOM   3241  N  N     . ILE A  1  424  ? 2.675   -120.133 127.438 1.00 49.39  ? 424  ILE A N     1 
ATOM   3242  C  CA    . ILE A  1  424  ? 3.882   -120.772 126.915 1.00 46.79  ? 424  ILE A CA    1 
ATOM   3243  C  C     . ILE A  1  424  ? 4.038   -122.256 127.158 1.00 45.77  ? 424  ILE A C     1 
ATOM   3244  O  O     . ILE A  1  424  ? 4.020   -122.712 128.288 1.00 46.89  ? 424  ILE A O     1 
ATOM   3245  C  CB    . ILE A  1  424  ? 5.164   -120.082 127.457 1.00 45.86  ? 424  ILE A CB    1 
ATOM   3246  C  CG1   . ILE A  1  424  ? 5.382   -118.752 126.733 1.00 45.45  ? 424  ILE A CG1   1 
ATOM   3247  C  CG2   . ILE A  1  424  ? 6.367   -120.985 127.271 1.00 46.18  ? 424  ILE A CG2   1 
ATOM   3248  C  CD1   . ILE A  1  424  ? 6.742   -118.150 126.927 1.00 43.60  ? 424  ILE A CD1   1 
ATOM   3249  N  N     . GLN A  1  425  ? 4.190   -123.010 126.082 1.00 45.28  ? 425  GLN A N     1 
ATOM   3250  C  CA    . GLN A  1  425  ? 4.420   -124.440 126.184 1.00 46.49  ? 425  GLN A CA    1 
ATOM   3251  C  C     . GLN A  1  425  ? 5.640   -124.572 125.320 1.00 44.22  ? 425  GLN A C     1 
ATOM   3252  O  O     . GLN A  1  425  ? 5.629   -124.184 124.152 1.00 42.97  ? 425  GLN A O     1 
ATOM   3253  C  CB    . GLN A  1  425  ? 3.251   -125.278 125.645 1.00 50.57  ? 425  GLN A CB    1 
ATOM   3254  C  CG    . GLN A  1  425  ? 2.478   -124.686 124.491 1.00 58.14  ? 425  GLN A CG    1 
ATOM   3255  C  CD    . GLN A  1  425  ? 1.721   -123.406 124.865 1.00 62.74  ? 425  GLN A CD    1 
ATOM   3256  O  OE1   . GLN A  1  425  ? 2.321   -122.337 125.031 1.00 64.69  ? 425  GLN A OE1   1 
ATOM   3257  N  NE2   . GLN A  1  425  ? 0.393   -123.515 124.999 1.00 63.74  ? 425  GLN A NE2   1 
ATOM   3258  N  N     . LEU A  1  426  ? 6.708   -125.085 125.920 1.00 42.05  ? 426  LEU A N     1 
ATOM   3259  C  CA    . LEU A  1  426  ? 7.976   -125.212 125.229 1.00 38.85  ? 426  LEU A CA    1 
ATOM   3260  C  C     . LEU A  1  426  ? 7.924   -126.021 123.958 1.00 37.65  ? 426  LEU A C     1 
ATOM   3261  O  O     . LEU A  1  426  ? 6.877   -126.520 123.568 1.00 37.06  ? 426  LEU A O     1 
ATOM   3262  C  CB    . LEU A  1  426  ? 9.033   -125.752 126.184 1.00 35.74  ? 426  LEU A CB    1 
ATOM   3263  C  CG    . LEU A  1  426  ? 9.188   -124.800 127.365 1.00 33.25  ? 426  LEU A CG    1 
ATOM   3264  C  CD1   . LEU A  1  426  ? 10.379  -125.214 128.177 1.00 32.24  ? 426  LEU A CD1   1 
ATOM   3265  C  CD2   . LEU A  1  426  ? 9.363   -123.374 126.863 1.00 32.93  ? 426  LEU A CD2   1 
ATOM   3266  N  N     . GLN A  1  427  ? 9.075   -126.129 123.311 1.00 37.46  ? 427  GLN A N     1 
ATOM   3267  C  CA    . GLN A  1  427  ? 9.201   -126.837 122.051 1.00 37.59  ? 427  GLN A CA    1 
ATOM   3268  C  C     . GLN A  1  427  ? 10.562  -127.478 121.905 1.00 37.87  ? 427  GLN A C     1 
ATOM   3269  O  O     . GLN A  1  427  ? 11.560  -126.762 121.774 1.00 37.54  ? 427  GLN A O     1 
ATOM   3270  C  CB    . GLN A  1  427  ? 9.040   -125.857 120.908 1.00 37.96  ? 427  GLN A CB    1 
ATOM   3271  C  CG    . GLN A  1  427  ? 7.692   -125.239 120.824 1.00 40.10  ? 427  GLN A CG    1 
ATOM   3272  C  CD    . GLN A  1  427  ? 6.886   -125.888 119.749 1.00 41.86  ? 427  GLN A CD    1 
ATOM   3273  O  OE1   . GLN A  1  427  ? 6.904   -127.116 119.625 1.00 42.50  ? 427  GLN A OE1   1 
ATOM   3274  N  NE2   . GLN A  1  427  ? 6.171   -125.082 118.954 1.00 41.60  ? 427  GLN A NE2   1 
ATOM   3275  N  N     . TYR A  1  428  ? 10.605  -128.809 121.918 1.00 37.86  ? 428  TYR A N     1 
ATOM   3276  C  CA    . TYR A  1  428  ? 11.862  -129.523 121.743 1.00 38.38  ? 428  TYR A CA    1 
ATOM   3277  C  C     . TYR A  1  428  ? 12.679  -128.684 120.783 1.00 37.39  ? 428  TYR A C     1 
ATOM   3278  O  O     . TYR A  1  428  ? 12.222  -128.409 119.675 1.00 37.97  ? 428  TYR A O     1 
ATOM   3279  C  CB    . TYR A  1  428  ? 11.608  -130.880 121.106 1.00 40.57  ? 428  TYR A CB    1 
ATOM   3280  C  CG    . TYR A  1  428  ? 11.015  -131.876 122.043 1.00 43.84  ? 428  TYR A CG    1 
ATOM   3281  C  CD1   . TYR A  1  428  ? 9.956   -132.678 121.647 1.00 45.53  ? 428  TYR A CD1   1 
ATOM   3282  C  CD2   . TYR A  1  428  ? 11.524  -132.036 123.328 1.00 45.35  ? 428  TYR A CD2   1 
ATOM   3283  C  CE1   . TYR A  1  428  ? 9.412   -133.618 122.507 1.00 46.67  ? 428  TYR A CE1   1 
ATOM   3284  C  CE2   . TYR A  1  428  ? 10.991  -132.967 124.190 1.00 46.19  ? 428  TYR A CE2   1 
ATOM   3285  C  CZ    . TYR A  1  428  ? 9.935   -133.757 123.778 1.00 46.94  ? 428  TYR A CZ    1 
ATOM   3286  O  OH    . TYR A  1  428  ? 9.389   -134.683 124.637 1.00 49.34  ? 428  TYR A OH    1 
ATOM   3287  N  N     . GLY A  1  429  ? 13.864  -128.253 121.195 1.00 34.86  ? 429  GLY A N     1 
ATOM   3288  C  CA    . GLY A  1  429  ? 14.662  -127.440 120.297 1.00 32.52  ? 429  GLY A CA    1 
ATOM   3289  C  C     . GLY A  1  429  ? 14.723  -125.970 120.663 1.00 30.41  ? 429  GLY A C     1 
ATOM   3290  O  O     . GLY A  1  429  ? 15.682  -125.283 120.328 1.00 30.97  ? 429  GLY A O     1 
ATOM   3291  N  N     . TRP A  1  430  ? 13.695  -125.464 121.321 1.00 27.60  ? 430  TRP A N     1 
ATOM   3292  C  CA    . TRP A  1  430  ? 13.720  -124.079 121.738 1.00 26.93  ? 430  TRP A CA    1 
ATOM   3293  C  C     . TRP A  1  430  ? 14.749  -123.973 122.862 1.00 27.08  ? 430  TRP A C     1 
ATOM   3294  O  O     . TRP A  1  430  ? 15.380  -124.966 123.244 1.00 28.07  ? 430  TRP A O     1 
ATOM   3295  C  CB    . TRP A  1  430  ? 12.374  -123.696 122.304 1.00 28.17  ? 430  TRP A CB    1 
ATOM   3296  C  CG    . TRP A  1  430  ? 11.352  -123.346 121.319 1.00 28.63  ? 430  TRP A CG    1 
ATOM   3297  C  CD1   . TRP A  1  430  ? 11.412  -123.504 119.973 1.00 30.91  ? 430  TRP A CD1   1 
ATOM   3298  C  CD2   . TRP A  1  430  ? 10.088  -122.753 121.602 1.00 28.51  ? 430  TRP A CD2   1 
ATOM   3299  N  NE1   . TRP A  1  430  ? 10.253  -123.039 119.387 1.00 30.55  ? 430  TRP A NE1   1 
ATOM   3300  C  CE2   . TRP A  1  430  ? 9.424   -122.575 120.372 1.00 29.14  ? 430  TRP A CE2   1 
ATOM   3301  C  CE3   . TRP A  1  430  ? 9.450   -122.355 122.782 1.00 27.70  ? 430  TRP A CE3   1 
ATOM   3302  C  CZ2   . TRP A  1  430  ? 8.157   -122.018 120.285 1.00 28.85  ? 430  TRP A CZ2   1 
ATOM   3303  C  CZ3   . TRP A  1  430  ? 8.200   -121.805 122.698 1.00 28.01  ? 430  TRP A CZ3   1 
ATOM   3304  C  CH2   . TRP A  1  430  ? 7.561   -121.640 121.455 1.00 28.54  ? 430  TRP A CH2   1 
ATOM   3305  N  N     . LYS A  1  431  ? 14.906  -122.779 123.419 1.00 25.15  ? 431  LYS A N     1 
ATOM   3306  C  CA    . LYS A  1  431  ? 15.845  -122.606 124.512 1.00 23.58  ? 431  LYS A CA    1 
ATOM   3307  C  C     . LYS A  1  431  ? 15.239  -121.783 125.619 1.00 21.25  ? 431  LYS A C     1 
ATOM   3308  O  O     . LYS A  1  431  ? 14.558  -120.804 125.353 1.00 20.71  ? 431  LYS A O     1 
ATOM   3309  C  CB    . LYS A  1  431  ? 17.123  -121.935 124.019 1.00 24.61  ? 431  LYS A CB    1 
ATOM   3310  C  CG    . LYS A  1  431  ? 17.883  -122.801 123.058 1.00 26.63  ? 431  LYS A CG    1 
ATOM   3311  C  CD    . LYS A  1  431  ? 19.340  -122.454 123.035 1.00 28.77  ? 431  LYS A CD    1 
ATOM   3312  C  CE    . LYS A  1  431  ? 19.589  -121.082 122.460 1.00 30.08  ? 431  LYS A CE    1 
ATOM   3313  N  NZ    . LYS A  1  431  ? 21.041  -120.714 122.666 1.00 33.83  ? 431  LYS A NZ    1 
ATOM   3314  N  N     . VAL A  1  432  ? 15.490  -122.188 126.860 1.00 19.16  ? 432  VAL A N     1 
ATOM   3315  C  CA    . VAL A  1  432  ? 14.986  -121.471 128.023 1.00 18.17  ? 432  VAL A CA    1 
ATOM   3316  C  C     . VAL A  1  432  ? 16.170  -120.914 128.786 1.00 17.81  ? 432  VAL A C     1 
ATOM   3317  O  O     . VAL A  1  432  ? 16.920  -121.674 129.372 1.00 19.43  ? 432  VAL A O     1 
ATOM   3318  C  CB    . VAL A  1  432  ? 14.250  -122.386 129.005 1.00 17.88  ? 432  VAL A CB    1 
ATOM   3319  C  CG1   . VAL A  1  432  ? 13.618  -121.560 130.070 1.00 19.62  ? 432  VAL A CG1   1 
ATOM   3320  C  CG2   . VAL A  1  432  ? 13.202  -123.173 128.316 1.00 19.76  ? 432  VAL A CG2   1 
ATOM   3321  N  N     . GLU A  1  433  ? 16.358  -119.601 128.785 1.00 17.17  ? 433  GLU A N     1 
ATOM   3322  C  CA    . GLU A  1  433  ? 17.469  -119.019 129.525 1.00 15.89  ? 433  GLU A CA    1 
ATOM   3323  C  C     . GLU A  1  433  ? 17.051  -119.065 130.985 1.00 15.97  ? 433  GLU A C     1 
ATOM   3324  O  O     . GLU A  1  433  ? 16.250  -118.255 131.418 1.00 16.55  ? 433  GLU A O     1 
ATOM   3325  C  CB    . GLU A  1  433  ? 17.679  -117.582 129.090 1.00 17.79  ? 433  GLU A CB    1 
ATOM   3326  C  CG    . GLU A  1  433  ? 18.281  -117.421 127.718 1.00 20.17  ? 433  GLU A CG    1 
ATOM   3327  C  CD    . GLU A  1  433  ? 19.166  -116.192 127.646 1.00 23.96  ? 433  GLU A CD    1 
ATOM   3328  O  OE1   . GLU A  1  433  ? 18.676  -115.114 127.200 1.00 23.19  ? 433  GLU A OE1   1 
ATOM   3329  O  OE2   . GLU A  1  433  ? 20.351  -116.322 128.067 1.00 24.80  ? 433  GLU A OE2   1 
ATOM   3330  N  N     . ARG A  1  434  ? 17.598  -120.001 131.747 1.00 14.87  ? 434  ARG A N     1 
ATOM   3331  C  CA    . ARG A  1  434  ? 17.208  -120.177 133.135 1.00 14.93  ? 434  ARG A CA    1 
ATOM   3332  C  C     . ARG A  1  434  ? 18.181  -119.614 134.128 1.00 15.94  ? 434  ARG A C     1 
ATOM   3333  O  O     . ARG A  1  434  ? 19.330  -119.373 133.804 1.00 16.28  ? 434  ARG A O     1 
ATOM   3334  C  CB    . ARG A  1  434  ? 17.061  -121.651 133.435 1.00 16.04  ? 434  ARG A CB    1 
ATOM   3335  C  CG    . ARG A  1  434  ? 18.375  -122.372 133.228 1.00 17.42  ? 434  ARG A CG    1 
ATOM   3336  C  CD    . ARG A  1  434  ? 18.353  -123.779 133.760 1.00 17.96  ? 434  ARG A CD    1 
ATOM   3337  N  NE    . ARG A  1  434  ? 19.473  -123.884 134.667 1.00 21.81  ? 434  ARG A NE    1 
ATOM   3338  C  CZ    . ARG A  1  434  ? 20.617  -124.488 134.395 1.00 23.62  ? 434  ARG A CZ    1 
ATOM   3339  N  NH1   . ARG A  1  434  ? 20.802  -125.074 133.221 1.00 24.60  ? 434  ARG A NH1   1 
ATOM   3340  N  NH2   . ARG A  1  434  ? 21.588  -124.476 135.299 1.00 24.68  ? 434  ARG A NH2   1 
ATOM   3341  N  N     . HIS A  1  435  ? 17.709  -119.445 135.360 1.00 17.97  ? 435  HIS A N     1 
ATOM   3342  C  CA    . HIS A  1  435  ? 18.528  -118.922 136.446 1.00 19.85  ? 435  HIS A CA    1 
ATOM   3343  C  C     . HIS A  1  435  ? 19.673  -119.880 136.768 1.00 21.50  ? 435  HIS A C     1 
ATOM   3344  O  O     . HIS A  1  435  ? 19.560  -121.097 136.621 1.00 20.64  ? 435  HIS A O     1 
ATOM   3345  C  CB    . HIS A  1  435  ? 17.695  -118.736 137.737 1.00 20.16  ? 435  HIS A CB    1 
ATOM   3346  C  CG    . HIS A  1  435  ? 16.726  -117.591 137.703 1.00 20.11  ? 435  HIS A CG    1 
ATOM   3347  N  ND1   . HIS A  1  435  ? 17.119  -116.272 137.791 1.00 20.47  ? 435  HIS A ND1   1 
ATOM   3348  C  CD2   . HIS A  1  435  ? 15.377  -117.572 137.595 1.00 19.69  ? 435  HIS A CD2   1 
ATOM   3349  C  CE1   . HIS A  1  435  ? 16.056  -115.488 137.735 1.00 19.85  ? 435  HIS A CE1   1 
ATOM   3350  N  NE2   . HIS A  1  435  ? 14.985  -116.254 137.616 1.00 21.66  ? 435  HIS A NE2   1 
ATOM   3351  N  N     . ILE A  1  436  ? 20.781  -119.308 137.210 1.00 23.80  ? 436  ILE A N     1 
ATOM   3352  C  CA    . ILE A  1  436  ? 21.928  -120.085 137.623 1.00 25.87  ? 436  ILE A CA    1 
ATOM   3353  C  C     . ILE A  1  436  ? 21.429  -120.917 138.790 1.00 26.47  ? 436  ILE A C     1 
ATOM   3354  O  O     . ILE A  1  436  ? 20.768  -120.401 139.685 1.00 27.32  ? 436  ILE A O     1 
ATOM   3355  C  CB    . ILE A  1  436  ? 23.044  -119.161 138.114 1.00 27.14  ? 436  ILE A CB    1 
ATOM   3356  C  CG1   . ILE A  1  436  ? 23.589  -118.367 136.938 1.00 29.08  ? 436  ILE A CG1   1 
ATOM   3357  C  CG2   . ILE A  1  436  ? 24.138  -119.953 138.745 1.00 27.28  ? 436  ILE A CG2   1 
ATOM   3358  C  CD1   . ILE A  1  436  ? 23.818  -119.239 135.706 1.00 30.09  ? 436  ILE A CD1   1 
ATOM   3359  N  N     . MET A  1  437  ? 21.730  -122.202 138.788 1.00 27.11  ? 437  MET A N     1 
ATOM   3360  C  CA    . MET A  1  437  ? 21.264  -123.043 139.868 1.00 28.43  ? 437  MET A CA    1 
ATOM   3361  C  C     . MET A  1  437  ? 22.359  -123.835 140.535 1.00 29.04  ? 437  MET A C     1 
ATOM   3362  O  O     . MET A  1  437  ? 23.440  -124.040 139.980 1.00 28.31  ? 437  MET A O     1 
ATOM   3363  C  CB    . MET A  1  437  ? 20.228  -124.023 139.367 1.00 32.41  ? 437  MET A CB    1 
ATOM   3364  C  CG    . MET A  1  437  ? 19.135  -123.419 138.529 1.00 36.20  ? 437  MET A CG    1 
ATOM   3365  S  SD    . MET A  1  437  ? 17.837  -124.664 138.297 1.00 44.24  ? 437  MET A SD    1 
ATOM   3366  C  CE    . MET A  1  437  ? 18.876  -126.158 137.586 1.00 39.79  ? 437  MET A CE    1 
ATOM   3367  N  N     . ASP A  1  438  ? 22.046  -124.313 141.733 1.00 29.65  ? 438  ASP A N     1 
ATOM   3368  C  CA    . ASP A  1  438  ? 22.985  -125.091 142.514 1.00 28.52  ? 438  ASP A CA    1 
ATOM   3369  C  C     . ASP A  1  438  ? 23.754  -126.071 141.651 1.00 27.39  ? 438  ASP A C     1 
ATOM   3370  O  O     . ASP A  1  438  ? 23.192  -126.811 140.863 1.00 25.69  ? 438  ASP A O     1 
ATOM   3371  C  CB    . ASP A  1  438  ? 22.252  -125.822 143.629 1.00 29.29  ? 438  ASP A CB    1 
ATOM   3372  C  CG    . ASP A  1  438  ? 22.037  -124.953 144.831 1.00 32.87  ? 438  ASP A CG    1 
ATOM   3373  O  OD1   . ASP A  1  438  ? 22.069  -123.719 144.680 1.00 35.29  ? 438  ASP A OD1   1 
ATOM   3374  O  OD2   . ASP A  1  438  ? 21.834  -125.495 145.935 1.00 37.17  ? 438  ASP A OD2   1 
ATOM   3375  N  N     . ASN A  1  439  ? 25.066  -126.027 141.793 1.00 27.26  ? 439  ASN A N     1 
ATOM   3376  C  CA    . ASN A  1  439  ? 25.945  -126.901 141.072 1.00 25.94  ? 439  ASN A CA    1 
ATOM   3377  C  C     . ASN A  1  439  ? 26.235  -126.602 139.634 1.00 25.88  ? 439  ASN A C     1 
ATOM   3378  O  O     . ASN A  1  439  ? 26.740  -127.458 138.921 1.00 26.15  ? 439  ASN A O     1 
ATOM   3379  C  CB    . ASN A  1  439  ? 25.476  -128.319 141.234 1.00 26.21  ? 439  ASN A CB    1 
ATOM   3380  C  CG    . ASN A  1  439  ? 25.940  -128.895 142.529 1.00 29.91  ? 439  ASN A CG    1 
ATOM   3381  O  OD1   . ASN A  1  439  ? 26.372  -128.154 143.427 1.00 30.54  ? 439  ASN A OD1   1 
ATOM   3382  N  ND2   . ASN A  1  439  ? 25.871  -130.214 142.653 1.00 32.45  ? 439  ASN A ND2   1 
ATOM   3383  N  N     . ASP A  1  440  ? 25.930  -125.390 139.189 1.00 25.83  ? 440  ASP A N     1 
ATOM   3384  C  CA    . ASP A  1  440  ? 26.282  -125.037 137.823 1.00 24.42  ? 440  ASP A CA    1 
ATOM   3385  C  C     . ASP A  1  440  ? 27.779  -124.762 137.915 1.00 23.55  ? 440  ASP A C     1 
ATOM   3386  O  O     . ASP A  1  440  ? 28.256  -124.183 138.896 1.00 24.21  ? 440  ASP A O     1 
ATOM   3387  C  CB    . ASP A  1  440  ? 25.560  -123.770 137.355 1.00 23.57  ? 440  ASP A CB    1 
ATOM   3388  C  CG    . ASP A  1  440  ? 24.193  -124.057 136.774 1.00 23.66  ? 440  ASP A CG    1 
ATOM   3389  O  OD1   . ASP A  1  440  ? 24.000  -125.188 136.293 1.00 22.33  ? 440  ASP A OD1   1 
ATOM   3390  O  OD2   . ASP A  1  440  ? 23.318  -123.155 136.782 1.00 24.27  ? 440  ASP A OD2   1 
ATOM   3391  N  N     . PRO A  1  441  ? 28.550  -125.200 136.922 1.00 21.73  ? 441  PRO A N     1 
ATOM   3392  C  CA    . PRO A  1  441  ? 29.981  -124.929 137.006 1.00 19.47  ? 441  PRO A CA    1 
ATOM   3393  C  C     . PRO A  1  441  ? 30.199  -123.469 136.625 1.00 17.34  ? 441  PRO A C     1 
ATOM   3394  O  O     . PRO A  1  441  ? 29.592  -122.982 135.674 1.00 17.81  ? 441  PRO A O     1 
ATOM   3395  C  CB    . PRO A  1  441  ? 30.555  -125.882 135.977 1.00 19.45  ? 441  PRO A CB    1 
ATOM   3396  C  CG    . PRO A  1  441  ? 29.536  -125.807 134.906 1.00 20.72  ? 441  PRO A CG    1 
ATOM   3397  C  CD    . PRO A  1  441  ? 28.228  -125.918 135.681 1.00 21.54  ? 441  PRO A CD    1 
ATOM   3398  N  N     . VAL A  1  442  ? 31.036  -122.768 137.377 1.00 14.58  ? 442  VAL A N     1 
ATOM   3399  C  CA    . VAL A  1  442  ? 31.311  -121.382 137.075 1.00 13.30  ? 442  VAL A CA    1 
ATOM   3400  C  C     . VAL A  1  442  ? 32.745  -121.002 137.391 1.00 15.48  ? 442  VAL A C     1 
ATOM   3401  O  O     . VAL A  1  442  ? 33.369  -121.552 138.301 1.00 15.58  ? 442  VAL A O     1 
ATOM   3402  C  CB    . VAL A  1  442  ? 30.369  -120.452 137.822 1.00 10.55  ? 442  VAL A CB    1 
ATOM   3403  C  CG1   . VAL A  1  442  ? 28.976  -120.694 137.362 1.00 7.77   ? 442  VAL A CG1   1 
ATOM   3404  C  CG2   . VAL A  1  442  ? 30.482  -120.668 139.314 1.00 10.72  ? 442  VAL A CG2   1 
ATOM   3405  N  N     . LEU A  1  443  ? 33.263  -120.063 136.603 1.00 17.63  ? 443  LEU A N     1 
ATOM   3406  C  CA    . LEU A  1  443  ? 34.624  -119.565 136.742 1.00 18.86  ? 443  LEU A CA    1 
ATOM   3407  C  C     . LEU A  1  443  ? 34.618  -118.487 137.812 1.00 20.33  ? 443  LEU A C     1 
ATOM   3408  O  O     . LEU A  1  443  ? 33.830  -117.546 137.746 1.00 21.54  ? 443  LEU A O     1 
ATOM   3409  C  CB    . LEU A  1  443  ? 35.114  -118.975 135.415 1.00 16.13  ? 443  LEU A CB    1 
ATOM   3410  C  CG    . LEU A  1  443  ? 36.477  -119.469 134.930 1.00 17.14  ? 443  LEU A CG    1 
ATOM   3411  C  CD1   . LEU A  1  443  ? 37.276  -118.294 134.443 1.00 17.03  ? 443  LEU A CD1   1 
ATOM   3412  C  CD2   . LEU A  1  443  ? 37.253  -120.131 136.040 1.00 16.93  ? 443  LEU A CD2   1 
ATOM   3413  N  N     . PHE A  1  444  ? 35.490  -118.629 138.801 1.00 21.17  ? 444  PHE A N     1 
ATOM   3414  C  CA    . PHE A  1  444  ? 35.567  -117.665 139.892 1.00 23.02  ? 444  PHE A CA    1 
ATOM   3415  C  C     . PHE A  1  444  ? 36.991  -117.185 139.899 1.00 24.59  ? 444  PHE A C     1 
ATOM   3416  O  O     . PHE A  1  444  ? 37.892  -118.015 139.828 1.00 27.23  ? 444  PHE A O     1 
ATOM   3417  C  CB    . PHE A  1  444  ? 35.277  -118.380 141.186 1.00 23.87  ? 444  PHE A CB    1 
ATOM   3418  C  CG    . PHE A  1  444  ? 35.014  -117.484 142.336 1.00 24.06  ? 444  PHE A CG    1 
ATOM   3419  C  CD1   . PHE A  1  444  ? 34.188  -116.393 142.202 1.00 25.18  ? 444  PHE A CD1   1 
ATOM   3420  C  CD2   . PHE A  1  444  ? 35.497  -117.809 143.593 1.00 25.09  ? 444  PHE A CD2   1 
ATOM   3421  C  CE1   . PHE A  1  444  ? 33.836  -115.639 143.310 1.00 27.28  ? 444  PHE A CE1   1 
ATOM   3422  C  CE2   . PHE A  1  444  ? 35.153  -117.070 144.703 1.00 26.42  ? 444  PHE A CE2   1 
ATOM   3423  C  CZ    . PHE A  1  444  ? 34.320  -115.982 144.566 1.00 27.21  ? 444  PHE A CZ    1 
ATOM   3424  N  N     . ASN A  1  445  ? 37.221  -115.875 140.001 1.00 24.26  ? 445  ASN A N     1 
ATOM   3425  C  CA    . ASN A  1  445  ? 38.598  -115.378 139.964 1.00 22.78  ? 445  ASN A CA    1 
ATOM   3426  C  C     . ASN A  1  445  ? 38.880  -114.121 140.769 1.00 21.46  ? 445  ASN A C     1 
ATOM   3427  O  O     . ASN A  1  445  ? 37.979  -113.340 141.050 1.00 20.63  ? 445  ASN A O     1 
ATOM   3428  C  CB    . ASN A  1  445  ? 39.028  -115.238 138.467 1.00 23.50  ? 445  ASN A CB    1 
ATOM   3429  C  CG    . ASN A  1  445  ? 39.510  -113.815 138.063 1.00 26.09  ? 445  ASN A CG    1 
ATOM   3430  O  OD1   . ASN A  1  445  ? 38.744  -112.982 137.523 1.00 26.95  ? 445  ASN A OD1   1 
ATOM   3431  N  ND2   . ASN A  1  445  ? 40.795  -113.554 138.293 1.00 26.72  ? 445  ASN A ND2   1 
ATOM   3432  N  N     . ARG A  1  446  ? 40.134  -113.968 141.183 1.00 22.03  ? 446  ARG A N     1 
ATOM   3433  C  CA    . ARG A  1  446  ? 40.572  -112.782 141.916 1.00 24.63  ? 446  ARG A CA    1 
ATOM   3434  C  C     . ARG A  1  446  ? 41.771  -112.151 141.248 1.00 25.48  ? 446  ARG A C     1 
ATOM   3435  O  O     . ARG A  1  446  ? 42.774  -112.810 141.001 1.00 25.09  ? 446  ARG A O     1 
ATOM   3436  C  CB    . ARG A  1  446  ? 40.975  -113.082 143.349 1.00 25.22  ? 446  ARG A CB    1 
ATOM   3437  C  CG    . ARG A  1  446  ? 41.562  -111.845 144.014 1.00 27.20  ? 446  ARG A CG    1 
ATOM   3438  C  CD    . ARG A  1  446  ? 41.840  -112.040 145.494 1.00 32.54  ? 446  ARG A CD    1 
ATOM   3439  N  NE    . ARG A  1  446  ? 42.427  -110.855 146.130 1.00 36.18  ? 446  ARG A NE    1 
ATOM   3440  C  CZ    . ARG A  1  446  ? 43.641  -110.367 145.863 1.00 38.44  ? 446  ARG A CZ    1 
ATOM   3441  N  NH1   . ARG A  1  446  ? 44.428  -110.952 144.961 1.00 39.38  ? 446  ARG A NH1   1 
ATOM   3442  N  NH2   . ARG A  1  446  ? 44.077  -109.295 146.511 1.00 39.26  ? 446  ARG A NH2   1 
ATOM   3443  N  N     . GLN A  1  447  ? 41.671  -110.858 140.983 1.00 27.83  ? 447  GLN A N     1 
ATOM   3444  C  CA    . GLN A  1  447  ? 42.750  -110.134 140.333 1.00 31.18  ? 447  GLN A CA    1 
ATOM   3445  C  C     . GLN A  1  447  ? 43.674  -109.483 141.357 1.00 31.45  ? 447  GLN A C     1 
ATOM   3446  O  O     . GLN A  1  447  ? 43.252  -109.095 142.438 1.00 32.06  ? 447  GLN A O     1 
ATOM   3447  C  CB    . GLN A  1  447  ? 42.164  -109.085 139.380 1.00 31.68  ? 447  GLN A CB    1 
ATOM   3448  C  CG    . GLN A  1  447  ? 41.216  -109.702 138.373 1.00 35.84  ? 447  GLN A CG    1 
ATOM   3449  C  CD    . GLN A  1  447  ? 40.152  -108.735 137.885 1.00 39.79  ? 447  GLN A CD    1 
ATOM   3450  O  OE1   . GLN A  1  447  ? 39.630  -107.922 138.660 1.00 42.51  ? 447  GLN A OE1   1 
ATOM   3451  N  NE2   . GLN A  1  447  ? 39.805  -108.829 136.597 1.00 41.25  ? 447  GLN A NE2   1 
ATOM   3452  N  N     . PRO A  1  448  ? 44.960  -109.368 141.024 1.00 32.20  ? 448  PRO A N     1 
ATOM   3453  C  CA    . PRO A  1  448  ? 45.545  -109.805 139.753 1.00 33.38  ? 448  PRO A CA    1 
ATOM   3454  C  C     . PRO A  1  448  ? 45.558  -111.326 139.586 1.00 33.71  ? 448  PRO A C     1 
ATOM   3455  O  O     . PRO A  1  448  ? 45.690  -112.083 140.556 1.00 32.48  ? 448  PRO A O     1 
ATOM   3456  C  CB    . PRO A  1  448  ? 46.938  -109.214 139.806 1.00 32.78  ? 448  PRO A CB    1 
ATOM   3457  C  CG    . PRO A  1  448  ? 47.250  -109.331 141.262 1.00 33.74  ? 448  PRO A CG    1 
ATOM   3458  C  CD    . PRO A  1  448  ? 45.993  -108.860 141.935 1.00 31.80  ? 448  PRO A CD    1 
ATOM   3459  N  N     . SER A  1  449  ? 45.412  -111.757 138.338 1.00 33.91  ? 449  SER A N     1 
ATOM   3460  C  CA    . SER A  1  449  ? 45.391  -113.174 138.007 1.00 33.97  ? 449  SER A CA    1 
ATOM   3461  C  C     . SER A  1  449  ? 46.803  -113.568 137.621 1.00 34.36  ? 449  SER A C     1 
ATOM   3462  O  O     . SER A  1  449  ? 47.194  -113.437 136.462 1.00 35.75  ? 449  SER A O     1 
ATOM   3463  C  CB    . SER A  1  449  ? 44.444  -113.373 136.843 1.00 33.26  ? 449  SER A CB    1 
ATOM   3464  O  OG    . SER A  1  449  ? 43.596  -112.239 136.765 1.00 33.60  ? 449  SER A OG    1 
ATOM   3465  N  N     . LEU A  1  450  ? 47.571  -114.051 138.590 1.00 33.31  ? 450  LEU A N     1 
ATOM   3466  C  CA    . LEU A  1  450  ? 48.956  -114.410 138.331 1.00 32.27  ? 450  LEU A CA    1 
ATOM   3467  C  C     . LEU A  1  450  ? 49.218  -115.821 137.800 1.00 31.81  ? 450  LEU A C     1 
ATOM   3468  O  O     . LEU A  1  450  ? 50.061  -115.984 136.929 1.00 33.36  ? 450  LEU A O     1 
ATOM   3469  C  CB    . LEU A  1  450  ? 49.784  -114.129 139.583 1.00 32.52  ? 450  LEU A CB    1 
ATOM   3470  C  CG    . LEU A  1  450  ? 49.667  -112.665 140.024 1.00 32.77  ? 450  LEU A CG    1 
ATOM   3471  C  CD1   . LEU A  1  450  ? 50.278  -112.471 141.405 1.00 33.68  ? 450  LEU A CD1   1 
ATOM   3472  C  CD2   . LEU A  1  450  ? 50.360  -111.776 139.012 1.00 33.95  ? 450  LEU A CD2   1 
ATOM   3473  N  N     . HIS A  1  451  ? 48.526  -116.837 138.309 1.00 30.42  ? 451  HIS A N     1 
ATOM   3474  C  CA    . HIS A  1  451  ? 48.719  -118.194 137.797 1.00 29.54  ? 451  HIS A CA    1 
ATOM   3475  C  C     . HIS A  1  451  ? 47.389  -118.878 137.577 1.00 29.96  ? 451  HIS A C     1 
ATOM   3476  O  O     . HIS A  1  451  ? 46.358  -118.353 137.987 1.00 29.74  ? 451  HIS A O     1 
ATOM   3477  C  CB    . HIS A  1  451  ? 49.591  -119.053 138.727 1.00 31.20  ? 451  HIS A CB    1 
ATOM   3478  C  CG    . HIS A  1  451  ? 49.344  -118.849 140.199 1.00 32.03  ? 451  HIS A CG    1 
ATOM   3479  N  ND1   . HIS A  1  451  ? 48.144  -118.405 140.711 1.00 32.08  ? 451  HIS A ND1   1 
ATOM   3480  C  CD2   . HIS A  1  451  ? 50.146  -119.072 141.271 1.00 31.09  ? 451  HIS A CD2   1 
ATOM   3481  C  CE1   . HIS A  1  451  ? 48.219  -118.360 142.031 1.00 30.98  ? 451  HIS A CE1   1 
ATOM   3482  N  NE2   . HIS A  1  451  ? 49.422  -118.760 142.395 1.00 30.37  ? 451  HIS A NE2   1 
ATOM   3483  N  N     . LYS A  1  452  ? 47.408  -120.034 136.915 1.00 29.98  ? 452  LYS A N     1 
ATOM   3484  C  CA    . LYS A  1  452  ? 46.181  -120.786 136.651 1.00 29.75  ? 452  LYS A CA    1 
ATOM   3485  C  C     . LYS A  1  452  ? 45.205  -120.627 137.801 1.00 30.88  ? 452  LYS A C     1 
ATOM   3486  O  O     . LYS A  1  452  ? 44.087  -120.158 137.612 1.00 30.54  ? 452  LYS A O     1 
ATOM   3487  C  CB    . LYS A  1  452  ? 46.468  -122.278 136.520 1.00 29.13  ? 452  LYS A CB    1 
ATOM   3488  C  CG    . LYS A  1  452  ? 47.426  -122.660 135.432 1.00 30.35  ? 452  LYS A CG    1 
ATOM   3489  C  CD    . LYS A  1  452  ? 47.835  -124.125 135.572 1.00 30.65  ? 452  LYS A CD    1 
ATOM   3490  C  CE    . LYS A  1  452  ? 46.637  -125.052 135.526 1.00 31.66  ? 452  LYS A CE    1 
ATOM   3491  N  NZ    . LYS A  1  452  ? 47.035  -126.476 135.720 1.00 33.54  ? 452  LYS A NZ    1 
ATOM   3492  N  N     . MET A  1  453  ? 45.661  -121.021 138.994 1.00 31.87  ? 453  MET A N     1 
ATOM   3493  C  CA    . MET A  1  453  ? 44.870  -120.999 140.222 1.00 32.76  ? 453  MET A CA    1 
ATOM   3494  C  C     . MET A  1  453  ? 44.252  -119.702 140.689 1.00 33.15  ? 453  MET A C     1 
ATOM   3495  O  O     . MET A  1  453  ? 43.776  -119.633 141.814 1.00 33.93  ? 453  MET A O     1 
ATOM   3496  C  CB    . MET A  1  453  ? 45.674  -121.567 141.379 1.00 34.41  ? 453  MET A CB    1 
ATOM   3497  C  CG    . MET A  1  453  ? 46.336  -122.876 141.062 1.00 38.28  ? 453  MET A CG    1 
ATOM   3498  S  SD    . MET A  1  453  ? 47.906  -122.608 140.262 1.00 43.22  ? 453  MET A SD    1 
ATOM   3499  C  CE    . MET A  1  453  ? 49.032  -122.461 141.766 1.00 39.89  ? 453  MET A CE    1 
ATOM   3500  N  N     . SER A  1  454  ? 44.274  -118.667 139.863 1.00 33.33  ? 454  SER A N     1 
ATOM   3501  C  CA    . SER A  1  454  ? 43.641  -117.412 140.248 1.00 32.67  ? 454  SER A CA    1 
ATOM   3502  C  C     . SER A  1  454  ? 42.268  -117.465 139.597 1.00 31.65  ? 454  SER A C     1 
ATOM   3503  O  O     . SER A  1  454  ? 41.431  -116.599 139.805 1.00 33.51  ? 454  SER A O     1 
ATOM   3504  C  CB    . SER A  1  454  ? 44.432  -116.202 139.728 1.00 32.77  ? 454  SER A CB    1 
ATOM   3505  O  OG    . SER A  1  454  ? 45.551  -115.918 140.550 1.00 32.73  ? 454  SER A OG    1 
ATOM   3506  N  N     . MET A  1  455  ? 42.052  -118.503 138.800 1.00 29.87  ? 455  MET A N     1 
ATOM   3507  C  CA    . MET A  1  455  ? 40.791  -118.702 138.104 1.00 28.73  ? 455  MET A CA    1 
ATOM   3508  C  C     . MET A  1  455  ? 40.430  -120.170 138.105 1.00 27.96  ? 455  MET A C     1 
ATOM   3509  O  O     . MET A  1  455  ? 40.820  -120.900 137.203 1.00 29.73  ? 455  MET A O     1 
ATOM   3510  C  CB    . MET A  1  455  ? 40.894  -118.266 136.655 1.00 29.08  ? 455  MET A CB    1 
ATOM   3511  C  CG    . MET A  1  455  ? 41.109  -116.821 136.430 1.00 28.22  ? 455  MET A CG    1 
ATOM   3512  S  SD    . MET A  1  455  ? 40.593  -116.624 134.749 1.00 34.48  ? 455  MET A SD    1 
ATOM   3513  C  CE    . MET A  1  455  ? 39.246  -115.436 134.906 1.00 30.64  ? 455  MET A CE    1 
ATOM   3514  N  N     . MET A  1  456  ? 39.684  -120.607 139.106 1.00 25.94  ? 456  MET A N     1 
ATOM   3515  C  CA    . MET A  1  456  ? 39.293  -121.998 139.171 1.00 23.50  ? 456  MET A CA    1 
ATOM   3516  C  C     . MET A  1  456  ? 37.775  -122.114 139.069 1.00 23.64  ? 456  MET A C     1 
ATOM   3517  O  O     . MET A  1  456  ? 37.028  -121.148 139.304 1.00 23.38  ? 456  MET A O     1 
ATOM   3518  C  CB    . MET A  1  456  ? 39.796  -122.615 140.467 1.00 23.30  ? 456  MET A CB    1 
ATOM   3519  C  CG    . MET A  1  456  ? 41.291  -122.516 140.657 1.00 22.01  ? 456  MET A CG    1 
ATOM   3520  S  SD    . MET A  1  456  ? 41.736  -123.180 142.272 1.00 25.78  ? 456  MET A SD    1 
ATOM   3521  C  CE    . MET A  1  456  ? 41.483  -121.803 143.278 1.00 24.12  ? 456  MET A CE    1 
ATOM   3522  N  N     . ALA A  1  457  ? 37.314  -123.306 138.717 1.00 22.41  ? 457  ALA A N     1 
ATOM   3523  C  CA    . ALA A  1  457  ? 35.890  -123.524 138.566 1.00 21.15  ? 457  ALA A CA    1 
ATOM   3524  C  C     . ALA A  1  457  ? 35.291  -124.082 139.852 1.00 20.30  ? 457  ALA A C     1 
ATOM   3525  O  O     . ALA A  1  457  ? 35.816  -125.049 140.409 1.00 20.79  ? 457  ALA A O     1 
ATOM   3526  C  CB    . ALA A  1  457  ? 35.643  -124.482 137.387 1.00 18.40  ? 457  ALA A CB    1 
ATOM   3527  N  N     . HIS A  1  458  ? 34.210  -123.459 140.327 1.00 18.53  ? 458  HIS A N     1 
ATOM   3528  C  CA    . HIS A  1  458  ? 33.509  -123.924 141.531 1.00 17.42  ? 458  HIS A CA    1 
ATOM   3529  C  C     . HIS A  1  458  ? 32.087  -124.315 141.203 1.00 18.71  ? 458  HIS A C     1 
ATOM   3530  O  O     . HIS A  1  458  ? 31.547  -123.951 140.156 1.00 19.52  ? 458  HIS A O     1 
ATOM   3531  C  CB    . HIS A  1  458  ? 33.388  -122.845 142.595 1.00 14.16  ? 458  HIS A CB    1 
ATOM   3532  C  CG    . HIS A  1  458  ? 34.682  -122.251 143.002 1.00 11.05  ? 458  HIS A CG    1 
ATOM   3533  N  ND1   . HIS A  1  458  ? 35.580  -122.911 143.801 1.00 9.58   ? 458  HIS A ND1   1 
ATOM   3534  C  CD2   . HIS A  1  458  ? 35.227  -121.046 142.735 1.00 11.94  ? 458  HIS A CD2   1 
ATOM   3535  C  CE1   . HIS A  1  458  ? 36.624  -122.134 144.012 1.00 12.03  ? 458  HIS A CE1   1 
ATOM   3536  N  NE2   . HIS A  1  458  ? 36.436  -120.996 143.376 1.00 11.53  ? 458  HIS A NE2   1 
ATOM   3537  N  N     . ARG A  1  459  ? 31.476  -125.029 142.140 1.00 19.77  ? 459  ARG A N     1 
ATOM   3538  C  CA    . ARG A  1  459  ? 30.093  -125.458 142.012 1.00 20.43  ? 459  ARG A CA    1 
ATOM   3539  C  C     . ARG A  1  459  ? 29.250  -124.360 142.654 1.00 20.85  ? 459  ARG A C     1 
ATOM   3540  O  O     . ARG A  1  459  ? 29.606  -123.829 143.711 1.00 22.91  ? 459  ARG A O     1 
ATOM   3541  C  CB    . ARG A  1  459  ? 29.888  -126.785 142.756 1.00 21.85  ? 459  ARG A CB    1 
ATOM   3542  C  CG    . ARG A  1  459  ? 30.290  -128.029 141.975 1.00 22.08  ? 459  ARG A CG    1 
ATOM   3543  C  CD    . ARG A  1  459  ? 30.651  -129.155 142.904 1.00 23.58  ? 459  ARG A CD    1 
ATOM   3544  N  NE    . ARG A  1  459  ? 29.643  -129.392 143.930 1.00 27.52  ? 459  ARG A NE    1 
ATOM   3545  C  CZ    . ARG A  1  459  ? 29.945  -129.634 145.203 1.00 30.12  ? 459  ARG A CZ    1 
ATOM   3546  N  NH1   . ARG A  1  459  ? 31.216  -129.661 145.576 1.00 31.09  ? 459  ARG A NH1   1 
ATOM   3547  N  NH2   . ARG A  1  459  ? 28.991  -129.851 146.103 1.00 31.41  ? 459  ARG A NH2   1 
ATOM   3548  N  N     . VAL A  1  460  ? 28.143  -124.002 142.024 1.00 19.27  ? 460  VAL A N     1 
ATOM   3549  C  CA    . VAL A  1  460  ? 27.308  -122.974 142.599 1.00 17.23  ? 460  VAL A CA    1 
ATOM   3550  C  C     . VAL A  1  460  ? 26.494  -123.527 143.744 1.00 17.74  ? 460  VAL A C     1 
ATOM   3551  O  O     . VAL A  1  460  ? 26.190  -124.718 143.807 1.00 17.11  ? 460  VAL A O     1 
ATOM   3552  C  CB    . VAL A  1  460  ? 26.347  -122.405 141.579 1.00 15.23  ? 460  VAL A CB    1 
ATOM   3553  C  CG1   . VAL A  1  460  ? 25.458  -121.377 142.228 1.00 14.09  ? 460  VAL A CG1   1 
ATOM   3554  C  CG2   . VAL A  1  460  ? 27.121  -121.798 140.452 1.00 15.09  ? 460  VAL A CG2   1 
ATOM   3555  N  N     . LYS A  1  461  ? 26.170  -122.636 144.663 1.00 19.22  ? 461  LYS A N     1 
ATOM   3556  C  CA    . LYS A  1  461  ? 25.342  -122.944 145.821 1.00 20.17  ? 461  LYS A CA    1 
ATOM   3557  C  C     . LYS A  1  461  ? 24.689  -121.593 146.048 1.00 20.31  ? 461  LYS A C     1 
ATOM   3558  O  O     . LYS A  1  461  ? 25.308  -120.689 146.613 1.00 20.74  ? 461  LYS A O     1 
ATOM   3559  C  CB    . LYS A  1  461  ? 26.199  -123.316 147.017 1.00 19.53  ? 461  LYS A CB    1 
ATOM   3560  C  CG    . LYS A  1  461  ? 25.606  -124.381 147.865 1.00 19.26  ? 461  LYS A CG    1 
ATOM   3561  C  CD    . LYS A  1  461  ? 24.258  -123.996 148.400 1.00 22.51  ? 461  LYS A CD    1 
ATOM   3562  C  CE    . LYS A  1  461  ? 23.918  -124.869 149.635 1.00 27.55  ? 461  LYS A CE    1 
ATOM   3563  N  NZ    . LYS A  1  461  ? 24.839  -124.625 150.843 1.00 26.47  ? 461  LYS A NZ    1 
ATOM   3564  N  N     . VAL A  1  462  ? 23.462  -121.434 145.554 1.00 19.22  ? 462  VAL A N     1 
ATOM   3565  C  CA    . VAL A  1  462  ? 22.775  -120.163 145.694 1.00 16.91  ? 462  VAL A CA    1 
ATOM   3566  C  C     . VAL A  1  462  ? 22.422  -119.989 147.152 1.00 17.84  ? 462  VAL A C     1 
ATOM   3567  O  O     . VAL A  1  462  ? 21.919  -120.916 147.794 1.00 18.53  ? 462  VAL A O     1 
ATOM   3568  C  CB    . VAL A  1  462  ? 21.552  -120.111 144.804 1.00 14.99  ? 462  VAL A CB    1 
ATOM   3569  C  CG1   . VAL A  1  462  ? 21.017  -118.695 144.756 1.00 14.09  ? 462  VAL A CG1   1 
ATOM   3570  C  CG2   . VAL A  1  462  ? 21.934  -120.575 143.410 1.00 13.16  ? 462  VAL A CG2   1 
ATOM   3571  N  N     . ILE A  1  463  ? 22.696  -118.795 147.670 1.00 16.68  ? 463  ILE A N     1 
ATOM   3572  C  CA    . ILE A  1  463  ? 22.502  -118.513 149.084 1.00 14.07  ? 463  ILE A CA    1 
ATOM   3573  C  C     . ILE A  1  463  ? 22.128  -117.059 149.372 1.00 16.10  ? 463  ILE A C     1 
ATOM   3574  O  O     . ILE A  1  463  ? 22.339  -116.163 148.543 1.00 15.89  ? 463  ILE A O     1 
ATOM   3575  C  CB    . ILE A  1  463  ? 23.805  -118.765 149.814 1.00 10.75  ? 463  ILE A CB    1 
ATOM   3576  C  CG1   . ILE A  1  463  ? 24.846  -117.787 149.268 1.00 8.01   ? 463  ILE A CG1   1 
ATOM   3577  C  CG2   . ILE A  1  463  ? 24.262  -120.196 149.611 1.00 8.55   ? 463  ILE A CG2   1 
ATOM   3578  C  CD1   . ILE A  1  463  ? 26.228  -118.043 149.703 1.00 7.66   ? 463  ILE A CD1   1 
ATOM   3579  N  N     . PRO A  1  464  ? 21.595  -116.806 150.582 1.00 16.43  ? 464  PRO A N     1 
ATOM   3580  C  CA    . PRO A  1  464  ? 21.182  -115.483 151.045 1.00 15.63  ? 464  PRO A CA    1 
ATOM   3581  C  C     . PRO A  1  464  ? 22.355  -114.528 151.223 1.00 15.23  ? 464  PRO A C     1 
ATOM   3582  O  O     . PRO A  1  464  ? 23.504  -114.920 151.110 1.00 16.28  ? 464  PRO A O     1 
ATOM   3583  C  CB    . PRO A  1  464  ? 20.486  -115.796 152.362 1.00 15.43  ? 464  PRO A CB    1 
ATOM   3584  C  CG    . PRO A  1  464  ? 21.215  -116.993 152.845 1.00 14.89  ? 464  PRO A CG    1 
ATOM   3585  C  CD    . PRO A  1  464  ? 21.266  -117.820 151.600 1.00 15.85  ? 464  PRO A CD    1 
ATOM   3586  N  N     . TYR A  1  465  ? 22.043  -113.273 151.509 1.00 16.29  ? 465  TYR A N     1 
ATOM   3587  C  CA    . TYR A  1  465  ? 23.035  -112.230 151.718 1.00 17.63  ? 465  TYR A CA    1 
ATOM   3588  C  C     . TYR A  1  465  ? 23.794  -111.897 150.469 1.00 17.56  ? 465  TYR A C     1 
ATOM   3589  O  O     . TYR A  1  465  ? 23.754  -112.641 149.500 1.00 18.22  ? 465  TYR A O     1 
ATOM   3590  C  CB    . TYR A  1  465  ? 23.963  -112.619 152.843 1.00 18.94  ? 465  TYR A CB    1 
ATOM   3591  C  CG    . TYR A  1  465  ? 23.152  -112.896 154.074 1.00 22.15  ? 465  TYR A CG    1 
ATOM   3592  C  CD1   . TYR A  1  465  ? 22.774  -114.198 154.405 1.00 23.06  ? 465  TYR A CD1   1 
ATOM   3593  C  CD2   . TYR A  1  465  ? 22.664  -111.845 154.849 1.00 24.01  ? 465  TYR A CD2   1 
ATOM   3594  C  CE1   . TYR A  1  465  ? 21.928  -114.446 155.467 1.00 25.39  ? 465  TYR A CE1   1 
ATOM   3595  C  CE2   . TYR A  1  465  ? 21.817  -112.078 155.911 1.00 26.16  ? 465  TYR A CE2   1 
ATOM   3596  C  CZ    . TYR A  1  465  ? 21.449  -113.382 156.217 1.00 27.32  ? 465  TYR A CZ    1 
ATOM   3597  O  OH    . TYR A  1  465  ? 20.582  -113.620 157.263 1.00 31.14  ? 465  TYR A OH    1 
ATOM   3598  N  N     . SER A  1  466  ? 24.508  -110.786 150.500 1.00 16.68  ? 466  SER A N     1 
ATOM   3599  C  CA    . SER A  1  466  ? 25.179  -110.329 149.309 1.00 16.00  ? 466  SER A CA    1 
ATOM   3600  C  C     . SER A  1  466  ? 26.653  -110.598 149.083 1.00 15.73  ? 466  SER A C     1 
ATOM   3601  O  O     . SER A  1  466  ? 27.309  -109.832 148.381 1.00 17.46  ? 466  SER A O     1 
ATOM   3602  C  CB    . SER A  1  466  ? 24.905  -108.837 149.162 1.00 15.31  ? 466  SER A CB    1 
ATOM   3603  O  OG    . SER A  1  466  ? 23.526  -108.584 149.367 1.00 15.12  ? 466  SER A OG    1 
ATOM   3604  N  N     . THR A  1  467  ? 27.194  -111.678 149.619 1.00 13.91  ? 467  THR A N     1 
ATOM   3605  C  CA    . THR A  1  467  ? 28.608  -111.899 149.361 1.00 15.66  ? 467  THR A CA    1 
ATOM   3606  C  C     . THR A  1  467  ? 29.012  -113.280 148.880 1.00 16.83  ? 467  THR A C     1 
ATOM   3607  O  O     . THR A  1  467  ? 28.534  -114.282 149.422 1.00 19.52  ? 467  THR A O     1 
ATOM   3608  C  CB    . THR A  1  467  ? 29.449  -111.613 150.588 1.00 15.22  ? 467  THR A CB    1 
ATOM   3609  O  OG1   . THR A  1  467  ? 28.889  -112.292 151.723 1.00 17.11  ? 467  THR A OG1   1 
ATOM   3610  C  CG2   . THR A  1  467  ? 29.549  -110.129 150.807 1.00 14.63  ? 467  THR A CG2   1 
ATOM   3611  N  N     . PHE A  1  468  ? 29.892  -113.335 147.872 1.00 14.30  ? 468  PHE A N     1 
ATOM   3612  C  CA    . PHE A  1  468  ? 30.377  -114.613 147.393 1.00 12.96  ? 468  PHE A CA    1 
ATOM   3613  C  C     . PHE A  1  468  ? 31.050  -115.245 148.594 1.00 14.52  ? 468  PHE A C     1 
ATOM   3614  O  O     . PHE A  1  468  ? 31.871  -114.614 149.259 1.00 15.38  ? 468  PHE A O     1 
ATOM   3615  C  CB    . PHE A  1  468  ? 31.430  -114.444 146.319 1.00 12.63  ? 468  PHE A CB    1 
ATOM   3616  C  CG    . PHE A  1  468  ? 30.905  -113.932 145.037 1.00 13.43  ? 468  PHE A CG    1 
ATOM   3617  C  CD1   . PHE A  1  468  ? 31.337  -112.719 144.536 1.00 14.98  ? 468  PHE A CD1   1 
ATOM   3618  C  CD2   . PHE A  1  468  ? 29.980  -114.659 144.320 1.00 14.11  ? 468  PHE A CD2   1 
ATOM   3619  C  CE1   . PHE A  1  468  ? 30.853  -112.237 143.339 1.00 15.04  ? 468  PHE A CE1   1 
ATOM   3620  C  CE2   . PHE A  1  468  ? 29.487  -114.190 143.120 1.00 14.35  ? 468  PHE A CE2   1 
ATOM   3621  C  CZ    . PHE A  1  468  ? 29.922  -112.977 142.628 1.00 15.61  ? 468  PHE A CZ    1 
ATOM   3622  N  N     . ARG A  1  469  ? 30.709  -116.488 148.886 1.00 13.95  ? 469  ARG A N     1 
ATOM   3623  C  CA    . ARG A  1  469  ? 31.320  -117.162 150.014 1.00 14.05  ? 469  ARG A CA    1 
ATOM   3624  C  C     . ARG A  1  469  ? 32.184  -118.288 149.472 1.00 14.38  ? 469  ARG A C     1 
ATOM   3625  O  O     . ARG A  1  469  ? 31.753  -119.068 148.618 1.00 14.88  ? 469  ARG A O     1 
ATOM   3626  C  CB    . ARG A  1  469  ? 30.244  -117.724 150.940 1.00 12.81  ? 469  ARG A CB    1 
ATOM   3627  C  CG    . ARG A  1  469  ? 29.057  -116.839 151.055 1.00 13.24  ? 469  ARG A CG    1 
ATOM   3628  C  CD    . ARG A  1  469  ? 28.324  -117.080 152.345 1.00 17.31  ? 469  ARG A CD    1 
ATOM   3629  N  NE    . ARG A  1  469  ? 28.407  -115.908 153.208 1.00 19.19  ? 469  ARG A NE    1 
ATOM   3630  C  CZ    . ARG A  1  469  ? 29.135  -115.842 154.317 1.00 19.59  ? 469  ARG A CZ    1 
ATOM   3631  N  NH1   . ARG A  1  469  ? 29.852  -116.887 154.728 1.00 14.58  ? 469  ARG A NH1   1 
ATOM   3632  N  NH2   . ARG A  1  469  ? 29.156  -114.707 155.001 1.00 20.99  ? 469  ARG A NH2   1 
ATOM   3633  N  N     . LEU A  1  470  ? 33.409  -118.374 149.956 1.00 14.22  ? 470  LEU A N     1 
ATOM   3634  C  CA    . LEU A  1  470  ? 34.292  -119.424 149.492 1.00 16.83  ? 470  LEU A CA    1 
ATOM   3635  C  C     . LEU A  1  470  ? 34.892  -120.150 150.667 1.00 15.39  ? 470  LEU A C     1 
ATOM   3636  O  O     . LEU A  1  470  ? 34.913  -119.618 151.763 1.00 16.34  ? 470  LEU A O     1 
ATOM   3637  C  CB    . LEU A  1  470  ? 35.381  -118.855 148.577 1.00 19.56  ? 470  LEU A CB    1 
ATOM   3638  C  CG    . LEU A  1  470  ? 36.161  -117.620 149.022 1.00 21.99  ? 470  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A  1  470  ? 37.048  -117.171 147.881 1.00 23.27  ? 470  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A  1  470  ? 35.209  -116.488 149.392 1.00 26.62  ? 470  LEU A CD2   1 
ATOM   3641  N  N     . ASN A  1  471  ? 35.347  -121.374 150.428 1.00 14.82  ? 471  ASN A N     1 
ATOM   3642  C  CA    . ASN A  1  471  ? 35.932  -122.227 151.454 1.00 16.10  ? 471  ASN A CA    1 
ATOM   3643  C  C     . ASN A  1  471  ? 37.285  -121.664 151.839 1.00 17.16  ? 471  ASN A C     1 
ATOM   3644  O  O     . ASN A  1  471  ? 38.070  -121.322 150.964 1.00 18.01  ? 471  ASN A O     1 
ATOM   3645  C  CB    . ASN A  1  471  ? 36.094  -123.640 150.897 1.00 17.17  ? 471  ASN A CB    1 
ATOM   3646  C  CG    . ASN A  1  471  ? 36.679  -124.600 151.901 1.00 19.24  ? 471  ASN A CG    1 
ATOM   3647  O  OD1   . ASN A  1  471  ? 37.740  -124.359 152.481 1.00 18.91  ? 471  ASN A OD1   1 
ATOM   3648  N  ND2   . ASN A  1  471  ? 35.986  -125.707 152.111 1.00 20.16  ? 471  ASN A ND2   1 
ATOM   3649  N  N     . LEU A  1  472  ? 37.583  -121.585 153.130 1.00 17.47  ? 472  LEU A N     1 
ATOM   3650  C  CA    . LEU A  1  472  ? 38.862  -121.006 153.549 1.00 19.03  ? 472  LEU A CA    1 
ATOM   3651  C  C     . LEU A  1  472  ? 40.133  -121.520 152.898 1.00 19.62  ? 472  LEU A C     1 
ATOM   3652  O  O     . LEU A  1  472  ? 41.073  -120.772 152.692 1.00 19.00  ? 472  LEU A O     1 
ATOM   3653  C  CB    . LEU A  1  472  ? 39.025  -121.141 155.045 1.00 21.11  ? 472  LEU A CB    1 
ATOM   3654  C  CG    . LEU A  1  472  ? 38.152  -120.198 155.849 1.00 22.99  ? 472  LEU A CG    1 
ATOM   3655  C  CD1   . LEU A  1  472  ? 37.776  -120.898 157.163 1.00 23.16  ? 472  LEU A CD1   1 
ATOM   3656  C  CD2   . LEU A  1  472  ? 38.892  -118.869 156.045 1.00 19.61  ? 472  LEU A CD2   1 
ATOM   3657  N  N     . SER A  1  473  ? 40.178  -122.799 152.579 1.00 21.23  ? 473  SER A N     1 
ATOM   3658  C  CA    . SER A  1  473  ? 41.383  -123.355 151.991 1.00 22.82  ? 473  SER A CA    1 
ATOM   3659  C  C     . SER A  1  473  ? 41.642  -123.002 150.522 1.00 23.50  ? 473  SER A C     1 
ATOM   3660  O  O     . SER A  1  473  ? 42.751  -123.200 150.032 1.00 24.72  ? 473  SER A O     1 
ATOM   3661  C  CB    . SER A  1  473  ? 41.383  -124.874 152.187 1.00 23.39  ? 473  SER A CB    1 
ATOM   3662  O  OG    . SER A  1  473  ? 41.412  -125.194 153.572 1.00 24.42  ? 473  SER A OG    1 
ATOM   3663  N  N     . VAL A  1  474  ? 40.639  -122.493 149.814 1.00 22.86  ? 474  VAL A N     1 
ATOM   3664  C  CA    . VAL A  1  474  ? 40.847  -122.118 148.422 1.00 24.22  ? 474  VAL A CA    1 
ATOM   3665  C  C     . VAL A  1  474  ? 41.241  -120.652 148.455 1.00 25.53  ? 474  VAL A C     1 
ATOM   3666  O  O     . VAL A  1  474  ? 41.328  -119.974 147.436 1.00 26.42  ? 474  VAL A O     1 
ATOM   3667  C  CB    . VAL A  1  474  ? 39.565  -122.301 147.575 1.00 24.16  ? 474  VAL A CB    1 
ATOM   3668  C  CG1   . VAL A  1  474  ? 38.636  -121.095 147.694 1.00 24.28  ? 474  VAL A CG1   1 
ATOM   3669  C  CG2   . VAL A  1  474  ? 39.945  -122.522 146.154 1.00 25.44  ? 474  VAL A CG2   1 
ATOM   3670  N  N     . THR A  1  475  ? 41.495  -120.193 149.669 1.00 26.81  ? 475  THR A N     1 
ATOM   3671  C  CA    . THR A  1  475  ? 41.873  -118.825 149.964 1.00 27.87  ? 475  THR A CA    1 
ATOM   3672  C  C     . THR A  1  475  ? 43.227  -118.437 149.371 1.00 30.22  ? 475  THR A C     1 
ATOM   3673  O  O     . THR A  1  475  ? 43.343  -117.415 148.696 1.00 30.86  ? 475  THR A O     1 
ATOM   3674  C  CB    . THR A  1  475  ? 41.894  -118.631 151.507 1.00 28.46  ? 475  THR A CB    1 
ATOM   3675  O  OG1   . THR A  1  475  ? 41.377  -117.340 151.835 1.00 28.05  ? 475  THR A OG1   1 
ATOM   3676  C  CG2   . THR A  1  475  ? 43.320  -118.818 152.088 1.00 27.18  ? 475  THR A CG2   1 
ATOM   3677  N  N     . SER A  1  476  ? 44.242  -119.263 149.618 1.00 32.00  ? 476  SER A N     1 
ATOM   3678  C  CA    . SER A  1  476  ? 45.603  -119.013 149.145 1.00 33.09  ? 476  SER A CA    1 
ATOM   3679  C  C     . SER A  1  476  ? 45.716  -118.886 147.644 1.00 33.35  ? 476  SER A C     1 
ATOM   3680  O  O     . SER A  1  476  ? 46.192  -117.886 147.151 1.00 34.82  ? 476  SER A O     1 
ATOM   3681  C  CB    . SER A  1  476  ? 46.543  -120.118 149.616 1.00 34.30  ? 476  SER A CB    1 
ATOM   3682  O  OG    . SER A  1  476  ? 46.211  -120.520 150.931 1.00 37.86  ? 476  SER A OG    1 
ATOM   3683  N  N     . PRO A  1  477  ? 45.274  -119.895 146.890 1.00 33.67  ? 477  PRO A N     1 
ATOM   3684  C  CA    . PRO A  1  477  ? 45.367  -119.816 145.432 1.00 33.83  ? 477  PRO A CA    1 
ATOM   3685  C  C     . PRO A  1  477  ? 44.998  -118.468 144.830 1.00 34.10  ? 477  PRO A C     1 
ATOM   3686  O  O     . PRO A  1  477  ? 45.712  -117.977 143.964 1.00 34.36  ? 477  PRO A O     1 
ATOM   3687  C  CB    . PRO A  1  477  ? 44.427  -120.918 144.965 1.00 34.49  ? 477  PRO A CB    1 
ATOM   3688  C  CG    . PRO A  1  477  ? 44.562  -121.927 146.034 1.00 35.70  ? 477  PRO A CG    1 
ATOM   3689  C  CD    . PRO A  1  477  ? 44.516  -121.088 147.291 1.00 34.77  ? 477  PRO A CD    1 
ATOM   3690  N  N     . TYR A  1  478  ? 43.890  -117.872 145.274 1.00 34.72  ? 478  TYR A N     1 
ATOM   3691  C  CA    . TYR A  1  478  ? 43.443  -116.573 144.741 1.00 35.32  ? 478  TYR A CA    1 
ATOM   3692  C  C     . TYR A  1  478  ? 44.216  -115.426 145.368 1.00 36.24  ? 478  TYR A C     1 
ATOM   3693  O  O     . TYR A  1  478  ? 44.472  -114.386 144.736 1.00 34.69  ? 478  TYR A O     1 
ATOM   3694  C  CB    . TYR A  1  478  ? 41.954  -116.358 145.016 1.00 33.37  ? 478  TYR A CB    1 
ATOM   3695  C  CG    . TYR A  1  478  ? 41.055  -117.388 144.399 1.00 31.70  ? 478  TYR A CG    1 
ATOM   3696  C  CD1   . TYR A  1  478  ? 40.427  -118.343 145.192 1.00 30.20  ? 478  TYR A CD1   1 
ATOM   3697  C  CD2   . TYR A  1  478  ? 40.847  -117.423 143.014 1.00 31.21  ? 478  TYR A CD2   1 
ATOM   3698  C  CE1   . TYR A  1  478  ? 39.613  -119.316 144.632 1.00 30.75  ? 478  TYR A CE1   1 
ATOM   3699  C  CE2   . TYR A  1  478  ? 40.036  -118.392 142.436 1.00 30.76  ? 478  TYR A CE2   1 
ATOM   3700  C  CZ    . TYR A  1  478  ? 39.422  -119.340 143.254 1.00 31.14  ? 478  TYR A CZ    1 
ATOM   3701  O  OH    . TYR A  1  478  ? 38.643  -120.329 142.706 1.00 28.92  ? 478  TYR A OH    1 
ATOM   3702  N  N     . ASN A  1  479  ? 44.579  -115.653 146.624 1.00 37.37  ? 479  ASN A N     1 
ATOM   3703  C  CA    . ASN A  1  479  ? 45.313  -114.705 147.437 1.00 40.54  ? 479  ASN A CA    1 
ATOM   3704  C  C     . ASN A  1  479  ? 44.308  -113.709 147.957 1.00 42.77  ? 479  ASN A C     1 
ATOM   3705  O  O     . ASN A  1  479  ? 44.520  -112.493 147.895 1.00 44.26  ? 479  ASN A O     1 
ATOM   3706  C  CB    . ASN A  1  479  ? 46.387  -113.975 146.633 1.00 41.19  ? 479  ASN A CB    1 
ATOM   3707  C  CG    . ASN A  1  479  ? 47.377  -113.250 147.526 1.00 42.50  ? 479  ASN A CG    1 
ATOM   3708  O  OD1   . ASN A  1  479  ? 48.323  -112.636 147.040 1.00 44.08  ? 479  ASN A OD1   1 
ATOM   3709  N  ND2   . ASN A  1  479  ? 47.166  -113.324 148.843 1.00 42.02  ? 479  ASN A ND2   1 
ATOM   3710  N  N     . ALA A  1  480  ? 43.203  -114.229 148.469 1.00 43.21  ? 480  ALA A N     1 
ATOM   3711  C  CA    . ALA A  1  480  ? 42.180  -113.364 148.990 1.00 43.67  ? 480  ALA A CA    1 
ATOM   3712  C  C     . ALA A  1  480  ? 42.114  -113.431 150.492 1.00 45.38  ? 480  ALA A C     1 
ATOM   3713  O  O     . ALA A  1  480  ? 42.396  -114.452 151.106 1.00 44.37  ? 480  ALA A O     1 
ATOM   3714  C  CB    . ALA A  1  480  ? 40.862  -113.731 148.408 1.00 43.15  ? 480  ALA A CB    1 
ATOM   3715  N  N     . ASP A  1  481  ? 41.769  -112.295 151.072 1.00 48.95  ? 481  ASP A N     1 
ATOM   3716  C  CA    . ASP A  1  481  ? 41.595  -112.155 152.506 1.00 51.88  ? 481  ASP A CA    1 
ATOM   3717  C  C     . ASP A  1  481  ? 40.225  -111.518 152.505 1.00 51.08  ? 481  ASP A C     1 
ATOM   3718  O  O     . ASP A  1  481  ? 39.665  -111.235 151.434 1.00 50.74  ? 481  ASP A O     1 
ATOM   3719  C  CB    . ASP A  1  481  ? 42.626  -111.193 153.113 1.00 57.67  ? 481  ASP A CB    1 
ATOM   3720  C  CG    . ASP A  1  481  ? 43.755  -110.848 152.140 1.00 64.74  ? 481  ASP A CG    1 
ATOM   3721  O  OD1   . ASP A  1  481  ? 44.195  -111.753 151.385 1.00 68.49  ? 481  ASP A OD1   1 
ATOM   3722  O  OD2   . ASP A  1  481  ? 44.209  -109.674 152.141 1.00 68.38  ? 481  ASP A OD2   1 
ATOM   3723  N  N     . PHE A  1  482  ? 39.672  -111.272 153.677 1.00 48.64  ? 482  PHE A N     1 
ATOM   3724  C  CA    . PHE A  1  482  ? 38.358  -110.688 153.682 1.00 45.86  ? 482  PHE A CA    1 
ATOM   3725  C  C     . PHE A  1  482  ? 38.328  -109.237 154.108 1.00 45.78  ? 482  PHE A C     1 
ATOM   3726  O  O     . PHE A  1  482  ? 37.311  -108.737 154.566 1.00 45.41  ? 482  PHE A O     1 
ATOM   3727  C  CB    . PHE A  1  482  ? 37.449  -111.582 154.498 1.00 43.30  ? 482  PHE A CB    1 
ATOM   3728  C  CG    . PHE A  1  482  ? 37.454  -113.007 154.007 1.00 41.23  ? 482  PHE A CG    1 
ATOM   3729  C  CD1   . PHE A  1  482  ? 37.783  -114.058 154.847 1.00 40.44  ? 482  PHE A CD1   1 
ATOM   3730  C  CD2   . PHE A  1  482  ? 37.194  -113.288 152.667 1.00 40.76  ? 482  PHE A CD2   1 
ATOM   3731  C  CE1   . PHE A  1  482  ? 37.857  -115.362 154.358 1.00 39.31  ? 482  PHE A CE1   1 
ATOM   3732  C  CE2   . PHE A  1  482  ? 37.266  -114.591 152.171 1.00 38.83  ? 482  PHE A CE2   1 
ATOM   3733  C  CZ    . PHE A  1  482  ? 37.600  -115.625 153.017 1.00 38.36  ? 482  PHE A CZ    1 
ATOM   3734  N  N     . ASP A  1  483  ? 39.460  -108.559 153.913 1.00 46.42  ? 483  ASP A N     1 
ATOM   3735  C  CA    . ASP A  1  483  ? 39.567  -107.143 154.217 1.00 45.85  ? 483  ASP A CA    1 
ATOM   3736  C  C     . ASP A  1  483  ? 38.590  -106.379 153.315 1.00 44.64  ? 483  ASP A C     1 
ATOM   3737  O  O     . ASP A  1  483  ? 38.398  -105.181 153.461 1.00 45.08  ? 483  ASP A O     1 
ATOM   3738  C  CB    . ASP A  1  483  ? 41.032  -106.613 154.048 1.00 49.42  ? 483  ASP A CB    1 
ATOM   3739  C  CG    . ASP A  1  483  ? 41.741  -107.079 152.735 1.00 52.10  ? 483  ASP A CG    1 
ATOM   3740  O  OD1   . ASP A  1  483  ? 42.728  -106.417 152.309 1.00 52.87  ? 483  ASP A OD1   1 
ATOM   3741  O  OD2   . ASP A  1  483  ? 41.353  -108.110 152.146 1.00 53.18  ? 483  ASP A OD2   1 
ATOM   3742  N  N     . GLY A  1  484  ? 37.947  -107.085 152.393 1.00 43.33  ? 484  GLY A N     1 
ATOM   3743  C  CA    . GLY A  1  484  ? 37.003  -106.429 151.517 1.00 41.07  ? 484  GLY A CA    1 
ATOM   3744  C  C     . GLY A  1  484  ? 37.258  -106.755 150.079 1.00 39.95  ? 484  GLY A C     1 
ATOM   3745  O  O     . GLY A  1  484  ? 36.657  -106.183 149.181 1.00 39.56  ? 484  GLY A O     1 
ATOM   3746  N  N     . ASP A  1  485  ? 38.154  -107.689 149.852 1.00 40.64  ? 485  ASP A N     1 
ATOM   3747  C  CA    . ASP A  1  485  ? 38.455  -108.042 148.485 1.00 42.09  ? 485  ASP A CA    1 
ATOM   3748  C  C     . ASP A  1  485  ? 37.168  -108.392 147.755 1.00 40.00  ? 485  ASP A C     1 
ATOM   3749  O  O     . ASP A  1  485  ? 36.188  -108.839 148.359 1.00 40.90  ? 485  ASP A O     1 
ATOM   3750  C  CB    . ASP A  1  485  ? 39.421  -109.231 148.429 1.00 45.85  ? 485  ASP A CB    1 
ATOM   3751  C  CG    . ASP A  1  485  ? 40.792  -108.909 149.025 1.00 50.58  ? 485  ASP A CG    1 
ATOM   3752  O  OD1   . ASP A  1  485  ? 41.308  -107.778 148.817 1.00 52.56  ? 485  ASP A OD1   1 
ATOM   3753  O  OD2   . ASP A  1  485  ? 41.357  -109.802 149.698 1.00 51.90  ? 485  ASP A OD2   1 
ATOM   3754  N  N     . GLU A  1  486  ? 37.180  -108.163 146.453 1.00 36.16  ? 486  GLU A N     1 
ATOM   3755  C  CA    . GLU A  1  486  ? 36.052  -108.480 145.611 1.00 33.42  ? 486  GLU A CA    1 
ATOM   3756  C  C     . GLU A  1  486  ? 36.515  -109.583 144.661 1.00 29.94  ? 486  GLU A C     1 
ATOM   3757  O  O     . GLU A  1  486  ? 37.703  -109.719 144.400 1.00 30.25  ? 486  GLU A O     1 
ATOM   3758  C  CB    . GLU A  1  486  ? 35.653  -107.245 144.826 1.00 35.60  ? 486  GLU A CB    1 
ATOM   3759  C  CG    . GLU A  1  486  ? 34.342  -106.643 145.236 1.00 40.70  ? 486  GLU A CG    1 
ATOM   3760  C  CD    . GLU A  1  486  ? 34.298  -105.149 144.964 1.00 44.86  ? 486  GLU A CD    1 
ATOM   3761  O  OE1   . GLU A  1  486  ? 34.900  -104.392 145.763 1.00 46.88  ? 486  GLU A OE1   1 
ATOM   3762  O  OE2   . GLU A  1  486  ? 33.674  -104.732 143.955 1.00 46.63  ? 486  GLU A OE2   1 
ATOM   3763  N  N     . MET A  1  487  ? 35.595  -110.387 144.154 1.00 25.46  ? 487  MET A N     1 
ATOM   3764  C  CA    . MET A  1  487  ? 35.979  -111.444 143.233 1.00 23.45  ? 487  MET A CA    1 
ATOM   3765  C  C     . MET A  1  487  ? 35.018  -111.455 142.065 1.00 24.31  ? 487  MET A C     1 
ATOM   3766  O  O     . MET A  1  487  ? 33.842  -111.151 142.233 1.00 24.79  ? 487  MET A O     1 
ATOM   3767  C  CB    . MET A  1  487  ? 35.922  -112.795 143.920 1.00 22.54  ? 487  MET A CB    1 
ATOM   3768  C  CG    . MET A  1  487  ? 36.833  -112.916 145.100 1.00 20.79  ? 487  MET A CG    1 
ATOM   3769  S  SD    . MET A  1  487  ? 38.266  -113.848 144.739 1.00 21.41  ? 487  MET A SD    1 
ATOM   3770  C  CE    . MET A  1  487  ? 37.689  -115.464 144.863 1.00 18.46  ? 487  MET A CE    1 
ATOM   3771  N  N     . ASN A  1  488  ? 35.511  -111.804 140.883 1.00 23.16  ? 488  ASN A N     1 
ATOM   3772  C  CA    . ASN A  1  488  ? 34.654  -111.861 139.715 1.00 22.79  ? 488  ASN A CA    1 
ATOM   3773  C  C     . ASN A  1  488  ? 34.199  -113.278 139.502 1.00 23.16  ? 488  ASN A C     1 
ATOM   3774  O  O     . ASN A  1  488  ? 34.804  -114.222 140.015 1.00 24.20  ? 488  ASN A O     1 
ATOM   3775  C  CB    . ASN A  1  488  ? 35.390  -111.421 138.474 1.00 25.78  ? 488  ASN A CB    1 
ATOM   3776  C  CG    . ASN A  1  488  ? 35.778  -109.983 138.521 1.00 29.64  ? 488  ASN A CG    1 
ATOM   3777  O  OD1   . ASN A  1  488  ? 35.441  -109.265 139.477 1.00 29.92  ? 488  ASN A OD1   1 
ATOM   3778  N  ND2   . ASN A  1  488  ? 36.493  -109.530 137.481 1.00 32.86  ? 488  ASN A ND2   1 
ATOM   3779  N  N     . LEU A  1  489  ? 33.138  -113.426 138.719 1.00 22.80  ? 489  LEU A N     1 
ATOM   3780  C  CA    . LEU A  1  489  ? 32.566  -114.730 138.415 1.00 21.31  ? 489  LEU A CA    1 
ATOM   3781  C  C     . LEU A  1  489  ? 32.000  -114.686 136.994 1.00 20.52  ? 489  LEU A C     1 
ATOM   3782  O  O     . LEU A  1  489  ? 31.302  -113.744 136.629 1.00 21.10  ? 489  LEU A O     1 
ATOM   3783  C  CB    . LEU A  1  489  ? 31.489  -115.052 139.467 1.00 20.41  ? 489  LEU A CB    1 
ATOM   3784  C  CG    . LEU A  1  489  ? 30.253  -115.912 139.192 1.00 20.99  ? 489  LEU A CG    1 
ATOM   3785  C  CD1   . LEU A  1  489  ? 30.582  -117.042 138.256 1.00 22.09  ? 489  LEU A CD1   1 
ATOM   3786  C  CD2   . LEU A  1  489  ? 29.717  -116.455 140.502 1.00 18.92  ? 489  LEU A CD2   1 
ATOM   3787  N  N     . HIS A  1  490  ? 32.329  -115.691 136.185 1.00 20.15  ? 490  HIS A N     1 
ATOM   3788  C  CA    . HIS A  1  490  ? 31.850  -115.768 134.797 1.00 20.59  ? 490  HIS A CA    1 
ATOM   3789  C  C     . HIS A  1  490  ? 31.050  -117.044 134.581 1.00 20.78  ? 490  HIS A C     1 
ATOM   3790  O  O     . HIS A  1  490  ? 31.518  -118.117 134.909 1.00 23.52  ? 490  HIS A O     1 
ATOM   3791  C  CB    . HIS A  1  490  ? 33.037  -115.747 133.835 1.00 17.27  ? 490  HIS A CB    1 
ATOM   3792  C  CG    . HIS A  1  490  ? 33.940  -114.576 134.038 1.00 17.25  ? 490  HIS A CG    1 
ATOM   3793  N  ND1   . HIS A  1  490  ? 33.761  -113.376 133.387 1.00 16.50  ? 490  HIS A ND1   1 
ATOM   3794  C  CD2   . HIS A  1  490  ? 35.001  -114.402 134.864 1.00 16.99  ? 490  HIS A CD2   1 
ATOM   3795  C  CE1   . HIS A  1  490  ? 34.676  -112.515 133.802 1.00 17.08  ? 490  HIS A CE1   1 
ATOM   3796  N  NE2   . HIS A  1  490  ? 35.442  -113.112 134.699 1.00 15.47  ? 490  HIS A NE2   1 
ATOM   3797  N  N     . VAL A  1  491  ? 29.848  -116.945 134.039 1.00 19.57  ? 491  VAL A N     1 
ATOM   3798  C  CA    . VAL A  1  491  ? 29.072  -118.146 133.816 1.00 19.49  ? 491  VAL A CA    1 
ATOM   3799  C  C     . VAL A  1  491  ? 29.201  -118.644 132.392 1.00 21.39  ? 491  VAL A C     1 
ATOM   3800  O  O     . VAL A  1  491  ? 28.846  -117.946 131.453 1.00 22.58  ? 491  VAL A O     1 
ATOM   3801  C  CB    . VAL A  1  491  ? 27.634  -117.907 134.081 1.00 19.32  ? 491  VAL A CB    1 
ATOM   3802  C  CG1   . VAL A  1  491  ? 26.886  -119.203 133.898 1.00 18.20  ? 491  VAL A CG1   1 
ATOM   3803  C  CG2   . VAL A  1  491  ? 27.472  -117.331 135.472 1.00 18.54  ? 491  VAL A CG2   1 
ATOM   3804  N  N     . PRO A  1  492  ? 29.686  -119.879 132.217 1.00 22.53  ? 492  PRO A N     1 
ATOM   3805  C  CA    . PRO A  1  492  ? 29.885  -120.515 130.909 1.00 22.77  ? 492  PRO A CA    1 
ATOM   3806  C  C     . PRO A  1  492  ? 28.542  -120.604 130.209 1.00 24.16  ? 492  PRO A C     1 
ATOM   3807  O  O     . PRO A  1  492  ? 27.521  -120.774 130.862 1.00 24.75  ? 492  PRO A O     1 
ATOM   3808  C  CB    . PRO A  1  492  ? 30.442  -121.873 131.284 1.00 21.54  ? 492  PRO A CB    1 
ATOM   3809  C  CG    . PRO A  1  492  ? 29.659  -122.185 132.512 1.00 24.20  ? 492  PRO A CG    1 
ATOM   3810  C  CD    . PRO A  1  492  ? 29.698  -120.887 133.290 1.00 22.68  ? 492  PRO A CD    1 
ATOM   3811  N  N     . GLN A  1  493  ? 28.533  -120.501 128.887 1.00 25.77  ? 493  GLN A N     1 
ATOM   3812  C  CA    . GLN A  1  493  ? 27.275  -120.523 128.143 1.00 27.10  ? 493  GLN A CA    1 
ATOM   3813  C  C     . GLN A  1  493  ? 26.959  -121.778 127.309 1.00 28.82  ? 493  GLN A C     1 
ATOM   3814  O  O     . GLN A  1  493  ? 25.798  -122.092 127.057 1.00 28.55  ? 493  GLN A O     1 
ATOM   3815  C  CB    . GLN A  1  493  ? 27.225  -119.284 127.249 1.00 26.14  ? 493  GLN A CB    1 
ATOM   3816  C  CG    . GLN A  1  493  ? 26.065  -118.377 127.502 1.00 26.68  ? 493  GLN A CG    1 
ATOM   3817  C  CD    . GLN A  1  493  ? 25.926  -118.029 128.960 1.00 29.57  ? 493  GLN A CD    1 
ATOM   3818  O  OE1   . GLN A  1  493  ? 24.916  -117.476 129.365 1.00 34.15  ? 493  GLN A OE1   1 
ATOM   3819  N  NE2   . GLN A  1  493  ? 26.934  -118.348 129.759 1.00 28.82  ? 493  GLN A NE2   1 
ATOM   3820  N  N     . SER A  1  494  ? 27.982  -122.506 126.887 1.00 30.75  ? 494  SER A N     1 
ATOM   3821  C  CA    . SER A  1  494  ? 27.750  -123.688 126.070 1.00 31.74  ? 494  SER A CA    1 
ATOM   3822  C  C     . SER A  1  494  ? 27.831  -124.965 126.878 1.00 31.15  ? 494  SER A C     1 
ATOM   3823  O  O     . SER A  1  494  ? 28.320  -124.975 127.999 1.00 31.57  ? 494  SER A O     1 
ATOM   3824  C  CB    . SER A  1  494  ? 28.775  -123.730 124.925 1.00 34.13  ? 494  SER A CB    1 
ATOM   3825  O  OG    . SER A  1  494  ? 28.539  -124.809 124.029 1.00 37.37  ? 494  SER A OG    1 
ATOM   3826  N  N     . GLU A  1  495  ? 27.349  -126.049 126.291 1.00 31.29  ? 495  GLU A N     1 
ATOM   3827  C  CA    . GLU A  1  495  ? 27.384  -127.350 126.938 1.00 30.77  ? 495  GLU A CA    1 
ATOM   3828  C  C     . GLU A  1  495  ? 28.839  -127.793 127.067 1.00 29.52  ? 495  GLU A C     1 
ATOM   3829  O  O     . GLU A  1  495  ? 29.214  -128.489 128.004 1.00 29.04  ? 495  GLU A O     1 
ATOM   3830  C  CB    . GLU A  1  495  ? 26.599  -128.360 126.100 1.00 32.00  ? 495  GLU A CB    1 
ATOM   3831  C  CG    . GLU A  1  495  ? 26.264  -129.625 126.831 1.00 33.91  ? 495  GLU A CG    1 
ATOM   3832  C  CD    . GLU A  1  495  ? 25.654  -129.336 128.183 1.00 36.99  ? 495  GLU A CD    1 
ATOM   3833  O  OE1   . GLU A  1  495  ? 24.578  -128.693 128.212 1.00 37.39  ? 495  GLU A OE1   1 
ATOM   3834  O  OE2   . GLU A  1  495  ? 26.254  -129.743 129.214 1.00 38.87  ? 495  GLU A OE2   1 
ATOM   3835  N  N     . GLU A  1  496  ? 29.661  -127.375 126.118 1.00 29.68  ? 496  GLU A N     1 
ATOM   3836  C  CA    . GLU A  1  496  ? 31.067  -127.735 126.131 1.00 30.40  ? 496  GLU A CA    1 
ATOM   3837  C  C     . GLU A  1  496  ? 31.893  -126.770 126.935 1.00 28.29  ? 496  GLU A C     1 
ATOM   3838  O  O     . GLU A  1  496  ? 32.891  -127.140 127.534 1.00 29.70  ? 496  GLU A O     1 
ATOM   3839  C  CB    . GLU A  1  496  ? 31.601  -127.787 124.718 1.00 32.45  ? 496  GLU A CB    1 
ATOM   3840  C  CG    . GLU A  1  496  ? 31.156  -126.664 123.868 1.00 36.19  ? 496  GLU A CG    1 
ATOM   3841  C  CD    . GLU A  1  496  ? 31.686  -126.827 122.480 1.00 41.05  ? 496  GLU A CD    1 
ATOM   3842  O  OE1   . GLU A  1  496  ? 31.011  -126.349 121.536 1.00 44.23  ? 496  GLU A OE1   1 
ATOM   3843  O  OE2   . GLU A  1  496  ? 32.779  -127.437 122.343 1.00 41.39  ? 496  GLU A OE2   1 
ATOM   3844  N  N     . THR A  1  497  ? 31.486  -125.518 126.918 1.00 26.11  ? 497  THR A N     1 
ATOM   3845  C  CA    . THR A  1  497  ? 32.175  -124.508 127.676 1.00 25.62  ? 497  THR A CA    1 
ATOM   3846  C  C     . THR A  1  497  ? 32.226  -124.987 129.131 1.00 25.58  ? 497  THR A C     1 
ATOM   3847  O  O     . THR A  1  497  ? 33.285  -125.003 129.765 1.00 25.84  ? 497  THR A O     1 
ATOM   3848  C  CB    . THR A  1  497  ? 31.403  -123.185 127.605 1.00 26.53  ? 497  THR A CB    1 
ATOM   3849  O  OG1   . THR A  1  497  ? 31.564  -122.607 126.314 1.00 28.27  ? 497  THR A OG1   1 
ATOM   3850  C  CG2   . THR A  1  497  ? 31.904  -122.213 128.619 1.00 29.70  ? 497  THR A CG2   1 
ATOM   3851  N  N     . ARG A  1  498  ? 31.079  -125.391 129.662 1.00 23.47  ? 498  ARG A N     1 
ATOM   3852  C  CA    . ARG A  1  498  ? 31.042  -125.833 131.038 1.00 21.91  ? 498  ARG A CA    1 
ATOM   3853  C  C     . ARG A  1  498  ? 31.821  -127.126 131.217 1.00 20.83  ? 498  ARG A C     1 
ATOM   3854  O  O     . ARG A  1  498  ? 32.430  -127.359 132.268 1.00 21.83  ? 498  ARG A O     1 
ATOM   3855  C  CB    . ARG A  1  498  ? 29.600  -126.001 131.506 1.00 22.11  ? 498  ARG A CB    1 
ATOM   3856  C  CG    . ARG A  1  498  ? 28.752  -126.838 130.601 1.00 24.82  ? 498  ARG A CG    1 
ATOM   3857  C  CD    . ARG A  1  498  ? 27.548  -127.328 131.351 1.00 26.28  ? 498  ARG A CD    1 
ATOM   3858  N  NE    . ARG A  1  498  ? 26.901  -126.223 132.040 1.00 28.15  ? 498  ARG A NE    1 
ATOM   3859  C  CZ    . ARG A  1  498  ? 26.130  -126.377 133.110 1.00 29.15  ? 498  ARG A CZ    1 
ATOM   3860  N  NH1   . ARG A  1  498  ? 25.923  -127.598 133.598 1.00 27.26  ? 498  ARG A NH1   1 
ATOM   3861  N  NH2   . ARG A  1  498  ? 25.582  -125.315 133.698 1.00 29.27  ? 498  ARG A NH2   1 
ATOM   3862  N  N     . ALA A  1  499  ? 31.815  -127.969 130.192 1.00 18.61  ? 499  ALA A N     1 
ATOM   3863  C  CA    . ALA A  1  499  ? 32.550  -129.217 130.279 1.00 16.34  ? 499  ALA A CA    1 
ATOM   3864  C  C     . ALA A  1  499  ? 34.003  -128.839 130.506 1.00 16.14  ? 499  ALA A C     1 
ATOM   3865  O  O     . ALA A  1  499  ? 34.666  -129.405 131.364 1.00 15.99  ? 499  ALA A O     1 
ATOM   3866  C  CB    . ALA A  1  499  ? 32.408  -130.018 128.998 1.00 14.87  ? 499  ALA A CB    1 
ATOM   3867  N  N     . GLU A  1  500  ? 34.494  -127.856 129.754 1.00 16.46  ? 500  GLU A N     1 
ATOM   3868  C  CA    . GLU A  1  500  ? 35.879  -127.444 129.893 1.00 16.23  ? 500  GLU A CA    1 
ATOM   3869  C  C     . GLU A  1  500  ? 36.198  -126.980 131.281 1.00 16.51  ? 500  GLU A C     1 
ATOM   3870  O  O     . GLU A  1  500  ? 37.319  -127.149 131.747 1.00 18.36  ? 500  GLU A O     1 
ATOM   3871  C  CB    . GLU A  1  500  ? 36.233  -126.347 128.911 1.00 16.72  ? 500  GLU A CB    1 
ATOM   3872  C  CG    . GLU A  1  500  ? 36.707  -126.891 127.595 1.00 21.91  ? 500  GLU A CG    1 
ATOM   3873  C  CD    . GLU A  1  500  ? 37.163  -125.800 126.641 1.00 26.37  ? 500  GLU A CD    1 
ATOM   3874  O  OE1   . GLU A  1  500  ? 37.853  -124.847 127.095 1.00 26.46  ? 500  GLU A OE1   1 
ATOM   3875  O  OE2   . GLU A  1  500  ? 36.837  -125.910 125.434 1.00 27.88  ? 500  GLU A OE2   1 
ATOM   3876  N  N     . LEU A  1  501  ? 35.220  -126.397 131.956 1.00 15.90  ? 501  LEU A N     1 
ATOM   3877  C  CA    . LEU A  1  501  ? 35.465  -125.928 133.298 1.00 14.26  ? 501  LEU A CA    1 
ATOM   3878  C  C     . LEU A  1  501  ? 35.495  -127.105 134.260 1.00 14.45  ? 501  LEU A C     1 
ATOM   3879  O  O     . LEU A  1  501  ? 36.483  -127.323 134.972 1.00 15.41  ? 501  LEU A O     1 
ATOM   3880  C  CB    . LEU A  1  501  ? 34.382  -124.944 133.720 1.00 13.99  ? 501  LEU A CB    1 
ATOM   3881  C  CG    . LEU A  1  501  ? 34.167  -123.725 132.831 1.00 14.98  ? 501  LEU A CG    1 
ATOM   3882  C  CD1   . LEU A  1  501  ? 33.196  -122.772 133.504 1.00 15.83  ? 501  LEU A CD1   1 
ATOM   3883  C  CD2   . LEU A  1  501  ? 35.479  -123.025 132.606 1.00 16.36  ? 501  LEU A CD2   1 
ATOM   3884  N  N     . SER A  1  502  ? 34.418  -127.879 134.272 1.00 13.18  ? 502  SER A N     1 
ATOM   3885  C  CA    . SER A  1  502  ? 34.337  -128.994 135.190 1.00 13.10  ? 502  SER A CA    1 
ATOM   3886  C  C     . SER A  1  502  ? 35.448  -130.002 135.036 1.00 14.27  ? 502  SER A C     1 
ATOM   3887  O  O     . SER A  1  502  ? 35.963  -130.502 136.016 1.00 14.79  ? 502  SER A O     1 
ATOM   3888  C  CB    . SER A  1  502  ? 32.989  -129.688 135.051 1.00 13.01  ? 502  SER A CB    1 
ATOM   3889  O  OG    . SER A  1  502  ? 32.790  -130.189 133.747 1.00 14.54  ? 502  SER A OG    1 
ATOM   3890  N  N     . GLN A  1  503  ? 35.826  -130.284 133.797 1.00 17.19  ? 503  GLN A N     1 
ATOM   3891  C  CA    . GLN A  1  503  ? 36.871  -131.266 133.490 1.00 18.59  ? 503  GLN A CA    1 
ATOM   3892  C  C     . GLN A  1  503  ? 38.319  -130.792 133.570 1.00 19.52  ? 503  GLN A C     1 
ATOM   3893  O  O     . GLN A  1  503  ? 39.190  -131.547 133.977 1.00 19.20  ? 503  GLN A O     1 
ATOM   3894  C  CB    . GLN A  1  503  ? 36.643  -131.849 132.092 1.00 19.21  ? 503  GLN A CB    1 
ATOM   3895  C  CG    . GLN A  1  503  ? 35.469  -132.794 131.987 1.00 21.69  ? 503  GLN A CG    1 
ATOM   3896  C  CD    . GLN A  1  503  ? 34.990  -133.269 133.342 1.00 22.67  ? 503  GLN A CD    1 
ATOM   3897  O  OE1   . GLN A  1  503  ? 34.280  -132.547 134.047 1.00 21.60  ? 503  GLN A OE1   1 
ATOM   3898  N  NE2   . GLN A  1  503  ? 35.386  -134.482 133.723 1.00 23.64  ? 503  GLN A NE2   1 
ATOM   3899  N  N     . LEU A  1  504  ? 38.584  -129.554 133.165 1.00 20.82  ? 504  LEU A N     1 
ATOM   3900  C  CA    . LEU A  1  504  ? 39.937  -129.037 133.189 1.00 19.77  ? 504  LEU A CA    1 
ATOM   3901  C  C     . LEU A  1  504  ? 40.315  -128.177 134.387 1.00 22.42  ? 504  LEU A C     1 
ATOM   3902  O  O     . LEU A  1  504  ? 41.360  -128.410 134.997 1.00 26.14  ? 504  LEU A O     1 
ATOM   3903  C  CB    . LEU A  1  504  ? 40.214  -128.267 131.904 1.00 17.29  ? 504  LEU A CB    1 
ATOM   3904  C  CG    . LEU A  1  504  ? 40.734  -129.131 130.758 1.00 17.50  ? 504  LEU A CG    1 
ATOM   3905  C  CD1   . LEU A  1  504  ? 40.142  -130.516 130.819 1.00 17.21  ? 504  LEU A CD1   1 
ATOM   3906  C  CD2   . LEU A  1  504  ? 40.399  -128.474 129.453 1.00 16.42  ? 504  LEU A CD2   1 
ATOM   3907  N  N     . CYS A  1  505  ? 39.478  -127.216 134.766 1.00 21.86  ? 505  CYS A N     1 
ATOM   3908  C  CA    . CYS A  1  505  ? 39.859  -126.327 135.855 1.00 21.05  ? 505  CYS A CA    1 
ATOM   3909  C  C     . CYS A  1  505  ? 39.034  -126.291 137.125 1.00 20.96  ? 505  CYS A C     1 
ATOM   3910  O  O     . CYS A  1  505  ? 38.817  -125.236 137.705 1.00 21.54  ? 505  CYS A O     1 
ATOM   3911  C  CB    . CYS A  1  505  ? 39.994  -124.908 135.296 1.00 21.83  ? 505  CYS A CB    1 
ATOM   3912  S  SG    . CYS A  1  505  ? 39.067  -124.591 133.734 1.00 28.71  ? 505  CYS A SG    1 
ATOM   3913  N  N     . ALA A  1  506  ? 38.565  -127.432 137.579 1.00 21.28  ? 506  ALA A N     1 
ATOM   3914  C  CA    . ALA A  1  506  ? 37.799  -127.429 138.811 1.00 21.24  ? 506  ALA A CA    1 
ATOM   3915  C  C     . ALA A  1  506  ? 38.744  -127.410 140.024 1.00 20.99  ? 506  ALA A C     1 
ATOM   3916  O  O     . ALA A  1  506  ? 39.734  -128.138 140.068 1.00 20.53  ? 506  ALA A O     1 
ATOM   3917  C  CB    . ALA A  1  506  ? 36.922  -128.646 138.859 1.00 22.82  ? 506  ALA A CB    1 
ATOM   3918  N  N     . VAL A  1  507  ? 38.426  -126.593 141.020 1.00 20.55  ? 507  VAL A N     1 
ATOM   3919  C  CA    . VAL A  1  507  ? 39.258  -126.497 142.222 1.00 19.84  ? 507  VAL A CA    1 
ATOM   3920  C  C     . VAL A  1  507  ? 39.867  -127.791 142.744 1.00 20.22  ? 507  VAL A C     1 
ATOM   3921  O  O     . VAL A  1  507  ? 40.986  -127.782 143.254 1.00 22.40  ? 507  VAL A O     1 
ATOM   3922  C  CB    . VAL A  1  507  ? 38.495  -125.827 143.360 1.00 18.00  ? 507  VAL A CB    1 
ATOM   3923  C  CG1   . VAL A  1  507  ? 39.228  -125.992 144.689 1.00 16.10  ? 507  VAL A CG1   1 
ATOM   3924  C  CG2   . VAL A  1  507  ? 38.339  -124.380 143.024 1.00 17.65  ? 507  VAL A CG2   1 
ATOM   3925  N  N     . PRO A  1  508  ? 39.145  -128.914 142.651 1.00 19.08  ? 508  PRO A N     1 
ATOM   3926  C  CA    . PRO A  1  508  ? 39.771  -130.134 143.158 1.00 18.72  ? 508  PRO A CA    1 
ATOM   3927  C  C     . PRO A  1  508  ? 40.969  -130.528 142.293 1.00 18.71  ? 508  PRO A C     1 
ATOM   3928  O  O     . PRO A  1  508  ? 41.992  -130.964 142.823 1.00 18.86  ? 508  PRO A O     1 
ATOM   3929  C  CB    . PRO A  1  508  ? 38.647  -131.152 143.090 1.00 18.63  ? 508  PRO A CB    1 
ATOM   3930  C  CG    . PRO A  1  508  ? 37.434  -130.311 143.272 1.00 19.11  ? 508  PRO A CG    1 
ATOM   3931  C  CD    . PRO A  1  508  ? 37.714  -129.125 142.405 1.00 18.68  ? 508  PRO A CD    1 
ATOM   3932  N  N     . LEU A  1  509  ? 40.852  -130.373 140.971 1.00 17.10  ? 509  LEU A N     1 
ATOM   3933  C  CA    . LEU A  1  509  ? 41.963  -130.710 140.082 1.00 16.30  ? 509  LEU A CA    1 
ATOM   3934  C  C     . LEU A  1  509  ? 43.141  -129.827 140.405 1.00 19.26  ? 509  LEU A C     1 
ATOM   3935  O  O     . LEU A  1  509  ? 44.233  -130.323 140.629 1.00 22.27  ? 509  LEU A O     1 
ATOM   3936  C  CB    . LEU A  1  509  ? 41.608  -130.496 138.631 1.00 11.40  ? 509  LEU A CB    1 
ATOM   3937  C  CG    . LEU A  1  509  ? 40.345  -131.249 138.278 1.00 11.12  ? 509  LEU A CG    1 
ATOM   3938  C  CD1   . LEU A  1  509  ? 39.851  -130.857 136.898 1.00 8.70   ? 509  LEU A CD1   1 
ATOM   3939  C  CD2   . LEU A  1  509  ? 40.632  -132.720 138.367 1.00 10.96  ? 509  LEU A CD2   1 
ATOM   3940  N  N     . GLN A  1  510  ? 42.927  -128.520 140.456 1.00 19.82  ? 510  GLN A N     1 
ATOM   3941  C  CA    . GLN A  1  510  ? 44.017  -127.610 140.746 1.00 21.93  ? 510  GLN A CA    1 
ATOM   3942  C  C     . GLN A  1  510  ? 44.797  -127.797 142.061 1.00 23.81  ? 510  GLN A C     1 
ATOM   3943  O  O     . GLN A  1  510  ? 45.872  -127.196 142.197 1.00 24.13  ? 510  GLN A O     1 
ATOM   3944  C  CB    . GLN A  1  510  ? 43.510  -126.182 140.657 1.00 23.69  ? 510  GLN A CB    1 
ATOM   3945  C  CG    . GLN A  1  510  ? 42.980  -125.820 139.289 1.00 27.12  ? 510  GLN A CG    1 
ATOM   3946  C  CD    . GLN A  1  510  ? 43.955  -126.172 138.189 1.00 29.14  ? 510  GLN A CD    1 
ATOM   3947  O  OE1   . GLN A  1  510  ? 45.161  -126.015 138.359 1.00 31.92  ? 510  GLN A OE1   1 
ATOM   3948  N  NE2   . GLN A  1  510  ? 43.441  -126.641 137.050 1.00 28.23  ? 510  GLN A NE2   1 
ATOM   3949  N  N     . ILE A  1  511  ? 44.292  -128.619 142.999 1.00 24.02  ? 511  ILE A N     1 
ATOM   3950  C  CA    . ILE A  1  511  ? 44.955  -128.860 144.307 1.00 25.66  ? 511  ILE A CA    1 
ATOM   3951  C  C     . ILE A  1  511  ? 46.483  -129.018 144.357 1.00 27.78  ? 511  ILE A C     1 
ATOM   3952  O  O     . ILE A  1  511  ? 47.144  -128.354 145.157 1.00 27.60  ? 511  ILE A O     1 
ATOM   3953  C  CB    . ILE A  1  511  ? 44.398  -130.089 145.039 1.00 24.87  ? 511  ILE A CB    1 
ATOM   3954  C  CG1   . ILE A  1  511  ? 43.075  -129.754 145.709 1.00 26.24  ? 511  ILE A CG1   1 
ATOM   3955  C  CG2   . ILE A  1  511  ? 45.378  -130.537 146.110 1.00 22.70  ? 511  ILE A CG2   1 
ATOM   3956  C  CD1   . ILE A  1  511  ? 42.579  -130.855 146.629 1.00 25.10  ? 511  ILE A CD1   1 
ATOM   3957  N  N     . VAL A  1  512  ? 47.038  -129.932 143.563 1.00 29.57  ? 512  VAL A N     1 
ATOM   3958  C  CA    . VAL A  1  512  ? 48.488  -130.113 143.532 1.00 31.30  ? 512  VAL A CA    1 
ATOM   3959  C  C     . VAL A  1  512  ? 49.029  -129.378 142.310 1.00 32.33  ? 512  VAL A C     1 
ATOM   3960  O  O     . VAL A  1  512  ? 48.854  -129.807 141.173 1.00 32.68  ? 512  VAL A O     1 
ATOM   3961  C  CB    . VAL A  1  512  ? 48.870  -131.604 143.511 1.00 31.68  ? 512  VAL A CB    1 
ATOM   3962  C  CG1   . VAL A  1  512  ? 50.044  -131.850 142.582 1.00 33.14  ? 512  VAL A CG1   1 
ATOM   3963  C  CG2   . VAL A  1  512  ? 49.251  -132.033 144.914 1.00 30.58  ? 512  VAL A CG2   1 
ATOM   3964  N  N     . SER A  1  513  ? 49.681  -128.253 142.584 1.00 32.99  ? 513  SER A N     1 
ATOM   3965  C  CA    . SER A  1  513  ? 50.225  -127.353 141.576 1.00 33.69  ? 513  SER A CA    1 
ATOM   3966  C  C     . SER A  1  513  ? 51.543  -127.725 140.945 1.00 32.53  ? 513  SER A C     1 
ATOM   3967  O  O     . SER A  1  513  ? 52.490  -128.069 141.637 1.00 32.95  ? 513  SER A O     1 
ATOM   3968  C  CB    . SER A  1  513  ? 50.355  -125.944 142.168 1.00 35.56  ? 513  SER A CB    1 
ATOM   3969  O  OG    . SER A  1  513  ? 51.267  -125.147 141.432 1.00 36.53  ? 513  SER A OG    1 
ATOM   3970  N  N     . PRO A  1  514  ? 51.620  -127.622 139.610 1.00 31.81  ? 514  PRO A N     1 
ATOM   3971  C  CA    . PRO A  1  514  ? 52.792  -127.920 138.798 1.00 31.85  ? 514  PRO A CA    1 
ATOM   3972  C  C     . PRO A  1  514  ? 53.806  -126.792 138.888 1.00 32.88  ? 514  PRO A C     1 
ATOM   3973  O  O     . PRO A  1  514  ? 54.920  -126.906 138.399 1.00 33.86  ? 514  PRO A O     1 
ATOM   3974  C  CB    . PRO A  1  514  ? 52.211  -128.030 137.403 1.00 31.06  ? 514  PRO A CB    1 
ATOM   3975  C  CG    . PRO A  1  514  ? 51.180  -126.990 137.431 1.00 30.90  ? 514  PRO A CG    1 
ATOM   3976  C  CD    . PRO A  1  514  ? 50.488  -127.290 138.734 1.00 31.23  ? 514  PRO A CD    1 
ATOM   3977  N  N     . GLN A  1  515  ? 53.422  -125.685 139.499 1.00 33.48  ? 515  GLN A N     1 
ATOM   3978  C  CA    . GLN A  1  515  ? 54.362  -124.585 139.612 1.00 34.07  ? 515  GLN A CA    1 
ATOM   3979  C  C     . GLN A  1  515  ? 55.558  -125.082 140.384 1.00 33.82  ? 515  GLN A C     1 
ATOM   3980  O  O     . GLN A  1  515  ? 56.690  -124.930 139.952 1.00 33.89  ? 515  GLN A O     1 
ATOM   3981  C  CB    . GLN A  1  515  ? 53.737  -123.406 140.352 1.00 36.05  ? 515  GLN A CB    1 
ATOM   3982  C  CG    . GLN A  1  515  ? 54.655  -122.206 140.482 1.00 36.97  ? 515  GLN A CG    1 
ATOM   3983  C  CD    . GLN A  1  515  ? 53.985  -121.052 141.197 1.00 39.11  ? 515  GLN A CD    1 
ATOM   3984  O  OE1   . GLN A  1  515  ? 52.892  -120.613 140.816 1.00 38.11  ? 515  GLN A OE1   1 
ATOM   3985  N  NE2   . GLN A  1  515  ? 54.640  -120.547 142.239 1.00 39.77  ? 515  GLN A NE2   1 
ATOM   3986  N  N     . SER A  1  516  ? 55.292  -125.701 141.525 1.00 33.62  ? 516  SER A N     1 
ATOM   3987  C  CA    . SER A  1  516  ? 56.352  -126.211 142.368 1.00 34.20  ? 516  SER A CA    1 
ATOM   3988  C  C     . SER A  1  516  ? 56.047  -127.615 142.876 1.00 34.81  ? 516  SER A C     1 
ATOM   3989  O  O     . SER A  1  516  ? 56.083  -127.884 144.081 1.00 35.27  ? 516  SER A O     1 
ATOM   3990  C  CB    . SER A  1  516  ? 56.566  -125.265 143.535 1.00 33.94  ? 516  SER A CB    1 
ATOM   3991  O  OG    . SER A  1  516  ? 55.385  -125.195 144.294 1.00 36.58  ? 516  SER A OG    1 
ATOM   3992  N  N     . ASN A  1  517  ? 55.752  -128.496 141.924 1.00 35.08  ? 517  ASN A N     1 
ATOM   3993  C  CA    . ASN A  1  517  ? 55.455  -129.907 142.162 1.00 34.65  ? 517  ASN A CA    1 
ATOM   3994  C  C     . ASN A  1  517  ? 55.005  -130.288 143.560 1.00 33.96  ? 517  ASN A C     1 
ATOM   3995  O  O     . ASN A  1  517  ? 55.499  -131.265 144.118 1.00 33.78  ? 517  ASN A O     1 
ATOM   3996  C  CB    . ASN A  1  517  ? 56.672  -130.748 141.804 1.00 36.46  ? 517  ASN A CB    1 
ATOM   3997  C  CG    . ASN A  1  517  ? 57.895  -130.347 142.600 1.00 38.12  ? 517  ASN A CG    1 
ATOM   3998  O  OD1   . ASN A  1  517  ? 57.916  -130.467 143.831 1.00 38.72  ? 517  ASN A OD1   1 
ATOM   3999  N  ND2   . ASN A  1  517  ? 58.920  -129.851 141.904 1.00 38.50  ? 517  ASN A ND2   1 
ATOM   4000  N  N     . LYS A  1  518  ? 54.074  -129.521 144.120 1.00 34.04  ? 518  LYS A N     1 
ATOM   4001  C  CA    . LYS A  1  518  ? 53.517  -129.801 145.446 1.00 33.49  ? 518  LYS A CA    1 
ATOM   4002  C  C     . LYS A  1  518  ? 52.100  -129.191 145.508 1.00 32.39  ? 518  LYS A C     1 
ATOM   4003  O  O     . LYS A  1  518  ? 51.704  -128.431 144.615 1.00 33.12  ? 518  LYS A O     1 
ATOM   4004  C  CB    . LYS A  1  518  ? 54.410  -129.207 146.546 1.00 33.78  ? 518  LYS A CB    1 
ATOM   4005  C  CG    . LYS A  1  518  ? 54.168  -127.729 146.811 1.00 35.18  ? 518  LYS A CG    1 
ATOM   4006  C  CD    . LYS A  1  518  ? 54.956  -127.207 147.995 1.00 34.65  ? 518  LYS A CD    1 
ATOM   4007  C  CE    . LYS A  1  518  ? 54.284  -125.973 148.572 1.00 36.09  ? 518  LYS A CE    1 
ATOM   4008  N  NZ    . LYS A  1  518  ? 53.952  -124.928 147.539 1.00 36.99  ? 518  LYS A NZ    1 
ATOM   4009  N  N     . PRO A  1  519  ? 51.315  -129.532 146.543 1.00 29.98  ? 519  PRO A N     1 
ATOM   4010  C  CA    . PRO A  1  519  ? 49.961  -128.993 146.675 1.00 28.57  ? 519  PRO A CA    1 
ATOM   4011  C  C     . PRO A  1  519  ? 49.976  -127.483 146.878 1.00 27.51  ? 519  PRO A C     1 
ATOM   4012  O  O     . PRO A  1  519  ? 50.926  -126.947 147.436 1.00 26.78  ? 519  PRO A O     1 
ATOM   4013  C  CB    . PRO A  1  519  ? 49.418  -129.742 147.883 1.00 28.73  ? 519  PRO A CB    1 
ATOM   4014  C  CG    . PRO A  1  519  ? 50.630  -130.016 148.682 1.00 29.16  ? 519  PRO A CG    1 
ATOM   4015  C  CD    . PRO A  1  519  ? 51.599  -130.469 147.638 1.00 29.22  ? 519  PRO A CD    1 
ATOM   4016  N  N     . CYS A  1  520  ? 48.926  -126.798 146.430 1.00 26.83  ? 520  CYS A N     1 
ATOM   4017  C  CA    . CYS A  1  520  ? 48.870  -125.347 146.569 1.00 26.54  ? 520  CYS A CA    1 
ATOM   4018  C  C     . CYS A  1  520  ? 47.759  -124.796 147.479 1.00 25.97  ? 520  CYS A C     1 
ATOM   4019  O  O     . CYS A  1  520  ? 47.478  -123.594 147.478 1.00 26.45  ? 520  CYS A O     1 
ATOM   4020  C  CB    . CYS A  1  520  ? 48.782  -124.694 145.183 1.00 25.09  ? 520  CYS A CB    1 
ATOM   4021  S  SG    . CYS A  1  520  ? 47.214  -124.857 144.347 1.00 25.57  ? 520  CYS A SG    1 
ATOM   4022  N  N     . MET A  1  521  ? 47.149  -125.675 148.263 1.00 25.49  ? 521  MET A N     1 
ATOM   4023  C  CA    . MET A  1  521  ? 46.093  -125.295 149.193 1.00 25.50  ? 521  MET A CA    1 
ATOM   4024  C  C     . MET A  1  521  ? 46.293  -126.169 150.419 1.00 25.78  ? 521  MET A C     1 
ATOM   4025  O  O     . MET A  1  521  ? 46.571  -127.356 150.285 1.00 25.75  ? 521  MET A O     1 
ATOM   4026  C  CB    . MET A  1  521  ? 44.710  -125.589 148.604 1.00 25.28  ? 521  MET A CB    1 
ATOM   4027  C  CG    . MET A  1  521  ? 44.455  -125.000 147.239 1.00 24.22  ? 521  MET A CG    1 
ATOM   4028  S  SD    . MET A  1  521  ? 42.839  -125.487 146.635 1.00 27.25  ? 521  MET A SD    1 
ATOM   4029  C  CE    . MET A  1  521  ? 43.095  -125.466 144.847 1.00 22.42  ? 521  MET A CE    1 
ATOM   4030  N  N     . GLY A  1  522  ? 46.158  -125.594 151.609 1.00 26.16  ? 522  GLY A N     1 
ATOM   4031  C  CA    . GLY A  1  522  ? 46.321  -126.392 152.813 1.00 26.15  ? 522  GLY A CA    1 
ATOM   4032  C  C     . GLY A  1  522  ? 45.249  -126.097 153.830 1.00 26.10  ? 522  GLY A C     1 
ATOM   4033  O  O     . GLY A  1  522  ? 44.150  -125.704 153.481 1.00 26.83  ? 522  GLY A O     1 
ATOM   4034  N  N     . ILE A  1  523  ? 45.556  -126.312 155.097 1.00 26.58  ? 523  ILE A N     1 
ATOM   4035  C  CA    . ILE A  1  523  ? 44.603  -126.010 156.161 1.00 27.01  ? 523  ILE A CA    1 
ATOM   4036  C  C     . ILE A  1  523  ? 45.085  -124.711 156.794 1.00 27.60  ? 523  ILE A C     1 
ATOM   4037  O  O     . ILE A  1  523  ? 46.276  -124.533 157.002 1.00 29.41  ? 523  ILE A O     1 
ATOM   4038  C  CB    . ILE A  1  523  ? 44.582  -127.118 157.209 1.00 24.90  ? 523  ILE A CB    1 
ATOM   4039  C  CG1   . ILE A  1  523  ? 44.192  -128.431 156.548 1.00 22.77  ? 523  ILE A CG1   1 
ATOM   4040  C  CG2   . ILE A  1  523  ? 43.586  -126.803 158.274 1.00 25.39  ? 523  ILE A CG2   1 
ATOM   4041  C  CD1   . ILE A  1  523  ? 42.928  -128.354 155.783 1.00 22.29  ? 523  ILE A CD1   1 
ATOM   4042  N  N     . VAL A  1  524  ? 44.187  -123.795 157.116 1.00 27.85  ? 524  VAL A N     1 
ATOM   4043  C  CA    . VAL A  1  524  ? 44.664  -122.537 157.675 1.00 28.04  ? 524  VAL A CA    1 
ATOM   4044  C  C     . VAL A  1  524  ? 43.987  -122.018 158.942 1.00 28.35  ? 524  VAL A C     1 
ATOM   4045  O  O     . VAL A  1  524  ? 43.189  -122.706 159.573 1.00 28.10  ? 524  VAL A O     1 
ATOM   4046  C  CB    . VAL A  1  524  ? 44.576  -121.451 156.615 1.00 26.86  ? 524  VAL A CB    1 
ATOM   4047  C  CG1   . VAL A  1  524  ? 45.616  -120.374 156.895 1.00 29.72  ? 524  VAL A CG1   1 
ATOM   4048  C  CG2   . VAL A  1  524  ? 44.754  -122.067 155.260 1.00 25.05  ? 524  VAL A CG2   1 
ATOM   4049  N  N     . GLN A  1  525  ? 44.335  -120.791 159.306 1.00 29.08  ? 525  GLN A N     1 
ATOM   4050  C  CA    . GLN A  1  525  ? 43.764  -120.114 160.462 1.00 31.19  ? 525  GLN A CA    1 
ATOM   4051  C  C     . GLN A  1  525  ? 43.182  -121.043 161.534 1.00 32.23  ? 525  GLN A C     1 
ATOM   4052  O  O     . GLN A  1  525  ? 43.834  -121.995 161.982 1.00 31.34  ? 525  GLN A O     1 
ATOM   4053  C  CB    . GLN A  1  525  ? 42.665  -119.155 159.999 1.00 31.88  ? 525  GLN A CB    1 
ATOM   4054  C  CG    . GLN A  1  525  ? 43.049  -118.287 158.822 1.00 34.96  ? 525  GLN A CG    1 
ATOM   4055  C  CD    . GLN A  1  525  ? 43.457  -116.887 159.219 1.00 36.12  ? 525  GLN A CD    1 
ATOM   4056  O  OE1   . GLN A  1  525  ? 42.660  -116.130 159.769 1.00 37.77  ? 525  GLN A OE1   1 
ATOM   4057  N  NE2   . GLN A  1  525  ? 44.702  -116.532 158.932 1.00 37.30  ? 525  GLN A NE2   1 
ATOM   4058  N  N     . ASP A  1  526  ? 41.947  -120.734 161.940 1.00 32.65  ? 526  ASP A N     1 
ATOM   4059  C  CA    . ASP A  1  526  ? 41.233  -121.488 162.960 1.00 32.05  ? 526  ASP A CA    1 
ATOM   4060  C  C     . ASP A  1  526  ? 41.546  -122.952 162.806 1.00 33.25  ? 526  ASP A C     1 
ATOM   4061  O  O     . ASP A  1  526  ? 42.216  -123.525 163.656 1.00 34.36  ? 526  ASP A O     1 
ATOM   4062  C  CB    . ASP A  1  526  ? 39.712  -121.255 162.869 1.00 30.86  ? 526  ASP A CB    1 
ATOM   4063  C  CG    . ASP A  1  526  ? 39.296  -119.866 163.364 1.00 32.38  ? 526  ASP A CG    1 
ATOM   4064  O  OD1   . ASP A  1  526  ? 40.153  -118.955 163.339 1.00 31.68  ? 526  ASP A OD1   1 
ATOM   4065  O  OD2   . ASP A  1  526  ? 38.120  -119.670 163.767 1.00 33.04  ? 526  ASP A OD2   1 
ATOM   4066  N  N     . THR A  1  527  ? 41.107  -123.552 161.703 1.00 34.10  ? 527  THR A N     1 
ATOM   4067  C  CA    . THR A  1  527  ? 41.340  -124.975 161.489 1.00 33.70  ? 527  THR A CA    1 
ATOM   4068  C  C     . THR A  1  527  ? 42.772  -125.440 161.746 1.00 33.74  ? 527  THR A C     1 
ATOM   4069  O  O     . THR A  1  527  ? 42.973  -126.481 162.365 1.00 33.84  ? 527  THR A O     1 
ATOM   4070  C  CB    . THR A  1  527  ? 40.920  -125.392 160.092 1.00 33.36  ? 527  THR A CB    1 
ATOM   4071  O  OG1   . THR A  1  527  ? 39.556  -125.016 159.890 1.00 34.88  ? 527  THR A OG1   1 
ATOM   4072  C  CG2   . THR A  1  527  ? 41.015  -126.894 159.946 1.00 33.75  ? 527  THR A CG2   1 
ATOM   4073  N  N     . LEU A  1  528  ? 43.765  -124.676 161.293 1.00 34.13  ? 528  LEU A N     1 
ATOM   4074  C  CA    . LEU A  1  528  ? 45.162  -125.060 161.512 1.00 33.92  ? 528  LEU A CA    1 
ATOM   4075  C  C     . LEU A  1  528  ? 45.538  -124.911 162.975 1.00 33.90  ? 528  LEU A C     1 
ATOM   4076  O  O     . LEU A  1  528  ? 46.077  -125.831 163.589 1.00 33.34  ? 528  LEU A O     1 
ATOM   4077  C  CB    . LEU A  1  528  ? 46.110  -124.207 160.663 1.00 33.39  ? 528  LEU A CB    1 
ATOM   4078  C  CG    . LEU A  1  528  ? 47.611  -124.468 160.890 1.00 31.99  ? 528  LEU A CG    1 
ATOM   4079  C  CD1   . LEU A  1  528  ? 47.935  -125.928 160.651 1.00 29.67  ? 528  LEU A CD1   1 
ATOM   4080  C  CD2   . LEU A  1  528  ? 48.432  -123.592 159.967 1.00 31.87  ? 528  LEU A CD2   1 
ATOM   4081  N  N     . CYS A  1  529  ? 45.254  -123.733 163.518 1.00 34.57  ? 529  CYS A N     1 
ATOM   4082  C  CA    . CYS A  1  529  ? 45.533  -123.427 164.916 1.00 35.62  ? 529  CYS A CA    1 
ATOM   4083  C  C     . CYS A  1  529  ? 44.865  -124.460 165.818 1.00 34.95  ? 529  CYS A C     1 
ATOM   4084  O  O     . CYS A  1  529  ? 45.470  -125.018 166.728 1.00 35.01  ? 529  CYS A O     1 
ATOM   4085  C  CB    . CYS A  1  529  ? 44.994  -122.030 165.242 1.00 36.10  ? 529  CYS A CB    1 
ATOM   4086  S  SG    . CYS A  1  529  ? 45.166  -121.502 166.961 1.00 39.08  ? 529  CYS A SG    1 
ATOM   4087  N  N     . GLY A  1  530  ? 43.600  -124.715 165.540 1.00 34.83  ? 530  GLY A N     1 
ATOM   4088  C  CA    . GLY A  1  530  ? 42.858  -125.663 166.330 1.00 34.91  ? 530  GLY A CA    1 
ATOM   4089  C  C     . GLY A  1  530  ? 43.230  -127.107 166.103 1.00 35.40  ? 530  GLY A C     1 
ATOM   4090  O  O     . GLY A  1  530  ? 43.241  -127.878 167.051 1.00 36.66  ? 530  GLY A O     1 
ATOM   4091  N  N     . ILE A  1  531  ? 43.540  -127.499 164.872 1.00 35.95  ? 531  ILE A N     1 
ATOM   4092  C  CA    . ILE A  1  531  ? 43.859  -128.904 164.643 1.00 35.74  ? 531  ILE A CA    1 
ATOM   4093  C  C     . ILE A  1  531  ? 45.045  -129.323 165.491 1.00 37.67  ? 531  ILE A C     1 
ATOM   4094  O  O     . ILE A  1  531  ? 45.118  -130.471 165.921 1.00 37.98  ? 531  ILE A O     1 
ATOM   4095  C  CB    . ILE A  1  531  ? 44.106  -129.238 163.136 1.00 32.96  ? 531  ILE A CB    1 
ATOM   4096  C  CG1   . ILE A  1  531  ? 44.001  -130.744 162.950 1.00 29.57  ? 531  ILE A CG1   1 
ATOM   4097  C  CG2   . ILE A  1  531  ? 45.453  -128.725 162.663 1.00 31.55  ? 531  ILE A CG2   1 
ATOM   4098  C  CD1   . ILE A  1  531  ? 44.252  -131.190 161.586 1.00 28.39  ? 531  ILE A CD1   1 
ATOM   4099  N  N     . ARG A  1  532  ? 45.963  -128.392 165.754 1.00 39.78  ? 532  ARG A N     1 
ATOM   4100  C  CA    . ARG A  1  532  ? 47.121  -128.707 166.597 1.00 41.52  ? 532  ARG A CA    1 
ATOM   4101  C  C     . ARG A  1  532  ? 46.627  -129.074 168.002 1.00 41.68  ? 532  ARG A C     1 
ATOM   4102  O  O     . ARG A  1  532  ? 46.913  -130.162 168.508 1.00 40.50  ? 532  ARG A O     1 
ATOM   4103  C  CB    . ARG A  1  532  ? 48.080  -127.513 166.697 1.00 42.30  ? 532  ARG A CB    1 
ATOM   4104  C  CG    . ARG A  1  532  ? 48.986  -127.612 167.911 1.00 44.79  ? 532  ARG A CG    1 
ATOM   4105  C  CD    . ARG A  1  532  ? 50.117  -126.615 167.906 1.00 47.55  ? 532  ARG A CD    1 
ATOM   4106  N  NE    . ARG A  1  532  ? 50.582  -126.366 169.267 1.00 50.64  ? 532  ARG A NE    1 
ATOM   4107  C  CZ    . ARG A  1  532  ? 49.851  -125.748 170.193 1.00 51.48  ? 532  ARG A CZ    1 
ATOM   4108  N  NH1   . ARG A  1  532  ? 48.626  -125.322 169.893 1.00 50.52  ? 532  ARG A NH1   1 
ATOM   4109  N  NH2   . ARG A  1  532  ? 50.342  -125.550 171.413 1.00 50.74  ? 532  ARG A NH2   1 
ATOM   4110  N  N     . LYS A  1  533  ? 45.881  -128.152 168.610 1.00 41.52  ? 533  LYS A N     1 
ATOM   4111  C  CA    . LYS A  1  533  ? 45.326  -128.339 169.935 1.00 41.53  ? 533  LYS A CA    1 
ATOM   4112  C  C     . LYS A  1  533  ? 44.560  -129.646 170.044 1.00 42.66  ? 533  LYS A C     1 
ATOM   4113  O  O     . LYS A  1  533  ? 44.809  -130.445 170.933 1.00 44.53  ? 533  LYS A O     1 
ATOM   4114  C  CB    . LYS A  1  533  ? 44.400  -127.181 170.279 1.00 41.10  ? 533  LYS A CB    1 
ATOM   4115  C  CG    . LYS A  1  533  ? 45.037  -125.829 170.104 1.00 41.34  ? 533  LYS A CG    1 
ATOM   4116  C  CD    . LYS A  1  533  ? 44.372  -124.813 171.005 1.00 41.67  ? 533  LYS A CD    1 
ATOM   4117  C  CE    . LYS A  1  533  ? 44.482  -125.234 172.463 1.00 41.59  ? 533  LYS A CE    1 
ATOM   4118  N  NZ    . LYS A  1  533  ? 44.046  -124.136 173.357 1.00 41.58  ? 533  LYS A NZ    1 
ATOM   4119  N  N     . LEU A  1  534  ? 43.619  -129.875 169.147 1.00 43.75  ? 534  LEU A N     1 
ATOM   4120  C  CA    . LEU A  1  534  ? 42.852  -131.108 169.193 1.00 45.36  ? 534  LEU A CA    1 
ATOM   4121  C  C     . LEU A  1  534  ? 43.758  -132.343 169.149 1.00 47.37  ? 534  LEU A C     1 
ATOM   4122  O  O     . LEU A  1  534  ? 43.317  -133.448 169.432 1.00 47.85  ? 534  LEU A O     1 
ATOM   4123  C  CB    . LEU A  1  534  ? 41.889  -131.160 168.013 1.00 44.46  ? 534  LEU A CB    1 
ATOM   4124  C  CG    . LEU A  1  534  ? 41.197  -132.508 167.857 1.00 43.75  ? 534  LEU A CG    1 
ATOM   4125  C  CD1   . LEU A  1  534  ? 40.083  -132.603 168.874 1.00 44.04  ? 534  LEU A CD1   1 
ATOM   4126  C  CD2   . LEU A  1  534  ? 40.666  -132.666 166.444 1.00 43.58  ? 534  LEU A CD2   1 
ATOM   4127  N  N     . THR A  1  535  ? 45.029  -132.154 168.807 1.00 49.88  ? 535  THR A N     1 
ATOM   4128  C  CA    . THR A  1  535  ? 45.979  -133.266 168.685 1.00 52.24  ? 535  THR A CA    1 
ATOM   4129  C  C     . THR A  1  535  ? 46.836  -133.667 169.909 1.00 54.85  ? 535  THR A C     1 
ATOM   4130  O  O     . THR A  1  535  ? 46.994  -134.859 170.184 1.00 55.05  ? 535  THR A O     1 
ATOM   4131  C  CB    . THR A  1  535  ? 46.928  -132.999 167.508 1.00 51.19  ? 535  THR A CB    1 
ATOM   4132  O  OG1   . THR A  1  535  ? 46.191  -133.026 166.289 1.00 50.24  ? 535  THR A OG1   1 
ATOM   4133  C  CG2   . THR A  1  535  ? 48.008  -134.042 167.447 1.00 52.02  ? 535  THR A CG2   1 
ATOM   4134  N  N     . LEU A  1  536  ? 47.402  -132.678 170.607 1.00 57.24  ? 536  LEU A N     1 
ATOM   4135  C  CA    . LEU A  1  536  ? 48.252  -132.865 171.799 1.00 59.66  ? 536  LEU A CA    1 
ATOM   4136  C  C     . LEU A  1  536  ? 47.853  -134.047 172.689 1.00 62.17  ? 536  LEU A C     1 
ATOM   4137  O  O     . LEU A  1  536  ? 46.693  -134.135 173.094 1.00 63.26  ? 536  LEU A O     1 
ATOM   4138  C  CB    . LEU A  1  536  ? 48.196  -131.601 172.654 1.00 59.14  ? 536  LEU A CB    1 
ATOM   4139  C  CG    . LEU A  1  536  ? 48.236  -130.259 171.926 1.00 59.30  ? 536  LEU A CG    1 
ATOM   4140  C  CD1   . LEU A  1  536  ? 47.971  -129.118 172.897 1.00 59.62  ? 536  LEU A CD1   1 
ATOM   4141  C  CD2   . LEU A  1  536  ? 49.584  -130.092 171.263 1.00 60.56  ? 536  LEU A CD2   1 
ATOM   4142  N  N     . ARG A  1  537  ? 48.805  -134.928 173.022 1.00 63.75  ? 537  ARG A N     1 
ATOM   4143  C  CA    . ARG A  1  537  ? 48.519  -136.103 173.877 1.00 64.60  ? 537  ARG A CA    1 
ATOM   4144  C  C     . ARG A  1  537  ? 47.555  -135.781 175.016 1.00 64.72  ? 537  ARG A C     1 
ATOM   4145  O  O     . ARG A  1  537  ? 46.739  -136.614 175.415 1.00 64.91  ? 537  ARG A O     1 
ATOM   4146  C  CB    . ARG A  1  537  ? 49.792  -136.641 174.530 1.00 65.53  ? 537  ARG A CB    1 
ATOM   4147  C  CG    . ARG A  1  537  ? 50.748  -137.409 173.662 1.00 66.16  ? 537  ARG A CG    1 
ATOM   4148  C  CD    . ARG A  1  537  ? 52.026  -137.640 174.458 1.00 67.28  ? 537  ARG A CD    1 
ATOM   4149  N  NE    . ARG A  1  537  ? 53.095  -138.207 173.649 1.00 68.54  ? 537  ARG A NE    1 
ATOM   4150  C  CZ    . ARG A  1  537  ? 53.067  -139.437 173.160 1.00 69.44  ? 537  ARG A CZ    1 
ATOM   4151  N  NH1   . ARG A  1  537  ? 52.022  -140.214 173.412 1.00 70.04  ? 537  ARG A NH1   1 
ATOM   4152  N  NH2   . ARG A  1  537  ? 54.072  -139.888 172.421 1.00 70.05  ? 537  ARG A NH2   1 
ATOM   4153  N  N     . ASP A  1  538  ? 47.694  -134.570 175.546 1.00 64.04  ? 538  ASP A N     1 
ATOM   4154  C  CA    . ASP A  1  538  ? 46.887  -134.071 176.648 1.00 63.85  ? 538  ASP A CA    1 
ATOM   4155  C  C     . ASP A  1  538  ? 45.386  -133.971 176.360 1.00 64.01  ? 538  ASP A C     1 
ATOM   4156  O  O     . ASP A  1  538  ? 44.562  -134.017 177.276 1.00 64.03  ? 538  ASP A O     1 
ATOM   4157  C  CB    . ASP A  1  538  ? 47.389  -132.690 177.028 1.00 65.37  ? 538  ASP A CB    1 
ATOM   4158  C  CG    . ASP A  1  538  ? 47.646  -132.561 178.498 1.00 67.64  ? 538  ASP A CG    1 
ATOM   4159  O  OD1   . ASP A  1  538  ? 47.581  -131.425 179.016 1.00 68.40  ? 538  ASP A OD1   1 
ATOM   4160  O  OD2   . ASP A  1  538  ? 47.924  -133.600 179.134 1.00 69.43  ? 538  ASP A OD2   1 
ATOM   4161  N  N     . THR A  1  539  ? 45.045  -133.824 175.082 1.00 63.58  ? 539  THR A N     1 
ATOM   4162  C  CA    . THR A  1  539  ? 43.664  -133.665 174.632 1.00 61.36  ? 539  THR A CA    1 
ATOM   4163  C  C     . THR A  1  539  ? 42.788  -134.909 174.635 1.00 60.41  ? 539  THR A C     1 
ATOM   4164  O  O     . THR A  1  539  ? 42.963  -135.818 173.821 1.00 59.97  ? 539  THR A O     1 
ATOM   4165  C  CB    . THR A  1  539  ? 43.636  -133.058 173.218 1.00 60.94  ? 539  THR A CB    1 
ATOM   4166  O  OG1   . THR A  1  539  ? 44.208  -131.746 173.254 1.00 61.04  ? 539  THR A OG1   1 
ATOM   4167  C  CG2   . THR A  1  539  ? 42.222  -132.957 172.707 1.00 61.27  ? 539  THR A CG2   1 
ATOM   4168  N  N     . PHE A  1  540  ? 41.829  -134.927 175.554 1.00 59.86  ? 540  PHE A N     1 
ATOM   4169  C  CA    . PHE A  1  540  ? 40.896  -136.040 175.662 1.00 59.71  ? 540  PHE A CA    1 
ATOM   4170  C  C     . PHE A  1  540  ? 39.467  -135.539 175.479 1.00 59.25  ? 540  PHE A C     1 
ATOM   4171  O  O     . PHE A  1  540  ? 39.115  -134.457 175.956 1.00 59.50  ? 540  PHE A O     1 
ATOM   4172  C  CB    . PHE A  1  540  ? 41.045  -136.738 177.017 1.00 59.86  ? 540  PHE A CB    1 
ATOM   4173  C  CG    . PHE A  1  540  ? 42.283  -137.580 177.126 1.00 59.14  ? 540  PHE A CG    1 
ATOM   4174  C  CD1   . PHE A  1  540  ? 43.472  -137.038 177.594 1.00 58.63  ? 540  PHE A CD1   1 
ATOM   4175  C  CD2   . PHE A  1  540  ? 42.267  -138.910 176.722 1.00 58.53  ? 540  PHE A CD2   1 
ATOM   4176  C  CE1   . PHE A  1  540  ? 44.630  -137.808 177.657 1.00 58.45  ? 540  PHE A CE1   1 
ATOM   4177  C  CE2   . PHE A  1  540  ? 43.418  -139.685 176.782 1.00 58.09  ? 540  PHE A CE2   1 
ATOM   4178  C  CZ    . PHE A  1  540  ? 44.602  -139.133 177.249 1.00 58.29  ? 540  PHE A CZ    1 
ATOM   4179  N  N     . ILE A  1  541  ? 38.647  -136.338 174.798 1.00 57.98  ? 541  ILE A N     1 
ATOM   4180  C  CA    . ILE A  1  541  ? 37.261  -135.974 174.516 1.00 56.74  ? 541  ILE A CA    1 
ATOM   4181  C  C     . ILE A  1  541  ? 36.260  -137.029 174.991 1.00 56.70  ? 541  ILE A C     1 
ATOM   4182  O  O     . ILE A  1  541  ? 36.452  -138.224 174.762 1.00 55.62  ? 541  ILE A O     1 
ATOM   4183  C  CB    . ILE A  1  541  ? 37.099  -135.741 172.999 1.00 55.64  ? 541  ILE A CB    1 
ATOM   4184  C  CG1   . ILE A  1  541  ? 38.010  -134.594 172.576 1.00 54.12  ? 541  ILE A CG1   1 
ATOM   4185  C  CG2   . ILE A  1  541  ? 35.659  -135.424 172.649 1.00 55.95  ? 541  ILE A CG2   1 
ATOM   4186  C  CD1   . ILE A  1  541  ? 38.095  -134.399 171.113 1.00 52.74  ? 541  ILE A CD1   1 
ATOM   4187  N  N     . GLU A  1  542  ? 35.188  -136.591 175.646 1.00 57.11  ? 542  GLU A N     1 
ATOM   4188  C  CA    . GLU A  1  542  ? 34.197  -137.542 176.139 1.00 59.29  ? 542  GLU A CA    1 
ATOM   4189  C  C     . GLU A  1  542  ? 32.997  -137.802 175.250 1.00 59.24  ? 542  GLU A C     1 
ATOM   4190  O  O     . GLU A  1  542  ? 32.611  -136.967 174.438 1.00 60.54  ? 542  GLU A O     1 
ATOM   4191  C  CB    . GLU A  1  542  ? 33.712  -137.151 177.529 1.00 60.90  ? 542  GLU A CB    1 
ATOM   4192  C  CG    . GLU A  1  542  ? 33.727  -135.683 177.813 1.00 63.88  ? 542  GLU A CG    1 
ATOM   4193  C  CD    . GLU A  1  542  ? 33.699  -135.433 179.308 1.00 66.02  ? 542  GLU A CD    1 
ATOM   4194  O  OE1   . GLU A  1  542  ? 34.384  -136.191 180.032 1.00 65.55  ? 542  GLU A OE1   1 
ATOM   4195  O  OE2   . GLU A  1  542  ? 33.009  -134.489 179.759 1.00 67.85  ? 542  GLU A OE2   1 
ATOM   4196  N  N     . LEU A  1  543  ? 32.410  -138.981 175.443 1.00 58.55  ? 543  LEU A N     1 
ATOM   4197  C  CA    . LEU A  1  543  ? 31.260  -139.469 174.687 1.00 57.13  ? 543  LEU A CA    1 
ATOM   4198  C  C     . LEU A  1  543  ? 30.302  -138.434 174.102 1.00 56.92  ? 543  LEU A C     1 
ATOM   4199  O  O     . LEU A  1  543  ? 30.195  -138.300 172.886 1.00 56.02  ? 543  LEU A O     1 
ATOM   4200  C  CB    . LEU A  1  543  ? 30.479  -140.454 175.554 1.00 55.64  ? 543  LEU A CB    1 
ATOM   4201  C  CG    . LEU A  1  543  ? 29.356  -141.239 174.888 1.00 53.92  ? 543  LEU A CG    1 
ATOM   4202  C  CD1   . LEU A  1  543  ? 29.873  -141.963 173.672 1.00 53.09  ? 543  LEU A CD1   1 
ATOM   4203  C  CD2   . LEU A  1  543  ? 28.802  -142.228 175.885 1.00 54.57  ? 543  LEU A CD2   1 
ATOM   4204  N  N     . ASP A  1  544  ? 29.601  -137.714 174.968 1.00 58.02  ? 544  ASP A N     1 
ATOM   4205  C  CA    . ASP A  1  544  ? 28.637  -136.706 174.535 1.00 59.77  ? 544  ASP A CA    1 
ATOM   4206  C  C     . ASP A  1  544  ? 29.096  -135.932 173.294 1.00 59.66  ? 544  ASP A C     1 
ATOM   4207  O  O     . ASP A  1  544  ? 28.352  -135.811 172.311 1.00 59.67  ? 544  ASP A O     1 
ATOM   4208  C  CB    . ASP A  1  544  ? 28.378  -135.713 175.670 1.00 61.90  ? 544  ASP A CB    1 
ATOM   4209  C  CG    . ASP A  1  544  ? 29.463  -134.636 175.763 1.00 65.58  ? 544  ASP A CG    1 
ATOM   4210  O  OD1   . ASP A  1  544  ? 30.660  -134.989 175.921 1.00 67.10  ? 544  ASP A OD1   1 
ATOM   4211  O  OD2   . ASP A  1  544  ? 29.118  -133.434 175.670 1.00 66.96  ? 544  ASP A OD2   1 
ATOM   4212  N  N     . GLN A  1  545  ? 30.323  -135.415 173.355 1.00 58.45  ? 545  GLN A N     1 
ATOM   4213  C  CA    . GLN A  1  545  ? 30.896  -134.631 172.276 1.00 56.99  ? 545  GLN A CA    1 
ATOM   4214  C  C     . GLN A  1  545  ? 31.455  -135.493 171.148 1.00 56.14  ? 545  GLN A C     1 
ATOM   4215  O  O     . GLN A  1  545  ? 31.159  -135.255 169.981 1.00 57.24  ? 545  GLN A O     1 
ATOM   4216  C  CB    . GLN A  1  545  ? 31.982  -133.737 172.820 1.00 56.91  ? 545  GLN A CB    1 
ATOM   4217  C  CG    . GLN A  1  545  ? 32.292  -132.613 171.900 1.00 60.83  ? 545  GLN A CG    1 
ATOM   4218  C  CD    . GLN A  1  545  ? 33.339  -131.692 172.471 1.00 63.96  ? 545  GLN A CD    1 
ATOM   4219  O  OE1   . GLN A  1  545  ? 34.524  -132.034 172.532 1.00 64.32  ? 545  GLN A OE1   1 
ATOM   4220  N  NE2   . GLN A  1  545  ? 32.908  -130.514 172.910 1.00 65.81  ? 545  GLN A NE2   1 
ATOM   4221  N  N     . VAL A  1  546  ? 32.270  -136.485 171.478 1.00 53.78  ? 546  VAL A N     1 
ATOM   4222  C  CA    . VAL A  1  546  ? 32.794  -137.363 170.442 1.00 51.94  ? 546  VAL A CA    1 
ATOM   4223  C  C     . VAL A  1  546  ? 31.669  -137.740 169.486 1.00 51.01  ? 546  VAL A C     1 
ATOM   4224  O  O     . VAL A  1  546  ? 31.876  -137.885 168.280 1.00 50.31  ? 546  VAL A O     1 
ATOM   4225  C  CB    . VAL A  1  546  ? 33.347  -138.659 171.033 1.00 52.51  ? 546  VAL A CB    1 
ATOM   4226  C  CG1   . VAL A  1  546  ? 33.455  -139.734 169.942 1.00 51.86  ? 546  VAL A CG1   1 
ATOM   4227  C  CG2   . VAL A  1  546  ? 34.700  -138.390 171.655 1.00 52.84  ? 546  VAL A CG2   1 
ATOM   4228  N  N     . LEU A  1  547  ? 30.472  -137.902 170.037 1.00 50.11  ? 547  LEU A N     1 
ATOM   4229  C  CA    . LEU A  1  547  ? 29.319  -138.273 169.232 1.00 48.32  ? 547  LEU A CA    1 
ATOM   4230  C  C     . LEU A  1  547  ? 28.945  -137.182 168.237 1.00 45.99  ? 547  LEU A C     1 
ATOM   4231  O  O     . LEU A  1  547  ? 28.615  -137.476 167.088 1.00 45.19  ? 547  LEU A O     1 
ATOM   4232  C  CB    . LEU A  1  547  ? 28.121  -138.633 170.131 1.00 48.03  ? 547  LEU A CB    1 
ATOM   4233  C  CG    . LEU A  1  547  ? 28.223  -139.941 170.942 1.00 47.09  ? 547  LEU A CG    1 
ATOM   4234  C  CD1   . LEU A  1  547  ? 26.834  -140.358 171.344 1.00 47.66  ? 547  LEU A CD1   1 
ATOM   4235  C  CD2   . LEU A  1  547  ? 28.846  -141.065 170.125 1.00 45.60  ? 547  LEU A CD2   1 
ATOM   4236  N  N     . ASN A  1  548  ? 28.992  -135.928 168.669 1.00 43.37  ? 548  ASN A N     1 
ATOM   4237  C  CA    . ASN A  1  548  ? 28.677  -134.846 167.756 1.00 42.52  ? 548  ASN A CA    1 
ATOM   4238  C  C     . ASN A  1  548  ? 29.760  -134.751 166.710 1.00 43.38  ? 548  ASN A C     1 
ATOM   4239  O  O     . ASN A  1  548  ? 29.470  -134.660 165.513 1.00 44.78  ? 548  ASN A O     1 
ATOM   4240  C  CB    . ASN A  1  548  ? 28.567  -133.528 168.487 1.00 39.88  ? 548  ASN A CB    1 
ATOM   4241  C  CG    . ASN A  1  548  ? 27.261  -133.394 169.200 1.00 39.45  ? 548  ASN A CG    1 
ATOM   4242  O  OD1   . ASN A  1  548  ? 26.234  -133.897 168.735 1.00 37.27  ? 548  ASN A OD1   1 
ATOM   4243  N  ND2   . ASN A  1  548  ? 27.276  -132.705 170.334 1.00 40.66  ? 548  ASN A ND2   1 
ATOM   4244  N  N     . MET A  1  549  ? 31.010  -134.776 167.163 1.00 43.35  ? 549  MET A N     1 
ATOM   4245  C  CA    . MET A  1  549  ? 32.137  -134.717 166.248 1.00 42.30  ? 549  MET A CA    1 
ATOM   4246  C  C     . MET A  1  549  ? 32.013  -135.805 165.190 1.00 42.05  ? 549  MET A C     1 
ATOM   4247  O  O     . MET A  1  549  ? 32.244  -135.560 164.007 1.00 42.20  ? 549  MET A O     1 
ATOM   4248  C  CB    . MET A  1  549  ? 33.450  -134.852 167.008 1.00 42.22  ? 549  MET A CB    1 
ATOM   4249  C  CG    . MET A  1  549  ? 33.740  -133.633 167.829 1.00 43.89  ? 549  MET A CG    1 
ATOM   4250  S  SD    . MET A  1  549  ? 35.490  -133.369 168.059 1.00 47.49  ? 549  MET A SD    1 
ATOM   4251  C  CE    . MET A  1  549  ? 35.495  -133.352 169.783 1.00 49.67  ? 549  MET A CE    1 
ATOM   4252  N  N     . LEU A  1  550  ? 31.632  -137.009 165.594 1.00 41.27  ? 550  LEU A N     1 
ATOM   4253  C  CA    . LEU A  1  550  ? 31.484  -138.055 164.599 1.00 41.28  ? 550  LEU A CA    1 
ATOM   4254  C  C     . LEU A  1  550  ? 30.422  -137.645 163.584 1.00 40.80  ? 550  LEU A C     1 
ATOM   4255  O  O     . LEU A  1  550  ? 30.687  -137.593 162.386 1.00 40.64  ? 550  LEU A O     1 
ATOM   4256  C  CB    . LEU A  1  550  ? 31.099  -139.380 165.258 1.00 42.09  ? 550  LEU A CB    1 
ATOM   4257  C  CG    . LEU A  1  550  ? 32.234  -140.065 166.011 1.00 42.82  ? 550  LEU A CG    1 
ATOM   4258  C  CD1   . LEU A  1  550  ? 31.745  -141.383 166.570 1.00 43.46  ? 550  LEU A CD1   1 
ATOM   4259  C  CD2   . LEU A  1  550  ? 33.406  -140.287 165.061 1.00 42.92  ? 550  LEU A CD2   1 
ATOM   4260  N  N     . TYR A  1  551  ? 29.231  -137.322 164.076 1.00 39.71  ? 551  TYR A N     1 
ATOM   4261  C  CA    . TYR A  1  551  ? 28.126  -136.948 163.219 1.00 38.40  ? 551  TYR A CA    1 
ATOM   4262  C  C     . TYR A  1  551  ? 28.473  -135.880 162.221 1.00 39.41  ? 551  TYR A C     1 
ATOM   4263  O  O     . TYR A  1  551  ? 28.016  -135.924 161.077 1.00 39.46  ? 551  TYR A O     1 
ATOM   4264  C  CB    . TYR A  1  551  ? 26.954  -136.465 164.043 1.00 38.86  ? 551  TYR A CB    1 
ATOM   4265  C  CG    . TYR A  1  551  ? 25.694  -136.402 163.236 1.00 39.47  ? 551  TYR A CG    1 
ATOM   4266  C  CD1   . TYR A  1  551  ? 25.371  -137.439 162.368 1.00 39.31  ? 551  TYR A CD1   1 
ATOM   4267  C  CD2   . TYR A  1  551  ? 24.813  -135.326 163.341 1.00 39.69  ? 551  TYR A CD2   1 
ATOM   4268  C  CE1   . TYR A  1  551  ? 24.208  -137.414 161.617 1.00 40.17  ? 551  TYR A CE1   1 
ATOM   4269  C  CE2   . TYR A  1  551  ? 23.634  -135.292 162.592 1.00 39.91  ? 551  TYR A CE2   1 
ATOM   4270  C  CZ    . TYR A  1  551  ? 23.342  -136.345 161.725 1.00 40.03  ? 551  TYR A CZ    1 
ATOM   4271  O  OH    . TYR A  1  551  ? 22.209  -136.339 160.935 1.00 39.79  ? 551  TYR A OH    1 
ATOM   4272  N  N     . TRP A  1  552  ? 29.278  -134.916 162.653 1.00 39.23  ? 552  TRP A N     1 
ATOM   4273  C  CA    . TRP A  1  552  ? 29.681  -133.818 161.780 1.00 39.07  ? 552  TRP A CA    1 
ATOM   4274  C  C     . TRP A  1  552  ? 30.408  -134.261 160.508 1.00 38.95  ? 552  TRP A C     1 
ATOM   4275  O  O     . TRP A  1  552  ? 30.309  -133.608 159.465 1.00 38.16  ? 552  TRP A O     1 
ATOM   4276  C  CB    . TRP A  1  552  ? 30.532  -132.813 162.554 1.00 38.42  ? 552  TRP A CB    1 
ATOM   4277  C  CG    . TRP A  1  552  ? 29.749  -131.621 162.986 1.00 38.73  ? 552  TRP A CG    1 
ATOM   4278  C  CD1   . TRP A  1  552  ? 29.340  -131.310 164.251 1.00 39.25  ? 552  TRP A CD1   1 
ATOM   4279  C  CD2   . TRP A  1  552  ? 29.256  -130.589 162.141 1.00 38.59  ? 552  TRP A CD2   1 
ATOM   4280  N  NE1   . TRP A  1  552  ? 28.620  -130.141 164.244 1.00 38.51  ? 552  TRP A NE1   1 
ATOM   4281  C  CE2   . TRP A  1  552  ? 28.552  -129.681 162.959 1.00 38.68  ? 552  TRP A CE2   1 
ATOM   4282  C  CE3   . TRP A  1  552  ? 29.339  -130.346 160.769 1.00 38.61  ? 552  TRP A CE3   1 
ATOM   4283  C  CZ2   . TRP A  1  552  ? 27.939  -128.550 162.448 1.00 39.46  ? 552  TRP A CZ2   1 
ATOM   4284  C  CZ3   . TRP A  1  552  ? 28.735  -129.226 160.262 1.00 38.69  ? 552  TRP A CZ3   1 
ATOM   4285  C  CH2   . TRP A  1  552  ? 28.038  -128.338 161.099 1.00 39.98  ? 552  TRP A CH2   1 
ATOM   4286  N  N     . VAL A  1  553  ? 31.142  -135.361 160.589 1.00 38.46  ? 553  VAL A N     1 
ATOM   4287  C  CA    . VAL A  1  553  ? 31.829  -135.859 159.414 1.00 38.93  ? 553  VAL A CA    1 
ATOM   4288  C  C     . VAL A  1  553  ? 30.742  -136.542 158.596 1.00 41.43  ? 553  VAL A C     1 
ATOM   4289  O  O     . VAL A  1  553  ? 30.194  -137.571 159.014 1.00 39.49  ? 553  VAL A O     1 
ATOM   4290  C  CB    . VAL A  1  553  ? 32.909  -136.871 159.792 1.00 38.47  ? 553  VAL A CB    1 
ATOM   4291  C  CG1   . VAL A  1  553  ? 33.793  -137.175 158.594 1.00 37.12  ? 553  VAL A CG1   1 
ATOM   4292  C  CG2   . VAL A  1  553  ? 33.726  -136.329 160.933 1.00 37.31  ? 553  VAL A CG2   1 
ATOM   4293  N  N     . PRO A  1  554  ? 30.406  -135.964 157.420 1.00 43.78  ? 554  PRO A N     1 
ATOM   4294  C  CA    . PRO A  1  554  ? 29.384  -136.437 156.479 1.00 44.91  ? 554  PRO A CA    1 
ATOM   4295  C  C     . PRO A  1  554  ? 29.514  -137.858 155.961 1.00 48.10  ? 554  PRO A C     1 
ATOM   4296  O  O     . PRO A  1  554  ? 28.546  -138.432 155.475 1.00 48.26  ? 554  PRO A O     1 
ATOM   4297  C  CB    . PRO A  1  554  ? 29.440  -135.400 155.360 1.00 42.83  ? 554  PRO A CB    1 
ATOM   4298  C  CG    . PRO A  1  554  ? 30.835  -134.960 155.387 1.00 43.48  ? 554  PRO A CG    1 
ATOM   4299  C  CD    . PRO A  1  554  ? 31.100  -134.796 156.856 1.00 43.59  ? 554  PRO A CD    1 
ATOM   4300  N  N     . ASP A  1  555  ? 30.697  -138.439 156.075 1.00 52.13  ? 555  ASP A N     1 
ATOM   4301  C  CA    . ASP A  1  555  ? 30.888  -139.793 155.587 1.00 55.77  ? 555  ASP A CA    1 
ATOM   4302  C  C     . ASP A  1  555  ? 30.894  -140.814 156.703 1.00 56.86  ? 555  ASP A C     1 
ATOM   4303  O  O     . ASP A  1  555  ? 30.558  -141.973 156.474 1.00 57.72  ? 555  ASP A O     1 
ATOM   4304  C  CB    . ASP A  1  555  ? 32.189  -139.874 154.789 1.00 59.41  ? 555  ASP A CB    1 
ATOM   4305  C  CG    . ASP A  1  555  ? 32.223  -138.868 153.645 1.00 62.78  ? 555  ASP A CG    1 
ATOM   4306  O  OD1   . ASP A  1  555  ? 31.352  -138.956 152.739 1.00 63.65  ? 555  ASP A OD1   1 
ATOM   4307  O  OD2   . ASP A  1  555  ? 33.112  -137.982 153.663 1.00 63.83  ? 555  ASP A OD2   1 
ATOM   4308  N  N     . TRP A  1  556  ? 31.266  -140.378 157.905 1.00 57.19  ? 556  TRP A N     1 
ATOM   4309  C  CA    . TRP A  1  556  ? 31.320  -141.260 159.063 1.00 57.28  ? 556  TRP A CA    1 
ATOM   4310  C  C     . TRP A  1  556  ? 30.420  -142.461 158.877 1.00 57.83  ? 556  TRP A C     1 
ATOM   4311  O  O     . TRP A  1  556  ? 29.204  -142.327 158.733 1.00 57.44  ? 556  TRP A O     1 
ATOM   4312  C  CB    . TRP A  1  556  ? 30.901  -140.523 160.322 1.00 57.75  ? 556  TRP A CB    1 
ATOM   4313  C  CG    . TRP A  1  556  ? 30.824  -141.436 161.466 1.00 57.53  ? 556  TRP A CG    1 
ATOM   4314  C  CD1   . TRP A  1  556  ? 31.796  -142.272 161.895 1.00 57.91  ? 556  TRP A CD1   1 
ATOM   4315  C  CD2   . TRP A  1  556  ? 29.710  -141.630 162.331 1.00 57.98  ? 556  TRP A CD2   1 
ATOM   4316  N  NE1   . TRP A  1  556  ? 31.363  -142.984 162.977 1.00 58.95  ? 556  TRP A NE1   1 
ATOM   4317  C  CE2   . TRP A  1  556  ? 30.081  -142.606 163.269 1.00 59.08  ? 556  TRP A CE2   1 
ATOM   4318  C  CE3   . TRP A  1  556  ? 28.432  -141.074 162.404 1.00 58.95  ? 556  TRP A CE3   1 
ATOM   4319  C  CZ2   . TRP A  1  556  ? 29.217  -143.043 164.279 1.00 60.80  ? 556  TRP A CZ2   1 
ATOM   4320  C  CZ3   . TRP A  1  556  ? 27.571  -141.508 163.405 1.00 60.16  ? 556  TRP A CZ3   1 
ATOM   4321  C  CH2   . TRP A  1  556  ? 27.968  -142.484 164.330 1.00 60.57  ? 556  TRP A CH2   1 
ATOM   4322  N  N     . ASP A  1  557  ? 31.027  -143.638 158.889 1.00 58.62  ? 557  ASP A N     1 
ATOM   4323  C  CA    . ASP A  1  557  ? 30.292  -144.877 158.684 1.00 59.29  ? 557  ASP A CA    1 
ATOM   4324  C  C     . ASP A  1  557  ? 29.380  -145.299 159.831 1.00 59.30  ? 557  ASP A C     1 
ATOM   4325  O  O     . ASP A  1  557  ? 28.978  -146.461 159.909 1.00 59.64  ? 557  ASP A O     1 
ATOM   4326  C  CB    . ASP A  1  557  ? 31.277  -145.996 158.359 1.00 59.64  ? 557  ASP A CB    1 
ATOM   4327  C  CG    . ASP A  1  557  ? 32.336  -146.156 159.419 1.00 60.79  ? 557  ASP A CG    1 
ATOM   4328  O  OD1   . ASP A  1  557  ? 32.835  -145.129 159.934 1.00 61.84  ? 557  ASP A OD1   1 
ATOM   4329  O  OD2   . ASP A  1  557  ? 32.680  -147.313 159.727 1.00 61.25  ? 557  ASP A OD2   1 
ATOM   4330  N  N     . GLY A  1  558  ? 29.038  -144.359 160.710 1.00 59.06  ? 558  GLY A N     1 
ATOM   4331  C  CA    . GLY A  1  558  ? 28.159  -144.687 161.820 1.00 57.75  ? 558  GLY A CA    1 
ATOM   4332  C  C     . GLY A  1  558  ? 28.712  -145.821 162.660 1.00 57.15  ? 558  GLY A C     1 
ATOM   4333  O  O     . GLY A  1  558  ? 27.994  -146.765 163.010 1.00 56.91  ? 558  GLY A O     1 
ATOM   4334  N  N     . VAL A  1  559  ? 30.001  -145.722 162.972 1.00 56.26  ? 559  VAL A N     1 
ATOM   4335  C  CA    . VAL A  1  559  ? 30.699  -146.723 163.772 1.00 54.88  ? 559  VAL A CA    1 
ATOM   4336  C  C     . VAL A  1  559  ? 31.500  -146.058 164.882 1.00 55.37  ? 559  VAL A C     1 
ATOM   4337  O  O     . VAL A  1  559  ? 32.639  -145.641 164.658 1.00 56.40  ? 559  VAL A O     1 
ATOM   4338  C  CB    . VAL A  1  559  ? 31.675  -147.519 162.915 1.00 52.36  ? 559  VAL A CB    1 
ATOM   4339  C  CG1   . VAL A  1  559  ? 32.420  -148.504 163.768 1.00 51.21  ? 559  VAL A CG1   1 
ATOM   4340  C  CG2   . VAL A  1  559  ? 30.928  -148.222 161.830 1.00 52.05  ? 559  VAL A CG2   1 
ATOM   4341  N  N     . ILE A  1  560  ? 30.920  -145.952 166.074 1.00 54.14  ? 560  ILE A N     1 
ATOM   4342  C  CA    . ILE A  1  560  ? 31.644  -145.326 167.164 1.00 53.75  ? 560  ILE A CA    1 
ATOM   4343  C  C     . ILE A  1  560  ? 32.921  -146.107 167.424 1.00 53.72  ? 560  ILE A C     1 
ATOM   4344  O  O     . ILE A  1  560  ? 32.880  -147.274 167.803 1.00 54.28  ? 560  ILE A O     1 
ATOM   4345  C  CB    . ILE A  1  560  ? 30.810  -145.286 168.443 1.00 53.71  ? 560  ILE A CB    1 
ATOM   4346  C  CG1   . ILE A  1  560  ? 29.533  -144.489 168.186 1.00 54.41  ? 560  ILE A CG1   1 
ATOM   4347  C  CG2   . ILE A  1  560  ? 31.619  -144.657 169.567 1.00 52.80  ? 560  ILE A CG2   1 
ATOM   4348  C  CD1   . ILE A  1  560  ? 28.750  -144.131 169.432 1.00 54.21  ? 560  ILE A CD1   1 
ATOM   4349  N  N     . PRO A  1  561  ? 34.079  -145.475 167.204 1.00 53.45  ? 561  PRO A N     1 
ATOM   4350  C  CA    . PRO A  1  561  ? 35.354  -146.152 167.429 1.00 53.44  ? 561  PRO A CA    1 
ATOM   4351  C  C     . PRO A  1  561  ? 35.620  -146.326 168.921 1.00 54.25  ? 561  PRO A C     1 
ATOM   4352  O  O     . PRO A  1  561  ? 35.235  -145.486 169.744 1.00 53.61  ? 561  PRO A O     1 
ATOM   4353  C  CB    . PRO A  1  561  ? 36.348  -145.227 166.745 1.00 52.57  ? 561  PRO A CB    1 
ATOM   4354  C  CG    . PRO A  1  561  ? 35.758  -143.889 167.012 1.00 52.52  ? 561  PRO A CG    1 
ATOM   4355  C  CD    . PRO A  1  561  ? 34.292  -144.098 166.732 1.00 53.17  ? 561  PRO A CD    1 
ATOM   4356  N  N     . THR A  1  562  ? 36.284  -147.424 169.259 1.00 55.14  ? 562  THR A N     1 
ATOM   4357  C  CA    . THR A  1  562  ? 36.586  -147.739 170.646 1.00 56.20  ? 562  THR A CA    1 
ATOM   4358  C  C     . THR A  1  562  ? 37.437  -146.696 171.356 1.00 56.69  ? 562  THR A C     1 
ATOM   4359  O  O     . THR A  1  562  ? 38.486  -146.301 170.862 1.00 56.05  ? 562  THR A O     1 
ATOM   4360  C  CB    . THR A  1  562  ? 37.298  -149.072 170.749 1.00 56.25  ? 562  THR A CB    1 
ATOM   4361  O  OG1   . THR A  1  562  ? 36.739  -149.988 169.799 1.00 56.77  ? 562  THR A OG1   1 
ATOM   4362  C  CG2   . THR A  1  562  ? 37.129  -149.632 172.148 1.00 56.83  ? 562  THR A CG2   1 
ATOM   4363  N  N     . PRO A  1  563  ? 36.997  -146.258 172.545 1.00 57.77  ? 563  PRO A N     1 
ATOM   4364  C  CA    . PRO A  1  563  ? 37.701  -145.255 173.350 1.00 57.87  ? 563  PRO A CA    1 
ATOM   4365  C  C     . PRO A  1  563  ? 39.099  -145.722 173.649 1.00 57.78  ? 563  PRO A C     1 
ATOM   4366  O  O     . PRO A  1  563  ? 39.298  -146.840 174.123 1.00 57.10  ? 563  PRO A O     1 
ATOM   4367  C  CB    . PRO A  1  563  ? 36.874  -145.167 174.631 1.00 58.52  ? 563  PRO A CB    1 
ATOM   4368  C  CG    . PRO A  1  563  ? 35.527  -145.667 174.226 1.00 59.48  ? 563  PRO A CG    1 
ATOM   4369  C  CD    . PRO A  1  563  ? 35.845  -146.797 173.283 1.00 58.58  ? 563  PRO A CD    1 
ATOM   4370  N  N     . ALA A  1  564  ? 40.066  -144.859 173.371 1.00 58.31  ? 564  ALA A N     1 
ATOM   4371  C  CA    . ALA A  1  564  ? 41.453  -145.192 173.624 1.00 59.42  ? 564  ALA A CA    1 
ATOM   4372  C  C     . ALA A  1  564  ? 41.544  -145.525 175.101 1.00 59.70  ? 564  ALA A C     1 
ATOM   4373  O  O     . ALA A  1  564  ? 42.383  -146.312 175.531 1.00 61.38  ? 564  ALA A O     1 
ATOM   4374  C  CB    . ALA A  1  564  ? 42.340  -144.013 173.292 1.00 59.01  ? 564  ALA A CB    1 
ATOM   4375  N  N     . ILE A  1  565  ? 40.652  -144.927 175.874 1.00 58.99  ? 565  ILE A N     1 
ATOM   4376  C  CA    . ILE A  1  565  ? 40.623  -145.156 177.302 1.00 58.30  ? 565  ILE A CA    1 
ATOM   4377  C  C     . ILE A  1  565  ? 39.233  -145.621 177.715 1.00 59.69  ? 565  ILE A C     1 
ATOM   4378  O  O     . ILE A  1  565  ? 38.242  -144.925 177.488 1.00 60.85  ? 565  ILE A O     1 
ATOM   4379  C  CB    . ILE A  1  565  ? 41.016  -143.864 178.048 1.00 55.51  ? 565  ILE A CB    1 
ATOM   4380  C  CG1   . ILE A  1  565  ? 42.532  -143.806 178.196 1.00 53.09  ? 565  ILE A CG1   1 
ATOM   4381  C  CG2   . ILE A  1  565  ? 40.319  -143.782 179.380 1.00 54.02  ? 565  ILE A CG2   1 
ATOM   4382  C  CD1   . ILE A  1  565  ? 43.026  -142.516 178.778 1.00 51.65  ? 565  ILE A CD1   1 
ATOM   4383  N  N     . ILE A  1  566  ? 39.162  -146.816 178.296 1.00 60.54  ? 566  ILE A N     1 
ATOM   4384  C  CA    . ILE A  1  566  ? 37.899  -147.375 178.771 1.00 60.88  ? 566  ILE A CA    1 
ATOM   4385  C  C     . ILE A  1  566  ? 37.859  -147.219 180.299 1.00 63.31  ? 566  ILE A C     1 
ATOM   4386  O  O     . ILE A  1  566  ? 36.874  -146.719 180.846 1.00 63.58  ? 566  ILE A O     1 
ATOM   4387  C  CB    . ILE A  1  566  ? 37.788  -148.852 178.413 1.00 59.00  ? 566  ILE A CB    1 
ATOM   4388  C  CG1   . ILE A  1  566  ? 38.404  -149.083 177.035 1.00 58.66  ? 566  ILE A CG1   1 
ATOM   4389  C  CG2   . ILE A  1  566  ? 36.325  -149.266 178.406 1.00 57.48  ? 566  ILE A CG2   1 
ATOM   4390  C  CD1   . ILE A  1  566  ? 38.548  -150.539 176.666 1.00 59.80  ? 566  ILE A CD1   1 
ATOM   4391  N  N     . LYS A  1  567  ? 38.953  -147.639 180.948 1.00 65.00  ? 567  LYS A N     1 
ATOM   4392  C  CA    . LYS A  1  567  ? 39.199  -147.588 182.401 1.00 65.88  ? 567  LYS A CA    1 
ATOM   4393  C  C     . LYS A  1  567  ? 38.150  -146.851 183.243 1.00 64.66  ? 567  LYS A C     1 
ATOM   4394  O  O     . LYS A  1  567  ? 36.971  -147.171 183.144 1.00 65.41  ? 567  LYS A O     1 
ATOM   4395  C  CB    . LYS A  1  567  ? 40.585  -146.996 182.629 1.00 69.33  ? 567  LYS A CB    1 
ATOM   4396  C  CG    . LYS A  1  567  ? 40.770  -145.605 182.043 1.00 75.86  ? 567  LYS A CG    1 
ATOM   4397  C  CD    . LYS A  1  567  ? 42.011  -144.913 182.633 1.00 81.52  ? 567  LYS A CD    1 
ATOM   4398  C  CE    . LYS A  1  567  ? 42.045  -143.389 182.352 1.00 84.36  ? 567  LYS A CE    1 
ATOM   4399  N  NZ    . LYS A  1  567  ? 43.251  -142.673 182.926 1.00 85.18  ? 567  LYS A NZ    1 
ATOM   4400  N  N     . PRO A  1  568  ? 38.547  -145.893 184.116 1.00 63.23  ? 568  PRO A N     1 
ATOM   4401  C  CA    . PRO A  1  568  ? 37.427  -145.282 184.834 1.00 63.50  ? 568  PRO A CA    1 
ATOM   4402  C  C     . PRO A  1  568  ? 36.364  -144.609 183.964 1.00 63.93  ? 568  PRO A C     1 
ATOM   4403  O  O     . PRO A  1  568  ? 35.178  -144.962 184.025 1.00 64.48  ? 568  PRO A O     1 
ATOM   4404  C  CB    . PRO A  1  568  ? 38.122  -144.292 185.781 1.00 62.33  ? 568  PRO A CB    1 
ATOM   4405  C  CG    . PRO A  1  568  ? 39.496  -144.126 185.222 1.00 61.00  ? 568  PRO A CG    1 
ATOM   4406  C  CD    . PRO A  1  568  ? 39.795  -145.525 184.804 1.00 62.18  ? 568  PRO A CD    1 
ATOM   4407  N  N     . LYS A  1  569  ? 36.802  -143.646 183.155 1.00 63.98  ? 569  LYS A N     1 
ATOM   4408  C  CA    . LYS A  1  569  ? 35.922  -142.884 182.273 1.00 62.71  ? 569  LYS A CA    1 
ATOM   4409  C  C     . LYS A  1  569  ? 36.273  -143.183 180.816 1.00 62.66  ? 569  LYS A C     1 
ATOM   4410  O  O     . LYS A  1  569  ? 37.450  -143.188 180.444 1.00 62.34  ? 569  LYS A O     1 
ATOM   4411  C  CB    . LYS A  1  569  ? 36.108  -141.386 182.557 1.00 62.04  ? 569  LYS A CB    1 
ATOM   4412  C  CG    . LYS A  1  569  ? 34.938  -140.496 182.182 1.00 61.74  ? 569  LYS A CG    1 
ATOM   4413  C  CD    . LYS A  1  569  ? 35.160  -139.063 182.680 1.00 61.16  ? 569  LYS A CD    1 
ATOM   4414  C  CE    . LYS A  1  569  ? 33.862  -138.249 182.625 1.00 60.98  ? 569  LYS A CE    1 
ATOM   4415  N  NZ    . LYS A  1  569  ? 34.003  -136.859 183.164 1.00 59.31  ? 569  LYS A NZ    1 
ATOM   4416  N  N     . PRO A  1  570  ? 35.261  -143.457 179.975 1.00 62.63  ? 570  PRO A N     1 
ATOM   4417  C  CA    . PRO A  1  570  ? 35.554  -143.738 178.571 1.00 62.01  ? 570  PRO A CA    1 
ATOM   4418  C  C     . PRO A  1  570  ? 35.873  -142.405 177.890 1.00 61.58  ? 570  PRO A C     1 
ATOM   4419  O  O     . PRO A  1  570  ? 35.012  -141.518 177.779 1.00 61.16  ? 570  PRO A O     1 
ATOM   4420  C  CB    . PRO A  1  570  ? 34.256  -144.356 178.070 1.00 62.17  ? 570  PRO A CB    1 
ATOM   4421  C  CG    . PRO A  1  570  ? 33.233  -143.550 178.801 1.00 62.44  ? 570  PRO A CG    1 
ATOM   4422  C  CD    . PRO A  1  570  ? 33.809  -143.509 180.218 1.00 63.25  ? 570  PRO A CD    1 
ATOM   4423  N  N     . LEU A  1  571  ? 37.127  -142.264 177.473 1.00 60.26  ? 571  LEU A N     1 
ATOM   4424  C  CA    . LEU A  1  571  ? 37.595  -141.061 176.807 1.00 58.65  ? 571  LEU A CA    1 
ATOM   4425  C  C     . LEU A  1  571  ? 38.155  -141.397 175.436 1.00 58.88  ? 571  LEU A C     1 
ATOM   4426  O  O     . LEU A  1  571  ? 38.610  -142.522 175.196 1.00 59.36  ? 571  LEU A O     1 
ATOM   4427  C  CB    . LEU A  1  571  ? 38.679  -140.383 177.645 1.00 56.73  ? 571  LEU A CB    1 
ATOM   4428  C  CG    . LEU A  1  571  ? 38.232  -139.241 178.560 1.00 55.67  ? 571  LEU A CG    1 
ATOM   4429  C  CD1   . LEU A  1  571  ? 36.991  -139.638 179.333 1.00 55.18  ? 571  LEU A CD1   1 
ATOM   4430  C  CD2   . LEU A  1  571  ? 39.369  -138.868 179.496 1.00 54.95  ? 571  LEU A CD2   1 
ATOM   4431  N  N     . TRP A  1  572  ? 38.089  -140.418 174.535 1.00 58.14  ? 572  TRP A N     1 
ATOM   4432  C  CA    . TRP A  1  572  ? 38.621  -140.543 173.180 1.00 56.32  ? 572  TRP A CA    1 
ATOM   4433  C  C     . TRP A  1  572  ? 39.673  -139.444 173.086 1.00 55.72  ? 572  TRP A C     1 
ATOM   4434  O  O     . TRP A  1  572  ? 39.598  -138.436 173.799 1.00 54.99  ? 572  TRP A O     1 
ATOM   4435  C  CB    . TRP A  1  572  ? 37.523  -140.318 172.133 1.00 55.34  ? 572  TRP A CB    1 
ATOM   4436  C  CG    . TRP A  1  572  ? 36.588  -141.480 171.956 1.00 54.46  ? 572  TRP A CG    1 
ATOM   4437  C  CD1   . TRP A  1  572  ? 36.641  -142.435 170.981 1.00 54.37  ? 572  TRP A CD1   1 
ATOM   4438  C  CD2   . TRP A  1  572  ? 35.466  -141.816 172.781 1.00 54.88  ? 572  TRP A CD2   1 
ATOM   4439  N  NE1   . TRP A  1  572  ? 35.622  -143.345 171.142 1.00 53.86  ? 572  TRP A NE1   1 
ATOM   4440  C  CE2   . TRP A  1  572  ? 34.884  -142.989 172.240 1.00 55.01  ? 572  TRP A CE2   1 
ATOM   4441  C  CE3   . TRP A  1  572  ? 34.892  -141.241 173.925 1.00 55.15  ? 572  TRP A CE3   1 
ATOM   4442  C  CZ2   . TRP A  1  572  ? 33.750  -143.599 172.807 1.00 55.25  ? 572  TRP A CZ2   1 
ATOM   4443  C  CZ3   . TRP A  1  572  ? 33.759  -141.852 174.491 1.00 55.65  ? 572  TRP A CZ3   1 
ATOM   4444  C  CH2   . TRP A  1  572  ? 33.204  -143.017 173.928 1.00 54.81  ? 572  TRP A CH2   1 
ATOM   4445  N  N     . SER A  1  573  ? 40.667  -139.634 172.233 1.00 54.76  ? 573  SER A N     1 
ATOM   4446  C  CA    . SER A  1  573  ? 41.701  -138.624 172.110 1.00 54.96  ? 573  SER A CA    1 
ATOM   4447  C  C     . SER A  1  573  ? 41.506  -137.866 170.823 1.00 54.91  ? 573  SER A C     1 
ATOM   4448  O  O     . SER A  1  573  ? 40.936  -138.395 169.861 1.00 55.55  ? 573  SER A O     1 
ATOM   4449  C  CB    . SER A  1  573  ? 43.067  -139.274 172.093 1.00 55.43  ? 573  SER A CB    1 
ATOM   4450  O  OG    . SER A  1  573  ? 43.128  -140.198 171.028 1.00 56.86  ? 573  SER A OG    1 
ATOM   4451  N  N     . GLY A  1  574  ? 41.985  -136.629 170.802 1.00 54.05  ? 574  GLY A N     1 
ATOM   4452  C  CA    . GLY A  1  574  ? 41.845  -135.823 169.607 1.00 53.83  ? 574  GLY A CA    1 
ATOM   4453  C  C     . GLY A  1  574  ? 42.303  -136.607 168.398 1.00 53.25  ? 574  GLY A C     1 
ATOM   4454  O  O     . GLY A  1  574  ? 41.525  -136.843 167.462 1.00 52.59  ? 574  GLY A O     1 
ATOM   4455  N  N     . LYS A  1  575  ? 43.570  -137.021 168.443 1.00 52.67  ? 575  LYS A N     1 
ATOM   4456  C  CA    . LYS A  1  575  ? 44.189  -137.798 167.374 1.00 52.00  ? 575  LYS A CA    1 
ATOM   4457  C  C     . LYS A  1  575  ? 43.231  -138.873 166.872 1.00 50.46  ? 575  LYS A C     1 
ATOM   4458  O  O     . LYS A  1  575  ? 43.191  -139.182 165.684 1.00 51.34  ? 575  LYS A O     1 
ATOM   4459  C  CB    . LYS A  1  575  ? 45.494  -138.446 167.868 1.00 52.10  ? 575  LYS A CB    1 
ATOM   4460  C  CG    . LYS A  1  575  ? 46.480  -137.450 168.480 1.00 53.02  ? 575  LYS A CG    1 
ATOM   4461  C  CD    . LYS A  1  575  ? 47.861  -138.051 168.724 1.00 53.59  ? 575  LYS A CD    1 
ATOM   4462  C  CE    . LYS A  1  575  ? 48.812  -137.016 169.351 1.00 54.08  ? 575  LYS A CE    1 
ATOM   4463  N  NZ    . LYS A  1  575  ? 50.207  -137.519 169.584 1.00 53.93  ? 575  LYS A NZ    1 
ATOM   4464  N  N     . GLN A  1  576  ? 42.439  -139.425 167.778 1.00 48.66  ? 576  GLN A N     1 
ATOM   4465  C  CA    . GLN A  1  576  ? 41.496  -140.466 167.408 1.00 46.86  ? 576  GLN A CA    1 
ATOM   4466  C  C     . GLN A  1  576  ? 40.424  -140.024 166.446 1.00 45.50  ? 576  GLN A C     1 
ATOM   4467  O  O     . GLN A  1  576  ? 40.437  -140.374 165.265 1.00 43.36  ? 576  GLN A O     1 
ATOM   4468  C  CB    . GLN A  1  576  ? 40.816  -141.029 168.640 1.00 46.32  ? 576  GLN A CB    1 
ATOM   4469  C  CG    . GLN A  1  576  ? 41.332  -142.368 169.037 1.00 44.83  ? 576  GLN A CG    1 
ATOM   4470  C  CD    . GLN A  1  576  ? 40.598  -142.882 170.227 1.00 45.79  ? 576  GLN A CD    1 
ATOM   4471  O  OE1   . GLN A  1  576  ? 40.490  -142.195 171.260 1.00 44.63  ? 576  GLN A OE1   1 
ATOM   4472  N  NE2   . GLN A  1  576  ? 40.070  -144.093 170.105 1.00 45.48  ? 576  GLN A NE2   1 
ATOM   4473  N  N     . ILE A  1  577  ? 39.476  -139.263 166.964 1.00 44.58  ? 577  ILE A N     1 
ATOM   4474  C  CA    . ILE A  1  577  ? 38.392  -138.823 166.125 1.00 44.06  ? 577  ILE A CA    1 
ATOM   4475  C  C     . ILE A  1  577  ? 38.875  -138.057 164.888 1.00 43.73  ? 577  ILE A C     1 
ATOM   4476  O  O     . ILE A  1  577  ? 38.302  -138.223 163.813 1.00 44.16  ? 577  ILE A O     1 
ATOM   4477  C  CB    . ILE A  1  577  ? 37.405  -137.992 166.923 1.00 43.85  ? 577  ILE A CB    1 
ATOM   4478  C  CG1   . ILE A  1  577  ? 38.145  -136.844 167.584 1.00 44.68  ? 577  ILE A CG1   1 
ATOM   4479  C  CG2   . ILE A  1  577  ? 36.720  -138.864 167.970 1.00 42.52  ? 577  ILE A CG2   1 
ATOM   4480  C  CD1   . ILE A  1  577  ? 37.220  -135.806 168.113 1.00 46.50  ? 577  ILE A CD1   1 
ATOM   4481  N  N     . LEU A  1  578  ? 39.923  -137.239 165.002 1.00 42.22  ? 578  LEU A N     1 
ATOM   4482  C  CA    . LEU A  1  578  ? 40.385  -136.520 163.813 1.00 40.37  ? 578  LEU A CA    1 
ATOM   4483  C  C     . LEU A  1  578  ? 40.691  -137.518 162.698 1.00 40.81  ? 578  LEU A C     1 
ATOM   4484  O  O     . LEU A  1  578  ? 40.515  -137.228 161.514 1.00 40.34  ? 578  LEU A O     1 
ATOM   4485  C  CB    . LEU A  1  578  ? 41.642  -135.696 164.096 1.00 37.83  ? 578  LEU A CB    1 
ATOM   4486  C  CG    . LEU A  1  578  ? 42.260  -135.095 162.825 1.00 35.44  ? 578  LEU A CG    1 
ATOM   4487  C  CD1   . LEU A  1  578  ? 41.297  -134.127 162.204 1.00 34.28  ? 578  LEU A CD1   1 
ATOM   4488  C  CD2   . LEU A  1  578  ? 43.558  -134.389 163.144 1.00 34.82  ? 578  LEU A CD2   1 
ATOM   4489  N  N     . SER A  1  579  ? 41.133  -138.706 163.091 1.00 41.16  ? 579  SER A N     1 
ATOM   4490  C  CA    . SER A  1  579  ? 41.482  -139.752 162.132 1.00 41.73  ? 579  SER A CA    1 
ATOM   4491  C  C     . SER A  1  579  ? 40.273  -140.324 161.395 1.00 40.80  ? 579  SER A C     1 
ATOM   4492  O  O     . SER A  1  579  ? 40.414  -141.111 160.448 1.00 40.44  ? 579  SER A O     1 
ATOM   4493  C  CB    . SER A  1  579  ? 42.218  -140.884 162.854 1.00 42.87  ? 579  SER A CB    1 
ATOM   4494  O  OG    . SER A  1  579  ? 43.323  -140.396 163.597 1.00 43.55  ? 579  SER A OG    1 
ATOM   4495  N  N     . VAL A  1  580  ? 39.085  -139.941 161.845 1.00 39.71  ? 580  VAL A N     1 
ATOM   4496  C  CA    . VAL A  1  580  ? 37.872  -140.429 161.228 1.00 38.79  ? 580  VAL A CA    1 
ATOM   4497  C  C     . VAL A  1  580  ? 37.751  -139.701 159.910 1.00 39.95  ? 580  VAL A C     1 
ATOM   4498  O  O     . VAL A  1  580  ? 37.128  -140.199 158.970 1.00 41.11  ? 580  VAL A O     1 
ATOM   4499  C  CB    . VAL A  1  580  ? 36.630  -140.145 162.106 1.00 38.02  ? 580  VAL A CB    1 
ATOM   4500  C  CG1   . VAL A  1  580  ? 35.378  -140.552 161.381 1.00 37.19  ? 580  VAL A CG1   1 
ATOM   4501  C  CG2   . VAL A  1  580  ? 36.717  -140.915 163.415 1.00 37.62  ? 580  VAL A CG2   1 
ATOM   4502  N  N     . ALA A  1  581  ? 38.365  -138.523 159.834 1.00 39.58  ? 581  ALA A N     1 
ATOM   4503  C  CA    . ALA A  1  581  ? 38.310  -137.735 158.607 1.00 39.42  ? 581  ALA A CA    1 
ATOM   4504  C  C     . ALA A  1  581  ? 39.294  -138.293 157.609 1.00 39.26  ? 581  ALA A C     1 
ATOM   4505  O  O     . ALA A  1  581  ? 39.053  -138.249 156.400 1.00 40.37  ? 581  ALA A O     1 
ATOM   4506  C  CB    . ALA A  1  581  ? 38.634  -136.291 158.894 1.00 39.84  ? 581  ALA A CB    1 
ATOM   4507  N  N     . ILE A  1  582  ? 40.404  -138.812 158.127 1.00 38.08  ? 582  ILE A N     1 
ATOM   4508  C  CA    . ILE A  1  582  ? 41.443  -139.394 157.299 1.00 37.97  ? 582  ILE A CA    1 
ATOM   4509  C  C     . ILE A  1  582  ? 41.010  -140.741 156.749 1.00 39.70  ? 582  ILE A C     1 
ATOM   4510  O  O     . ILE A  1  582  ? 40.849  -141.711 157.502 1.00 40.07  ? 582  ILE A O     1 
ATOM   4511  C  CB    . ILE A  1  582  ? 42.721  -139.614 158.084 1.00 37.15  ? 582  ILE A CB    1 
ATOM   4512  C  CG1   . ILE A  1  582  ? 43.211  -138.293 158.662 1.00 37.00  ? 582  ILE A CG1   1 
ATOM   4513  C  CG2   . ILE A  1  582  ? 43.769  -140.220 157.179 1.00 37.75  ? 582  ILE A CG2   1 
ATOM   4514  C  CD1   . ILE A  1  582  ? 44.582  -138.381 159.297 1.00 35.71  ? 582  ILE A CD1   1 
ATOM   4515  N  N     . PRO A  1  583  ? 40.848  -140.825 155.420 1.00 41.48  ? 583  PRO A N     1 
ATOM   4516  C  CA    . PRO A  1  583  ? 40.432  -142.021 154.674 1.00 43.97  ? 583  PRO A CA    1 
ATOM   4517  C  C     . PRO A  1  583  ? 41.367  -143.203 154.895 1.00 46.56  ? 583  PRO A C     1 
ATOM   4518  O  O     . PRO A  1  583  ? 42.413  -143.045 155.513 1.00 47.76  ? 583  PRO A O     1 
ATOM   4519  C  CB    . PRO A  1  583  ? 40.432  -141.537 153.231 1.00 43.16  ? 583  PRO A CB    1 
ATOM   4520  C  CG    . PRO A  1  583  ? 41.528  -140.526 153.229 1.00 42.18  ? 583  PRO A CG    1 
ATOM   4521  C  CD    . PRO A  1  583  ? 41.274  -139.762 154.496 1.00 41.15  ? 583  PRO A CD    1 
ATOM   4522  N  N     . ASN A  1  584  ? 41.003  -144.382 154.395 1.00 48.76  ? 584  ASN A N     1 
ATOM   4523  C  CA    . ASN A  1  584  ? 41.853  -145.552 154.590 1.00 50.72  ? 584  ASN A CA    1 
ATOM   4524  C  C     . ASN A  1  584  ? 42.927  -145.662 153.552 1.00 51.78  ? 584  ASN A C     1 
ATOM   4525  O  O     . ASN A  1  584  ? 42.820  -145.077 152.479 1.00 52.34  ? 584  ASN A O     1 
ATOM   4526  C  CB    . ASN A  1  584  ? 41.039  -146.829 154.565 1.00 52.02  ? 584  ASN A CB    1 
ATOM   4527  C  CG    . ASN A  1  584  ? 39.942  -146.810 155.565 1.00 53.94  ? 584  ASN A CG    1 
ATOM   4528  O  OD1   . ASN A  1  584  ? 40.140  -146.423 156.728 1.00 55.07  ? 584  ASN A OD1   1 
ATOM   4529  N  ND2   . ASN A  1  584  ? 38.760  -147.225 155.134 1.00 55.41  ? 584  ASN A ND2   1 
ATOM   4530  N  N     . GLY A  1  585  ? 43.958  -146.430 153.878 1.00 52.11  ? 585  GLY A N     1 
ATOM   4531  C  CA    . GLY A  1  585  ? 45.054  -146.622 152.953 1.00 53.44  ? 585  GLY A CA    1 
ATOM   4532  C  C     . GLY A  1  585  ? 46.021  -145.459 152.921 1.00 54.01  ? 585  GLY A C     1 
ATOM   4533  O  O     . GLY A  1  585  ? 46.988  -145.455 152.157 1.00 54.67  ? 585  GLY A O     1 
ATOM   4534  N  N     . ILE A  1  586  ? 45.775  -144.453 153.742 1.00 54.36  ? 586  ILE A N     1 
ATOM   4535  C  CA    . ILE A  1  586  ? 46.679  -143.324 153.742 1.00 55.69  ? 586  ILE A CA    1 
ATOM   4536  C  C     . ILE A  1  586  ? 47.799  -143.612 154.725 1.00 56.71  ? 586  ILE A C     1 
ATOM   4537  O  O     . ILE A  1  586  ? 47.583  -143.742 155.929 1.00 57.19  ? 586  ILE A O     1 
ATOM   4538  C  CB    . ILE A  1  586  ? 45.930  -142.016 154.066 1.00 55.20  ? 586  ILE A CB    1 
ATOM   4539  C  CG1   . ILE A  1  586  ? 45.041  -141.641 152.872 1.00 55.77  ? 586  ILE A CG1   1 
ATOM   4540  C  CG2   . ILE A  1  586  ? 46.904  -140.893 154.339 1.00 55.31  ? 586  ILE A CG2   1 
ATOM   4541  C  CD1   . ILE A  1  586  ? 45.782  -141.495 151.529 1.00 53.64  ? 586  ILE A CD1   1 
ATOM   4542  N  N     . HIS A  1  587  ? 49.003  -143.725 154.183 1.00 57.34  ? 587  HIS A N     1 
ATOM   4543  C  CA    . HIS A  1  587  ? 50.171  -144.042 154.970 1.00 58.05  ? 587  HIS A CA    1 
ATOM   4544  C  C     . HIS A  1  587  ? 51.125  -142.849 154.976 1.00 56.01  ? 587  HIS A C     1 
ATOM   4545  O  O     . HIS A  1  587  ? 51.529  -142.366 153.924 1.00 54.70  ? 587  HIS A O     1 
ATOM   4546  C  CB    . HIS A  1  587  ? 50.821  -145.279 154.340 1.00 63.09  ? 587  HIS A CB    1 
ATOM   4547  C  CG    . HIS A  1  587  ? 51.537  -146.171 155.309 1.00 69.03  ? 587  HIS A CG    1 
ATOM   4548  N  ND1   . HIS A  1  587  ? 52.757  -145.846 155.871 1.00 70.51  ? 587  HIS A ND1   1 
ATOM   4549  C  CD2   . HIS A  1  587  ? 51.222  -147.402 155.783 1.00 71.32  ? 587  HIS A CD2   1 
ATOM   4550  C  CE1   . HIS A  1  587  ? 53.164  -146.838 156.643 1.00 71.48  ? 587  HIS A CE1   1 
ATOM   4551  N  NE2   . HIS A  1  587  ? 52.252  -147.795 156.607 1.00 73.10  ? 587  HIS A NE2   1 
ATOM   4552  N  N     . LEU A  1  588  ? 51.480  -142.370 156.163 1.00 55.46  ? 588  LEU A N     1 
ATOM   4553  C  CA    . LEU A  1  588  ? 52.396  -141.236 156.274 1.00 55.80  ? 588  LEU A CA    1 
ATOM   4554  C  C     . LEU A  1  588  ? 53.401  -141.396 157.427 1.00 57.17  ? 588  LEU A C     1 
ATOM   4555  O  O     . LEU A  1  588  ? 53.067  -141.960 158.476 1.00 56.69  ? 588  LEU A O     1 
ATOM   4556  C  CB    . LEU A  1  588  ? 51.597  -139.950 156.454 1.00 53.42  ? 588  LEU A CB    1 
ATOM   4557  C  CG    . LEU A  1  588  ? 52.391  -138.652 156.395 1.00 50.80  ? 588  LEU A CG    1 
ATOM   4558  C  CD1   . LEU A  1  588  ? 53.228  -138.639 155.148 1.00 51.42  ? 588  LEU A CD1   1 
ATOM   4559  C  CD2   . LEU A  1  588  ? 51.451  -137.471 156.416 1.00 50.54  ? 588  LEU A CD2   1 
ATOM   4560  N  N     . GLN A  1  589  ? 54.624  -140.895 157.221 1.00 58.74  ? 589  GLN A N     1 
ATOM   4561  C  CA    . GLN A  1  589  ? 55.705  -140.980 158.214 1.00 60.30  ? 589  GLN A CA    1 
ATOM   4562  C  C     . GLN A  1  589  ? 56.654  -139.796 158.081 1.00 59.82  ? 589  GLN A C     1 
ATOM   4563  O  O     . GLN A  1  589  ? 57.048  -139.470 156.969 1.00 60.04  ? 589  GLN A O     1 
ATOM   4564  C  CB    . GLN A  1  589  ? 56.505  -142.252 157.988 1.00 62.93  ? 589  GLN A CB    1 
ATOM   4565  C  CG    . GLN A  1  589  ? 57.665  -142.424 158.943 1.00 67.55  ? 589  GLN A CG    1 
ATOM   4566  C  CD    . GLN A  1  589  ? 58.727  -143.368 158.403 1.00 70.93  ? 589  GLN A CD    1 
ATOM   4567  O  OE1   . GLN A  1  589  ? 59.511  -143.000 157.511 1.00 72.15  ? 589  GLN A OE1   1 
ATOM   4568  N  NE2   . GLN A  1  589  ? 58.755  -144.599 158.931 1.00 71.62  ? 589  GLN A NE2   1 
ATOM   4569  N  N     . ARG A  1  590  ? 57.056  -139.173 159.189 1.00 60.04  ? 590  ARG A N     1 
ATOM   4570  C  CA    . ARG A  1  590  ? 57.947  -138.019 159.074 1.00 62.13  ? 590  ARG A CA    1 
ATOM   4571  C  C     . ARG A  1  590  ? 59.282  -138.005 159.834 1.00 64.63  ? 590  ARG A C     1 
ATOM   4572  O  O     . ARG A  1  590  ? 60.332  -138.280 159.237 1.00 64.95  ? 590  ARG A O     1 
ATOM   4573  C  CB    . ARG A  1  590  ? 57.181  -136.730 159.392 1.00 61.67  ? 590  ARG A CB    1 
ATOM   4574  C  CG    . ARG A  1  590  ? 57.916  -135.447 158.971 1.00 60.51  ? 590  ARG A CG    1 
ATOM   4575  C  CD    . ARG A  1  590  ? 56.974  -134.436 158.323 1.00 59.54  ? 590  ARG A CD    1 
ATOM   4576  N  NE    . ARG A  1  590  ? 55.873  -134.085 159.209 1.00 58.29  ? 590  ARG A NE    1 
ATOM   4577  C  CZ    . ARG A  1  590  ? 56.042  -133.477 160.373 1.00 59.21  ? 590  ARG A CZ    1 
ATOM   4578  N  NH1   . ARG A  1  590  ? 57.264  -133.154 160.773 1.00 59.12  ? 590  ARG A NH1   1 
ATOM   4579  N  NH2   . ARG A  1  590  ? 54.996  -133.206 161.138 1.00 59.27  ? 590  ARG A NH2   1 
ATOM   4580  N  N     . PHE A  1  591  ? 59.250  -137.664 161.126 1.00 66.09  ? 591  PHE A N     1 
ATOM   4581  C  CA    . PHE A  1  591  ? 60.463  -137.567 161.963 1.00 67.42  ? 591  PHE A CA    1 
ATOM   4582  C  C     . PHE A  1  591  ? 61.087  -136.178 161.873 1.00 69.07  ? 591  PHE A C     1 
ATOM   4583  O  O     . PHE A  1  591  ? 61.751  -135.848 160.893 1.00 68.25  ? 591  PHE A O     1 
ATOM   4584  C  CB    . PHE A  1  591  ? 61.541  -138.581 161.556 1.00 66.58  ? 591  PHE A CB    1 
ATOM   4585  C  CG    . PHE A  1  591  ? 61.301  -139.963 162.059 1.00 65.26  ? 591  PHE A CG    1 
ATOM   4586  C  CD1   . PHE A  1  591  ? 60.468  -140.831 161.372 1.00 65.23  ? 591  PHE A CD1   1 
ATOM   4587  C  CD2   . PHE A  1  591  ? 61.887  -140.388 163.237 1.00 64.36  ? 591  PHE A CD2   1 
ATOM   4588  C  CE1   . PHE A  1  591  ? 60.218  -142.101 161.851 1.00 64.30  ? 591  PHE A CE1   1 
ATOM   4589  C  CE2   . PHE A  1  591  ? 61.643  -141.655 163.726 1.00 64.94  ? 591  PHE A CE2   1 
ATOM   4590  C  CZ    . PHE A  1  591  ? 60.805  -142.515 163.030 1.00 64.86  ? 591  PHE A CZ    1 
ATOM   4591  N  N     . ASP A  1  592  ? 60.888  -135.364 162.900 1.00 72.12  ? 592  ASP A N     1 
ATOM   4592  C  CA    . ASP A  1  592  ? 61.445  -134.020 162.895 1.00 75.16  ? 592  ASP A CA    1 
ATOM   4593  C  C     . ASP A  1  592  ? 62.838  -134.022 163.505 1.00 76.36  ? 592  ASP A C     1 
ATOM   4594  O  O     . ASP A  1  592  ? 63.827  -133.852 162.797 1.00 77.53  ? 592  ASP A O     1 
ATOM   4595  C  CB    . ASP A  1  592  ? 60.531  -133.042 163.657 1.00 77.09  ? 592  ASP A CB    1 
ATOM   4596  C  CG    . ASP A  1  592  ? 59.308  -132.607 162.838 1.00 78.24  ? 592  ASP A CG    1 
ATOM   4597  O  OD1   . ASP A  1  592  ? 59.503  -132.065 161.723 1.00 78.90  ? 592  ASP A OD1   1 
ATOM   4598  O  OD2   . ASP A  1  592  ? 58.161  -132.801 163.315 1.00 77.59  ? 592  ASP A OD2   1 
ATOM   4599  N  N     . GLU A  1  593  ? 62.922  -134.222 164.813 1.00 76.95  ? 593  GLU A N     1 
ATOM   4600  C  CA    . GLU A  1  593  ? 64.215  -134.234 165.476 1.00 77.82  ? 593  GLU A CA    1 
ATOM   4601  C  C     . GLU A  1  593  ? 64.254  -135.358 166.475 1.00 77.30  ? 593  GLU A C     1 
ATOM   4602  O  O     . GLU A  1  593  ? 64.620  -136.486 166.146 1.00 77.26  ? 593  GLU A O     1 
ATOM   4603  C  CB    . GLU A  1  593  ? 64.443  -132.918 166.201 1.00 80.00  ? 593  GLU A CB    1 
ATOM   4604  C  CG    . GLU A  1  593  ? 64.523  -131.719 165.292 1.00 84.69  ? 593  GLU A CG    1 
ATOM   4605  C  CD    . GLU A  1  593  ? 64.152  -130.427 166.007 1.00 87.98  ? 593  GLU A CD    1 
ATOM   4606  O  OE1   . GLU A  1  593  ? 64.710  -130.172 167.102 1.00 89.16  ? 593  GLU A OE1   1 
ATOM   4607  O  OE2   . GLU A  1  593  ? 63.303  -129.669 165.472 1.00 89.49  ? 593  GLU A OE2   1 
ATOM   4608  N  N     . GLY A  1  594  ? 63.878  -135.044 167.706 1.00 76.60  ? 594  GLY A N     1 
ATOM   4609  C  CA    . GLY A  1  594  ? 63.869  -136.061 168.733 1.00 76.64  ? 594  GLY A CA    1 
ATOM   4610  C  C     . GLY A  1  594  ? 62.752  -137.041 168.445 1.00 76.35  ? 594  GLY A C     1 
ATOM   4611  O  O     . GLY A  1  594  ? 62.031  -137.461 169.352 1.00 77.43  ? 594  GLY A O     1 
ATOM   4612  N  N     . THR A  1  595  ? 62.596  -137.399 167.176 1.00 75.17  ? 595  THR A N     1 
ATOM   4613  C  CA    . THR A  1  595  ? 61.552  -138.329 166.773 1.00 73.96  ? 595  THR A CA    1 
ATOM   4614  C  C     . THR A  1  595  ? 62.131  -139.725 166.881 1.00 72.32  ? 595  THR A C     1 
ATOM   4615  O  O     . THR A  1  595  ? 63.291  -139.925 166.554 1.00 71.48  ? 595  THR A O     1 
ATOM   4616  C  CB    . THR A  1  595  ? 61.104  -138.042 165.340 1.00 74.10  ? 595  THR A CB    1 
ATOM   4617  O  OG1   . THR A  1  595  ? 60.943  -136.623 165.171 1.00 72.30  ? 595  THR A OG1   1 
ATOM   4618  C  CG2   . THR A  1  595  ? 59.774  -138.737 165.064 1.00 74.55  ? 595  THR A CG2   1 
ATOM   4619  N  N     . THR A  1  596  ? 61.333  -140.690 167.324 1.00 71.58  ? 596  THR A N     1 
ATOM   4620  C  CA    . THR A  1  596  ? 61.853  -142.037 167.507 1.00 71.77  ? 596  THR A CA    1 
ATOM   4621  C  C     . THR A  1  596  ? 60.809  -143.131 167.693 1.00 71.52  ? 596  THR A C     1 
ATOM   4622  O  O     . THR A  1  596  ? 60.764  -143.750 168.751 1.00 72.26  ? 596  THR A O     1 
ATOM   4623  C  CB    . THR A  1  596  ? 62.751  -142.086 168.756 1.00 73.25  ? 596  THR A CB    1 
ATOM   4624  O  OG1   . THR A  1  596  ? 62.089  -141.413 169.838 1.00 73.67  ? 596  THR A OG1   1 
ATOM   4625  C  CG2   . THR A  1  596  ? 64.102  -141.443 168.494 1.00 73.65  ? 596  THR A CG2   1 
ATOM   4626  N  N     . LEU A  1  597  ? 59.984  -143.393 166.690 1.00 71.09  ? 597  LEU A N     1 
ATOM   4627  C  CA    . LEU A  1  597  ? 58.957  -144.439 166.799 1.00 70.86  ? 597  LEU A CA    1 
ATOM   4628  C  C     . LEU A  1  597  ? 58.235  -144.475 168.152 1.00 71.40  ? 597  LEU A C     1 
ATOM   4629  O  O     . LEU A  1  597  ? 57.380  -145.327 168.386 1.00 71.59  ? 597  LEU A O     1 
ATOM   4630  C  CB    . LEU A  1  597  ? 59.558  -145.822 166.558 1.00 70.03  ? 597  LEU A CB    1 
ATOM   4631  C  CG    . LEU A  1  597  ? 60.585  -146.020 165.455 1.00 70.24  ? 597  LEU A CG    1 
ATOM   4632  C  CD1   . LEU A  1  597  ? 61.937  -145.414 165.865 1.00 69.67  ? 597  LEU A CD1   1 
ATOM   4633  C  CD2   . LEU A  1  597  ? 60.723  -147.509 165.215 1.00 70.45  ? 597  LEU A CD2   1 
ATOM   4634  N  N     . LEU A  1  598  ? 58.593  -143.563 169.043 1.00 71.64  ? 598  LEU A N     1 
ATOM   4635  C  CA    . LEU A  1  598  ? 57.989  -143.479 170.361 1.00 71.73  ? 598  LEU A CA    1 
ATOM   4636  C  C     . LEU A  1  598  ? 58.157  -142.014 170.731 1.00 71.85  ? 598  LEU A C     1 
ATOM   4637  O  O     . LEU A  1  598  ? 58.057  -141.624 171.892 1.00 71.49  ? 598  LEU A O     1 
ATOM   4638  C  CB    . LEU A  1  598  ? 58.738  -144.392 171.336 1.00 71.53  ? 598  LEU A CB    1 
ATOM   4639  C  CG    . LEU A  1  598  ? 57.944  -144.878 172.555 1.00 72.18  ? 598  LEU A CG    1 
ATOM   4640  C  CD1   . LEU A  1  598  ? 58.412  -146.267 172.946 1.00 72.76  ? 598  LEU A CD1   1 
ATOM   4641  C  CD2   . LEU A  1  598  ? 58.101  -143.915 173.713 1.00 71.09  ? 598  LEU A CD2   1 
ATOM   4642  N  N     . SER A  1  599  ? 58.403  -141.217 169.693 1.00 72.36  ? 599  SER A N     1 
ATOM   4643  C  CA    . SER A  1  599  ? 58.611  -139.782 169.807 1.00 72.00  ? 599  SER A CA    1 
ATOM   4644  C  C     . SER A  1  599  ? 58.117  -139.287 171.140 1.00 70.68  ? 599  SER A C     1 
ATOM   4645  O  O     . SER A  1  599  ? 56.919  -139.164 171.382 1.00 70.83  ? 599  SER A O     1 
ATOM   4646  C  CB    . SER A  1  599  ? 57.899  -139.028 168.680 1.00 72.87  ? 599  SER A CB    1 
ATOM   4647  O  OG    . SER A  1  599  ? 56.495  -139.028 168.864 1.00 73.76  ? 599  SER A OG    1 
ATOM   4648  N  N     . PRO A  1  600  ? 59.053  -139.027 172.041 1.00 69.88  ? 600  PRO A N     1 
ATOM   4649  C  CA    . PRO A  1  600  ? 58.790  -138.538 173.389 1.00 69.87  ? 600  PRO A CA    1 
ATOM   4650  C  C     . PRO A  1  600  ? 58.217  -137.132 173.343 1.00 69.38  ? 600  PRO A C     1 
ATOM   4651  O  O     . PRO A  1  600  ? 57.343  -136.777 174.130 1.00 69.96  ? 600  PRO A O     1 
ATOM   4652  C  CB    . PRO A  1  600  ? 60.164  -138.579 174.027 1.00 70.62  ? 600  PRO A CB    1 
ATOM   4653  C  CG    . PRO A  1  600  ? 61.068  -138.294 172.852 1.00 70.51  ? 600  PRO A CG    1 
ATOM   4654  C  CD    . PRO A  1  600  ? 60.494  -139.183 171.805 1.00 69.61  ? 600  PRO A CD    1 
ATOM   4655  N  N     . LYS A  1  601  ? 58.712  -136.334 172.409 1.00 68.31  ? 601  LYS A N     1 
ATOM   4656  C  CA    . LYS A  1  601  ? 58.235  -134.974 172.275 1.00 67.82  ? 601  LYS A CA    1 
ATOM   4657  C  C     . LYS A  1  601  ? 57.009  -134.904 171.354 1.00 67.92  ? 601  LYS A C     1 
ATOM   4658  O  O     . LYS A  1  601  ? 56.543  -133.814 171.013 1.00 68.53  ? 601  LYS A O     1 
ATOM   4659  C  CB    . LYS A  1  601  ? 59.353  -134.101 171.725 1.00 68.00  ? 601  LYS A CB    1 
ATOM   4660  C  CG    . LYS A  1  601  ? 60.648  -134.244 172.480 1.00 69.68  ? 601  LYS A CG    1 
ATOM   4661  C  CD    . LYS A  1  601  ? 61.728  -133.348 171.902 1.00 70.46  ? 601  LYS A CD    1 
ATOM   4662  C  CE    . LYS A  1  601  ? 61.402  -131.882 172.120 1.00 70.41  ? 601  LYS A CE    1 
ATOM   4663  N  NZ    . LYS A  1  601  ? 62.407  -130.998 171.465 1.00 71.35  ? 601  LYS A NZ    1 
ATOM   4664  N  N     . ASP A  1  602  ? 56.476  -136.065 170.968 1.00 65.96  ? 602  ASP A N     1 
ATOM   4665  C  CA    . ASP A  1  602  ? 55.323  -136.119 170.071 1.00 62.83  ? 602  ASP A CA    1 
ATOM   4666  C  C     . ASP A  1  602  ? 55.749  -135.311 168.838 1.00 62.49  ? 602  ASP A C     1 
ATOM   4667  O  O     . ASP A  1  602  ? 55.145  -134.299 168.499 1.00 62.67  ? 602  ASP A O     1 
ATOM   4668  C  CB    . ASP A  1  602  ? 54.087  -135.501 170.761 1.00 60.77  ? 602  ASP A CB    1 
ATOM   4669  C  CG    . ASP A  1  602  ? 52.768  -136.236 170.431 1.00 59.68  ? 602  ASP A CG    1 
ATOM   4670  O  OD1   . ASP A  1  602  ? 52.777  -137.468 170.189 1.00 57.63  ? 602  ASP A OD1   1 
ATOM   4671  O  OD2   . ASP A  1  602  ? 51.703  -135.575 170.446 1.00 58.25  ? 602  ASP A OD2   1 
ATOM   4672  N  N     . ASN A  1  603  ? 56.828  -135.759 168.201 1.00 61.69  ? 603  ASN A N     1 
ATOM   4673  C  CA    . ASN A  1  603  ? 57.374  -135.115 167.011 1.00 61.56  ? 603  ASN A CA    1 
ATOM   4674  C  C     . ASN A  1  603  ? 56.889  -135.832 165.778 1.00 61.35  ? 603  ASN A C     1 
ATOM   4675  O  O     . ASN A  1  603  ? 55.988  -136.669 165.834 1.00 61.24  ? 603  ASN A O     1 
ATOM   4676  C  CB    . ASN A  1  603  ? 58.895  -135.211 166.982 1.00 64.20  ? 603  ASN A CB    1 
ATOM   4677  C  CG    . ASN A  1  603  ? 59.563  -134.199 167.855 1.00 67.37  ? 603  ASN A CG    1 
ATOM   4678  O  OD1   . ASN A  1  603  ? 59.489  -132.999 167.592 1.00 68.51  ? 603  ASN A OD1   1 
ATOM   4679  N  ND2   . ASN A  1  603  ? 60.238  -134.670 168.908 1.00 68.96  ? 603  ASN A ND2   1 
ATOM   4680  N  N     . GLY A  1  604  ? 57.540  -135.504 164.666 1.00 60.67  ? 604  GLY A N     1 
ATOM   4681  C  CA    . GLY A  1  604  ? 57.239  -136.116 163.388 1.00 59.00  ? 604  GLY A CA    1 
ATOM   4682  C  C     . GLY A  1  604  ? 55.775  -136.397 163.185 1.00 58.37  ? 604  GLY A C     1 
ATOM   4683  O  O     . GLY A  1  604  ? 54.923  -135.605 163.584 1.00 58.62  ? 604  GLY A O     1 
ATOM   4684  N  N     . MET A  1  605  ? 55.482  -137.541 162.581 1.00 57.36  ? 605  MET A N     1 
ATOM   4685  C  CA    . MET A  1  605  ? 54.103  -137.912 162.300 1.00 56.64  ? 605  MET A CA    1 
ATOM   4686  C  C     . MET A  1  605  ? 54.054  -139.323 161.743 1.00 55.43  ? 605  MET A C     1 
ATOM   4687  O  O     . MET A  1  605  ? 54.783  -139.656 160.813 1.00 55.27  ? 605  MET A O     1 
ATOM   4688  C  CB    . MET A  1  605  ? 53.517  -136.944 161.266 1.00 57.23  ? 605  MET A CB    1 
ATOM   4689  C  CG    . MET A  1  605  ? 52.026  -137.067 161.022 1.00 57.23  ? 605  MET A CG    1 
ATOM   4690  S  SD    . MET A  1  605  ? 51.118  -136.522 162.471 1.00 59.29  ? 605  MET A SD    1 
ATOM   4691  C  CE    . MET A  1  605  ? 50.385  -138.061 162.936 1.00 60.17  ? 605  MET A CE    1 
ATOM   4692  N  N     . LEU A  1  606  ? 53.205  -140.159 162.316 1.00 54.68  ? 606  LEU A N     1 
ATOM   4693  C  CA    . LEU A  1  606  ? 53.068  -141.513 161.824 1.00 54.74  ? 606  LEU A CA    1 
ATOM   4694  C  C     . LEU A  1  606  ? 51.599  -141.841 161.703 1.00 55.36  ? 606  LEU A C     1 
ATOM   4695  O  O     . LEU A  1  606  ? 50.879  -141.920 162.699 1.00 55.49  ? 606  LEU A O     1 
ATOM   4696  C  CB    . LEU A  1  606  ? 53.738  -142.510 162.756 1.00 53.87  ? 606  LEU A CB    1 
ATOM   4697  C  CG    . LEU A  1  606  ? 53.407  -143.962 162.417 1.00 53.08  ? 606  LEU A CG    1 
ATOM   4698  C  CD1   . LEU A  1  606  ? 53.902  -144.288 161.028 1.00 52.29  ? 606  LEU A CD1   1 
ATOM   4699  C  CD2   . LEU A  1  606  ? 54.023  -144.877 163.446 1.00 52.06  ? 606  LEU A CD2   1 
ATOM   4700  N  N     . ILE A  1  607  ? 51.161  -142.023 160.469 1.00 55.89  ? 607  ILE A N     1 
ATOM   4701  C  CA    . ILE A  1  607  ? 49.776  -142.341 160.196 1.00 57.45  ? 607  ILE A CA    1 
ATOM   4702  C  C     . ILE A  1  607  ? 49.793  -143.659 159.436 1.00 58.79  ? 607  ILE A C     1 
ATOM   4703  O  O     . ILE A  1  607  ? 50.603  -143.834 158.523 1.00 58.98  ? 607  ILE A O     1 
ATOM   4704  C  CB    . ILE A  1  607  ? 49.127  -141.234 159.324 1.00 57.24  ? 607  ILE A CB    1 
ATOM   4705  C  CG1   . ILE A  1  607  ? 49.341  -139.871 159.990 1.00 56.73  ? 607  ILE A CG1   1 
ATOM   4706  C  CG2   . ILE A  1  607  ? 47.640  -141.514 159.131 1.00 57.05  ? 607  ILE A CG2   1 
ATOM   4707  C  CD1   . ILE A  1  607  ? 49.044  -138.699 159.106 1.00 55.00  ? 607  ILE A CD1   1 
ATOM   4708  N  N     . ILE A  1  608  ? 48.926  -144.591 159.826 1.00 59.40  ? 608  ILE A N     1 
ATOM   4709  C  CA    . ILE A  1  608  ? 48.859  -145.881 159.151 1.00 59.47  ? 608  ILE A CA    1 
ATOM   4710  C  C     . ILE A  1  608  ? 47.426  -146.295 158.855 1.00 60.60  ? 608  ILE A C     1 
ATOM   4711  O  O     . ILE A  1  608  ? 46.544  -146.229 159.721 1.00 59.90  ? 608  ILE A O     1 
ATOM   4712  C  CB    . ILE A  1  608  ? 49.532  -146.977 159.966 1.00 59.14  ? 608  ILE A CB    1 
ATOM   4713  C  CG1   . ILE A  1  608  ? 50.955  -146.552 160.314 1.00 59.09  ? 608  ILE A CG1   1 
ATOM   4714  C  CG2   . ILE A  1  608  ? 49.566  -148.257 159.156 1.00 59.71  ? 608  ILE A CG2   1 
ATOM   4715  C  CD1   . ILE A  1  608  ? 51.761  -147.627 160.976 1.00 58.14  ? 608  ILE A CD1   1 
ATOM   4716  N  N     . ASP A  1  609  ? 47.214  -146.737 157.618 1.00 61.30  ? 609  ASP A N     1 
ATOM   4717  C  CA    . ASP A  1  609  ? 45.893  -147.132 157.143 1.00 61.76  ? 609  ASP A CA    1 
ATOM   4718  C  C     . ASP A  1  609  ? 44.892  -146.048 157.499 1.00 61.17  ? 609  ASP A C     1 
ATOM   4719  O  O     . ASP A  1  609  ? 43.751  -146.322 157.869 1.00 61.97  ? 609  ASP A O     1 
ATOM   4720  C  CB    . ASP A  1  609  ? 45.448  -148.472 157.738 1.00 63.09  ? 609  ASP A CB    1 
ATOM   4721  C  CG    . ASP A  1  609  ? 44.167  -149.005 157.084 1.00 65.01  ? 609  ASP A CG    1 
ATOM   4722  O  OD1   . ASP A  1  609  ? 44.029  -148.890 155.841 1.00 65.10  ? 609  ASP A OD1   1 
ATOM   4723  O  OD2   . ASP A  1  609  ? 43.302  -149.549 157.811 1.00 66.25  ? 609  ASP A OD2   1 
ATOM   4724  N  N     . GLY A  1  610  ? 45.345  -144.806 157.401 1.00 60.17  ? 610  GLY A N     1 
ATOM   4725  C  CA    . GLY A  1  610  ? 44.480  -143.683 157.686 1.00 58.86  ? 610  GLY A CA    1 
ATOM   4726  C  C     . GLY A  1  610  ? 44.128  -143.441 159.134 1.00 57.49  ? 610  GLY A C     1 
ATOM   4727  O  O     . GLY A  1  610  ? 43.008  -143.003 159.426 1.00 57.79  ? 610  GLY A O     1 
ATOM   4728  N  N     . GLN A  1  611  ? 45.062  -143.730 160.037 1.00 55.62  ? 611  GLN A N     1 
ATOM   4729  C  CA    . GLN A  1  611  ? 44.826  -143.499 161.454 1.00 54.91  ? 611  GLN A CA    1 
ATOM   4730  C  C     . GLN A  1  611  ? 46.089  -142.893 162.050 1.00 53.41  ? 611  GLN A C     1 
ATOM   4731  O  O     . GLN A  1  611  ? 47.190  -143.382 161.819 1.00 52.61  ? 611  GLN A O     1 
ATOM   4732  C  CB    . GLN A  1  611  ? 44.453  -144.803 162.176 1.00 56.13  ? 611  GLN A CB    1 
ATOM   4733  C  CG    . GLN A  1  611  ? 43.234  -145.547 161.593 1.00 60.04  ? 611  GLN A CG    1 
ATOM   4734  C  CD    . GLN A  1  611  ? 41.934  -144.720 161.594 1.00 62.04  ? 611  GLN A CD    1 
ATOM   4735  O  OE1   . GLN A  1  611  ? 41.503  -144.242 162.643 1.00 61.92  ? 611  GLN A OE1   1 
ATOM   4736  N  NE2   . GLN A  1  611  ? 41.304  -144.564 160.413 1.00 62.75  ? 611  GLN A NE2   1 
ATOM   4737  N  N     . ILE A  1  612  ? 45.921  -141.802 162.788 1.00 52.35  ? 612  ILE A N     1 
ATOM   4738  C  CA    . ILE A  1  612  ? 47.038  -141.113 163.421 1.00 51.17  ? 612  ILE A CA    1 
ATOM   4739  C  C     . ILE A  1  612  ? 47.580  -141.971 164.554 1.00 51.46  ? 612  ILE A C     1 
ATOM   4740  O  O     . ILE A  1  612  ? 46.856  -142.298 165.505 1.00 50.93  ? 612  ILE A O     1 
ATOM   4741  C  CB    . ILE A  1  612  ? 46.598  -139.750 164.021 1.00 50.97  ? 612  ILE A CB    1 
ATOM   4742  C  CG1   . ILE A  1  612  ? 46.209  -138.774 162.908 1.00 49.06  ? 612  ILE A CG1   1 
ATOM   4743  C  CG2   . ILE A  1  612  ? 47.715  -139.174 164.885 1.00 51.30  ? 612  ILE A CG2   1 
ATOM   4744  C  CD1   . ILE A  1  612  ? 45.676  -137.454 163.420 1.00 46.11  ? 612  ILE A CD1   1 
ATOM   4745  N  N     . ILE A  1  613  ? 48.856  -142.330 164.450 1.00 51.45  ? 613  ILE A N     1 
ATOM   4746  C  CA    . ILE A  1  613  ? 49.499  -143.143 165.470 1.00 50.18  ? 613  ILE A CA    1 
ATOM   4747  C  C     . ILE A  1  613  ? 50.248  -142.290 166.468 1.00 50.53  ? 613  ILE A C     1 
ATOM   4748  O  O     . ILE A  1  613  ? 50.220  -142.561 167.663 1.00 51.02  ? 613  ILE A O     1 
ATOM   4749  C  CB    . ILE A  1  613  ? 50.467  -144.124 164.866 1.00 48.38  ? 613  ILE A CB    1 
ATOM   4750  C  CG1   . ILE A  1  613  ? 49.700  -145.167 164.081 1.00 46.27  ? 613  ILE A CG1   1 
ATOM   4751  C  CG2   . ILE A  1  613  ? 51.255  -144.792 165.951 1.00 48.77  ? 613  ILE A CG2   1 
ATOM   4752  C  CD1   . ILE A  1  613  ? 50.593  -146.104 163.377 1.00 46.86  ? 613  ILE A CD1   1 
ATOM   4753  N  N     . PHE A  1  614  ? 50.934  -141.264 165.989 1.00 51.28  ? 614  PHE A N     1 
ATOM   4754  C  CA    . PHE A  1  614  ? 51.637  -140.393 166.915 1.00 53.24  ? 614  PHE A CA    1 
ATOM   4755  C  C     . PHE A  1  614  ? 52.118  -139.089 166.291 1.00 53.08  ? 614  PHE A C     1 
ATOM   4756  O  O     . PHE A  1  614  ? 52.287  -138.984 165.073 1.00 54.12  ? 614  PHE A O     1 
ATOM   4757  C  CB    . PHE A  1  614  ? 52.809  -141.147 167.577 1.00 53.80  ? 614  PHE A CB    1 
ATOM   4758  C  CG    . PHE A  1  614  ? 54.053  -141.268 166.718 1.00 53.04  ? 614  PHE A CG    1 
ATOM   4759  C  CD1   . PHE A  1  614  ? 54.912  -140.178 166.547 1.00 52.25  ? 614  PHE A CD1   1 
ATOM   4760  C  CD2   . PHE A  1  614  ? 54.394  -142.483 166.132 1.00 51.92  ? 614  PHE A CD2   1 
ATOM   4761  C  CE1   . PHE A  1  614  ? 56.086  -140.296 165.818 1.00 50.75  ? 614  PHE A CE1   1 
ATOM   4762  C  CE2   . PHE A  1  614  ? 55.566  -142.609 165.403 1.00 50.86  ? 614  PHE A CE2   1 
ATOM   4763  C  CZ    . PHE A  1  614  ? 56.415  -141.510 165.247 1.00 50.83  ? 614  PHE A CZ    1 
ATOM   4764  N  N     . GLY A  1  615  ? 52.330  -138.090 167.138 1.00 52.04  ? 615  GLY A N     1 
ATOM   4765  C  CA    . GLY A  1  615  ? 52.796  -136.814 166.647 1.00 50.77  ? 615  GLY A CA    1 
ATOM   4766  C  C     . GLY A  1  615  ? 51.675  -135.808 166.554 1.00 50.28  ? 615  GLY A C     1 
ATOM   4767  O  O     . GLY A  1  615  ? 50.546  -136.157 166.221 1.00 48.55  ? 615  GLY A O     1 
ATOM   4768  N  N     . VAL A  1  616  ? 51.992  -134.559 166.874 1.00 50.64  ? 616  VAL A N     1 
ATOM   4769  C  CA    . VAL A  1  616  ? 51.025  -133.480 166.809 1.00 51.37  ? 616  VAL A CA    1 
ATOM   4770  C  C     . VAL A  1  616  ? 50.789  -133.148 165.340 1.00 53.91  ? 616  VAL A C     1 
ATOM   4771  O  O     . VAL A  1  616  ? 51.698  -133.254 164.500 1.00 55.81  ? 616  VAL A O     1 
ATOM   4772  C  CB    . VAL A  1  616  ? 51.540  -132.218 167.516 1.00 50.43  ? 616  VAL A CB    1 
ATOM   4773  C  CG1   . VAL A  1  616  ? 50.520  -131.114 167.420 1.00 50.67  ? 616  VAL A CG1   1 
ATOM   4774  C  CG2   . VAL A  1  616  ? 51.832  -132.521 168.960 1.00 52.00  ? 616  VAL A CG2   1 
ATOM   4775  N  N     . VAL A  1  617  ? 49.563  -132.755 165.022 1.00 53.31  ? 617  VAL A N     1 
ATOM   4776  C  CA    . VAL A  1  617  ? 49.235  -132.405 163.656 1.00 50.68  ? 617  VAL A CA    1 
ATOM   4777  C  C     . VAL A  1  617  ? 49.219  -130.899 163.506 1.00 49.61  ? 617  VAL A C     1 
ATOM   4778  O  O     . VAL A  1  617  ? 48.384  -130.219 164.099 1.00 48.91  ? 617  VAL A O     1 
ATOM   4779  C  CB    . VAL A  1  617  ? 47.872  -132.951 163.272 1.00 50.49  ? 617  VAL A CB    1 
ATOM   4780  C  CG1   . VAL A  1  617  ? 47.445  -132.378 161.935 1.00 51.30  ? 617  VAL A CG1   1 
ATOM   4781  C  CG2   . VAL A  1  617  ? 47.932  -134.462 163.221 1.00 49.72  ? 617  VAL A CG2   1 
ATOM   4782  N  N     . GLU A  1  618  ? 50.165  -130.383 162.733 1.00 48.00  ? 618  GLU A N     1 
ATOM   4783  C  CA    . GLU A  1  618  ? 50.233  -128.959 162.476 1.00 46.66  ? 618  GLU A CA    1 
ATOM   4784  C  C     . GLU A  1  618  ? 50.678  -128.752 161.033 1.00 44.59  ? 618  GLU A C     1 
ATOM   4785  O  O     . GLU A  1  618  ? 50.721  -129.702 160.257 1.00 44.15  ? 618  GLU A O     1 
ATOM   4786  C  CB    . GLU A  1  618  ? 51.169  -128.276 163.472 1.00 48.04  ? 618  GLU A CB    1 
ATOM   4787  C  CG    . GLU A  1  618  ? 52.466  -129.002 163.669 1.00 52.76  ? 618  GLU A CG    1 
ATOM   4788  C  CD    . GLU A  1  618  ? 53.366  -128.920 162.454 1.00 54.71  ? 618  GLU A CD    1 
ATOM   4789  O  OE1   . GLU A  1  618  ? 54.225  -128.002 162.406 1.00 54.35  ? 618  GLU A OE1   1 
ATOM   4790  O  OE2   . GLU A  1  618  ? 53.195  -129.773 161.550 1.00 55.23  ? 618  GLU A OE2   1 
ATOM   4791  N  N     . LYS A  1  619  ? 51.008  -127.517 160.681 1.00 42.11  ? 619  LYS A N     1 
ATOM   4792  C  CA    . LYS A  1  619  ? 51.401  -127.164 159.322 1.00 40.14  ? 619  LYS A CA    1 
ATOM   4793  C  C     . LYS A  1  619  ? 52.202  -128.164 158.491 1.00 39.34  ? 619  LYS A C     1 
ATOM   4794  O  O     . LYS A  1  619  ? 51.799  -128.487 157.386 1.00 39.77  ? 619  LYS A O     1 
ATOM   4795  C  CB    . LYS A  1  619  ? 52.129  -125.830 159.341 1.00 39.83  ? 619  LYS A CB    1 
ATOM   4796  C  CG    . LYS A  1  619  ? 52.063  -125.066 158.037 1.00 40.60  ? 619  LYS A CG    1 
ATOM   4797  C  CD    . LYS A  1  619  ? 52.491  -123.617 158.273 1.00 43.19  ? 619  LYS A CD    1 
ATOM   4798  C  CE    . LYS A  1  619  ? 52.322  -122.733 157.044 1.00 44.47  ? 619  LYS A CE    1 
ATOM   4799  N  NZ    . LYS A  1  619  ? 52.765  -121.336 157.314 1.00 45.24  ? 619  LYS A NZ    1 
ATOM   4800  N  N     . LYS A  1  620  ? 53.328  -128.651 159.002 1.00 38.54  ? 620  LYS A N     1 
ATOM   4801  C  CA    . LYS A  1  620  ? 54.171  -129.592 158.257 1.00 38.72  ? 620  LYS A CA    1 
ATOM   4802  C  C     . LYS A  1  620  ? 53.428  -130.849 157.819 1.00 38.98  ? 620  LYS A C     1 
ATOM   4803  O  O     . LYS A  1  620  ? 53.899  -131.591 156.957 1.00 40.01  ? 620  LYS A O     1 
ATOM   4804  C  CB    . LYS A  1  620  ? 55.371  -130.023 159.104 1.00 39.77  ? 620  LYS A CB    1 
ATOM   4805  C  CG    . LYS A  1  620  ? 56.111  -128.892 159.784 1.00 43.99  ? 620  LYS A CG    1 
ATOM   4806  C  CD    . LYS A  1  620  ? 56.902  -129.385 160.995 1.00 47.37  ? 620  LYS A CD    1 
ATOM   4807  C  CE    . LYS A  1  620  ? 57.346  -128.205 161.869 1.00 50.83  ? 620  LYS A CE    1 
ATOM   4808  N  NZ    . LYS A  1  620  ? 57.780  -128.612 163.247 1.00 52.69  ? 620  LYS A NZ    1 
ATOM   4809  N  N     . THR A  1  621  ? 52.264  -131.087 158.408 1.00 38.83  ? 621  THR A N     1 
ATOM   4810  C  CA    . THR A  1  621  ? 51.496  -132.290 158.111 1.00 37.74  ? 621  THR A CA    1 
ATOM   4811  C  C     . THR A  1  621  ? 50.273  -132.065 157.243 1.00 37.67  ? 621  THR A C     1 
ATOM   4812  O  O     . THR A  1  621  ? 49.991  -132.815 156.309 1.00 36.80  ? 621  THR A O     1 
ATOM   4813  C  CB    . THR A  1  621  ? 50.955  -132.940 159.412 1.00 37.39  ? 621  THR A CB    1 
ATOM   4814  O  OG1   . THR A  1  621  ? 51.952  -132.902 160.444 1.00 36.95  ? 621  THR A OG1   1 
ATOM   4815  C  CG2   . THR A  1  621  ? 50.525  -134.373 159.138 1.00 35.70  ? 621  THR A CG2   1 
ATOM   4816  N  N     . VAL A  1  622  ? 49.543  -131.016 157.585 1.00 37.97  ? 622  VAL A N     1 
ATOM   4817  C  CA    . VAL A  1  622  ? 48.291  -130.722 156.940 1.00 37.68  ? 622  VAL A CA    1 
ATOM   4818  C  C     . VAL A  1  622  ? 48.276  -129.397 156.182 1.00 38.16  ? 622  VAL A C     1 
ATOM   4819  O  O     . VAL A  1  622  ? 47.234  -128.928 155.732 1.00 37.62  ? 622  VAL A O     1 
ATOM   4820  C  CB    . VAL A  1  622  ? 47.194  -130.791 158.033 1.00 37.65  ? 622  VAL A CB    1 
ATOM   4821  C  CG1   . VAL A  1  622  ? 47.363  -129.656 159.023 1.00 37.02  ? 622  VAL A CG1   1 
ATOM   4822  C  CG2   . VAL A  1  622  ? 45.842  -130.806 157.423 1.00 38.73  ? 622  VAL A CG2   1 
ATOM   4823  N  N     . GLY A  1  623  ? 49.444  -128.787 156.043 1.00 39.70  ? 623  GLY A N     1 
ATOM   4824  C  CA    . GLY A  1  623  ? 49.532  -127.540 155.305 1.00 40.60  ? 623  GLY A CA    1 
ATOM   4825  C  C     . GLY A  1  623  ? 49.772  -127.914 153.856 1.00 41.84  ? 623  GLY A C     1 
ATOM   4826  O  O     . GLY A  1  623  ? 49.658  -129.097 153.499 1.00 43.31  ? 623  GLY A O     1 
ATOM   4827  N  N     . SER A  1  624  ? 50.103  -126.938 153.015 1.00 42.13  ? 624  SER A N     1 
ATOM   4828  C  CA    . SER A  1  624  ? 50.357  -127.223 151.599 1.00 42.69  ? 624  SER A CA    1 
ATOM   4829  C  C     . SER A  1  624  ? 51.803  -127.671 151.456 1.00 43.65  ? 624  SER A C     1 
ATOM   4830  O  O     . SER A  1  624  ? 52.480  -127.361 150.467 1.00 43.28  ? 624  SER A O     1 
ATOM   4831  C  CB    . SER A  1  624  ? 50.119  -125.981 150.743 1.00 42.48  ? 624  SER A CB    1 
ATOM   4832  O  OG    . SER A  1  624  ? 50.975  -124.930 151.155 1.00 44.02  ? 624  SER A OG    1 
ATOM   4833  N  N     . SER A  1  625  ? 52.261  -128.403 152.471 1.00 43.86  ? 625  SER A N     1 
ATOM   4834  C  CA    . SER A  1  625  ? 53.621  -128.924 152.536 1.00 42.83  ? 625  SER A CA    1 
ATOM   4835  C  C     . SER A  1  625  ? 53.863  -129.986 151.465 1.00 41.69  ? 625  SER A C     1 
ATOM   4836  O  O     . SER A  1  625  ? 52.913  -130.596 150.969 1.00 41.68  ? 625  SER A O     1 
ATOM   4837  C  CB    . SER A  1  625  ? 53.883  -129.508 153.938 1.00 42.20  ? 625  SER A CB    1 
ATOM   4838  O  OG    . SER A  1  625  ? 53.011  -130.588 154.233 1.00 41.03  ? 625  SER A OG    1 
ATOM   4839  N  N     . ASN A  1  626  ? 55.134  -130.209 151.127 1.00 40.22  ? 626  ASN A N     1 
ATOM   4840  C  CA    . ASN A  1  626  ? 55.509  -131.188 150.117 1.00 40.19  ? 626  ASN A CA    1 
ATOM   4841  C  C     . ASN A  1  626  ? 55.072  -132.638 150.404 1.00 39.74  ? 626  ASN A C     1 
ATOM   4842  O  O     . ASN A  1  626  ? 54.281  -133.218 149.669 1.00 39.23  ? 626  ASN A O     1 
ATOM   4843  C  CB    . ASN A  1  626  ? 57.012  -131.122 149.884 1.00 40.84  ? 626  ASN A CB    1 
ATOM   4844  C  CG    . ASN A  1  626  ? 57.379  -131.341 148.422 1.00 44.34  ? 626  ASN A CG    1 
ATOM   4845  O  OD1   . ASN A  1  626  ? 57.174  -132.435 147.879 1.00 45.92  ? 626  ASN A OD1   1 
ATOM   4846  N  ND2   . ASN A  1  626  ? 57.912  -130.294 147.768 1.00 44.47  ? 626  ASN A ND2   1 
ATOM   4847  N  N     . GLY A  1  627  ? 55.571  -133.243 151.467 1.00 40.01  ? 627  GLY A N     1 
ATOM   4848  C  CA    . GLY A  1  627  ? 55.143  -134.603 151.742 1.00 40.68  ? 627  GLY A CA    1 
ATOM   4849  C  C     . GLY A  1  627  ? 53.781  -134.652 152.409 1.00 40.77  ? 627  GLY A C     1 
ATOM   4850  O  O     . GLY A  1  627  ? 53.396  -135.682 152.969 1.00 41.16  ? 627  GLY A O     1 
ATOM   4851  N  N     . GLY A  1  628  ? 53.056  -133.534 152.314 1.00 40.45  ? 628  GLY A N     1 
ATOM   4852  C  CA    . GLY A  1  628  ? 51.735  -133.352 152.919 1.00 38.79  ? 628  GLY A CA    1 
ATOM   4853  C  C     . GLY A  1  628  ? 50.652  -134.429 152.990 1.00 36.51  ? 628  GLY A C     1 
ATOM   4854  O  O     . GLY A  1  628  ? 50.488  -135.256 152.092 1.00 36.72  ? 628  GLY A O     1 
ATOM   4855  N  N     . LEU A  1  629  ? 49.903  -134.412 154.090 1.00 33.42  ? 629  LEU A N     1 
ATOM   4856  C  CA    . LEU A  1  629  ? 48.806  -135.344 154.276 1.00 29.76  ? 629  LEU A CA    1 
ATOM   4857  C  C     . LEU A  1  629  ? 47.949  -135.111 153.019 1.00 29.28  ? 629  LEU A C     1 
ATOM   4858  O  O     . LEU A  1  629  ? 47.318  -136.016 152.486 1.00 27.90  ? 629  LEU A O     1 
ATOM   4859  C  CB    . LEU A  1  629  ? 48.060  -134.988 155.581 1.00 25.00  ? 629  LEU A CB    1 
ATOM   4860  C  CG    . LEU A  1  629  ? 46.870  -135.775 156.161 1.00 21.11  ? 629  LEU A CG    1 
ATOM   4861  C  CD1   . LEU A  1  629  ? 45.589  -135.117 155.763 1.00 19.47  ? 629  LEU A CD1   1 
ATOM   4862  C  CD2   . LEU A  1  629  ? 46.886  -137.215 155.720 1.00 18.72  ? 629  LEU A CD2   1 
ATOM   4863  N  N     . ILE A  1  630  ? 47.981  -133.880 152.528 1.00 29.68  ? 630  ILE A N     1 
ATOM   4864  C  CA    . ILE A  1  630  ? 47.240  -133.510 151.338 1.00 29.49  ? 630  ILE A CA    1 
ATOM   4865  C  C     . ILE A  1  630  ? 47.938  -133.998 150.075 1.00 30.13  ? 630  ILE A C     1 
ATOM   4866  O  O     . ILE A  1  630  ? 47.323  -134.683 149.265 1.00 30.28  ? 630  ILE A O     1 
ATOM   4867  C  CB    . ILE A  1  630  ? 47.084  -132.009 151.271 1.00 28.73  ? 630  ILE A CB    1 
ATOM   4868  C  CG1   . ILE A  1  630  ? 46.325  -131.557 152.494 1.00 28.47  ? 630  ILE A CG1   1 
ATOM   4869  C  CG2   . ILE A  1  630  ? 46.333  -131.611 150.041 1.00 25.49  ? 630  ILE A CG2   1 
ATOM   4870  C  CD1   . ILE A  1  630  ? 46.196  -130.101 152.557 1.00 33.18  ? 630  ILE A CD1   1 
ATOM   4871  N  N     . HIS A  1  631  ? 49.215  -133.650 149.906 1.00 30.25  ? 631  HIS A N     1 
ATOM   4872  C  CA    . HIS A  1  631  ? 49.970  -134.083 148.726 1.00 29.62  ? 631  HIS A CA    1 
ATOM   4873  C  C     . HIS A  1  631  ? 49.782  -135.587 148.497 1.00 28.27  ? 631  HIS A C     1 
ATOM   4874  O  O     . HIS A  1  631  ? 49.766  -136.064 147.358 1.00 28.01  ? 631  HIS A O     1 
ATOM   4875  C  CB    . HIS A  1  631  ? 51.471  -133.774 148.883 1.00 30.56  ? 631  HIS A CB    1 
ATOM   4876  C  CG    . HIS A  1  631  ? 52.248  -133.876 147.600 1.00 32.14  ? 631  HIS A CG    1 
ATOM   4877  N  ND1   . HIS A  1  631  ? 51.651  -134.140 146.384 1.00 32.77  ? 631  HIS A ND1   1 
ATOM   4878  C  CD2   . HIS A  1  631  ? 53.566  -133.706 147.337 1.00 31.81  ? 631  HIS A CD2   1 
ATOM   4879  C  CE1   . HIS A  1  631  ? 52.566  -134.125 145.430 1.00 32.75  ? 631  HIS A CE1   1 
ATOM   4880  N  NE2   . HIS A  1  631  ? 53.736  -133.862 145.983 1.00 32.56  ? 631  HIS A NE2   1 
ATOM   4881  N  N     . VAL A  1  632  ? 49.624  -136.324 149.587 1.00 26.90  ? 632  VAL A N     1 
ATOM   4882  C  CA    . VAL A  1  632  ? 49.444  -137.769 149.516 1.00 27.38  ? 632  VAL A CA    1 
ATOM   4883  C  C     . VAL A  1  632  ? 48.008  -138.178 149.191 1.00 27.25  ? 632  VAL A C     1 
ATOM   4884  O  O     . VAL A  1  632  ? 47.756  -138.908 148.234 1.00 27.60  ? 632  VAL A O     1 
ATOM   4885  C  CB    . VAL A  1  632  ? 49.827  -138.452 150.852 1.00 27.37  ? 632  VAL A CB    1 
ATOM   4886  C  CG1   . VAL A  1  632  ? 49.765  -139.968 150.696 1.00 25.60  ? 632  VAL A CG1   1 
ATOM   4887  C  CG2   . VAL A  1  632  ? 51.209  -137.990 151.311 1.00 26.38  ? 632  VAL A CG2   1 
ATOM   4888  N  N     . VAL A  1  633  ? 47.065  -137.721 150.000 1.00 26.98  ? 633  VAL A N     1 
ATOM   4889  C  CA    . VAL A  1  633  ? 45.692  -138.084 149.764 1.00 26.30  ? 633  VAL A CA    1 
ATOM   4890  C  C     . VAL A  1  633  ? 45.285  -137.739 148.343 1.00 27.31  ? 633  VAL A C     1 
ATOM   4891  O  O     . VAL A  1  633  ? 44.501  -138.453 147.747 1.00 28.04  ? 633  VAL A O     1 
ATOM   4892  C  CB    . VAL A  1  633  ? 44.740  -137.385 150.739 1.00 26.34  ? 633  VAL A CB    1 
ATOM   4893  C  CG1   . VAL A  1  633  ? 43.333  -137.934 150.552 1.00 25.89  ? 633  VAL A CG1   1 
ATOM   4894  C  CG2   . VAL A  1  633  ? 45.200  -137.595 152.164 1.00 25.37  ? 633  VAL A CG2   1 
ATOM   4895  N  N     . THR A  1  634  ? 45.810  -136.655 147.782 1.00 29.36  ? 634  THR A N     1 
ATOM   4896  C  CA    . THR A  1  634  ? 45.429  -136.298 146.408 1.00 31.08  ? 634  THR A CA    1 
ATOM   4897  C  C     . THR A  1  634  ? 45.889  -137.375 145.449 1.00 33.09  ? 634  THR A C     1 
ATOM   4898  O  O     . THR A  1  634  ? 45.083  -137.993 144.739 1.00 32.28  ? 634  THR A O     1 
ATOM   4899  C  CB    . THR A  1  634  ? 46.057  -134.969 145.912 1.00 29.19  ? 634  THR A CB    1 
ATOM   4900  O  OG1   . THR A  1  634  ? 45.652  -133.883 146.752 1.00 27.75  ? 634  THR A OG1   1 
ATOM   4901  C  CG2   . THR A  1  634  ? 45.597  -134.686 144.486 1.00 26.91  ? 634  THR A CG2   1 
ATOM   4902  N  N     . ARG A  1  635  ? 47.206  -137.573 145.439 1.00 35.98  ? 635  ARG A N     1 
ATOM   4903  C  CA    . ARG A  1  635  ? 47.857  -138.557 144.587 1.00 38.49  ? 635  ARG A CA    1 
ATOM   4904  C  C     . ARG A  1  635  ? 47.276  -139.949 144.789 1.00 39.19  ? 635  ARG A C     1 
ATOM   4905  O  O     . ARG A  1  635  ? 46.844  -140.603 143.838 1.00 39.81  ? 635  ARG A O     1 
ATOM   4906  C  CB    . ARG A  1  635  ? 49.360  -138.597 144.890 1.00 38.73  ? 635  ARG A CB    1 
ATOM   4907  C  CG    . ARG A  1  635  ? 50.158  -137.393 144.426 1.00 39.37  ? 635  ARG A CG    1 
ATOM   4908  C  CD    . ARG A  1  635  ? 50.978  -137.713 143.164 1.00 39.74  ? 635  ARG A CD    1 
ATOM   4909  N  NE    . ARG A  1  635  ? 50.633  -136.800 142.086 1.00 39.32  ? 635  ARG A NE    1 
ATOM   4910  C  CZ    . ARG A  1  635  ? 49.465  -136.806 141.454 1.00 39.35  ? 635  ARG A CZ    1 
ATOM   4911  N  NH1   . ARG A  1  635  ? 48.534  -137.695 141.783 1.00 37.27  ? 635  ARG A NH1   1 
ATOM   4912  N  NH2   . ARG A  1  635  ? 49.211  -135.889 140.524 1.00 39.69  ? 635  ARG A NH2   1 
ATOM   4913  N  N     . GLU A  1  636  ? 47.251  -140.380 146.042 1.00 40.03  ? 636  GLU A N     1 
ATOM   4914  C  CA    . GLU A  1  636  ? 46.777  -141.706 146.391 1.00 42.05  ? 636  GLU A CA    1 
ATOM   4915  C  C     . GLU A  1  636  ? 45.301  -141.992 146.146 1.00 41.73  ? 636  GLU A C     1 
ATOM   4916  O  O     . GLU A  1  636  ? 44.949  -143.036 145.599 1.00 42.13  ? 636  GLU A O     1 
ATOM   4917  C  CB    . GLU A  1  636  ? 47.097  -141.986 147.858 1.00 45.44  ? 636  GLU A CB    1 
ATOM   4918  C  CG    . GLU A  1  636  ? 47.534  -143.423 148.158 1.00 50.66  ? 636  GLU A CG    1 
ATOM   4919  C  CD    . GLU A  1  636  ? 48.953  -143.728 147.679 1.00 54.80  ? 636  GLU A CD    1 
ATOM   4920  O  OE1   . GLU A  1  636  ? 49.143  -144.012 146.471 1.00 57.31  ? 636  GLU A OE1   1 
ATOM   4921  O  OE2   . GLU A  1  636  ? 49.887  -143.672 148.517 1.00 56.98  ? 636  GLU A OE2   1 
ATOM   4922  N  N     . LYS A  1  637  ? 44.433  -141.072 146.541 1.00 41.03  ? 637  LYS A N     1 
ATOM   4923  C  CA    . LYS A  1  637  ? 43.001  -141.302 146.404 1.00 39.46  ? 637  LYS A CA    1 
ATOM   4924  C  C     . LYS A  1  637  ? 42.249  -140.514 145.330 1.00 39.50  ? 637  LYS A C     1 
ATOM   4925  O  O     . LYS A  1  637  ? 41.109  -140.848 145.027 1.00 39.21  ? 637  LYS A O     1 
ATOM   4926  C  CB    . LYS A  1  637  ? 42.326  -141.079 147.765 1.00 38.68  ? 637  LYS A CB    1 
ATOM   4927  C  CG    . LYS A  1  637  ? 42.854  -141.959 148.887 1.00 38.37  ? 637  LYS A CG    1 
ATOM   4928  C  CD    . LYS A  1  637  ? 42.623  -143.428 148.571 1.00 39.79  ? 637  LYS A CD    1 
ATOM   4929  C  CE    . LYS A  1  637  ? 42.941  -144.328 149.761 1.00 40.53  ? 637  LYS A CE    1 
ATOM   4930  N  NZ    . LYS A  1  637  ? 42.747  -145.779 149.452 1.00 40.41  ? 637  LYS A NZ    1 
ATOM   4931  N  N     . GLY A  1  638  ? 42.852  -139.473 144.761 1.00 38.84  ? 638  GLY A N     1 
ATOM   4932  C  CA    . GLY A  1  638  ? 42.145  -138.718 143.737 1.00 38.54  ? 638  GLY A CA    1 
ATOM   4933  C  C     . GLY A  1  638  ? 41.751  -137.303 144.116 1.00 38.15  ? 638  GLY A C     1 
ATOM   4934  O  O     . GLY A  1  638  ? 41.431  -137.039 145.263 1.00 38.14  ? 638  GLY A O     1 
ATOM   4935  N  N     . PRO A  1  639  ? 41.722  -136.373 143.154 1.00 38.71  ? 639  PRO A N     1 
ATOM   4936  C  CA    . PRO A  1  639  ? 41.361  -134.992 143.469 1.00 38.10  ? 639  PRO A CA    1 
ATOM   4937  C  C     . PRO A  1  639  ? 40.057  -134.891 144.223 1.00 38.07  ? 639  PRO A C     1 
ATOM   4938  O  O     . PRO A  1  639  ? 39.908  -134.069 145.118 1.00 37.93  ? 639  PRO A O     1 
ATOM   4939  C  CB    . PRO A  1  639  ? 41.278  -134.338 142.095 1.00 37.45  ? 639  PRO A CB    1 
ATOM   4940  C  CG    . PRO A  1  639  ? 40.768  -135.454 141.235 1.00 37.59  ? 639  PRO A CG    1 
ATOM   4941  C  CD    . PRO A  1  639  ? 41.621  -136.615 141.703 1.00 38.93  ? 639  PRO A CD    1 
ATOM   4942  N  N     . GLN A  1  640  ? 39.121  -135.754 143.861 1.00 39.09  ? 640  GLN A N     1 
ATOM   4943  C  CA    . GLN A  1  640  ? 37.797  -135.756 144.462 1.00 40.83  ? 640  GLN A CA    1 
ATOM   4944  C  C     . GLN A  1  640  ? 37.834  -136.016 145.945 1.00 39.95  ? 640  GLN A C     1 
ATOM   4945  O  O     . GLN A  1  640  ? 37.318  -135.237 146.744 1.00 39.52  ? 640  GLN A O     1 
ATOM   4946  C  CB    . GLN A  1  640  ? 36.940  -136.826 143.818 1.00 45.06  ? 640  GLN A CB    1 
ATOM   4947  C  CG    . GLN A  1  640  ? 37.167  -136.974 142.336 1.00 52.92  ? 640  GLN A CG    1 
ATOM   4948  C  CD    . GLN A  1  640  ? 37.009  -135.662 141.592 1.00 56.38  ? 640  GLN A CD    1 
ATOM   4949  O  OE1   . GLN A  1  640  ? 36.189  -134.802 141.973 1.00 57.69  ? 640  GLN A OE1   1 
ATOM   4950  N  NE2   . GLN A  1  640  ? 37.782  -135.502 140.509 1.00 58.24  ? 640  GLN A NE2   1 
ATOM   4951  N  N     . VAL A  1  641  ? 38.431  -137.142 146.307 1.00 39.13  ? 641  VAL A N     1 
ATOM   4952  C  CA    . VAL A  1  641  ? 38.530  -137.532 147.701 1.00 36.76  ? 641  VAL A CA    1 
ATOM   4953  C  C     . VAL A  1  641  ? 39.223  -136.465 148.528 1.00 36.07  ? 641  VAL A C     1 
ATOM   4954  O  O     . VAL A  1  641  ? 38.694  -136.028 149.546 1.00 36.16  ? 641  VAL A O     1 
ATOM   4955  C  CB    . VAL A  1  641  ? 39.293  -138.844 147.837 1.00 36.18  ? 641  VAL A CB    1 
ATOM   4956  C  CG1   . VAL A  1  641  ? 39.312  -139.293 149.283 1.00 35.90  ? 641  VAL A CG1   1 
ATOM   4957  C  CG2   . VAL A  1  641  ? 38.659  -139.878 146.950 1.00 34.67  ? 641  VAL A CG2   1 
ATOM   4958  N  N     . CYS A  1  642  ? 40.404  -136.049 148.082 1.00 34.76  ? 642  CYS A N     1 
ATOM   4959  C  CA    . CYS A  1  642  ? 41.170  -135.039 148.789 1.00 34.71  ? 642  CYS A CA    1 
ATOM   4960  C  C     . CYS A  1  642  ? 40.384  -133.758 148.930 1.00 33.53  ? 642  CYS A C     1 
ATOM   4961  O  O     . CYS A  1  642  ? 40.549  -133.016 149.904 1.00 32.90  ? 642  CYS A O     1 
ATOM   4962  C  CB    . CYS A  1  642  ? 42.465  -134.739 148.053 1.00 36.37  ? 642  CYS A CB    1 
ATOM   4963  S  SG    . CYS A  1  642  ? 43.574  -133.615 148.948 1.00 41.43  ? 642  CYS A SG    1 
ATOM   4964  N  N     . ALA A  1  643  ? 39.535  -133.489 147.949 1.00 32.28  ? 643  ALA A N     1 
ATOM   4965  C  CA    . ALA A  1  643  ? 38.734  -132.284 147.997 1.00 31.51  ? 643  ALA A CA    1 
ATOM   4966  C  C     . ALA A  1  643  ? 37.835  -132.355 149.210 1.00 31.21  ? 643  ALA A C     1 
ATOM   4967  O  O     . ALA A  1  643  ? 37.788  -131.421 150.007 1.00 31.28  ? 643  ALA A O     1 
ATOM   4968  C  CB    . ALA A  1  643  ? 37.920  -132.149 146.751 1.00 31.56  ? 643  ALA A CB    1 
ATOM   4969  N  N     . LYS A  1  644  ? 37.133  -133.468 149.374 1.00 31.10  ? 644  LYS A N     1 
ATOM   4970  C  CA    . LYS A  1  644  ? 36.267  -133.577 150.529 1.00 31.49  ? 644  LYS A CA    1 
ATOM   4971  C  C     . LYS A  1  644  ? 37.024  -133.692 151.866 1.00 30.85  ? 644  LYS A C     1 
ATOM   4972  O  O     . LYS A  1  644  ? 36.427  -133.550 152.935 1.00 29.32  ? 644  LYS A O     1 
ATOM   4973  C  CB    . LYS A  1  644  ? 35.301  -134.741 150.372 1.00 33.67  ? 644  LYS A CB    1 
ATOM   4974  C  CG    . LYS A  1  644  ? 34.140  -134.581 151.348 1.00 39.66  ? 644  LYS A CG    1 
ATOM   4975  C  CD    . LYS A  1  644  ? 32.903  -135.403 151.006 1.00 42.76  ? 644  LYS A CD    1 
ATOM   4976  C  CE    . LYS A  1  644  ? 31.746  -135.014 151.934 1.00 43.27  ? 644  LYS A CE    1 
ATOM   4977  N  NZ    . LYS A  1  644  ? 30.553  -135.907 151.789 1.00 45.86  ? 644  LYS A NZ    1 
ATOM   4978  N  N     . LEU A  1  645  ? 38.334  -133.936 151.801 1.00 30.21  ? 645  LEU A N     1 
ATOM   4979  C  CA    . LEU A  1  645  ? 39.173  -134.047 152.995 1.00 28.93  ? 645  LEU A CA    1 
ATOM   4980  C  C     . LEU A  1  645  ? 39.320  -132.695 153.698 1.00 29.09  ? 645  LEU A C     1 
ATOM   4981  O  O     . LEU A  1  645  ? 39.382  -132.633 154.927 1.00 29.89  ? 645  LEU A O     1 
ATOM   4982  C  CB    . LEU A  1  645  ? 40.558  -134.566 152.635 1.00 27.88  ? 645  LEU A CB    1 
ATOM   4983  C  CG    . LEU A  1  645  ? 41.497  -134.636 153.836 1.00 27.10  ? 645  LEU A CG    1 
ATOM   4984  C  CD1   . LEU A  1  645  ? 40.971  -135.678 154.816 1.00 25.54  ? 645  LEU A CD1   1 
ATOM   4985  C  CD2   . LEU A  1  645  ? 42.902  -134.977 153.378 1.00 26.44  ? 645  LEU A CD2   1 
ATOM   4986  N  N     . PHE A  1  646  ? 39.420  -131.619 152.920 1.00 28.08  ? 646  PHE A N     1 
ATOM   4987  C  CA    . PHE A  1  646  ? 39.498  -130.283 153.502 1.00 26.72  ? 646  PHE A CA    1 
ATOM   4988  C  C     . PHE A  1  646  ? 38.173  -130.162 154.209 1.00 27.32  ? 646  PHE A C     1 
ATOM   4989  O  O     . PHE A  1  646  ? 38.087  -129.762 155.366 1.00 26.88  ? 646  PHE A O     1 
ATOM   4990  C  CB    . PHE A  1  646  ? 39.566  -129.206 152.418 1.00 25.09  ? 646  PHE A CB    1 
ATOM   4991  C  CG    . PHE A  1  646  ? 40.899  -129.091 151.760 1.00 22.19  ? 646  PHE A CG    1 
ATOM   4992  C  CD1   . PHE A  1  646  ? 41.302  -130.022 150.812 1.00 20.68  ? 646  PHE A CD1   1 
ATOM   4993  C  CD2   . PHE A  1  646  ? 41.788  -128.093 152.157 1.00 20.81  ? 646  PHE A CD2   1 
ATOM   4994  C  CE1   . PHE A  1  646  ? 42.572  -129.970 150.273 1.00 20.66  ? 646  PHE A CE1   1 
ATOM   4995  C  CE2   . PHE A  1  646  ? 43.058  -128.026 151.632 1.00 20.83  ? 646  PHE A CE2   1 
ATOM   4996  C  CZ    . PHE A  1  646  ? 43.457  -128.972 150.683 1.00 22.49  ? 646  PHE A CZ    1 
ATOM   4997  N  N     . GLY A  1  647  ? 37.137  -130.541 153.470 1.00 28.83  ? 647  GLY A N     1 
ATOM   4998  C  CA    . GLY A  1  647  ? 35.781  -130.512 153.977 1.00 30.60  ? 647  GLY A CA    1 
ATOM   4999  C  C     . GLY A  1  647  ? 35.617  -131.101 155.363 1.00 30.18  ? 647  GLY A C     1 
ATOM   5000  O  O     . GLY A  1  647  ? 35.163  -130.415 156.265 1.00 29.99  ? 647  GLY A O     1 
ATOM   5001  N  N     . ASN A  1  648  ? 35.985  -132.363 155.547 1.00 29.65  ? 648  ASN A N     1 
ATOM   5002  C  CA    . ASN A  1  648  ? 35.832  -132.975 156.853 1.00 30.22  ? 648  ASN A CA    1 
ATOM   5003  C  C     . ASN A  1  648  ? 36.789  -132.409 157.899 1.00 29.91  ? 648  ASN A C     1 
ATOM   5004  O  O     . ASN A  1  648  ? 36.347  -131.884 158.925 1.00 29.88  ? 648  ASN A O     1 
ATOM   5005  C  CB    . ASN A  1  648  ? 36.000  -134.491 156.751 1.00 32.08  ? 648  ASN A CB    1 
ATOM   5006  C  CG    . ASN A  1  648  ? 35.058  -135.116 155.731 1.00 34.66  ? 648  ASN A CG    1 
ATOM   5007  O  OD1   . ASN A  1  648  ? 33.877  -134.771 155.663 1.00 35.79  ? 648  ASN A OD1   1 
ATOM   5008  N  ND2   . ASN A  1  648  ? 35.576  -136.051 154.940 1.00 35.38  ? 648  ASN A ND2   1 
ATOM   5009  N  N     . ILE A  1  649  ? 38.094  -132.496 157.644 1.00 28.47  ? 649  ILE A N     1 
ATOM   5010  C  CA    . ILE A  1  649  ? 39.077  -132.002 158.602 1.00 25.45  ? 649  ILE A CA    1 
ATOM   5011  C  C     . ILE A  1  649  ? 38.655  -130.676 159.173 1.00 26.22  ? 649  ILE A C     1 
ATOM   5012  O  O     . ILE A  1  649  ? 38.857  -130.420 160.352 1.00 27.47  ? 649  ILE A O     1 
ATOM   5013  C  CB    . ILE A  1  649  ? 40.440  -131.859 157.977 1.00 22.79  ? 649  ILE A CB    1 
ATOM   5014  C  CG1   . ILE A  1  649  ? 40.924  -133.237 157.562 1.00 20.91  ? 649  ILE A CG1   1 
ATOM   5015  C  CG2   . ILE A  1  649  ? 41.395  -131.229 158.961 1.00 20.87  ? 649  ILE A CG2   1 
ATOM   5016  C  CD1   . ILE A  1  649  ? 42.110  -133.206 156.678 1.00 20.91  ? 649  ILE A CD1   1 
ATOM   5017  N  N     . GLN A  1  650  ? 38.048  -129.842 158.341 1.00 26.53  ? 650  GLN A N     1 
ATOM   5018  C  CA    . GLN A  1  650  ? 37.578  -128.542 158.799 1.00 27.41  ? 650  GLN A CA    1 
ATOM   5019  C  C     . GLN A  1  650  ? 36.349  -128.706 159.703 1.00 28.21  ? 650  GLN A C     1 
ATOM   5020  O  O     . GLN A  1  650  ? 36.369  -128.313 160.865 1.00 30.29  ? 650  GLN A O     1 
ATOM   5021  C  CB    . GLN A  1  650  ? 37.216  -127.650 157.609 1.00 26.42  ? 650  GLN A CB    1 
ATOM   5022  C  CG    . GLN A  1  650  ? 38.363  -126.919 156.947 1.00 24.43  ? 650  GLN A CG    1 
ATOM   5023  C  CD    . GLN A  1  650  ? 37.912  -126.206 155.691 1.00 24.78  ? 650  GLN A CD    1 
ATOM   5024  O  OE1   . GLN A  1  650  ? 37.684  -126.832 154.665 1.00 24.33  ? 650  GLN A OE1   1 
ATOM   5025  N  NE2   . GLN A  1  650  ? 37.751  -124.894 155.774 1.00 27.90  ? 650  GLN A NE2   1 
ATOM   5026  N  N     . LYS A  1  651  ? 35.282  -129.294 159.176 1.00 28.22  ? 651  LYS A N     1 
ATOM   5027  C  CA    . LYS A  1  651  ? 34.062  -129.475 159.958 1.00 29.50  ? 651  LYS A CA    1 
ATOM   5028  C  C     . LYS A  1  651  ? 34.274  -130.040 161.371 1.00 28.83  ? 651  LYS A C     1 
ATOM   5029  O  O     . LYS A  1  651  ? 33.578  -129.626 162.311 1.00 28.52  ? 651  LYS A O     1 
ATOM   5030  C  CB    . LYS A  1  651  ? 33.062  -130.347 159.183 1.00 30.07  ? 651  LYS A CB    1 
ATOM   5031  C  CG    . LYS A  1  651  ? 32.157  -129.571 158.222 1.00 29.92  ? 651  LYS A CG    1 
ATOM   5032  C  CD    . LYS A  1  651  ? 31.340  -130.507 157.345 1.00 32.47  ? 651  LYS A CD    1 
ATOM   5033  C  CE    . LYS A  1  651  ? 31.890  -130.585 155.918 1.00 34.24  ? 651  LYS A CE    1 
ATOM   5034  N  NZ    . LYS A  1  651  ? 31.655  -129.303 155.178 1.00 36.35  ? 651  LYS A NZ    1 
ATOM   5035  N  N     . VAL A  1  652  ? 35.226  -130.969 161.520 1.00 27.64  ? 652  VAL A N     1 
ATOM   5036  C  CA    . VAL A  1  652  ? 35.527  -131.568 162.827 1.00 25.14  ? 652  VAL A CA    1 
ATOM   5037  C  C     . VAL A  1  652  ? 36.299  -130.604 163.701 1.00 26.13  ? 652  VAL A C     1 
ATOM   5038  O  O     . VAL A  1  652  ? 35.826  -130.210 164.765 1.00 26.61  ? 652  VAL A O     1 
ATOM   5039  C  CB    . VAL A  1  652  ? 36.390  -132.800 162.727 1.00 21.57  ? 652  VAL A CB    1 
ATOM   5040  C  CG1   . VAL A  1  652  ? 36.534  -133.393 164.086 1.00 19.91  ? 652  VAL A CG1   1 
ATOM   5041  C  CG2   . VAL A  1  652  ? 35.780  -133.780 161.796 1.00 20.46  ? 652  VAL A CG2   1 
ATOM   5042  N  N     . VAL A  1  653  ? 37.497  -130.242 163.257 1.00 25.45  ? 653  VAL A N     1 
ATOM   5043  C  CA    . VAL A  1  653  ? 38.318  -129.313 164.008 1.00 25.51  ? 653  VAL A CA    1 
ATOM   5044  C  C     . VAL A  1  653  ? 37.554  -128.037 164.287 1.00 26.62  ? 653  VAL A C     1 
ATOM   5045  O  O     . VAL A  1  653  ? 37.468  -127.593 165.432 1.00 26.57  ? 653  VAL A O     1 
ATOM   5046  C  CB    . VAL A  1  653  ? 39.589  -128.945 163.250 1.00 26.09  ? 653  VAL A CB    1 
ATOM   5047  C  CG1   . VAL A  1  653  ? 40.275  -127.766 163.941 1.00 26.08  ? 653  VAL A CG1   1 
ATOM   5048  C  CG2   . VAL A  1  653  ? 40.525  -130.153 163.187 1.00 26.65  ? 653  VAL A CG2   1 
ATOM   5049  N  N     . ASN A  1  654  ? 37.002  -127.450 163.233 1.00 28.21  ? 654  ASN A N     1 
ATOM   5050  C  CA    . ASN A  1  654  ? 36.255  -126.208 163.361 1.00 29.91  ? 654  ASN A CA    1 
ATOM   5051  C  C     . ASN A  1  654  ? 35.253  -126.301 164.482 1.00 30.14  ? 654  ASN A C     1 
ATOM   5052  O  O     . ASN A  1  654  ? 35.092  -125.357 165.268 1.00 29.16  ? 654  ASN A O     1 
ATOM   5053  C  CB    . ASN A  1  654  ? 35.519  -125.870 162.061 1.00 31.86  ? 654  ASN A CB    1 
ATOM   5054  C  CG    . ASN A  1  654  ? 36.423  -125.242 161.024 1.00 33.34  ? 654  ASN A CG    1 
ATOM   5055  O  OD1   . ASN A  1  654  ? 37.393  -124.557 161.368 1.00 32.82  ? 654  ASN A OD1   1 
ATOM   5056  N  ND2   . ASN A  1  654  ? 36.100  -125.453 159.743 1.00 34.15  ? 654  ASN A ND2   1 
ATOM   5057  N  N     . PHE A  1  655  ? 34.573  -127.442 164.539 1.00 31.24  ? 655  PHE A N     1 
ATOM   5058  C  CA    . PHE A  1  655  ? 33.562  -127.680 165.568 1.00 33.93  ? 655  PHE A CA    1 
ATOM   5059  C  C     . PHE A  1  655  ? 34.186  -127.695 166.944 1.00 33.43  ? 655  PHE A C     1 
ATOM   5060  O  O     . PHE A  1  655  ? 33.774  -126.958 167.851 1.00 32.45  ? 655  PHE A O     1 
ATOM   5061  C  CB    . PHE A  1  655  ? 32.866  -129.018 165.346 1.00 34.51  ? 655  PHE A CB    1 
ATOM   5062  C  CG    . PHE A  1  655  ? 31.898  -129.384 166.440 1.00 35.40  ? 655  PHE A CG    1 
ATOM   5063  C  CD1   . PHE A  1  655  ? 30.815  -128.564 166.732 1.00 35.80  ? 655  PHE A CD1   1 
ATOM   5064  C  CD2   . PHE A  1  655  ? 32.048  -130.565 167.147 1.00 36.30  ? 655  PHE A CD2   1 
ATOM   5065  C  CE1   . PHE A  1  655  ? 29.899  -128.914 167.705 1.00 35.97  ? 655  PHE A CE1   1 
ATOM   5066  C  CE2   . PHE A  1  655  ? 31.133  -130.927 168.124 1.00 38.13  ? 655  PHE A CE2   1 
ATOM   5067  C  CZ    . PHE A  1  655  ? 30.056  -130.099 168.402 1.00 37.46  ? 655  PHE A CZ    1 
ATOM   5068  N  N     . TRP A  1  656  ? 35.178  -128.566 167.079 1.00 33.21  ? 656  TRP A N     1 
ATOM   5069  C  CA    . TRP A  1  656  ? 35.894  -128.727 168.319 1.00 33.01  ? 656  TRP A CA    1 
ATOM   5070  C  C     . TRP A  1  656  ? 36.361  -127.357 168.806 1.00 31.63  ? 656  TRP A C     1 
ATOM   5071  O  O     . TRP A  1  656  ? 36.049  -126.944 169.927 1.00 32.43  ? 656  TRP A O     1 
ATOM   5072  C  CB    . TRP A  1  656  ? 37.085  -129.672 168.113 1.00 33.65  ? 656  TRP A CB    1 
ATOM   5073  C  CG    . TRP A  1  656  ? 37.780  -130.007 169.381 1.00 36.17  ? 656  TRP A CG    1 
ATOM   5074  C  CD1   . TRP A  1  656  ? 37.420  -130.958 170.282 1.00 37.16  ? 656  TRP A CD1   1 
ATOM   5075  C  CD2   . TRP A  1  656  ? 38.875  -129.291 169.968 1.00 37.78  ? 656  TRP A CD2   1 
ATOM   5076  N  NE1   . TRP A  1  656  ? 38.211  -130.876 171.405 1.00 38.63  ? 656  TRP A NE1   1 
ATOM   5077  C  CE2   . TRP A  1  656  ? 39.112  -129.858 171.235 1.00 37.84  ? 656  TRP A CE2   1 
ATOM   5078  C  CE3   . TRP A  1  656  ? 39.674  -128.217 169.544 1.00 37.58  ? 656  TRP A CE3   1 
ATOM   5079  C  CZ2   . TRP A  1  656  ? 40.109  -129.389 172.085 1.00 38.80  ? 656  TRP A CZ2   1 
ATOM   5080  C  CZ3   . TRP A  1  656  ? 40.666  -127.750 170.389 1.00 37.53  ? 656  TRP A CZ3   1 
ATOM   5081  C  CH2   . TRP A  1  656  ? 40.875  -128.334 171.645 1.00 39.22  ? 656  TRP A CH2   1 
ATOM   5082  N  N     . LEU A  1  657  ? 37.083  -126.639 167.958 1.00 29.79  ? 657  LEU A N     1 
ATOM   5083  C  CA    . LEU A  1  657  ? 37.581  -125.343 168.364 1.00 29.42  ? 657  LEU A CA    1 
ATOM   5084  C  C     . LEU A  1  657  ? 36.474  -124.409 168.819 1.00 30.38  ? 657  LEU A C     1 
ATOM   5085  O  O     . LEU A  1  657  ? 36.678  -123.624 169.721 1.00 30.49  ? 657  LEU A O     1 
ATOM   5086  C  CB    . LEU A  1  657  ? 38.375  -124.685 167.237 1.00 28.85  ? 657  LEU A CB    1 
ATOM   5087  C  CG    . LEU A  1  657  ? 38.964  -123.335 167.648 1.00 26.76  ? 657  LEU A CG    1 
ATOM   5088  C  CD1   . LEU A  1  657  ? 39.837  -123.533 168.854 1.00 26.49  ? 657  LEU A CD1   1 
ATOM   5089  C  CD2   . LEU A  1  657  ? 39.760  -122.736 166.523 1.00 25.70  ? 657  LEU A CD2   1 
ATOM   5090  N  N     . LEU A  1  658  ? 35.305  -124.486 168.198 1.00 32.50  ? 658  LEU A N     1 
ATOM   5091  C  CA    . LEU A  1  658  ? 34.187  -123.616 168.579 1.00 34.26  ? 658  LEU A CA    1 
ATOM   5092  C  C     . LEU A  1  658  ? 33.861  -123.705 170.069 1.00 35.89  ? 658  LEU A C     1 
ATOM   5093  O  O     . LEU A  1  658  ? 33.525  -122.704 170.720 1.00 34.53  ? 658  LEU A O     1 
ATOM   5094  C  CB    . LEU A  1  658  ? 32.926  -123.993 167.798 1.00 33.42  ? 658  LEU A CB    1 
ATOM   5095  C  CG    . LEU A  1  658  ? 31.649  -123.402 168.412 1.00 31.82  ? 658  LEU A CG    1 
ATOM   5096  C  CD1   . LEU A  1  658  ? 31.644  -121.897 168.203 1.00 30.18  ? 658  LEU A CD1   1 
ATOM   5097  C  CD2   . LEU A  1  658  ? 30.410  -124.051 167.813 1.00 30.58  ? 658  LEU A CD2   1 
ATOM   5098  N  N     . HIS A  1  659  ? 33.939  -124.926 170.587 1.00 37.42  ? 659  HIS A N     1 
ATOM   5099  C  CA    . HIS A  1  659  ? 33.644  -125.184 171.978 1.00 39.01  ? 659  HIS A CA    1 
ATOM   5100  C  C     . HIS A  1  659  ? 34.841  -125.019 172.901 1.00 40.98  ? 659  HIS A C     1 
ATOM   5101  O  O     . HIS A  1  659  ? 34.689  -124.564 174.042 1.00 42.77  ? 659  HIS A O     1 
ATOM   5102  C  CB    . HIS A  1  659  ? 33.051  -126.571 172.115 1.00 38.32  ? 659  HIS A CB    1 
ATOM   5103  C  CG    . HIS A  1  659  ? 31.689  -126.688 171.516 1.00 38.38  ? 659  HIS A CG    1 
ATOM   5104  N  ND1   . HIS A  1  659  ? 30.837  -125.611 171.414 1.00 37.85  ? 659  HIS A ND1   1 
ATOM   5105  C  CD2   . HIS A  1  659  ? 31.020  -127.750 171.009 1.00 38.62  ? 659  HIS A CD2   1 
ATOM   5106  C  CE1   . HIS A  1  659  ? 29.701  -126.002 170.865 1.00 38.64  ? 659  HIS A CE1   1 
ATOM   5107  N  NE2   . HIS A  1  659  ? 29.787  -127.296 170.611 1.00 40.27  ? 659  HIS A NE2   1 
ATOM   5108  N  N     . ASN A  1  660  ? 36.028  -125.379 172.420 1.00 41.46  ? 660  ASN A N     1 
ATOM   5109  C  CA    . ASN A  1  660  ? 37.235  -125.222 173.227 1.00 40.80  ? 660  ASN A CA    1 
ATOM   5110  C  C     . ASN A  1  660  ? 37.647  -123.754 173.294 1.00 39.21  ? 660  ASN A C     1 
ATOM   5111  O  O     . ASN A  1  660  ? 38.281  -123.319 174.248 1.00 39.27  ? 660  ASN A O     1 
ATOM   5112  C  CB    . ASN A  1  660  ? 38.389  -126.018 172.638 1.00 42.68  ? 660  ASN A CB    1 
ATOM   5113  C  CG    . ASN A  1  660  ? 39.621  -125.953 173.501 1.00 44.13  ? 660  ASN A CG    1 
ATOM   5114  O  OD1   . ASN A  1  660  ? 39.735  -126.685 174.484 1.00 45.33  ? 660  ASN A OD1   1 
ATOM   5115  N  ND2   . ASN A  1  660  ? 40.545  -125.062 173.157 1.00 44.41  ? 660  ASN A ND2   1 
ATOM   5116  N  N     . GLY A  1  661  ? 37.284  -123.000 172.264 1.00 38.53  ? 661  GLY A N     1 
ATOM   5117  C  CA    . GLY A  1  661  ? 37.620  -121.588 172.198 1.00 36.77  ? 661  GLY A CA    1 
ATOM   5118  C  C     . GLY A  1  661  ? 39.110  -121.345 172.039 1.00 35.73  ? 661  GLY A C     1 
ATOM   5119  O  O     . GLY A  1  661  ? 39.927  -122.255 172.195 1.00 36.25  ? 661  GLY A O     1 
ATOM   5120  N  N     . PHE A  1  662  ? 39.466  -120.116 171.704 1.00 34.04  ? 662  PHE A N     1 
ATOM   5121  C  CA    . PHE A  1  662  ? 40.865  -119.740 171.567 1.00 34.60  ? 662  PHE A CA    1 
ATOM   5122  C  C     . PHE A  1  662  ? 40.933  -118.235 171.442 1.00 35.27  ? 662  PHE A C     1 
ATOM   5123  O  O     . PHE A  1  662  ? 40.034  -117.633 170.874 1.00 36.24  ? 662  PHE A O     1 
ATOM   5124  C  CB    . PHE A  1  662  ? 41.479  -120.362 170.335 1.00 34.25  ? 662  PHE A CB    1 
ATOM   5125  C  CG    . PHE A  1  662  ? 42.899  -119.944 170.102 1.00 34.20  ? 662  PHE A CG    1 
ATOM   5126  C  CD1   . PHE A  1  662  ? 43.948  -120.673 170.636 1.00 35.08  ? 662  PHE A CD1   1 
ATOM   5127  C  CD2   . PHE A  1  662  ? 43.190  -118.817 169.347 1.00 33.56  ? 662  PHE A CD2   1 
ATOM   5128  C  CE1   . PHE A  1  662  ? 45.267  -120.285 170.415 1.00 35.17  ? 662  PHE A CE1   1 
ATOM   5129  C  CE2   . PHE A  1  662  ? 44.506  -118.425 169.125 1.00 34.40  ? 662  PHE A CE2   1 
ATOM   5130  C  CZ    . PHE A  1  662  ? 45.544  -119.161 169.658 1.00 33.99  ? 662  PHE A CZ    1 
ATOM   5131  N  N     . SER A  1  663  ? 42.000  -117.623 171.948 1.00 35.20  ? 663  SER A N     1 
ATOM   5132  C  CA    . SER A  1  663  ? 42.108  -116.170 171.886 1.00 35.30  ? 663  SER A CA    1 
ATOM   5133  C  C     . SER A  1  663  ? 43.538  -115.619 171.993 1.00 35.36  ? 663  SER A C     1 
ATOM   5134  O  O     . SER A  1  663  ? 44.511  -116.323 171.742 1.00 35.30  ? 663  SER A O     1 
ATOM   5135  C  CB    . SER A  1  663  ? 41.223  -115.580 172.986 1.00 35.66  ? 663  SER A CB    1 
ATOM   5136  O  OG    . SER A  1  663  ? 41.320  -114.170 173.032 1.00 39.35  ? 663  SER A OG    1 
ATOM   5137  N  N     . THR A  1  664  ? 43.661  -114.347 172.347 1.00 36.00  ? 664  THR A N     1 
ATOM   5138  C  CA    . THR A  1  664  ? 44.967  -113.727 172.496 1.00 38.57  ? 664  THR A CA    1 
ATOM   5139  C  C     . THR A  1  664  ? 44.821  -112.282 172.981 1.00 40.82  ? 664  THR A C     1 
ATOM   5140  O  O     . THR A  1  664  ? 43.908  -111.580 172.546 1.00 42.46  ? 664  THR A O     1 
ATOM   5141  C  CB    . THR A  1  664  ? 45.702  -113.714 171.175 1.00 38.57  ? 664  THR A CB    1 
ATOM   5142  O  OG1   . THR A  1  664  ? 47.081  -113.443 171.413 1.00 41.26  ? 664  THR A OG1   1 
ATOM   5143  C  CG2   . THR A  1  664  ? 45.151  -112.628 170.278 1.00 39.51  ? 664  THR A CG2   1 
ATOM   5144  N  N     . GLY A  1  665  ? 45.713  -111.843 173.876 1.00 42.04  ? 665  GLY A N     1 
ATOM   5145  C  CA    . GLY A  1  665  ? 45.662  -110.477 174.407 1.00 43.10  ? 665  GLY A CA    1 
ATOM   5146  C  C     . GLY A  1  665  ? 47.021  -109.991 174.896 1.00 43.15  ? 665  GLY A C     1 
ATOM   5147  O  O     . GLY A  1  665  ? 47.932  -110.810 174.946 1.00 44.93  ? 665  GLY A O     1 
ATOM   5148  N  N     . ILE A  1  666  ? 47.178  -108.704 175.246 1.00 41.69  ? 666  ILE A N     1 
ATOM   5149  C  CA    . ILE A  1  666  ? 48.476  -108.187 175.722 1.00 39.85  ? 666  ILE A CA    1 
ATOM   5150  C  C     . ILE A  1  666  ? 49.114  -109.151 176.704 1.00 40.68  ? 666  ILE A C     1 
ATOM   5151  O  O     . ILE A  1  666  ? 50.332  -109.339 176.696 1.00 40.31  ? 666  ILE A O     1 
ATOM   5152  C  CB    . ILE A  1  666  ? 48.373  -106.836 176.445 1.00 38.29  ? 666  ILE A CB    1 
ATOM   5153  C  CG1   . ILE A  1  666  ? 46.921  -106.549 176.760 1.00 38.90  ? 666  ILE A CG1   1 
ATOM   5154  C  CG2   . ILE A  1  666  ? 49.060  -105.742 175.649 1.00 36.43  ? 666  ILE A CG2   1 
ATOM   5155  C  CD1   . ILE A  1  666  ? 46.315  -107.586 177.693 1.00 42.07  ? 666  ILE A CD1   1 
ATOM   5156  N  N     . GLY A  1  667  ? 48.290  -109.762 177.550 1.00 41.02  ? 667  GLY A N     1 
ATOM   5157  C  CA    . GLY A  1  667  ? 48.815  -110.716 178.505 1.00 42.94  ? 667  GLY A CA    1 
ATOM   5158  C  C     . GLY A  1  667  ? 49.795  -111.709 177.884 1.00 44.36  ? 667  GLY A C     1 
ATOM   5159  O  O     . GLY A  1  667  ? 50.716  -112.189 178.555 1.00 44.66  ? 667  GLY A O     1 
ATOM   5160  N  N     . ASP A  1  668  ? 49.587  -112.018 176.604 1.00 44.51  ? 668  ASP A N     1 
ATOM   5161  C  CA    . ASP A  1  668  ? 50.421  -112.954 175.858 1.00 44.41  ? 668  ASP A CA    1 
ATOM   5162  C  C     . ASP A  1  668  ? 51.720  -112.323 175.378 1.00 45.03  ? 668  ASP A C     1 
ATOM   5163  O  O     . ASP A  1  668  ? 52.579  -113.029 174.853 1.00 44.89  ? 668  ASP A O     1 
ATOM   5164  C  CB    . ASP A  1  668  ? 49.672  -113.486 174.624 1.00 44.79  ? 668  ASP A CB    1 
ATOM   5165  C  CG    . ASP A  1  668  ? 48.655  -114.565 174.956 1.00 44.74  ? 668  ASP A CG    1 
ATOM   5166  O  OD1   . ASP A  1  668  ? 49.061  -115.661 175.401 1.00 44.33  ? 668  ASP A OD1   1 
ATOM   5167  O  OD2   . ASP A  1  668  ? 47.446  -114.319 174.753 1.00 44.65  ? 668  ASP A OD2   1 
ATOM   5168  N  N     . THR A  1  669  ? 51.873  -111.011 175.542 1.00 45.78  ? 669  THR A N     1 
ATOM   5169  C  CA    . THR A  1  669  ? 53.087  -110.350 175.068 1.00 49.51  ? 669  THR A CA    1 
ATOM   5170  C  C     . THR A  1  669  ? 54.078  -109.904 176.118 1.00 51.82  ? 669  THR A C     1 
ATOM   5171  O  O     . THR A  1  669  ? 55.169  -109.441 175.776 1.00 52.49  ? 669  THR A O     1 
ATOM   5172  C  CB    . THR A  1  669  ? 52.785  -109.107 174.209 1.00 49.93  ? 669  THR A CB    1 
ATOM   5173  O  OG1   . THR A  1  669  ? 51.857  -108.257 174.901 1.00 49.62  ? 669  THR A OG1   1 
ATOM   5174  C  CG2   . THR A  1  669  ? 52.252  -109.519 172.840 1.00 50.00  ? 669  THR A CG2   1 
ATOM   5175  N  N     . ILE A  1  670  ? 53.720  -110.012 177.391 1.00 54.57  ? 670  ILE A N     1 
ATOM   5176  C  CA    . ILE A  1  670  ? 54.657  -109.596 178.425 1.00 55.90  ? 670  ILE A CA    1 
ATOM   5177  C  C     . ILE A  1  670  ? 55.519  -110.742 178.916 1.00 58.21  ? 670  ILE A C     1 
ATOM   5178  O  O     . ILE A  1  670  ? 55.024  -111.790 179.341 1.00 56.86  ? 670  ILE A O     1 
ATOM   5179  C  CB    . ILE A  1  670  ? 53.955  -108.939 179.624 1.00 53.67  ? 670  ILE A CB    1 
ATOM   5180  C  CG1   . ILE A  1  670  ? 52.664  -109.681 179.951 1.00 53.11  ? 670  ILE A CG1   1 
ATOM   5181  C  CG2   . ILE A  1  670  ? 53.708  -107.461 179.323 1.00 52.06  ? 670  ILE A CG2   1 
ATOM   5182  C  CD1   . ILE A  1  670  ? 51.445  -109.078 179.309 1.00 52.37  ? 670  ILE A CD1   1 
ATOM   5183  N  N     . ALA A  1  671  ? 56.826  -110.523 178.828 1.00 61.62  ? 671  ALA A N     1 
ATOM   5184  C  CA    . ALA A  1  671  ? 57.799  -111.509 179.255 1.00 65.23  ? 671  ALA A CA    1 
ATOM   5185  C  C     . ALA A  1  671  ? 58.001  -111.423 180.771 1.00 68.52  ? 671  ALA A C     1 
ATOM   5186  O  O     . ALA A  1  671  ? 57.915  -110.345 181.380 1.00 69.79  ? 671  ALA A O     1 
ATOM   5187  C  CB    . ALA A  1  671  ? 59.122  -111.287 178.524 1.00 63.91  ? 671  ALA A CB    1 
ATOM   5188  N  N     . ASP A  1  672  ? 58.263  -112.581 181.365 1.00 70.82  ? 672  ASP A N     1 
ATOM   5189  C  CA    . ASP A  1  672  ? 58.492  -112.734 182.797 1.00 72.38  ? 672  ASP A CA    1 
ATOM   5190  C  C     . ASP A  1  672  ? 59.451  -111.702 183.409 1.00 72.95  ? 672  ASP A C     1 
ATOM   5191  O  O     . ASP A  1  672  ? 60.461  -111.348 182.798 1.00 72.84  ? 672  ASP A O     1 
ATOM   5192  C  CB    . ASP A  1  672  ? 59.015  -114.149 183.030 1.00 74.52  ? 672  ASP A CB    1 
ATOM   5193  C  CG    . ASP A  1  672  ? 59.452  -114.385 184.441 1.00 76.84  ? 672  ASP A CG    1 
ATOM   5194  O  OD1   . ASP A  1  672  ? 58.594  -114.301 185.349 1.00 78.02  ? 672  ASP A OD1   1 
ATOM   5195  O  OD2   . ASP A  1  672  ? 60.658  -114.662 184.632 1.00 78.27  ? 672  ASP A OD2   1 
ATOM   5196  N  N     . GLY A  1  673  ? 59.125  -111.240 184.620 1.00 73.45  ? 673  GLY A N     1 
ATOM   5197  C  CA    . GLY A  1  673  ? 59.942  -110.259 185.335 1.00 74.08  ? 673  GLY A CA    1 
ATOM   5198  C  C     . GLY A  1  673  ? 61.458  -110.364 185.169 1.00 74.21  ? 673  GLY A C     1 
ATOM   5199  O  O     . GLY A  1  673  ? 62.078  -109.466 184.589 1.00 74.44  ? 673  GLY A O     1 
ATOM   5200  N  N     . PRO A  1  674  ? 62.100  -111.427 185.685 1.00 73.42  ? 674  PRO A N     1 
ATOM   5201  C  CA    . PRO A  1  674  ? 63.551  -111.520 185.513 1.00 73.18  ? 674  PRO A CA    1 
ATOM   5202  C  C     . PRO A  1  674  ? 63.947  -111.652 184.040 1.00 72.86  ? 674  PRO A C     1 
ATOM   5203  O  O     . PRO A  1  674  ? 64.892  -111.000 183.587 1.00 73.16  ? 674  PRO A O     1 
ATOM   5204  C  CB    . PRO A  1  674  ? 63.919  -112.753 186.335 1.00 72.80  ? 674  PRO A CB    1 
ATOM   5205  C  CG    . PRO A  1  674  ? 62.685  -113.586 186.275 1.00 72.14  ? 674  PRO A CG    1 
ATOM   5206  C  CD    . PRO A  1  674  ? 61.598  -112.560 186.480 1.00 72.67  ? 674  PRO A CD    1 
ATOM   5207  N  N     . THR A  1  675  ? 63.222  -112.484 183.295 1.00 71.63  ? 675  THR A N     1 
ATOM   5208  C  CA    . THR A  1  675  ? 63.519  -112.672 181.881 1.00 71.01  ? 675  THR A CA    1 
ATOM   5209  C  C     . THR A  1  675  ? 63.511  -111.340 181.154 1.00 70.75  ? 675  THR A C     1 
ATOM   5210  O  O     . THR A  1  675  ? 63.977  -111.240 180.024 1.00 70.42  ? 675  THR A O     1 
ATOM   5211  C  CB    . THR A  1  675  ? 62.517  -113.605 181.211 1.00 70.62  ? 675  THR A CB    1 
ATOM   5212  O  OG1   . THR A  1  675  ? 62.465  -114.831 181.945 1.00 72.09  ? 675  THR A OG1   1 
ATOM   5213  C  CG2   . THR A  1  675  ? 62.938  -113.897 179.767 1.00 69.05  ? 675  THR A CG2   1 
ATOM   5214  N  N     . MET A  1  676  ? 62.964  -110.318 181.801 1.00 71.03  ? 676  MET A N     1 
ATOM   5215  C  CA    . MET A  1  676  ? 62.945  -108.980 181.222 1.00 72.32  ? 676  MET A CA    1 
ATOM   5216  C  C     . MET A  1  676  ? 64.266  -108.327 181.620 1.00 72.73  ? 676  MET A C     1 
ATOM   5217  O  O     . MET A  1  676  ? 65.073  -107.958 180.768 1.00 72.71  ? 676  MET A O     1 
ATOM   5218  C  CB    . MET A  1  676  ? 61.776  -108.159 181.779 1.00 72.81  ? 676  MET A CB    1 
ATOM   5219  C  CG    . MET A  1  676  ? 60.470  -108.229 180.985 1.00 73.52  ? 676  MET A CG    1 
ATOM   5220  S  SD    . MET A  1  676  ? 60.521  -107.327 179.407 1.00 76.38  ? 676  MET A SD    1 
ATOM   5221  C  CE    . MET A  1  676  ? 59.138  -108.120 178.463 1.00 74.27  ? 676  MET A CE    1 
ATOM   5222  N  N     . ARG A  1  677  ? 64.474  -108.199 182.928 1.00 73.28  ? 677  ARG A N     1 
ATOM   5223  C  CA    . ARG A  1  677  ? 65.687  -107.610 183.482 1.00 73.77  ? 677  ARG A CA    1 
ATOM   5224  C  C     . ARG A  1  677  ? 66.878  -108.212 182.733 1.00 72.45  ? 677  ARG A C     1 
ATOM   5225  O  O     . ARG A  1  677  ? 67.773  -107.492 182.282 1.00 71.78  ? 677  ARG A O     1 
ATOM   5226  C  CB    . ARG A  1  677  ? 65.735  -107.919 184.990 1.00 76.51  ? 677  ARG A CB    1 
ATOM   5227  C  CG    . ARG A  1  677  ? 66.846  -107.262 185.803 1.00 80.29  ? 677  ARG A CG    1 
ATOM   5228  C  CD    . ARG A  1  677  ? 68.062  -108.177 185.912 1.00 84.13  ? 677  ARG A CD    1 
ATOM   5229  N  NE    . ARG A  1  677  ? 67.668  -109.549 186.244 1.00 88.00  ? 677  ARG A NE    1 
ATOM   5230  C  CZ    . ARG A  1  677  ? 68.509  -110.580 186.329 1.00 89.54  ? 677  ARG A CZ    1 
ATOM   5231  N  NH1   . ARG A  1  677  ? 69.811  -110.407 186.112 1.00 89.61  ? 677  ARG A NH1   1 
ATOM   5232  N  NH2   . ARG A  1  677  ? 68.042  -111.791 186.621 1.00 89.47  ? 677  ARG A NH2   1 
ATOM   5233  N  N     . GLU A  1  678  ? 66.857  -109.533 182.582 1.00 71.20  ? 678  GLU A N     1 
ATOM   5234  C  CA    . GLU A  1  678  ? 67.905  -110.269 181.876 1.00 71.04  ? 678  GLU A CA    1 
ATOM   5235  C  C     . GLU A  1  678  ? 68.109  -109.748 180.447 1.00 71.64  ? 678  GLU A C     1 
ATOM   5236  O  O     . GLU A  1  678  ? 69.237  -109.688 179.941 1.00 70.88  ? 678  GLU A O     1 
ATOM   5237  C  CB    . GLU A  1  678  ? 67.542  -111.757 181.840 1.00 70.36  ? 678  GLU A CB    1 
ATOM   5238  C  CG    . GLU A  1  678  ? 68.503  -112.624 181.040 1.00 70.17  ? 678  GLU A CG    1 
ATOM   5239  C  CD    . GLU A  1  678  ? 68.209  -114.107 181.187 1.00 70.27  ? 678  GLU A CD    1 
ATOM   5240  O  OE1   . GLU A  1  678  ? 68.961  -114.924 180.606 1.00 69.98  ? 678  GLU A OE1   1 
ATOM   5241  O  OE2   . GLU A  1  678  ? 67.228  -114.453 181.886 1.00 69.79  ? 678  GLU A OE2   1 
ATOM   5242  N  N     . ILE A  1  679  ? 67.009  -109.379 179.798 1.00 72.03  ? 679  ILE A N     1 
ATOM   5243  C  CA    . ILE A  1  679  ? 67.069  -108.857 178.442 1.00 71.91  ? 679  ILE A CA    1 
ATOM   5244  C  C     . ILE A  1  679  ? 67.763  -107.504 178.444 1.00 72.47  ? 679  ILE A C     1 
ATOM   5245  O  O     . ILE A  1  679  ? 68.742  -107.304 177.728 1.00 72.36  ? 679  ILE A O     1 
ATOM   5246  C  CB    . ILE A  1  679  ? 65.660  -108.697 177.836 1.00 71.45  ? 679  ILE A CB    1 
ATOM   5247  C  CG1   . ILE A  1  679  ? 65.015  -110.074 177.657 1.00 71.89  ? 679  ILE A CG1   1 
ATOM   5248  C  CG2   . ILE A  1  679  ? 65.750  -107.996 176.493 1.00 71.10  ? 679  ILE A CG2   1 
ATOM   5249  C  CD1   . ILE A  1  679  ? 63.605  -110.040 177.085 1.00 71.93  ? 679  ILE A CD1   1 
ATOM   5250  N  N     . THR A  1  680  ? 67.258  -106.584 179.261 1.00 73.62  ? 680  THR A N     1 
ATOM   5251  C  CA    . THR A  1  680  ? 67.827  -105.242 179.351 1.00 75.36  ? 680  THR A CA    1 
ATOM   5252  C  C     . THR A  1  680  ? 69.350  -105.264 179.404 1.00 76.28  ? 680  THR A C     1 
ATOM   5253  O  O     . THR A  1  680  ? 70.002  -104.463 178.731 1.00 76.58  ? 680  THR A O     1 
ATOM   5254  C  CB    . THR A  1  680  ? 67.294  -104.468 180.588 1.00 75.09  ? 680  THR A CB    1 
ATOM   5255  O  OG1   . THR A  1  680  ? 66.639  -105.378 181.482 1.00 74.87  ? 680  THR A OG1   1 
ATOM   5256  C  CG2   . THR A  1  680  ? 66.322  -103.363 180.155 1.00 73.66  ? 680  THR A CG2   1 
ATOM   5257  N  N     . GLU A  1  681  ? 69.923  -106.170 180.196 1.00 77.20  ? 681  GLU A N     1 
ATOM   5258  C  CA    . GLU A  1  681  ? 71.378  -106.239 180.275 1.00 78.11  ? 681  GLU A CA    1 
ATOM   5259  C  C     . GLU A  1  681  ? 71.969  -106.826 179.000 1.00 77.03  ? 681  GLU A C     1 
ATOM   5260  O  O     . GLU A  1  681  ? 73.051  -106.429 178.576 1.00 77.21  ? 681  GLU A O     1 
ATOM   5261  C  CB    . GLU A  1  681  ? 71.845  -107.024 181.518 1.00 79.83  ? 681  GLU A CB    1 
ATOM   5262  C  CG    . GLU A  1  681  ? 70.962  -108.179 181.962 1.00 83.12  ? 681  GLU A CG    1 
ATOM   5263  C  CD    . GLU A  1  681  ? 71.303  -108.674 183.380 1.00 85.28  ? 681  GLU A CD    1 
ATOM   5264  O  OE1   . GLU A  1  681  ? 71.257  -107.865 184.343 1.00 86.29  ? 681  GLU A OE1   1 
ATOM   5265  O  OE2   . GLU A  1  681  ? 71.613  -109.878 183.533 1.00 85.80  ? 681  GLU A OE2   1 
ATOM   5266  N  N     . THR A  1  682  ? 71.258  -107.753 178.372 1.00 75.32  ? 682  THR A N     1 
ATOM   5267  C  CA    . THR A  1  682  ? 71.750  -108.332 177.137 1.00 74.37  ? 682  THR A CA    1 
ATOM   5268  C  C     . THR A  1  682  ? 71.864  -107.218 176.095 1.00 74.47  ? 682  THR A C     1 
ATOM   5269  O  O     . THR A  1  682  ? 72.667  -107.299 175.165 1.00 74.35  ? 682  THR A O     1 
ATOM   5270  C  CB    . THR A  1  682  ? 70.804  -109.419 176.640 1.00 74.53  ? 682  THR A CB    1 
ATOM   5271  O  OG1   . THR A  1  682  ? 70.561  -110.342 177.710 1.00 73.95  ? 682  THR A OG1   1 
ATOM   5272  C  CG2   . THR A  1  682  ? 71.411  -110.161 175.442 1.00 73.84  ? 682  THR A CG2   1 
ATOM   5273  N  N     . ILE A  1  683  ? 71.053  -106.178 176.257 1.00 74.65  ? 683  ILE A N     1 
ATOM   5274  C  CA    . ILE A  1  683  ? 71.086  -105.031 175.354 1.00 75.25  ? 683  ILE A CA    1 
ATOM   5275  C  C     . ILE A  1  683  ? 72.194  -104.113 175.868 1.00 76.27  ? 683  ILE A C     1 
ATOM   5276  O  O     . ILE A  1  683  ? 73.041  -103.643 175.105 1.00 76.56  ? 683  ILE A O     1 
ATOM   5277  C  CB    . ILE A  1  683  ? 69.741  -104.247 175.363 1.00 74.60  ? 683  ILE A CB    1 
ATOM   5278  C  CG1   . ILE A  1  683  ? 68.638  -105.095 174.733 1.00 74.15  ? 683  ILE A CG1   1 
ATOM   5279  C  CG2   . ILE A  1  683  ? 69.887  -102.928 174.607 1.00 73.46  ? 683  ILE A CG2   1 
ATOM   5280  C  CD1   . ILE A  1  683  ? 67.263  -104.458 174.814 1.00 74.39  ? 683  ILE A CD1   1 
ATOM   5281  N  N     . ALA A  1  684  ? 72.185  -103.877 177.177 1.00 77.07  ? 684  ALA A N     1 
ATOM   5282  C  CA    . ALA A  1  684  ? 73.177  -103.025 177.822 1.00 77.39  ? 684  ALA A CA    1 
ATOM   5283  C  C     . ALA A  1  684  ? 74.600  -103.463 177.477 1.00 78.03  ? 684  ALA A C     1 
ATOM   5284  O  O     . ALA A  1  684  ? 75.408  -102.658 176.998 1.00 77.86  ? 684  ALA A O     1 
ATOM   5285  C  CB    . ALA A  1  684  ? 72.972  -103.052 179.329 1.00 76.65  ? 684  ALA A CB    1 
ATOM   5286  N  N     . GLU A  1  685  ? 74.901  -104.740 177.720 1.00 78.71  ? 685  GLU A N     1 
ATOM   5287  C  CA    . GLU A  1  685  ? 76.229  -105.277 177.438 1.00 79.72  ? 685  GLU A CA    1 
ATOM   5288  C  C     . GLU A  1  685  ? 76.606  -105.122 175.964 1.00 78.60  ? 685  GLU A C     1 
ATOM   5289  O  O     . GLU A  1  685  ? 77.756  -104.816 175.645 1.00 78.79  ? 685  GLU A O     1 
ATOM   5290  C  CB    . GLU A  1  685  ? 76.333  -106.754 177.864 1.00 81.70  ? 685  GLU A CB    1 
ATOM   5291  C  CG    . GLU A  1  685  ? 75.373  -107.705 177.161 1.00 85.98  ? 685  GLU A CG    1 
ATOM   5292  C  CD    . GLU A  1  685  ? 76.057  -108.968 176.633 1.00 87.75  ? 685  GLU A CD    1 
ATOM   5293  O  OE1   . GLU A  1  685  ? 76.739  -109.659 177.432 1.00 87.60  ? 685  GLU A OE1   1 
ATOM   5294  O  OE2   . GLU A  1  685  ? 75.903  -109.265 175.417 1.00 88.79  ? 685  GLU A OE2   1 
ATOM   5295  N  N     . ALA A  1  686  ? 75.649  -105.334 175.065 1.00 77.52  ? 686  ALA A N     1 
ATOM   5296  C  CA    . ALA A  1  686  ? 75.928  -105.185 173.644 1.00 76.26  ? 686  ALA A CA    1 
ATOM   5297  C  C     . ALA A  1  686  ? 76.125  -103.699 173.381 1.00 75.47  ? 686  ALA A C     1 
ATOM   5298  O  O     . ALA A  1  686  ? 76.768  -103.312 172.408 1.00 74.67  ? 686  ALA A O     1 
ATOM   5299  C  CB    . ALA A  1  686  ? 74.780  -105.726 172.815 1.00 75.78  ? 686  ALA A CB    1 
ATOM   5300  N  N     . LYS A  1  687  ? 75.576  -102.866 174.261 1.00 75.31  ? 687  LYS A N     1 
ATOM   5301  C  CA    . LYS A  1  687  ? 75.722  -101.425 174.115 1.00 76.26  ? 687  LYS A CA    1 
ATOM   5302  C  C     . LYS A  1  687  ? 77.164  -101.034 174.373 1.00 76.74  ? 687  LYS A C     1 
ATOM   5303  O  O     . LYS A  1  687  ? 77.724  -100.212 173.649 1.00 76.87  ? 687  LYS A O     1 
ATOM   5304  C  CB    . LYS A  1  687  ? 74.803  -100.665 175.079 1.00 76.54  ? 687  LYS A CB    1 
ATOM   5305  C  CG    . LYS A  1  687  ? 73.507  -100.186 174.442 1.00 77.15  ? 687  LYS A CG    1 
ATOM   5306  C  CD    . LYS A  1  687  ? 72.816  -99.138  175.295 1.00 78.24  ? 687  LYS A CD    1 
ATOM   5307  C  CE    . LYS A  1  687  ? 71.572  -98.589  174.604 1.00 78.97  ? 687  LYS A CE    1 
ATOM   5308  N  NZ    . LYS A  1  687  ? 70.941  -97.488  175.393 1.00 78.59  ? 687  LYS A NZ    1 
ATOM   5309  N  N     . LYS A  1  688  ? 77.765  -101.621 175.407 1.00 77.20  ? 688  LYS A N     1 
ATOM   5310  C  CA    . LYS A  1  688  ? 79.157  -101.319 175.734 1.00 77.02  ? 688  LYS A CA    1 
ATOM   5311  C  C     . LYS A  1  688  ? 80.072  -101.947 174.682 1.00 75.84  ? 688  LYS A C     1 
ATOM   5312  O  O     . LYS A  1  688  ? 80.994  -101.302 174.190 1.00 75.33  ? 688  LYS A O     1 
ATOM   5313  C  CB    . LYS A  1  688  ? 79.510  -101.845 177.125 1.00 78.00  ? 688  LYS A CB    1 
ATOM   5314  C  CG    . LYS A  1  688  ? 80.493  -100.964 177.875 1.00 79.91  ? 688  LYS A CG    1 
ATOM   5315  C  CD    . LYS A  1  688  ? 80.669  -101.470 179.286 1.00 81.98  ? 688  LYS A CD    1 
ATOM   5316  C  CE    . LYS A  1  688  ? 81.509  -100.532 180.135 1.00 83.30  ? 688  LYS A CE    1 
ATOM   5317  N  NZ    . LYS A  1  688  ? 81.646  -101.073 181.528 1.00 83.69  ? 688  LYS A NZ    1 
ATOM   5318  N  N     . LYS A  1  689  ? 79.803  -103.202 174.336 1.00 74.68  ? 689  LYS A N     1 
ATOM   5319  C  CA    . LYS A  1  689  ? 80.579  -103.913 173.326 1.00 73.21  ? 689  LYS A CA    1 
ATOM   5320  C  C     . LYS A  1  689  ? 80.726  -103.009 172.100 1.00 72.57  ? 689  LYS A C     1 
ATOM   5321  O  O     . LYS A  1  689  ? 81.684  -103.142 171.343 1.00 72.85  ? 689  LYS A O     1 
ATOM   5322  C  CB    . LYS A  1  689  ? 79.862  -105.219 172.955 1.00 73.36  ? 689  LYS A CB    1 
ATOM   5323  C  CG    . LYS A  1  689  ? 80.632  -106.199 172.071 1.00 73.28  ? 689  LYS A CG    1 
ATOM   5324  C  CD    . LYS A  1  689  ? 79.860  -107.525 171.968 1.00 73.86  ? 689  LYS A CD    1 
ATOM   5325  C  CE    . LYS A  1  689  ? 80.668  -108.635 171.299 1.00 74.30  ? 689  LYS A CE    1 
ATOM   5326  N  NZ    . LYS A  1  689  ? 79.993  -109.971 171.368 1.00 73.76  ? 689  LYS A NZ    1 
ATOM   5327  N  N     . VAL A  1  690  ? 79.778  -102.085 171.918 1.00 71.81  ? 690  VAL A N     1 
ATOM   5328  C  CA    . VAL A  1  690  ? 79.806  -101.153 170.784 1.00 71.01  ? 690  VAL A CA    1 
ATOM   5329  C  C     . VAL A  1  690  ? 80.511  -99.851  171.178 1.00 70.79  ? 690  VAL A C     1 
ATOM   5330  O  O     . VAL A  1  690  ? 81.241  -99.262  170.376 1.00 70.64  ? 690  VAL A O     1 
ATOM   5331  C  CB    . VAL A  1  690  ? 78.365  -100.830 170.256 1.00 70.27  ? 690  VAL A CB    1 
ATOM   5332  C  CG1   . VAL A  1  690  ? 77.753  -99.663  171.020 1.00 69.16  ? 690  VAL A CG1   1 
ATOM   5333  C  CG2   . VAL A  1  690  ? 78.417  -100.530 168.762 1.00 68.54  ? 690  VAL A CG2   1 
ATOM   5334  N  N     . LEU A  1  691  ? 80.281  -99.411  172.415 1.00 70.39  ? 691  LEU A N     1 
ATOM   5335  C  CA    . LEU A  1  691  ? 80.900  -98.203  172.965 1.00 69.63  ? 691  LEU A CA    1 
ATOM   5336  C  C     . LEU A  1  691  ? 82.420  -98.322  172.857 1.00 69.24  ? 691  LEU A C     1 
ATOM   5337  O  O     . LEU A  1  691  ? 83.114  -97.389  172.448 1.00 67.31  ? 691  LEU A O     1 
ATOM   5338  C  CB    . LEU A  1  691  ? 80.509  -98.055  174.441 1.00 69.34  ? 691  LEU A CB    1 
ATOM   5339  C  CG    . LEU A  1  691  ? 81.524  -97.398  175.385 1.00 69.01  ? 691  LEU A CG    1 
ATOM   5340  C  CD1   . LEU A  1  691  ? 81.708  -95.945  174.985 1.00 67.99  ? 691  LEU A CD1   1 
ATOM   5341  C  CD2   . LEU A  1  691  ? 81.059  -97.518  176.841 1.00 68.08  ? 691  LEU A CD2   1 
ATOM   5342  N  N     . ASP A  1  692  ? 82.919  -99.489  173.250 1.00 69.69  ? 692  ASP A N     1 
ATOM   5343  C  CA    . ASP A  1  692  ? 84.338  -99.779  173.208 1.00 69.99  ? 692  ASP A CA    1 
ATOM   5344  C  C     . ASP A  1  692  ? 84.781  -99.644  171.756 1.00 70.38  ? 692  ASP A C     1 
ATOM   5345  O  O     . ASP A  1  692  ? 85.548  -98.742  171.412 1.00 70.39  ? 692  ASP A O     1 
ATOM   5346  C  CB    . ASP A  1  692  ? 84.607  -101.204 173.737 1.00 70.05  ? 692  ASP A CB    1 
ATOM   5347  C  CG    . ASP A  1  692  ? 84.103  -101.416 175.189 1.00 70.76  ? 692  ASP A CG    1 
ATOM   5348  O  OD1   . ASP A  1  692  ? 83.917  -100.423 175.931 1.00 70.29  ? 692  ASP A OD1   1 
ATOM   5349  O  OD2   . ASP A  1  692  ? 83.906  -102.586 175.597 1.00 70.74  ? 692  ASP A OD2   1 
ATOM   5350  N  N     . VAL A  1  693  ? 84.267  -100.531 170.907 1.00 70.89  ? 693  VAL A N     1 
ATOM   5351  C  CA    . VAL A  1  693  ? 84.585  -100.531 169.479 1.00 71.22  ? 693  VAL A CA    1 
ATOM   5352  C  C     . VAL A  1  693  ? 84.650  -99.123  168.913 1.00 70.71  ? 693  VAL A C     1 
ATOM   5353  O  O     . VAL A  1  693  ? 85.371  -98.867  167.950 1.00 70.11  ? 693  VAL A O     1 
ATOM   5354  C  CB    . VAL A  1  693  ? 83.533  -101.337 168.678 1.00 71.56  ? 693  VAL A CB    1 
ATOM   5355  C  CG1   . VAL A  1  693  ? 83.701  -101.097 167.187 1.00 71.61  ? 693  VAL A CG1   1 
ATOM   5356  C  CG2   . VAL A  1  693  ? 83.680  -102.818 168.986 1.00 72.47  ? 693  VAL A CG2   1 
ATOM   5357  N  N     . THR A  1  694  ? 83.894  -98.214  169.521 1.00 70.92  ? 694  THR A N     1 
ATOM   5358  C  CA    . THR A  1  694  ? 83.861  -96.831  169.076 1.00 72.10  ? 694  THR A CA    1 
ATOM   5359  C  C     . THR A  1  694  ? 85.094  -96.058  169.523 1.00 72.83  ? 694  THR A C     1 
ATOM   5360  O  O     . THR A  1  694  ? 85.757  -95.419  168.708 1.00 73.18  ? 694  THR A O     1 
ATOM   5361  C  CB    . THR A  1  694  ? 82.617  -96.106  169.597 1.00 72.10  ? 694  THR A CB    1 
ATOM   5362  O  OG1   . THR A  1  694  ? 81.444  -96.809  169.171 1.00 72.29  ? 694  THR A OG1   1 
ATOM   5363  C  CG2   . THR A  1  694  ? 82.571  -94.680  169.059 1.00 71.47  ? 694  THR A CG2   1 
ATOM   5364  N  N     . LYS A  1  695  ? 85.400  -96.101  170.816 1.00 73.62  ? 695  LYS A N     1 
ATOM   5365  C  CA    . LYS A  1  695  ? 86.576  -95.396  171.309 1.00 74.02  ? 695  LYS A CA    1 
ATOM   5366  C  C     . LYS A  1  695  ? 87.819  -96.009  170.671 1.00 74.77  ? 695  LYS A C     1 
ATOM   5367  O  O     . LYS A  1  695  ? 88.728  -95.292  170.242 1.00 75.03  ? 695  LYS A O     1 
ATOM   5368  C  CB    . LYS A  1  695  ? 86.631  -95.462  172.836 1.00 72.94  ? 695  LYS A CB    1 
ATOM   5369  C  CG    . LYS A  1  695  ? 85.697  -94.454  173.484 1.00 72.32  ? 695  LYS A CG    1 
ATOM   5370  C  CD    . LYS A  1  695  ? 85.637  -94.595  174.990 1.00 72.33  ? 695  LYS A CD    1 
ATOM   5371  C  CE    . LYS A  1  695  ? 84.752  -93.506  175.590 1.00 73.00  ? 695  LYS A CE    1 
ATOM   5372  N  NZ    . LYS A  1  695  ? 84.554  -93.652  177.068 1.00 73.50  ? 695  LYS A NZ    1 
ATOM   5373  N  N     . GLU A  1  696  ? 87.838  -97.335  170.582 1.00 75.17  ? 696  GLU A N     1 
ATOM   5374  C  CA    . GLU A  1  696  ? 88.953  -98.041  169.962 1.00 76.17  ? 696  GLU A CA    1 
ATOM   5375  C  C     . GLU A  1  696  ? 89.138  -97.596  168.507 1.00 75.63  ? 696  GLU A C     1 
ATOM   5376  O  O     . GLU A  1  696  ? 90.172  -97.851  167.894 1.00 75.86  ? 696  GLU A O     1 
ATOM   5377  C  CB    . GLU A  1  696  ? 88.708  -99.551  169.989 1.00 77.91  ? 696  GLU A CB    1 
ATOM   5378  C  CG    . GLU A  1  696  ? 89.782  -100.346 169.256 1.00 81.14  ? 696  GLU A CG    1 
ATOM   5379  C  CD    . GLU A  1  696  ? 89.474  -101.828 169.178 1.00 83.66  ? 696  GLU A CD    1 
ATOM   5380  O  OE1   . GLU A  1  696  ? 89.296  -102.457 170.250 1.00 84.91  ? 696  GLU A OE1   1 
ATOM   5381  O  OE2   . GLU A  1  696  ? 89.415  -102.361 168.042 1.00 85.09  ? 696  GLU A OE2   1 
ATOM   5382  N  N     . ALA A  1  697  ? 88.128  -96.937  167.957 1.00 74.82  ? 697  ALA A N     1 
ATOM   5383  C  CA    . ALA A  1  697  ? 88.180  -96.480  166.579 1.00 73.63  ? 697  ALA A CA    1 
ATOM   5384  C  C     . ALA A  1  697  ? 88.469  -94.994  166.530 1.00 73.43  ? 697  ALA A C     1 
ATOM   5385  O  O     . ALA A  1  697  ? 88.747  -94.438  165.467 1.00 72.66  ? 697  ALA A O     1 
ATOM   5386  C  CB    . ALA A  1  697  ? 86.864  -96.771  165.895 1.00 73.71  ? 697  ALA A CB    1 
ATOM   5387  N  N     . GLN A  1  698  ? 88.392  -94.349  167.684 1.00 73.57  ? 698  GLN A N     1 
ATOM   5388  C  CA    . GLN A  1  698  ? 88.654  -92.925  167.753 1.00 75.40  ? 698  GLN A CA    1 
ATOM   5389  C  C     . GLN A  1  698  ? 90.126  -92.687  168.078 1.00 77.53  ? 698  GLN A C     1 
ATOM   5390  O  O     . GLN A  1  698  ? 90.619  -91.553  168.000 1.00 78.17  ? 698  GLN A O     1 
ATOM   5391  C  CB    . GLN A  1  698  ? 87.759  -92.278  168.807 1.00 75.31  ? 698  GLN A CB    1 
ATOM   5392  C  CG    . GLN A  1  698  ? 86.282  -92.406  168.510 1.00 75.44  ? 698  GLN A CG    1 
ATOM   5393  C  CD    . GLN A  1  698  ? 85.413  -91.744  169.559 1.00 75.93  ? 698  GLN A CD    1 
ATOM   5394  O  OE1   . GLN A  1  698  ? 85.477  -92.078  170.747 1.00 76.51  ? 698  GLN A OE1   1 
ATOM   5395  N  NE2   . GLN A  1  698  ? 84.591  -90.800  169.125 1.00 75.20  ? 698  GLN A NE2   1 
ATOM   5396  N  N     . ALA A  1  699  ? 90.823  -93.765  168.442 1.00 78.57  ? 699  ALA A N     1 
ATOM   5397  C  CA    . ALA A  1  699  ? 92.249  -93.707  168.762 1.00 78.77  ? 699  ALA A CA    1 
ATOM   5398  C  C     . ALA A  1  699  ? 93.055  -94.219  167.567 1.00 79.42  ? 699  ALA A C     1 
ATOM   5399  O  O     . ALA A  1  699  ? 94.273  -94.356  167.636 1.00 79.53  ? 699  ALA A O     1 
ATOM   5400  C  CB    . ALA A  1  699  ? 92.546  -94.548  169.992 1.00 78.20  ? 699  ALA A CB    1 
ATOM   5401  N  N     . ASN A  1  700  ? 92.357  -94.509  166.474 1.00 80.07  ? 700  ASN A N     1 
ATOM   5402  C  CA    . ASN A  1  700  ? 92.989  -94.990  165.254 1.00 80.68  ? 700  ASN A CA    1 
ATOM   5403  C  C     . ASN A  1  700  ? 93.634  -96.369  165.444 1.00 81.23  ? 700  ASN A C     1 
ATOM   5404  O  O     . ASN A  1  700  ? 94.610  -96.703  164.778 1.00 82.02  ? 700  ASN A O     1 
ATOM   5405  C  CB    . ASN A  1  700  ? 94.024  -93.958  164.790 1.00 81.16  ? 700  ASN A CB    1 
ATOM   5406  C  CG    . ASN A  1  700  ? 94.525  -94.221  163.392 1.00 81.86  ? 700  ASN A CG    1 
ATOM   5407  O  OD1   . ASN A  1  700  ? 93.761  -94.623  162.517 1.00 82.16  ? 700  ASN A OD1   1 
ATOM   5408  N  ND2   . ASN A  1  700  ? 95.815  -93.980  163.165 1.00 82.52  ? 700  ASN A ND2   1 
ATOM   5409  N  N     . LEU A  1  701  ? 93.060  -97.177  166.333 1.00 81.30  ? 701  LEU A N     1 
ATOM   5410  C  CA    . LEU A  1  701  ? 93.580  -98.513  166.622 1.00 81.39  ? 701  LEU A CA    1 
ATOM   5411  C  C     . LEU A  1  701  ? 92.785  -99.636  165.947 1.00 82.29  ? 701  LEU A C     1 
ATOM   5412  O  O     . LEU A  1  701  ? 92.692  -100.741 166.482 1.00 82.17  ? 701  LEU A O     1 
ATOM   5413  C  CB    . LEU A  1  701  ? 93.573  -98.742  168.134 1.00 80.71  ? 701  LEU A CB    1 
ATOM   5414  C  CG    . LEU A  1  701  ? 93.789  -97.497  169.001 1.00 80.16  ? 701  LEU A CG    1 
ATOM   5415  C  CD1   . LEU A  1  701  ? 93.716  -97.869  170.476 1.00 79.81  ? 701  LEU A CD1   1 
ATOM   5416  C  CD2   . LEU A  1  701  ? 95.127  -96.876  168.677 1.00 80.61  ? 701  LEU A CD2   1 
ATOM   5417  N  N     . LEU A  1  702  ? 92.214  -99.365  164.777 1.00 83.39  ? 702  LEU A N     1 
ATOM   5418  C  CA    . LEU A  1  702  ? 91.430  -100.379 164.078 1.00 84.85  ? 702  LEU A CA    1 
ATOM   5419  C  C     . LEU A  1  702  ? 92.104  -100.908 162.824 1.00 86.21  ? 702  LEU A C     1 
ATOM   5420  O  O     . LEU A  1  702  ? 92.797  -100.175 162.112 1.00 86.29  ? 702  LEU A O     1 
ATOM   5421  C  CB    . LEU A  1  702  ? 90.054  -99.833  163.693 1.00 84.53  ? 702  LEU A CB    1 
ATOM   5422  C  CG    . LEU A  1  702  ? 89.055  -99.420  164.775 1.00 84.22  ? 702  LEU A CG    1 
ATOM   5423  C  CD1   . LEU A  1  702  ? 87.755  -99.081  164.082 1.00 83.68  ? 702  LEU A CD1   1 
ATOM   5424  C  CD2   . LEU A  1  702  ? 88.831  -100.536 165.788 1.00 83.99  ? 702  LEU A CD2   1 
ATOM   5425  N  N     . THR A  1  703  ? 91.881  -102.190 162.558 1.00 87.68  ? 703  THR A N     1 
ATOM   5426  C  CA    . THR A  1  703  ? 92.447  -102.853 161.387 1.00 89.44  ? 703  THR A CA    1 
ATOM   5427  C  C     . THR A  1  703  ? 91.451  -102.813 160.242 1.00 89.49  ? 703  THR A C     1 
ATOM   5428  O  O     . THR A  1  703  ? 90.583  -103.682 160.144 1.00 89.11  ? 703  THR A O     1 
ATOM   5429  C  CB    . THR A  1  703  ? 92.770  -104.347 161.678 1.00 90.54  ? 703  THR A CB    1 
ATOM   5430  O  OG1   . THR A  1  703  ? 93.878  -104.435 162.583 1.00 91.59  ? 703  THR A OG1   1 
ATOM   5431  C  CG2   . THR A  1  703  ? 93.094  -105.106 160.381 1.00 90.08  ? 703  THR A CG2   1 
ATOM   5432  N  N     . ALA A  1  704  ? 91.568  -101.807 159.382 1.00 89.99  ? 704  ALA A N     1 
ATOM   5433  C  CA    . ALA A  1  704  ? 90.667  -101.703 158.241 1.00 90.66  ? 704  ALA A CA    1 
ATOM   5434  C  C     . ALA A  1  704  ? 90.668  -103.053 157.511 1.00 91.55  ? 704  ALA A C     1 
ATOM   5435  O  O     . ALA A  1  704  ? 91.673  -103.440 156.904 1.00 92.26  ? 704  ALA A O     1 
ATOM   5436  C  CB    . ALA A  1  704  ? 91.133  -100.592 157.310 1.00 89.95  ? 704  ALA A CB    1 
ATOM   5437  N  N     . LYS A  1  705  ? 89.549  -103.774 157.592 1.00 91.67  ? 705  LYS A N     1 
ATOM   5438  C  CA    . LYS A  1  705  ? 89.414  -105.082 156.949 1.00 91.79  ? 705  LYS A CA    1 
ATOM   5439  C  C     . LYS A  1  705  ? 89.560  -104.935 155.433 1.00 92.53  ? 705  LYS A C     1 
ATOM   5440  O  O     . LYS A  1  705  ? 88.918  -104.072 154.828 1.00 92.83  ? 705  LYS A O     1 
ATOM   5441  C  CB    . LYS A  1  705  ? 88.047  -105.677 157.286 1.00 91.63  ? 705  LYS A CB    1 
ATOM   5442  C  CG    . LYS A  1  705  ? 87.715  -105.630 158.765 1.00 90.94  ? 705  LYS A CG    1 
ATOM   5443  C  CD    . LYS A  1  705  ? 86.286  -106.058 159.035 1.00 90.25  ? 705  LYS A CD    1 
ATOM   5444  C  CE    . LYS A  1  705  ? 85.988  -106.018 160.523 1.00 89.67  ? 705  LYS A CE    1 
ATOM   5445  N  NZ    . LYS A  1  705  ? 84.599  -106.454 160.816 1.00 89.21  ? 705  LYS A NZ    1 
ATOM   5446  N  N     . HIS A  1  706  ? 90.394  -105.781 154.825 1.00 92.59  ? 706  HIS A N     1 
ATOM   5447  C  CA    . HIS A  1  706  ? 90.651  -105.726 153.381 1.00 92.25  ? 706  HIS A CA    1 
ATOM   5448  C  C     . HIS A  1  706  ? 89.426  -105.358 152.532 1.00 92.00  ? 706  HIS A C     1 
ATOM   5449  O  O     . HIS A  1  706  ? 88.347  -105.944 152.683 1.00 92.03  ? 706  HIS A O     1 
ATOM   5450  C  CB    . HIS A  1  706  ? 91.231  -107.061 152.891 1.00 92.45  ? 706  HIS A CB    1 
ATOM   5451  C  CG    . HIS A  1  706  ? 91.891  -106.974 151.546 1.00 92.67  ? 706  HIS A CG    1 
ATOM   5452  N  ND1   . HIS A  1  706  ? 93.079  -106.305 151.343 1.00 92.43  ? 706  HIS A ND1   1 
ATOM   5453  C  CD2   . HIS A  1  706  ? 91.521  -107.457 150.335 1.00 92.67  ? 706  HIS A CD2   1 
ATOM   5454  C  CE1   . HIS A  1  706  ? 93.413  -106.380 150.066 1.00 92.20  ? 706  HIS A CE1   1 
ATOM   5455  N  NE2   . HIS A  1  706  ? 92.484  -107.073 149.433 1.00 91.98  ? 706  HIS A NE2   1 
ATOM   5456  N  N     . GLY A  1  707  ? 89.605  -104.379 151.645 1.00 91.24  ? 707  GLY A N     1 
ATOM   5457  C  CA    . GLY A  1  707  ? 88.523  -103.940 150.779 1.00 90.63  ? 707  GLY A CA    1 
ATOM   5458  C  C     . GLY A  1  707  ? 87.473  -103.053 151.437 1.00 90.45  ? 707  GLY A C     1 
ATOM   5459  O  O     . GLY A  1  707  ? 86.485  -102.691 150.797 1.00 90.07  ? 707  GLY A O     1 
ATOM   5460  N  N     . MET A  1  708  ? 87.677  -102.704 152.708 1.00 90.10  ? 708  MET A N     1 
ATOM   5461  C  CA    . MET A  1  708  ? 86.738  -101.853 153.453 1.00 88.84  ? 708  MET A CA    1 
ATOM   5462  C  C     . MET A  1  708  ? 87.412  -100.679 154.157 1.00 86.95  ? 708  MET A C     1 
ATOM   5463  O  O     . MET A  1  708  ? 88.555  -100.785 154.598 1.00 87.48  ? 708  MET A O     1 
ATOM   5464  C  CB    . MET A  1  708  ? 86.011  -102.660 154.524 1.00 90.55  ? 708  MET A CB    1 
ATOM   5465  C  CG    . MET A  1  708  ? 84.985  -103.637 154.028 1.00 93.57  ? 708  MET A CG    1 
ATOM   5466  S  SD    . MET A  1  708  ? 84.134  -104.343 155.455 1.00 98.16  ? 708  MET A SD    1 
ATOM   5467  C  CE    . MET A  1  708  ? 85.161  -105.815 155.785 1.00 97.04  ? 708  MET A CE    1 
ATOM   5468  N  N     . THR A  1  709  ? 86.691  -99.570  154.280 1.00 84.19  ? 709  THR A N     1 
ATOM   5469  C  CA    . THR A  1  709  ? 87.220  -98.399  154.964 1.00 81.76  ? 709  THR A CA    1 
ATOM   5470  C  C     . THR A  1  709  ? 87.238  -98.718  156.441 1.00 81.08  ? 709  THR A C     1 
ATOM   5471  O  O     . THR A  1  709  ? 86.757  -99.768  156.862 1.00 80.29  ? 709  THR A O     1 
ATOM   5472  C  CB    . THR A  1  709  ? 86.328  -97.177  154.770 1.00 81.40  ? 709  THR A CB    1 
ATOM   5473  O  OG1   . THR A  1  709  ? 86.179  -96.929  153.372 1.00 81.33  ? 709  THR A OG1   1 
ATOM   5474  C  CG2   . THR A  1  709  ? 86.947  -95.950  155.425 1.00 80.87  ? 709  THR A CG2   1 
ATOM   5475  N  N     . LEU A  1  710  ? 87.804  -97.813  157.226 1.00 80.87  ? 710  LEU A N     1 
ATOM   5476  C  CA    . LEU A  1  710  ? 87.860  -97.999  158.667 1.00 80.50  ? 710  LEU A CA    1 
ATOM   5477  C  C     . LEU A  1  710  ? 86.424  -97.830  159.124 1.00 79.84  ? 710  LEU A C     1 
ATOM   5478  O  O     . LEU A  1  710  ? 85.925  -98.583  159.964 1.00 80.43  ? 710  LEU A O     1 
ATOM   5479  C  CB    . LEU A  1  710  ? 88.713  -96.914  159.328 1.00 80.27  ? 710  LEU A CB    1 
ATOM   5480  C  CG    . LEU A  1  710  ? 90.029  -96.457  158.701 1.00 80.35  ? 710  LEU A CG    1 
ATOM   5481  C  CD1   . LEU A  1  710  ? 89.810  -95.874  157.299 1.00 79.78  ? 710  LEU A CD1   1 
ATOM   5482  C  CD2   . LEU A  1  710  ? 90.635  -95.410  159.621 1.00 80.33  ? 710  LEU A CD2   1 
ATOM   5483  N  N     . ARG A  1  711  ? 85.768  -96.826  158.551 1.00 78.47  ? 711  ARG A N     1 
ATOM   5484  C  CA    . ARG A  1  711  ? 84.390  -96.517  158.881 1.00 77.34  ? 711  ARG A CA    1 
ATOM   5485  C  C     . ARG A  1  711  ? 83.502  -97.661  158.415 1.00 77.44  ? 711  ARG A C     1 
ATOM   5486  O  O     . ARG A  1  711  ? 82.679  -98.160  159.182 1.00 77.13  ? 711  ARG A O     1 
ATOM   5487  C  CB    . ARG A  1  711  ? 84.010  -95.196  158.227 1.00 76.27  ? 711  ARG A CB    1 
ATOM   5488  C  CG    . ARG A  1  711  ? 85.213  -94.283  158.119 1.00 75.55  ? 711  ARG A CG    1 
ATOM   5489  C  CD    . ARG A  1  711  ? 84.861  -92.824  157.923 1.00 76.38  ? 711  ARG A CD    1 
ATOM   5490  N  NE    . ARG A  1  711  ? 84.519  -92.154  159.177 1.00 76.34  ? 711  ARG A NE    1 
ATOM   5491  C  CZ    . ARG A  1  711  ? 84.628  -90.841  159.370 1.00 76.32  ? 711  ARG A CZ    1 
ATOM   5492  N  NH1   . ARG A  1  711  ? 85.074  -90.063  158.387 1.00 75.89  ? 711  ARG A NH1   1 
ATOM   5493  N  NH2   . ARG A  1  711  ? 84.293  -90.306  160.538 1.00 75.04  ? 711  ARG A NH2   1 
ATOM   5494  N  N     . GLU A  1  712  ? 83.679  -98.096  157.169 1.00 77.85  ? 712  GLU A N     1 
ATOM   5495  C  CA    . GLU A  1  712  ? 82.883  -99.211  156.667 1.00 78.04  ? 712  GLU A CA    1 
ATOM   5496  C  C     . GLU A  1  712  ? 83.058  -100.368 157.645 1.00 76.96  ? 712  GLU A C     1 
ATOM   5497  O  O     . GLU A  1  712  ? 82.086  -100.890 158.190 1.00 77.11  ? 712  GLU A O     1 
ATOM   5498  C  CB    . GLU A  1  712  ? 83.344  -99.656  155.273 1.00 79.57  ? 712  GLU A CB    1 
ATOM   5499  C  CG    . GLU A  1  712  ? 83.228  -98.598  154.187 1.00 82.72  ? 712  GLU A CG    1 
ATOM   5500  C  CD    . GLU A  1  712  ? 83.141  -99.202  152.786 1.00 84.78  ? 712  GLU A CD    1 
ATOM   5501  O  OE1   . GLU A  1  712  ? 83.957  -100.098 152.461 1.00 85.75  ? 712  GLU A OE1   1 
ATOM   5502  O  OE2   . GLU A  1  712  ? 82.255  -98.774  152.007 1.00 85.71  ? 712  GLU A OE2   1 
ATOM   5503  N  N     . SER A  1  713  ? 84.310  -100.750 157.875 1.00 75.58  ? 713  SER A N     1 
ATOM   5504  C  CA    . SER A  1  713  ? 84.618  -101.840 158.789 1.00 73.98  ? 713  SER A CA    1 
ATOM   5505  C  C     . SER A  1  713  ? 84.144  -101.531 160.206 1.00 73.20  ? 713  SER A C     1 
ATOM   5506  O  O     . SER A  1  713  ? 83.938  -102.440 161.003 1.00 73.27  ? 713  SER A O     1 
ATOM   5507  C  CB    . SER A  1  713  ? 86.122  -102.122 158.788 1.00 73.35  ? 713  SER A CB    1 
ATOM   5508  O  OG    . SER A  1  713  ? 86.569  -102.518 157.503 1.00 72.70  ? 713  SER A OG    1 
ATOM   5509  N  N     . PHE A  1  714  ? 83.969  -100.252 160.524 1.00 72.15  ? 714  PHE A N     1 
ATOM   5510  C  CA    . PHE A  1  714  ? 83.505  -99.883  161.854 1.00 71.39  ? 714  PHE A CA    1 
ATOM   5511  C  C     . PHE A  1  714  ? 82.053  -100.272 162.032 1.00 72.47  ? 714  PHE A C     1 
ATOM   5512  O  O     . PHE A  1  714  ? 81.713  -101.056 162.919 1.00 72.09  ? 714  PHE A O     1 
ATOM   5513  C  CB    . PHE A  1  714  ? 83.629  -98.383  162.095 1.00 69.61  ? 714  PHE A CB    1 
ATOM   5514  C  CG    . PHE A  1  714  ? 82.873  -97.910  163.309 1.00 68.31  ? 714  PHE A CG    1 
ATOM   5515  C  CD1   . PHE A  1  714  ? 83.085  -98.504  164.552 1.00 66.95  ? 714  PHE A CD1   1 
ATOM   5516  C  CD2   . PHE A  1  714  ? 81.939  -96.882  163.213 1.00 68.03  ? 714  PHE A CD2   1 
ATOM   5517  C  CE1   . PHE A  1  714  ? 82.382  -98.083  165.679 1.00 65.72  ? 714  PHE A CE1   1 
ATOM   5518  C  CE2   . PHE A  1  714  ? 81.227  -96.453  164.344 1.00 67.02  ? 714  PHE A CE2   1 
ATOM   5519  C  CZ    . PHE A  1  714  ? 81.452  -97.056  165.575 1.00 65.39  ? 714  PHE A CZ    1 
ATOM   5520  N  N     . GLU A  1  715  ? 81.199  -99.697  161.190 1.00 73.46  ? 715  GLU A N     1 
ATOM   5521  C  CA    . GLU A  1  715  ? 79.772  -99.969  161.238 1.00 74.61  ? 715  GLU A CA    1 
ATOM   5522  C  C     . GLU A  1  715  ? 79.503  -101.469 161.203 1.00 75.42  ? 715  GLU A C     1 
ATOM   5523  O  O     . GLU A  1  715  ? 78.786  -101.989 162.057 1.00 75.74  ? 715  GLU A O     1 
ATOM   5524  C  CB    . GLU A  1  715  ? 79.065  -99.281  160.070 1.00 74.95  ? 715  GLU A CB    1 
ATOM   5525  C  CG    . GLU A  1  715  ? 79.039  -97.757  160.155 1.00 76.40  ? 715  GLU A CG    1 
ATOM   5526  C  CD    . GLU A  1  715  ? 78.095  -97.227  161.230 1.00 77.18  ? 715  GLU A CD    1 
ATOM   5527  O  OE1   . GLU A  1  715  ? 76.896  -97.565  161.188 1.00 77.04  ? 715  GLU A OE1   1 
ATOM   5528  O  OE2   . GLU A  1  715  ? 78.545  -96.463  162.112 1.00 78.09  ? 715  GLU A OE2   1 
ATOM   5529  N  N     . ASP A  1  716  ? 80.086  -102.164 160.227 1.00 76.04  ? 716  ASP A N     1 
ATOM   5530  C  CA    . ASP A  1  716  ? 79.902  -103.610 160.103 1.00 76.85  ? 716  ASP A CA    1 
ATOM   5531  C  C     . ASP A  1  716  ? 79.942  -104.277 161.470 1.00 76.89  ? 716  ASP A C     1 
ATOM   5532  O  O     . ASP A  1  716  ? 79.057  -105.056 161.817 1.00 77.43  ? 716  ASP A O     1 
ATOM   5533  C  CB    . ASP A  1  716  ? 80.992  -104.234 159.222 1.00 78.23  ? 716  ASP A CB    1 
ATOM   5534  C  CG    . ASP A  1  716  ? 80.851  -105.760 159.096 1.00 80.01  ? 716  ASP A CG    1 
ATOM   5535  O  OD1   . ASP A  1  716  ? 80.741  -106.457 160.135 1.00 79.99  ? 716  ASP A OD1   1 
ATOM   5536  O  OD2   . ASP A  1  716  ? 80.861  -106.266 157.951 1.00 80.70  ? 716  ASP A OD2   1 
ATOM   5537  N  N     . ASN A  1  717  ? 80.978  -103.981 162.245 1.00 76.80  ? 717  ASN A N     1 
ATOM   5538  C  CA    . ASN A  1  717  ? 81.099  -104.572 163.571 1.00 76.75  ? 717  ASN A CA    1 
ATOM   5539  C  C     . ASN A  1  717  ? 79.973  -104.064 164.455 1.00 75.10  ? 717  ASN A C     1 
ATOM   5540  O  O     . ASN A  1  717  ? 79.327  -104.843 165.154 1.00 75.43  ? 717  ASN A O     1 
ATOM   5541  C  CB    . ASN A  1  717  ? 82.459  -104.230 164.201 1.00 78.07  ? 717  ASN A CB    1 
ATOM   5542  C  CG    . ASN A  1  717  ? 83.624  -104.906 163.490 1.00 79.21  ? 717  ASN A CG    1 
ATOM   5543  O  OD1   . ASN A  1  717  ? 83.721  -106.134 163.463 1.00 81.07  ? 717  ASN A OD1   1 
ATOM   5544  N  ND2   . ASN A  1  717  ? 84.511  -104.107 162.909 1.00 79.12  ? 717  ASN A ND2   1 
ATOM   5545  N  N     . VAL A  1  718  ? 79.734  -102.757 164.409 1.00 73.07  ? 718  VAL A N     1 
ATOM   5546  C  CA    . VAL A  1  718  ? 78.684  -102.143 165.212 1.00 71.62  ? 718  VAL A CA    1 
ATOM   5547  C  C     . VAL A  1  718  ? 77.358  -102.857 165.016 1.00 70.96  ? 718  VAL A C     1 
ATOM   5548  O  O     . VAL A  1  718  ? 76.860  -103.531 165.919 1.00 70.80  ? 718  VAL A O     1 
ATOM   5549  C  CB    . VAL A  1  718  ? 78.492  -100.675 164.838 1.00 71.02  ? 718  VAL A CB    1 
ATOM   5550  C  CG1   . VAL A  1  718  ? 77.403  -100.060 165.700 1.00 69.63  ? 718  VAL A CG1   1 
ATOM   5551  C  CG2   . VAL A  1  718  ? 79.797  -99.938  165.002 1.00 70.56  ? 718  VAL A CG2   1 
ATOM   5552  N  N     . VAL A  1  719  ? 76.793  -102.701 163.825 1.00 70.05  ? 719  VAL A N     1 
ATOM   5553  C  CA    . VAL A  1  719  ? 75.523  -103.319 163.483 1.00 68.61  ? 719  VAL A CA    1 
ATOM   5554  C  C     . VAL A  1  719  ? 75.426  -104.779 163.920 1.00 69.34  ? 719  VAL A C     1 
ATOM   5555  O  O     . VAL A  1  719  ? 74.459  -105.166 164.578 1.00 69.75  ? 719  VAL A O     1 
ATOM   5556  C  CB    . VAL A  1  719  ? 75.264  -103.209 161.971 1.00 66.77  ? 719  VAL A CB    1 
ATOM   5557  C  CG1   . VAL A  1  719  ? 74.261  -104.235 161.535 1.00 66.44  ? 719  VAL A CG1   1 
ATOM   5558  C  CG2   . VAL A  1  719  ? 74.737  -101.832 161.651 1.00 65.57  ? 719  VAL A CG2   1 
ATOM   5559  N  N     . ARG A  1  720  ? 76.424  -105.586 163.577 1.00 69.48  ? 720  ARG A N     1 
ATOM   5560  C  CA    . ARG A  1  720  ? 76.392  -106.994 163.944 1.00 69.89  ? 720  ARG A CA    1 
ATOM   5561  C  C     . ARG A  1  720  ? 76.263  -107.184 165.443 1.00 69.46  ? 720  ARG A C     1 
ATOM   5562  O  O     . ARG A  1  720  ? 75.956  -108.277 165.901 1.00 69.37  ? 720  ARG A O     1 
ATOM   5563  C  CB    . ARG A  1  720  ? 77.644  -107.716 163.449 1.00 71.28  ? 720  ARG A CB    1 
ATOM   5564  C  CG    . ARG A  1  720  ? 77.568  -109.232 163.579 1.00 73.33  ? 720  ARG A CG    1 
ATOM   5565  C  CD    . ARG A  1  720  ? 78.896  -109.889 163.250 1.00 75.30  ? 720  ARG A CD    1 
ATOM   5566  N  NE    . ARG A  1  720  ? 79.968  -109.389 164.113 1.00 78.01  ? 720  ARG A NE    1 
ATOM   5567  C  CZ    . ARG A  1  720  ? 80.879  -108.485 163.750 1.00 78.71  ? 720  ARG A CZ    1 
ATOM   5568  N  NH1   . ARG A  1  720  ? 80.865  -107.967 162.522 1.00 78.27  ? 720  ARG A NH1   1 
ATOM   5569  N  NH2   . ARG A  1  720  ? 81.804  -108.089 164.625 1.00 78.54  ? 720  ARG A NH2   1 
ATOM   5570  N  N     . PHE A  1  721  ? 76.502  -106.128 166.210 1.00 69.70  ? 721  PHE A N     1 
ATOM   5571  C  CA    . PHE A  1  721  ? 76.394  -106.229 167.660 1.00 71.45  ? 721  PHE A CA    1 
ATOM   5572  C  C     . PHE A  1  721  ? 74.953  -106.046 168.093 1.00 71.39  ? 721  PHE A C     1 
ATOM   5573  O  O     . PHE A  1  721  ? 74.403  -106.870 168.834 1.00 71.06  ? 721  PHE A O     1 
ATOM   5574  C  CB    . PHE A  1  721  ? 77.268  -105.171 168.355 1.00 73.11  ? 721  PHE A CB    1 
ATOM   5575  C  CG    . PHE A  1  721  ? 78.746  -105.471 168.319 1.00 75.13  ? 721  PHE A CG    1 
ATOM   5576  C  CD1   . PHE A  1  721  ? 79.676  -104.457 168.538 1.00 74.78  ? 721  PHE A CD1   1 
ATOM   5577  C  CD2   . PHE A  1  721  ? 79.211  -106.762 168.035 1.00 76.26  ? 721  PHE A CD2   1 
ATOM   5578  C  CE1   . PHE A  1  721  ? 81.039  -104.717 168.470 1.00 75.37  ? 721  PHE A CE1   1 
ATOM   5579  C  CE2   . PHE A  1  721  ? 80.575  -107.031 167.964 1.00 76.24  ? 721  PHE A CE2   1 
ATOM   5580  C  CZ    . PHE A  1  721  ? 81.490  -106.004 168.180 1.00 76.19  ? 721  PHE A CZ    1 
ATOM   5581  N  N     . LEU A  1  722  ? 74.343  -104.965 167.616 1.00 71.08  ? 722  LEU A N     1 
ATOM   5582  C  CA    . LEU A  1  722  ? 72.968  -104.653 167.970 1.00 71.25  ? 722  LEU A CA    1 
ATOM   5583  C  C     . LEU A  1  722  ? 71.980  -105.727 167.516 1.00 72.53  ? 722  LEU A C     1 
ATOM   5584  O  O     . LEU A  1  722  ? 71.062  -106.080 168.255 1.00 73.36  ? 722  LEU A O     1 
ATOM   5585  C  CB    . LEU A  1  722  ? 72.569  -103.292 167.396 1.00 69.23  ? 722  LEU A CB    1 
ATOM   5586  C  CG    . LEU A  1  722  ? 73.489  -102.108 167.693 1.00 67.09  ? 722  LEU A CG    1 
ATOM   5587  C  CD1   . LEU A  1  722  ? 74.659  -102.169 166.738 1.00 66.58  ? 722  LEU A CD1   1 
ATOM   5588  C  CD2   . LEU A  1  722  ? 72.754  -100.782 167.519 1.00 65.97  ? 722  LEU A CD2   1 
ATOM   5589  N  N     . ASN A  1  723  ? 72.155  -106.245 166.308 1.00 73.40  ? 723  ASN A N     1 
ATOM   5590  C  CA    . ASN A  1  723  ? 71.257  -107.280 165.821 1.00 74.65  ? 723  ASN A CA    1 
ATOM   5591  C  C     . ASN A  1  723  ? 71.505  -108.541 166.609 1.00 75.66  ? 723  ASN A C     1 
ATOM   5592  O  O     . ASN A  1  723  ? 70.592  -109.128 167.183 1.00 75.90  ? 723  ASN A O     1 
ATOM   5593  C  CB    . ASN A  1  723  ? 71.502  -107.538 164.348 1.00 74.51  ? 723  ASN A CB    1 
ATOM   5594  C  CG    . ASN A  1  723  ? 71.349  -106.294 163.535 1.00 74.95  ? 723  ASN A CG    1 
ATOM   5595  O  OD1   . ASN A  1  723  ? 70.496  -105.453 163.831 1.00 74.86  ? 723  ASN A OD1   1 
ATOM   5596  N  ND2   . ASN A  1  723  ? 72.165  -106.158 162.502 1.00 75.17  ? 723  ASN A ND2   1 
ATOM   5597  N  N     . GLU A  1  724  ? 72.759  -108.958 166.620 1.00 77.22  ? 724  GLU A N     1 
ATOM   5598  C  CA    . GLU A  1  724  ? 73.155  -110.140 167.355 1.00 78.65  ? 724  GLU A CA    1 
ATOM   5599  C  C     . GLU A  1  724  ? 72.594  -110.005 168.773 1.00 76.91  ? 724  GLU A C     1 
ATOM   5600  O  O     . GLU A  1  724  ? 72.154  -110.991 169.374 1.00 76.41  ? 724  GLU A O     1 
ATOM   5601  C  CB    . GLU A  1  724  ? 74.685  -110.228 167.342 1.00 81.87  ? 724  GLU A CB    1 
ATOM   5602  C  CG    . GLU A  1  724  ? 75.329  -111.036 168.454 1.00 86.68  ? 724  GLU A CG    1 
ATOM   5603  C  CD    . GLU A  1  724  ? 76.854  -111.062 168.340 1.00 89.44  ? 724  GLU A CD    1 
ATOM   5604  O  OE1   . GLU A  1  724  ? 77.429  -110.148 167.691 1.00 90.24  ? 724  GLU A OE1   1 
ATOM   5605  O  OE2   . GLU A  1  724  ? 77.474  -111.991 168.912 1.00 90.89  ? 724  GLU A OE2   1 
ATOM   5606  N  N     . ALA A  1  725  ? 72.586  -108.774 169.282 1.00 75.05  ? 725  ALA A N     1 
ATOM   5607  C  CA    . ALA A  1  725  ? 72.063  -108.488 170.616 1.00 74.76  ? 725  ALA A CA    1 
ATOM   5608  C  C     . ALA A  1  725  ? 70.557  -108.729 170.662 1.00 74.54  ? 725  ALA A C     1 
ATOM   5609  O  O     . ALA A  1  725  ? 70.071  -109.575 171.421 1.00 74.56  ? 725  ALA A O     1 
ATOM   5610  C  CB    . ALA A  1  725  ? 72.359  -107.053 170.993 1.00 74.35  ? 725  ALA A CB    1 
ATOM   5611  N  N     . ARG A  1  726  ? 69.833  -107.965 169.842 1.00 74.32  ? 726  ARG A N     1 
ATOM   5612  C  CA    . ARG A  1  726  ? 68.372  -108.046 169.725 1.00 72.59  ? 726  ARG A CA    1 
ATOM   5613  C  C     . ARG A  1  726  ? 67.876  -109.487 169.620 1.00 72.48  ? 726  ARG A C     1 
ATOM   5614  O  O     . ARG A  1  726  ? 67.028  -109.928 170.404 1.00 72.48  ? 726  ARG A O     1 
ATOM   5615  C  CB    . ARG A  1  726  ? 67.902  -107.284 168.486 1.00 70.57  ? 726  ARG A CB    1 
ATOM   5616  C  CG    . ARG A  1  726  ? 66.414  -107.395 168.248 1.00 68.67  ? 726  ARG A CG    1 
ATOM   5617  C  CD    . ARG A  1  726  ? 66.053  -106.973 166.844 1.00 67.74  ? 726  ARG A CD    1 
ATOM   5618  N  NE    . ARG A  1  726  ? 66.445  -107.963 165.844 1.00 65.80  ? 726  ARG A NE    1 
ATOM   5619  C  CZ    . ARG A  1  726  ? 67.120  -107.669 164.740 1.00 65.53  ? 726  ARG A CZ    1 
ATOM   5620  N  NH1   . ARG A  1  726  ? 67.481  -106.412 164.501 1.00 64.60  ? 726  ARG A NH1   1 
ATOM   5621  N  NH2   . ARG A  1  726  ? 67.423  -108.627 163.874 1.00 65.38  ? 726  ARG A NH2   1 
ATOM   5622  N  N     . ASP A  1  727  ? 68.401  -110.205 168.633 1.00 71.69  ? 727  ASP A N     1 
ATOM   5623  C  CA    . ASP A  1  727  ? 68.023  -111.586 168.414 1.00 70.94  ? 727  ASP A CA    1 
ATOM   5624  C  C     . ASP A  1  727  ? 68.102  -112.382 169.696 1.00 70.54  ? 727  ASP A C     1 
ATOM   5625  O  O     . ASP A  1  727  ? 67.241  -113.210 169.957 1.00 70.60  ? 727  ASP A O     1 
ATOM   5626  C  CB    . ASP A  1  727  ? 68.904  -112.196 167.330 1.00 72.12  ? 727  ASP A CB    1 
ATOM   5627  C  CG    . ASP A  1  727  ? 68.560  -111.659 165.948 1.00 73.37  ? 727  ASP A CG    1 
ATOM   5628  O  OD1   . ASP A  1  727  ? 68.542  -110.421 165.783 1.00 73.51  ? 727  ASP A OD1   1 
ATOM   5629  O  OD2   . ASP A  1  727  ? 68.297  -112.468 165.029 1.00 74.53  ? 727  ASP A OD2   1 
ATOM   5630  N  N     . LYS A  1  728  ? 69.118  -112.127 170.511 1.00 70.17  ? 728  LYS A N     1 
ATOM   5631  C  CA    . LYS A  1  728  ? 69.230  -112.854 171.764 1.00 70.21  ? 728  LYS A CA    1 
ATOM   5632  C  C     . LYS A  1  728  ? 68.129  -112.387 172.713 1.00 69.50  ? 728  LYS A C     1 
ATOM   5633  O  O     . LYS A  1  728  ? 67.420  -113.207 173.302 1.00 69.61  ? 728  LYS A O     1 
ATOM   5634  C  CB    . LYS A  1  728  ? 70.611  -112.652 172.392 1.00 71.82  ? 728  LYS A CB    1 
ATOM   5635  C  CG    . LYS A  1  728  ? 70.905  -113.640 173.526 1.00 73.95  ? 728  LYS A CG    1 
ATOM   5636  C  CD    . LYS A  1  728  ? 72.394  -113.973 173.639 1.00 74.80  ? 728  LYS A CD    1 
ATOM   5637  C  CE    . LYS A  1  728  ? 73.243  -112.750 173.973 1.00 74.24  ? 728  LYS A CE    1 
ATOM   5638  N  NZ    . LYS A  1  728  ? 74.688  -113.116 174.003 1.00 73.69  ? 728  LYS A NZ    1 
ATOM   5639  N  N     . ALA A  1  729  ? 67.981  -111.071 172.850 1.00 68.35  ? 729  ALA A N     1 
ATOM   5640  C  CA    . ALA A  1  729  ? 66.945  -110.505 173.710 1.00 67.38  ? 729  ALA A CA    1 
ATOM   5641  C  C     . ALA A  1  729  ? 65.656  -111.235 173.381 1.00 67.33  ? 729  ALA A C     1 
ATOM   5642  O  O     . ALA A  1  729  ? 64.878  -111.590 174.272 1.00 66.46  ? 729  ALA A O     1 
ATOM   5643  C  CB    . ALA A  1  729  ? 66.786  -109.027 173.427 1.00 67.31  ? 729  ALA A CB    1 
ATOM   5644  N  N     . GLY A  1  730  ? 65.457  -111.456 172.081 1.00 67.79  ? 730  GLY A N     1 
ATOM   5645  C  CA    . GLY A  1  730  ? 64.286  -112.156 171.586 1.00 67.55  ? 730  GLY A CA    1 
ATOM   5646  C  C     . GLY A  1  730  ? 64.267  -113.603 172.042 1.00 67.76  ? 730  GLY A C     1 
ATOM   5647  O  O     . GLY A  1  730  ? 63.436  -113.979 172.868 1.00 68.64  ? 730  GLY A O     1 
ATOM   5648  N  N     . ARG A  1  731  ? 65.178  -114.418 171.516 1.00 67.29  ? 731  ARG A N     1 
ATOM   5649  C  CA    . ARG A  1  731  ? 65.246  -115.825 171.897 1.00 67.02  ? 731  ARG A CA    1 
ATOM   5650  C  C     . ARG A  1  731  ? 65.094  -115.979 173.407 1.00 66.58  ? 731  ARG A C     1 
ATOM   5651  O  O     . ARG A  1  731  ? 64.677  -117.032 173.889 1.00 66.58  ? 731  ARG A O     1 
ATOM   5652  C  CB    . ARG A  1  731  ? 66.567  -116.448 171.435 1.00 68.29  ? 731  ARG A CB    1 
ATOM   5653  C  CG    . ARG A  1  731  ? 66.637  -116.725 169.939 1.00 71.08  ? 731  ARG A CG    1 
ATOM   5654  C  CD    . ARG A  1  731  ? 68.035  -117.163 169.479 1.00 74.20  ? 731  ARG A CD    1 
ATOM   5655  N  NE    . ARG A  1  731  ? 68.959  -116.048 169.234 1.00 76.62  ? 731  ARG A NE    1 
ATOM   5656  C  CZ    . ARG A  1  731  ? 69.858  -115.583 170.106 1.00 77.92  ? 731  ARG A CZ    1 
ATOM   5657  N  NH1   . ARG A  1  731  ? 69.981  -116.128 171.317 1.00 77.96  ? 731  ARG A NH1   1 
ATOM   5658  N  NH2   . ARG A  1  731  ? 70.649  -114.571 169.760 1.00 78.37  ? 731  ARG A NH2   1 
ATOM   5659  N  N     . LEU A  1  732  ? 65.430  -114.931 174.154 1.00 64.98  ? 732  LEU A N     1 
ATOM   5660  C  CA    . LEU A  1  732  ? 65.291  -114.974 175.602 1.00 63.78  ? 732  LEU A CA    1 
ATOM   5661  C  C     . LEU A  1  732  ? 63.818  -115.073 175.959 1.00 63.88  ? 732  LEU A C     1 
ATOM   5662  O  O     . LEU A  1  732  ? 63.382  -116.028 176.604 1.00 64.03  ? 732  LEU A O     1 
ATOM   5663  C  CB    . LEU A  1  732  ? 65.873  -113.719 176.247 1.00 63.27  ? 732  LEU A CB    1 
ATOM   5664  C  CG    . LEU A  1  732  ? 67.390  -113.642 176.422 1.00 62.71  ? 732  LEU A CG    1 
ATOM   5665  C  CD1   . LEU A  1  732  ? 67.733  -112.432 177.284 1.00 62.38  ? 732  LEU A CD1   1 
ATOM   5666  C  CD2   . LEU A  1  732  ? 67.898  -114.911 177.080 1.00 61.69  ? 732  LEU A CD2   1 
ATOM   5667  N  N     . ALA A  1  733  ? 63.059  -114.071 175.531 1.00 63.22  ? 733  ALA A N     1 
ATOM   5668  C  CA    . ALA A  1  733  ? 61.631  -114.023 175.795 1.00 63.07  ? 733  ALA A CA    1 
ATOM   5669  C  C     . ALA A  1  733  ? 60.899  -115.204 175.163 1.00 63.22  ? 733  ALA A C     1 
ATOM   5670  O  O     . ALA A  1  733  ? 60.054  -115.827 175.804 1.00 63.04  ? 733  ALA A O     1 
ATOM   5671  C  CB    . ALA A  1  733  ? 61.063  -112.717 175.281 1.00 62.82  ? 733  ALA A CB    1 
ATOM   5672  N  N     . GLU A  1  734  ? 61.226  -115.507 173.910 1.00 63.73  ? 734  GLU A N     1 
ATOM   5673  C  CA    . GLU A  1  734  ? 60.597  -116.613 173.194 1.00 64.94  ? 734  GLU A CA    1 
ATOM   5674  C  C     . GLU A  1  734  ? 60.620  -117.914 173.980 1.00 65.14  ? 734  GLU A C     1 
ATOM   5675  O  O     . GLU A  1  734  ? 59.697  -118.724 173.899 1.00 64.63  ? 734  GLU A O     1 
ATOM   5676  C  CB    . GLU A  1  734  ? 61.300  -116.852 171.867 1.00 65.66  ? 734  GLU A CB    1 
ATOM   5677  C  CG    . GLU A  1  734  ? 60.912  -118.175 171.237 1.00 68.68  ? 734  GLU A CG    1 
ATOM   5678  C  CD    . GLU A  1  734  ? 61.554  -118.377 169.888 1.00 70.78  ? 734  GLU A CD    1 
ATOM   5679  O  OE1   . GLU A  1  734  ? 62.804  -118.398 169.833 1.00 71.91  ? 734  GLU A OE1   1 
ATOM   5680  O  OE2   . GLU A  1  734  ? 60.810  -118.511 168.885 1.00 72.06  ? 734  GLU A OE2   1 
ATOM   5681  N  N     . VAL A  1  735  ? 61.698  -118.111 174.726 1.00 65.99  ? 735  VAL A N     1 
ATOM   5682  C  CA    . VAL A  1  735  ? 61.870  -119.310 175.530 1.00 67.50  ? 735  VAL A CA    1 
ATOM   5683  C  C     . VAL A  1  735  ? 61.203  -119.177 176.885 1.00 68.35  ? 735  VAL A C     1 
ATOM   5684  O  O     . VAL A  1  735  ? 60.842  -120.170 177.521 1.00 68.61  ? 735  VAL A O     1 
ATOM   5685  C  CB    . VAL A  1  735  ? 63.356  -119.612 175.735 1.00 67.54  ? 735  VAL A CB    1 
ATOM   5686  C  CG1   . VAL A  1  735  ? 63.541  -120.619 176.874 1.00 67.14  ? 735  VAL A CG1   1 
ATOM   5687  C  CG2   . VAL A  1  735  ? 63.937  -120.155 174.432 1.00 67.88  ? 735  VAL A CG2   1 
ATOM   5688  N  N     . ASN A  1  736  ? 61.044  -117.939 177.323 1.00 69.13  ? 736  ASN A N     1 
ATOM   5689  C  CA    . ASN A  1  736  ? 60.412  -117.665 178.600 1.00 69.62  ? 736  ASN A CA    1 
ATOM   5690  C  C     . ASN A  1  736  ? 58.874  -117.735 178.490 1.00 68.28  ? 736  ASN A C     1 
ATOM   5691  O  O     . ASN A  1  736  ? 58.159  -117.668 179.495 1.00 67.87  ? 736  ASN A O     1 
ATOM   5692  C  CB    . ASN A  1  736  ? 60.881  -116.293 179.101 1.00 72.45  ? 736  ASN A CB    1 
ATOM   5693  C  CG    . ASN A  1  736  ? 60.148  -115.842 180.346 1.00 74.35  ? 736  ASN A CG    1 
ATOM   5694  O  OD1   . ASN A  1  736  ? 59.206  -115.048 180.266 1.00 75.63  ? 736  ASN A OD1   1 
ATOM   5695  N  ND2   . ASN A  1  736  ? 60.566  -116.355 181.507 1.00 74.62  ? 736  ASN A ND2   1 
ATOM   5696  N  N     . LEU A  1  737  ? 58.367  -117.883 177.268 1.00 66.09  ? 737  LEU A N     1 
ATOM   5697  C  CA    . LEU A  1  737  ? 56.928  -117.978 177.068 1.00 63.43  ? 737  LEU A CA    1 
ATOM   5698  C  C     . LEU A  1  737  ? 56.509  -119.423 177.191 1.00 62.65  ? 737  LEU A C     1 
ATOM   5699  O  O     . LEU A  1  737  ? 56.952  -120.273 176.415 1.00 61.74  ? 737  LEU A O     1 
ATOM   5700  C  CB    . LEU A  1  737  ? 56.539  -117.446 175.692 1.00 62.22  ? 737  LEU A CB    1 
ATOM   5701  C  CG    . LEU A  1  737  ? 56.910  -115.979 175.513 1.00 61.13  ? 737  LEU A CG    1 
ATOM   5702  C  CD1   . LEU A  1  737  ? 56.167  -115.413 174.330 1.00 59.96  ? 737  LEU A CD1   1 
ATOM   5703  C  CD2   . LEU A  1  737  ? 56.561  -115.207 176.777 1.00 61.18  ? 737  LEU A CD2   1 
ATOM   5704  N  N     . LYS A  1  738  ? 55.666  -119.711 178.178 1.00 61.97  ? 738  LYS A N     1 
ATOM   5705  C  CA    . LYS A  1  738  ? 55.224  -121.081 178.357 1.00 61.61  ? 738  LYS A CA    1 
ATOM   5706  C  C     . LYS A  1  738  ? 54.349  -121.502 177.189 1.00 61.00  ? 738  LYS A C     1 
ATOM   5707  O  O     . LYS A  1  738  ? 54.047  -120.708 176.306 1.00 61.66  ? 738  LYS A O     1 
ATOM   5708  C  CB    . LYS A  1  738  ? 54.491  -121.276 179.698 1.00 60.95  ? 738  LYS A CB    1 
ATOM   5709  C  CG    . LYS A  1  738  ? 53.595  -120.147 180.149 1.00 60.70  ? 738  LYS A CG    1 
ATOM   5710  C  CD    . LYS A  1  738  ? 54.363  -119.101 180.923 1.00 60.97  ? 738  LYS A CD    1 
ATOM   5711  C  CE    . LYS A  1  738  ? 53.411  -118.122 181.587 1.00 61.60  ? 738  LYS A CE    1 
ATOM   5712  N  NZ    . LYS A  1  738  ? 54.126  -116.984 182.223 1.00 61.67  ? 738  LYS A NZ    1 
ATOM   5713  N  N     . ASP A  1  739  ? 53.951  -122.759 177.179 1.00 60.93  ? 739  ASP A N     1 
ATOM   5714  C  CA    . ASP A  1  739  ? 53.141  -123.269 176.098 1.00 61.28  ? 739  ASP A CA    1 
ATOM   5715  C  C     . ASP A  1  739  ? 51.690  -122.846 176.144 1.00 60.00  ? 739  ASP A C     1 
ATOM   5716  O  O     . ASP A  1  739  ? 50.956  -123.059 175.186 1.00 61.02  ? 739  ASP A O     1 
ATOM   5717  C  CB    . ASP A  1  739  ? 53.252  -124.781 176.080 1.00 64.14  ? 739  ASP A CB    1 
ATOM   5718  C  CG    . ASP A  1  739  ? 54.670  -125.232 175.876 1.00 67.36  ? 739  ASP A CG    1 
ATOM   5719  O  OD1   . ASP A  1  739  ? 55.558  -124.647 176.532 1.00 69.53  ? 739  ASP A OD1   1 
ATOM   5720  O  OD2   . ASP A  1  739  ? 54.904  -126.153 175.065 1.00 69.42  ? 739  ASP A OD2   1 
ATOM   5721  N  N     . LEU A  1  740  ? 51.268  -122.247 177.249 1.00 58.19  ? 740  LEU A N     1 
ATOM   5722  C  CA    . LEU A  1  740  ? 49.885  -121.802 177.363 1.00 56.39  ? 740  LEU A CA    1 
ATOM   5723  C  C     . LEU A  1  740  ? 49.732  -120.468 176.648 1.00 55.08  ? 740  LEU A C     1 
ATOM   5724  O  O     . LEU A  1  740  ? 48.621  -120.008 176.368 1.00 54.80  ? 740  LEU A O     1 
ATOM   5725  C  CB    . LEU A  1  740  ? 49.466  -121.678 178.840 1.00 56.66  ? 740  LEU A CB    1 
ATOM   5726  C  CG    . LEU A  1  740  ? 50.165  -120.761 179.854 1.00 56.50  ? 740  LEU A CG    1 
ATOM   5727  C  CD1   . LEU A  1  740  ? 50.032  -119.296 179.473 1.00 56.43  ? 740  LEU A CD1   1 
ATOM   5728  C  CD2   . LEU A  1  740  ? 49.526  -120.986 181.203 1.00 56.45  ? 740  LEU A CD2   1 
ATOM   5729  N  N     . ASN A  1  741  ? 50.867  -119.854 176.348 1.00 53.68  ? 741  ASN A N     1 
ATOM   5730  C  CA    . ASN A  1  741  ? 50.859  -118.582 175.661 1.00 52.49  ? 741  ASN A CA    1 
ATOM   5731  C  C     . ASN A  1  741  ? 50.188  -118.795 174.325 1.00 51.82  ? 741  ASN A C     1 
ATOM   5732  O  O     . ASN A  1  741  ? 50.537  -119.718 173.588 1.00 51.51  ? 741  ASN A O     1 
ATOM   5733  C  CB    . ASN A  1  741  ? 52.280  -118.072 175.447 1.00 53.17  ? 741  ASN A CB    1 
ATOM   5734  C  CG    . ASN A  1  741  ? 52.306  -116.709 174.796 1.00 53.53  ? 741  ASN A CG    1 
ATOM   5735  O  OD1   . ASN A  1  741  ? 52.792  -115.734 175.373 1.00 51.84  ? 741  ASN A OD1   1 
ATOM   5736  N  ND2   . ASN A  1  741  ? 51.768  -116.629 173.587 1.00 54.44  ? 741  ASN A ND2   1 
ATOM   5737  N  N     . ASN A  1  742  ? 49.223  -117.936 174.021 1.00 50.70  ? 742  ASN A N     1 
ATOM   5738  C  CA    . ASN A  1  742  ? 48.483  -118.026 172.772 1.00 49.89  ? 742  ASN A CA    1 
ATOM   5739  C  C     . ASN A  1  742  ? 49.304  -117.612 171.545 1.00 48.96  ? 742  ASN A C     1 
ATOM   5740  O  O     . ASN A  1  742  ? 49.300  -118.319 170.534 1.00 47.67  ? 742  ASN A O     1 
ATOM   5741  C  CB    . ASN A  1  742  ? 47.205  -117.203 172.904 1.00 49.71  ? 742  ASN A CB    1 
ATOM   5742  C  CG    . ASN A  1  742  ? 46.349  -117.668 174.073 1.00 49.74  ? 742  ASN A CG    1 
ATOM   5743  O  OD1   . ASN A  1  742  ? 45.730  -118.734 174.026 1.00 48.51  ? 742  ASN A OD1   1 
ATOM   5744  N  ND2   . ASN A  1  742  ? 46.330  -116.879 175.139 1.00 49.33  ? 742  ASN A ND2   1 
ATOM   5745  N  N     . VAL A  1  743  ? 50.019  -116.490 171.631 1.00 47.79  ? 743  VAL A N     1 
ATOM   5746  C  CA    . VAL A  1  743  ? 50.845  -116.048 170.512 1.00 47.13  ? 743  VAL A CA    1 
ATOM   5747  C  C     . VAL A  1  743  ? 51.857  -117.117 170.166 1.00 48.47  ? 743  VAL A C     1 
ATOM   5748  O  O     . VAL A  1  743  ? 52.208  -117.285 169.002 1.00 49.81  ? 743  VAL A O     1 
ATOM   5749  C  CB    . VAL A  1  743  ? 51.628  -114.776 170.819 1.00 45.04  ? 743  VAL A CB    1 
ATOM   5750  C  CG1   . VAL A  1  743  ? 52.565  -114.464 169.668 1.00 42.16  ? 743  VAL A CG1   1 
ATOM   5751  C  CG2   . VAL A  1  743  ? 50.675  -113.631 171.045 1.00 45.33  ? 743  VAL A CG2   1 
ATOM   5752  N  N     . LYS A  1  744  ? 52.335  -117.833 171.179 1.00 49.62  ? 744  LYS A N     1 
ATOM   5753  C  CA    . LYS A  1  744  ? 53.310  -118.896 170.954 1.00 51.29  ? 744  LYS A CA    1 
ATOM   5754  C  C     . LYS A  1  744  ? 52.582  -120.046 170.288 1.00 51.28  ? 744  LYS A C     1 
ATOM   5755  O  O     . LYS A  1  744  ? 53.064  -120.621 169.311 1.00 51.01  ? 744  LYS A O     1 
ATOM   5756  C  CB    . LYS A  1  744  ? 53.935  -119.378 172.278 1.00 52.44  ? 744  LYS A CB    1 
ATOM   5757  C  CG    . LYS A  1  744  ? 55.041  -120.439 172.100 1.00 53.39  ? 744  LYS A CG    1 
ATOM   5758  C  CD    . LYS A  1  744  ? 55.921  -120.591 173.347 1.00 54.18  ? 744  LYS A CD    1 
ATOM   5759  C  CE    . LYS A  1  744  ? 57.126  -121.531 173.120 1.00 54.42  ? 744  LYS A CE    1 
ATOM   5760  N  NZ    . LYS A  1  744  ? 56.795  -122.993 173.122 1.00 52.41  ? 744  LYS A NZ    1 
ATOM   5761  N  N     . GLN A  1  745  ? 51.411  -120.362 170.828 1.00 51.78  ? 745  GLN A N     1 
ATOM   5762  C  CA    . GLN A  1  745  ? 50.583  -121.437 170.316 1.00 52.25  ? 745  GLN A CA    1 
ATOM   5763  C  C     . GLN A  1  745  ? 50.300  -121.284 168.829 1.00 52.39  ? 745  GLN A C     1 
ATOM   5764  O  O     . GLN A  1  745  ? 50.229  -122.274 168.099 1.00 52.23  ? 745  GLN A O     1 
ATOM   5765  C  CB    . GLN A  1  745  ? 49.270  -121.484 171.077 1.00 53.13  ? 745  GLN A CB    1 
ATOM   5766  C  CG    . GLN A  1  745  ? 49.239  -122.479 172.206 1.00 54.07  ? 745  GLN A CG    1 
ATOM   5767  C  CD    . GLN A  1  745  ? 47.849  -122.582 172.804 1.00 55.83  ? 745  GLN A CD    1 
ATOM   5768  O  OE1   . GLN A  1  745  ? 47.336  -121.612 173.363 1.00 56.68  ? 745  GLN A OE1   1 
ATOM   5769  N  NE2   . GLN A  1  745  ? 47.223  -123.752 172.675 1.00 56.51  ? 745  GLN A NE2   1 
ATOM   5770  N  N     . MET A  1  746  ? 50.116  -120.047 168.379 1.00 51.82  ? 746  MET A N     1 
ATOM   5771  C  CA    . MET A  1  746  ? 49.870  -119.826 166.968 1.00 50.87  ? 746  MET A CA    1 
ATOM   5772  C  C     . MET A  1  746  ? 51.162  -120.057 166.215 1.00 51.41  ? 746  MET A C     1 
ATOM   5773  O  O     . MET A  1  746  ? 51.160  -120.700 165.165 1.00 52.77  ? 746  MET A O     1 
ATOM   5774  C  CB    . MET A  1  746  ? 49.334  -118.420 166.715 1.00 49.34  ? 746  MET A CB    1 
ATOM   5775  C  CG    . MET A  1  746  ? 47.854  -118.319 167.027 1.00 47.64  ? 746  MET A CG    1 
ATOM   5776  S  SD    . MET A  1  746  ? 47.185  -116.711 166.681 1.00 47.46  ? 746  MET A SD    1 
ATOM   5777  C  CE    . MET A  1  746  ? 47.689  -115.820 168.119 1.00 46.84  ? 746  MET A CE    1 
ATOM   5778  N  N     . VAL A  1  747  ? 52.275  -119.565 166.750 1.00 50.87  ? 747  VAL A N     1 
ATOM   5779  C  CA    . VAL A  1  747  ? 53.542  -119.781 166.069 1.00 50.22  ? 747  VAL A CA    1 
ATOM   5780  C  C     . VAL A  1  747  ? 53.854  -121.264 166.009 1.00 50.76  ? 747  VAL A C     1 
ATOM   5781  O  O     . VAL A  1  747  ? 54.457  -121.724 165.047 1.00 51.10  ? 747  VAL A O     1 
ATOM   5782  C  CB    . VAL A  1  747  ? 54.704  -119.038 166.742 1.00 49.15  ? 747  VAL A CB    1 
ATOM   5783  C  CG1   . VAL A  1  747  ? 55.988  -119.317 166.006 1.00 47.02  ? 747  VAL A CG1   1 
ATOM   5784  C  CG2   . VAL A  1  747  ? 54.446  -117.543 166.703 1.00 49.81  ? 747  VAL A CG2   1 
ATOM   5785  N  N     . MET A  1  748  ? 53.427  -122.022 167.015 1.00 52.21  ? 748  MET A N     1 
ATOM   5786  C  CA    . MET A  1  748  ? 53.677  -123.459 167.012 1.00 54.09  ? 748  MET A CA    1 
ATOM   5787  C  C     . MET A  1  748  ? 52.894  -124.176 165.924 1.00 53.47  ? 748  MET A C     1 
ATOM   5788  O  O     . MET A  1  748  ? 53.461  -124.943 165.150 1.00 53.79  ? 748  MET A O     1 
ATOM   5789  C  CB    . MET A  1  748  ? 53.357  -124.066 168.371 1.00 57.16  ? 748  MET A CB    1 
ATOM   5790  C  CG    . MET A  1  748  ? 54.411  -123.731 169.417 1.00 63.37  ? 748  MET A CG    1 
ATOM   5791  S  SD    . MET A  1  748  ? 54.224  -124.619 171.000 1.00 72.18  ? 748  MET A SD    1 
ATOM   5792  C  CE    . MET A  1  748  ? 53.447  -123.321 172.066 1.00 69.75  ? 748  MET A CE    1 
ATOM   5793  N  N     . ALA A  1  749  ? 51.593  -123.925 165.852 1.00 53.17  ? 749  ALA A N     1 
ATOM   5794  C  CA    . ALA A  1  749  ? 50.771  -124.562 164.827 1.00 52.44  ? 749  ALA A CA    1 
ATOM   5795  C  C     . ALA A  1  749  ? 51.262  -124.129 163.459 1.00 51.43  ? 749  ALA A C     1 
ATOM   5796  O  O     . ALA A  1  749  ? 51.306  -124.924 162.522 1.00 51.59  ? 749  ALA A O     1 
ATOM   5797  C  CB    . ALA A  1  749  ? 49.310  -124.170 164.997 1.00 52.47  ? 749  ALA A CB    1 
ATOM   5798  N  N     . GLY A  1  750  ? 51.639  -122.859 163.363 1.00 50.71  ? 750  GLY A N     1 
ATOM   5799  C  CA    . GLY A  1  750  ? 52.115  -122.314 162.108 1.00 49.94  ? 750  GLY A CA    1 
ATOM   5800  C  C     . GLY A  1  750  ? 50.973  -121.617 161.403 1.00 49.69  ? 750  GLY A C     1 
ATOM   5801  O  O     . GLY A  1  750  ? 50.983  -121.464 160.180 1.00 49.68  ? 750  GLY A O     1 
ATOM   5802  N  N     . SER A  1  751  ? 49.978  -121.201 162.180 1.00 48.93  ? 751  SER A N     1 
ATOM   5803  C  CA    . SER A  1  751  ? 48.825  -120.517 161.627 1.00 49.08  ? 751  SER A CA    1 
ATOM   5804  C  C     . SER A  1  751  ? 49.143  -119.040 161.439 1.00 49.22  ? 751  SER A C     1 
ATOM   5805  O  O     . SER A  1  751  ? 48.681  -118.428 160.490 1.00 50.63  ? 751  SER A O     1 
ATOM   5806  C  CB    . SER A  1  751  ? 47.634  -120.661 162.550 1.00 49.00  ? 751  SER A CB    1 
ATOM   5807  O  OG    . SER A  1  751  ? 47.760  -119.755 163.620 1.00 51.21  ? 751  SER A OG    1 
ATOM   5808  N  N     . LYS A  1  752  ? 49.921  -118.459 162.342 1.00 49.27  ? 752  LYS A N     1 
ATOM   5809  C  CA    . LYS A  1  752  ? 50.300  -117.056 162.207 1.00 50.75  ? 752  LYS A CA    1 
ATOM   5810  C  C     . LYS A  1  752  ? 51.456  -116.657 163.097 1.00 52.64  ? 752  LYS A C     1 
ATOM   5811  O  O     . LYS A  1  752  ? 51.694  -117.263 164.142 1.00 52.32  ? 752  LYS A O     1 
ATOM   5812  C  CB    . LYS A  1  752  ? 49.129  -116.130 162.513 1.00 49.62  ? 752  LYS A CB    1 
ATOM   5813  C  CG    . LYS A  1  752  ? 48.442  -115.583 161.288 1.00 48.44  ? 752  LYS A CG    1 
ATOM   5814  C  CD    . LYS A  1  752  ? 49.410  -114.915 160.336 1.00 46.82  ? 752  LYS A CD    1 
ATOM   5815  C  CE    . LYS A  1  752  ? 48.660  -114.419 159.107 1.00 46.58  ? 752  LYS A CE    1 
ATOM   5816  N  NZ    . LYS A  1  752  ? 49.560  -113.836 158.069 1.00 47.49  ? 752  LYS A NZ    1 
ATOM   5817  N  N     . GLY A  1  753  ? 52.165  -115.616 162.672 1.00 54.88  ? 753  GLY A N     1 
ATOM   5818  C  CA    . GLY A  1  753  ? 53.291  -115.115 163.440 1.00 57.17  ? 753  GLY A CA    1 
ATOM   5819  C  C     . GLY A  1  753  ? 54.537  -115.983 163.437 1.00 58.53  ? 753  GLY A C     1 
ATOM   5820  O  O     . GLY A  1  753  ? 54.478  -117.179 163.137 1.00 59.01  ? 753  GLY A O     1 
ATOM   5821  N  N     . SER A  1  754  ? 55.668  -115.371 163.786 1.00 59.20  ? 754  SER A N     1 
ATOM   5822  C  CA    . SER A  1  754  ? 56.955  -116.058 163.826 1.00 59.64  ? 754  SER A CA    1 
ATOM   5823  C  C     . SER A  1  754  ? 57.837  -115.477 164.917 1.00 60.45  ? 754  SER A C     1 
ATOM   5824  O  O     . SER A  1  754  ? 57.427  -114.590 165.662 1.00 60.38  ? 754  SER A O     1 
ATOM   5825  C  CB    . SER A  1  754  ? 57.673  -115.891 162.495 1.00 59.21  ? 754  SER A CB    1 
ATOM   5826  O  OG    . SER A  1  754  ? 57.854  -114.513 162.222 1.00 58.43  ? 754  SER A OG    1 
ATOM   5827  N  N     . PHE A  1  755  ? 59.064  -115.976 164.990 1.00 61.17  ? 755  PHE A N     1 
ATOM   5828  C  CA    . PHE A  1  755  ? 60.023  -115.513 165.985 1.00 60.69  ? 755  PHE A CA    1 
ATOM   5829  C  C     . PHE A  1  755  ? 60.060  -113.990 166.062 1.00 59.56  ? 755  PHE A C     1 
ATOM   5830  O  O     . PHE A  1  755  ? 59.580  -113.405 167.032 1.00 58.78  ? 755  PHE A O     1 
ATOM   5831  C  CB    . PHE A  1  755  ? 61.423  -116.058 165.649 1.00 62.24  ? 755  PHE A CB    1 
ATOM   5832  C  CG    . PHE A  1  755  ? 62.554  -115.406 166.423 1.00 62.93  ? 755  PHE A CG    1 
ATOM   5833  C  CD1   . PHE A  1  755  ? 62.726  -115.649 167.783 1.00 63.12  ? 755  PHE A CD1   1 
ATOM   5834  C  CD2   . PHE A  1  755  ? 63.455  -114.550 165.777 1.00 63.38  ? 755  PHE A CD2   1 
ATOM   5835  C  CE1   . PHE A  1  755  ? 63.777  -115.049 168.488 1.00 62.89  ? 755  PHE A CE1   1 
ATOM   5836  C  CE2   . PHE A  1  755  ? 64.505  -113.948 166.472 1.00 62.30  ? 755  PHE A CE2   1 
ATOM   5837  C  CZ    . PHE A  1  755  ? 64.665  -114.199 167.828 1.00 62.78  ? 755  PHE A CZ    1 
ATOM   5838  N  N     . ILE A  1  756  ? 60.615  -113.360 165.028 1.00 58.71  ? 756  ILE A N     1 
ATOM   5839  C  CA    . ILE A  1  756  ? 60.761  -111.907 164.989 1.00 58.50  ? 756  ILE A CA    1 
ATOM   5840  C  C     . ILE A  1  756  ? 59.600  -111.149 165.605 1.00 57.43  ? 756  ILE A C     1 
ATOM   5841  O  O     . ILE A  1  756  ? 59.802  -110.136 166.281 1.00 57.08  ? 756  ILE A O     1 
ATOM   5842  C  CB    . ILE A  1  756  ? 60.986  -111.395 163.540 1.00 59.42  ? 756  ILE A CB    1 
ATOM   5843  C  CG1   . ILE A  1  756  ? 62.386  -111.799 163.055 1.00 60.93  ? 756  ILE A CG1   1 
ATOM   5844  C  CG2   . ILE A  1  756  ? 60.857  -109.873 163.491 1.00 58.34  ? 756  ILE A CG2   1 
ATOM   5845  C  CD1   . ILE A  1  756  ? 63.552  -111.210 163.883 1.00 61.25  ? 756  ILE A CD1   1 
ATOM   5846  N  N     . ASN A  1  757  ? 58.387  -111.645 165.376 1.00 56.43  ? 757  ASN A N     1 
ATOM   5847  C  CA    . ASN A  1  757  ? 57.186  -111.005 165.903 1.00 54.95  ? 757  ASN A CA    1 
ATOM   5848  C  C     . ASN A  1  757  ? 57.191  -111.007 167.433 1.00 53.61  ? 757  ASN A C     1 
ATOM   5849  O  O     . ASN A  1  757  ? 57.076  -109.952 168.062 1.00 53.34  ? 757  ASN A O     1 
ATOM   5850  C  CB    . ASN A  1  757  ? 55.929  -111.715 165.373 1.00 55.24  ? 757  ASN A CB    1 
ATOM   5851  C  CG    . ASN A  1  757  ? 55.740  -111.543 163.869 1.00 55.65  ? 757  ASN A CG    1 
ATOM   5852  O  OD1   . ASN A  1  757  ? 55.720  -110.418 163.368 1.00 55.24  ? 757  ASN A OD1   1 
ATOM   5853  N  ND2   . ASN A  1  757  ? 55.589  -112.659 163.145 1.00 54.90  ? 757  ASN A ND2   1 
ATOM   5854  N  N     . ILE A  1  758  ? 57.325  -112.192 168.028 1.00 51.24  ? 758  ILE A N     1 
ATOM   5855  C  CA    . ILE A  1  758  ? 57.354  -112.308 169.475 1.00 48.92  ? 758  ILE A CA    1 
ATOM   5856  C  C     . ILE A  1  758  ? 58.479  -111.433 169.981 1.00 48.51  ? 758  ILE A C     1 
ATOM   5857  O  O     . ILE A  1  758  ? 58.393  -110.850 171.055 1.00 48.17  ? 758  ILE A O     1 
ATOM   5858  C  CB    . ILE A  1  758  ? 57.627  -113.742 169.910 1.00 48.05  ? 758  ILE A CB    1 
ATOM   5859  C  CG1   . ILE A  1  758  ? 56.485  -114.640 169.457 1.00 47.07  ? 758  ILE A CG1   1 
ATOM   5860  C  CG2   . ILE A  1  758  ? 57.764  -113.812 171.417 1.00 48.53  ? 758  ILE A CG2   1 
ATOM   5861  C  CD1   . ILE A  1  758  ? 56.599  -116.051 169.964 1.00 46.99  ? 758  ILE A CD1   1 
ATOM   5862  N  N     . ALA A  1  759  ? 59.532  -111.344 169.180 1.00 48.45  ? 759  ALA A N     1 
ATOM   5863  C  CA    . ALA A  1  759  ? 60.700  -110.542 169.510 1.00 49.44  ? 759  ALA A CA    1 
ATOM   5864  C  C     . ALA A  1  759  ? 60.392  -109.058 169.667 1.00 50.35  ? 759  ALA A C     1 
ATOM   5865  O  O     . ALA A  1  759  ? 60.428  -108.521 170.774 1.00 49.99  ? 759  ALA A O     1 
ATOM   5866  C  CB    . ALA A  1  759  ? 61.766  -110.728 168.444 1.00 49.10  ? 759  ALA A CB    1 
ATOM   5867  N  N     . GLN A  1  760  ? 60.091  -108.399 168.552 1.00 51.56  ? 760  GLN A N     1 
ATOM   5868  C  CA    . GLN A  1  760  ? 59.808  -106.972 168.568 1.00 53.08  ? 760  GLN A CA    1 
ATOM   5869  C  C     . GLN A  1  760  ? 58.607  -106.597 169.416 1.00 54.52  ? 760  GLN A C     1 
ATOM   5870  O  O     . GLN A  1  760  ? 58.375  -105.416 169.671 1.00 56.38  ? 760  GLN A O     1 
ATOM   5871  C  CB    . GLN A  1  760  ? 59.573  -106.453 167.157 1.00 52.66  ? 760  GLN A CB    1 
ATOM   5872  C  CG    . GLN A  1  760  ? 60.614  -106.847 166.154 1.00 53.43  ? 760  GLN A CG    1 
ATOM   5873  C  CD    . GLN A  1  760  ? 60.385  -106.161 164.832 1.00 54.60  ? 760  GLN A CD    1 
ATOM   5874  O  OE1   . GLN A  1  760  ? 59.271  -106.147 164.319 1.00 55.49  ? 760  GLN A OE1   1 
ATOM   5875  N  NE2   . GLN A  1  760  ? 61.437  -105.583 164.271 1.00 55.65  ? 760  GLN A NE2   1 
ATOM   5876  N  N     . MET A  1  761  ? 57.830  -107.581 169.846 1.00 55.20  ? 761  MET A N     1 
ATOM   5877  C  CA    . MET A  1  761  ? 56.663  -107.269 170.657 1.00 55.91  ? 761  MET A CA    1 
ATOM   5878  C  C     . MET A  1  761  ? 56.958  -107.302 172.140 1.00 55.15  ? 761  MET A C     1 
ATOM   5879  O  O     . MET A  1  761  ? 56.438  -106.487 172.890 1.00 55.73  ? 761  MET A O     1 
ATOM   5880  C  CB    . MET A  1  761  ? 55.509  -108.245 170.382 1.00 57.66  ? 761  MET A CB    1 
ATOM   5881  C  CG    . MET A  1  761  ? 54.762  -108.050 169.058 1.00 58.55  ? 761  MET A CG    1 
ATOM   5882  S  SD    . MET A  1  761  ? 53.018  -108.605 169.130 1.00 59.35  ? 761  MET A SD    1 
ATOM   5883  C  CE    . MET A  1  761  ? 53.217  -110.369 169.572 1.00 56.96  ? 761  MET A CE    1 
ATOM   5884  N  N     . SER A  1  762  ? 57.807  -108.234 172.557 1.00 55.07  ? 762  SER A N     1 
ATOM   5885  C  CA    . SER A  1  762  ? 58.105  -108.398 173.977 1.00 55.81  ? 762  SER A CA    1 
ATOM   5886  C  C     . SER A  1  762  ? 59.536  -108.138 174.416 1.00 54.68  ? 762  SER A C     1 
ATOM   5887  O  O     . SER A  1  762  ? 59.783  -107.833 175.584 1.00 54.47  ? 762  SER A O     1 
ATOM   5888  C  CB    . SER A  1  762  ? 57.723  -109.814 174.397 1.00 55.71  ? 762  SER A CB    1 
ATOM   5889  O  OG    . SER A  1  762  ? 56.781  -110.356 173.488 1.00 56.62  ? 762  SER A OG    1 
ATOM   5890  N  N     . ALA A  1  763  ? 60.469  -108.266 173.481 1.00 53.59  ? 763  ALA A N     1 
ATOM   5891  C  CA    . ALA A  1  763  ? 61.881  -108.087 173.778 1.00 52.97  ? 763  ALA A CA    1 
ATOM   5892  C  C     . ALA A  1  763  ? 62.482  -106.746 173.361 1.00 52.71  ? 763  ALA A C     1 
ATOM   5893  O  O     . ALA A  1  763  ? 62.650  -105.825 174.164 1.00 51.33  ? 763  ALA A O     1 
ATOM   5894  C  CB    . ALA A  1  763  ? 62.667  -109.218 173.133 1.00 52.79  ? 763  ALA A CB    1 
ATOM   5895  N  N     . CYS A  1  764  ? 62.821  -106.644 172.090 1.00 52.67  ? 764  CYS A N     1 
ATOM   5896  C  CA    . CYS A  1  764  ? 63.426  -105.430 171.600 1.00 53.64  ? 764  CYS A CA    1 
ATOM   5897  C  C     . CYS A  1  764  ? 63.183  -105.286 170.105 1.00 53.63  ? 764  CYS A C     1 
ATOM   5898  O  O     . CYS A  1  764  ? 63.505  -106.188 169.335 1.00 54.11  ? 764  CYS A O     1 
ATOM   5899  C  CB    . CYS A  1  764  ? 64.919  -105.487 171.897 1.00 55.15  ? 764  CYS A CB    1 
ATOM   5900  S  SG    . CYS A  1  764  ? 65.901  -104.277 171.021 1.00 60.10  ? 764  CYS A SG    1 
ATOM   5901  N  N     . VAL A  1  765  ? 62.613  -104.153 169.698 1.00 52.70  ? 765  VAL A N     1 
ATOM   5902  C  CA    . VAL A  1  765  ? 62.329  -103.901 168.289 1.00 50.85  ? 765  VAL A CA    1 
ATOM   5903  C  C     . VAL A  1  765  ? 63.537  -104.141 167.388 1.00 49.50  ? 765  VAL A C     1 
ATOM   5904  O  O     . VAL A  1  765  ? 63.469  -104.961 166.486 1.00 48.71  ? 765  VAL A O     1 
ATOM   5905  C  CB    . VAL A  1  765  ? 61.807  -102.468 168.076 1.00 51.12  ? 765  VAL A CB    1 
ATOM   5906  C  CG1   . VAL A  1  765  ? 61.684  -102.167 166.583 1.00 50.38  ? 765  VAL A CG1   1 
ATOM   5907  C  CG2   . VAL A  1  765  ? 60.455  -102.312 168.771 1.00 50.76  ? 765  VAL A CG2   1 
ATOM   5908  N  N     . GLY A  1  766  ? 64.641  -103.440 167.619 1.00 48.08  ? 766  GLY A N     1 
ATOM   5909  C  CA    . GLY A  1  766  ? 65.800  -103.658 166.774 1.00 47.63  ? 766  GLY A CA    1 
ATOM   5910  C  C     . GLY A  1  766  ? 66.301  -102.382 166.143 1.00 47.55  ? 766  GLY A C     1 
ATOM   5911  O  O     . GLY A  1  766  ? 65.743  -101.322 166.404 1.00 48.24  ? 766  GLY A O     1 
ATOM   5912  N  N     . GLN A  1  767  ? 67.338  -102.485 165.310 1.00 47.05  ? 767  GLN A N     1 
ATOM   5913  C  CA    . GLN A  1  767  ? 67.948  -101.317 164.653 1.00 46.37  ? 767  GLN A CA    1 
ATOM   5914  C  C     . GLN A  1  767  ? 67.297  -100.948 163.324 1.00 45.82  ? 767  GLN A C     1 
ATOM   5915  O  O     . GLN A  1  767  ? 67.378  -101.701 162.363 1.00 46.16  ? 767  GLN A O     1 
ATOM   5916  C  CB    . GLN A  1  767  ? 69.457  -101.572 164.448 1.00 45.19  ? 767  GLN A CB    1 
ATOM   5917  C  CG    . GLN A  1  767  ? 70.182  -100.694 163.412 1.00 45.88  ? 767  GLN A CG    1 
ATOM   5918  C  CD    . GLN A  1  767  ? 70.634  -99.329  163.930 1.00 48.01  ? 767  GLN A CD    1 
ATOM   5919  O  OE1   . GLN A  1  767  ? 71.209  -99.209  165.013 1.00 50.65  ? 767  GLN A OE1   1 
ATOM   5920  N  NE2   . GLN A  1  767  ? 70.399  -98.296  163.137 1.00 48.52  ? 767  GLN A NE2   1 
ATOM   5921  N  N     . GLN A  1  768  ? 66.650  -99.789  163.269 1.00 45.05  ? 768  GLN A N     1 
ATOM   5922  C  CA    . GLN A  1  768  ? 66.014  -99.340  162.032 1.00 45.12  ? 768  GLN A CA    1 
ATOM   5923  C  C     . GLN A  1  768  ? 67.090  -99.104  160.981 1.00 44.50  ? 768  GLN A C     1 
ATOM   5924  O  O     . GLN A  1  768  ? 68.263  -99.030  161.317 1.00 45.47  ? 768  GLN A O     1 
ATOM   5925  C  CB    . GLN A  1  768  ? 65.245  -98.047  162.281 1.00 45.48  ? 768  GLN A CB    1 
ATOM   5926  C  CG    . GLN A  1  768  ? 63.741  -98.230  162.416 1.00 46.49  ? 768  GLN A CG    1 
ATOM   5927  C  CD    . GLN A  1  768  ? 63.361  -99.383  163.323 1.00 47.87  ? 768  GLN A CD    1 
ATOM   5928  O  OE1   . GLN A  1  768  ? 63.986  -99.608  164.362 1.00 48.60  ? 768  GLN A OE1   1 
ATOM   5929  N  NE2   . GLN A  1  768  ? 62.319  -100.116 162.941 1.00 48.46  ? 768  GLN A NE2   1 
ATOM   5930  N  N     . SER A  1  769  ? 66.715  -98.994  159.713 1.00 43.99  ? 769  SER A N     1 
ATOM   5931  C  CA    . SER A  1  769  ? 67.728  -98.763  158.692 1.00 44.38  ? 769  SER A CA    1 
ATOM   5932  C  C     . SER A  1  769  ? 67.186  -98.286  157.364 1.00 44.08  ? 769  SER A C     1 
ATOM   5933  O  O     . SER A  1  769  ? 66.019  -98.450  157.051 1.00 43.98  ? 769  SER A O     1 
ATOM   5934  C  CB    . SER A  1  769  ? 68.543  -100.023 158.451 1.00 44.70  ? 769  SER A CB    1 
ATOM   5935  O  OG    . SER A  1  769  ? 67.817  -100.917 157.635 1.00 47.09  ? 769  SER A OG    1 
ATOM   5936  N  N     . VAL A  1  770  ? 68.068  -97.710  156.568 1.00 44.65  ? 770  VAL A N     1 
ATOM   5937  C  CA    . VAL A  1  770  ? 67.680  -97.184  155.285 1.00 45.02  ? 770  VAL A CA    1 
ATOM   5938  C  C     . VAL A  1  770  ? 68.787  -97.408  154.275 1.00 46.12  ? 770  VAL A C     1 
ATOM   5939  O  O     . VAL A  1  770  ? 69.926  -97.013  154.494 1.00 45.33  ? 770  VAL A O     1 
ATOM   5940  C  CB    . VAL A  1  770  ? 67.414  -95.685  155.381 1.00 44.55  ? 770  VAL A CB    1 
ATOM   5941  C  CG1   . VAL A  1  770  ? 66.900  -95.184  154.051 1.00 45.91  ? 770  VAL A CG1   1 
ATOM   5942  C  CG2   . VAL A  1  770  ? 66.434  -95.394  156.505 1.00 42.45  ? 770  VAL A CG2   1 
ATOM   5943  N  N     . GLU A  1  771  ? 68.440  -98.042  153.165 1.00 47.95  ? 771  GLU A N     1 
ATOM   5944  C  CA    . GLU A  1  771  ? 69.399  -98.319  152.114 1.00 49.97  ? 771  GLU A CA    1 
ATOM   5945  C  C     . GLU A  1  771  ? 70.602  -99.036  152.705 1.00 50.64  ? 771  GLU A C     1 
ATOM   5946  O  O     . GLU A  1  771  ? 71.729  -98.884  152.234 1.00 50.78  ? 771  GLU A O     1 
ATOM   5947  C  CB    . GLU A  1  771  ? 69.813  -97.011  151.459 1.00 51.01  ? 771  GLU A CB    1 
ATOM   5948  C  CG    . GLU A  1  771  ? 68.634  -96.067  151.303 1.00 55.66  ? 771  GLU A CG    1 
ATOM   5949  C  CD    . GLU A  1  771  ? 68.910  -94.896  150.368 1.00 59.50  ? 771  GLU A CD    1 
ATOM   5950  O  OE1   . GLU A  1  771  ? 69.035  -95.123  149.135 1.00 61.13  ? 771  GLU A OE1   1 
ATOM   5951  O  OE2   . GLU A  1  771  ? 68.997  -93.747  150.869 1.00 60.12  ? 771  GLU A OE2   1 
ATOM   5952  N  N     . GLY A  1  772  ? 70.346  -99.821  153.747 1.00 50.89  ? 772  GLY A N     1 
ATOM   5953  C  CA    . GLY A  1  772  ? 71.410  -100.562 154.389 1.00 51.67  ? 772  GLY A CA    1 
ATOM   5954  C  C     . GLY A  1  772  ? 71.928  -99.885  155.639 1.00 52.97  ? 772  GLY A C     1 
ATOM   5955  O  O     . GLY A  1  772  ? 71.738  -100.390 156.750 1.00 54.08  ? 772  GLY A O     1 
ATOM   5956  N  N     . LYS A  1  773  ? 72.580  -98.739  155.467 1.00 52.61  ? 773  LYS A N     1 
ATOM   5957  C  CA    . LYS A  1  773  ? 73.137  -98.016  156.603 1.00 52.62  ? 773  LYS A CA    1 
ATOM   5958  C  C     . LYS A  1  773  ? 72.083  -97.682  157.660 1.00 52.40  ? 773  LYS A C     1 
ATOM   5959  O  O     . LYS A  1  773  ? 70.895  -97.577  157.351 1.00 52.02  ? 773  LYS A O     1 
ATOM   5960  C  CB    . LYS A  1  773  ? 73.792  -96.721  156.132 1.00 53.37  ? 773  LYS A CB    1 
ATOM   5961  C  CG    . LYS A  1  773  ? 74.835  -96.885  155.055 1.00 54.51  ? 773  LYS A CG    1 
ATOM   5962  C  CD    . LYS A  1  773  ? 74.210  -97.064  153.687 1.00 56.13  ? 773  LYS A CD    1 
ATOM   5963  C  CE    . LYS A  1  773  ? 75.248  -96.817  152.591 1.00 58.63  ? 773  LYS A CE    1 
ATOM   5964  N  NZ    . LYS A  1  773  ? 74.684  -96.908  151.207 1.00 60.27  ? 773  LYS A NZ    1 
ATOM   5965  N  N     . ARG A  1  774  ? 72.522  -97.534  158.909 1.00 51.50  ? 774  ARG A N     1 
ATOM   5966  C  CA    . ARG A  1  774  ? 71.614  -97.175  159.988 1.00 50.28  ? 774  ARG A CA    1 
ATOM   5967  C  C     . ARG A  1  774  ? 71.227  -95.736  159.699 1.00 50.03  ? 774  ARG A C     1 
ATOM   5968  O  O     . ARG A  1  774  ? 71.787  -95.122  158.794 1.00 49.24  ? 774  ARG A O     1 
ATOM   5969  C  CB    . ARG A  1  774  ? 72.313  -97.303  161.335 1.00 49.78  ? 774  ARG A CB    1 
ATOM   5970  C  CG    . ARG A  1  774  ? 73.810  -97.378  161.227 1.00 52.06  ? 774  ARG A CG    1 
ATOM   5971  C  CD    . ARG A  1  774  ? 74.382  -98.369  162.233 1.00 55.43  ? 774  ARG A CD    1 
ATOM   5972  N  NE    . ARG A  1  774  ? 74.265  -97.931  163.626 1.00 57.84  ? 774  ARG A NE    1 
ATOM   5973  C  CZ    . ARG A  1  774  ? 75.210  -97.284  164.308 1.00 57.21  ? 774  ARG A CZ    1 
ATOM   5974  N  NH1   . ARG A  1  774  ? 76.378  -96.976  163.751 1.00 55.19  ? 774  ARG A NH1   1 
ATOM   5975  N  NH2   . ARG A  1  774  ? 74.975  -96.948  165.566 1.00 57.28  ? 774  ARG A NH2   1 
ATOM   5976  N  N     . ILE A  1  775  ? 70.279  -95.189  160.445 1.00 50.64  ? 775  ILE A N     1 
ATOM   5977  C  CA    . ILE A  1  775  ? 69.835  -93.826  160.173 1.00 52.76  ? 775  ILE A CA    1 
ATOM   5978  C  C     . ILE A  1  775  ? 70.993  -92.864  159.965 1.00 53.31  ? 775  ILE A C     1 
ATOM   5979  O  O     . ILE A  1  775  ? 71.914  -92.797  160.780 1.00 53.63  ? 775  ILE A O     1 
ATOM   5980  C  CB    . ILE A  1  775  ? 68.933  -93.280  161.296 1.00 54.18  ? 775  ILE A CB    1 
ATOM   5981  C  CG1   . ILE A  1  775  ? 67.856  -94.303  161.645 1.00 56.50  ? 775  ILE A CG1   1 
ATOM   5982  C  CG2   . ILE A  1  775  ? 68.239  -91.991  160.829 1.00 54.21  ? 775  ILE A CG2   1 
ATOM   5983  C  CD1   . ILE A  1  775  ? 66.870  -94.556  160.509 1.00 58.78  ? 775  ILE A CD1   1 
ATOM   5984  N  N     . ALA A  1  776  ? 70.920  -92.109  158.871 1.00 53.88  ? 776  ALA A N     1 
ATOM   5985  C  CA    . ALA A  1  776  ? 71.948  -91.146  158.495 1.00 55.08  ? 776  ALA A CA    1 
ATOM   5986  C  C     . ALA A  1  776  ? 71.923  -89.793  159.218 1.00 56.62  ? 776  ALA A C     1 
ATOM   5987  O  O     . ALA A  1  776  ? 71.159  -89.572  160.157 1.00 56.43  ? 776  ALA A O     1 
ATOM   5988  C  CB    . ALA A  1  776  ? 71.886  -90.918  157.001 1.00 54.30  ? 776  ALA A CB    1 
ATOM   5989  N  N     . PHE A  1  777  ? 72.789  -88.893  158.760 1.00 58.25  ? 777  PHE A N     1 
ATOM   5990  C  CA    . PHE A  1  777  ? 72.913  -87.548  159.315 1.00 58.85  ? 777  PHE A CA    1 
ATOM   5991  C  C     . PHE A  1  777  ? 72.254  -86.579  158.342 1.00 58.94  ? 777  PHE A C     1 
ATOM   5992  O  O     . PHE A  1  777  ? 72.939  -85.953  157.531 1.00 59.70  ? 777  PHE A O     1 
ATOM   5993  C  CB    . PHE A  1  777  ? 74.400  -87.177  159.477 1.00 59.99  ? 777  PHE A CB    1 
ATOM   5994  C  CG    . PHE A  1  777  ? 75.114  -87.918  160.597 1.00 62.39  ? 777  PHE A CG    1 
ATOM   5995  C  CD1   . PHE A  1  777  ? 76.508  -87.957  160.642 1.00 62.32  ? 777  PHE A CD1   1 
ATOM   5996  C  CD2   . PHE A  1  777  ? 74.402  -88.547  161.626 1.00 63.74  ? 777  PHE A CD2   1 
ATOM   5997  C  CE1   . PHE A  1  777  ? 77.181  -88.608  161.691 1.00 63.06  ? 777  PHE A CE1   1 
ATOM   5998  C  CE2   . PHE A  1  777  ? 75.073  -89.202  162.686 1.00 64.01  ? 777  PHE A CE2   1 
ATOM   5999  C  CZ    . PHE A  1  777  ? 76.461  -89.231  162.713 1.00 62.80  ? 777  PHE A CZ    1 
ATOM   6000  N  N     . GLY A  1  778  ? 70.929  -86.470  158.402 1.00 58.31  ? 778  GLY A N     1 
ATOM   6001  C  CA    . GLY A  1  778  ? 70.233  -85.562  157.499 1.00 58.61  ? 778  GLY A CA    1 
ATOM   6002  C  C     . GLY A  1  778  ? 70.623  -84.160  157.892 1.00 58.62  ? 778  GLY A C     1 
ATOM   6003  O  O     . GLY A  1  778  ? 70.743  -83.244  157.070 1.00 56.87  ? 778  GLY A O     1 
ATOM   6004  N  N     . PHE A  1  779  ? 70.816  -84.028  159.197 1.00 60.12  ? 779  PHE A N     1 
ATOM   6005  C  CA    . PHE A  1  779  ? 71.234  -82.793  159.833 1.00 61.63  ? 779  PHE A CA    1 
ATOM   6006  C  C     . PHE A  1  779  ? 72.761  -82.847  159.871 1.00 62.90  ? 779  PHE A C     1 
ATOM   6007  O  O     . PHE A  1  779  ? 73.343  -83.929  160.011 1.00 63.99  ? 779  PHE A O     1 
ATOM   6008  C  CB    . PHE A  1  779  ? 70.698  -82.742  161.262 1.00 60.94  ? 779  PHE A CB    1 
ATOM   6009  C  CG    . PHE A  1  779  ? 69.248  -82.352  161.366 1.00 60.52  ? 779  PHE A CG    1 
ATOM   6010  C  CD1   . PHE A  1  779  ? 68.348  -83.161  162.060 1.00 59.64  ? 779  PHE A CD1   1 
ATOM   6011  C  CD2   . PHE A  1  779  ? 68.796  -81.137  160.845 1.00 59.46  ? 779  PHE A CD2   1 
ATOM   6012  C  CE1   . PHE A  1  779  ? 67.031  -82.763  162.237 1.00 59.13  ? 779  PHE A CE1   1 
ATOM   6013  C  CE2   . PHE A  1  779  ? 67.471  -80.731  161.023 1.00 58.72  ? 779  PHE A CE2   1 
ATOM   6014  C  CZ    . PHE A  1  779  ? 66.590  -81.544  161.721 1.00 58.83  ? 779  PHE A CZ    1 
ATOM   6015  N  N     . VAL A  1  780  ? 73.407  -81.690  159.752 1.00 62.53  ? 780  VAL A N     1 
ATOM   6016  C  CA    . VAL A  1  780  ? 74.862  -81.630  159.777 1.00 60.92  ? 780  VAL A CA    1 
ATOM   6017  C  C     . VAL A  1  780  ? 75.467  -82.452  160.924 1.00 60.40  ? 780  VAL A C     1 
ATOM   6018  O  O     . VAL A  1  780  ? 75.394  -82.070  162.092 1.00 60.44  ? 780  VAL A O     1 
ATOM   6019  C  CB    . VAL A  1  780  ? 75.327  -80.169  159.871 1.00 59.98  ? 780  VAL A CB    1 
ATOM   6020  C  CG1   . VAL A  1  780  ? 76.825  -80.104  159.999 1.00 60.04  ? 780  VAL A CG1   1 
ATOM   6021  C  CG2   . VAL A  1  780  ? 74.876  -79.417  158.639 1.00 58.39  ? 780  VAL A CG2   1 
ATOM   6022  N  N     . ASP A  1  781  ? 76.038  -83.598  160.563 1.00 60.11  ? 781  ASP A N     1 
ATOM   6023  C  CA    . ASP A  1  781  ? 76.686  -84.519  161.495 1.00 61.51  ? 781  ASP A CA    1 
ATOM   6024  C  C     . ASP A  1  781  ? 75.864  -85.081  162.663 1.00 61.08  ? 781  ASP A C     1 
ATOM   6025  O  O     . ASP A  1  781  ? 76.385  -85.341  163.752 1.00 60.07  ? 781  ASP A O     1 
ATOM   6026  C  CB    . ASP A  1  781  ? 77.980  -83.887  162.005 1.00 63.77  ? 781  ASP A CB    1 
ATOM   6027  C  CG    . ASP A  1  781  ? 79.112  -83.961  160.971 1.00 66.13  ? 781  ASP A CG    1 
ATOM   6028  O  OD1   . ASP A  1  781  ? 79.640  -85.072  160.731 1.00 67.39  ? 781  ASP A OD1   1 
ATOM   6029  O  OD2   . ASP A  1  781  ? 79.472  -82.914  160.389 1.00 66.76  ? 781  ASP A OD2   1 
ATOM   6030  N  N     . ARG A  1  782  ? 74.578  -85.302  162.414 1.00 61.37  ? 782  ARG A N     1 
ATOM   6031  C  CA    . ARG A  1  782  ? 73.681  -85.862  163.421 1.00 60.71  ? 782  ARG A CA    1 
ATOM   6032  C  C     . ARG A  1  782  ? 72.333  -86.317  162.832 1.00 61.04  ? 782  ARG A C     1 
ATOM   6033  O  O     . ARG A  1  782  ? 71.933  -85.918  161.724 1.00 60.39  ? 782  ARG A O     1 
ATOM   6034  C  CB    . ARG A  1  782  ? 73.465  -84.853  164.544 1.00 58.36  ? 782  ARG A CB    1 
ATOM   6035  C  CG    . ARG A  1  782  ? 73.222  -83.449  164.041 1.00 55.23  ? 782  ARG A CG    1 
ATOM   6036  C  CD    . ARG A  1  782  ? 73.063  -82.514  165.192 1.00 51.76  ? 782  ARG A CD    1 
ATOM   6037  N  NE    . ARG A  1  782  ? 72.701  -81.179  164.755 1.00 48.81  ? 782  ARG A NE    1 
ATOM   6038  C  CZ    . ARG A  1  782  ? 72.132  -80.291  165.558 1.00 49.52  ? 782  ARG A CZ    1 
ATOM   6039  N  NH1   . ARG A  1  782  ? 71.875  -80.614  166.828 1.00 47.50  ? 782  ARG A NH1   1 
ATOM   6040  N  NH2   . ARG A  1  782  ? 71.804  -79.092  165.095 1.00 49.12  ? 782  ARG A NH2   1 
ATOM   6041  N  N     . THR A  1  783  ? 71.649  -87.165  163.593 1.00 60.90  ? 783  THR A N     1 
ATOM   6042  C  CA    . THR A  1  783  ? 70.370  -87.731  163.194 1.00 60.96  ? 783  THR A CA    1 
ATOM   6043  C  C     . THR A  1  783  ? 69.210  -86.764  163.338 1.00 61.26  ? 783  THR A C     1 
ATOM   6044  O  O     . THR A  1  783  ? 68.447  -86.529  162.402 1.00 61.10  ? 783  THR A O     1 
ATOM   6045  C  CB    . THR A  1  783  ? 70.073  -88.943  164.035 1.00 60.67  ? 783  THR A CB    1 
ATOM   6046  O  OG1   . THR A  1  783  ? 71.223  -89.250  164.824 1.00 61.11  ? 783  THR A OG1   1 
ATOM   6047  C  CG2   . THR A  1  783  ? 69.767  -90.115  163.158 1.00 62.15  ? 783  THR A CG2   1 
ATOM   6048  N  N     . LEU A  1  784  ? 69.073  -86.218  164.535 1.00 61.82  ? 784  LEU A N     1 
ATOM   6049  C  CA    . LEU A  1  784  ? 68.012  -85.269  164.829 1.00 62.34  ? 784  LEU A CA    1 
ATOM   6050  C  C     . LEU A  1  784  ? 68.652  -84.038  165.454 1.00 62.75  ? 784  LEU A C     1 
ATOM   6051  O  O     . LEU A  1  784  ? 69.858  -84.026  165.695 1.00 63.61  ? 784  LEU A O     1 
ATOM   6052  C  CB    . LEU A  1  784  ? 67.027  -85.905  165.806 1.00 61.45  ? 784  LEU A CB    1 
ATOM   6053  C  CG    . LEU A  1  784  ? 66.224  -87.040  165.187 1.00 60.09  ? 784  LEU A CG    1 
ATOM   6054  C  CD1   . LEU A  1  784  ? 65.536  -87.872  166.252 1.00 60.39  ? 784  LEU A CD1   1 
ATOM   6055  C  CD2   . LEU A  1  784  ? 65.223  -86.423  164.240 1.00 59.84  ? 784  LEU A CD2   1 
ATOM   6056  N  N     . PRO A  1  785  ? 67.870  -82.976  165.704 1.00 62.52  ? 785  PRO A N     1 
ATOM   6057  C  CA    . PRO A  1  785  ? 68.496  -81.806  166.314 1.00 63.44  ? 785  PRO A CA    1 
ATOM   6058  C  C     . PRO A  1  785  ? 68.424  -81.894  167.850 1.00 63.71  ? 785  PRO A C     1 
ATOM   6059  O  O     . PRO A  1  785  ? 68.477  -80.884  168.550 1.00 64.24  ? 785  PRO A O     1 
ATOM   6060  C  CB    . PRO A  1  785  ? 67.689  -80.652  165.723 1.00 62.56  ? 785  PRO A CB    1 
ATOM   6061  C  CG    . PRO A  1  785  ? 66.340  -81.205  165.681 1.00 62.34  ? 785  PRO A CG    1 
ATOM   6062  C  CD    . PRO A  1  785  ? 66.532  -82.636  165.199 1.00 62.53  ? 785  PRO A CD    1 
ATOM   6063  N  N     . HIS A  1  786  ? 68.307  -83.120  168.356 1.00 63.80  ? 786  HIS A N     1 
ATOM   6064  C  CA    . HIS A  1  786  ? 68.240  -83.390  169.792 1.00 64.23  ? 786  HIS A CA    1 
ATOM   6065  C  C     . HIS A  1  786  ? 69.523  -84.102  170.163 1.00 65.04  ? 786  HIS A C     1 
ATOM   6066  O  O     . HIS A  1  786  ? 69.673  -84.624  171.271 1.00 64.60  ? 786  HIS A O     1 
ATOM   6067  C  CB    . HIS A  1  786  ? 67.082  -84.325  170.113 1.00 63.88  ? 786  HIS A CB    1 
ATOM   6068  C  CG    . HIS A  1  786  ? 65.788  -83.921  169.491 1.00 63.68  ? 786  HIS A CG    1 
ATOM   6069  N  ND1   . HIS A  1  786  ? 64.572  -84.361  169.965 1.00 64.18  ? 786  HIS A ND1   1 
ATOM   6070  C  CD2   . HIS A  1  786  ? 65.515  -83.111  168.442 1.00 63.32  ? 786  HIS A CD2   1 
ATOM   6071  C  CE1   . HIS A  1  786  ? 63.604  -83.834  169.237 1.00 64.26  ? 786  HIS A CE1   1 
ATOM   6072  N  NE2   . HIS A  1  786  ? 64.150  -83.072  168.307 1.00 63.94  ? 786  HIS A NE2   1 
ATOM   6073  N  N     . PHE A  1  787  ? 70.432  -84.141  169.198 1.00 66.15  ? 787  PHE A N     1 
ATOM   6074  C  CA    . PHE A  1  787  ? 71.720  -84.798  169.349 1.00 66.30  ? 787  PHE A CA    1 
ATOM   6075  C  C     . PHE A  1  787  ? 72.847  -83.819  169.038 1.00 66.13  ? 787  PHE A C     1 
ATOM   6076  O  O     . PHE A  1  787  ? 72.676  -82.852  168.283 1.00 64.97  ? 787  PHE A O     1 
ATOM   6077  C  CB    . PHE A  1  787  ? 71.816  -86.007  168.398 1.00 66.00  ? 787  PHE A CB    1 
ATOM   6078  C  CG    . PHE A  1  787  ? 70.957  -87.185  168.798 1.00 64.66  ? 787  PHE A CG    1 
ATOM   6079  C  CD1   . PHE A  1  787  ? 70.348  -87.973  167.822 1.00 64.55  ? 787  PHE A CD1   1 
ATOM   6080  C  CD2   . PHE A  1  787  ? 70.800  -87.537  170.135 1.00 64.47  ? 787  PHE A CD2   1 
ATOM   6081  C  CE1   . PHE A  1  787  ? 69.600  -89.090  168.170 1.00 64.48  ? 787  PHE A CE1   1 
ATOM   6082  C  CE2   . PHE A  1  787  ? 70.052  -88.657  170.496 1.00 64.74  ? 787  PHE A CE2   1 
ATOM   6083  C  CZ    . PHE A  1  787  ? 69.452  -89.435  169.511 1.00 65.11  ? 787  PHE A CZ    1 
ATOM   6084  N  N     . SER A  1  788  ? 73.995  -84.089  169.644 1.00 66.36  ? 788  SER A N     1 
ATOM   6085  C  CA    . SER A  1  788  ? 75.191  -83.288  169.464 1.00 67.14  ? 788  SER A CA    1 
ATOM   6086  C  C     . SER A  1  788  ? 75.964  -83.921  168.323 1.00 67.17  ? 788  SER A C     1 
ATOM   6087  O  O     . SER A  1  788  ? 76.088  -85.147  168.252 1.00 67.99  ? 788  SER A O     1 
ATOM   6088  C  CB    . SER A  1  788  ? 76.014  -83.304  170.751 1.00 68.34  ? 788  SER A CB    1 
ATOM   6089  O  OG    . SER A  1  788  ? 75.941  -84.580  171.374 1.00 70.32  ? 788  SER A OG    1 
ATOM   6090  N  N     . LYS A  1  789  ? 76.479  -83.081  167.434 1.00 66.40  ? 789  LYS A N     1 
ATOM   6091  C  CA    . LYS A  1  789  ? 77.211  -83.543  166.264 1.00 66.04  ? 789  LYS A CA    1 
ATOM   6092  C  C     . LYS A  1  789  ? 78.140  -84.736  166.473 1.00 66.69  ? 789  LYS A C     1 
ATOM   6093  O  O     . LYS A  1  789  ? 78.572  -85.038  167.589 1.00 66.68  ? 789  LYS A O     1 
ATOM   6094  C  CB    . LYS A  1  789  ? 77.978  -82.371  165.651 1.00 64.68  ? 789  LYS A CB    1 
ATOM   6095  C  CG    . LYS A  1  789  ? 77.046  -81.258  165.198 1.00 64.11  ? 789  LYS A CG    1 
ATOM   6096  C  CD    . LYS A  1  789  ? 77.762  -80.126  164.493 1.00 63.54  ? 789  LYS A CD    1 
ATOM   6097  C  CE    . LYS A  1  789  ? 76.764  -79.096  163.984 1.00 63.62  ? 789  LYS A CE    1 
ATOM   6098  N  NZ    . LYS A  1  789  ? 77.432  -78.032  163.189 1.00 64.35  ? 789  LYS A NZ    1 
ATOM   6099  N  N     . ASP A  1  790  ? 78.410  -85.425  165.371 1.00 67.09  ? 790  ASP A N     1 
ATOM   6100  C  CA    . ASP A  1  790  ? 79.285  -86.590  165.342 1.00 67.14  ? 790  ASP A CA    1 
ATOM   6101  C  C     . ASP A  1  790  ? 79.002  -87.693  166.367 1.00 67.37  ? 790  ASP A C     1 
ATOM   6102  O  O     . ASP A  1  790  ? 79.929  -88.316  166.891 1.00 67.42  ? 790  ASP A O     1 
ATOM   6103  C  CB    . ASP A  1  790  ? 80.746  -86.142  165.447 1.00 66.08  ? 790  ASP A CB    1 
ATOM   6104  C  CG    . ASP A  1  790  ? 81.119  -85.114  164.391 1.00 65.89  ? 790  ASP A CG    1 
ATOM   6105  O  OD1   . ASP A  1  790  ? 80.866  -83.907  164.611 1.00 65.59  ? 790  ASP A OD1   1 
ATOM   6106  O  OD2   . ASP A  1  790  ? 81.656  -85.515  163.335 1.00 65.46  ? 790  ASP A OD2   1 
ATOM   6107  N  N     . ASP A  1  791  ? 77.724  -87.943  166.640 1.00 67.70  ? 791  ASP A N     1 
ATOM   6108  C  CA    . ASP A  1  791  ? 77.345  -89.005  167.571 1.00 67.94  ? 791  ASP A CA    1 
ATOM   6109  C  C     . ASP A  1  791  ? 77.026  -90.283  166.782 1.00 67.74  ? 791  ASP A C     1 
ATOM   6110  O  O     . ASP A  1  791  ? 76.107  -90.304  165.954 1.00 68.35  ? 791  ASP A O     1 
ATOM   6111  C  CB    . ASP A  1  791  ? 76.121  -88.607  168.396 1.00 67.85  ? 791  ASP A CB    1 
ATOM   6112  C  CG    . ASP A  1  791  ? 75.725  -89.687  169.389 1.00 67.56  ? 791  ASP A CG    1 
ATOM   6113  O  OD1   . ASP A  1  791  ? 75.837  -90.884  169.033 1.00 66.49  ? 791  ASP A OD1   1 
ATOM   6114  O  OD2   . ASP A  1  791  ? 75.298  -89.346  170.514 1.00 66.96  ? 791  ASP A OD2   1 
ATOM   6115  N  N     . TYR A  1  792  ? 77.779  -91.346  167.046 1.00 66.74  ? 792  TYR A N     1 
ATOM   6116  C  CA    . TYR A  1  792  ? 77.580  -92.604  166.342 1.00 65.79  ? 792  TYR A CA    1 
ATOM   6117  C  C     . TYR A  1  792  ? 76.944  -93.683  167.189 1.00 64.94  ? 792  TYR A C     1 
ATOM   6118  O  O     . TYR A  1  792  ? 76.710  -94.781  166.697 1.00 64.20  ? 792  TYR A O     1 
ATOM   6119  C  CB    . TYR A  1  792  ? 78.913  -93.122  165.807 1.00 65.15  ? 792  TYR A CB    1 
ATOM   6120  C  CG    . TYR A  1  792  ? 79.394  -92.414  164.569 1.00 66.41  ? 792  TYR A CG    1 
ATOM   6121  C  CD1   . TYR A  1  792  ? 79.613  -91.034  164.563 1.00 66.25  ? 792  TYR A CD1   1 
ATOM   6122  C  CD2   . TYR A  1  792  ? 79.618  -93.125  163.388 1.00 67.75  ? 792  TYR A CD2   1 
ATOM   6123  C  CE1   . TYR A  1  792  ? 80.044  -90.377  163.404 1.00 67.02  ? 792  TYR A CE1   1 
ATOM   6124  C  CE2   . TYR A  1  792  ? 80.049  -92.482  162.221 1.00 68.28  ? 792  TYR A CE2   1 
ATOM   6125  C  CZ    . TYR A  1  792  ? 80.258  -91.108  162.234 1.00 68.07  ? 792  TYR A CZ    1 
ATOM   6126  O  OH    . TYR A  1  792  ? 80.662  -90.480  161.073 1.00 67.84  ? 792  TYR A OH    1 
ATOM   6127  N  N     . SER A  1  793  ? 76.664  -93.370  168.453 1.00 65.11  ? 793  SER A N     1 
ATOM   6128  C  CA    . SER A  1  793  ? 76.074  -94.339  169.389 1.00 66.18  ? 793  SER A CA    1 
ATOM   6129  C  C     . SER A  1  793  ? 74.806  -94.958  168.833 1.00 65.92  ? 793  SER A C     1 
ATOM   6130  O  O     . SER A  1  793  ? 74.222  -94.427  167.896 1.00 67.17  ? 793  SER A O     1 
ATOM   6131  C  CB    . SER A  1  793  ? 75.753  -93.674  170.742 1.00 67.01  ? 793  SER A CB    1 
ATOM   6132  O  OG    . SER A  1  793  ? 74.454  -93.092  170.772 1.00 65.85  ? 793  SER A OG    1 
ATOM   6133  N  N     . PRO A  1  794  ? 74.356  -96.090  169.405 1.00 65.59  ? 794  PRO A N     1 
ATOM   6134  C  CA    . PRO A  1  794  ? 73.132  -96.706  168.882 1.00 66.06  ? 794  PRO A CA    1 
ATOM   6135  C  C     . PRO A  1  794  ? 71.880  -95.852  169.088 1.00 66.04  ? 794  PRO A C     1 
ATOM   6136  O  O     . PRO A  1  794  ? 71.043  -95.753  168.187 1.00 66.57  ? 794  PRO A O     1 
ATOM   6137  C  CB    . PRO A  1  794  ? 73.074  -98.042  169.623 1.00 65.42  ? 794  PRO A CB    1 
ATOM   6138  C  CG    . PRO A  1  794  ? 73.752  -97.742  170.922 1.00 64.97  ? 794  PRO A CG    1 
ATOM   6139  C  CD    . PRO A  1  794  ? 74.927  -96.896  170.499 1.00 65.13  ? 794  PRO A CD    1 
ATOM   6140  N  N     . GLU A  1  795  ? 71.766  -95.225  170.260 1.00 66.34  ? 795  GLU A N     1 
ATOM   6141  C  CA    . GLU A  1  795  ? 70.610  -94.384  170.587 1.00 66.37  ? 795  GLU A CA    1 
ATOM   6142  C  C     . GLU A  1  795  ? 70.588  -93.130  169.736 1.00 65.27  ? 795  GLU A C     1 
ATOM   6143  O  O     . GLU A  1  795  ? 70.015  -92.119  170.142 1.00 65.55  ? 795  GLU A O     1 
ATOM   6144  C  CB    . GLU A  1  795  ? 70.618  -93.942  172.060 1.00 68.35  ? 795  GLU A CB    1 
ATOM   6145  C  CG    . GLU A  1  795  ? 70.914  -95.021  173.087 1.00 71.40  ? 795  GLU A CG    1 
ATOM   6146  C  CD    . GLU A  1  795  ? 72.401  -95.295  173.213 1.00 72.87  ? 795  GLU A CD    1 
ATOM   6147  O  OE1   . GLU A  1  795  ? 73.171  -94.307  173.294 1.00 72.81  ? 795  GLU A OE1   1 
ATOM   6148  O  OE2   . GLU A  1  795  ? 72.796  -96.487  173.235 1.00 72.79  ? 795  GLU A OE2   1 
ATOM   6149  N  N     . SER A  1  796  ? 71.214  -93.194  168.567 1.00 63.66  ? 796  SER A N     1 
ATOM   6150  C  CA    . SER A  1  796  ? 71.269  -92.049  167.673 1.00 62.91  ? 796  SER A CA    1 
ATOM   6151  C  C     . SER A  1  796  ? 71.264  -92.431  166.212 1.00 63.01  ? 796  SER A C     1 
ATOM   6152  O  O     . SER A  1  796  ? 70.774  -91.681  165.379 1.00 63.46  ? 796  SER A O     1 
ATOM   6153  C  CB    . SER A  1  796  ? 72.521  -91.227  167.944 1.00 63.04  ? 796  SER A CB    1 
ATOM   6154  O  OG    . SER A  1  796  ? 72.915  -90.530  166.775 1.00 62.93  ? 796  SER A OG    1 
ATOM   6155  N  N     . LYS A  1  797  ? 71.836  -93.583  165.889 1.00 63.37  ? 797  LYS A N     1 
ATOM   6156  C  CA    . LYS A  1  797  ? 71.879  -94.028  164.502 1.00 62.83  ? 797  LYS A CA    1 
ATOM   6157  C  C     . LYS A  1  797  ? 70.622  -94.823  164.165 1.00 62.08  ? 797  LYS A C     1 
ATOM   6158  O  O     . LYS A  1  797  ? 70.405  -95.202  163.011 1.00 62.39  ? 797  LYS A O     1 
ATOM   6159  C  CB    . LYS A  1  797  ? 73.141  -94.861  164.238 1.00 62.63  ? 797  LYS A CB    1 
ATOM   6160  C  CG    . LYS A  1  797  ? 74.448  -94.075  164.397 1.00 60.76  ? 797  LYS A CG    1 
ATOM   6161  C  CD    . LYS A  1  797  ? 74.621  -93.003  163.334 1.00 59.19  ? 797  LYS A CD    1 
ATOM   6162  C  CE    . LYS A  1  797  ? 75.218  -93.584  162.066 1.00 58.24  ? 797  LYS A CE    1 
ATOM   6163  N  NZ    . LYS A  1  797  ? 75.537  -92.534  161.059 1.00 57.10  ? 797  LYS A NZ    1 
ATOM   6164  N  N     . GLY A  1  798  ? 69.797  -95.080  165.174 1.00 60.14  ? 798  GLY A N     1 
ATOM   6165  C  CA    . GLY A  1  798  ? 68.559  -95.776  164.907 1.00 58.53  ? 798  GLY A CA    1 
ATOM   6166  C  C     . GLY A  1  798  ? 68.322  -97.127  165.535 1.00 57.42  ? 798  GLY A C     1 
ATOM   6167  O  O     . GLY A  1  798  ? 67.656  -97.974  164.936 1.00 57.34  ? 798  GLY A O     1 
ATOM   6168  N  N     . PHE A  1  799  ? 68.853  -97.357  166.726 1.00 56.07  ? 799  PHE A N     1 
ATOM   6169  C  CA    . PHE A  1  799  ? 68.604  -98.636  167.375 1.00 54.86  ? 799  PHE A CA    1 
ATOM   6170  C  C     . PHE A  1  799  ? 67.435  -98.429  168.316 1.00 54.96  ? 799  PHE A C     1 
ATOM   6171  O  O     . PHE A  1  799  ? 67.526  -97.637  169.246 1.00 55.60  ? 799  PHE A O     1 
ATOM   6172  C  CB    . PHE A  1  799  ? 69.821  -99.109  168.179 1.00 52.46  ? 799  PHE A CB    1 
ATOM   6173  C  CG    . PHE A  1  799  ? 69.602  -100.418 168.923 1.00 49.84  ? 799  PHE A CG    1 
ATOM   6174  C  CD1   . PHE A  1  799  ? 69.549  -101.626 168.241 1.00 48.30  ? 799  PHE A CD1   1 
ATOM   6175  C  CD2   . PHE A  1  799  ? 69.484  -100.439 170.315 1.00 49.71  ? 799  PHE A CD2   1 
ATOM   6176  C  CE1   . PHE A  1  799  ? 69.389  -102.835 168.932 1.00 47.55  ? 799  PHE A CE1   1 
ATOM   6177  C  CE2   . PHE A  1  799  ? 69.324  -101.642 171.011 1.00 47.51  ? 799  PHE A CE2   1 
ATOM   6178  C  CZ    . PHE A  1  799  ? 69.278  -102.840 170.317 1.00 46.74  ? 799  PHE A CZ    1 
ATOM   6179  N  N     . VAL A  1  800  ? 66.327  -99.115  168.060 1.00 55.33  ? 800  VAL A N     1 
ATOM   6180  C  CA    . VAL A  1  800  ? 65.167  -99.009  168.934 1.00 55.41  ? 800  VAL A CA    1 
ATOM   6181  C  C     . VAL A  1  800  ? 65.322  -100.073 170.012 1.00 56.31  ? 800  VAL A C     1 
ATOM   6182  O  O     . VAL A  1  800  ? 65.075  -101.259 169.761 1.00 55.58  ? 800  VAL A O     1 
ATOM   6183  C  CB    . VAL A  1  800  ? 63.855  -99.238  168.166 1.00 54.57  ? 800  VAL A CB    1 
ATOM   6184  C  CG1   . VAL A  1  800  ? 62.722  -99.501  169.140 1.00 54.16  ? 800  VAL A CG1   1 
ATOM   6185  C  CG2   . VAL A  1  800  ? 63.539  -98.017  167.325 1.00 52.86  ? 800  VAL A CG2   1 
ATOM   6186  N  N     . GLU A  1  801  ? 65.742  -99.639  171.201 1.00 56.64  ? 801  GLU A N     1 
ATOM   6187  C  CA    . GLU A  1  801  ? 65.960  -100.544 172.314 1.00 57.96  ? 801  GLU A CA    1 
ATOM   6188  C  C     . GLU A  1  801  ? 64.677  -101.075 172.939 1.00 58.23  ? 801  GLU A C     1 
ATOM   6189  O  O     . GLU A  1  801  ? 64.632  -102.204 173.434 1.00 58.17  ? 801  GLU A O     1 
ATOM   6190  C  CB    . GLU A  1  801  ? 66.794  -99.867  173.399 1.00 60.18  ? 801  GLU A CB    1 
ATOM   6191  C  CG    . GLU A  1  801  ? 67.207  -100.860 174.488 1.00 63.70  ? 801  GLU A CG    1 
ATOM   6192  C  CD    . GLU A  1  801  ? 67.869  -100.223 175.690 1.00 63.99  ? 801  GLU A CD    1 
ATOM   6193  O  OE1   . GLU A  1  801  ? 68.395  -100.986 176.532 1.00 64.50  ? 801  GLU A OE1   1 
ATOM   6194  O  OE2   . GLU A  1  801  ? 67.855  -98.977  175.794 1.00 63.91  ? 801  GLU A OE2   1 
ATOM   6195  N  N     . ASN A  1  802  ? 63.633  -100.260 172.918 1.00 58.57  ? 802  ASN A N     1 
ATOM   6196  C  CA    . ASN A  1  802  ? 62.356  -100.653 173.498 1.00 59.94  ? 802  ASN A CA    1 
ATOM   6197  C  C     . ASN A  1  802  ? 61.553  -101.699 172.709 1.00 60.86  ? 802  ASN A C     1 
ATOM   6198  O  O     . ASN A  1  802  ? 61.720  -101.868 171.495 1.00 61.93  ? 802  ASN A O     1 
ATOM   6199  C  CB    . ASN A  1  802  ? 61.488  -99.413  173.706 1.00 60.59  ? 802  ASN A CB    1 
ATOM   6200  C  CG    . ASN A  1  802  ? 61.864  -98.646  174.950 1.00 61.23  ? 802  ASN A CG    1 
ATOM   6201  O  OD1   . ASN A  1  802  ? 61.869  -99.203  176.051 1.00 62.17  ? 802  ASN A OD1   1 
ATOM   6202  N  ND2   . ASN A  1  802  ? 62.171  -97.360  174.789 1.00 60.46  ? 802  ASN A ND2   1 
ATOM   6203  N  N     . SER A  1  803  ? 60.676  -102.401 173.421 1.00 59.94  ? 803  SER A N     1 
ATOM   6204  C  CA    . SER A  1  803  ? 59.811  -103.405 172.813 1.00 58.18  ? 803  SER A CA    1 
ATOM   6205  C  C     . SER A  1  803  ? 58.523  -102.684 172.444 1.00 57.16  ? 803  SER A C     1 
ATOM   6206  O  O     . SER A  1  803  ? 58.327  -101.539 172.849 1.00 57.69  ? 803  SER A O     1 
ATOM   6207  C  CB    . SER A  1  803  ? 59.517  -104.525 173.816 1.00 58.13  ? 803  SER A CB    1 
ATOM   6208  O  OG    . SER A  1  803  ? 59.107  -103.998 175.067 1.00 56.80  ? 803  SER A OG    1 
ATOM   6209  N  N     . TYR A  1  804  ? 57.651  -103.334 171.677 1.00 55.62  ? 804  TYR A N     1 
ATOM   6210  C  CA    . TYR A  1  804  ? 56.383  -102.717 171.291 1.00 53.37  ? 804  TYR A CA    1 
ATOM   6211  C  C     . TYR A  1  804  ? 55.462  -102.596 172.501 1.00 52.94  ? 804  TYR A C     1 
ATOM   6212  O  O     . TYR A  1  804  ? 54.634  -101.687 172.581 1.00 52.77  ? 804  TYR A O     1 
ATOM   6213  C  CB    . TYR A  1  804  ? 55.719  -103.538 170.195 1.00 50.73  ? 804  TYR A CB    1 
ATOM   6214  C  CG    . TYR A  1  804  ? 56.237  -103.200 168.827 1.00 48.21  ? 804  TYR A CG    1 
ATOM   6215  C  CD1   . TYR A  1  804  ? 56.539  -104.202 167.914 1.00 47.52  ? 804  TYR A CD1   1 
ATOM   6216  C  CD2   . TYR A  1  804  ? 56.391  -101.876 168.431 1.00 47.01  ? 804  TYR A CD2   1 
ATOM   6217  C  CE1   . TYR A  1  804  ? 56.981  -103.902 166.636 1.00 47.12  ? 804  TYR A CE1   1 
ATOM   6218  C  CE2   . TYR A  1  804  ? 56.829  -101.562 167.156 1.00 47.21  ? 804  TYR A CE2   1 
ATOM   6219  C  CZ    . TYR A  1  804  ? 57.122  -102.583 166.262 1.00 47.35  ? 804  TYR A CZ    1 
ATOM   6220  O  OH    . TYR A  1  804  ? 57.549  -102.296 164.988 1.00 47.25  ? 804  TYR A OH    1 
ATOM   6221  N  N     . LEU A  1  805  ? 55.636  -103.523 173.439 1.00 52.24  ? 805  LEU A N     1 
ATOM   6222  C  CA    . LEU A  1  805  ? 54.879  -103.572 174.684 1.00 51.26  ? 805  LEU A CA    1 
ATOM   6223  C  C     . LEU A  1  805  ? 55.208  -102.304 175.469 1.00 52.55  ? 805  LEU A C     1 
ATOM   6224  O  O     . LEU A  1  805  ? 54.336  -101.665 176.053 1.00 52.41  ? 805  LEU A O     1 
ATOM   6225  C  CB    . LEU A  1  805  ? 55.327  -104.798 175.481 1.00 48.82  ? 805  LEU A CB    1 
ATOM   6226  C  CG    . LEU A  1  805  ? 54.597  -105.328 176.710 1.00 48.00  ? 805  LEU A CG    1 
ATOM   6227  C  CD1   . LEU A  1  805  ? 54.162  -104.190 177.620 1.00 46.53  ? 805  LEU A CD1   1 
ATOM   6228  C  CD2   . LEU A  1  805  ? 53.411  -106.134 176.248 1.00 48.60  ? 805  LEU A CD2   1 
ATOM   6229  N  N     . ARG A  1  806  ? 56.489  -101.948 175.457 1.00 54.37  ? 806  ARG A N     1 
ATOM   6230  C  CA    . ARG A  1  806  ? 56.997  -100.783 176.171 1.00 55.87  ? 806  ARG A CA    1 
ATOM   6231  C  C     . ARG A  1  806  ? 56.722  -99.429  175.540 1.00 54.29  ? 806  ARG A C     1 
ATOM   6232  O  O     . ARG A  1  806  ? 56.426  -98.468  176.238 1.00 54.43  ? 806  ARG A O     1 
ATOM   6233  C  CB    . ARG A  1  806  ? 58.504  -100.928 176.388 1.00 59.95  ? 806  ARG A CB    1 
ATOM   6234  C  CG    . ARG A  1  806  ? 58.875  -101.981 177.414 1.00 64.31  ? 806  ARG A CG    1 
ATOM   6235  C  CD    . ARG A  1  806  ? 60.306  -101.808 177.885 1.00 68.20  ? 806  ARG A CD    1 
ATOM   6236  N  NE    . ARG A  1  806  ? 60.560  -102.632 179.064 1.00 73.00  ? 806  ARG A NE    1 
ATOM   6237  C  CZ    . ARG A  1  806  ? 61.690  -102.619 179.766 1.00 74.81  ? 806  ARG A CZ    1 
ATOM   6238  N  NH1   . ARG A  1  806  ? 62.689  -101.816 179.415 1.00 75.83  ? 806  ARG A NH1   1 
ATOM   6239  N  NH2   . ARG A  1  806  ? 61.823  -103.415 180.821 1.00 75.15  ? 806  ARG A NH2   1 
ATOM   6240  N  N     . GLY A  1  807  ? 56.853  -99.336  174.228 1.00 53.04  ? 807  GLY A N     1 
ATOM   6241  C  CA    . GLY A  1  807  ? 56.589  -98.071  173.573 1.00 52.23  ? 807  GLY A CA    1 
ATOM   6242  C  C     . GLY A  1  807  ? 57.818  -97.258  173.228 1.00 51.43  ? 807  GLY A C     1 
ATOM   6243  O  O     . GLY A  1  807  ? 58.573  -96.851  174.107 1.00 51.75  ? 807  GLY A O     1 
ATOM   6244  N  N     . LEU A  1  808  ? 58.009  -97.022  171.936 1.00 50.13  ? 808  LEU A N     1 
ATOM   6245  C  CA    . LEU A  1  808  ? 59.136  -96.248  171.452 1.00 49.94  ? 808  LEU A CA    1 
ATOM   6246  C  C     . LEU A  1  808  ? 59.170  -94.834  172.028 1.00 50.28  ? 808  LEU A C     1 
ATOM   6247  O  O     . LEU A  1  808  ? 58.164  -94.315  172.507 1.00 50.18  ? 808  LEU A O     1 
ATOM   6248  C  CB    . LEU A  1  808  ? 59.096  -96.166  169.924 1.00 49.47  ? 808  LEU A CB    1 
ATOM   6249  C  CG    . LEU A  1  808  ? 59.609  -97.369  169.135 1.00 48.96  ? 808  LEU A CG    1 
ATOM   6250  C  CD1   . LEU A  1  808  ? 58.897  -98.650  169.571 1.00 47.34  ? 808  LEU A CD1   1 
ATOM   6251  C  CD2   . LEU A  1  808  ? 59.412  -97.087  167.649 1.00 47.57  ? 808  LEU A CD2   1 
ATOM   6252  N  N     . THR A  1  809  ? 60.348  -94.223  171.979 1.00 50.62  ? 809  THR A N     1 
ATOM   6253  C  CA    . THR A  1  809  ? 60.546  -92.870  172.462 1.00 49.88  ? 809  THR A CA    1 
ATOM   6254  C  C     . THR A  1  809  ? 60.507  -92.009  171.214 1.00 49.60  ? 809  THR A C     1 
ATOM   6255  O  O     . THR A  1  809  ? 60.760  -92.489  170.114 1.00 48.92  ? 809  THR A O     1 
ATOM   6256  C  CB    . THR A  1  809  ? 61.907  -92.724  173.123 1.00 50.51  ? 809  THR A CB    1 
ATOM   6257  O  OG1   . THR A  1  809  ? 62.927  -93.005  172.156 1.00 51.25  ? 809  THR A OG1   1 
ATOM   6258  C  CG2   . THR A  1  809  ? 62.030  -93.695  174.295 1.00 49.29  ? 809  THR A CG2   1 
ATOM   6259  N  N     . PRO A  1  810  ? 60.205  -90.721  171.370 1.00 49.91  ? 810  PRO A N     1 
ATOM   6260  C  CA    . PRO A  1  810  ? 60.121  -89.772  170.257 1.00 50.49  ? 810  PRO A CA    1 
ATOM   6261  C  C     . PRO A  1  810  ? 61.143  -89.974  169.152 1.00 51.16  ? 810  PRO A C     1 
ATOM   6262  O  O     . PRO A  1  810  ? 60.840  -89.760  167.979 1.00 51.18  ? 810  PRO A O     1 
ATOM   6263  C  CB    . PRO A  1  810  ? 60.266  -88.426  170.945 1.00 50.02  ? 810  PRO A CB    1 
ATOM   6264  C  CG    . PRO A  1  810  ? 59.565  -88.664  172.234 1.00 51.06  ? 810  PRO A CG    1 
ATOM   6265  C  CD    . PRO A  1  810  ? 60.095  -90.023  172.660 1.00 50.19  ? 810  PRO A CD    1 
ATOM   6266  N  N     . GLN A  1  811  ? 62.354  -90.376  169.528 1.00 52.47  ? 811  GLN A N     1 
ATOM   6267  C  CA    . GLN A  1  811  ? 63.416  -90.607  168.551 1.00 53.27  ? 811  GLN A CA    1 
ATOM   6268  C  C     . GLN A  1  811  ? 63.170  -91.970  167.921 1.00 52.81  ? 811  GLN A C     1 
ATOM   6269  O  O     . GLN A  1  811  ? 63.054  -92.086  166.697 1.00 52.62  ? 811  GLN A O     1 
ATOM   6270  C  CB    . GLN A  1  811  ? 64.804  -90.621  169.216 1.00 55.58  ? 811  GLN A CB    1 
ATOM   6271  C  CG    . GLN A  1  811  ? 65.295  -89.332  169.900 1.00 57.27  ? 811  GLN A CG    1 
ATOM   6272  C  CD    . GLN A  1  811  ? 64.510  -88.961  171.158 1.00 58.94  ? 811  GLN A CD    1 
ATOM   6273  O  OE1   . GLN A  1  811  ? 64.156  -89.822  171.977 1.00 58.96  ? 811  GLN A OE1   1 
ATOM   6274  N  NE2   . GLN A  1  811  ? 64.252  -87.666  171.325 1.00 58.80  ? 811  GLN A NE2   1 
ATOM   6275  N  N     . GLU A  1  812  ? 63.096  -93.001  168.768 1.00 51.32  ? 812  GLU A N     1 
ATOM   6276  C  CA    . GLU A  1  812  ? 62.858  -94.361  168.294 1.00 50.08  ? 812  GLU A CA    1 
ATOM   6277  C  C     . GLU A  1  812  ? 61.692  -94.321  167.323 1.00 49.58  ? 812  GLU A C     1 
ATOM   6278  O  O     . GLU A  1  812  ? 61.740  -94.905  166.239 1.00 49.41  ? 812  GLU A O     1 
ATOM   6279  C  CB    . GLU A  1  812  ? 62.528  -95.290  169.459 1.00 49.45  ? 812  GLU A CB    1 
ATOM   6280  C  CG    . GLU A  1  812  ? 63.652  -95.426  170.447 1.00 52.56  ? 812  GLU A CG    1 
ATOM   6281  C  CD    . GLU A  1  812  ? 63.442  -96.561  171.437 1.00 55.58  ? 812  GLU A CD    1 
ATOM   6282  O  OE1   . GLU A  1  812  ? 62.503  -96.478  172.257 1.00 57.38  ? 812  GLU A OE1   1 
ATOM   6283  O  OE2   . GLU A  1  812  ? 64.221  -97.543  171.399 1.00 56.37  ? 812  GLU A OE2   1 
ATOM   6284  N  N     . PHE A  1  813  ? 60.652  -93.595  167.717 1.00 47.45  ? 813  PHE A N     1 
ATOM   6285  C  CA    . PHE A  1  813  ? 59.475  -93.461  166.894 1.00 44.67  ? 813  PHE A CA    1 
ATOM   6286  C  C     . PHE A  1  813  ? 59.797  -92.883  165.526 1.00 44.09  ? 813  PHE A C     1 
ATOM   6287  O  O     . PHE A  1  813  ? 59.504  -93.501  164.506 1.00 44.54  ? 813  PHE A O     1 
ATOM   6288  C  CB    . PHE A  1  813  ? 58.452  -92.564  167.573 1.00 43.76  ? 813  PHE A CB    1 
ATOM   6289  C  CG    . PHE A  1  813  ? 57.120  -92.523  166.865 1.00 42.60  ? 813  PHE A CG    1 
ATOM   6290  C  CD1   . PHE A  1  813  ? 56.212  -93.579  167.001 1.00 41.76  ? 813  PHE A CD1   1 
ATOM   6291  C  CD2   . PHE A  1  813  ? 56.767  -91.426  166.080 1.00 40.57  ? 813  PHE A CD2   1 
ATOM   6292  C  CE1   . PHE A  1  813  ? 54.985  -93.544  166.377 1.00 39.56  ? 813  PHE A CE1   1 
ATOM   6293  C  CE2   . PHE A  1  813  ? 55.544  -91.379  165.451 1.00 38.77  ? 813  PHE A CE2   1 
ATOM   6294  C  CZ    . PHE A  1  813  ? 54.648  -92.441  165.602 1.00 39.99  ? 813  PHE A CZ    1 
ATOM   6295  N  N     . PHE A  1  814  ? 60.402  -91.703  165.487 1.00 42.53  ? 814  PHE A N     1 
ATOM   6296  C  CA    . PHE A  1  814  ? 60.681  -91.110  164.196 1.00 42.08  ? 814  PHE A CA    1 
ATOM   6297  C  C     . PHE A  1  814  ? 61.631  -91.923  163.351 1.00 43.47  ? 814  PHE A C     1 
ATOM   6298  O  O     . PHE A  1  814  ? 61.528  -91.910  162.131 1.00 44.45  ? 814  PHE A O     1 
ATOM   6299  C  CB    . PHE A  1  814  ? 61.234  -89.707  164.334 1.00 40.02  ? 814  PHE A CB    1 
ATOM   6300  C  CG    . PHE A  1  814  ? 61.290  -88.954  163.033 1.00 38.81  ? 814  PHE A CG    1 
ATOM   6301  C  CD1   . PHE A  1  814  ? 60.287  -88.065  162.686 1.00 39.29  ? 814  PHE A CD1   1 
ATOM   6302  C  CD2   . PHE A  1  814  ? 62.348  -89.133  162.153 1.00 38.28  ? 814  PHE A CD2   1 
ATOM   6303  C  CE1   . PHE A  1  814  ? 60.338  -87.361  161.481 1.00 38.58  ? 814  PHE A CE1   1 
ATOM   6304  C  CE2   . PHE A  1  814  ? 62.407  -88.434  160.948 1.00 38.50  ? 814  PHE A CE2   1 
ATOM   6305  C  CZ    . PHE A  1  814  ? 61.397  -87.546  160.615 1.00 38.54  ? 814  PHE A CZ    1 
ATOM   6306  N  N     . PHE A  1  815  ? 62.564  -92.627  163.976 1.00 44.94  ? 815  PHE A N     1 
ATOM   6307  C  CA    . PHE A  1  815  ? 63.505  -93.424  163.193 1.00 46.39  ? 815  PHE A CA    1 
ATOM   6308  C  C     . PHE A  1  815  ? 62.773  -94.610  162.598 1.00 46.96  ? 815  PHE A C     1 
ATOM   6309  O  O     . PHE A  1  815  ? 62.904  -94.891  161.401 1.00 47.57  ? 815  PHE A O     1 
ATOM   6310  C  CB    . PHE A  1  815  ? 64.688  -93.883  164.060 1.00 46.75  ? 815  PHE A CB    1 
ATOM   6311  C  CG    . PHE A  1  815  ? 65.603  -92.754  164.478 1.00 47.13  ? 815  PHE A CG    1 
ATOM   6312  C  CD1   . PHE A  1  815  ? 66.270  -92.794  165.695 1.00 46.92  ? 815  PHE A CD1   1 
ATOM   6313  C  CD2   . PHE A  1  815  ? 65.743  -91.618  163.673 1.00 46.24  ? 815  PHE A CD2   1 
ATOM   6314  C  CE1   . PHE A  1  815  ? 67.049  -91.715  166.108 1.00 47.74  ? 815  PHE A CE1   1 
ATOM   6315  C  CE2   . PHE A  1  815  ? 66.517  -90.543  164.079 1.00 45.28  ? 815  PHE A CE2   1 
ATOM   6316  C  CZ    . PHE A  1  815  ? 67.169  -90.586  165.296 1.00 46.73  ? 815  PHE A CZ    1 
ATOM   6317  N  N     . HIS A  1  816  ? 61.988  -95.290  163.431 1.00 46.61  ? 816  HIS A N     1 
ATOM   6318  C  CA    . HIS A  1  816  ? 61.218  -96.441  162.980 1.00 46.44  ? 816  HIS A CA    1 
ATOM   6319  C  C     . HIS A  1  816  ? 60.432  -96.016  161.753 1.00 46.22  ? 816  HIS A C     1 
ATOM   6320  O  O     . HIS A  1  816  ? 60.390  -96.722  160.750 1.00 45.29  ? 816  HIS A O     1 
ATOM   6321  C  CB    . HIS A  1  816  ? 60.246  -96.894  164.063 1.00 47.05  ? 816  HIS A CB    1 
ATOM   6322  C  CG    . HIS A  1  816  ? 59.643  -98.234  163.798 1.00 47.80  ? 816  HIS A CG    1 
ATOM   6323  N  ND1   . HIS A  1  816  ? 59.560  -98.771  162.531 1.00 47.75  ? 816  HIS A ND1   1 
ATOM   6324  C  CD2   . HIS A  1  816  ? 59.099  -99.149  164.632 1.00 48.07  ? 816  HIS A CD2   1 
ATOM   6325  C  CE1   . HIS A  1  816  ? 58.994  -99.962  162.597 1.00 48.08  ? 816  HIS A CE1   1 
ATOM   6326  N  NE2   . HIS A  1  816  ? 58.704  -100.216 163.861 1.00 48.94  ? 816  HIS A NE2   1 
ATOM   6327  N  N     . ALA A  1  817  ? 59.808  -94.848  161.851 1.00 46.49  ? 817  ALA A N     1 
ATOM   6328  C  CA    . ALA A  1  817  ? 59.035  -94.297  160.752 1.00 47.77  ? 817  ALA A CA    1 
ATOM   6329  C  C     . ALA A  1  817  ? 59.914  -94.290  159.512 1.00 48.75  ? 817  ALA A C     1 
ATOM   6330  O  O     . ALA A  1  817  ? 59.659  -95.008  158.548 1.00 49.77  ? 817  ALA A O     1 
ATOM   6331  C  CB    . ALA A  1  817  ? 58.607  -92.893  161.082 1.00 47.39  ? 817  ALA A CB    1 
ATOM   6332  N  N     . MET A  1  818  ? 60.951  -93.465  159.546 1.00 49.40  ? 818  MET A N     1 
ATOM   6333  C  CA    . MET A  1  818  ? 61.892  -93.366  158.444 1.00 49.66  ? 818  MET A CA    1 
ATOM   6334  C  C     . MET A  1  818  ? 62.142  -94.734  157.835 1.00 47.97  ? 818  MET A C     1 
ATOM   6335  O  O     . MET A  1  818  ? 62.157  -94.892  156.616 1.00 46.91  ? 818  MET A O     1 
ATOM   6336  C  CB    . MET A  1  818  ? 63.219  -92.813  158.948 1.00 52.16  ? 818  MET A CB    1 
ATOM   6337  C  CG    . MET A  1  818  ? 63.154  -91.402  159.463 1.00 53.72  ? 818  MET A CG    1 
ATOM   6338  S  SD    . MET A  1  818  ? 64.810  -90.849  159.786 1.00 57.80  ? 818  MET A SD    1 
ATOM   6339  C  CE    . MET A  1  818  ? 65.514  -90.892  158.061 1.00 54.84  ? 818  MET A CE    1 
ATOM   6340  N  N     . GLY A  1  819  ? 62.351  -95.715  158.703 1.00 46.97  ? 819  GLY A N     1 
ATOM   6341  C  CA    . GLY A  1  819  ? 62.608  -97.062  158.242 1.00 47.96  ? 819  GLY A CA    1 
ATOM   6342  C  C     . GLY A  1  819  ? 61.416  -97.642  157.515 1.00 48.39  ? 819  GLY A C     1 
ATOM   6343  O  O     . GLY A  1  819  ? 61.539  -98.153  156.396 1.00 47.59  ? 819  GLY A O     1 
ATOM   6344  N  N     . GLY A  1  820  ? 60.256  -97.562  158.161 1.00 48.57  ? 820  GLY A N     1 
ATOM   6345  C  CA    . GLY A  1  820  ? 59.039  -98.082  157.571 1.00 48.59  ? 820  GLY A CA    1 
ATOM   6346  C  C     . GLY A  1  820  ? 58.792  -97.449  156.220 1.00 48.79  ? 820  GLY A C     1 
ATOM   6347  O  O     . GLY A  1  820  ? 58.805  -98.125  155.190 1.00 48.48  ? 820  GLY A O     1 
ATOM   6348  N  N     . ARG A  1  821  ? 58.577  -96.140  156.229 1.00 48.93  ? 821  ARG A N     1 
ATOM   6349  C  CA    . ARG A  1  821  ? 58.324  -95.402  155.011 1.00 49.89  ? 821  ARG A CA    1 
ATOM   6350  C  C     . ARG A  1  821  ? 59.150  -95.895  153.827 1.00 52.04  ? 821  ARG A C     1 
ATOM   6351  O  O     . ARG A  1  821  ? 58.744  -95.703  152.687 1.00 53.21  ? 821  ARG A O     1 
ATOM   6352  C  CB    . ARG A  1  821  ? 58.586  -93.924  155.246 1.00 49.03  ? 821  ARG A CB    1 
ATOM   6353  C  CG    . ARG A  1  821  ? 58.644  -93.112  153.986 1.00 49.59  ? 821  ARG A CG    1 
ATOM   6354  C  CD    . ARG A  1  821  ? 57.272  -92.818  153.428 1.00 50.30  ? 821  ARG A CD    1 
ATOM   6355  N  NE    . ARG A  1  821  ? 57.078  -91.378  153.391 1.00 50.81  ? 821  ARG A NE    1 
ATOM   6356  C  CZ    . ARG A  1  821  ? 56.695  -90.671  154.442 1.00 51.64  ? 821  ARG A CZ    1 
ATOM   6357  N  NH1   . ARG A  1  821  ? 56.453  -91.296  155.589 1.00 52.07  ? 821  ARG A NH1   1 
ATOM   6358  N  NH2   . ARG A  1  821  ? 56.600  -89.348  154.361 1.00 51.80  ? 821  ARG A NH2   1 
ATOM   6359  N  N     . GLU A  1  822  ? 60.299  -96.528  154.078 1.00 54.04  ? 822  GLU A N     1 
ATOM   6360  C  CA    . GLU A  1  822  ? 61.133  -97.032  152.974 1.00 54.84  ? 822  GLU A CA    1 
ATOM   6361  C  C     . GLU A  1  822  ? 60.525  -98.315  152.421 1.00 53.12  ? 822  GLU A C     1 
ATOM   6362  O  O     . GLU A  1  822  ? 60.520  -98.544  151.211 1.00 52.79  ? 822  GLU A O     1 
ATOM   6363  C  CB    . GLU A  1  822  ? 62.569  -97.319  153.426 1.00 57.30  ? 822  GLU A CB    1 
ATOM   6364  C  CG    . GLU A  1  822  ? 63.590  -97.232  152.281 1.00 60.98  ? 822  GLU A CG    1 
ATOM   6365  C  CD    . GLU A  1  822  ? 64.797  -98.155  152.476 1.00 63.72  ? 822  GLU A CD    1 
ATOM   6366  O  OE1   . GLU A  1  822  ? 65.296  -98.276  153.623 1.00 64.54  ? 822  GLU A OE1   1 
ATOM   6367  O  OE2   . GLU A  1  822  ? 65.255  -98.755  151.474 1.00 64.24  ? 822  GLU A OE2   1 
ATOM   6368  N  N     . GLY A  1  823  ? 60.023  -99.155  153.317 1.00 51.16  ? 823  GLY A N     1 
ATOM   6369  C  CA    . GLY A  1  823  ? 59.398  -100.382 152.880 1.00 49.64  ? 823  GLY A CA    1 
ATOM   6370  C  C     . GLY A  1  823  ? 58.237  -100.002 151.989 1.00 48.71  ? 823  GLY A C     1 
ATOM   6371  O  O     . GLY A  1  823  ? 58.196  -100.354 150.808 1.00 48.30  ? 823  GLY A O     1 
ATOM   6372  N  N     . LEU A  1  824  ? 57.298  -99.251  152.553 1.00 48.03  ? 824  LEU A N     1 
ATOM   6373  C  CA    . LEU A  1  824  ? 56.135  -98.832  151.795 1.00 47.50  ? 824  LEU A CA    1 
ATOM   6374  C  C     . LEU A  1  824  ? 56.533  -98.348  150.421 1.00 47.47  ? 824  LEU A C     1 
ATOM   6375  O  O     . LEU A  1  824  ? 55.874  -98.665  149.438 1.00 47.09  ? 824  LEU A O     1 
ATOM   6376  C  CB    . LEU A  1  824  ? 55.361  -97.729  152.520 1.00 45.62  ? 824  LEU A CB    1 
ATOM   6377  C  CG    . LEU A  1  824  ? 54.679  -98.108  153.837 1.00 45.53  ? 824  LEU A CG    1 
ATOM   6378  C  CD1   . LEU A  1  824  ? 53.615  -97.076  154.117 1.00 44.73  ? 824  LEU A CD1   1 
ATOM   6379  C  CD2   . LEU A  1  824  ? 54.042  -99.491  153.770 1.00 46.12  ? 824  LEU A CD2   1 
ATOM   6380  N  N     . ILE A  1  825  ? 57.624  -97.600  150.333 1.00 48.34  ? 825  ILE A N     1 
ATOM   6381  C  CA    . ILE A  1  825  ? 58.021  -97.104  149.029 1.00 49.66  ? 825  ILE A CA    1 
ATOM   6382  C  C     . ILE A  1  825  ? 58.351  -98.202  148.052 1.00 51.22  ? 825  ILE A C     1 
ATOM   6383  O  O     . ILE A  1  825  ? 57.611  -98.414  147.095 1.00 51.64  ? 825  ILE A O     1 
ATOM   6384  C  CB    . ILE A  1  825  ? 59.210  -96.144  149.086 1.00 48.68  ? 825  ILE A CB    1 
ATOM   6385  C  CG1   . ILE A  1  825  ? 58.818  -94.888  149.868 1.00 48.46  ? 825  ILE A CG1   1 
ATOM   6386  C  CG2   . ILE A  1  825  ? 59.608  -95.746  147.662 1.00 46.94  ? 825  ILE A CG2   1 
ATOM   6387  C  CD1   . ILE A  1  825  ? 59.993  -94.045  150.349 1.00 48.30  ? 825  ILE A CD1   1 
ATOM   6388  N  N     . ASP A  1  826  ? 59.439  -98.923  148.259 1.00 53.03  ? 826  ASP A N     1 
ATOM   6389  C  CA    . ASP A  1  826  ? 59.715  -99.934  147.264 1.00 56.44  ? 826  ASP A CA    1 
ATOM   6390  C  C     . ASP A  1  826  ? 58.586  -100.966 147.169 1.00 56.77  ? 826  ASP A C     1 
ATOM   6391  O  O     . ASP A  1  826  ? 58.382  -101.560 146.109 1.00 58.24  ? 826  ASP A O     1 
ATOM   6392  C  CB    . ASP A  1  826  ? 61.106  -100.586 147.459 1.00 58.90  ? 826  ASP A CB    1 
ATOM   6393  C  CG    . ASP A  1  826  ? 61.163  -101.561 148.606 1.00 60.60  ? 826  ASP A CG    1 
ATOM   6394  O  OD1   . ASP A  1  826  ? 60.448  -102.586 148.569 1.00 61.75  ? 826  ASP A OD1   1 
ATOM   6395  O  OD2   . ASP A  1  826  ? 61.950  -101.303 149.541 1.00 62.25  ? 826  ASP A OD2   1 
ATOM   6396  N  N     . THR A  1  827  ? 57.815  -101.160 148.234 1.00 55.42  ? 827  THR A N     1 
ATOM   6397  C  CA    . THR A  1  827  ? 56.723  -102.124 148.132 1.00 54.76  ? 827  THR A CA    1 
ATOM   6398  C  C     . THR A  1  827  ? 55.813  -101.645 146.992 1.00 54.36  ? 827  THR A C     1 
ATOM   6399  O  O     . THR A  1  827  ? 55.213  -102.437 146.264 1.00 52.86  ? 827  THR A O     1 
ATOM   6400  C  CB    . THR A  1  827  ? 55.914  -102.211 149.450 1.00 54.68  ? 827  THR A CB    1 
ATOM   6401  O  OG1   . THR A  1  827  ? 55.393  -103.535 149.605 1.00 52.51  ? 827  THR A OG1   1 
ATOM   6402  C  CG2   . THR A  1  827  ? 54.743  -101.231 149.437 1.00 55.08  ? 827  THR A CG2   1 
ATOM   6403  N  N     . ALA A  1  828  ? 55.751  -100.328 146.836 1.00 54.92  ? 828  ALA A N     1 
ATOM   6404  C  CA    . ALA A  1  828  ? 54.931  -99.695  145.813 1.00 55.70  ? 828  ALA A CA    1 
ATOM   6405  C  C     . ALA A  1  828  ? 55.641  -99.609  144.466 1.00 55.78  ? 828  ALA A C     1 
ATOM   6406  O  O     . ALA A  1  828  ? 55.035  -99.283  143.447 1.00 56.68  ? 828  ALA A O     1 
ATOM   6407  C  CB    . ALA A  1  828  ? 54.528  -98.310  146.275 1.00 55.88  ? 828  ALA A CB    1 
ATOM   6408  N  N     . VAL A  1  829  ? 56.931  -99.889  144.461 1.00 55.37  ? 829  VAL A N     1 
ATOM   6409  C  CA    . VAL A  1  829  ? 57.673  -99.849  143.226 1.00 56.65  ? 829  VAL A CA    1 
ATOM   6410  C  C     . VAL A  1  829  ? 57.858  -101.297 142.814 1.00 58.17  ? 829  VAL A C     1 
ATOM   6411  O  O     . VAL A  1  829  ? 57.636  -101.658 141.658 1.00 58.83  ? 829  VAL A O     1 
ATOM   6412  C  CB    . VAL A  1  829  ? 59.023  -99.170  143.441 1.00 56.25  ? 829  VAL A CB    1 
ATOM   6413  C  CG1   . VAL A  1  829  ? 59.700  -98.903  142.107 1.00 56.64  ? 829  VAL A CG1   1 
ATOM   6414  C  CG2   . VAL A  1  829  ? 58.818  -97.882  144.221 1.00 55.85  ? 829  VAL A CG2   1 
ATOM   6415  N  N     . LYS A  1  830  ? 58.242  -102.120 143.788 1.00 59.87  ? 830  LYS A N     1 
ATOM   6416  C  CA    . LYS A  1  830  ? 58.465  -103.562 143.604 1.00 61.59  ? 830  LYS A CA    1 
ATOM   6417  C  C     . LYS A  1  830  ? 57.258  -104.157 142.881 1.00 61.12  ? 830  LYS A C     1 
ATOM   6418  O  O     . LYS A  1  830  ? 57.375  -105.147 142.157 1.00 61.90  ? 830  LYS A O     1 
ATOM   6419  C  CB    . LYS A  1  830  ? 58.608  -104.273 144.974 1.00 62.99  ? 830  LYS A CB    1 
ATOM   6420  C  CG    . LYS A  1  830  ? 59.896  -105.086 145.216 1.00 64.79  ? 830  LYS A CG    1 
ATOM   6421  C  CD    . LYS A  1  830  ? 61.114  -104.173 145.424 1.00 66.22  ? 830  LYS A CD    1 
ATOM   6422  C  CE    . LYS A  1  830  ? 62.367  -104.957 145.800 1.00 67.19  ? 830  LYS A CE    1 
ATOM   6423  N  NZ    . LYS A  1  830  ? 63.582  -104.089 145.769 1.00 67.54  ? 830  LYS A NZ    1 
ATOM   6424  N  N     . THR A  1  831  ? 56.099  -103.539 143.086 1.00 59.41  ? 831  THR A N     1 
ATOM   6425  C  CA    . THR A  1  831  ? 54.853  -104.004 142.499 1.00 56.68  ? 831  THR A CA    1 
ATOM   6426  C  C     . THR A  1  831  ? 54.677  -103.717 141.008 1.00 55.10  ? 831  THR A C     1 
ATOM   6427  O  O     . THR A  1  831  ? 54.339  -104.608 140.228 1.00 55.77  ? 831  THR A O     1 
ATOM   6428  C  CB    . THR A  1  831  ? 53.679  -103.409 143.255 1.00 56.07  ? 831  THR A CB    1 
ATOM   6429  O  OG1   . THR A  1  831  ? 52.468  -103.796 142.617 1.00 56.05  ? 831  THR A OG1   1 
ATOM   6430  C  CG2   . THR A  1  831  ? 53.771  -101.908 143.264 1.00 56.83  ? 831  THR A CG2   1 
ATOM   6431  N  N     . ALA A  1  832  ? 54.896  -102.480 140.600 1.00 52.63  ? 832  ALA A N     1 
ATOM   6432  C  CA    . ALA A  1  832  ? 54.736  -102.164 139.199 1.00 50.72  ? 832  ALA A CA    1 
ATOM   6433  C  C     . ALA A  1  832  ? 55.848  -102.794 138.398 1.00 49.09  ? 832  ALA A C     1 
ATOM   6434  O  O     . ALA A  1  832  ? 55.658  -103.150 137.248 1.00 48.75  ? 832  ALA A O     1 
ATOM   6435  C  CB    . ALA A  1  832  ? 54.743  -100.677 139.001 1.00 52.64  ? 832  ALA A CB    1 
ATOM   6436  N  N     . GLU A  1  833  ? 57.016  -102.930 139.004 1.00 48.32  ? 833  GLU A N     1 
ATOM   6437  C  CA    . GLU A  1  833  ? 58.150  -103.513 138.301 1.00 49.11  ? 833  GLU A CA    1 
ATOM   6438  C  C     . GLU A  1  833  ? 57.878  -105.005 138.183 1.00 46.62  ? 833  GLU A C     1 
ATOM   6439  O  O     . GLU A  1  833  ? 58.015  -105.602 137.112 1.00 47.01  ? 833  GLU A O     1 
ATOM   6440  C  CB    . GLU A  1  833  ? 59.443  -103.237 139.082 1.00 52.43  ? 833  GLU A CB    1 
ATOM   6441  C  CG    . GLU A  1  833  ? 60.733  -103.164 138.245 1.00 58.38  ? 833  GLU A CG    1 
ATOM   6442  C  CD    . GLU A  1  833  ? 61.836  -102.330 138.928 1.00 62.41  ? 833  GLU A CD    1 
ATOM   6443  O  OE1   . GLU A  1  833  ? 61.958  -102.398 140.178 1.00 65.93  ? 833  GLU A OE1   1 
ATOM   6444  O  OE2   . GLU A  1  833  ? 62.587  -101.613 138.223 1.00 62.99  ? 833  GLU A OE2   1 
ATOM   6445  N  N     . THR A  1  834  ? 57.476  -105.597 139.297 1.00 43.26  ? 834  THR A N     1 
ATOM   6446  C  CA    . THR A  1  834  ? 57.146  -107.009 139.331 1.00 40.12  ? 834  THR A CA    1 
ATOM   6447  C  C     . THR A  1  834  ? 56.129  -107.242 138.206 1.00 39.20  ? 834  THR A C     1 
ATOM   6448  O  O     . THR A  1  834  ? 56.334  -108.081 137.332 1.00 39.14  ? 834  THR A O     1 
ATOM   6449  C  CB    . THR A  1  834  ? 56.539  -107.388 140.729 1.00 39.18  ? 834  THR A CB    1 
ATOM   6450  O  OG1   . THR A  1  834  ? 57.416  -108.283 141.415 1.00 36.42  ? 834  THR A OG1   1 
ATOM   6451  C  CG2   . THR A  1  834  ? 55.171  -108.040 140.592 1.00 40.04  ? 834  THR A CG2   1 
ATOM   6452  N  N     . GLY A  1  835  ? 55.052  -106.464 138.220 1.00 36.91  ? 835  GLY A N     1 
ATOM   6453  C  CA    . GLY A  1  835  ? 54.016  -106.602 137.220 1.00 34.91  ? 835  GLY A CA    1 
ATOM   6454  C  C     . GLY A  1  835  ? 54.453  -106.630 135.766 1.00 34.45  ? 835  GLY A C     1 
ATOM   6455  O  O     . GLY A  1  835  ? 54.085  -107.541 135.034 1.00 34.44  ? 835  GLY A O     1 
ATOM   6456  N  N     . TYR A  1  836  ? 55.219  -105.631 135.338 1.00 34.08  ? 836  TYR A N     1 
ATOM   6457  C  CA    . TYR A  1  836  ? 55.690  -105.539 133.956 1.00 32.82  ? 836  TYR A CA    1 
ATOM   6458  C  C     . TYR A  1  836  ? 56.519  -106.746 133.563 1.00 33.09  ? 836  TYR A C     1 
ATOM   6459  O  O     . TYR A  1  836  ? 56.410  -107.234 132.441 1.00 33.63  ? 836  TYR A O     1 
ATOM   6460  C  CB    . TYR A  1  836  ? 56.520  -104.275 133.774 1.00 32.79  ? 836  TYR A CB    1 
ATOM   6461  C  CG    . TYR A  1  836  ? 56.973  -104.008 132.363 1.00 31.81  ? 836  TYR A CG    1 
ATOM   6462  C  CD1   . TYR A  1  836  ? 56.139  -104.248 131.281 1.00 32.93  ? 836  TYR A CD1   1 
ATOM   6463  C  CD2   . TYR A  1  836  ? 58.205  -103.427 132.117 1.00 32.03  ? 836  TYR A CD2   1 
ATOM   6464  C  CE1   . TYR A  1  836  ? 56.521  -103.904 129.980 1.00 32.65  ? 836  TYR A CE1   1 
ATOM   6465  C  CE2   . TYR A  1  836  ? 58.596  -103.078 130.828 1.00 32.19  ? 836  TYR A CE2   1 
ATOM   6466  C  CZ    . TYR A  1  836  ? 57.749  -103.316 129.767 1.00 32.33  ? 836  TYR A CZ    1 
ATOM   6467  O  OH    . TYR A  1  836  ? 58.130  -102.941 128.503 1.00 33.18  ? 836  TYR A OH    1 
ATOM   6468  N  N     . ILE A  1  837  ? 57.364  -107.215 134.478 1.00 31.77  ? 837  ILE A N     1 
ATOM   6469  C  CA    . ILE A  1  837  ? 58.187  -108.396 134.223 1.00 29.41  ? 837  ILE A CA    1 
ATOM   6470  C  C     . ILE A  1  837  ? 57.281  -109.586 133.914 1.00 28.71  ? 837  ILE A C     1 
ATOM   6471  O  O     . ILE A  1  837  ? 57.470  -110.323 132.942 1.00 27.03  ? 837  ILE A O     1 
ATOM   6472  C  CB    . ILE A  1  837  ? 59.020  -108.750 135.457 1.00 28.37  ? 837  ILE A CB    1 
ATOM   6473  C  CG1   . ILE A  1  837  ? 60.125  -107.724 135.646 1.00 29.36  ? 837  ILE A CG1   1 
ATOM   6474  C  CG2   . ILE A  1  837  ? 59.608  -110.127 135.308 1.00 26.94  ? 837  ILE A CG2   1 
ATOM   6475  C  CD1   . ILE A  1  837  ? 61.051  -108.067 136.770 1.00 29.83  ? 837  ILE A CD1   1 
ATOM   6476  N  N     . GLN A  1  838  ? 56.285  -109.749 134.773 1.00 28.75  ? 838  GLN A N     1 
ATOM   6477  C  CA    . GLN A  1  838  ? 55.325  -110.829 134.672 1.00 28.70  ? 838  GLN A CA    1 
ATOM   6478  C  C     . GLN A  1  838  ? 54.670  -110.847 133.289 1.00 26.15  ? 838  GLN A C     1 
ATOM   6479  O  O     . GLN A  1  838  ? 54.496  -111.900 132.689 1.00 25.56  ? 838  GLN A O     1 
ATOM   6480  C  CB    . GLN A  1  838  ? 54.299  -110.676 135.806 1.00 30.97  ? 838  GLN A CB    1 
ATOM   6481  C  CG    . GLN A  1  838  ? 53.840  -111.982 136.424 1.00 35.92  ? 838  GLN A CG    1 
ATOM   6482  C  CD    . GLN A  1  838  ? 52.612  -112.557 135.717 1.00 41.19  ? 838  GLN A CD    1 
ATOM   6483  O  OE1   . GLN A  1  838  ? 52.446  -112.410 134.494 1.00 43.65  ? 838  GLN A OE1   1 
ATOM   6484  N  NE2   . GLN A  1  838  ? 51.746  -113.222 136.483 1.00 41.99  ? 838  GLN A NE2   1 
ATOM   6485  N  N     . ARG A  1  839  ? 54.333  -109.678 132.771 1.00 25.01  ? 839  ARG A N     1 
ATOM   6486  C  CA    . ARG A  1  839  ? 53.710  -109.592 131.457 1.00 23.76  ? 839  ARG A CA    1 
ATOM   6487  C  C     . ARG A  1  839  ? 54.689  -109.997 130.370 1.00 22.81  ? 839  ARG A C     1 
ATOM   6488  O  O     . ARG A  1  839  ? 54.415  -110.874 129.556 1.00 21.06  ? 839  ARG A O     1 
ATOM   6489  C  CB    . ARG A  1  839  ? 53.233  -108.164 131.185 1.00 22.99  ? 839  ARG A CB    1 
ATOM   6490  C  CG    . ARG A  1  839  ? 52.801  -107.965 129.776 1.00 21.17  ? 839  ARG A CG    1 
ATOM   6491  C  CD    . ARG A  1  839  ? 52.039  -106.694 129.594 1.00 23.10  ? 839  ARG A CD    1 
ATOM   6492  N  NE    . ARG A  1  839  ? 51.218  -106.821 128.395 1.00 27.57  ? 839  ARG A NE    1 
ATOM   6493  C  CZ    . ARG A  1  839  ? 51.544  -106.343 127.195 1.00 29.56  ? 839  ARG A CZ    1 
ATOM   6494  N  NH1   . ARG A  1  839  ? 52.686  -105.676 127.020 1.00 29.52  ? 839  ARG A NH1   1 
ATOM   6495  N  NH2   . ARG A  1  839  ? 50.733  -106.563 126.160 1.00 29.06  ? 839  ARG A NH2   1 
ATOM   6496  N  N     . ARG A  1  840  ? 55.838  -109.337 130.370 1.00 23.61  ? 840  ARG A N     1 
ATOM   6497  C  CA    . ARG A  1  840  ? 56.872  -109.591 129.385 1.00 24.60  ? 840  ARG A CA    1 
ATOM   6498  C  C     . ARG A  1  840  ? 57.175  -111.084 129.325 1.00 24.58  ? 840  ARG A C     1 
ATOM   6499  O  O     . ARG A  1  840  ? 57.366  -111.639 128.238 1.00 26.50  ? 840  ARG A O     1 
ATOM   6500  C  CB    . ARG A  1  840  ? 58.131  -108.796 129.737 1.00 24.90  ? 840  ARG A CB    1 
ATOM   6501  C  CG    . ARG A  1  840  ? 57.974  -107.277 129.659 1.00 25.42  ? 840  ARG A CG    1 
ATOM   6502  C  CD    . ARG A  1  840  ? 58.759  -106.592 130.788 1.00 26.15  ? 840  ARG A CD    1 
ATOM   6503  N  NE    . ARG A  1  840  ? 60.200  -106.849 130.732 1.00 27.67  ? 840  ARG A NE    1 
ATOM   6504  C  CZ    . ARG A  1  840  ? 61.041  -106.697 131.761 1.00 29.33  ? 840  ARG A CZ    1 
ATOM   6505  N  NH1   . ARG A  1  840  ? 60.605  -106.285 132.954 1.00 29.43  ? 840  ARG A NH1   1 
ATOM   6506  N  NH2   . ARG A  1  840  ? 62.331  -106.961 131.601 1.00 28.99  ? 840  ARG A NH2   1 
ATOM   6507  N  N     . LEU A  1  841  ? 57.217  -111.734 130.485 1.00 22.19  ? 841  LEU A N     1 
ATOM   6508  C  CA    . LEU A  1  841  ? 57.475  -113.166 130.522 1.00 20.18  ? 841  LEU A CA    1 
ATOM   6509  C  C     . LEU A  1  841  ? 56.395  -113.896 129.732 1.00 20.36  ? 841  LEU A C     1 
ATOM   6510  O  O     . LEU A  1  841  ? 56.667  -114.644 128.796 1.00 21.19  ? 841  LEU A O     1 
ATOM   6511  C  CB    . LEU A  1  841  ? 57.466  -113.667 131.961 1.00 17.72  ? 841  LEU A CB    1 
ATOM   6512  C  CG    . LEU A  1  841  ? 58.809  -113.599 132.668 1.00 16.45  ? 841  LEU A CG    1 
ATOM   6513  C  CD1   . LEU A  1  841  ? 58.727  -114.259 134.018 1.00 15.14  ? 841  LEU A CD1   1 
ATOM   6514  C  CD2   . LEU A  1  841  ? 59.829  -114.337 131.820 1.00 18.21  ? 841  LEU A CD2   1 
ATOM   6515  N  N     . VAL A  1  842  ? 55.153  -113.660 130.112 1.00 19.81  ? 842  VAL A N     1 
ATOM   6516  C  CA    . VAL A  1  842  ? 54.046  -114.306 129.454 1.00 20.00  ? 842  VAL A CA    1 
ATOM   6517  C  C     . VAL A  1  842  ? 53.968  -113.989 127.974 1.00 21.68  ? 842  VAL A C     1 
ATOM   6518  O  O     . VAL A  1  842  ? 53.665  -114.845 127.145 1.00 23.00  ? 842  VAL A O     1 
ATOM   6519  C  CB    . VAL A  1  842  ? 52.748  -113.892 130.096 1.00 18.78  ? 842  VAL A CB    1 
ATOM   6520  C  CG1   . VAL A  1  842  ? 51.612  -114.653 129.483 1.00 18.03  ? 842  VAL A CG1   1 
ATOM   6521  C  CG2   . VAL A  1  842  ? 52.827  -114.128 131.581 1.00 20.36  ? 842  VAL A CG2   1 
ATOM   6522  N  N     . LYS A  1  843  ? 54.224  -112.752 127.615 1.00 22.71  ? 843  LYS A N     1 
ATOM   6523  C  CA    . LYS A  1  843  ? 54.128  -112.445 126.213 1.00 23.59  ? 843  LYS A CA    1 
ATOM   6524  C  C     . LYS A  1  843  ? 55.236  -113.117 125.423 1.00 23.70  ? 843  LYS A C     1 
ATOM   6525  O  O     . LYS A  1  843  ? 55.136  -113.275 124.208 1.00 25.04  ? 843  LYS A O     1 
ATOM   6526  C  CB    . LYS A  1  843  ? 54.142  -110.932 126.011 1.00 23.91  ? 843  LYS A CB    1 
ATOM   6527  C  CG    . LYS A  1  843  ? 52.746  -110.343 125.987 1.00 24.67  ? 843  LYS A CG    1 
ATOM   6528  C  CD    . LYS A  1  843  ? 51.954  -110.905 124.816 1.00 24.49  ? 843  LYS A CD    1 
ATOM   6529  C  CE    . LYS A  1  843  ? 50.521  -110.431 124.842 1.00 26.55  ? 843  LYS A CE    1 
ATOM   6530  N  NZ    . LYS A  1  843  ? 49.823  -110.973 123.655 1.00 28.34  ? 843  LYS A NZ    1 
ATOM   6531  N  N     . ALA A  1  844  ? 56.280  -113.549 126.110 1.00 21.74  ? 844  ALA A N     1 
ATOM   6532  C  CA    . ALA A  1  844  ? 57.382  -114.165 125.410 1.00 22.05  ? 844  ALA A CA    1 
ATOM   6533  C  C     . ALA A  1  844  ? 57.327  -115.690 125.379 1.00 23.95  ? 844  ALA A C     1 
ATOM   6534  O  O     . ALA A  1  844  ? 58.222  -116.337 124.833 1.00 26.07  ? 844  ALA A O     1 
ATOM   6535  C  CB    . ALA A  1  844  ? 58.667  -113.699 126.015 1.00 20.15  ? 844  ALA A CB    1 
ATOM   6536  N  N     . LEU A  1  845  ? 56.277  -116.272 125.945 1.00 24.25  ? 845  LEU A N     1 
ATOM   6537  C  CA    . LEU A  1  845  ? 56.159  -117.724 125.954 1.00 23.79  ? 845  LEU A CA    1 
ATOM   6538  C  C     . LEU A  1  845  ? 54.749  -118.188 125.590 1.00 25.14  ? 845  LEU A C     1 
ATOM   6539  O  O     . LEU A  1  845  ? 54.520  -119.388 125.449 1.00 26.87  ? 845  LEU A O     1 
ATOM   6540  C  CB    . LEU A  1  845  ? 56.540  -118.260 127.335 1.00 20.83  ? 845  LEU A CB    1 
ATOM   6541  C  CG    . LEU A  1  845  ? 57.853  -117.714 127.904 1.00 19.85  ? 845  LEU A CG    1 
ATOM   6542  C  CD1   . LEU A  1  845  ? 57.926  -117.967 129.388 1.00 20.64  ? 845  LEU A CD1   1 
ATOM   6543  C  CD2   . LEU A  1  845  ? 59.012  -118.351 127.215 1.00 18.60  ? 845  LEU A CD2   1 
ATOM   6544  N  N     . GLU A  1  846  ? 53.821  -117.241 125.431 1.00 25.68  ? 846  GLU A N     1 
ATOM   6545  C  CA    . GLU A  1  846  ? 52.428  -117.541 125.106 1.00 27.15  ? 846  GLU A CA    1 
ATOM   6546  C  C     . GLU A  1  846  ? 52.297  -118.868 124.389 1.00 28.20  ? 846  GLU A C     1 
ATOM   6547  O  O     . GLU A  1  846  ? 51.849  -119.869 124.950 1.00 29.91  ? 846  GLU A O     1 
ATOM   6548  C  CB    . GLU A  1  846  ? 51.815  -116.499 124.161 1.00 30.39  ? 846  GLU A CB    1 
ATOM   6549  C  CG    . GLU A  1  846  ? 51.890  -115.011 124.531 1.00 33.25  ? 846  GLU A CG    1 
ATOM   6550  C  CD    . GLU A  1  846  ? 51.045  -114.141 123.561 1.00 36.11  ? 846  GLU A CD    1 
ATOM   6551  O  OE1   . GLU A  1  846  ? 49.795  -114.109 123.693 1.00 36.93  ? 846  GLU A OE1   1 
ATOM   6552  O  OE2   . GLU A  1  846  ? 51.624  -113.505 122.651 1.00 35.90  ? 846  GLU A OE2   1 
ATOM   6553  N  N     . ASP A  1  847  ? 52.714  -118.824 123.128 1.00 28.02  ? 847  ASP A N     1 
ATOM   6554  C  CA    . ASP A  1  847  ? 52.670  -119.906 122.149 1.00 29.02  ? 847  ASP A CA    1 
ATOM   6555  C  C     . ASP A  1  847  ? 53.554  -121.154 122.311 1.00 29.37  ? 847  ASP A C     1 
ATOM   6556  O  O     . ASP A  1  847  ? 53.695  -121.938 121.365 1.00 28.95  ? 847  ASP A O     1 
ATOM   6557  C  CB    . ASP A  1  847  ? 52.974  -119.295 120.808 1.00 29.62  ? 847  ASP A CB    1 
ATOM   6558  C  CG    . ASP A  1  847  ? 54.369  -118.711 120.774 1.00 33.46  ? 847  ASP A CG    1 
ATOM   6559  O  OD1   . ASP A  1  847  ? 54.833  -118.249 121.843 1.00 33.95  ? 847  ASP A OD1   1 
ATOM   6560  O  OD2   . ASP A  1  847  ? 55.009  -118.710 119.699 1.00 35.85  ? 847  ASP A OD2   1 
ATOM   6561  N  N     . ILE A  1  848  ? 54.158  -121.359 123.472 1.00 29.20  ? 848  ILE A N     1 
ATOM   6562  C  CA    . ILE A  1  848  ? 54.972  -122.550 123.633 1.00 28.71  ? 848  ILE A CA    1 
ATOM   6563  C  C     . ILE A  1  848  ? 54.140  -123.620 124.313 1.00 28.77  ? 848  ILE A C     1 
ATOM   6564  O  O     . ILE A  1  848  ? 53.653  -123.387 125.415 1.00 30.62  ? 848  ILE A O     1 
ATOM   6565  C  CB    . ILE A  1  848  ? 56.211  -122.257 124.466 1.00 28.15  ? 848  ILE A CB    1 
ATOM   6566  C  CG1   . ILE A  1  848  ? 57.142  -121.373 123.658 1.00 28.93  ? 848  ILE A CG1   1 
ATOM   6567  C  CG2   . ILE A  1  848  ? 56.926  -123.537 124.825 1.00 26.68  ? 848  ILE A CG2   1 
ATOM   6568  C  CD1   . ILE A  1  848  ? 58.374  -120.997 124.401 1.00 31.57  ? 848  ILE A CD1   1 
ATOM   6569  N  N     . MET A  1  849  ? 53.954  -124.765 123.644 1.00 27.51  ? 849  MET A N     1 
ATOM   6570  C  CA    . MET A  1  849  ? 53.180  -125.898 124.186 1.00 27.00  ? 849  MET A CA    1 
ATOM   6571  C  C     . MET A  1  849  ? 53.722  -127.246 123.719 1.00 26.76  ? 849  MET A C     1 
ATOM   6572  O  O     . MET A  1  849  ? 54.242  -127.379 122.620 1.00 29.60  ? 849  MET A O     1 
ATOM   6573  C  CB    . MET A  1  849  ? 51.699  -125.839 123.771 1.00 25.81  ? 849  MET A CB    1 
ATOM   6574  C  CG    . MET A  1  849  ? 51.404  -126.554 122.459 1.00 24.92  ? 849  MET A CG    1 
ATOM   6575  S  SD    . MET A  1  849  ? 49.686  -126.546 121.944 1.00 25.45  ? 849  MET A SD    1 
ATOM   6576  C  CE    . MET A  1  849  ? 49.508  -128.191 121.539 1.00 22.84  ? 849  MET A CE    1 
ATOM   6577  N  N     . VAL A  1  850  ? 53.571  -128.257 124.551 1.00 24.87  ? 850  VAL A N     1 
ATOM   6578  C  CA    . VAL A  1  850  ? 54.024  -129.583 124.204 1.00 22.49  ? 850  VAL A CA    1 
ATOM   6579  C  C     . VAL A  1  850  ? 53.229  -130.153 123.045 1.00 22.47  ? 850  VAL A C     1 
ATOM   6580  O  O     . VAL A  1  850  ? 52.038  -130.344 123.177 1.00 23.36  ? 850  VAL A O     1 
ATOM   6581  C  CB    . VAL A  1  850  ? 53.840  -130.485 125.380 1.00 21.91  ? 850  VAL A CB    1 
ATOM   6582  C  CG1   . VAL A  1  850  ? 53.751  -131.924 124.920 1.00 22.06  ? 850  VAL A CG1   1 
ATOM   6583  C  CG2   . VAL A  1  850  ? 54.965  -130.257 126.353 1.00 21.72  ? 850  VAL A CG2   1 
ATOM   6584  N  N     . HIS A  1  851  ? 53.874  -130.444 121.922 1.00 22.86  ? 851  HIS A N     1 
ATOM   6585  C  CA    . HIS A  1  851  ? 53.157  -131.012 120.776 1.00 25.27  ? 851  HIS A CA    1 
ATOM   6586  C  C     . HIS A  1  851  ? 52.954  -132.524 120.845 1.00 25.90  ? 851  HIS A C     1 
ATOM   6587  O  O     . HIS A  1  851  ? 53.581  -133.205 121.654 1.00 24.97  ? 851  HIS A O     1 
ATOM   6588  C  CB    . HIS A  1  851  ? 53.837  -130.627 119.464 1.00 25.41  ? 851  HIS A CB    1 
ATOM   6589  C  CG    . HIS A  1  851  ? 53.628  -129.197 119.108 1.00 26.61  ? 851  HIS A CG    1 
ATOM   6590  N  ND1   . HIS A  1  851  ? 52.514  -128.763 118.428 1.00 27.79  ? 851  HIS A ND1   1 
ATOM   6591  C  CD2   . HIS A  1  851  ? 54.320  -128.084 119.447 1.00 27.66  ? 851  HIS A CD2   1 
ATOM   6592  C  CE1   . HIS A  1  851  ? 52.527  -127.443 118.365 1.00 28.98  ? 851  HIS A CE1   1 
ATOM   6593  N  NE2   . HIS A  1  851  ? 53.612  -127.005 118.978 1.00 28.41  ? 851  HIS A NE2   1 
ATOM   6594  N  N     . TYR A  1  852  ? 52.077  -133.042 119.984 1.00 27.05  ? 852  TYR A N     1 
ATOM   6595  C  CA    . TYR A  1  852  ? 51.758  -134.458 120.010 1.00 27.84  ? 852  TYR A CA    1 
ATOM   6596  C  C     . TYR A  1  852  ? 52.912  -135.419 119.825 1.00 29.96  ? 852  TYR A C     1 
ATOM   6597  O  O     . TYR A  1  852  ? 52.713  -136.630 119.924 1.00 31.96  ? 852  TYR A O     1 
ATOM   6598  C  CB    . TYR A  1  852  ? 50.645  -134.770 119.012 1.00 26.26  ? 852  TYR A CB    1 
ATOM   6599  C  CG    . TYR A  1  852  ? 49.278  -134.697 119.648 1.00 25.50  ? 852  TYR A CG    1 
ATOM   6600  C  CD1   . TYR A  1  852  ? 48.236  -134.005 119.038 1.00 25.47  ? 852  TYR A CD1   1 
ATOM   6601  C  CD2   . TYR A  1  852  ? 49.051  -135.248 120.910 1.00 24.95  ? 852  TYR A CD2   1 
ATOM   6602  C  CE1   . TYR A  1  852  ? 47.009  -133.848 119.675 1.00 25.89  ? 852  TYR A CE1   1 
ATOM   6603  C  CE2   . TYR A  1  852  ? 47.833  -135.100 121.556 1.00 24.61  ? 852  TYR A CE2   1 
ATOM   6604  C  CZ    . TYR A  1  852  ? 46.822  -134.392 120.936 1.00 26.34  ? 852  TYR A CZ    1 
ATOM   6605  O  OH    . TYR A  1  852  ? 45.647  -134.168 121.604 1.00 27.28  ? 852  TYR A OH    1 
ATOM   6606  N  N     . ASP A  1  853  ? 54.112  -134.894 119.581 1.00 30.44  ? 853  ASP A N     1 
ATOM   6607  C  CA    . ASP A  1  853  ? 55.290  -135.734 119.400 1.00 30.37  ? 853  ASP A CA    1 
ATOM   6608  C  C     . ASP A  1  853  ? 56.236  -135.617 120.600 1.00 31.03  ? 853  ASP A C     1 
ATOM   6609  O  O     . ASP A  1  853  ? 57.376  -136.075 120.573 1.00 29.97  ? 853  ASP A O     1 
ATOM   6610  C  CB    . ASP A  1  853  ? 56.013  -135.352 118.110 1.00 31.51  ? 853  ASP A CB    1 
ATOM   6611  C  CG    . ASP A  1  853  ? 56.551  -133.942 118.147 1.00 33.74  ? 853  ASP A CG    1 
ATOM   6612  O  OD1   . ASP A  1  853  ? 56.717  -133.429 119.271 1.00 35.54  ? 853  ASP A OD1   1 
ATOM   6613  O  OD2   . ASP A  1  853  ? 56.825  -133.352 117.072 1.00 33.62  ? 853  ASP A OD2   1 
ATOM   6614  N  N     . ASN A  1  854  ? 55.738  -134.991 121.656 1.00 32.96  ? 854  ASN A N     1 
ATOM   6615  C  CA    . ASN A  1  854  ? 56.486  -134.804 122.892 1.00 34.53  ? 854  ASN A CA    1 
ATOM   6616  C  C     . ASN A  1  854  ? 57.581  -133.762 122.814 1.00 34.36  ? 854  ASN A C     1 
ATOM   6617  O  O     . ASN A  1  854  ? 58.452  -133.676 123.678 1.00 36.54  ? 854  ASN A O     1 
ATOM   6618  C  CB    . ASN A  1  854  ? 57.045  -136.137 123.358 1.00 37.50  ? 854  ASN A CB    1 
ATOM   6619  C  CG    . ASN A  1  854  ? 56.219  -136.731 124.475 1.00 42.34  ? 854  ASN A CG    1 
ATOM   6620  O  OD1   . ASN A  1  854  ? 56.370  -136.342 125.639 1.00 45.53  ? 854  ASN A OD1   1 
ATOM   6621  N  ND2   . ASN A  1  854  ? 55.313  -137.653 124.133 1.00 44.05  ? 854  ASN A ND2   1 
ATOM   6622  N  N     . THR A  1  855  ? 57.491  -132.941 121.781 1.00 31.87  ? 855  THR A N     1 
ATOM   6623  C  CA    . THR A  1  855  ? 58.438  -131.880 121.526 1.00 28.70  ? 855  THR A CA    1 
ATOM   6624  C  C     . THR A  1  855  ? 57.837  -130.586 122.078 1.00 27.42  ? 855  THR A C     1 
ATOM   6625  O  O     . THR A  1  855  ? 56.627  -130.459 122.126 1.00 29.41  ? 855  THR A O     1 
ATOM   6626  C  CB    . THR A  1  855  ? 58.657  -131.798 119.994 1.00 28.63  ? 855  THR A CB    1 
ATOM   6627  O  OG1   . THR A  1  855  ? 60.038  -131.575 119.732 1.00 32.07  ? 855  THR A OG1   1 
ATOM   6628  C  CG2   . THR A  1  855  ? 57.808  -130.703 119.345 1.00 26.28  ? 855  THR A CG2   1 
ATOM   6629  N  N     . THR A  1  856  ? 58.656  -129.640 122.522 1.00 25.28  ? 856  THR A N     1 
ATOM   6630  C  CA    . THR A  1  856  ? 58.136  -128.356 123.024 1.00 23.49  ? 856  THR A CA    1 
ATOM   6631  C  C     . THR A  1  856  ? 58.438  -127.285 121.981 1.00 22.45  ? 856  THR A C     1 
ATOM   6632  O  O     . THR A  1  856  ? 59.587  -126.940 121.752 1.00 21.10  ? 856  THR A O     1 
ATOM   6633  C  CB    . THR A  1  856  ? 58.797  -127.933 124.366 1.00 23.50  ? 856  THR A CB    1 
ATOM   6634  O  OG1   . THR A  1  856  ? 58.298  -128.737 125.441 1.00 22.68  ? 856  THR A OG1   1 
ATOM   6635  C  CG2   . THR A  1  856  ? 58.497  -126.490 124.670 1.00 24.48  ? 856  THR A CG2   1 
ATOM   6636  N  N     . ARG A  1  857  ? 57.421  -126.745 121.339 1.00 23.96  ? 857  ARG A N     1 
ATOM   6637  C  CA    . ARG A  1  857  ? 57.697  -125.751 120.314 1.00 27.65  ? 857  ARG A CA    1 
ATOM   6638  C  C     . ARG A  1  857  ? 56.888  -124.484 120.479 1.00 30.08  ? 857  ARG A C     1 
ATOM   6639  O  O     . ARG A  1  857  ? 56.051  -124.373 121.375 1.00 32.92  ? 857  ARG A O     1 
ATOM   6640  C  CB    . ARG A  1  857  ? 57.428  -126.321 118.920 1.00 26.33  ? 857  ARG A CB    1 
ATOM   6641  C  CG    . ARG A  1  857  ? 58.008  -127.702 118.669 1.00 26.18  ? 857  ARG A CG    1 
ATOM   6642  C  CD    . ARG A  1  857  ? 57.878  -128.054 117.215 1.00 26.13  ? 857  ARG A CD    1 
ATOM   6643  N  NE    . ARG A  1  857  ? 58.151  -129.453 116.934 1.00 26.52  ? 857  ARG A NE    1 
ATOM   6644  C  CZ    . ARG A  1  857  ? 58.312  -129.945 115.705 1.00 28.32  ? 857  ARG A CZ    1 
ATOM   6645  N  NH1   . ARG A  1  857  ? 58.237  -129.156 114.634 1.00 24.38  ? 857  ARG A NH1   1 
ATOM   6646  N  NH2   . ARG A  1  857  ? 58.524  -131.244 115.540 1.00 29.93  ? 857  ARG A NH2   1 
ATOM   6647  N  N     . ASN A  1  858  ? 57.147  -123.522 119.600 1.00 31.30  ? 858  ASN A N     1 
ATOM   6648  C  CA    . ASN A  1  858  ? 56.436  -122.259 119.630 1.00 31.41  ? 858  ASN A CA    1 
ATOM   6649  C  C     . ASN A  1  858  ? 55.520  -122.226 118.417 1.00 31.76  ? 858  ASN A C     1 
ATOM   6650  O  O     . ASN A  1  858  ? 55.336  -123.242 117.754 1.00 32.93  ? 858  ASN A O     1 
ATOM   6651  C  CB    . ASN A  1  858  ? 57.421  -121.109 119.581 1.00 30.08  ? 858  ASN A CB    1 
ATOM   6652  C  CG    . ASN A  1  858  ? 58.219  -121.101 118.323 1.00 29.55  ? 858  ASN A CG    1 
ATOM   6653  O  OD1   . ASN A  1  858  ? 59.183  -120.368 118.214 1.00 31.02  ? 858  ASN A OD1   1 
ATOM   6654  N  ND2   . ASN A  1  858  ? 57.822  -121.913 117.354 1.00 28.75  ? 858  ASN A ND2   1 
ATOM   6655  N  N     . SER A  1  859  ? 54.969  -121.061 118.107 1.00 31.39  ? 859  SER A N     1 
ATOM   6656  C  CA    . SER A  1  859  ? 54.047  -120.954 116.986 1.00 32.00  ? 859  SER A CA    1 
ATOM   6657  C  C     . SER A  1  859  ? 54.713  -120.991 115.608 1.00 31.23  ? 859  SER A C     1 
ATOM   6658  O  O     . SER A  1  859  ? 54.062  -120.782 114.581 1.00 32.01  ? 859  SER A O     1 
ATOM   6659  C  CB    . SER A  1  859  ? 53.204  -119.685 117.143 1.00 32.16  ? 859  SER A CB    1 
ATOM   6660  O  OG    . SER A  1  859  ? 54.040  -118.561 117.353 1.00 32.49  ? 859  SER A OG    1 
ATOM   6661  N  N     . LEU A  1  860  ? 56.009  -121.257 115.584 1.00 29.54  ? 860  LEU A N     1 
ATOM   6662  C  CA    . LEU A  1  860  ? 56.725  -121.314 114.320 1.00 28.61  ? 860  LEU A CA    1 
ATOM   6663  C  C     . LEU A  1  860  ? 57.119  -122.747 114.021 1.00 29.52  ? 860  LEU A C     1 
ATOM   6664  O  O     . LEU A  1  860  ? 57.521  -123.088 112.895 1.00 30.59  ? 860  LEU A O     1 
ATOM   6665  C  CB    . LEU A  1  860  ? 57.973  -120.435 114.377 1.00 25.05  ? 860  LEU A CB    1 
ATOM   6666  C  CG    . LEU A  1  860  ? 57.762  -118.988 113.961 1.00 23.22  ? 860  LEU A CG    1 
ATOM   6667  C  CD1   . LEU A  1  860  ? 59.106  -118.276 113.960 1.00 21.79  ? 860  LEU A CD1   1 
ATOM   6668  C  CD2   . LEU A  1  860  ? 57.097  -118.943 112.573 1.00 21.41  ? 860  LEU A CD2   1 
ATOM   6669  N  N     . GLY A  1  861  ? 56.999  -123.579 115.048 1.00 28.67  ? 861  GLY A N     1 
ATOM   6670  C  CA    . GLY A  1  861  ? 57.349  -124.971 114.911 1.00 26.60  ? 861  GLY A CA    1 
ATOM   6671  C  C     . GLY A  1  861  ? 58.778  -125.172 115.325 1.00 24.61  ? 861  GLY A C     1 
ATOM   6672  O  O     . GLY A  1  861  ? 59.270  -126.281 115.323 1.00 25.33  ? 861  GLY A O     1 
ATOM   6673  N  N     . ASN A  1  862  ? 59.451  -124.094 115.681 1.00 24.57  ? 862  ASN A N     1 
ATOM   6674  C  CA    . ASN A  1  862  ? 60.839  -124.191 116.100 1.00 27.03  ? 862  ASN A CA    1 
ATOM   6675  C  C     . ASN A  1  862  ? 60.963  -124.942 117.420 1.00 27.80  ? 862  ASN A C     1 
ATOM   6676  O  O     . ASN A  1  862  ? 60.264  -124.628 118.388 1.00 27.74  ? 862  ASN A O     1 
ATOM   6677  C  CB    . ASN A  1  862  ? 61.423  -122.794 116.246 1.00 29.65  ? 862  ASN A CB    1 
ATOM   6678  C  CG    . ASN A  1  862  ? 61.465  -122.057 114.935 1.00 33.42  ? 862  ASN A CG    1 
ATOM   6679  O  OD1   . ASN A  1  862  ? 60.532  -122.145 114.131 1.00 36.24  ? 862  ASN A OD1   1 
ATOM   6680  N  ND2   . ASN A  1  862  ? 62.544  -121.320 114.704 1.00 35.98  ? 862  ASN A ND2   1 
ATOM   6681  N  N     . VAL A  1  863  ? 61.848  -125.935 117.467 1.00 27.16  ? 863  VAL A N     1 
ATOM   6682  C  CA    . VAL A  1  863  ? 62.021  -126.696 118.698 1.00 27.44  ? 863  VAL A CA    1 
ATOM   6683  C  C     . VAL A  1  863  ? 62.616  -125.789 119.763 1.00 28.91  ? 863  VAL A C     1 
ATOM   6684  O  O     . VAL A  1  863  ? 63.411  -124.905 119.456 1.00 30.56  ? 863  VAL A O     1 
ATOM   6685  C  CB    . VAL A  1  863  ? 62.935  -127.923 118.487 1.00 25.42  ? 863  VAL A CB    1 
ATOM   6686  C  CG1   . VAL A  1  863  ? 63.137  -128.678 119.812 1.00 21.87  ? 863  VAL A CG1   1 
ATOM   6687  C  CG2   . VAL A  1  863  ? 62.309  -128.840 117.454 1.00 24.33  ? 863  VAL A CG2   1 
ATOM   6688  N  N     . ILE A  1  864  ? 62.221  -125.995 121.013 1.00 28.51  ? 864  ILE A N     1 
ATOM   6689  C  CA    . ILE A  1  864  ? 62.738  -125.185 122.097 1.00 28.48  ? 864  ILE A CA    1 
ATOM   6690  C  C     . ILE A  1  864  ? 63.288  -126.103 123.160 1.00 30.61  ? 864  ILE A C     1 
ATOM   6691  O  O     . ILE A  1  864  ? 64.282  -125.804 123.802 1.00 32.42  ? 864  ILE A O     1 
ATOM   6692  C  CB    . ILE A  1  864  ? 61.644  -124.321 122.641 1.00 27.79  ? 864  ILE A CB    1 
ATOM   6693  C  CG1   . ILE A  1  864  ? 61.194  -123.400 121.528 1.00 29.38  ? 864  ILE A CG1   1 
ATOM   6694  C  CG2   . ILE A  1  864  ? 62.114  -123.533 123.830 1.00 26.13  ? 864  ILE A CG2   1 
ATOM   6695  C  CD1   . ILE A  1  864  ? 60.045  -122.520 121.907 1.00 36.05  ? 864  ILE A CD1   1 
ATOM   6696  N  N     . GLN A  1  865  ? 62.617  -127.229 123.337 1.00 32.53  ? 865  GLN A N     1 
ATOM   6697  C  CA    . GLN A  1  865  ? 63.019  -128.281 124.265 1.00 33.75  ? 865  GLN A CA    1 
ATOM   6698  C  C     . GLN A  1  865  ? 62.665  -129.511 123.429 1.00 35.28  ? 865  GLN A C     1 
ATOM   6699  O  O     . GLN A  1  865  ? 61.583  -129.565 122.844 1.00 37.03  ? 865  GLN A O     1 
ATOM   6700  C  CB    . GLN A  1  865  ? 62.176  -128.269 125.550 1.00 33.07  ? 865  GLN A CB    1 
ATOM   6701  C  CG    . GLN A  1  865  ? 62.430  -127.108 126.494 1.00 34.75  ? 865  GLN A CG    1 
ATOM   6702  C  CD    . GLN A  1  865  ? 62.151  -127.460 127.964 1.00 36.33  ? 865  GLN A CD    1 
ATOM   6703  O  OE1   . GLN A  1  865  ? 61.117  -128.047 128.294 1.00 37.21  ? 865  GLN A OE1   1 
ATOM   6704  N  NE2   . GLN A  1  865  ? 63.074  -127.087 128.850 1.00 34.99  ? 865  GLN A NE2   1 
ATOM   6705  N  N     . PHE A  1  866  ? 63.553  -130.487 123.320 1.00 34.88  ? 866  PHE A N     1 
ATOM   6706  C  CA    . PHE A  1  866  ? 63.187  -131.634 122.517 1.00 33.34  ? 866  PHE A CA    1 
ATOM   6707  C  C     . PHE A  1  866  ? 62.143  -132.487 123.205 1.00 32.65  ? 866  PHE A C     1 
ATOM   6708  O  O     . PHE A  1  866  ? 61.240  -133.014 122.565 1.00 33.34  ? 866  PHE A O     1 
ATOM   6709  C  CB    . PHE A  1  866  ? 64.430  -132.421 122.133 1.00 32.27  ? 866  PHE A CB    1 
ATOM   6710  C  CG    . PHE A  1  866  ? 65.153  -131.811 120.976 1.00 32.67  ? 866  PHE A CG    1 
ATOM   6711  C  CD1   . PHE A  1  866  ? 66.145  -130.865 121.178 1.00 31.75  ? 866  PHE A CD1   1 
ATOM   6712  C  CD2   . PHE A  1  866  ? 64.744  -132.087 119.665 1.00 33.20  ? 866  PHE A CD2   1 
ATOM   6713  C  CE1   . PHE A  1  866  ? 66.714  -130.194 120.090 1.00 31.26  ? 866  PHE A CE1   1 
ATOM   6714  C  CE2   . PHE A  1  866  ? 65.305  -131.422 118.576 1.00 31.48  ? 866  PHE A CE2   1 
ATOM   6715  C  CZ    . PHE A  1  866  ? 66.289  -130.473 118.792 1.00 30.75  ? 866  PHE A CZ    1 
ATOM   6716  N  N     . ILE A  1  867  ? 62.259  -132.592 124.520 1.00 31.54  ? 867  ILE A N     1 
ATOM   6717  C  CA    . ILE A  1  867  ? 61.327  -133.348 125.340 1.00 31.22  ? 867  ILE A CA    1 
ATOM   6718  C  C     . ILE A  1  867  ? 61.095  -132.379 126.496 1.00 31.83  ? 867  ILE A C     1 
ATOM   6719  O  O     . ILE A  1  867  ? 62.060  -131.913 127.102 1.00 32.36  ? 867  ILE A O     1 
ATOM   6720  C  CB    . ILE A  1  867  ? 61.981  -134.698 125.791 1.00 30.92  ? 867  ILE A CB    1 
ATOM   6721  C  CG1   . ILE A  1  867  ? 61.919  -135.703 124.631 1.00 34.90  ? 867  ILE A CG1   1 
ATOM   6722  C  CG2   . ILE A  1  867  ? 61.286  -135.295 126.985 1.00 25.92  ? 867  ILE A CG2   1 
ATOM   6723  C  CD1   . ILE A  1  867  ? 62.848  -135.406 123.384 1.00 36.58  ? 867  ILE A CD1   1 
ATOM   6724  N  N     . TYR A  1  868  ? 59.831  -132.037 126.768 1.00 30.84  ? 868  TYR A N     1 
ATOM   6725  C  CA    . TYR A  1  868  ? 59.494  -131.085 127.836 1.00 28.91  ? 868  TYR A CA    1 
ATOM   6726  C  C     . TYR A  1  868  ? 60.192  -131.358 129.160 1.00 28.68  ? 868  TYR A C     1 
ATOM   6727  O  O     . TYR A  1  868  ? 60.121  -132.462 129.695 1.00 28.34  ? 868  TYR A O     1 
ATOM   6728  C  CB    . TYR A  1  868  ? 57.982  -131.049 128.069 1.00 28.31  ? 868  TYR A CB    1 
ATOM   6729  C  CG    . TYR A  1  868  ? 57.544  -130.140 129.209 1.00 28.11  ? 868  TYR A CG    1 
ATOM   6730  C  CD1   . TYR A  1  868  ? 57.775  -128.776 129.166 1.00 27.49  ? 868  TYR A CD1   1 
ATOM   6731  C  CD2   . TYR A  1  868  ? 56.862  -130.647 130.317 1.00 28.56  ? 868  TYR A CD2   1 
ATOM   6732  C  CE1   . TYR A  1  868  ? 57.333  -127.938 130.191 1.00 27.81  ? 868  TYR A CE1   1 
ATOM   6733  C  CE2   . TYR A  1  868  ? 56.415  -129.807 131.350 1.00 27.99  ? 868  TYR A CE2   1 
ATOM   6734  C  CZ    . TYR A  1  868  ? 56.651  -128.449 131.275 1.00 27.66  ? 868  TYR A CZ    1 
ATOM   6735  O  OH    . TYR A  1  868  ? 56.182  -127.592 132.254 1.00 26.50  ? 868  TYR A OH    1 
ATOM   6736  N  N     . GLY A  1  869  ? 60.858  -130.340 129.694 1.00 28.74  ? 869  GLY A N     1 
ATOM   6737  C  CA    . GLY A  1  869  ? 61.546  -130.498 130.961 1.00 29.09  ? 869  GLY A CA    1 
ATOM   6738  C  C     . GLY A  1  869  ? 62.704  -131.474 130.898 1.00 29.21  ? 869  GLY A C     1 
ATOM   6739  O  O     . GLY A  1  869  ? 63.177  -131.964 131.922 1.00 29.15  ? 869  GLY A O     1 
ATOM   6740  N  N     . GLU A  1  870  ? 63.177  -131.752 129.693 1.00 29.82  ? 870  GLU A N     1 
ATOM   6741  C  CA    . GLU A  1  870  ? 64.285  -132.676 129.525 1.00 31.19  ? 870  GLU A CA    1 
ATOM   6742  C  C     . GLU A  1  870  ? 63.913  -134.082 130.013 1.00 31.72  ? 870  GLU A C     1 
ATOM   6743  O  O     . GLU A  1  870  ? 64.767  -134.973 130.045 1.00 33.55  ? 870  GLU A O     1 
ATOM   6744  C  CB    . GLU A  1  870  ? 65.517  -132.148 130.275 1.00 29.17  ? 870  GLU A CB    1 
ATOM   6745  C  CG    . GLU A  1  870  ? 66.231  -131.034 129.535 1.00 31.01  ? 870  GLU A CG    1 
ATOM   6746  C  CD    . GLU A  1  870  ? 67.179  -130.213 130.411 1.00 33.76  ? 870  GLU A CD    1 
ATOM   6747  O  OE1   . GLU A  1  870  ? 67.938  -130.796 131.224 1.00 34.46  ? 870  GLU A OE1   1 
ATOM   6748  O  OE2   . GLU A  1  870  ? 67.175  -128.966 130.268 1.00 34.21  ? 870  GLU A OE2   1 
ATOM   6749  N  N     . ASP A  1  871  ? 62.641  -134.290 130.365 1.00 30.25  ? 871  ASP A N     1 
ATOM   6750  C  CA    . ASP A  1  871  ? 62.213  -135.590 130.859 1.00 29.09  ? 871  ASP A CA    1 
ATOM   6751  C  C     . ASP A  1  871  ? 60.823  -136.037 130.437 1.00 27.76  ? 871  ASP A C     1 
ATOM   6752  O  O     . ASP A  1  871  ? 60.468  -137.199 130.613 1.00 26.92  ? 871  ASP A O     1 
ATOM   6753  C  CB    . ASP A  1  871  ? 62.360  -135.641 132.394 1.00 32.22  ? 871  ASP A CB    1 
ATOM   6754  C  CG    . ASP A  1  871  ? 61.190  -134.989 133.150 1.00 34.24  ? 871  ASP A CG    1 
ATOM   6755  O  OD1   . ASP A  1  871  ? 60.403  -134.246 132.525 1.00 36.87  ? 871  ASP A OD1   1 
ATOM   6756  O  OD2   . ASP A  1  871  ? 61.074  -135.217 134.385 1.00 33.46  ? 871  ASP A OD2   1 
ATOM   6757  N  N     . GLY A  1  872  ? 60.037  -135.115 129.896 1.00 26.76  ? 872  GLY A N     1 
ATOM   6758  C  CA    . GLY A  1  872  ? 58.704  -135.452 129.417 1.00 26.39  ? 872  GLY A CA    1 
ATOM   6759  C  C     . GLY A  1  872  ? 57.603  -135.565 130.436 1.00 25.44  ? 872  GLY A C     1 
ATOM   6760  O  O     . GLY A  1  872  ? 56.464  -135.818 130.088 1.00 25.67  ? 872  GLY A O     1 
ATOM   6761  N  N     . MET A  1  873  ? 57.954  -135.355 131.693 1.00 26.04  ? 873  MET A N     1 
ATOM   6762  C  CA    . MET A  1  873  ? 57.030  -135.439 132.817 1.00 27.25  ? 873  MET A CA    1 
ATOM   6763  C  C     . MET A  1  873  ? 56.252  -134.132 133.114 1.00 28.02  ? 873  MET A C     1 
ATOM   6764  O  O     . MET A  1  873  ? 56.782  -133.032 132.922 1.00 27.87  ? 873  MET A O     1 
ATOM   6765  C  CB    . MET A  1  873  ? 57.837  -135.840 134.055 1.00 27.48  ? 873  MET A CB    1 
ATOM   6766  C  CG    . MET A  1  873  ? 57.463  -137.165 134.676 1.00 30.32  ? 873  MET A CG    1 
ATOM   6767  S  SD    . MET A  1  873  ? 57.507  -138.535 133.535 1.00 35.72  ? 873  MET A SD    1 
ATOM   6768  C  CE    . MET A  1  873  ? 59.331  -138.770 133.396 1.00 33.84  ? 873  MET A CE    1 
ATOM   6769  N  N     . ASP A  1  874  ? 54.996  -134.275 133.563 1.00 28.08  ? 874  ASP A N     1 
ATOM   6770  C  CA    . ASP A  1  874  ? 54.123  -133.157 133.962 1.00 28.47  ? 874  ASP A CA    1 
ATOM   6771  C  C     . ASP A  1  874  ? 54.467  -132.903 135.428 1.00 28.34  ? 874  ASP A C     1 
ATOM   6772  O  O     . ASP A  1  874  ? 54.415  -133.809 136.243 1.00 28.79  ? 874  ASP A O     1 
ATOM   6773  C  CB    . ASP A  1  874  ? 52.643  -133.554 133.849 1.00 31.70  ? 874  ASP A CB    1 
ATOM   6774  C  CG    . ASP A  1  874  ? 51.688  -132.565 134.568 1.00 34.20  ? 874  ASP A CG    1 
ATOM   6775  O  OD1   . ASP A  1  874  ? 52.030  -132.094 135.681 1.00 31.73  ? 874  ASP A OD1   1 
ATOM   6776  O  OD2   . ASP A  1  874  ? 50.582  -132.287 134.021 1.00 35.25  ? 874  ASP A OD2   1 
ATOM   6777  N  N     . ALA A  1  875  ? 54.788  -131.668 135.769 1.00 28.20  ? 875  ALA A N     1 
ATOM   6778  C  CA    . ALA A  1  875  ? 55.206  -131.333 137.127 1.00 28.42  ? 875  ALA A CA    1 
ATOM   6779  C  C     . ALA A  1  875  ? 54.312  -131.674 138.301 1.00 27.99  ? 875  ALA A C     1 
ATOM   6780  O  O     . ALA A  1  875  ? 54.803  -131.825 139.415 1.00 25.90  ? 875  ALA A O     1 
ATOM   6781  C  CB    . ALA A  1  875  ? 55.548  -129.876 137.186 1.00 30.74  ? 875  ALA A CB    1 
ATOM   6782  N  N     . ALA A  1  876  ? 53.011  -131.778 138.057 1.00 29.60  ? 876  ALA A N     1 
ATOM   6783  C  CA    . ALA A  1  876  ? 52.044  -132.074 139.110 1.00 31.78  ? 876  ALA A CA    1 
ATOM   6784  C  C     . ALA A  1  876  ? 52.268  -133.459 139.665 1.00 33.96  ? 876  ALA A C     1 
ATOM   6785  O  O     . ALA A  1  876  ? 52.007  -133.737 140.846 1.00 33.98  ? 876  ALA A O     1 
ATOM   6786  C  CB    . ALA A  1  876  ? 50.662  -131.974 138.561 1.00 31.79  ? 876  ALA A CB    1 
ATOM   6787  N  N     . HIS A  1  877  ? 52.769  -134.316 138.782 1.00 36.84  ? 877  HIS A N     1 
ATOM   6788  C  CA    . HIS A  1  877  ? 53.064  -135.713 139.080 1.00 39.44  ? 877  HIS A CA    1 
ATOM   6789  C  C     . HIS A  1  877  ? 54.478  -135.987 139.543 1.00 40.49  ? 877  HIS A C     1 
ATOM   6790  O  O     . HIS A  1  877  ? 54.996  -137.079 139.322 1.00 42.15  ? 877  HIS A O     1 
ATOM   6791  C  CB    . HIS A  1  877  ? 52.822  -136.555 137.846 1.00 39.48  ? 877  HIS A CB    1 
ATOM   6792  C  CG    . HIS A  1  877  ? 51.395  -136.598 137.432 1.00 40.96  ? 877  HIS A CG    1 
ATOM   6793  N  ND1   . HIS A  1  877  ? 50.444  -137.298 138.139 1.00 40.41  ? 877  HIS A ND1   1 
ATOM   6794  C  CD2   . HIS A  1  877  ? 50.749  -136.012 136.398 1.00 42.07  ? 877  HIS A CD2   1 
ATOM   6795  C  CE1   . HIS A  1  877  ? 49.270  -137.142 137.558 1.00 42.05  ? 877  HIS A CE1   1 
ATOM   6796  N  NE2   . HIS A  1  877  ? 49.427  -136.367 136.500 1.00 44.02  ? 877  HIS A NE2   1 
ATOM   6797  N  N     . ILE A  1  878  ? 55.111  -135.018 140.181 1.00 40.48  ? 878  ILE A N     1 
ATOM   6798  C  CA    . ILE A  1  878  ? 56.465  -135.233 140.630 1.00 39.90  ? 878  ILE A CA    1 
ATOM   6799  C  C     . ILE A  1  878  ? 56.576  -135.017 142.130 1.00 40.65  ? 878  ILE A C     1 
ATOM   6800  O  O     . ILE A  1  878  ? 55.789  -134.259 142.713 1.00 41.62  ? 878  ILE A O     1 
ATOM   6801  C  CB    . ILE A  1  878  ? 57.411  -134.309 139.876 1.00 39.40  ? 878  ILE A CB    1 
ATOM   6802  C  CG1   . ILE A  1  878  ? 57.584  -134.799 138.443 1.00 38.51  ? 878  ILE A CG1   1 
ATOM   6803  C  CG2   . ILE A  1  878  ? 58.740  -134.279 140.550 1.00 41.54  ? 878  ILE A CG2   1 
ATOM   6804  C  CD1   . ILE A  1  878  ? 58.634  -134.018 137.673 1.00 39.83  ? 878  ILE A CD1   1 
ATOM   6805  N  N     . GLU A  1  879  ? 57.529  -135.716 142.750 1.00 39.80  ? 879  GLU A N     1 
ATOM   6806  C  CA    . GLU A  1  879  ? 57.770  -135.614 144.183 1.00 39.77  ? 879  GLU A CA    1 
ATOM   6807  C  C     . GLU A  1  879  ? 59.254  -135.816 144.438 1.00 40.80  ? 879  GLU A C     1 
ATOM   6808  O  O     . GLU A  1  879  ? 59.951  -136.464 143.647 1.00 39.29  ? 879  GLU A O     1 
ATOM   6809  C  CB    . GLU A  1  879  ? 56.970  -136.672 144.943 1.00 39.14  ? 879  GLU A CB    1 
ATOM   6810  C  CG    . GLU A  1  879  ? 55.609  -136.957 144.322 1.00 40.77  ? 879  GLU A CG    1 
ATOM   6811  C  CD    . GLU A  1  879  ? 54.756  -137.904 145.145 1.00 42.50  ? 879  GLU A CD    1 
ATOM   6812  O  OE1   . GLU A  1  879  ? 53.780  -138.462 144.583 1.00 42.69  ? 879  GLU A OE1   1 
ATOM   6813  O  OE2   . GLU A  1  879  ? 55.057  -138.078 146.350 1.00 42.36  ? 879  GLU A OE2   1 
ATOM   6814  N  N     . LYS A  1  880  ? 59.738  -135.245 145.537 1.00 42.33  ? 880  LYS A N     1 
ATOM   6815  C  CA    . LYS A  1  880  ? 61.143  -135.366 145.893 1.00 43.30  ? 880  LYS A CA    1 
ATOM   6816  C  C     . LYS A  1  880  ? 61.337  -136.784 146.399 1.00 43.71  ? 880  LYS A C     1 
ATOM   6817  O  O     . LYS A  1  880  ? 60.630  -137.222 147.295 1.00 44.16  ? 880  LYS A O     1 
ATOM   6818  C  CB    . LYS A  1  880  ? 61.516  -134.349 146.988 1.00 45.23  ? 880  LYS A CB    1 
ATOM   6819  C  CG    . LYS A  1  880  ? 62.690  -133.437 146.595 1.00 48.70  ? 880  LYS A CG    1 
ATOM   6820  C  CD    . LYS A  1  880  ? 62.651  -132.047 147.269 1.00 52.30  ? 880  LYS A CD    1 
ATOM   6821  C  CE    . LYS A  1  880  ? 63.478  -131.008 146.453 1.00 54.44  ? 880  LYS A CE    1 
ATOM   6822  N  NZ    . LYS A  1  880  ? 63.219  -129.550 146.757 1.00 53.59  ? 880  LYS A NZ    1 
ATOM   6823  N  N     . GLN A  1  881  ? 62.264  -137.517 145.794 1.00 43.64  ? 881  GLN A N     1 
ATOM   6824  C  CA    . GLN A  1  881  ? 62.554  -138.879 146.222 1.00 42.58  ? 881  GLN A CA    1 
ATOM   6825  C  C     . GLN A  1  881  ? 64.048  -138.980 146.459 1.00 44.41  ? 881  GLN A C     1 
ATOM   6826  O  O     . GLN A  1  881  ? 64.836  -138.278 145.827 1.00 44.93  ? 881  GLN A O     1 
ATOM   6827  C  CB    . GLN A  1  881  ? 62.139  -139.883 145.161 1.00 38.79  ? 881  GLN A CB    1 
ATOM   6828  C  CG    . GLN A  1  881  ? 60.699  -139.815 144.826 1.00 35.08  ? 881  GLN A CG    1 
ATOM   6829  C  CD    . GLN A  1  881  ? 60.206  -141.109 144.272 1.00 34.43  ? 881  GLN A CD    1 
ATOM   6830  O  OE1   . GLN A  1  881  ? 60.288  -142.138 144.932 1.00 34.53  ? 881  GLN A OE1   1 
ATOM   6831  N  NE2   . GLN A  1  881  ? 59.691  -141.079 143.052 1.00 33.54  ? 881  GLN A NE2   1 
ATOM   6832  N  N     . SER A  1  882  ? 64.438  -139.850 147.376 1.00 45.49  ? 882  SER A N     1 
ATOM   6833  C  CA    . SER A  1  882  ? 65.843  -140.021 147.692 1.00 45.71  ? 882  SER A CA    1 
ATOM   6834  C  C     . SER A  1  882  ? 66.478  -141.118 146.844 1.00 46.46  ? 882  SER A C     1 
ATOM   6835  O  O     . SER A  1  882  ? 65.943  -142.220 146.770 1.00 46.45  ? 882  SER A O     1 
ATOM   6836  C  CB    . SER A  1  882  ? 65.972  -140.354 149.174 1.00 45.16  ? 882  SER A CB    1 
ATOM   6837  O  OG    . SER A  1  882  ? 67.076  -141.200 149.408 1.00 45.06  ? 882  SER A OG    1 
ATOM   6838  N  N     . LEU A  1  883  ? 67.608  -140.812 146.200 1.00 47.86  ? 883  LEU A N     1 
ATOM   6839  C  CA    . LEU A  1  883  ? 68.328  -141.793 145.368 1.00 49.70  ? 883  LEU A CA    1 
ATOM   6840  C  C     . LEU A  1  883  ? 69.457  -142.464 146.154 1.00 52.02  ? 883  LEU A C     1 
ATOM   6841  O  O     . LEU A  1  883  ? 70.623  -142.264 145.833 1.00 53.93  ? 883  LEU A O     1 
ATOM   6842  C  CB    . LEU A  1  883  ? 68.929  -141.119 144.131 1.00 45.34  ? 883  LEU A CB    1 
ATOM   6843  C  CG    . LEU A  1  883  ? 67.938  -140.602 143.097 1.00 43.36  ? 883  LEU A CG    1 
ATOM   6844  C  CD1   . LEU A  1  883  ? 68.673  -140.045 141.896 1.00 43.19  ? 883  LEU A CD1   1 
ATOM   6845  C  CD2   . LEU A  1  883  ? 67.032  -141.731 142.677 1.00 42.19  ? 883  LEU A CD2   1 
ATOM   6846  N  N     . ASP A  1  884  ? 69.102  -143.259 147.165 1.00 53.67  ? 884  ASP A N     1 
ATOM   6847  C  CA    . ASP A  1  884  ? 70.052  -143.957 148.047 1.00 55.47  ? 884  ASP A CA    1 
ATOM   6848  C  C     . ASP A  1  884  ? 71.429  -144.264 147.482 1.00 55.66  ? 884  ASP A C     1 
ATOM   6849  O  O     . ASP A  1  884  ? 72.446  -143.947 148.103 1.00 55.95  ? 884  ASP A O     1 
ATOM   6850  C  CB    . ASP A  1  884  ? 69.438  -145.258 148.511 1.00 58.04  ? 884  ASP A CB    1 
ATOM   6851  C  CG    . ASP A  1  884  ? 67.994  -145.100 148.865 1.00 60.57  ? 884  ASP A CG    1 
ATOM   6852  O  OD1   . ASP A  1  884  ? 67.707  -144.304 149.787 1.00 61.97  ? 884  ASP A OD1   1 
ATOM   6853  O  OD2   . ASP A  1  884  ? 67.151  -145.763 148.217 1.00 61.79  ? 884  ASP A OD2   1 
ATOM   6854  N  N     . THR A  1  885  ? 71.448  -144.900 146.316 1.00 53.90  ? 885  THR A N     1 
ATOM   6855  C  CA    . THR A  1  885  ? 72.681  -145.267 145.644 1.00 52.59  ? 885  THR A CA    1 
ATOM   6856  C  C     . THR A  1  885  ? 73.795  -144.213 145.652 1.00 54.02  ? 885  THR A C     1 
ATOM   6857  O  O     . THR A  1  885  ? 74.958  -144.547 145.864 1.00 54.64  ? 885  THR A O     1 
ATOM   6858  C  CB    . THR A  1  885  ? 72.371  -145.675 144.203 1.00 51.17  ? 885  THR A CB    1 
ATOM   6859  O  OG1   . THR A  1  885  ? 71.665  -146.912 144.232 1.00 51.41  ? 885  THR A OG1   1 
ATOM   6860  C  CG2   . THR A  1  885  ? 73.624  -145.865 143.390 1.00 50.43  ? 885  THR A CG2   1 
ATOM   6861  N  N     . ILE A  1  886  ? 73.457  -142.945 145.446 1.00 54.55  ? 886  ILE A N     1 
ATOM   6862  C  CA    . ILE A  1  886  ? 74.481  -141.904 145.398 1.00 54.56  ? 886  ILE A CA    1 
ATOM   6863  C  C     . ILE A  1  886  ? 75.243  -141.657 146.699 1.00 55.44  ? 886  ILE A C     1 
ATOM   6864  O  O     . ILE A  1  886  ? 76.468  -141.716 146.706 1.00 56.02  ? 886  ILE A O     1 
ATOM   6865  C  CB    . ILE A  1  886  ? 73.894  -140.569 144.877 1.00 53.47  ? 886  ILE A CB    1 
ATOM   6866  C  CG1   . ILE A  1  886  ? 75.022  -139.684 144.358 1.00 53.30  ? 886  ILE A CG1   1 
ATOM   6867  C  CG2   . ILE A  1  886  ? 73.143  -139.855 145.975 1.00 53.99  ? 886  ILE A CG2   1 
ATOM   6868  C  CD1   . ILE A  1  886  ? 74.553  -138.415 143.698 1.00 53.51  ? 886  ILE A CD1   1 
ATOM   6869  N  N     . GLY A  1  887  ? 74.540  -141.395 147.795 1.00 56.49  ? 887  GLY A N     1 
ATOM   6870  C  CA    . GLY A  1  887  ? 75.226  -141.146 149.052 1.00 58.87  ? 887  GLY A CA    1 
ATOM   6871  C  C     . GLY A  1  887  ? 75.844  -142.386 149.688 1.00 60.58  ? 887  GLY A C     1 
ATOM   6872  O  O     . GLY A  1  887  ? 76.006  -143.423 149.034 1.00 60.28  ? 887  GLY A O     1 
ATOM   6873  N  N     . GLY A  1  888  ? 76.208  -142.271 150.965 1.00 61.46  ? 888  GLY A N     1 
ATOM   6874  C  CA    . GLY A  1  888  ? 76.789  -143.389 151.692 1.00 61.77  ? 888  GLY A CA    1 
ATOM   6875  C  C     . GLY A  1  888  ? 78.167  -143.879 151.275 1.00 62.25  ? 888  GLY A C     1 
ATOM   6876  O  O     . GLY A  1  888  ? 78.596  -143.720 150.130 1.00 61.60  ? 888  GLY A O     1 
ATOM   6877  N  N     . SER A  1  889  ? 78.856  -144.494 152.230 1.00 62.81  ? 889  SER A N     1 
ATOM   6878  C  CA    . SER A  1  889  ? 80.195  -145.039 152.023 1.00 63.42  ? 889  SER A CA    1 
ATOM   6879  C  C     . SER A  1  889  ? 80.125  -146.294 151.178 1.00 63.38  ? 889  SER A C     1 
ATOM   6880  O  O     . SER A  1  889  ? 79.132  -147.019 151.222 1.00 62.96  ? 889  SER A O     1 
ATOM   6881  C  CB    . SER A  1  889  ? 80.814  -145.418 153.361 1.00 63.87  ? 889  SER A CB    1 
ATOM   6882  O  OG    . SER A  1  889  ? 80.060  -146.464 153.954 1.00 63.90  ? 889  SER A OG    1 
ATOM   6883  N  N     . ASP A  1  890  ? 81.189  -146.565 150.427 1.00 63.70  ? 890  ASP A N     1 
ATOM   6884  C  CA    . ASP A  1  890  ? 81.233  -147.764 149.591 1.00 63.75  ? 890  ASP A CA    1 
ATOM   6885  C  C     . ASP A  1  890  ? 81.000  -148.970 150.502 1.00 62.68  ? 890  ASP A C     1 
ATOM   6886  O  O     . ASP A  1  890  ? 80.517  -150.029 150.074 1.00 60.51  ? 890  ASP A O     1 
ATOM   6887  C  CB    . ASP A  1  890  ? 82.595  -147.878 148.909 1.00 64.65  ? 890  ASP A CB    1 
ATOM   6888  C  CG    . ASP A  1  890  ? 82.899  -146.694 148.012 1.00 66.56  ? 890  ASP A CG    1 
ATOM   6889  O  OD1   . ASP A  1  890  ? 82.502  -146.706 146.817 1.00 67.47  ? 890  ASP A OD1   1 
ATOM   6890  O  OD2   . ASP A  1  890  ? 83.530  -145.743 148.519 1.00 67.67  ? 890  ASP A OD2   1 
ATOM   6891  N  N     . ALA A  1  891  ? 81.346  -148.778 151.772 1.00 62.13  ? 891  ALA A N     1 
ATOM   6892  C  CA    . ALA A  1  891  ? 81.193  -149.808 152.784 1.00 61.02  ? 891  ALA A CA    1 
ATOM   6893  C  C     . ALA A  1  891  ? 79.751  -150.286 152.846 1.00 59.77  ? 891  ALA A C     1 
ATOM   6894  O  O     . ALA A  1  891  ? 79.460  -151.435 152.517 1.00 59.22  ? 891  ALA A O     1 
ATOM   6895  C  CB    . ALA A  1  891  ? 81.624  -149.267 154.142 1.00 62.29  ? 891  ALA A CB    1 
ATOM   6896  N  N     . ALA A  1  892  ? 78.851  -149.397 153.256 1.00 58.25  ? 892  ALA A N     1 
ATOM   6897  C  CA    . ALA A  1  892  ? 77.443  -149.750 153.369 1.00 57.00  ? 892  ALA A CA    1 
ATOM   6898  C  C     . ALA A  1  892  ? 76.747  -149.972 152.025 1.00 55.75  ? 892  ALA A C     1 
ATOM   6899  O  O     . ALA A  1  892  ? 75.707  -150.629 151.974 1.00 54.53  ? 892  ALA A O     1 
ATOM   6900  C  CB    . ALA A  1  892  ? 76.707  -148.696 154.175 1.00 57.09  ? 892  ALA A CB    1 
ATOM   6901  N  N     . PHE A  1  893  ? 77.308  -149.429 150.944 1.00 54.34  ? 893  PHE A N     1 
ATOM   6902  C  CA    . PHE A  1  893  ? 76.712  -149.614 149.623 1.00 53.22  ? 893  PHE A CA    1 
ATOM   6903  C  C     . PHE A  1  893  ? 76.722  -151.094 149.313 1.00 54.96  ? 893  PHE A C     1 
ATOM   6904  O  O     . PHE A  1  893  ? 75.709  -151.662 148.893 1.00 55.69  ? 893  PHE A O     1 
ATOM   6905  C  CB    . PHE A  1  893  ? 77.516  -148.895 148.547 1.00 50.91  ? 893  PHE A CB    1 
ATOM   6906  C  CG    . PHE A  1  893  ? 77.113  -149.260 147.129 1.00 48.88  ? 893  PHE A CG    1 
ATOM   6907  C  CD1   . PHE A  1  893  ? 76.062  -148.610 146.493 1.00 48.05  ? 893  PHE A CD1   1 
ATOM   6908  C  CD2   . PHE A  1  893  ? 77.815  -150.231 146.417 1.00 47.52  ? 893  PHE A CD2   1 
ATOM   6909  C  CE1   . PHE A  1  893  ? 75.723  -148.917 145.170 1.00 46.72  ? 893  PHE A CE1   1 
ATOM   6910  C  CE2   . PHE A  1  893  ? 77.480  -150.540 145.098 1.00 45.89  ? 893  PHE A CE2   1 
ATOM   6911  C  CZ    . PHE A  1  893  ? 76.435  -149.881 144.477 1.00 45.45  ? 893  PHE A CZ    1 
ATOM   6912  N  N     . GLU A  1  894  ? 77.883  -151.713 149.513 1.00 55.64  ? 894  GLU A N     1 
ATOM   6913  C  CA    . GLU A  1  894  ? 78.025  -153.134 149.261 1.00 55.80  ? 894  GLU A CA    1 
ATOM   6914  C  C     . GLU A  1  894  ? 77.162  -153.939 150.231 1.00 55.49  ? 894  GLU A C     1 
ATOM   6915  O  O     . GLU A  1  894  ? 76.432  -154.845 149.824 1.00 55.25  ? 894  GLU A O     1 
ATOM   6916  C  CB    . GLU A  1  894  ? 79.485  -153.567 149.398 1.00 57.68  ? 894  GLU A CB    1 
ATOM   6917  C  CG    . GLU A  1  894  ? 79.624  -155.096 149.444 1.00 62.04  ? 894  GLU A CG    1 
ATOM   6918  C  CD    . GLU A  1  894  ? 81.063  -155.599 149.565 1.00 64.66  ? 894  GLU A CD    1 
ATOM   6919  O  OE1   . GLU A  1  894  ? 81.241  -156.812 149.862 1.00 64.70  ? 894  GLU A OE1   1 
ATOM   6920  O  OE2   . GLU A  1  894  ? 82.006  -154.796 149.356 1.00 65.82  ? 894  GLU A OE2   1 
ATOM   6921  N  N     . LYS A  1  895  ? 77.240  -153.600 151.515 1.00 55.14  ? 895  LYS A N     1 
ATOM   6922  C  CA    . LYS A  1  895  ? 76.474  -154.311 152.536 1.00 54.78  ? 895  LYS A CA    1 
ATOM   6923  C  C     . LYS A  1  895  ? 74.985  -154.293 152.251 1.00 55.08  ? 895  LYS A C     1 
ATOM   6924  O  O     . LYS A  1  895  ? 74.229  -155.102 152.792 1.00 54.99  ? 895  LYS A O     1 
ATOM   6925  C  CB    . LYS A  1  895  ? 76.726  -153.708 153.925 1.00 54.40  ? 895  LYS A CB    1 
ATOM   6926  C  CG    . LYS A  1  895  ? 75.929  -154.373 155.045 1.00 53.98  ? 895  LYS A CG    1 
ATOM   6927  C  CD    . LYS A  1  895  ? 76.473  -154.009 156.425 1.00 55.59  ? 895  LYS A CD    1 
ATOM   6928  C  CE    . LYS A  1  895  ? 75.746  -154.777 157.539 1.00 56.57  ? 895  LYS A CE    1 
ATOM   6929  N  NZ    . LYS A  1  895  ? 76.507  -154.837 158.835 1.00 56.54  ? 895  LYS A NZ    1 
ATOM   6930  N  N     . ARG A  1  896  ? 74.566  -153.381 151.384 1.00 54.86  ? 896  ARG A N     1 
ATOM   6931  C  CA    . ARG A  1  896  ? 73.159  -153.258 151.080 1.00 54.15  ? 896  ARG A CA    1 
ATOM   6932  C  C     . ARG A  1  896  ? 72.737  -153.943 149.819 1.00 53.50  ? 896  ARG A C     1 
ATOM   6933  O  O     . ARG A  1  896  ? 71.835  -154.764 149.845 1.00 53.89  ? 896  ARG A O     1 
ATOM   6934  C  CB    . ARG A  1  896  ? 72.770  -151.796 150.985 1.00 54.70  ? 896  ARG A CB    1 
ATOM   6935  C  CG    . ARG A  1  896  ? 71.276  -151.564 150.987 1.00 56.78  ? 896  ARG A CG    1 
ATOM   6936  C  CD    . ARG A  1  896  ? 71.010  -150.082 150.893 1.00 58.94  ? 896  ARG A CD    1 
ATOM   6937  N  NE    . ARG A  1  896  ? 69.727  -149.680 151.447 1.00 61.95  ? 896  ARG A NE    1 
ATOM   6938  C  CZ    . ARG A  1  896  ? 69.386  -148.410 151.642 1.00 64.22  ? 896  ARG A CZ    1 
ATOM   6939  N  NH1   . ARG A  1  896  ? 70.241  -147.441 151.322 1.00 64.14  ? 896  ARG A NH1   1 
ATOM   6940  N  NH2   . ARG A  1  896  ? 68.203  -148.108 152.168 1.00 66.03  ? 896  ARG A NH2   1 
ATOM   6941  N  N     . TYR A  1  897  ? 73.390  -153.612 148.717 1.00 53.34  ? 897  TYR A N     1 
ATOM   6942  C  CA    . TYR A  1  897  ? 73.017  -154.178 147.433 1.00 54.37  ? 897  TYR A CA    1 
ATOM   6943  C  C     . TYR A  1  897  ? 73.744  -155.442 146.973 1.00 55.40  ? 897  TYR A C     1 
ATOM   6944  O  O     . TYR A  1  897  ? 73.347  -156.068 145.973 1.00 55.97  ? 897  TYR A O     1 
ATOM   6945  C  CB    . TYR A  1  897  ? 73.150  -153.093 146.373 1.00 53.56  ? 897  TYR A CB    1 
ATOM   6946  C  CG    . TYR A  1  897  ? 72.375  -151.850 146.718 1.00 53.95  ? 897  TYR A CG    1 
ATOM   6947  C  CD1   . TYR A  1  897  ? 72.836  -150.964 147.676 1.00 54.18  ? 897  TYR A CD1   1 
ATOM   6948  C  CD2   . TYR A  1  897  ? 71.168  -151.560 146.087 1.00 55.33  ? 897  TYR A CD2   1 
ATOM   6949  C  CE1   . TYR A  1  897  ? 72.111  -149.809 147.994 1.00 55.49  ? 897  TYR A CE1   1 
ATOM   6950  C  CE2   . TYR A  1  897  ? 70.433  -150.411 146.400 1.00 54.94  ? 897  TYR A CE2   1 
ATOM   6951  C  CZ    . TYR A  1  897  ? 70.911  -149.539 147.351 1.00 55.27  ? 897  TYR A CZ    1 
ATOM   6952  O  OH    . TYR A  1  897  ? 70.199  -148.396 147.648 1.00 55.58  ? 897  TYR A OH    1 
ATOM   6953  N  N     . ARG A  1  898  ? 74.785  -155.834 147.703 1.00 55.91  ? 898  ARG A N     1 
ATOM   6954  C  CA    . ARG A  1  898  ? 75.562  -157.002 147.312 1.00 55.80  ? 898  ARG A CA    1 
ATOM   6955  C  C     . ARG A  1  898  ? 74.989  -158.338 147.699 1.00 56.13  ? 898  ARG A C     1 
ATOM   6956  O  O     . ARG A  1  898  ? 74.596  -158.566 148.844 1.00 55.98  ? 898  ARG A O     1 
ATOM   6957  C  CB    . ARG A  1  898  ? 76.991  -156.915 147.843 1.00 55.83  ? 898  ARG A CB    1 
ATOM   6958  C  CG    . ARG A  1  898  ? 77.921  -158.002 147.286 1.00 55.69  ? 898  ARG A CG    1 
ATOM   6959  C  CD    . ARG A  1  898  ? 77.703  -158.226 145.788 1.00 54.91  ? 898  ARG A CD    1 
ATOM   6960  N  NE    . ARG A  1  898  ? 78.806  -158.950 145.150 1.00 54.79  ? 898  ARG A NE    1 
ATOM   6961  C  CZ    . ARG A  1  898  ? 78.743  -159.492 143.933 1.00 54.37  ? 898  ARG A CZ    1 
ATOM   6962  N  NH1   . ARG A  1  898  ? 77.628  -159.402 143.215 1.00 54.15  ? 898  ARG A NH1   1 
ATOM   6963  N  NH2   . ARG A  1  898  ? 79.797  -160.115 143.428 1.00 52.70  ? 898  ARG A NH2   1 
ATOM   6964  N  N     . VAL A  1  899  ? 74.961  -159.218 146.709 1.00 56.44  ? 899  VAL A N     1 
ATOM   6965  C  CA    . VAL A  1  899  ? 74.471  -160.571 146.873 1.00 57.63  ? 899  VAL A CA    1 
ATOM   6966  C  C     . VAL A  1  899  ? 75.454  -161.478 146.157 1.00 59.69  ? 899  VAL A C     1 
ATOM   6967  O  O     . VAL A  1  899  ? 75.497  -161.511 144.917 1.00 59.80  ? 899  VAL A O     1 
ATOM   6968  C  CB    . VAL A  1  899  ? 73.087  -160.742 146.250 1.00 57.18  ? 899  VAL A CB    1 
ATOM   6969  C  CG1   . VAL A  1  899  ? 72.730  -162.218 146.136 1.00 56.23  ? 899  VAL A CG1   1 
ATOM   6970  C  CG2   . VAL A  1  899  ? 72.070  -160.012 147.093 1.00 57.43  ? 899  VAL A CG2   1 
ATOM   6971  N  N     . ASP A  1  900  ? 76.255  -162.185 146.959 1.00 60.91  ? 900  ASP A N     1 
ATOM   6972  C  CA    . ASP A  1  900  ? 77.267  -163.122 146.478 1.00 60.56  ? 900  ASP A CA    1 
ATOM   6973  C  C     . ASP A  1  900  ? 76.754  -164.498 146.841 1.00 59.09  ? 900  ASP A C     1 
ATOM   6974  O  O     . ASP A  1  900  ? 76.775  -164.884 148.008 1.00 59.14  ? 900  ASP A O     1 
ATOM   6975  C  CB    . ASP A  1  900  ? 78.609  -162.882 147.189 1.00 63.99  ? 900  ASP A CB    1 
ATOM   6976  C  CG    . ASP A  1  900  ? 79.786  -163.567 146.481 1.00 66.64  ? 900  ASP A CG    1 
ATOM   6977  O  OD1   . ASP A  1  900  ? 79.538  -164.467 145.642 1.00 67.85  ? 900  ASP A OD1   1 
ATOM   6978  O  OD2   . ASP A  1  900  ? 80.957  -163.208 146.768 1.00 66.70  ? 900  ASP A OD2   1 
ATOM   6979  N  N     . LEU A  1  901  ? 76.276  -165.231 145.845 1.00 57.86  ? 901  LEU A N     1 
ATOM   6980  C  CA    . LEU A  1  901  ? 75.755  -166.570 146.081 1.00 58.02  ? 901  LEU A CA    1 
ATOM   6981  C  C     . LEU A  1  901  ? 76.873  -167.584 146.309 1.00 58.29  ? 901  LEU A C     1 
ATOM   6982  O  O     . LEU A  1  901  ? 76.668  -168.616 146.950 1.00 59.78  ? 901  LEU A O     1 
ATOM   6983  C  CB    . LEU A  1  901  ? 74.893  -167.020 144.904 1.00 56.44  ? 901  LEU A CB    1 
ATOM   6984  C  CG    . LEU A  1  901  ? 73.530  -166.354 144.815 1.00 55.54  ? 901  LEU A CG    1 
ATOM   6985  C  CD1   . LEU A  1  901  ? 72.807  -166.824 143.559 1.00 54.58  ? 901  LEU A CD1   1 
ATOM   6986  C  CD2   . LEU A  1  901  ? 72.747  -166.680 146.077 1.00 54.86  ? 901  LEU A CD2   1 
ATOM   6987  N  N     . LEU A  1  902  ? 78.053  -167.287 145.779 1.00 56.80  ? 902  LEU A N     1 
ATOM   6988  C  CA    . LEU A  1  902  ? 79.196  -168.167 145.927 1.00 54.88  ? 902  LEU A CA    1 
ATOM   6989  C  C     . LEU A  1  902  ? 79.947  -167.789 147.190 1.00 55.85  ? 902  LEU A C     1 
ATOM   6990  O  O     . LEU A  1  902  ? 81.162  -167.667 147.164 1.00 56.91  ? 902  LEU A O     1 
ATOM   6991  C  CB    . LEU A  1  902  ? 80.113  -168.019 144.720 1.00 52.14  ? 902  LEU A CB    1 
ATOM   6992  C  CG    . LEU A  1  902  ? 79.347  -167.796 143.413 1.00 51.19  ? 902  LEU A CG    1 
ATOM   6993  C  CD1   . LEU A  1  902  ? 80.328  -167.752 142.250 1.00 50.54  ? 902  LEU A CD1   1 
ATOM   6994  C  CD2   . LEU A  1  902  ? 78.307  -168.891 143.213 1.00 48.77  ? 902  LEU A CD2   1 
ATOM   6995  N  N     . ASN A  1  903  ? 79.224  -167.603 148.293 1.00 56.41  ? 903  ASN A N     1 
ATOM   6996  C  CA    . ASN A  1  903  ? 79.848  -167.230 149.555 1.00 57.99  ? 903  ASN A CA    1 
ATOM   6997  C  C     . ASN A  1  903  ? 78.918  -167.458 150.747 1.00 60.06  ? 903  ASN A C     1 
ATOM   6998  O  O     . ASN A  1  903  ? 77.781  -167.004 150.749 1.00 61.10  ? 903  ASN A O     1 
ATOM   6999  C  CB    . ASN A  1  903  ? 80.273  -165.765 149.481 1.00 55.86  ? 903  ASN A CB    1 
ATOM   7000  C  CG    . ASN A  1  903  ? 80.999  -165.298 150.720 1.00 56.10  ? 903  ASN A CG    1 
ATOM   7001  O  OD1   . ASN A  1  903  ? 81.718  -164.306 150.681 1.00 56.69  ? 903  ASN A OD1   1 
ATOM   7002  N  ND2   . ASN A  1  903  ? 80.810  -165.996 151.828 1.00 55.90  ? 903  ASN A ND2   1 
ATOM   7003  N  N     . THR A  1  904  ? 79.420  -168.159 151.760 1.00 62.09  ? 904  THR A N     1 
ATOM   7004  C  CA    . THR A  1  904  ? 78.663  -168.462 152.972 1.00 64.53  ? 904  THR A CA    1 
ATOM   7005  C  C     . THR A  1  904  ? 78.328  -167.235 153.815 1.00 66.61  ? 904  THR A C     1 
ATOM   7006  O  O     . THR A  1  904  ? 77.494  -167.309 154.718 1.00 67.57  ? 904  THR A O     1 
ATOM   7007  C  CB    . THR A  1  904  ? 79.442  -169.469 153.847 1.00 64.30  ? 904  THR A CB    1 
ATOM   7008  O  OG1   . THR A  1  904  ? 79.414  -170.743 153.202 1.00 64.69  ? 904  THR A OG1   1 
ATOM   7009  C  CG2   . THR A  1  904  ? 78.839  -169.601 155.247 1.00 63.76  ? 904  THR A CG2   1 
ATOM   7010  N  N     . ASP A  1  905  ? 78.957  -166.104 153.523 1.00 68.06  ? 905  ASP A N     1 
ATOM   7011  C  CA    . ASP A  1  905  ? 78.700  -164.904 154.309 1.00 70.04  ? 905  ASP A CA    1 
ATOM   7012  C  C     . ASP A  1  905  ? 78.082  -163.733 153.539 1.00 70.67  ? 905  ASP A C     1 
ATOM   7013  O  O     . ASP A  1  905  ? 77.789  -162.686 154.132 1.00 72.14  ? 905  ASP A O     1 
ATOM   7014  C  CB    . ASP A  1  905  ? 79.997  -164.460 154.993 1.00 71.76  ? 905  ASP A CB    1 
ATOM   7015  C  CG    . ASP A  1  905  ? 80.560  -165.529 155.922 1.00 73.20  ? 905  ASP A CG    1 
ATOM   7016  O  OD1   . ASP A  1  905  ? 79.844  -165.928 156.872 1.00 73.36  ? 905  ASP A OD1   1 
ATOM   7017  O  OD2   . ASP A  1  905  ? 81.712  -165.968 155.700 1.00 73.84  ? 905  ASP A OD2   1 
ATOM   7018  N  N     . HIS A  1  906  ? 77.875  -163.906 152.232 1.00 69.18  ? 906  HIS A N     1 
ATOM   7019  C  CA    . HIS A  1  906  ? 77.291  -162.853 151.402 1.00 66.47  ? 906  HIS A CA    1 
ATOM   7020  C  C     . HIS A  1  906  ? 76.164  -163.343 150.499 1.00 64.70  ? 906  HIS A C     1 
ATOM   7021  O  O     . HIS A  1  906  ? 75.935  -162.783 149.433 1.00 63.96  ? 906  HIS A O     1 
ATOM   7022  C  CB    . HIS A  1  906  ? 78.376  -162.180 150.556 1.00 66.97  ? 906  HIS A CB    1 
ATOM   7023  C  CG    . HIS A  1  906  ? 79.352  -161.368 151.353 1.00 68.56  ? 906  HIS A CG    1 
ATOM   7024  N  ND1   . HIS A  1  906  ? 79.577  -161.577 152.698 1.00 68.12  ? 906  HIS A ND1   1 
ATOM   7025  C  CD2   . HIS A  1  906  ? 80.188  -160.367 150.984 1.00 69.56  ? 906  HIS A CD2   1 
ATOM   7026  C  CE1   . HIS A  1  906  ? 80.508  -160.742 153.125 1.00 68.35  ? 906  HIS A CE1   1 
ATOM   7027  N  NE2   . HIS A  1  906  ? 80.895  -159.996 152.105 1.00 70.13  ? 906  HIS A NE2   1 
ATOM   7028  N  N     . THR A  1  907  ? 75.470  -164.396 150.922 1.00 63.61  ? 907  THR A N     1 
ATOM   7029  C  CA    . THR A  1  907  ? 74.338  -164.923 150.162 1.00 62.86  ? 907  THR A CA    1 
ATOM   7030  C  C     . THR A  1  907  ? 73.057  -164.523 150.874 1.00 63.47  ? 907  THR A C     1 
ATOM   7031  O  O     . THR A  1  907  ? 73.072  -164.036 152.012 1.00 63.95  ? 907  THR A O     1 
ATOM   7032  C  CB    . THR A  1  907  ? 74.381  -166.492 150.012 1.00 61.20  ? 907  THR A CB    1 
ATOM   7033  O  OG1   . THR A  1  907  ? 74.595  -166.817 148.639 1.00 60.41  ? 907  THR A OG1   1 
ATOM   7034  C  CG2   . THR A  1  907  ? 73.065  -167.157 150.425 1.00 59.24  ? 907  THR A CG2   1 
ATOM   7035  N  N     . LEU A  1  908  ? 71.942  -164.702 150.190 1.00 63.18  ? 908  LEU A N     1 
ATOM   7036  C  CA    . LEU A  1  908  ? 70.676  -164.385 150.797 1.00 63.06  ? 908  LEU A CA    1 
ATOM   7037  C  C     . LEU A  1  908  ? 70.430  -165.540 151.748 1.00 63.01  ? 908  LEU A C     1 
ATOM   7038  O  O     . LEU A  1  908  ? 70.327  -166.687 151.305 1.00 62.59  ? 908  LEU A O     1 
ATOM   7039  C  CB    . LEU A  1  908  ? 69.586  -164.350 149.731 1.00 62.11  ? 908  LEU A CB    1 
ATOM   7040  C  CG    . LEU A  1  908  ? 70.035  -163.707 148.424 1.00 60.55  ? 908  LEU A CG    1 
ATOM   7041  C  CD1   . LEU A  1  908  ? 68.894  -163.651 147.433 1.00 59.10  ? 908  LEU A CD1   1 
ATOM   7042  C  CD2   . LEU A  1  908  ? 70.550  -162.326 148.733 1.00 61.26  ? 908  LEU A CD2   1 
ATOM   7043  N  N     . ASP A  1  909  ? 70.380  -165.258 153.046 1.00 62.96  ? 909  ASP A N     1 
ATOM   7044  C  CA    . ASP A  1  909  ? 70.106  -166.319 154.006 1.00 64.28  ? 909  ASP A CA    1 
ATOM   7045  C  C     . ASP A  1  909  ? 68.756  -166.928 153.615 1.00 64.13  ? 909  ASP A C     1 
ATOM   7046  O  O     . ASP A  1  909  ? 67.812  -166.204 153.313 1.00 65.25  ? 909  ASP A O     1 
ATOM   7047  C  CB    . ASP A  1  909  ? 70.024  -165.749 155.416 1.00 66.47  ? 909  ASP A CB    1 
ATOM   7048  C  CG    . ASP A  1  909  ? 69.443  -166.736 156.402 1.00 67.65  ? 909  ASP A CG    1 
ATOM   7049  O  OD1   . ASP A  1  909  ? 68.264  -167.110 156.239 1.00 67.35  ? 909  ASP A OD1   1 
ATOM   7050  O  OD2   . ASP A  1  909  ? 70.168  -167.142 157.334 1.00 69.65  ? 909  ASP A OD2   1 
ATOM   7051  N  N     . PRO A  1  910  ? 68.638  -168.264 153.627 1.00 63.28  ? 910  PRO A N     1 
ATOM   7052  C  CA    . PRO A  1  910  ? 67.364  -168.893 153.251 1.00 62.65  ? 910  PRO A CA    1 
ATOM   7053  C  C     . PRO A  1  910  ? 66.110  -168.503 154.044 1.00 61.77  ? 910  PRO A C     1 
ATOM   7054  O  O     . PRO A  1  910  ? 65.021  -169.014 153.770 1.00 61.96  ? 910  PRO A O     1 
ATOM   7055  C  CB    . PRO A  1  910  ? 67.679  -170.387 153.332 1.00 62.54  ? 910  PRO A CB    1 
ATOM   7056  C  CG    . PRO A  1  910  ? 68.727  -170.446 154.384 1.00 63.39  ? 910  PRO A CG    1 
ATOM   7057  C  CD    . PRO A  1  910  ? 69.619  -169.276 154.046 1.00 63.10  ? 910  PRO A CD    1 
ATOM   7058  N  N     . SER A  1  911  ? 66.253  -167.605 155.016 1.00 60.47  ? 911  SER A N     1 
ATOM   7059  C  CA    . SER A  1  911  ? 65.102  -167.161 155.796 1.00 59.27  ? 911  SER A CA    1 
ATOM   7060  C  C     . SER A  1  911  ? 64.366  -166.118 154.958 1.00 58.47  ? 911  SER A C     1 
ATOM   7061  O  O     . SER A  1  911  ? 63.182  -165.855 155.162 1.00 59.01  ? 911  SER A O     1 
ATOM   7062  C  CB    . SER A  1  911  ? 65.539  -166.559 157.146 1.00 58.07  ? 911  SER A CB    1 
ATOM   7063  O  OG    . SER A  1  911  ? 66.327  -165.390 156.986 1.00 56.42  ? 911  SER A OG    1 
ATOM   7064  N  N     . LEU A  1  912  ? 65.080  -165.541 153.999 1.00 57.22  ? 912  LEU A N     1 
ATOM   7065  C  CA    . LEU A  1  912  ? 64.511  -164.531 153.125 1.00 57.60  ? 912  LEU A CA    1 
ATOM   7066  C  C     . LEU A  1  912  ? 63.910  -165.253 151.939 1.00 57.89  ? 912  LEU A C     1 
ATOM   7067  O  O     . LEU A  1  912  ? 62.723  -165.544 151.910 1.00 59.23  ? 912  LEU A O     1 
ATOM   7068  C  CB    . LEU A  1  912  ? 65.600  -163.579 152.640 1.00 56.52  ? 912  LEU A CB    1 
ATOM   7069  C  CG    . LEU A  1  912  ? 66.685  -163.187 153.648 1.00 56.00  ? 912  LEU A CG    1 
ATOM   7070  C  CD1   . LEU A  1  912  ? 67.742  -162.354 152.934 1.00 54.22  ? 912  LEU A CD1   1 
ATOM   7071  C  CD2   . LEU A  1  912  ? 66.084  -162.434 154.835 1.00 54.99  ? 912  LEU A CD2   1 
ATOM   7072  N  N     . LEU A  1  913  ? 64.737  -165.544 150.951 1.00 58.38  ? 913  LEU A N     1 
ATOM   7073  C  CA    . LEU A  1  913  ? 64.252  -166.254 149.789 1.00 59.46  ? 913  LEU A CA    1 
ATOM   7074  C  C     . LEU A  1  913  ? 63.909  -167.684 150.183 1.00 61.30  ? 913  LEU A C     1 
ATOM   7075  O  O     . LEU A  1  913  ? 64.553  -168.269 151.052 1.00 62.71  ? 913  LEU A O     1 
ATOM   7076  C  CB    . LEU A  1  913  ? 65.314  -166.259 148.701 1.00 58.24  ? 913  LEU A CB    1 
ATOM   7077  C  CG    . LEU A  1  913  ? 65.000  -167.174 147.526 1.00 58.35  ? 913  LEU A CG    1 
ATOM   7078  C  CD1   . LEU A  1  913  ? 63.555  -167.009 147.100 1.00 58.34  ? 913  LEU A CD1   1 
ATOM   7079  C  CD2   . LEU A  1  913  ? 65.938  -166.851 146.386 1.00 59.13  ? 913  LEU A CD2   1 
ATOM   7080  N  N     . GLU A  1  914  ? 62.889  -168.241 149.544 1.00 62.31  ? 914  GLU A N     1 
ATOM   7081  C  CA    . GLU A  1  914  ? 62.450  -169.603 149.818 1.00 63.10  ? 914  GLU A CA    1 
ATOM   7082  C  C     . GLU A  1  914  ? 63.489  -170.569 149.290 1.00 63.43  ? 914  GLU A C     1 
ATOM   7083  O  O     . GLU A  1  914  ? 63.946  -171.448 150.008 1.00 64.02  ? 914  GLU A O     1 
ATOM   7084  C  CB    . GLU A  1  914  ? 61.121  -169.852 149.123 1.00 64.91  ? 914  GLU A CB    1 
ATOM   7085  C  CG    . GLU A  1  914  ? 60.208  -170.836 149.813 1.00 66.87  ? 914  GLU A CG    1 
ATOM   7086  C  CD    . GLU A  1  914  ? 58.772  -170.726 149.316 1.00 68.07  ? 914  GLU A CD    1 
ATOM   7087  O  OE1   . GLU A  1  914  ? 58.542  -170.944 148.099 1.00 67.68  ? 914  GLU A OE1   1 
ATOM   7088  O  OE2   . GLU A  1  914  ? 57.879  -170.413 150.144 1.00 68.73  ? 914  GLU A OE2   1 
ATOM   7089  N  N     . SER A  1  915  ? 63.852  -170.399 148.024 1.00 63.16  ? 915  SER A N     1 
ATOM   7090  C  CA    . SER A  1  915  ? 64.862  -171.240 147.390 1.00 63.89  ? 915  SER A CA    1 
ATOM   7091  C  C     . SER A  1  915  ? 66.262  -170.792 147.841 1.00 65.06  ? 915  SER A C     1 
ATOM   7092  O  O     . SER A  1  915  ? 67.222  -170.824 147.063 1.00 63.94  ? 915  SER A O     1 
ATOM   7093  C  CB    . SER A  1  915  ? 64.758  -171.113 145.874 1.00 63.70  ? 915  SER A CB    1 
ATOM   7094  O  OG    . SER A  1  915  ? 65.183  -169.834 145.439 1.00 63.68  ? 915  SER A OG    1 
ATOM   7095  N  N     . GLY A  1  916  ? 66.363  -170.388 149.109 1.00 66.01  ? 916  GLY A N     1 
ATOM   7096  C  CA    . GLY A  1  916  ? 67.617  -169.898 149.666 1.00 66.73  ? 916  GLY A CA    1 
ATOM   7097  C  C     . GLY A  1  916  ? 68.788  -170.853 149.824 1.00 66.66  ? 916  GLY A C     1 
ATOM   7098  O  O     . GLY A  1  916  ? 69.947  -170.479 149.593 1.00 66.31  ? 916  GLY A O     1 
ATOM   7099  N  N     . SER A  1  917  ? 68.498  -172.080 150.237 1.00 66.55  ? 917  SER A N     1 
ATOM   7100  C  CA    . SER A  1  917  ? 69.548  -173.065 150.426 1.00 65.92  ? 917  SER A CA    1 
ATOM   7101  C  C     . SER A  1  917  ? 69.952  -173.640 149.080 1.00 64.36  ? 917  SER A C     1 
ATOM   7102  O  O     . SER A  1  917  ? 71.138  -173.729 148.769 1.00 65.00  ? 917  SER A O     1 
ATOM   7103  C  CB    . SER A  1  917  ? 69.068  -174.193 151.337 1.00 65.61  ? 917  SER A CB    1 
ATOM   7104  O  OG    . SER A  1  917  ? 68.057  -174.935 150.686 1.00 66.03  ? 917  SER A OG    1 
ATOM   7105  N  N     . GLU A  1  918  ? 68.973  -174.015 148.269 1.00 62.46  ? 918  GLU A N     1 
ATOM   7106  C  CA    . GLU A  1  918  ? 69.294  -174.604 146.983 1.00 62.05  ? 918  GLU A CA    1 
ATOM   7107  C  C     . GLU A  1  918  ? 69.860  -173.633 145.977 1.00 59.77  ? 918  GLU A C     1 
ATOM   7108  O  O     . GLU A  1  918  ? 70.081  -173.993 144.823 1.00 58.67  ? 918  GLU A O     1 
ATOM   7109  C  CB    . GLU A  1  918  ? 68.068  -175.274 146.385 1.00 64.94  ? 918  GLU A CB    1 
ATOM   7110  C  CG    . GLU A  1  918  ? 66.913  -174.344 146.112 1.00 69.06  ? 918  GLU A CG    1 
ATOM   7111  C  CD    . GLU A  1  918  ? 65.852  -175.007 145.245 1.00 71.37  ? 918  GLU A CD    1 
ATOM   7112  O  OE1   . GLU A  1  918  ? 66.197  -175.448 144.122 1.00 72.71  ? 918  GLU A OE1   1 
ATOM   7113  O  OE2   . GLU A  1  918  ? 64.682  -175.090 145.684 1.00 73.01  ? 918  GLU A OE2   1 
ATOM   7114  N  N     . ILE A  1  919  ? 70.110  -172.406 146.413 1.00 58.89  ? 919  ILE A N     1 
ATOM   7115  C  CA    . ILE A  1  919  ? 70.640  -171.378 145.518 1.00 57.87  ? 919  ILE A CA    1 
ATOM   7116  C  C     . ILE A  1  919  ? 72.148  -171.121 145.721 1.00 56.98  ? 919  ILE A C     1 
ATOM   7117  O  O     . ILE A  1  919  ? 72.867  -170.753 144.780 1.00 55.41  ? 919  ILE A O     1 
ATOM   7118  C  CB    . ILE A  1  919  ? 69.821  -170.059 145.694 1.00 57.82  ? 919  ILE A CB    1 
ATOM   7119  C  CG1   . ILE A  1  919  ? 69.993  -169.173 144.466 1.00 58.06  ? 919  ILE A CG1   1 
ATOM   7120  C  CG2   . ILE A  1  919  ? 70.255  -169.316 146.948 1.00 56.82  ? 919  ILE A CG2   1 
ATOM   7121  C  CD1   . ILE A  1  919  ? 68.990  -168.052 144.399 1.00 58.61  ? 919  ILE A CD1   1 
ATOM   7122  N  N     . LEU A  1  920  ? 72.609  -171.348 146.953 1.00 55.67  ? 920  LEU A N     1 
ATOM   7123  C  CA    . LEU A  1  920  ? 74.004  -171.166 147.350 1.00 53.40  ? 920  LEU A CA    1 
ATOM   7124  C  C     . LEU A  1  920  ? 74.966  -171.856 146.404 1.00 53.03  ? 920  LEU A C     1 
ATOM   7125  O  O     . LEU A  1  920  ? 74.863  -173.048 146.158 1.00 52.13  ? 920  LEU A O     1 
ATOM   7126  C  CB    . LEU A  1  920  ? 74.220  -171.724 148.756 1.00 52.22  ? 920  LEU A CB    1 
ATOM   7127  C  CG    . LEU A  1  920  ? 75.506  -171.392 149.517 1.00 50.97  ? 920  LEU A CG    1 
ATOM   7128  C  CD1   . LEU A  1  920  ? 75.519  -172.235 150.777 1.00 50.78  ? 920  LEU A CD1   1 
ATOM   7129  C  CD2   . LEU A  1  920  ? 76.741  -171.667 148.695 1.00 49.42  ? 920  LEU A CD2   1 
ATOM   7130  N  N     . GLY A  1  921  ? 75.914  -171.099 145.880 1.00 53.42  ? 921  GLY A N     1 
ATOM   7131  C  CA    . GLY A  1  921  ? 76.886  -171.686 144.988 1.00 54.65  ? 921  GLY A CA    1 
ATOM   7132  C  C     . GLY A  1  921  ? 76.455  -171.743 143.543 1.00 55.67  ? 921  GLY A C     1 
ATOM   7133  O  O     . GLY A  1  921  ? 77.261  -172.049 142.669 1.00 54.90  ? 921  GLY A O     1 
ATOM   7134  N  N     . ASP A  1  922  ? 75.191  -171.453 143.269 1.00 57.55  ? 922  ASP A N     1 
ATOM   7135  C  CA    . ASP A  1  922  ? 74.741  -171.486 141.884 1.00 59.77  ? 922  ASP A CA    1 
ATOM   7136  C  C     . ASP A  1  922  ? 75.536  -170.517 141.003 1.00 59.92  ? 922  ASP A C     1 
ATOM   7137  O  O     . ASP A  1  922  ? 75.396  -169.304 141.122 1.00 60.83  ? 922  ASP A O     1 
ATOM   7138  C  CB    . ASP A  1  922  ? 73.264  -171.133 141.777 1.00 60.46  ? 922  ASP A CB    1 
ATOM   7139  C  CG    . ASP A  1  922  ? 72.747  -171.296 140.358 1.00 62.30  ? 922  ASP A CG    1 
ATOM   7140  O  OD1   . ASP A  1  922  ? 73.419  -170.805 139.419 1.00 62.39  ? 922  ASP A OD1   1 
ATOM   7141  O  OD2   . ASP A  1  922  ? 71.678  -171.921 140.175 1.00 63.70  ? 922  ASP A OD2   1 
ATOM   7142  N  N     . LEU A  1  923  ? 76.351  -171.043 140.100 1.00 59.63  ? 923  LEU A N     1 
ATOM   7143  C  CA    . LEU A  1  923  ? 77.140  -170.172 139.252 1.00 60.29  ? 923  LEU A CA    1 
ATOM   7144  C  C     . LEU A  1  923  ? 76.359  -169.390 138.217 1.00 60.29  ? 923  LEU A C     1 
ATOM   7145  O  O     . LEU A  1  923  ? 76.690  -168.246 137.937 1.00 61.22  ? 923  LEU A O     1 
ATOM   7146  C  CB    . LEU A  1  923  ? 78.240  -170.964 138.561 1.00 60.99  ? 923  LEU A CB    1 
ATOM   7147  C  CG    . LEU A  1  923  ? 79.466  -171.196 139.438 1.00 62.03  ? 923  LEU A CG    1 
ATOM   7148  C  CD1   . LEU A  1  923  ? 80.514  -171.972 138.672 1.00 61.89  ? 923  LEU A CD1   1 
ATOM   7149  C  CD2   . LEU A  1  923  ? 80.024  -169.848 139.877 1.00 63.28  ? 923  LEU A CD2   1 
ATOM   7150  N  N     . LYS A  1  924  ? 75.331  -170.006 137.646 1.00 60.63  ? 924  LYS A N     1 
ATOM   7151  C  CA    . LYS A  1  924  ? 74.496  -169.365 136.620 1.00 60.78  ? 924  LYS A CA    1 
ATOM   7152  C  C     . LYS A  1  924  ? 73.780  -168.088 137.100 1.00 59.59  ? 924  LYS A C     1 
ATOM   7153  O  O     . LYS A  1  924  ? 73.534  -167.158 136.322 1.00 57.63  ? 924  LYS A O     1 
ATOM   7154  C  CB    . LYS A  1  924  ? 73.446  -170.363 136.126 1.00 62.66  ? 924  LYS A CB    1 
ATOM   7155  C  CG    . LYS A  1  924  ? 74.008  -171.629 135.488 1.00 63.85  ? 924  LYS A CG    1 
ATOM   7156  C  CD    . LYS A  1  924  ? 73.869  -171.589 133.968 1.00 64.39  ? 924  LYS A CD    1 
ATOM   7157  C  CE    . LYS A  1  924  ? 74.505  -170.333 133.381 1.00 65.64  ? 924  LYS A CE    1 
ATOM   7158  N  NZ    . LYS A  1  924  ? 74.418  -170.313 131.891 1.00 66.55  ? 924  LYS A NZ    1 
ATOM   7159  N  N     . LEU A  1  925  ? 73.437  -168.065 138.384 1.00 58.24  ? 925  LEU A N     1 
ATOM   7160  C  CA    . LEU A  1  925  ? 72.753  -166.927 138.974 1.00 56.76  ? 925  LEU A CA    1 
ATOM   7161  C  C     . LEU A  1  925  ? 73.702  -165.790 139.307 1.00 56.75  ? 925  LEU A C     1 
ATOM   7162  O  O     . LEU A  1  925  ? 73.390  -164.633 139.034 1.00 57.89  ? 925  LEU A O     1 
ATOM   7163  C  CB    . LEU A  1  925  ? 71.993  -167.347 140.236 1.00 54.96  ? 925  LEU A CB    1 
ATOM   7164  C  CG    . LEU A  1  925  ? 70.865  -168.348 139.975 1.00 53.80  ? 925  LEU A CG    1 
ATOM   7165  C  CD1   . LEU A  1  925  ? 69.954  -168.404 141.185 1.00 53.15  ? 925  LEU A CD1   1 
ATOM   7166  C  CD2   . LEU A  1  925  ? 70.074  -167.942 138.736 1.00 52.89  ? 925  LEU A CD2   1 
ATOM   7167  N  N     . GLN A  1  926  ? 74.852  -166.102 139.900 1.00 55.24  ? 926  GLN A N     1 
ATOM   7168  C  CA    . GLN A  1  926  ? 75.801  -165.054 140.233 1.00 52.92  ? 926  GLN A CA    1 
ATOM   7169  C  C     . GLN A  1  926  ? 76.155  -164.268 138.994 1.00 53.63  ? 926  GLN A C     1 
ATOM   7170  O  O     . GLN A  1  926  ? 76.692  -163.168 139.100 1.00 54.62  ? 926  GLN A O     1 
ATOM   7171  C  CB    . GLN A  1  926  ? 77.062  -165.620 140.857 1.00 51.16  ? 926  GLN A CB    1 
ATOM   7172  C  CG    . GLN A  1  926  ? 76.954  -165.746 142.347 1.00 50.10  ? 926  GLN A CG    1 
ATOM   7173  C  CD    . GLN A  1  926  ? 76.626  -164.433 143.011 1.00 48.69  ? 926  GLN A CD    1 
ATOM   7174  O  OE1   . GLN A  1  926  ? 77.449  -163.525 143.077 1.00 46.73  ? 926  GLN A OE1   1 
ATOM   7175  N  NE2   . GLN A  1  926  ? 75.409  -164.325 143.502 1.00 50.45  ? 926  GLN A NE2   1 
ATOM   7176  N  N     . VAL A  1  927  ? 75.856  -164.819 137.818 1.00 52.98  ? 927  VAL A N     1 
ATOM   7177  C  CA    . VAL A  1  927  ? 76.137  -164.104 136.579 1.00 52.50  ? 927  VAL A CA    1 
ATOM   7178  C  C     . VAL A  1  927  ? 75.184  -162.925 136.517 1.00 52.44  ? 927  VAL A C     1 
ATOM   7179  O  O     . VAL A  1  927  ? 75.574  -161.821 136.133 1.00 53.54  ? 927  VAL A O     1 
ATOM   7180  C  CB    . VAL A  1  927  ? 75.890  -164.957 135.346 1.00 52.91  ? 927  VAL A CB    1 
ATOM   7181  C  CG1   . VAL A  1  927  ? 76.219  -164.150 134.096 1.00 52.59  ? 927  VAL A CG1   1 
ATOM   7182  C  CG2   . VAL A  1  927  ? 76.724  -166.213 135.414 1.00 54.55  ? 927  VAL A CG2   1 
ATOM   7183  N  N     . LEU A  1  928  ? 73.927  -163.175 136.888 1.00 51.06  ? 928  LEU A N     1 
ATOM   7184  C  CA    . LEU A  1  928  ? 72.898  -162.142 136.908 1.00 48.29  ? 928  LEU A CA    1 
ATOM   7185  C  C     . LEU A  1  928  ? 73.113  -161.245 138.119 1.00 46.81  ? 928  LEU A C     1 
ATOM   7186  O  O     . LEU A  1  928  ? 73.164  -160.036 137.978 1.00 47.77  ? 928  LEU A O     1 
ATOM   7187  C  CB    . LEU A  1  928  ? 71.503  -162.773 136.957 1.00 46.49  ? 928  LEU A CB    1 
ATOM   7188  C  CG    . LEU A  1  928  ? 71.013  -163.454 135.674 1.00 44.92  ? 928  LEU A CG    1 
ATOM   7189  C  CD1   . LEU A  1  928  ? 69.713  -164.182 135.933 1.00 43.29  ? 928  LEU A CD1   1 
ATOM   7190  C  CD2   . LEU A  1  928  ? 70.825  -162.415 134.583 1.00 45.34  ? 928  LEU A CD2   1 
ATOM   7191  N  N     . LEU A  1  929  ? 73.247  -161.830 139.302 1.00 45.44  ? 929  LEU A N     1 
ATOM   7192  C  CA    . LEU A  1  929  ? 73.473  -161.039 140.500 1.00 46.70  ? 929  LEU A CA    1 
ATOM   7193  C  C     . LEU A  1  929  ? 74.704  -160.159 140.352 1.00 48.31  ? 929  LEU A C     1 
ATOM   7194  O  O     . LEU A  1  929  ? 74.778  -159.090 140.950 1.00 49.29  ? 929  LEU A O     1 
ATOM   7195  C  CB    . LEU A  1  929  ? 73.649  -161.942 141.717 1.00 46.09  ? 929  LEU A CB    1 
ATOM   7196  C  CG    . LEU A  1  929  ? 72.371  -162.548 142.278 1.00 44.83  ? 929  LEU A CG    1 
ATOM   7197  C  CD1   . LEU A  1  929  ? 71.588  -161.479 142.996 1.00 43.75  ? 929  LEU A CD1   1 
ATOM   7198  C  CD2   . LEU A  1  929  ? 71.559  -163.158 141.156 1.00 43.99  ? 929  LEU A CD2   1 
ATOM   7199  N  N     . ASP A  1  930  ? 75.680  -160.606 139.570 1.00 50.04  ? 930  ASP A N     1 
ATOM   7200  C  CA    . ASP A  1  930  ? 76.886  -159.807 139.373 1.00 52.51  ? 930  ASP A CA    1 
ATOM   7201  C  C     . ASP A  1  930  ? 76.627  -158.767 138.293 1.00 53.09  ? 930  ASP A C     1 
ATOM   7202  O  O     . ASP A  1  930  ? 77.216  -157.695 138.292 1.00 54.38  ? 930  ASP A O     1 
ATOM   7203  C  CB    . ASP A  1  930  ? 78.081  -160.680 138.963 1.00 54.33  ? 930  ASP A CB    1 
ATOM   7204  C  CG    . ASP A  1  930  ? 78.719  -161.411 140.140 1.00 55.54  ? 930  ASP A CG    1 
ATOM   7205  O  OD1   . ASP A  1  930  ? 78.487  -161.006 141.306 1.00 56.09  ? 930  ASP A OD1   1 
ATOM   7206  O  OD2   . ASP A  1  930  ? 79.471  -162.380 139.886 1.00 55.21  ? 930  ASP A OD2   1 
ATOM   7207  N  N     . GLU A  1  931  ? 75.746  -159.103 137.365 1.00 52.98  ? 931  GLU A N     1 
ATOM   7208  C  CA    . GLU A  1  931  ? 75.376  -158.206 136.287 1.00 52.72  ? 931  GLU A CA    1 
ATOM   7209  C  C     . GLU A  1  931  ? 74.588  -157.063 136.929 1.00 51.61  ? 931  GLU A C     1 
ATOM   7210  O  O     . GLU A  1  931  ? 74.749  -155.904 136.556 1.00 49.55  ? 931  GLU A O     1 
ATOM   7211  C  CB    . GLU A  1  931  ? 74.495  -158.973 135.322 1.00 56.81  ? 931  GLU A CB    1 
ATOM   7212  C  CG    . GLU A  1  931  ? 74.394  -158.430 133.925 1.00 62.20  ? 931  GLU A CG    1 
ATOM   7213  C  CD    . GLU A  1  931  ? 73.405  -159.254 133.101 1.00 66.20  ? 931  GLU A CD    1 
ATOM   7214  O  OE1   . GLU A  1  931  ? 73.497  -160.507 133.143 1.00 67.51  ? 931  GLU A OE1   1 
ATOM   7215  O  OE2   . GLU A  1  931  ? 72.535  -158.656 132.418 1.00 68.27  ? 931  GLU A OE2   1 
ATOM   7216  N  N     . GLU A  1  932  ? 73.740  -157.418 137.900 1.00 51.09  ? 932  GLU A N     1 
ATOM   7217  C  CA    . GLU A  1  932  ? 72.914  -156.463 138.642 1.00 49.91  ? 932  GLU A CA    1 
ATOM   7218  C  C     . GLU A  1  932  ? 73.792  -155.545 139.472 1.00 49.91  ? 932  GLU A C     1 
ATOM   7219  O  O     . GLU A  1  932  ? 73.765  -154.329 139.300 1.00 50.86  ? 932  GLU A O     1 
ATOM   7220  C  CB    . GLU A  1  932  ? 71.935  -157.163 139.605 1.00 49.35  ? 932  GLU A CB    1 
ATOM   7221  C  CG    . GLU A  1  932  ? 71.428  -156.201 140.701 1.00 52.04  ? 932  GLU A CG    1 
ATOM   7222  C  CD    . GLU A  1  932  ? 70.783  -156.866 141.935 1.00 54.25  ? 932  GLU A CD    1 
ATOM   7223  O  OE1   . GLU A  1  932  ? 69.627  -157.343 141.819 1.00 54.73  ? 932  GLU A OE1   1 
ATOM   7224  O  OE2   . GLU A  1  932  ? 71.426  -156.891 143.025 1.00 53.67  ? 932  GLU A OE2   1 
ATOM   7225  N  N     . TYR A  1  933  ? 74.561  -156.129 140.384 1.00 49.03  ? 933  TYR A N     1 
ATOM   7226  C  CA    . TYR A  1  933  ? 75.425  -155.343 141.253 1.00 48.42  ? 933  TYR A CA    1 
ATOM   7227  C  C     . TYR A  1  933  ? 76.434  -154.514 140.468 1.00 48.52  ? 933  TYR A C     1 
ATOM   7228  O  O     . TYR A  1  933  ? 77.032  -153.592 141.015 1.00 48.61  ? 933  TYR A O     1 
ATOM   7229  C  CB    . TYR A  1  933  ? 76.168  -156.249 142.231 1.00 47.67  ? 933  TYR A CB    1 
ATOM   7230  C  CG    . TYR A  1  933  ? 76.942  -155.491 143.273 1.00 46.08  ? 933  TYR A CG    1 
ATOM   7231  C  CD1   . TYR A  1  933  ? 76.418  -155.297 144.540 1.00 47.41  ? 933  TYR A CD1   1 
ATOM   7232  C  CD2   . TYR A  1  933  ? 78.196  -154.955 142.993 1.00 44.76  ? 933  TYR A CD2   1 
ATOM   7233  C  CE1   . TYR A  1  933  ? 77.130  -154.582 145.518 1.00 46.74  ? 933  TYR A CE1   1 
ATOM   7234  C  CE2   . TYR A  1  933  ? 78.912  -154.241 143.956 1.00 44.90  ? 933  TYR A CE2   1 
ATOM   7235  C  CZ    . TYR A  1  933  ? 78.375  -154.061 145.220 1.00 45.11  ? 933  TYR A CZ    1 
ATOM   7236  O  OH    . TYR A  1  933  ? 79.080  -153.397 146.200 1.00 43.60  ? 933  TYR A OH    1 
ATOM   7237  N  N     . LYS A  1  934  ? 76.628  -154.840 139.192 1.00 48.65  ? 934  LYS A N     1 
ATOM   7238  C  CA    . LYS A  1  934  ? 77.570  -154.096 138.355 1.00 48.66  ? 934  LYS A CA    1 
ATOM   7239  C  C     . LYS A  1  934  ? 76.901  -152.812 137.925 1.00 47.86  ? 934  LYS A C     1 
ATOM   7240  O  O     . LYS A  1  934  ? 77.512  -151.745 137.963 1.00 47.43  ? 934  LYS A O     1 
ATOM   7241  C  CB    . LYS A  1  934  ? 77.958  -154.904 137.119 1.00 51.39  ? 934  LYS A CB    1 
ATOM   7242  C  CG    . LYS A  1  934  ? 79.035  -154.266 136.242 1.00 54.04  ? 934  LYS A CG    1 
ATOM   7243  C  CD    . LYS A  1  934  ? 79.456  -155.226 135.132 1.00 56.30  ? 934  LYS A CD    1 
ATOM   7244  C  CE    . LYS A  1  934  ? 79.979  -156.539 135.725 1.00 58.92  ? 934  LYS A CE    1 
ATOM   7245  N  NZ    . LYS A  1  934  ? 79.566  -157.743 134.931 1.00 60.42  ? 934  LYS A NZ    1 
ATOM   7246  N  N     . GLN A  1  935  ? 75.639  -152.927 137.514 1.00 47.23  ? 935  GLN A N     1 
ATOM   7247  C  CA    . GLN A  1  935  ? 74.857  -151.767 137.090 1.00 45.47  ? 935  GLN A CA    1 
ATOM   7248  C  C     . GLN A  1  935  ? 74.684  -150.820 138.270 1.00 43.50  ? 935  GLN A C     1 
ATOM   7249  O  O     . GLN A  1  935  ? 74.997  -149.635 138.155 1.00 43.36  ? 935  GLN A O     1 
ATOM   7250  C  CB    . GLN A  1  935  ? 73.482  -152.187 136.579 1.00 46.28  ? 935  GLN A CB    1 
ATOM   7251  C  CG    . GLN A  1  935  ? 72.679  -151.053 135.950 1.00 48.75  ? 935  GLN A CG    1 
ATOM   7252  C  CD    . GLN A  1  935  ? 73.255  -150.575 134.617 1.00 52.14  ? 935  GLN A CD    1 
ATOM   7253  O  OE1   . GLN A  1  935  ? 73.782  -151.371 133.840 1.00 54.13  ? 935  GLN A OE1   1 
ATOM   7254  N  NE2   . GLN A  1  935  ? 73.132  -149.272 134.339 1.00 53.06  ? 935  GLN A NE2   1 
ATOM   7255  N  N     . LEU A  1  936  ? 74.196  -151.344 139.398 1.00 40.75  ? 936  LEU A N     1 
ATOM   7256  C  CA    . LEU A  1  936  ? 73.992  -150.529 140.597 1.00 38.91  ? 936  LEU A CA    1 
ATOM   7257  C  C     . LEU A  1  936  ? 75.211  -149.660 140.877 1.00 38.57  ? 936  LEU A C     1 
ATOM   7258  O  O     . LEU A  1  936  ? 75.101  -148.463 141.159 1.00 38.41  ? 936  LEU A O     1 
ATOM   7259  C  CB    . LEU A  1  936  ? 73.740  -151.400 141.830 1.00 36.64  ? 936  LEU A CB    1 
ATOM   7260  C  CG    . LEU A  1  936  ? 72.659  -152.473 141.867 1.00 35.58  ? 936  LEU A CG    1 
ATOM   7261  C  CD1   . LEU A  1  936  ? 72.137  -152.510 143.285 1.00 31.12  ? 936  LEU A CD1   1 
ATOM   7262  C  CD2   . LEU A  1  936  ? 71.531  -152.192 140.864 1.00 34.98  ? 936  LEU A CD2   1 
ATOM   7263  N  N     . VAL A  1  937  ? 76.379  -150.280 140.798 1.00 38.65  ? 937  VAL A N     1 
ATOM   7264  C  CA    . VAL A  1  937  ? 77.623  -149.584 141.052 1.00 39.69  ? 937  VAL A CA    1 
ATOM   7265  C  C     . VAL A  1  937  ? 77.912  -148.567 139.939 1.00 39.92  ? 937  VAL A C     1 
ATOM   7266  O  O     . VAL A  1  937  ? 78.461  -147.494 140.204 1.00 39.13  ? 937  VAL A O     1 
ATOM   7267  C  CB    . VAL A  1  937  ? 78.790  -150.593 141.185 1.00 39.53  ? 937  VAL A CB    1 
ATOM   7268  C  CG1   . VAL A  1  937  ? 79.403  -150.866 139.816 1.00 39.88  ? 937  VAL A CG1   1 
ATOM   7269  C  CG2   . VAL A  1  937  ? 79.819  -150.078 142.189 1.00 39.23  ? 937  VAL A CG2   1 
ATOM   7270  N  N     . LYS A  1  938  ? 77.549  -148.898 138.699 1.00 39.76  ? 938  LYS A N     1 
ATOM   7271  C  CA    . LYS A  1  938  ? 77.763  -147.968 137.598 1.00 39.98  ? 938  LYS A CA    1 
ATOM   7272  C  C     . LYS A  1  938  ? 76.868  -146.762 137.809 1.00 41.51  ? 938  LYS A C     1 
ATOM   7273  O  O     . LYS A  1  938  ? 77.290  -145.621 137.618 1.00 42.05  ? 938  LYS A O     1 
ATOM   7274  C  CB    . LYS A  1  938  ? 77.402  -148.569 136.249 1.00 38.86  ? 938  LYS A CB    1 
ATOM   7275  C  CG    . LYS A  1  938  ? 77.364  -147.481 135.203 1.00 37.84  ? 938  LYS A CG    1 
ATOM   7276  C  CD    . LYS A  1  938  ? 76.498  -147.811 134.032 1.00 38.56  ? 938  LYS A CD    1 
ATOM   7277  C  CE    . LYS A  1  938  ? 77.230  -148.659 133.038 1.00 38.57  ? 938  LYS A CE    1 
ATOM   7278  N  NZ    . LYS A  1  938  ? 76.523  -148.598 131.734 1.00 39.44  ? 938  LYS A NZ    1 
ATOM   7279  N  N     . ASP A  1  939  ? 75.616  -147.024 138.170 1.00 42.58  ? 939  ASP A N     1 
ATOM   7280  C  CA    . ASP A  1  939  ? 74.660  -145.958 138.437 1.00 43.43  ? 939  ASP A CA    1 
ATOM   7281  C  C     . ASP A  1  939  ? 75.280  -145.003 139.449 1.00 43.82  ? 939  ASP A C     1 
ATOM   7282  O  O     . ASP A  1  939  ? 75.414  -143.809 139.189 1.00 42.89  ? 939  ASP A O     1 
ATOM   7283  C  CB    . ASP A  1  939  ? 73.360  -146.545 138.988 1.00 44.86  ? 939  ASP A CB    1 
ATOM   7284  C  CG    . ASP A  1  939  ? 72.564  -147.288 137.924 1.00 46.44  ? 939  ASP A CG    1 
ATOM   7285  O  OD1   . ASP A  1  939  ? 73.058  -147.396 136.774 1.00 45.87  ? 939  ASP A OD1   1 
ATOM   7286  O  OD2   . ASP A  1  939  ? 71.446  -147.760 138.238 1.00 47.25  ? 939  ASP A OD2   1 
ATOM   7287  N  N     . ARG A  1  940  ? 75.672  -145.548 140.596 1.00 43.90  ? 940  ARG A N     1 
ATOM   7288  C  CA    . ARG A  1  940  ? 76.296  -144.770 141.655 1.00 44.70  ? 940  ARG A CA    1 
ATOM   7289  C  C     . ARG A  1  940  ? 77.354  -143.798 141.149 1.00 45.95  ? 940  ARG A C     1 
ATOM   7290  O  O     . ARG A  1  940  ? 77.468  -142.676 141.639 1.00 46.12  ? 940  ARG A O     1 
ATOM   7291  C  CB    . ARG A  1  940  ? 76.938  -145.711 142.658 1.00 44.13  ? 940  ARG A CB    1 
ATOM   7292  C  CG    . ARG A  1  940  ? 77.527  -145.048 143.878 1.00 43.17  ? 940  ARG A CG    1 
ATOM   7293  C  CD    . ARG A  1  940  ? 77.725  -146.135 144.883 1.00 43.59  ? 940  ARG A CD    1 
ATOM   7294  N  NE    . ARG A  1  940  ? 77.822  -145.640 146.239 1.00 45.47  ? 940  ARG A NE    1 
ATOM   7295  C  CZ    . ARG A  1  940  ? 78.953  -145.234 146.787 1.00 47.65  ? 940  ARG A CZ    1 
ATOM   7296  N  NH1   . ARG A  1  940  ? 80.070  -145.274 146.062 1.00 48.44  ? 940  ARG A NH1   1 
ATOM   7297  N  NH2   . ARG A  1  940  ? 78.965  -144.815 148.053 1.00 46.56  ? 940  ARG A NH2   1 
ATOM   7298  N  N     . LYS A  1  941  ? 78.150  -144.225 140.180 1.00 47.34  ? 941  LYS A N     1 
ATOM   7299  C  CA    . LYS A  1  941  ? 79.176  -143.340 139.672 1.00 48.93  ? 941  LYS A CA    1 
ATOM   7300  C  C     . LYS A  1  941  ? 78.513  -142.308 138.787 1.00 48.81  ? 941  LYS A C     1 
ATOM   7301  O  O     . LYS A  1  941  ? 78.823  -141.123 138.881 1.00 50.91  ? 941  LYS A O     1 
ATOM   7302  C  CB    . LYS A  1  941  ? 80.253  -144.127 138.921 1.00 50.10  ? 941  LYS A CB    1 
ATOM   7303  C  CG    . LYS A  1  941  ? 80.933  -145.220 139.798 1.00 55.76  ? 941  LYS A CG    1 
ATOM   7304  C  CD    . LYS A  1  941  ? 81.659  -144.674 141.074 1.00 57.96  ? 941  LYS A CD    1 
ATOM   7305  C  CE    . LYS A  1  941  ? 81.033  -145.133 142.437 1.00 58.91  ? 941  LYS A CE    1 
ATOM   7306  N  NZ    . LYS A  1  941  ? 81.148  -146.591 142.803 1.00 57.29  ? 941  LYS A NZ    1 
ATOM   7307  N  N     . PHE A  1  942  ? 77.573  -142.740 137.953 1.00 47.66  ? 942  PHE A N     1 
ATOM   7308  C  CA    . PHE A  1  942  ? 76.866  -141.807 137.075 1.00 46.35  ? 942  PHE A CA    1 
ATOM   7309  C  C     . PHE A  1  942  ? 76.093  -140.734 137.843 1.00 45.66  ? 942  PHE A C     1 
ATOM   7310  O  O     . PHE A  1  942  ? 75.977  -139.608 137.375 1.00 45.38  ? 942  PHE A O     1 
ATOM   7311  C  CB    . PHE A  1  942  ? 75.879  -142.537 136.177 1.00 46.32  ? 942  PHE A CB    1 
ATOM   7312  C  CG    . PHE A  1  942  ? 75.025  -141.616 135.349 1.00 44.10  ? 942  PHE A CG    1 
ATOM   7313  C  CD1   . PHE A  1  942  ? 75.434  -141.217 134.084 1.00 43.93  ? 942  PHE A CD1   1 
ATOM   7314  C  CD2   . PHE A  1  942  ? 73.816  -141.147 135.839 1.00 42.55  ? 942  PHE A CD2   1 
ATOM   7315  C  CE1   . PHE A  1  942  ? 74.651  -140.366 133.315 1.00 42.77  ? 942  PHE A CE1   1 
ATOM   7316  C  CE2   . PHE A  1  942  ? 73.030  -140.298 135.080 1.00 42.61  ? 942  PHE A CE2   1 
ATOM   7317  C  CZ    . PHE A  1  942  ? 73.446  -139.906 133.814 1.00 42.21  ? 942  PHE A CZ    1 
ATOM   7318  N  N     . LEU A  1  943  ? 75.530  -141.085 138.995 1.00 44.36  ? 943  LEU A N     1 
ATOM   7319  C  CA    . LEU A  1  943  ? 74.798  -140.096 139.765 1.00 42.98  ? 943  LEU A CA    1 
ATOM   7320  C  C     . LEU A  1  943  ? 75.785  -139.102 140.335 1.00 43.56  ? 943  LEU A C     1 
ATOM   7321  O  O     . LEU A  1  943  ? 75.590  -137.896 140.233 1.00 44.13  ? 943  LEU A O     1 
ATOM   7322  C  CB    . LEU A  1  943  ? 74.013  -140.730 140.910 1.00 40.31  ? 943  LEU A CB    1 
ATOM   7323  C  CG    . LEU A  1  943  ? 72.834  -141.657 140.609 1.00 39.43  ? 943  LEU A CG    1 
ATOM   7324  C  CD1   . LEU A  1  943  ? 71.927  -141.618 141.820 1.00 39.12  ? 943  LEU A CD1   1 
ATOM   7325  C  CD2   . LEU A  1  943  ? 72.057  -141.238 139.381 1.00 36.80  ? 943  LEU A CD2   1 
ATOM   7326  N  N     . ARG A  1  944  ? 76.855  -139.607 140.931 1.00 44.51  ? 944  ARG A N     1 
ATOM   7327  C  CA    . ARG A  1  944  ? 77.860  -138.731 141.513 1.00 46.30  ? 944  ARG A CA    1 
ATOM   7328  C  C     . ARG A  1  944  ? 78.483  -137.825 140.446 1.00 48.15  ? 944  ARG A C     1 
ATOM   7329  O  O     . ARG A  1  944  ? 79.191  -136.861 140.765 1.00 48.30  ? 944  ARG A O     1 
ATOM   7330  C  CB    . ARG A  1  944  ? 78.937  -139.565 142.213 1.00 44.38  ? 944  ARG A CB    1 
ATOM   7331  C  CG    . ARG A  1  944  ? 78.443  -140.273 143.450 1.00 42.08  ? 944  ARG A CG    1 
ATOM   7332  C  CD    . ARG A  1  944  ? 79.558  -140.997 144.150 1.00 41.99  ? 944  ARG A CD    1 
ATOM   7333  N  NE    . ARG A  1  944  ? 79.180  -141.352 145.513 1.00 42.84  ? 944  ARG A NE    1 
ATOM   7334  C  CZ    . ARG A  1  944  ? 80.047  -141.517 146.511 1.00 43.94  ? 944  ARG A CZ    1 
ATOM   7335  N  NH1   . ARG A  1  944  ? 81.349  -141.360 146.291 1.00 44.19  ? 944  ARG A NH1   1 
ATOM   7336  N  NH2   . ARG A  1  944  ? 79.617  -141.819 147.735 1.00 43.29  ? 944  ARG A NH2   1 
ATOM   7337  N  N     . GLU A  1  945  ? 78.191  -138.131 139.183 1.00 50.00  ? 945  GLU A N     1 
ATOM   7338  C  CA    . GLU A  1  945  ? 78.708  -137.376 138.046 1.00 52.76  ? 945  GLU A CA    1 
ATOM   7339  C  C     . GLU A  1  945  ? 77.765  -136.227 137.690 1.00 53.19  ? 945  GLU A C     1 
ATOM   7340  O  O     . GLU A  1  945  ? 78.204  -135.127 137.349 1.00 53.75  ? 945  GLU A O     1 
ATOM   7341  C  CB    . GLU A  1  945  ? 78.854  -138.314 136.851 1.00 55.13  ? 945  GLU A CB    1 
ATOM   7342  C  CG    . GLU A  1  945  ? 80.043  -138.033 135.952 1.00 61.21  ? 945  GLU A CG    1 
ATOM   7343  C  CD    . GLU A  1  945  ? 80.282  -139.145 134.917 1.00 65.15  ? 945  GLU A CD    1 
ATOM   7344  O  OE1   . GLU A  1  945  ? 79.470  -139.274 133.966 1.00 66.53  ? 945  GLU A OE1   1 
ATOM   7345  O  OE2   . GLU A  1  945  ? 81.283  -139.894 135.061 1.00 66.20  ? 945  GLU A OE2   1 
ATOM   7346  N  N     . VAL A  1  946  ? 76.465  -136.502 137.778 1.00 53.37  ? 946  VAL A N     1 
ATOM   7347  C  CA    . VAL A  1  946  ? 75.406  -135.539 137.479 1.00 52.08  ? 946  VAL A CA    1 
ATOM   7348  C  C     . VAL A  1  946  ? 75.184  -134.582 138.637 1.00 51.78  ? 946  VAL A C     1 
ATOM   7349  O  O     . VAL A  1  946  ? 75.063  -133.379 138.442 1.00 51.92  ? 946  VAL A O     1 
ATOM   7350  C  CB    . VAL A  1  946  ? 74.083  -136.262 137.199 1.00 51.58  ? 946  VAL A CB    1 
ATOM   7351  C  CG1   . VAL A  1  946  ? 72.949  -135.275 137.181 1.00 52.26  ? 946  VAL A CG1   1 
ATOM   7352  C  CG2   . VAL A  1  946  ? 74.168  -136.991 135.878 1.00 51.17  ? 946  VAL A CG2   1 
ATOM   7353  N  N     . PHE A  1  947  ? 75.119  -135.134 139.840 1.00 52.11  ? 947  PHE A N     1 
ATOM   7354  C  CA    . PHE A  1  947  ? 74.911  -134.348 141.050 1.00 53.49  ? 947  PHE A CA    1 
ATOM   7355  C  C     . PHE A  1  947  ? 76.200  -134.259 141.871 1.00 54.22  ? 947  PHE A C     1 
ATOM   7356  O  O     . PHE A  1  947  ? 76.216  -134.664 143.038 1.00 54.59  ? 947  PHE A O     1 
ATOM   7357  C  CB    . PHE A  1  947  ? 73.814  -134.993 141.906 1.00 53.88  ? 947  PHE A CB    1 
ATOM   7358  C  CG    . PHE A  1  947  ? 72.471  -135.055 141.236 1.00 53.73  ? 947  PHE A CG    1 
ATOM   7359  C  CD1   . PHE A  1  947  ? 71.543  -136.008 141.610 1.00 53.07  ? 947  PHE A CD1   1 
ATOM   7360  C  CD2   . PHE A  1  947  ? 72.123  -134.145 140.251 1.00 54.10  ? 947  PHE A CD2   1 
ATOM   7361  C  CE1   . PHE A  1  947  ? 70.291  -136.053 141.012 1.00 53.63  ? 947  PHE A CE1   1 
ATOM   7362  C  CE2   . PHE A  1  947  ? 70.866  -134.185 139.651 1.00 53.91  ? 947  PHE A CE2   1 
ATOM   7363  C  CZ    . PHE A  1  947  ? 69.952  -135.138 140.032 1.00 53.00  ? 947  PHE A CZ    1 
ATOM   7364  N  N     . VAL A  1  948  ? 77.266  -133.736 141.256 1.00 54.25  ? 948  VAL A N     1 
ATOM   7365  C  CA    . VAL A  1  948  ? 78.584  -133.582 141.895 1.00 53.20  ? 948  VAL A CA    1 
ATOM   7366  C  C     . VAL A  1  948  ? 78.474  -133.335 143.381 1.00 53.22  ? 948  VAL A C     1 
ATOM   7367  O  O     . VAL A  1  948  ? 79.142  -133.955 144.205 1.00 52.15  ? 948  VAL A O     1 
ATOM   7368  C  CB    . VAL A  1  948  ? 79.349  -132.404 141.303 1.00 52.04  ? 948  VAL A CB    1 
ATOM   7369  C  CG1   . VAL A  1  948  ? 80.596  -132.152 142.115 1.00 51.78  ? 948  VAL A CG1   1 
ATOM   7370  C  CG2   . VAL A  1  948  ? 79.711  -132.695 139.856 1.00 52.47  ? 948  VAL A CG2   1 
ATOM   7371  N  N     . ASP A  1  949  ? 77.617  -132.385 143.687 1.00 54.86  ? 949  ASP A N     1 
ATOM   7372  C  CA    . ASP A  1  949  ? 77.312  -131.974 145.036 1.00 57.36  ? 949  ASP A CA    1 
ATOM   7373  C  C     . ASP A  1  949  ? 77.228  -133.150 146.010 1.00 56.97  ? 949  ASP A C     1 
ATOM   7374  O  O     . ASP A  1  949  ? 77.761  -133.102 147.120 1.00 56.18  ? 949  ASP A O     1 
ATOM   7375  C  CB    . ASP A  1  949  ? 75.975  -131.241 144.993 1.00 60.45  ? 949  ASP A CB    1 
ATOM   7376  C  CG    . ASP A  1  949  ? 75.511  -130.815 146.344 1.00 63.72  ? 949  ASP A CG    1 
ATOM   7377  O  OD1   . ASP A  1  949  ? 74.275  -130.723 146.532 1.00 66.31  ? 949  ASP A OD1   1 
ATOM   7378  O  OD2   . ASP A  1  949  ? 76.384  -130.566 147.209 1.00 65.31  ? 949  ASP A OD2   1 
ATOM   7379  N  N     . GLY A  1  950  ? 76.549  -134.204 145.572 1.00 57.93  ? 950  GLY A N     1 
ATOM   7380  C  CA    . GLY A  1  950  ? 76.348  -135.376 146.402 1.00 58.28  ? 950  GLY A CA    1 
ATOM   7381  C  C     . GLY A  1  950  ? 74.894  -135.412 146.850 1.00 58.80  ? 950  GLY A C     1 
ATOM   7382  O  O     . GLY A  1  950  ? 74.450  -136.366 147.489 1.00 59.27  ? 950  GLY A O     1 
ATOM   7383  N  N     . GLU A  1  951  ? 74.148  -134.366 146.497 1.00 58.80  ? 951  GLU A N     1 
ATOM   7384  C  CA    . GLU A  1  951  ? 72.737  -134.245 146.864 1.00 57.44  ? 951  GLU A CA    1 
ATOM   7385  C  C     . GLU A  1  951  ? 71.927  -135.398 146.328 1.00 55.74  ? 951  GLU A C     1 
ATOM   7386  O  O     . GLU A  1  951  ? 71.872  -135.611 145.119 1.00 55.68  ? 951  GLU A O     1 
ATOM   7387  C  CB    . GLU A  1  951  ? 72.144  -132.949 146.327 1.00 58.95  ? 951  GLU A CB    1 
ATOM   7388  C  CG    . GLU A  1  951  ? 70.759  -132.690 146.885 1.00 60.82  ? 951  GLU A CG    1 
ATOM   7389  C  CD    . GLU A  1  951  ? 70.765  -132.629 148.400 1.00 62.09  ? 951  GLU A CD    1 
ATOM   7390  O  OE1   . GLU A  1  951  ? 71.348  -131.668 148.952 1.00 62.13  ? 951  GLU A OE1   1 
ATOM   7391  O  OE2   . GLU A  1  951  ? 70.199  -133.547 149.035 1.00 62.80  ? 951  GLU A OE2   1 
ATOM   7392  N  N     . ALA A  1  952  ? 71.265  -136.110 147.234 1.00 54.14  ? 952  ALA A N     1 
ATOM   7393  C  CA    . ALA A  1  952  ? 70.475  -137.285 146.872 1.00 52.94  ? 952  ALA A CA    1 
ATOM   7394  C  C     . ALA A  1  952  ? 68.952  -137.130 146.731 1.00 51.62  ? 952  ALA A C     1 
ATOM   7395  O  O     . ALA A  1  952  ? 68.279  -138.061 146.272 1.00 51.49  ? 952  ALA A O     1 
ATOM   7396  C  CB    . ALA A  1  952  ? 70.781  -138.416 147.855 1.00 52.96  ? 952  ALA A CB    1 
ATOM   7397  N  N     . ASN A  1  953  ? 68.397  -135.985 147.116 1.00 48.72  ? 953  ASN A N     1 
ATOM   7398  C  CA    . ASN A  1  953  ? 66.962  -135.818 146.999 1.00 45.65  ? 953  ASN A CA    1 
ATOM   7399  C  C     . ASN A  1  953  ? 66.554  -134.989 145.829 1.00 44.61  ? 953  ASN A C     1 
ATOM   7400  O  O     . ASN A  1  953  ? 66.926  -133.823 145.713 1.00 46.59  ? 953  ASN A O     1 
ATOM   7401  C  CB    . ASN A  1  953  ? 66.416  -135.230 148.262 1.00 45.21  ? 953  ASN A CB    1 
ATOM   7402  C  CG    . ASN A  1  953  ? 66.610  -136.147 149.400 1.00 47.17  ? 953  ASN A CG    1 
ATOM   7403  O  OD1   . ASN A  1  953  ? 66.256  -137.325 149.318 1.00 47.09  ? 953  ASN A OD1   1 
ATOM   7404  N  ND2   . ASN A  1  953  ? 67.191  -135.643 150.476 1.00 49.21  ? 953  ASN A ND2   1 
ATOM   7405  N  N     . TRP A  1  954  ? 65.781  -135.607 144.948 1.00 42.02  ? 954  TRP A N     1 
ATOM   7406  C  CA    . TRP A  1  954  ? 65.331  -134.929 143.756 1.00 40.08  ? 954  TRP A CA    1 
ATOM   7407  C  C     . TRP A  1  954  ? 63.924  -135.268 143.312 1.00 38.30  ? 954  TRP A C     1 
ATOM   7408  O  O     . TRP A  1  954  ? 63.455  -136.401 143.424 1.00 38.39  ? 954  TRP A O     1 
ATOM   7409  C  CB    . TRP A  1  954  ? 66.290  -135.212 142.608 1.00 40.00  ? 954  TRP A CB    1 
ATOM   7410  C  CG    . TRP A  1  954  ? 67.669  -134.897 142.966 1.00 40.46  ? 954  TRP A CG    1 
ATOM   7411  C  CD1   . TRP A  1  954  ? 68.534  -135.677 143.669 1.00 40.69  ? 954  TRP A CD1   1 
ATOM   7412  C  CD2   . TRP A  1  954  ? 68.341  -133.674 142.711 1.00 41.15  ? 954  TRP A CD2   1 
ATOM   7413  N  NE1   . TRP A  1  954  ? 69.716  -135.007 143.873 1.00 41.71  ? 954  TRP A NE1   1 
ATOM   7414  C  CE2   . TRP A  1  954  ? 69.621  -133.772 143.294 1.00 41.82  ? 954  TRP A CE2   1 
ATOM   7415  C  CE3   . TRP A  1  954  ? 67.984  -132.498 142.048 1.00 41.44  ? 954  TRP A CE3   1 
ATOM   7416  C  CZ2   . TRP A  1  954  ? 70.544  -132.744 143.230 1.00 42.70  ? 954  TRP A CZ2   1 
ATOM   7417  C  CZ3   . TRP A  1  954  ? 68.895  -131.478 141.985 1.00 42.51  ? 954  TRP A CZ3   1 
ATOM   7418  C  CH2   . TRP A  1  954  ? 70.165  -131.602 142.574 1.00 43.72  ? 954  TRP A CH2   1 
ATOM   7419  N  N     . PRO A  1  955  ? 63.225  -134.266 142.806 1.00 35.72  ? 955  PRO A N     1 
ATOM   7420  C  CA    . PRO A  1  955  ? 61.870  -134.472 142.334 1.00 34.04  ? 955  PRO A CA    1 
ATOM   7421  C  C     . PRO A  1  955  ? 61.905  -135.431 141.144 1.00 32.50  ? 955  PRO A C     1 
ATOM   7422  O  O     . PRO A  1  955  ? 62.621  -135.178 140.176 1.00 32.11  ? 955  PRO A O     1 
ATOM   7423  C  CB    . PRO A  1  955  ? 61.452  -133.062 141.940 1.00 35.46  ? 955  PRO A CB    1 
ATOM   7424  C  CG    . PRO A  1  955  ? 62.766  -132.393 141.586 1.00 35.10  ? 955  PRO A CG    1 
ATOM   7425  C  CD    . PRO A  1  955  ? 63.609  -132.850 142.712 1.00 35.19  ? 955  PRO A CD    1 
ATOM   7426  N  N     . LEU A  1  956  ? 61.138  -136.522 141.229 1.00 31.01  ? 956  LEU A N     1 
ATOM   7427  C  CA    . LEU A  1  956  ? 61.045  -137.544 140.164 1.00 28.60  ? 956  LEU A CA    1 
ATOM   7428  C  C     . LEU A  1  956  ? 59.654  -138.208 140.142 1.00 27.46  ? 956  LEU A C     1 
ATOM   7429  O  O     . LEU A  1  956  ? 59.083  -138.492 141.196 1.00 26.80  ? 956  LEU A O     1 
ATOM   7430  C  CB    . LEU A  1  956  ? 62.081  -138.644 140.389 1.00 27.18  ? 956  LEU A CB    1 
ATOM   7431  C  CG    . LEU A  1  956  ? 63.570  -138.376 140.239 1.00 25.20  ? 956  LEU A CG    1 
ATOM   7432  C  CD1   . LEU A  1  956  ? 64.333  -139.308 141.153 1.00 25.09  ? 956  LEU A CD1   1 
ATOM   7433  C  CD2   . LEU A  1  956  ? 63.974  -138.581 138.797 1.00 24.00  ? 956  LEU A CD2   1 
ATOM   7434  N  N     . PRO A  1  957  ? 59.112  -138.497 138.942 1.00 25.77  ? 957  PRO A N     1 
ATOM   7435  C  CA    . PRO A  1  957  ? 57.789  -139.127 138.853 1.00 24.76  ? 957  PRO A CA    1 
ATOM   7436  C  C     . PRO A  1  957  ? 57.653  -140.426 139.656 1.00 23.62  ? 957  PRO A C     1 
ATOM   7437  O  O     . PRO A  1  957  ? 58.635  -140.988 140.114 1.00 23.09  ? 957  PRO A O     1 
ATOM   7438  C  CB    . PRO A  1  957  ? 57.615  -139.334 137.349 1.00 22.84  ? 957  PRO A CB    1 
ATOM   7439  C  CG    . PRO A  1  957  ? 58.993  -139.551 136.891 1.00 22.35  ? 957  PRO A CG    1 
ATOM   7440  C  CD    . PRO A  1  957  ? 59.760  -138.484 137.621 1.00 24.46  ? 957  PRO A CD    1 
ATOM   7441  N  N     . VAL A  1  958  ? 56.421  -140.881 139.838 1.00 24.35  ? 958  VAL A N     1 
ATOM   7442  C  CA    . VAL A  1  958  ? 56.138  -142.113 140.578 1.00 26.00  ? 958  VAL A CA    1 
ATOM   7443  C  C     . VAL A  1  958  ? 56.820  -142.276 141.934 1.00 26.91  ? 958  VAL A C     1 
ATOM   7444  O  O     . VAL A  1  958  ? 57.956  -142.733 142.012 1.00 25.65  ? 958  VAL A O     1 
ATOM   7445  C  CB    . VAL A  1  958  ? 56.502  -143.351 139.767 1.00 26.13  ? 958  VAL A CB    1 
ATOM   7446  C  CG1   . VAL A  1  958  ? 56.081  -144.593 140.536 1.00 26.87  ? 958  VAL A CG1   1 
ATOM   7447  C  CG2   . VAL A  1  958  ? 55.820  -143.311 138.416 1.00 26.03  ? 958  VAL A CG2   1 
ATOM   7448  N  N     . ASN A  1  959  ? 56.120  -141.929 143.006 1.00 28.01  ? 959  ASN A N     1 
ATOM   7449  C  CA    . ASN A  1  959  ? 56.710  -142.069 144.320 1.00 30.48  ? 959  ASN A CA    1 
ATOM   7450  C  C     . ASN A  1  959  ? 56.797  -143.555 144.593 1.00 32.57  ? 959  ASN A C     1 
ATOM   7451  O  O     . ASN A  1  959  ? 55.759  -144.212 144.756 1.00 32.98  ? 959  ASN A O     1 
ATOM   7452  C  CB    . ASN A  1  959  ? 55.831  -141.424 145.383 1.00 31.58  ? 959  ASN A CB    1 
ATOM   7453  C  CG    . ASN A  1  959  ? 56.440  -141.523 146.779 1.00 32.60  ? 959  ASN A CG    1 
ATOM   7454  O  OD1   . ASN A  1  959  ? 57.061  -142.526 147.127 1.00 32.58  ? 959  ASN A OD1   1 
ATOM   7455  N  ND2   . ASN A  1  959  ? 56.249  -140.486 147.585 1.00 34.06  ? 959  ASN A ND2   1 
ATOM   7456  N  N     . ILE A  1  960  ? 58.019  -144.090 144.655 1.00 32.82  ? 960  ILE A N     1 
ATOM   7457  C  CA    . ILE A  1  960  ? 58.173  -145.512 144.901 1.00 32.42  ? 960  ILE A CA    1 
ATOM   7458  C  C     . ILE A  1  960  ? 58.125  -145.907 146.359 1.00 34.65  ? 960  ILE A C     1 
ATOM   7459  O  O     . ILE A  1  960  ? 57.660  -146.997 146.667 1.00 35.47  ? 960  ILE A O     1 
ATOM   7460  C  CB    . ILE A  1  960  ? 59.447  -146.088 144.284 1.00 30.73  ? 960  ILE A CB    1 
ATOM   7461  C  CG1   . ILE A  1  960  ? 59.468  -145.843 142.778 1.00 30.36  ? 960  ILE A CG1   1 
ATOM   7462  C  CG2   . ILE A  1  960  ? 59.454  -147.577 144.459 1.00 30.28  ? 960  ILE A CG2   1 
ATOM   7463  C  CD1   . ILE A  1  960  ? 60.654  -146.467 142.075 1.00 28.58  ? 960  ILE A CD1   1 
ATOM   7464  N  N     . ARG A  1  961  ? 58.582  -145.059 147.276 1.00 37.27  ? 961  ARG A N     1 
ATOM   7465  C  CA    . ARG A  1  961  ? 58.497  -145.471 148.680 1.00 40.14  ? 961  ARG A CA    1 
ATOM   7466  C  C     . ARG A  1  961  ? 57.072  -145.884 149.054 1.00 40.68  ? 961  ARG A C     1 
ATOM   7467  O  O     . ARG A  1  961  ? 56.862  -146.952 149.609 1.00 40.75  ? 961  ARG A O     1 
ATOM   7468  C  CB    . ARG A  1  961  ? 58.929  -144.367 149.633 1.00 42.20  ? 961  ARG A CB    1 
ATOM   7469  C  CG    . ARG A  1  961  ? 58.589  -144.705 151.084 1.00 45.52  ? 961  ARG A CG    1 
ATOM   7470  C  CD    . ARG A  1  961  ? 58.549  -143.451 151.954 1.00 51.82  ? 961  ARG A CD    1 
ATOM   7471  N  NE    . ARG A  1  961  ? 59.563  -143.464 153.005 1.00 57.02  ? 961  ARG A NE    1 
ATOM   7472  C  CZ    . ARG A  1  961  ? 60.854  -143.731 152.800 1.00 60.87  ? 961  ARG A CZ    1 
ATOM   7473  N  NH1   . ARG A  1  961  ? 61.299  -144.013 151.580 1.00 63.10  ? 961  ARG A NH1   1 
ATOM   7474  N  NH2   . ARG A  1  961  ? 61.712  -143.712 153.813 1.00 62.72  ? 961  ARG A NH2   1 
ATOM   7475  N  N     . ARG A  1  962  ? 56.091  -145.037 148.748 1.00 42.25  ? 962  ARG A N     1 
ATOM   7476  C  CA    . ARG A  1  962  ? 54.700  -145.342 149.083 1.00 42.86  ? 962  ARG A CA    1 
ATOM   7477  C  C     . ARG A  1  962  ? 54.189  -146.539 148.298 1.00 42.72  ? 962  ARG A C     1 
ATOM   7478  O  O     . ARG A  1  962  ? 53.670  -147.499 148.871 1.00 43.34  ? 962  ARG A O     1 
ATOM   7479  C  CB    . ARG A  1  962  ? 53.786  -144.117 148.847 1.00 42.55  ? 962  ARG A CB    1 
ATOM   7480  C  CG    . ARG A  1  962  ? 53.860  -143.074 149.977 1.00 42.82  ? 962  ARG A CG    1 
ATOM   7481  C  CD    . ARG A  1  962  ? 52.842  -141.940 149.861 1.00 42.15  ? 962  ARG A CD    1 
ATOM   7482  N  NE    . ARG A  1  962  ? 53.130  -140.985 148.789 1.00 41.13  ? 962  ARG A NE    1 
ATOM   7483  C  CZ    . ARG A  1  962  ? 52.661  -141.082 147.547 1.00 40.61  ? 962  ARG A CZ    1 
ATOM   7484  N  NH1   . ARG A  1  962  ? 51.876  -142.099 147.210 1.00 39.97  ? 962  ARG A NH1   1 
ATOM   7485  N  NH2   . ARG A  1  962  ? 52.964  -140.154 146.646 1.00 38.48  ? 962  ARG A NH2   1 
ATOM   7486  N  N     . ILE A  1  963  ? 54.361  -146.492 146.986 1.00 42.36  ? 963  ILE A N     1 
ATOM   7487  C  CA    . ILE A  1  963  ? 53.893  -147.565 146.125 1.00 41.79  ? 963  ILE A CA    1 
ATOM   7488  C  C     . ILE A  1  963  ? 54.275  -148.937 146.680 1.00 41.64  ? 963  ILE A C     1 
ATOM   7489  O  O     . ILE A  1  963  ? 53.775  -149.952 146.217 1.00 42.14  ? 963  ILE A O     1 
ATOM   7490  C  CB    . ILE A  1  963  ? 54.445  -147.383 144.687 1.00 40.55  ? 963  ILE A CB    1 
ATOM   7491  C  CG1   . ILE A  1  963  ? 53.661  -148.228 143.686 1.00 39.02  ? 963  ILE A CG1   1 
ATOM   7492  C  CG2   . ILE A  1  963  ? 55.877  -147.821 144.636 1.00 42.42  ? 963  ILE A CG2   1 
ATOM   7493  C  CD1   . ILE A  1  963  ? 53.967  -147.888 142.258 1.00 36.29  ? 963  ILE A CD1   1 
ATOM   7494  N  N     . ILE A  1  964  ? 55.157  -148.969 147.673 1.00 42.09  ? 964  ILE A N     1 
ATOM   7495  C  CA    . ILE A  1  964  ? 55.566  -150.239 148.275 1.00 42.82  ? 964  ILE A CA    1 
ATOM   7496  C  C     . ILE A  1  964  ? 54.901  -150.441 149.623 1.00 43.63  ? 964  ILE A C     1 
ATOM   7497  O  O     . ILE A  1  964  ? 54.562  -151.558 149.988 1.00 43.94  ? 964  ILE A O     1 
ATOM   7498  C  CB    . ILE A  1  964  ? 57.111  -150.336 148.443 1.00 40.69  ? 964  ILE A CB    1 
ATOM   7499  C  CG1   . ILE A  1  964  ? 57.723  -150.896 147.163 1.00 38.85  ? 964  ILE A CG1   1 
ATOM   7500  C  CG2   . ILE A  1  964  ? 57.472  -151.219 149.629 1.00 38.80  ? 964  ILE A CG2   1 
ATOM   7501  C  CD1   . ILE A  1  964  ? 59.206  -150.947 147.192 1.00 38.91  ? 964  ILE A CD1   1 
ATOM   7502  N  N     . GLN A  1  965  ? 54.721  -149.361 150.365 1.00 44.84  ? 965  GLN A N     1 
ATOM   7503  C  CA    . GLN A  1  965  ? 54.081  -149.460 151.656 1.00 47.13  ? 965  GLN A CA    1 
ATOM   7504  C  C     . GLN A  1  965  ? 52.679  -149.969 151.456 1.00 48.09  ? 965  GLN A C     1 
ATOM   7505  O  O     . GLN A  1  965  ? 52.175  -150.752 152.263 1.00 49.05  ? 965  GLN A O     1 
ATOM   7506  C  CB    . GLN A  1  965  ? 54.021  -148.108 152.311 1.00 48.66  ? 965  GLN A CB    1 
ATOM   7507  C  CG    . GLN A  1  965  ? 55.342  -147.442 152.319 1.00 52.92  ? 965  GLN A CG    1 
ATOM   7508  C  CD    . GLN A  1  965  ? 55.252  -146.074 152.906 1.00 55.88  ? 965  GLN A CD    1 
ATOM   7509  O  OE1   . GLN A  1  965  ? 54.721  -145.901 154.006 1.00 58.14  ? 965  GLN A OE1   1 
ATOM   7510  N  NE2   . GLN A  1  965  ? 55.765  -145.080 152.184 1.00 56.42  ? 965  GLN A NE2   1 
ATOM   7511  N  N     . ASN A  1  966  ? 52.034  -149.512 150.389 1.00 48.23  ? 966  ASN A N     1 
ATOM   7512  C  CA    . ASN A  1  966  ? 50.686  -149.973 150.126 1.00 49.26  ? 966  ASN A CA    1 
ATOM   7513  C  C     . ASN A  1  966  ? 50.850  -151.451 149.810 1.00 50.31  ? 966  ASN A C     1 
ATOM   7514  O  O     . ASN A  1  966  ? 50.117  -152.299 150.321 1.00 51.28  ? 966  ASN A O     1 
ATOM   7515  C  CB    . ASN A  1  966  ? 50.062  -149.263 148.921 1.00 49.34  ? 966  ASN A CB    1 
ATOM   7516  C  CG    . ASN A  1  966  ? 50.226  -147.757 148.967 1.00 49.34  ? 966  ASN A CG    1 
ATOM   7517  O  OD1   . ASN A  1  966  ? 50.184  -147.138 150.034 1.00 47.78  ? 966  ASN A OD1   1 
ATOM   7518  N  ND2   . ASN A  1  966  ? 50.393  -147.153 147.790 1.00 49.07  ? 966  ASN A ND2   1 
ATOM   7519  N  N     . ALA A  1  967  ? 51.837  -151.755 148.974 1.00 50.50  ? 967  ALA A N     1 
ATOM   7520  C  CA    . ALA A  1  967  ? 52.107  -153.132 148.581 1.00 50.31  ? 967  ALA A CA    1 
ATOM   7521  C  C     . ALA A  1  967  ? 52.134  -153.993 149.812 1.00 49.98  ? 967  ALA A C     1 
ATOM   7522  O  O     . ALA A  1  967  ? 51.487  -155.030 149.871 1.00 49.54  ? 967  ALA A O     1 
ATOM   7523  C  CB    . ALA A  1  967  ? 53.433  -153.222 147.865 1.00 51.16  ? 967  ALA A CB    1 
ATOM   7524  N  N     . GLN A  1  968  ? 52.892  -153.544 150.801 1.00 50.80  ? 968  GLN A N     1 
ATOM   7525  C  CA    . GLN A  1  968  ? 53.005  -154.270 152.046 1.00 52.23  ? 968  GLN A CA    1 
ATOM   7526  C  C     . GLN A  1  968  ? 51.650  -154.435 152.697 1.00 52.72  ? 968  GLN A C     1 
ATOM   7527  O  O     . GLN A  1  968  ? 51.118  -155.539 152.752 1.00 54.43  ? 968  GLN A O     1 
ATOM   7528  C  CB    . GLN A  1  968  ? 53.947  -153.553 153.003 1.00 52.77  ? 968  GLN A CB    1 
ATOM   7529  C  CG    . GLN A  1  968  ? 55.371  -153.498 152.513 1.00 54.73  ? 968  GLN A CG    1 
ATOM   7530  C  CD    . GLN A  1  968  ? 56.321  -153.074 153.601 1.00 56.61  ? 968  GLN A CD    1 
ATOM   7531  O  OE1   . GLN A  1  968  ? 56.072  -152.095 154.310 1.00 57.64  ? 968  GLN A OE1   1 
ATOM   7532  N  NE2   . GLN A  1  968  ? 57.422  -153.808 153.746 1.00 58.04  ? 968  GLN A NE2   1 
ATOM   7533  N  N     . GLN A  1  969  ? 51.071  -153.346 153.174 1.00 52.71  ? 969  GLN A N     1 
ATOM   7534  C  CA    . GLN A  1  969  ? 49.784  -153.447 153.836 1.00 53.72  ? 969  GLN A CA    1 
ATOM   7535  C  C     . GLN A  1  969  ? 48.655  -154.093 153.027 1.00 52.08  ? 969  GLN A C     1 
ATOM   7536  O  O     . GLN A  1  969  ? 47.761  -154.701 153.607 1.00 51.44  ? 969  GLN A O     1 
ATOM   7537  C  CB    . GLN A  1  969  ? 49.349  -152.080 154.310 1.00 56.52  ? 969  GLN A CB    1 
ATOM   7538  C  CG    . GLN A  1  969  ? 48.190  -152.126 155.250 1.00 60.48  ? 969  GLN A CG    1 
ATOM   7539  C  CD    . GLN A  1  969  ? 47.817  -150.749 155.721 1.00 63.80  ? 969  GLN A CD    1 
ATOM   7540  O  OE1   . GLN A  1  969  ? 48.647  -150.023 156.296 1.00 65.69  ? 969  GLN A OE1   1 
ATOM   7541  N  NE2   . GLN A  1  969  ? 46.566  -150.364 155.475 1.00 64.98  ? 969  GLN A NE2   1 
ATOM   7542  N  N     . THR A  1  970  ? 48.678  -153.967 151.705 1.00 51.06  ? 970  THR A N     1 
ATOM   7543  C  CA    . THR A  1  970  ? 47.629  -154.580 150.893 1.00 51.01  ? 970  THR A CA    1 
ATOM   7544  C  C     . THR A  1  970  ? 47.676  -156.087 151.063 1.00 52.95  ? 970  THR A C     1 
ATOM   7545  O  O     . THR A  1  970  ? 46.642  -156.754 151.022 1.00 53.65  ? 970  THR A O     1 
ATOM   7546  C  CB    . THR A  1  970  ? 47.802  -154.307 149.390 1.00 49.06  ? 970  THR A CB    1 
ATOM   7547  O  OG1   . THR A  1  970  ? 47.876  -152.906 149.161 1.00 49.69  ? 970  THR A OG1   1 
ATOM   7548  C  CG2   . THR A  1  970  ? 46.628  -154.867 148.606 1.00 47.04  ? 970  THR A CG2   1 
ATOM   7549  N  N     . PHE A  1  971  ? 48.879  -156.623 151.248 1.00 54.41  ? 971  PHE A N     1 
ATOM   7550  C  CA    . PHE A  1  971  ? 49.051  -158.061 151.397 1.00 56.46  ? 971  PHE A CA    1 
ATOM   7551  C  C     . PHE A  1  971  ? 49.550  -158.515 152.769 1.00 60.59  ? 971  PHE A C     1 
ATOM   7552  O  O     . PHE A  1  971  ? 50.082  -159.617 152.910 1.00 60.81  ? 971  PHE A O     1 
ATOM   7553  C  CB    . PHE A  1  971  ? 49.998  -158.583 150.326 1.00 52.79  ? 971  PHE A CB    1 
ATOM   7554  C  CG    . PHE A  1  971  ? 49.604  -158.211 148.927 1.00 49.65  ? 971  PHE A CG    1 
ATOM   7555  C  CD1   . PHE A  1  971  ? 49.928  -156.971 148.407 1.00 48.89  ? 971  PHE A CD1   1 
ATOM   7556  C  CD2   . PHE A  1  971  ? 48.958  -159.122 148.106 1.00 47.72  ? 971  PHE A CD2   1 
ATOM   7557  C  CE1   . PHE A  1  971  ? 49.622  -156.652 147.086 1.00 47.69  ? 971  PHE A CE1   1 
ATOM   7558  C  CE2   . PHE A  1  971  ? 48.651  -158.806 146.793 1.00 45.06  ? 971  PHE A CE2   1 
ATOM   7559  C  CZ    . PHE A  1  971  ? 48.984  -157.576 146.284 1.00 45.71  ? 971  PHE A CZ    1 
ATOM   7560  N  N     . HIS A  1  972  ? 49.375  -157.665 153.775 1.00 65.83  ? 972  HIS A N     1 
ATOM   7561  C  CA    . HIS A  1  972  ? 49.785  -157.965 155.149 1.00 70.70  ? 972  HIS A CA    1 
ATOM   7562  C  C     . HIS A  1  972  ? 51.072  -158.787 155.196 1.00 72.74  ? 972  HIS A C     1 
ATOM   7563  O  O     . HIS A  1  972  ? 51.216  -159.690 156.016 1.00 72.88  ? 972  HIS A O     1 
ATOM   7564  C  CB    . HIS A  1  972  ? 48.663  -158.716 155.863 1.00 73.73  ? 972  HIS A CB    1 
ATOM   7565  C  CG    . HIS A  1  972  ? 47.290  -158.315 155.412 1.00 78.03  ? 972  HIS A CG    1 
ATOM   7566  N  ND1   . HIS A  1  972  ? 46.748  -157.075 155.678 1.00 79.44  ? 972  HIS A ND1   1 
ATOM   7567  C  CD2   . HIS A  1  972  ? 46.362  -158.983 154.681 1.00 79.32  ? 972  HIS A CD2   1 
ATOM   7568  C  CE1   . HIS A  1  972  ? 45.546  -156.996 155.130 1.00 80.34  ? 972  HIS A CE1   1 
ATOM   7569  N  NE2   . HIS A  1  972  ? 45.288  -158.140 154.520 1.00 80.16  ? 972  HIS A NE2   1 
ATOM   7570  N  N     . ILE A  1  973  ? 52.001  -158.462 154.304 1.00 75.37  ? 973  ILE A N     1 
ATOM   7571  C  CA    . ILE A  1  973  ? 53.286  -159.146 154.215 1.00 78.11  ? 973  ILE A CA    1 
ATOM   7572  C  C     . ILE A  1  973  ? 54.008  -159.224 155.550 1.00 80.37  ? 973  ILE A C     1 
ATOM   7573  O  O     . ILE A  1  973  ? 54.451  -158.201 156.077 1.00 80.68  ? 973  ILE A O     1 
ATOM   7574  C  CB    . ILE A  1  973  ? 54.196  -158.444 153.183 1.00 77.25  ? 973  ILE A CB    1 
ATOM   7575  C  CG1   . ILE A  1  973  ? 53.848  -158.957 151.785 1.00 76.83  ? 973  ILE A CG1   1 
ATOM   7576  C  CG2   . ILE A  1  973  ? 55.667  -158.661 153.523 1.00 77.04  ? 973  ILE A CG2   1 
ATOM   7577  C  CD1   . ILE A  1  973  ? 54.664  -158.343 150.687 1.00 76.89  ? 973  ILE A CD1   1 
ATOM   7578  N  N     . ASP A  1  974  ? 54.133  -160.442 156.083 1.00 83.59  ? 974  ASP A N     1 
ATOM   7579  C  CA    . ASP A  1  974  ? 54.809  -160.650 157.369 1.00 86.90  ? 974  ASP A CA    1 
ATOM   7580  C  C     . ASP A  1  974  ? 56.312  -160.856 157.194 1.00 87.32  ? 974  ASP A C     1 
ATOM   7581  O  O     . ASP A  1  974  ? 56.765  -161.705 156.421 1.00 86.54  ? 974  ASP A O     1 
ATOM   7582  C  CB    . ASP A  1  974  ? 54.177  -161.826 158.156 1.00 87.61  ? 974  ASP A CB    1 
ATOM   7583  C  CG    . ASP A  1  974  ? 54.688  -163.192 157.721 1.00 87.99  ? 974  ASP A CG    1 
ATOM   7584  O  OD1   . ASP A  1  974  ? 54.690  -163.474 156.504 1.00 89.25  ? 974  ASP A OD1   1 
ATOM   7585  O  OD2   . ASP A  1  974  ? 55.069  -163.990 158.606 1.00 87.49  ? 974  ASP A OD2   1 
ATOM   7586  N  N     . HIS A  1  975  ? 57.074  -160.056 157.929 1.00 89.02  ? 975  HIS A N     1 
ATOM   7587  C  CA    . HIS A  1  975  ? 58.526  -160.086 157.860 1.00 90.65  ? 975  HIS A CA    1 
ATOM   7588  C  C     . HIS A  1  975  ? 59.128  -161.357 158.467 1.00 89.05  ? 975  HIS A C     1 
ATOM   7589  O  O     . HIS A  1  975  ? 60.353  -161.498 158.540 1.00 89.10  ? 975  HIS A O     1 
ATOM   7590  C  CB    . HIS A  1  975  ? 59.090  -158.821 158.542 1.00 93.75  ? 975  HIS A CB    1 
ATOM   7591  C  CG    . HIS A  1  975  ? 58.452  -157.538 158.073 1.00 96.80  ? 975  HIS A CG    1 
ATOM   7592  N  ND1   . HIS A  1  975  ? 58.342  -157.198 156.738 1.00 97.89  ? 975  HIS A ND1   1 
ATOM   7593  C  CD2   . HIS A  1  975  ? 57.896  -156.512 158.764 1.00 97.83  ? 975  HIS A CD2   1 
ATOM   7594  C  CE1   . HIS A  1  975  ? 57.746  -156.023 156.629 1.00 97.65  ? 975  HIS A CE1   1 
ATOM   7595  N  NE2   . HIS A  1  975  ? 57.465  -155.585 157.843 1.00 98.16  ? 975  HIS A NE2   1 
ATOM   7596  N  N     . THR A  1  976  ? 58.263  -162.286 158.875 1.00 86.93  ? 976  THR A N     1 
ATOM   7597  C  CA    . THR A  1  976  ? 58.705  -163.542 159.483 1.00 84.32  ? 976  THR A CA    1 
ATOM   7598  C  C     . THR A  1  976  ? 58.970  -164.652 158.467 1.00 81.97  ? 976  THR A C     1 
ATOM   7599  O  O     . THR A  1  976  ? 60.077  -165.181 158.404 1.00 81.90  ? 976  THR A O     1 
ATOM   7600  C  CB    . THR A  1  976  ? 57.682  -164.052 160.529 1.00 84.72  ? 976  THR A CB    1 
ATOM   7601  O  OG1   . THR A  1  976  ? 56.514  -163.221 160.503 1.00 85.72  ? 976  THR A OG1   1 
ATOM   7602  C  CG2   . THR A  1  976  ? 58.289  -164.020 161.933 1.00 83.74  ? 976  THR A CG2   1 
ATOM   7603  N  N     . LYS A  1  977  ? 57.966  -165.007 157.672 1.00 79.07  ? 977  LYS A N     1 
ATOM   7604  C  CA    . LYS A  1  977  ? 58.140  -166.057 156.670 1.00 75.87  ? 977  LYS A CA    1 
ATOM   7605  C  C     . LYS A  1  977  ? 59.107  -165.654 155.554 1.00 72.45  ? 977  LYS A C     1 
ATOM   7606  O  O     . LYS A  1  977  ? 59.621  -164.524 155.524 1.00 72.29  ? 977  LYS A O     1 
ATOM   7607  C  CB    . LYS A  1  977  ? 56.786  -166.450 156.067 1.00 77.34  ? 977  LYS A CB    1 
ATOM   7608  C  CG    . LYS A  1  977  ? 55.801  -166.950 157.104 1.00 80.33  ? 977  LYS A CG    1 
ATOM   7609  C  CD    . LYS A  1  977  ? 54.703  -167.804 156.490 1.00 82.17  ? 977  LYS A CD    1 
ATOM   7610  C  CE    . LYS A  1  977  ? 53.840  -168.414 157.589 1.00 83.65  ? 977  LYS A CE    1 
ATOM   7611  N  NZ    . LYS A  1  977  ? 53.070  -169.601 157.120 1.00 84.95  ? 977  LYS A NZ    1 
ATOM   7612  N  N     . PRO A  1  978  ? 59.378  -166.583 154.625 1.00 68.34  ? 978  PRO A N     1 
ATOM   7613  C  CA    . PRO A  1  978  ? 60.282  -166.344 153.501 1.00 65.26  ? 978  PRO A CA    1 
ATOM   7614  C  C     . PRO A  1  978  ? 59.523  -165.991 152.226 1.00 61.18  ? 978  PRO A C     1 
ATOM   7615  O  O     . PRO A  1  978  ? 58.401  -166.445 152.036 1.00 60.64  ? 978  PRO A O     1 
ATOM   7616  C  CB    . PRO A  1  978  ? 60.982  -167.680 153.370 1.00 65.67  ? 978  PRO A CB    1 
ATOM   7617  C  CG    . PRO A  1  978  ? 59.830  -168.615 153.542 1.00 66.53  ? 978  PRO A CG    1 
ATOM   7618  C  CD    . PRO A  1  978  ? 59.106  -168.027 154.751 1.00 67.70  ? 978  PRO A CD    1 
ATOM   7619  N  N     . SER A  1  979  ? 60.138  -165.197 151.353 1.00 56.91  ? 979  SER A N     1 
ATOM   7620  C  CA    . SER A  1  979  ? 59.502  -164.829 150.095 1.00 53.77  ? 979  SER A CA    1 
ATOM   7621  C  C     . SER A  1  979  ? 59.361  -166.063 149.238 1.00 51.32  ? 979  SER A C     1 
ATOM   7622  O  O     . SER A  1  979  ? 59.586  -167.165 149.700 1.00 51.06  ? 979  SER A O     1 
ATOM   7623  C  CB    . SER A  1  979  ? 60.340  -163.808 149.326 1.00 54.33  ? 979  SER A CB    1 
ATOM   7624  O  OG    . SER A  1  979  ? 59.838  -163.623 148.005 1.00 52.72  ? 979  SER A OG    1 
ATOM   7625  N  N     . ASP A  1  980  ? 58.984  -165.859 147.986 1.00 49.38  ? 980  ASP A N     1 
ATOM   7626  C  CA    . ASP A  1  980  ? 58.825  -166.936 147.029 1.00 49.24  ? 980  ASP A CA    1 
ATOM   7627  C  C     . ASP A  1  980  ? 59.173  -166.357 145.674 1.00 48.86  ? 980  ASP A C     1 
ATOM   7628  O  O     . ASP A  1  980  ? 58.630  -166.729 144.640 1.00 46.99  ? 980  ASP A O     1 
ATOM   7629  C  CB    . ASP A  1  980  ? 57.393  -167.458 147.036 1.00 51.74  ? 980  ASP A CB    1 
ATOM   7630  C  CG    . ASP A  1  980  ? 56.372  -166.357 146.867 1.00 54.22  ? 980  ASP A CG    1 
ATOM   7631  O  OD1   . ASP A  1  980  ? 56.458  -165.372 147.629 1.00 57.23  ? 980  ASP A OD1   1 
ATOM   7632  O  OD2   . ASP A  1  980  ? 55.482  -166.472 145.987 1.00 53.89  ? 980  ASP A OD2   1 
ATOM   7633  N  N     . LEU A  1  981  ? 60.093  -165.412 145.704 1.00 49.93  ? 981  LEU A N     1 
ATOM   7634  C  CA    . LEU A  1  981  ? 60.558  -164.759 144.500 1.00 50.75  ? 981  LEU A CA    1 
ATOM   7635  C  C     . LEU A  1  981  ? 61.836  -165.438 144.011 1.00 51.73  ? 981  LEU A C     1 
ATOM   7636  O  O     . LEU A  1  981  ? 62.764  -165.664 144.785 1.00 53.45  ? 981  LEU A O     1 
ATOM   7637  C  CB    . LEU A  1  981  ? 60.828  -163.287 144.804 1.00 49.51  ? 981  LEU A CB    1 
ATOM   7638  C  CG    . LEU A  1  981  ? 59.534  -162.505 144.925 1.00 48.05  ? 981  LEU A CG    1 
ATOM   7639  C  CD1   . LEU A  1  981  ? 59.746  -161.185 145.615 1.00 48.18  ? 981  LEU A CD1   1 
ATOM   7640  C  CD2   . LEU A  1  981  ? 59.006  -162.315 143.530 1.00 48.70  ? 981  LEU A CD2   1 
ATOM   7641  N  N     . THR A  1  982  ? 61.883  -165.783 142.733 1.00 50.81  ? 982  THR A N     1 
ATOM   7642  C  CA    . THR A  1  982  ? 63.083  -166.398 142.196 1.00 50.99  ? 982  THR A CA    1 
ATOM   7643  C  C     . THR A  1  982  ? 64.102  -165.272 142.134 1.00 50.92  ? 982  THR A C     1 
ATOM   7644  O  O     . THR A  1  982  ? 63.745  -164.123 141.872 1.00 50.03  ? 982  THR A O     1 
ATOM   7645  C  CB    . THR A  1  982  ? 62.880  -166.886 140.757 1.00 52.64  ? 982  THR A CB    1 
ATOM   7646  O  OG1   . THR A  1  982  ? 61.569  -167.438 140.613 1.00 54.17  ? 982  THR A OG1   1 
ATOM   7647  C  CG2   . THR A  1  982  ? 63.919  -167.946 140.397 1.00 54.24  ? 982  THR A CG2   1 
ATOM   7648  N  N     . ILE A  1  983  ? 65.371  -165.573 142.370 1.00 50.82  ? 983  ILE A N     1 
ATOM   7649  C  CA    . ILE A  1  983  ? 66.339  -164.508 142.273 1.00 49.97  ? 983  ILE A CA    1 
ATOM   7650  C  C     . ILE A  1  983  ? 66.297  -164.019 140.834 1.00 50.73  ? 983  ILE A C     1 
ATOM   7651  O  O     . ILE A  1  983  ? 66.703  -162.907 140.532 1.00 52.10  ? 983  ILE A O     1 
ATOM   7652  C  CB    . ILE A  1  983  ? 67.734  -164.983 142.638 1.00 48.95  ? 983  ILE A CB    1 
ATOM   7653  C  CG1   . ILE A  1  983  ? 68.189  -164.203 143.873 1.00 49.75  ? 983  ILE A CG1   1 
ATOM   7654  C  CG2   . ILE A  1  983  ? 68.675  -164.812 141.460 1.00 47.34  ? 983  ILE A CG2   1 
ATOM   7655  C  CD1   . ILE A  1  983  ? 69.562  -164.550 144.379 1.00 52.43  ? 983  ILE A CD1   1 
ATOM   7656  N  N     . LYS A  1  984  ? 65.782  -164.864 139.950 1.00 51.11  ? 984  LYS A N     1 
ATOM   7657  C  CA    . LYS A  1  984  ? 65.652  -164.532 138.536 1.00 51.01  ? 984  LYS A CA    1 
ATOM   7658  C  C     . LYS A  1  984  ? 64.359  -163.740 138.358 1.00 51.15  ? 984  LYS A C     1 
ATOM   7659  O  O     . LYS A  1  984  ? 64.237  -162.931 137.440 1.00 51.41  ? 984  LYS A O     1 
ATOM   7660  C  CB    . LYS A  1  984  ? 65.608  -165.819 137.706 1.00 51.44  ? 984  LYS A CB    1 
ATOM   7661  C  CG    . LYS A  1  984  ? 65.811  -165.627 136.218 1.00 51.37  ? 984  LYS A CG    1 
ATOM   7662  C  CD    . LYS A  1  984  ? 66.131  -166.953 135.541 1.00 52.26  ? 984  LYS A CD    1 
ATOM   7663  C  CE    . LYS A  1  984  ? 66.487  -166.752 134.075 1.00 52.80  ? 984  LYS A CE    1 
ATOM   7664  N  NZ    . LYS A  1  984  ? 66.846  -168.031 133.403 1.00 53.49  ? 984  LYS A NZ    1 
ATOM   7665  N  N     . ASP A  1  985  ? 63.398  -163.994 139.249 1.00 51.15  ? 985  ASP A N     1 
ATOM   7666  C  CA    . ASP A  1  985  ? 62.100  -163.308 139.254 1.00 49.91  ? 985  ASP A CA    1 
ATOM   7667  C  C     . ASP A  1  985  ? 62.384  -161.822 139.330 1.00 47.80  ? 985  ASP A C     1 
ATOM   7668  O  O     . ASP A  1  985  ? 62.159  -161.076 138.379 1.00 47.33  ? 985  ASP A O     1 
ATOM   7669  C  CB    . ASP A  1  985  ? 61.280  -163.686 140.501 1.00 51.72  ? 985  ASP A CB    1 
ATOM   7670  C  CG    . ASP A  1  985  ? 60.156  -164.667 140.206 1.00 53.21  ? 985  ASP A CG    1 
ATOM   7671  O  OD1   . ASP A  1  985  ? 59.840  -164.873 139.011 1.00 54.48  ? 985  ASP A OD1   1 
ATOM   7672  O  OD2   . ASP A  1  985  ? 59.582  -165.217 141.179 1.00 52.77  ? 985  ASP A OD2   1 
ATOM   7673  N  N     . ILE A  1  986  ? 62.878  -161.412 140.494 1.00 44.85  ? 986  ILE A N     1 
ATOM   7674  C  CA    . ILE A  1  986  ? 63.211  -160.032 140.744 1.00 42.17  ? 986  ILE A CA    1 
ATOM   7675  C  C     . ILE A  1  986  ? 64.005  -159.437 139.596 1.00 41.83  ? 986  ILE A C     1 
ATOM   7676  O  O     . ILE A  1  986  ? 63.481  -158.691 138.783 1.00 42.21  ? 986  ILE A O     1 
ATOM   7677  C  CB    . ILE A  1  986  ? 64.020  -159.907 142.016 1.00 39.98  ? 986  ILE A CB    1 
ATOM   7678  C  CG1   . ILE A  1  986  ? 63.200  -160.436 143.183 1.00 39.89  ? 986  ILE A CG1   1 
ATOM   7679  C  CG2   . ILE A  1  986  ? 64.407  -158.473 142.239 1.00 38.69  ? 986  ILE A CG2   1 
ATOM   7680  C  CD1   . ILE A  1  986  ? 63.832  -160.166 144.522 1.00 41.73  ? 986  ILE A CD1   1 
ATOM   7681  N  N     . VAL A  1  987  ? 65.274  -159.790 139.520 1.00 41.46  ? 987  VAL A N     1 
ATOM   7682  C  CA    . VAL A  1  987  ? 66.145  -159.263 138.487 1.00 41.01  ? 987  VAL A CA    1 
ATOM   7683  C  C     . VAL A  1  987  ? 65.592  -159.096 137.077 1.00 41.18  ? 987  VAL A C     1 
ATOM   7684  O  O     . VAL A  1  987  ? 65.749  -158.037 136.474 1.00 41.07  ? 987  VAL A O     1 
ATOM   7685  C  CB    . VAL A  1  987  ? 67.439  -160.080 138.436 1.00 40.78  ? 987  VAL A CB    1 
ATOM   7686  C  CG1   . VAL A  1  987  ? 67.998  -160.124 137.013 1.00 39.49  ? 987  VAL A CG1   1 
ATOM   7687  C  CG2   . VAL A  1  987  ? 68.442  -159.458 139.405 1.00 39.59  ? 987  VAL A CG2   1 
ATOM   7688  N  N     . LEU A  1  988  ? 64.952  -160.117 136.535 1.00 41.46  ? 988  LEU A N     1 
ATOM   7689  C  CA    . LEU A  1  988  ? 64.435  -159.990 135.179 1.00 42.44  ? 988  LEU A CA    1 
ATOM   7690  C  C     . LEU A  1  988  ? 63.108  -159.240 135.096 1.00 43.84  ? 988  LEU A C     1 
ATOM   7691  O  O     . LEU A  1  988  ? 62.659  -158.863 134.001 1.00 44.85  ? 988  LEU A O     1 
ATOM   7692  C  CB    . LEU A  1  988  ? 64.301  -161.369 134.541 1.00 41.94  ? 988  LEU A CB    1 
ATOM   7693  C  CG    . LEU A  1  988  ? 65.638  -162.094 134.405 1.00 42.64  ? 988  LEU A CG    1 
ATOM   7694  C  CD1   . LEU A  1  988  ? 65.393  -163.445 133.784 1.00 42.93  ? 988  LEU A CD1   1 
ATOM   7695  C  CD2   . LEU A  1  988  ? 66.619  -161.271 133.567 1.00 42.42  ? 988  LEU A CD2   1 
ATOM   7696  N  N     . GLY A  1  989  ? 62.482  -159.024 136.255 1.00 44.00  ? 989  GLY A N     1 
ATOM   7697  C  CA    . GLY A  1  989  ? 61.216  -158.303 136.305 1.00 42.31  ? 989  GLY A CA    1 
ATOM   7698  C  C     . GLY A  1  989  ? 61.461  -156.806 136.300 1.00 40.54  ? 989  GLY A C     1 
ATOM   7699  O  O     . GLY A  1  989  ? 60.859  -156.062 135.530 1.00 39.24  ? 989  GLY A O     1 
ATOM   7700  N  N     . VAL A  1  990  ? 62.360  -156.377 137.177 1.00 39.73  ? 990  VAL A N     1 
ATOM   7701  C  CA    . VAL A  1  990  ? 62.729  -154.984 137.284 1.00 39.57  ? 990  VAL A CA    1 
ATOM   7702  C  C     . VAL A  1  990  ? 63.355  -154.627 135.954 1.00 41.15  ? 990  VAL A C     1 
ATOM   7703  O  O     . VAL A  1  990  ? 63.126  -153.560 135.404 1.00 41.19  ? 990  VAL A O     1 
ATOM   7704  C  CB    . VAL A  1  990  ? 63.768  -154.776 138.389 1.00 38.25  ? 990  VAL A CB    1 
ATOM   7705  C  CG1   . VAL A  1  990  ? 63.872  -153.315 138.729 1.00 37.90  ? 990  VAL A CG1   1 
ATOM   7706  C  CG2   . VAL A  1  990  ? 63.393  -155.571 139.607 1.00 38.05  ? 990  VAL A CG2   1 
ATOM   7707  N  N     . LYS A  1  991  ? 64.156  -155.543 135.434 1.00 44.19  ? 991  LYS A N     1 
ATOM   7708  C  CA    . LYS A  1  991  ? 64.820  -155.326 134.158 1.00 47.06  ? 991  LYS A CA    1 
ATOM   7709  C  C     . LYS A  1  991  ? 63.757  -155.139 133.088 1.00 48.34  ? 991  LYS A C     1 
ATOM   7710  O  O     . LYS A  1  991  ? 63.909  -154.329 132.177 1.00 49.00  ? 991  LYS A O     1 
ATOM   7711  C  CB    . LYS A  1  991  ? 65.701  -156.533 133.813 1.00 47.45  ? 991  LYS A CB    1 
ATOM   7712  C  CG    . LYS A  1  991  ? 66.717  -156.296 132.703 1.00 49.28  ? 991  LYS A CG    1 
ATOM   7713  C  CD    . LYS A  1  991  ? 67.688  -157.478 132.609 1.00 51.62  ? 991  LYS A CD    1 
ATOM   7714  C  CE    . LYS A  1  991  ? 68.965  -157.139 131.838 1.00 52.09  ? 991  LYS A CE    1 
ATOM   7715  N  NZ    . LYS A  1  991  ? 69.885  -158.312 131.768 1.00 53.05  ? 991  LYS A NZ    1 
ATOM   7716  N  N     . ASP A  1  992  ? 62.663  -155.875 133.223 1.00 49.62  ? 992  ASP A N     1 
ATOM   7717  C  CA    . ASP A  1  992  ? 61.605  -155.798 132.243 1.00 50.78  ? 992  ASP A CA    1 
ATOM   7718  C  C     . ASP A  1  992  ? 60.665  -154.615 132.411 1.00 49.55  ? 992  ASP A C     1 
ATOM   7719  O  O     . ASP A  1  992  ? 60.098  -154.120 131.436 1.00 48.90  ? 992  ASP A O     1 
ATOM   7720  C  CB    . ASP A  1  992  ? 60.803  -157.084 132.242 1.00 54.81  ? 992  ASP A CB    1 
ATOM   7721  C  CG    . ASP A  1  992  ? 60.211  -157.369 130.878 1.00 60.09  ? 992  ASP A CG    1 
ATOM   7722  O  OD1   . ASP A  1  992  ? 59.421  -156.527 130.373 1.00 61.74  ? 992  ASP A OD1   1 
ATOM   7723  O  OD2   . ASP A  1  992  ? 60.555  -158.427 130.301 1.00 62.83  ? 992  ASP A OD2   1 
ATOM   7724  N  N     . LEU A  1  993  ? 60.492  -154.175 133.651 1.00 48.38  ? 993  LEU A N     1 
ATOM   7725  C  CA    . LEU A  1  993  ? 59.624  -153.039 133.960 1.00 45.85  ? 993  LEU A CA    1 
ATOM   7726  C  C     . LEU A  1  993  ? 60.085  -151.812 133.196 1.00 45.28  ? 993  LEU A C     1 
ATOM   7727  O  O     . LEU A  1  993  ? 59.272  -151.070 132.651 1.00 44.80  ? 993  LEU A O     1 
ATOM   7728  C  CB    . LEU A  1  993  ? 59.668  -152.755 135.464 1.00 43.84  ? 993  LEU A CB    1 
ATOM   7729  C  CG    . LEU A  1  993  ? 59.318  -151.354 135.950 1.00 40.79  ? 993  LEU A CG    1 
ATOM   7730  C  CD1   . LEU A  1  993  ? 57.904  -151.033 135.524 1.00 40.24  ? 993  LEU A CD1   1 
ATOM   7731  C  CD2   . LEU A  1  993  ? 59.488  -151.272 137.462 1.00 38.04  ? 993  LEU A CD2   1 
ATOM   7732  N  N     . GLN A  1  994  ? 61.402  -151.617 133.172 1.00 45.15  ? 994  GLN A N     1 
ATOM   7733  C  CA    . GLN A  1  994  ? 62.031  -150.494 132.495 1.00 44.81  ? 994  GLN A CA    1 
ATOM   7734  C  C     . GLN A  1  994  ? 61.615  -150.434 131.039 1.00 44.38  ? 994  GLN A C     1 
ATOM   7735  O  O     . GLN A  1  994  ? 61.370  -149.381 130.490 1.00 43.64  ? 994  GLN A O     1 
ATOM   7736  C  CB    . GLN A  1  994  ? 63.543  -150.628 132.576 1.00 44.66  ? 994  GLN A CB    1 
ATOM   7737  C  CG    . GLN A  1  994  ? 64.053  -150.871 133.966 1.00 46.11  ? 994  GLN A CG    1 
ATOM   7738  C  CD    . GLN A  1  994  ? 65.554  -150.681 134.069 1.00 48.84  ? 994  GLN A CD    1 
ATOM   7739  O  OE1   . GLN A  1  994  ? 66.159  -150.970 135.111 1.00 49.67  ? 994  GLN A OE1   1 
ATOM   7740  N  NE2   . GLN A  1  994  ? 66.171  -150.183 132.990 1.00 48.75  ? 994  GLN A NE2   1 
ATOM   7741  N  N     . GLU A  1  995  ? 61.544  -151.586 130.409 1.00 45.87  ? 995  GLU A N     1 
ATOM   7742  C  CA    . GLU A  1  995  ? 61.151  -151.660 129.020 1.00 47.67  ? 995  GLU A CA    1 
ATOM   7743  C  C     . GLU A  1  995  ? 59.834  -150.964 128.707 1.00 45.91  ? 995  GLU A C     1 
ATOM   7744  O  O     . GLU A  1  995  ? 59.529  -150.699 127.544 1.00 44.54  ? 995  GLU A O     1 
ATOM   7745  C  CB    . GLU A  1  995  ? 61.032  -153.126 128.622 1.00 53.90  ? 995  GLU A CB    1 
ATOM   7746  C  CG    . GLU A  1  995  ? 62.196  -153.611 127.824 1.00 62.15  ? 995  GLU A CG    1 
ATOM   7747  C  CD    . GLU A  1  995  ? 62.374  -152.776 126.573 1.00 67.69  ? 995  GLU A CD    1 
ATOM   7748  O  OE1   . GLU A  1  995  ? 61.514  -152.872 125.658 1.00 70.73  ? 995  GLU A OE1   1 
ATOM   7749  O  OE2   . GLU A  1  995  ? 63.367  -152.011 126.517 1.00 70.66  ? 995  GLU A OE2   1 
ATOM   7750  N  N     . ASN A  1  996  ? 59.052  -150.669 129.740 1.00 44.88  ? 996  ASN A N     1 
ATOM   7751  C  CA    . ASN A  1  996  ? 57.744  -150.053 129.531 1.00 43.15  ? 996  ASN A CA    1 
ATOM   7752  C  C     . ASN A  1  996  ? 57.502  -148.666 130.101 1.00 39.74  ? 996  ASN A C     1 
ATOM   7753  O  O     . ASN A  1  996  ? 56.403  -148.137 129.993 1.00 39.68  ? 996  ASN A O     1 
ATOM   7754  C  CB    . ASN A  1  996  ? 56.656  -150.995 130.031 1.00 46.58  ? 996  ASN A CB    1 
ATOM   7755  C  CG    . ASN A  1  996  ? 56.701  -152.328 129.335 1.00 49.66  ? 996  ASN A CG    1 
ATOM   7756  O  OD1   . ASN A  1  996  ? 56.671  -152.395 128.100 1.00 51.56  ? 996  ASN A OD1   1 
ATOM   7757  N  ND2   . ASN A  1  996  ? 56.783  -153.404 130.116 1.00 51.34  ? 996  ASN A ND2   1 
ATOM   7758  N  N     . LEU A  1  997  ? 58.510  -148.076 130.715 1.00 35.10  ? 997  LEU A N     1 
ATOM   7759  C  CA    . LEU A  1  997  ? 58.346  -146.741 131.234 1.00 31.71  ? 997  LEU A CA    1 
ATOM   7760  C  C     . LEU A  1  997  ? 58.485  -145.789 130.049 1.00 31.17  ? 997  LEU A C     1 
ATOM   7761  O  O     . LEU A  1  997  ? 59.387  -144.953 130.002 1.00 31.27  ? 997  LEU A O     1 
ATOM   7762  C  CB    . LEU A  1  997  ? 59.413  -146.475 132.277 1.00 30.52  ? 997  LEU A CB    1 
ATOM   7763  C  CG    . LEU A  1  997  ? 59.360  -147.496 133.406 1.00 29.12  ? 997  LEU A CG    1 
ATOM   7764  C  CD1   . LEU A  1  997  ? 60.501  -147.243 134.360 1.00 29.72  ? 997  LEU A CD1   1 
ATOM   7765  C  CD2   . LEU A  1  997  ? 58.031  -147.403 134.121 1.00 28.05  ? 997  LEU A CD2   1 
ATOM   7766  N  N     . LEU A  1  998  ? 57.574  -145.928 129.091 1.00 29.76  ? 998  LEU A N     1 
ATOM   7767  C  CA    . LEU A  1  998  ? 57.577  -145.119 127.884 1.00 28.09  ? 998  LEU A CA    1 
ATOM   7768  C  C     . LEU A  1  998  ? 57.211  -143.659 127.983 1.00 28.71  ? 998  LEU A C     1 
ATOM   7769  O  O     . LEU A  1  998  ? 56.241  -143.283 128.626 1.00 28.76  ? 998  LEU A O     1 
ATOM   7770  C  CB    . LEU A  1  998  ? 56.681  -145.744 126.843 1.00 26.53  ? 998  LEU A CB    1 
ATOM   7771  C  CG    . LEU A  1  998  ? 57.496  -146.808 126.157 1.00 26.73  ? 998  LEU A CG    1 
ATOM   7772  C  CD1   . LEU A  1  998  ? 57.262  -148.126 126.858 1.00 26.63  ? 998  LEU A CD1   1 
ATOM   7773  C  CD2   . LEU A  1  998  ? 57.115  -146.866 124.686 1.00 28.44  ? 998  LEU A CD2   1 
ATOM   7774  N  N     . VAL A  1  999  ? 57.998  -142.850 127.290 1.00 29.64  ? 999  VAL A N     1 
ATOM   7775  C  CA    . VAL A  1  999  ? 57.809  -141.420 127.232 1.00 30.74  ? 999  VAL A CA    1 
ATOM   7776  C  C     . VAL A  1  999  ? 57.718  -141.006 125.781 1.00 32.18  ? 999  VAL A C     1 
ATOM   7777  O  O     . VAL A  1  999  ? 56.903  -140.172 125.429 1.00 32.95  ? 999  VAL A O     1 
ATOM   7778  C  CB    . VAL A  1  999  ? 58.957  -140.696 127.886 1.00 30.70  ? 999  VAL A CB    1 
ATOM   7779  C  CG1   . VAL A  1  999  ? 58.935  -139.236 127.476 1.00 31.64  ? 999  VAL A CG1   1 
ATOM   7780  C  CG2   . VAL A  1  999  ? 58.840  -140.843 129.399 1.00 30.85  ? 999  VAL A CG2   1 
ATOM   7781  N  N     . LEU A  1  1000 ? 58.572  -141.578 124.943 1.00 34.52  ? 1000 LEU A N     1 
ATOM   7782  C  CA    . LEU A  1  1000 ? 58.556  -141.312 123.505 1.00 37.95  ? 1000 LEU A CA    1 
ATOM   7783  C  C     . LEU A  1  1000 ? 58.158  -142.627 122.864 1.00 41.41  ? 1000 LEU A C     1 
ATOM   7784  O  O     . LEU A  1  1000 ? 58.164  -143.650 123.543 1.00 43.19  ? 1000 LEU A O     1 
ATOM   7785  C  CB    . LEU A  1  1000 ? 59.931  -140.887 123.038 1.00 36.68  ? 1000 LEU A CB    1 
ATOM   7786  C  CG    . LEU A  1  1000 ? 60.146  -139.471 123.525 1.00 36.93  ? 1000 LEU A CG    1 
ATOM   7787  C  CD1   . LEU A  1  1000 ? 61.605  -139.099 123.510 1.00 36.95  ? 1000 LEU A CD1   1 
ATOM   7788  C  CD2   . LEU A  1  1000 ? 59.315  -138.560 122.637 1.00 38.80  ? 1000 LEU A CD2   1 
ATOM   7789  N  N     . ARG A  1  1001 ? 57.813  -142.649 121.581 1.00 44.48  ? 1001 ARG A N     1 
ATOM   7790  C  CA    . ARG A  1  1001 ? 57.403  -143.932 121.029 1.00 47.67  ? 1001 ARG A CA    1 
ATOM   7791  C  C     . ARG A  1  1001 ? 57.980  -144.375 119.717 1.00 49.19  ? 1001 ARG A C     1 
ATOM   7792  O  O     . ARG A  1  1001 ? 58.313  -145.545 119.583 1.00 51.60  ? 1001 ARG A O     1 
ATOM   7793  C  CB    . ARG A  1  1001 ? 55.870  -144.021 120.970 1.00 49.22  ? 1001 ARG A CB    1 
ATOM   7794  C  CG    . ARG A  1  1001 ? 55.244  -144.452 122.303 1.00 51.46  ? 1001 ARG A CG    1 
ATOM   7795  C  CD    . ARG A  1  1001 ? 53.835  -143.893 122.503 1.00 53.56  ? 1001 ARG A CD    1 
ATOM   7796  N  NE    . ARG A  1  1001 ? 53.490  -143.782 123.921 1.00 54.14  ? 1001 ARG A NE    1 
ATOM   7797  C  CZ    . ARG A  1  1001 ? 53.298  -144.816 124.736 1.00 54.86  ? 1001 ARG A CZ    1 
ATOM   7798  N  NH1   . ARG A  1  1001 ? 53.405  -146.061 124.285 1.00 53.33  ? 1001 ARG A NH1   1 
ATOM   7799  N  NH2   . ARG A  1  1001 ? 53.018  -144.603 126.016 1.00 56.37  ? 1001 ARG A NH2   1 
ATOM   7800  N  N     . GLY A  1  1002 ? 58.103  -143.466 118.757 1.00 50.10  ? 1002 GLY A N     1 
ATOM   7801  C  CA    . GLY A  1  1002 ? 58.634  -143.825 117.443 1.00 52.91  ? 1002 GLY A CA    1 
ATOM   7802  C  C     . GLY A  1  1002 ? 59.538  -145.049 117.236 1.00 54.66  ? 1002 GLY A C     1 
ATOM   7803  O  O     . GLY A  1  1002 ? 60.404  -145.366 118.060 1.00 54.77  ? 1002 GLY A O     1 
ATOM   7804  N  N     . LYS A  1  1003 ? 59.347  -145.737 116.113 1.00 56.12  ? 1003 LYS A N     1 
ATOM   7805  C  CA    . LYS A  1  1003 ? 60.157  -146.912 115.792 1.00 57.98  ? 1003 LYS A CA    1 
ATOM   7806  C  C     . LYS A  1  1003 ? 61.430  -146.532 115.026 1.00 58.19  ? 1003 LYS A C     1 
ATOM   7807  O  O     . LYS A  1  1003 ? 61.470  -146.621 113.796 1.00 58.05  ? 1003 LYS A O     1 
ATOM   7808  C  CB    . LYS A  1  1003 ? 59.363  -147.898 114.927 1.00 60.76  ? 1003 LYS A CB    1 
ATOM   7809  C  CG    . LYS A  1  1003 ? 58.111  -148.495 115.556 1.00 63.82  ? 1003 LYS A CG    1 
ATOM   7810  C  CD    . LYS A  1  1003 ? 57.569  -149.612 114.667 1.00 64.56  ? 1003 LYS A CD    1 
ATOM   7811  C  CE    . LYS A  1  1003 ? 56.356  -150.279 115.280 1.00 65.21  ? 1003 LYS A CE    1 
ATOM   7812  N  NZ    . LYS A  1  1003 ? 55.952  -151.462 114.476 1.00 66.94  ? 1003 LYS A NZ    1 
ATOM   7813  N  N     . ASN A  1  1004 ? 62.464  -146.102 115.738 1.00 57.80  ? 1004 ASN A N     1 
ATOM   7814  C  CA    . ASN A  1  1004 ? 63.722  -145.739 115.090 1.00 57.59  ? 1004 ASN A CA    1 
ATOM   7815  C  C     . ASN A  1  1004 ? 64.756  -145.320 116.129 1.00 57.24  ? 1004 ASN A C     1 
ATOM   7816  O  O     . ASN A  1  1004 ? 64.411  -144.946 117.247 1.00 56.99  ? 1004 ASN A O     1 
ATOM   7817  C  CB    . ASN A  1  1004 ? 63.516  -144.638 114.023 1.00 57.41  ? 1004 ASN A CB    1 
ATOM   7818  C  CG    . ASN A  1  1004 ? 63.496  -143.229 114.601 1.00 57.49  ? 1004 ASN A CG    1 
ATOM   7819  O  OD1   . ASN A  1  1004 ? 64.467  -142.768 115.206 1.00 57.80  ? 1004 ASN A OD1   1 
ATOM   7820  N  ND2   . ASN A  1  1004 ? 62.389  -142.532 114.399 1.00 56.73  ? 1004 ASN A ND2   1 
ATOM   7821  N  N     . GLU A  1  1005 ? 66.027  -145.373 115.752 1.00 57.25  ? 1005 GLU A N     1 
ATOM   7822  C  CA    . GLU A  1  1005 ? 67.102  -145.061 116.681 1.00 57.52  ? 1005 GLU A CA    1 
ATOM   7823  C  C     . GLU A  1  1005 ? 67.148  -143.687 117.324 1.00 55.29  ? 1005 GLU A C     1 
ATOM   7824  O  O     . GLU A  1  1005 ? 67.242  -143.577 118.552 1.00 54.44  ? 1005 GLU A O     1 
ATOM   7825  C  CB    . GLU A  1  1005 ? 68.453  -145.390 116.037 1.00 60.77  ? 1005 GLU A CB    1 
ATOM   7826  C  CG    . GLU A  1  1005 ? 69.166  -146.551 116.747 1.00 64.83  ? 1005 GLU A CG    1 
ATOM   7827  C  CD    . GLU A  1  1005 ? 68.174  -147.564 117.362 1.00 67.69  ? 1005 GLU A CD    1 
ATOM   7828  O  OE1   . GLU A  1  1005 ? 67.330  -148.098 116.602 1.00 68.80  ? 1005 GLU A OE1   1 
ATOM   7829  O  OE2   . GLU A  1  1005 ? 68.233  -147.824 118.597 1.00 67.62  ? 1005 GLU A OE2   1 
ATOM   7830  N  N     . ILE A  1  1006 ? 67.085  -142.636 116.522 1.00 53.18  ? 1006 ILE A N     1 
ATOM   7831  C  CA    . ILE A  1  1006 ? 67.136  -141.312 117.107 1.00 50.61  ? 1006 ILE A CA    1 
ATOM   7832  C  C     . ILE A  1  1006 ? 66.114  -141.185 118.226 1.00 48.27  ? 1006 ILE A C     1 
ATOM   7833  O  O     . ILE A  1  1006 ? 66.441  -140.751 119.330 1.00 48.03  ? 1006 ILE A O     1 
ATOM   7834  C  CB    . ILE A  1  1006 ? 66.865  -140.221 116.079 1.00 50.65  ? 1006 ILE A CB    1 
ATOM   7835  C  CG1   . ILE A  1  1006 ? 67.837  -140.353 114.904 1.00 51.71  ? 1006 ILE A CG1   1 
ATOM   7836  C  CG2   . ILE A  1  1006 ? 67.056  -138.875 116.728 1.00 51.39  ? 1006 ILE A CG2   1 
ATOM   7837  C  CD1   . ILE A  1  1006 ? 67.872  -139.138 113.973 1.00 51.99  ? 1006 ILE A CD1   1 
ATOM   7838  N  N     . ILE A  1  1007 ? 64.880  -141.582 117.944 1.00 45.23  ? 1007 ILE A N     1 
ATOM   7839  C  CA    . ILE A  1  1007 ? 63.823  -141.493 118.934 1.00 42.38  ? 1007 ILE A CA    1 
ATOM   7840  C  C     . ILE A  1  1007 ? 64.032  -142.445 120.094 1.00 41.77  ? 1007 ILE A C     1 
ATOM   7841  O  O     . ILE A  1  1007 ? 63.946  -142.054 121.254 1.00 40.30  ? 1007 ILE A O     1 
ATOM   7842  C  CB    . ILE A  1  1007 ? 62.479  -141.796 118.312 1.00 40.84  ? 1007 ILE A CB    1 
ATOM   7843  C  CG1   . ILE A  1  1007 ? 62.246  -140.881 117.109 1.00 39.72  ? 1007 ILE A CG1   1 
ATOM   7844  C  CG2   . ILE A  1  1007 ? 61.404  -141.609 119.344 1.00 41.78  ? 1007 ILE A CG2   1 
ATOM   7845  C  CD1   . ILE A  1  1007 ? 62.241  -139.411 117.454 1.00 39.05  ? 1007 ILE A CD1   1 
ATOM   7846  N  N     . GLN A  1  1008 ? 64.298  -143.704 119.776 1.00 42.20  ? 1008 GLN A N     1 
ATOM   7847  C  CA    . GLN A  1  1008 ? 64.515  -144.706 120.802 1.00 42.91  ? 1008 GLN A CA    1 
ATOM   7848  C  C     . GLN A  1  1008 ? 65.617  -144.292 121.753 1.00 43.61  ? 1008 GLN A C     1 
ATOM   7849  O  O     . GLN A  1  1008 ? 65.514  -144.491 122.967 1.00 43.58  ? 1008 GLN A O     1 
ATOM   7850  C  CB    . GLN A  1  1008 ? 64.852  -146.048 120.169 1.00 43.10  ? 1008 GLN A CB    1 
ATOM   7851  C  CG    . GLN A  1  1008 ? 63.635  -146.773 119.644 1.00 43.27  ? 1008 GLN A CG    1 
ATOM   7852  C  CD    . GLN A  1  1008 ? 62.590  -146.969 120.720 1.00 43.24  ? 1008 GLN A CD    1 
ATOM   7853  O  OE1   . GLN A  1  1008 ? 62.863  -147.548 121.783 1.00 42.74  ? 1008 GLN A OE1   1 
ATOM   7854  N  NE2   . GLN A  1  1008 ? 61.381  -146.484 120.457 1.00 42.35  ? 1008 GLN A NE2   1 
ATOM   7855  N  N     . ASN A  1  1009 ? 66.681  -143.724 121.205 1.00 43.74  ? 1009 ASN A N     1 
ATOM   7856  C  CA    . ASN A  1  1009 ? 67.768  -143.266 122.051 1.00 44.50  ? 1009 ASN A CA    1 
ATOM   7857  C  C     . ASN A  1  1009 ? 67.225  -142.188 122.977 1.00 43.28  ? 1009 ASN A C     1 
ATOM   7858  O  O     . ASN A  1  1009 ? 67.418  -142.245 124.190 1.00 42.07  ? 1009 ASN A O     1 
ATOM   7859  C  CB    . ASN A  1  1009 ? 68.896  -142.701 121.198 1.00 47.63  ? 1009 ASN A CB    1 
ATOM   7860  C  CG    . ASN A  1  1009 ? 69.890  -143.762 120.774 1.00 49.99  ? 1009 ASN A CG    1 
ATOM   7861  O  OD1   . ASN A  1  1009 ? 70.722  -144.203 121.577 1.00 51.16  ? 1009 ASN A OD1   1 
ATOM   7862  N  ND2   . ASN A  1  1009 ? 69.809  -144.185 119.512 1.00 51.03  ? 1009 ASN A ND2   1 
ATOM   7863  N  N     . ALA A  1  1010 ? 66.538  -141.213 122.386 1.00 41.82  ? 1010 ALA A N     1 
ATOM   7864  C  CA    . ALA A  1  1010 ? 65.940  -140.115 123.129 1.00 40.32  ? 1010 ALA A CA    1 
ATOM   7865  C  C     . ALA A  1  1010 ? 65.142  -140.667 124.291 1.00 39.39  ? 1010 ALA A C     1 
ATOM   7866  O  O     . ALA A  1  1010 ? 65.199  -140.149 125.404 1.00 38.27  ? 1010 ALA A O     1 
ATOM   7867  C  CB    . ALA A  1  1010 ? 65.035  -139.315 122.222 1.00 41.30  ? 1010 ALA A CB    1 
ATOM   7868  N  N     . GLN A  1  1011 ? 64.389  -141.721 124.015 1.00 38.84  ? 1011 GLN A N     1 
ATOM   7869  C  CA    . GLN A  1  1011 ? 63.584  -142.363 125.034 1.00 39.55  ? 1011 GLN A CA    1 
ATOM   7870  C  C     . GLN A  1  1011 ? 64.471  -142.806 126.190 1.00 41.45  ? 1011 GLN A C     1 
ATOM   7871  O  O     . GLN A  1  1011 ? 64.284  -142.403 127.339 1.00 41.08  ? 1011 GLN A O     1 
ATOM   7872  C  CB    . GLN A  1  1011 ? 62.869  -143.561 124.424 1.00 37.38  ? 1011 GLN A CB    1 
ATOM   7873  C  CG    . GLN A  1  1011 ? 62.586  -144.681 125.394 1.00 37.26  ? 1011 GLN A CG    1 
ATOM   7874  C  CD    . GLN A  1  1011 ? 61.680  -144.285 126.544 1.00 36.22  ? 1011 GLN A CD    1 
ATOM   7875  O  OE1   . GLN A  1  1011 ? 60.468  -144.139 126.387 1.00 34.94  ? 1011 GLN A OE1   1 
ATOM   7876  N  NE2   . GLN A  1  1011 ? 62.271  -144.113 127.713 1.00 36.67  ? 1011 GLN A NE2   1 
ATOM   7877  N  N     . ARG A  1  1012 ? 65.450  -143.637 125.873 1.00 43.92  ? 1012 ARG A N     1 
ATOM   7878  C  CA    . ARG A  1  1012 ? 66.373  -144.142 126.873 1.00 46.20  ? 1012 ARG A CA    1 
ATOM   7879  C  C     . ARG A  1  1012 ? 66.963  -143.007 127.716 1.00 45.91  ? 1012 ARG A C     1 
ATOM   7880  O  O     . ARG A  1  1012 ? 67.179  -143.168 128.911 1.00 45.72  ? 1012 ARG A O     1 
ATOM   7881  C  CB    . ARG A  1  1012 ? 67.476  -144.912 126.167 1.00 49.71  ? 1012 ARG A CB    1 
ATOM   7882  C  CG    . ARG A  1  1012 ? 68.221  -145.936 126.997 1.00 54.17  ? 1012 ARG A CG    1 
ATOM   7883  C  CD    . ARG A  1  1012 ? 69.213  -146.633 126.068 1.00 58.63  ? 1012 ARG A CD    1 
ATOM   7884  N  NE    . ARG A  1  1012 ? 68.553  -147.049 124.822 1.00 62.69  ? 1012 ARG A NE    1 
ATOM   7885  C  CZ    . ARG A  1  1012 ? 69.053  -146.862 123.599 1.00 64.26  ? 1012 ARG A CZ    1 
ATOM   7886  N  NH1   . ARG A  1  1012 ? 70.234  -146.260 123.451 1.00 65.29  ? 1012 ARG A NH1   1 
ATOM   7887  N  NH2   . ARG A  1  1012 ? 68.368  -147.266 122.526 1.00 63.05  ? 1012 ARG A NH2   1 
ATOM   7888  N  N     . ASP A  1  1013 ? 67.231  -141.865 127.093 1.00 45.50  ? 1013 ASP A N     1 
ATOM   7889  C  CA    . ASP A  1  1013 ? 67.783  -140.725 127.814 1.00 46.48  ? 1013 ASP A CA    1 
ATOM   7890  C  C     . ASP A  1  1013 ? 66.749  -140.279 128.832 1.00 45.59  ? 1013 ASP A C     1 
ATOM   7891  O  O     . ASP A  1  1013 ? 66.993  -140.234 130.030 1.00 45.11  ? 1013 ASP A O     1 
ATOM   7892  C  CB    . ASP A  1  1013 ? 68.037  -139.540 126.871 1.00 51.63  ? 1013 ASP A CB    1 
ATOM   7893  C  CG    . ASP A  1  1013 ? 69.104  -139.819 125.821 1.00 54.90  ? 1013 ASP A CG    1 
ATOM   7894  O  OD1   . ASP A  1  1013 ? 70.236  -140.200 126.206 1.00 56.87  ? 1013 ASP A OD1   1 
ATOM   7895  O  OD2   . ASP A  1  1013 ? 68.809  -139.633 124.610 1.00 56.03  ? 1013 ASP A OD2   1 
ATOM   7896  N  N     . ALA A  1  1014 ? 65.586  -139.928 128.310 1.00 44.33  ? 1014 ALA A N     1 
ATOM   7897  C  CA    . ALA A  1  1014 ? 64.462  -139.464 129.100 1.00 43.13  ? 1014 ALA A CA    1 
ATOM   7898  C  C     . ALA A  1  1014 ? 64.224  -140.237 130.386 1.00 41.83  ? 1014 ALA A C     1 
ATOM   7899  O  O     . ALA A  1  1014 ? 63.759  -139.690 131.385 1.00 42.14  ? 1014 ALA A O     1 
ATOM   7900  C  CB    . ALA A  1  1014 ? 63.204  -139.521 128.252 1.00 44.57  ? 1014 ALA A CB    1 
ATOM   7901  N  N     . VAL A  1  1015 ? 64.542  -141.517 130.361 1.00 40.05  ? 1015 VAL A N     1 
ATOM   7902  C  CA    . VAL A  1  1015 ? 64.293  -142.355 131.511 1.00 38.19  ? 1015 VAL A CA    1 
ATOM   7903  C  C     . VAL A  1  1015 ? 65.507  -142.685 132.379 1.00 38.44  ? 1015 VAL A C     1 
ATOM   7904  O  O     . VAL A  1  1015 ? 65.380  -143.255 133.468 1.00 37.75  ? 1015 VAL A O     1 
ATOM   7905  C  CB    . VAL A  1  1015 ? 63.639  -143.629 131.015 1.00 36.87  ? 1015 VAL A CB    1 
ATOM   7906  C  CG1   . VAL A  1  1015 ? 63.425  -144.580 132.139 1.00 38.78  ? 1015 VAL A CG1   1 
ATOM   7907  C  CG2   . VAL A  1  1015 ? 62.334  -143.285 130.347 1.00 35.39  ? 1015 VAL A CG2   1 
ATOM   7908  N  N     . THR A  1  1016 ? 66.681  -142.298 131.903 1.00 38.17  ? 1016 THR A N     1 
ATOM   7909  C  CA    . THR A  1  1016 ? 67.929  -142.572 132.595 1.00 37.66  ? 1016 THR A CA    1 
ATOM   7910  C  C     . THR A  1  1016 ? 67.946  -142.361 134.100 1.00 37.73  ? 1016 THR A C     1 
ATOM   7911  O  O     . THR A  1  1016 ? 68.254  -143.284 134.860 1.00 37.83  ? 1016 THR A O     1 
ATOM   7912  C  CB    . THR A  1  1016 ? 69.051  -141.739 132.022 1.00 38.63  ? 1016 THR A CB    1 
ATOM   7913  O  OG1   . THR A  1  1016 ? 68.991  -141.784 130.591 1.00 40.53  ? 1016 THR A OG1   1 
ATOM   7914  C  CG2   . THR A  1  1016 ? 70.397  -142.267 132.515 1.00 38.87  ? 1016 THR A CG2   1 
ATOM   7915  N  N     . LEU A  1  1017 ? 67.632  -141.147 134.539 1.00 36.75  ? 1017 LEU A N     1 
ATOM   7916  C  CA    . LEU A  1  1017 ? 67.670  -140.877 135.959 1.00 35.43  ? 1017 LEU A CA    1 
ATOM   7917  C  C     . LEU A  1  1017 ? 66.600  -141.634 136.713 1.00 36.30  ? 1017 LEU A C     1 
ATOM   7918  O  O     . LEU A  1  1017 ? 66.854  -142.135 137.810 1.00 36.27  ? 1017 LEU A O     1 
ATOM   7919  C  CB    . LEU A  1  1017 ? 67.560  -139.377 136.231 1.00 32.71  ? 1017 LEU A CB    1 
ATOM   7920  C  CG    . LEU A  1  1017 ? 67.477  -138.965 137.709 1.00 31.14  ? 1017 LEU A CG    1 
ATOM   7921  C  CD1   . LEU A  1  1017 ? 68.605  -139.541 138.570 1.00 26.48  ? 1017 LEU A CD1   1 
ATOM   7922  C  CD2   . LEU A  1  1017 ? 67.491  -137.462 137.737 1.00 30.77  ? 1017 LEU A CD2   1 
ATOM   7923  N  N     . PHE A  1  1018 ? 65.408  -141.746 136.138 1.00 37.40  ? 1018 PHE A N     1 
ATOM   7924  C  CA    . PHE A  1  1018 ? 64.349  -142.456 136.850 1.00 39.02  ? 1018 PHE A CA    1 
ATOM   7925  C  C     . PHE A  1  1018 ? 64.749  -143.885 137.131 1.00 40.09  ? 1018 PHE A C     1 
ATOM   7926  O  O     . PHE A  1  1018 ? 64.597  -144.369 138.258 1.00 41.51  ? 1018 PHE A O     1 
ATOM   7927  C  CB    . PHE A  1  1018 ? 63.024  -142.469 136.077 1.00 38.51  ? 1018 PHE A CB    1 
ATOM   7928  C  CG    . PHE A  1  1018 ? 61.919  -143.220 136.786 1.00 36.51  ? 1018 PHE A CG    1 
ATOM   7929  C  CD1   . PHE A  1  1018 ? 61.600  -142.927 138.107 1.00 35.44  ? 1018 PHE A CD1   1 
ATOM   7930  C  CD2   . PHE A  1  1018 ? 61.230  -144.243 136.149 1.00 36.25  ? 1018 PHE A CD2   1 
ATOM   7931  C  CE1   . PHE A  1  1018 ? 60.615  -143.644 138.786 1.00 35.02  ? 1018 PHE A CE1   1 
ATOM   7932  C  CE2   . PHE A  1  1018 ? 60.240  -144.967 136.827 1.00 36.76  ? 1018 PHE A CE2   1 
ATOM   7933  C  CZ    . PHE A  1  1018 ? 59.937  -144.665 138.146 1.00 35.17  ? 1018 PHE A CZ    1 
ATOM   7934  N  N     . CYS A  1  1019 ? 65.265  -144.560 136.112 1.00 39.23  ? 1019 CYS A N     1 
ATOM   7935  C  CA    . CYS A  1  1019 ? 65.659  -145.945 136.279 1.00 39.41  ? 1019 CYS A CA    1 
ATOM   7936  C  C     . CYS A  1  1019 ? 66.669  -146.155 137.388 1.00 38.68  ? 1019 CYS A C     1 
ATOM   7937  O  O     . CYS A  1  1019 ? 66.583  -147.135 138.133 1.00 38.77  ? 1019 CYS A O     1 
ATOM   7938  C  CB    . CYS A  1  1019 ? 66.161  -146.491 134.957 1.00 39.46  ? 1019 CYS A CB    1 
ATOM   7939  S  SG    . CYS A  1  1019 ? 64.785  -146.622 133.809 1.00 41.46  ? 1019 CYS A SG    1 
ATOM   7940  N  N     . CYS A  1  1020 ? 67.625  -145.245 137.511 1.00 37.37  ? 1020 CYS A N     1 
ATOM   7941  C  CA    . CYS A  1  1020 ? 68.579  -145.371 138.595 1.00 37.24  ? 1020 CYS A CA    1 
ATOM   7942  C  C     . CYS A  1  1020 ? 67.772  -145.489 139.881 1.00 36.09  ? 1020 CYS A C     1 
ATOM   7943  O  O     . CYS A  1  1020 ? 68.043  -146.340 140.732 1.00 35.73  ? 1020 CYS A O     1 
ATOM   7944  C  CB    . CYS A  1  1020 ? 69.461  -144.139 138.670 1.00 37.32  ? 1020 CYS A CB    1 
ATOM   7945  S  SG    . CYS A  1  1020 ? 70.482  -143.988 137.249 1.00 41.48  ? 1020 CYS A SG    1 
ATOM   7946  N  N     . LEU A  1  1021 ? 66.774  -144.624 140.016 1.00 34.60  ? 1021 LEU A N     1 
ATOM   7947  C  CA    . LEU A  1  1021 ? 65.945  -144.666 141.197 1.00 33.55  ? 1021 LEU A CA    1 
ATOM   7948  C  C     . LEU A  1  1021 ? 65.366  -146.061 141.274 1.00 32.56  ? 1021 LEU A C     1 
ATOM   7949  O  O     . LEU A  1  1021 ? 65.532  -146.761 142.272 1.00 32.88  ? 1021 LEU A O     1 
ATOM   7950  C  CB    . LEU A  1  1021 ? 64.813  -143.635 141.120 1.00 32.54  ? 1021 LEU A CB    1 
ATOM   7951  C  CG    . LEU A  1  1021 ? 63.782  -143.773 142.255 1.00 31.43  ? 1021 LEU A CG    1 
ATOM   7952  C  CD1   . LEU A  1  1021 ? 64.422  -143.527 143.626 1.00 28.29  ? 1021 LEU A CD1   1 
ATOM   7953  C  CD2   . LEU A  1  1021 ? 62.646  -142.811 141.998 1.00 30.27  ? 1021 LEU A CD2   1 
ATOM   7954  N  N     . LEU A  1  1022 ? 64.707  -146.468 140.198 1.00 31.58  ? 1022 LEU A N     1 
ATOM   7955  C  CA    . LEU A  1  1022 ? 64.083  -147.774 140.150 1.00 33.17  ? 1022 LEU A CA    1 
ATOM   7956  C  C     . LEU A  1  1022 ? 65.001  -148.878 140.695 1.00 34.63  ? 1022 LEU A C     1 
ATOM   7957  O  O     . LEU A  1  1022 ? 64.647  -149.557 141.670 1.00 35.12  ? 1022 LEU A O     1 
ATOM   7958  C  CB    . LEU A  1  1022 ? 63.638  -148.078 138.716 1.00 32.85  ? 1022 LEU A CB    1 
ATOM   7959  C  CG    . LEU A  1  1022 ? 62.747  -149.307 138.508 1.00 33.16  ? 1022 LEU A CG    1 
ATOM   7960  C  CD1   . LEU A  1  1022 ? 61.624  -149.312 139.519 1.00 32.89  ? 1022 LEU A CD1   1 
ATOM   7961  C  CD2   . LEU A  1  1022 ? 62.183  -149.301 137.097 1.00 33.09  ? 1022 LEU A CD2   1 
ATOM   7962  N  N     . ARG A  1  1023 ? 66.180  -149.045 140.092 1.00 35.10  ? 1023 ARG A N     1 
ATOM   7963  C  CA    . ARG A  1  1023 ? 67.130  -150.070 140.536 1.00 34.70  ? 1023 ARG A CA    1 
ATOM   7964  C  C     . ARG A  1  1023 ? 67.626  -149.838 141.948 1.00 35.75  ? 1023 ARG A C     1 
ATOM   7965  O  O     . ARG A  1  1023 ? 67.937  -150.776 142.674 1.00 35.99  ? 1023 ARG A O     1 
ATOM   7966  C  CB    . ARG A  1  1023 ? 68.308  -150.129 139.587 1.00 31.91  ? 1023 ARG A CB    1 
ATOM   7967  C  CG    . ARG A  1  1023 ? 67.856  -150.409 138.194 1.00 30.27  ? 1023 ARG A CG    1 
ATOM   7968  C  CD    . ARG A  1  1023 ? 69.015  -150.393 137.271 1.00 30.34  ? 1023 ARG A CD    1 
ATOM   7969  N  NE    . ARG A  1  1023 ? 68.668  -149.699 136.049 1.00 30.18  ? 1023 ARG A NE    1 
ATOM   7970  C  CZ    . ARG A  1  1023 ? 69.377  -148.696 135.549 1.00 31.22  ? 1023 ARG A CZ    1 
ATOM   7971  N  NH1   . ARG A  1  1023 ? 70.472  -148.289 136.182 1.00 27.28  ? 1023 ARG A NH1   1 
ATOM   7972  N  NH2   . ARG A  1  1023 ? 68.985  -148.100 134.420 1.00 31.82  ? 1023 ARG A NH2   1 
ATOM   7973  N  N     . SER A  1  1024 ? 67.698  -148.576 142.332 1.00 37.23  ? 1024 SER A N     1 
ATOM   7974  C  CA    . SER A  1  1024 ? 68.134  -148.214 143.664 1.00 39.44  ? 1024 SER A CA    1 
ATOM   7975  C  C     . SER A  1  1024 ? 67.182  -148.837 144.681 1.00 40.29  ? 1024 SER A C     1 
ATOM   7976  O  O     . SER A  1  1024 ? 67.587  -149.200 145.786 1.00 41.19  ? 1024 SER A O     1 
ATOM   7977  C  CB    . SER A  1  1024 ? 68.108  -146.686 143.810 1.00 41.03  ? 1024 SER A CB    1 
ATOM   7978  O  OG    . SER A  1  1024 ? 68.479  -146.256 145.115 1.00 43.64  ? 1024 SER A OG    1 
ATOM   7979  N  N     . ARG A  1  1025 ? 65.919  -148.976 144.289 1.00 40.04  ? 1025 ARG A N     1 
ATOM   7980  C  CA    . ARG A  1  1025 ? 64.895  -149.491 145.181 1.00 39.80  ? 1025 ARG A CA    1 
ATOM   7981  C  C     . ARG A  1  1025 ? 64.448  -150.912 144.959 1.00 38.58  ? 1025 ARG A C     1 
ATOM   7982  O  O     . ARG A  1  1025 ? 63.899  -151.529 145.861 1.00 38.76  ? 1025 ARG A O     1 
ATOM   7983  C  CB    . ARG A  1  1025 ? 63.670  -148.586 145.110 1.00 41.60  ? 1025 ARG A CB    1 
ATOM   7984  C  CG    . ARG A  1  1025 ? 63.953  -147.140 145.467 1.00 43.51  ? 1025 ARG A CG    1 
ATOM   7985  C  CD    . ARG A  1  1025 ? 64.221  -146.993 146.952 1.00 44.71  ? 1025 ARG A CD    1 
ATOM   7986  N  NE    . ARG A  1  1025 ? 64.409  -145.596 147.313 1.00 46.62  ? 1025 ARG A NE    1 
ATOM   7987  C  CZ    . ARG A  1  1025 ? 63.499  -144.650 147.116 1.00 47.97  ? 1025 ARG A CZ    1 
ATOM   7988  N  NH1   . ARG A  1  1025 ? 62.336  -144.956 146.562 1.00 48.98  ? 1025 ARG A NH1   1 
ATOM   7989  N  NH2   . ARG A  1  1025 ? 63.749  -143.396 147.471 1.00 49.33  ? 1025 ARG A NH2   1 
ATOM   7990  N  N     . LEU A  1  1026 ? 64.643  -151.434 143.761 1.00 37.72  ? 1026 LEU A N     1 
ATOM   7991  C  CA    . LEU A  1  1026 ? 64.219  -152.801 143.503 1.00 37.93  ? 1026 LEU A CA    1 
ATOM   7992  C  C     . LEU A  1  1026 ? 65.384  -153.770 143.328 1.00 39.41  ? 1026 LEU A C     1 
ATOM   7993  O  O     . LEU A  1  1026 ? 65.385  -154.631 142.450 1.00 38.79  ? 1026 LEU A O     1 
ATOM   7994  C  CB    . LEU A  1  1026 ? 63.298  -152.826 142.294 1.00 34.89  ? 1026 LEU A CB    1 
ATOM   7995  C  CG    . LEU A  1  1026 ? 62.083  -151.942 142.555 1.00 32.63  ? 1026 LEU A CG    1 
ATOM   7996  C  CD1   . LEU A  1  1026 ? 61.074  -152.140 141.448 1.00 31.84  ? 1026 LEU A CD1   1 
ATOM   7997  C  CD2   . LEU A  1  1026 ? 61.476  -152.287 143.910 1.00 30.95  ? 1026 LEU A CD2   1 
ATOM   7998  N  N     . ALA A  1  1027 ? 66.382  -153.609 144.190 1.00 41.53  ? 1027 ALA A N     1 
ATOM   7999  C  CA    . ALA A  1  1027 ? 67.562  -154.455 144.179 1.00 41.80  ? 1027 ALA A CA    1 
ATOM   8000  C  C     . ALA A  1  1027 ? 67.230  -155.728 144.937 1.00 41.57  ? 1027 ALA A C     1 
ATOM   8001  O  O     . ALA A  1  1027 ? 66.633  -155.700 146.019 1.00 40.44  ? 1027 ALA A O     1 
ATOM   8002  C  CB    . ALA A  1  1027 ? 68.726  -153.738 144.839 1.00 42.61  ? 1027 ALA A CB    1 
ATOM   8003  N  N     . THR A  1  1028 ? 67.624  -156.844 144.352 1.00 41.34  ? 1028 THR A N     1 
ATOM   8004  C  CA    . THR A  1  1028 ? 67.362  -158.132 144.941 1.00 42.16  ? 1028 THR A CA    1 
ATOM   8005  C  C     . THR A  1  1028 ? 67.500  -158.164 146.443 1.00 42.21  ? 1028 THR A C     1 
ATOM   8006  O  O     . THR A  1  1028 ? 66.610  -158.626 147.138 1.00 41.45  ? 1028 THR A O     1 
ATOM   8007  C  CB    . THR A  1  1028 ? 68.270  -159.154 144.347 1.00 43.04  ? 1028 THR A CB    1 
ATOM   8008  O  OG1   . THR A  1  1028 ? 68.009  -159.232 142.940 1.00 43.91  ? 1028 THR A OG1   1 
ATOM   8009  C  CG2   . THR A  1  1028 ? 68.028  -160.498 144.995 1.00 43.38  ? 1028 THR A CG2   1 
ATOM   8010  N  N     . ARG A  1  1029 ? 68.618  -157.676 146.949 1.00 43.57  ? 1029 ARG A N     1 
ATOM   8011  C  CA    . ARG A  1  1029 ? 68.828  -157.666 148.386 1.00 45.40  ? 1029 ARG A CA    1 
ATOM   8012  C  C     . ARG A  1  1029 ? 67.714  -156.938 149.126 1.00 45.04  ? 1029 ARG A C     1 
ATOM   8013  O  O     . ARG A  1  1029 ? 67.122  -157.478 150.056 1.00 44.44  ? 1029 ARG A O     1 
ATOM   8014  C  CB    . ARG A  1  1029 ? 70.155  -156.996 148.716 1.00 48.82  ? 1029 ARG A CB    1 
ATOM   8015  C  CG    . ARG A  1  1029 ? 71.064  -157.846 149.569 1.00 52.20  ? 1029 ARG A CG    1 
ATOM   8016  C  CD    . ARG A  1  1029 ? 70.490  -158.115 150.950 1.00 53.33  ? 1029 ARG A CD    1 
ATOM   8017  N  NE    . ARG A  1  1029 ? 71.041  -159.361 151.469 1.00 54.89  ? 1029 ARG A NE    1 
ATOM   8018  C  CZ    . ARG A  1  1029 ? 72.337  -159.653 151.497 1.00 56.22  ? 1029 ARG A CZ    1 
ATOM   8019  N  NH1   . ARG A  1  1029 ? 73.240  -158.788 151.041 1.00 55.42  ? 1029 ARG A NH1   1 
ATOM   8020  N  NH2   . ARG A  1  1029 ? 72.727  -160.828 151.971 1.00 58.03  ? 1029 ARG A NH2   1 
ATOM   8021  N  N     . ARG A  1  1030 ? 67.455  -155.700 148.709 1.00 44.81  ? 1030 ARG A N     1 
ATOM   8022  C  CA    . ARG A  1  1030 ? 66.426  -154.856 149.306 1.00 43.80  ? 1030 ARG A CA    1 
ATOM   8023  C  C     . ARG A  1  1030 ? 65.079  -155.543 149.229 1.00 42.06  ? 1030 ARG A C     1 
ATOM   8024  O  O     . ARG A  1  1030 ? 64.434  -155.804 150.244 1.00 41.43  ? 1030 ARG A O     1 
ATOM   8025  C  CB    . ARG A  1  1030 ? 66.337  -153.536 148.551 1.00 45.67  ? 1030 ARG A CB    1 
ATOM   8026  C  CG    . ARG A  1  1030 ? 67.121  -152.375 149.128 1.00 49.46  ? 1030 ARG A CG    1 
ATOM   8027  C  CD    . ARG A  1  1030 ? 67.205  -151.255 148.081 1.00 53.67  ? 1030 ARG A CD    1 
ATOM   8028  N  NE    . ARG A  1  1030 ? 67.413  -149.910 148.627 1.00 55.29  ? 1030 ARG A NE    1 
ATOM   8029  C  CZ    . ARG A  1  1030 ? 66.507  -149.239 149.331 1.00 55.53  ? 1030 ARG A CZ    1 
ATOM   8030  N  NH1   . ARG A  1  1030 ? 65.324  -149.782 149.591 1.00 56.04  ? 1030 ARG A NH1   1 
ATOM   8031  N  NH2   . ARG A  1  1030 ? 66.776  -148.013 149.751 1.00 55.50  ? 1030 ARG A NH2   1 
ATOM   8032  N  N     . VAL A  1  1031 ? 64.666  -155.817 147.999 1.00 40.09  ? 1031 VAL A N     1 
ATOM   8033  C  CA    . VAL A  1  1031 ? 63.396  -156.458 147.721 1.00 38.82  ? 1031 VAL A CA    1 
ATOM   8034  C  C     . VAL A  1  1031 ? 63.064  -157.577 148.683 1.00 39.32  ? 1031 VAL A C     1 
ATOM   8035  O  O     . VAL A  1  1031 ? 61.897  -157.766 149.014 1.00 39.92  ? 1031 VAL A O     1 
ATOM   8036  C  CB    . VAL A  1  1031 ? 63.378  -157.055 146.301 1.00 38.27  ? 1031 VAL A CB    1 
ATOM   8037  C  CG1   . VAL A  1  1031 ? 62.068  -157.780 146.048 1.00 35.46  ? 1031 VAL A CG1   1 
ATOM   8038  C  CG2   . VAL A  1  1031 ? 63.602  -155.957 145.278 1.00 38.52  ? 1031 VAL A CG2   1 
ATOM   8039  N  N     . LEU A  1  1032 ? 64.085  -158.305 149.140 1.00 39.09  ? 1032 LEU A N     1 
ATOM   8040  C  CA    . LEU A  1  1032 ? 63.883  -159.458 150.030 1.00 38.53  ? 1032 LEU A CA    1 
ATOM   8041  C  C     . LEU A  1  1032 ? 64.237  -159.264 151.498 1.00 39.01  ? 1032 LEU A C     1 
ATOM   8042  O  O     . LEU A  1  1032 ? 63.540  -159.743 152.392 1.00 37.80  ? 1032 LEU A O     1 
ATOM   8043  C  CB    . LEU A  1  1032 ? 64.679  -160.660 149.501 1.00 36.00  ? 1032 LEU A CB    1 
ATOM   8044  C  CG    . LEU A  1  1032 ? 64.378  -161.256 148.120 1.00 33.38  ? 1032 LEU A CG    1 
ATOM   8045  C  CD1   . LEU A  1  1032 ? 65.595  -161.981 147.626 1.00 31.97  ? 1032 LEU A CD1   1 
ATOM   8046  C  CD2   . LEU A  1  1032 ? 63.193  -162.198 148.178 1.00 31.78  ? 1032 LEU A CD2   1 
ATOM   8047  N  N     . GLN A  1  1033 ? 65.343  -158.580 151.728 1.00 41.61  ? 1033 GLN A N     1 
ATOM   8048  C  CA    . GLN A  1  1033 ? 65.837  -158.328 153.071 1.00 45.71  ? 1033 GLN A CA    1 
ATOM   8049  C  C     . GLN A  1  1033 ? 65.061  -157.200 153.739 1.00 47.68  ? 1033 GLN A C     1 
ATOM   8050  O  O     . GLN A  1  1033 ? 64.605  -157.319 154.883 1.00 48.12  ? 1033 GLN A O     1 
ATOM   8051  C  CB    . GLN A  1  1033 ? 67.317  -157.948 152.984 1.00 47.09  ? 1033 GLN A CB    1 
ATOM   8052  C  CG    . GLN A  1  1033 ? 68.020  -157.801 154.306 1.00 49.69  ? 1033 GLN A CG    1 
ATOM   8053  C  CD    . GLN A  1  1033 ? 69.079  -158.853 154.482 1.00 52.29  ? 1033 GLN A CD    1 
ATOM   8054  O  OE1   . GLN A  1  1033 ? 68.768  -160.029 154.666 1.00 54.52  ? 1033 GLN A OE1   1 
ATOM   8055  N  NE2   . GLN A  1  1033 ? 70.343  -158.446 154.407 1.00 53.24  ? 1033 GLN A NE2   1 
ATOM   8056  N  N     . GLU A  1  1034 ? 64.923  -156.103 152.998 1.00 49.05  ? 1034 GLU A N     1 
ATOM   8057  C  CA    . GLU A  1  1034 ? 64.250  -154.917 153.478 1.00 49.56  ? 1034 GLU A CA    1 
ATOM   8058  C  C     . GLU A  1  1034 ? 62.721  -154.981 153.361 1.00 50.29  ? 1034 GLU A C     1 
ATOM   8059  O  O     . GLU A  1  1034 ? 62.016  -155.069 154.374 1.00 50.61  ? 1034 GLU A O     1 
ATOM   8060  C  CB    . GLU A  1  1034 ? 64.815  -153.694 152.733 1.00 49.29  ? 1034 GLU A CB    1 
ATOM   8061  C  CG    . GLU A  1  1034 ? 66.277  -153.361 153.085 1.00 49.39  ? 1034 GLU A CG    1 
ATOM   8062  C  CD    . GLU A  1  1034 ? 66.824  -152.095 152.397 1.00 50.14  ? 1034 GLU A CD    1 
ATOM   8063  O  OE1   . GLU A  1  1034 ? 66.202  -151.016 152.505 1.00 49.68  ? 1034 GLU A OE1   1 
ATOM   8064  O  OE2   . GLU A  1  1034 ? 67.894  -152.172 151.757 1.00 49.58  ? 1034 GLU A OE2   1 
ATOM   8065  N  N     . TYR A  1  1035 ? 62.220  -154.961 152.128 1.00 50.09  ? 1035 TYR A N     1 
ATOM   8066  C  CA    . TYR A  1  1035 ? 60.779  -154.972 151.858 1.00 51.04  ? 1035 TYR A CA    1 
ATOM   8067  C  C     . TYR A  1  1035 ? 60.053  -156.251 152.274 1.00 52.17  ? 1035 TYR A C     1 
ATOM   8068  O  O     . TYR A  1  1035 ? 58.902  -156.211 152.736 1.00 53.00  ? 1035 TYR A O     1 
ATOM   8069  C  CB    . TYR A  1  1035 ? 60.520  -154.733 150.360 1.00 49.62  ? 1035 TYR A CB    1 
ATOM   8070  C  CG    . TYR A  1  1035 ? 61.241  -153.539 149.760 1.00 48.09  ? 1035 TYR A CG    1 
ATOM   8071  C  CD1   . TYR A  1  1035 ? 61.394  -153.419 148.379 1.00 47.44  ? 1035 TYR A CD1   1 
ATOM   8072  C  CD2   . TYR A  1  1035 ? 61.795  -152.545 150.572 1.00 47.00  ? 1035 TYR A CD2   1 
ATOM   8073  C  CE1   . TYR A  1  1035 ? 62.087  -152.344 147.825 1.00 46.63  ? 1035 TYR A CE1   1 
ATOM   8074  C  CE2   . TYR A  1  1035 ? 62.489  -151.468 150.028 1.00 45.76  ? 1035 TYR A CE2   1 
ATOM   8075  C  CZ    . TYR A  1  1035 ? 62.632  -151.375 148.658 1.00 46.19  ? 1035 TYR A CZ    1 
ATOM   8076  O  OH    . TYR A  1  1035 ? 63.333  -150.319 148.129 1.00 46.40  ? 1035 TYR A OH    1 
ATOM   8077  N  N     . ARG A  1  1036 ? 60.720  -157.385 152.095 1.00 52.00  ? 1036 ARG A N     1 
ATOM   8078  C  CA    . ARG A  1  1036 ? 60.125  -158.670 152.428 1.00 51.13  ? 1036 ARG A CA    1 
ATOM   8079  C  C     . ARG A  1  1036 ? 58.941  -158.966 151.521 1.00 49.15  ? 1036 ARG A C     1 
ATOM   8080  O  O     . ARG A  1  1036 ? 58.024  -159.670 151.921 1.00 49.17  ? 1036 ARG A O     1 
ATOM   8081  C  CB    . ARG A  1  1036 ? 59.663  -158.690 153.888 1.00 53.35  ? 1036 ARG A CB    1 
ATOM   8082  C  CG    . ARG A  1  1036 ? 60.679  -159.266 154.864 1.00 56.81  ? 1036 ARG A CG    1 
ATOM   8083  C  CD    . ARG A  1  1036 ? 61.022  -160.733 154.546 1.00 60.21  ? 1036 ARG A CD    1 
ATOM   8084  N  NE    . ARG A  1  1036 ? 61.910  -161.297 155.556 1.00 63.55  ? 1036 ARG A NE    1 
ATOM   8085  C  CZ    . ARG A  1  1036 ? 62.994  -160.676 156.018 1.00 65.77  ? 1036 ARG A CZ    1 
ATOM   8086  N  NH1   . ARG A  1  1036 ? 63.322  -159.474 155.560 1.00 66.93  ? 1036 ARG A NH1   1 
ATOM   8087  N  NH2   . ARG A  1  1036 ? 63.756  -161.247 156.941 1.00 66.63  ? 1036 ARG A NH2   1 
ATOM   8088  N  N     . LEU A  1  1037 ? 58.962  -158.440 150.300 1.00 47.44  ? 1037 LEU A N     1 
ATOM   8089  C  CA    . LEU A  1  1037 ? 57.862  -158.667 149.362 1.00 46.80  ? 1037 LEU A CA    1 
ATOM   8090  C  C     . LEU A  1  1037 ? 57.708  -160.117 148.934 1.00 46.10  ? 1037 LEU A C     1 
ATOM   8091  O  O     . LEU A  1  1037 ? 58.683  -160.845 148.816 1.00 46.08  ? 1037 LEU A O     1 
ATOM   8092  C  CB    . LEU A  1  1037 ? 58.038  -157.848 148.087 1.00 47.26  ? 1037 LEU A CB    1 
ATOM   8093  C  CG    . LEU A  1  1037 ? 58.208  -156.339 148.101 1.00 47.79  ? 1037 LEU A CG    1 
ATOM   8094  C  CD1   . LEU A  1  1037 ? 57.701  -155.848 146.759 1.00 47.18  ? 1037 LEU A CD1   1 
ATOM   8095  C  CD2   . LEU A  1  1037 ? 57.434  -155.691 149.240 1.00 47.64  ? 1037 LEU A CD2   1 
ATOM   8096  N  N     . THR A  1  1038 ? 56.471  -160.525 148.677 1.00 45.78  ? 1038 THR A N     1 
ATOM   8097  C  CA    . THR A  1  1038 ? 56.190  -161.876 148.214 1.00 44.23  ? 1038 THR A CA    1 
ATOM   8098  C  C     . THR A  1  1038 ? 56.161  -161.741 146.702 1.00 44.18  ? 1038 THR A C     1 
ATOM   8099  O  O     . THR A  1  1038 ? 56.268  -160.640 146.185 1.00 44.53  ? 1038 THR A O     1 
ATOM   8100  C  CB    . THR A  1  1038 ? 54.817  -162.351 148.663 1.00 43.41  ? 1038 THR A CB    1 
ATOM   8101  O  OG1   . THR A  1  1038 ? 53.839  -161.912 147.714 1.00 43.18  ? 1038 THR A OG1   1 
ATOM   8102  C  CG2   . THR A  1  1038 ? 54.473  -161.775 150.030 1.00 42.93  ? 1038 THR A CG2   1 
ATOM   8103  N  N     . LYS A  1  1039 ? 56.003  -162.840 145.986 1.00 45.01  ? 1039 LYS A N     1 
ATOM   8104  C  CA    . LYS A  1  1039 ? 55.976  -162.768 144.527 1.00 47.18  ? 1039 LYS A CA    1 
ATOM   8105  C  C     . LYS A  1  1039 ? 54.784  -161.978 144.027 1.00 48.05  ? 1039 LYS A C     1 
ATOM   8106  O  O     . LYS A  1  1039 ? 54.838  -161.369 142.962 1.00 47.95  ? 1039 LYS A O     1 
ATOM   8107  C  CB    . LYS A  1  1039 ? 55.948  -164.172 143.919 1.00 47.91  ? 1039 LYS A CB    1 
ATOM   8108  C  CG    . LYS A  1  1039 ? 55.328  -164.267 142.527 1.00 46.92  ? 1039 LYS A CG    1 
ATOM   8109  C  CD    . LYS A  1  1039 ? 56.248  -163.843 141.402 1.00 46.76  ? 1039 LYS A CD    1 
ATOM   8110  C  CE    . LYS A  1  1039 ? 55.597  -164.224 140.071 1.00 48.35  ? 1039 LYS A CE    1 
ATOM   8111  N  NZ    . LYS A  1  1039 ? 56.395  -163.896 138.854 1.00 49.00  ? 1039 LYS A NZ    1 
ATOM   8112  N  N     . GLN A  1  1040 ? 53.708  -162.001 144.802 1.00 49.72  ? 1040 GLN A N     1 
ATOM   8113  C  CA    . GLN A  1  1040 ? 52.485  -161.288 144.455 1.00 50.22  ? 1040 GLN A CA    1 
ATOM   8114  C  C     . GLN A  1  1040 ? 52.708  -159.799 144.678 1.00 49.03  ? 1040 GLN A C     1 
ATOM   8115  O  O     . GLN A  1  1040 ? 52.645  -159.006 143.740 1.00 49.22  ? 1040 GLN A O     1 
ATOM   8116  C  CB    . GLN A  1  1040 ? 51.344  -161.787 145.329 1.00 52.30  ? 1040 GLN A CB    1 
ATOM   8117  C  CG    . GLN A  1  1040 ? 50.009  -161.174 145.028 1.00 56.30  ? 1040 GLN A CG    1 
ATOM   8118  C  CD    . GLN A  1  1040 ? 48.897  -161.832 145.825 1.00 58.45  ? 1040 GLN A CD    1 
ATOM   8119  O  OE1   . GLN A  1  1040 ? 48.997  -161.978 147.049 1.00 59.32  ? 1040 GLN A OE1   1 
ATOM   8120  N  NE2   . GLN A  1  1040 ? 47.826  -162.232 145.136 1.00 58.91  ? 1040 GLN A NE2   1 
ATOM   8121  N  N     . ALA A  1  1041 ? 52.977  -159.426 145.924 1.00 47.01  ? 1041 ALA A N     1 
ATOM   8122  C  CA    . ALA A  1  1041 ? 53.242  -158.036 146.263 1.00 46.19  ? 1041 ALA A CA    1 
ATOM   8123  C  C     . ALA A  1  1041 ? 54.173  -157.393 145.231 1.00 45.69  ? 1041 ALA A C     1 
ATOM   8124  O  O     . ALA A  1  1041 ? 53.967  -156.255 144.815 1.00 46.15  ? 1041 ALA A O     1 
ATOM   8125  C  CB    . ALA A  1  1041 ? 53.875  -157.953 147.643 1.00 45.73  ? 1041 ALA A CB    1 
ATOM   8126  N  N     . PHE A  1  1042 ? 55.198  -158.131 144.825 1.00 44.49  ? 1042 PHE A N     1 
ATOM   8127  C  CA    . PHE A  1  1042 ? 56.166  -157.642 143.855 1.00 42.87  ? 1042 PHE A CA    1 
ATOM   8128  C  C     . PHE A  1  1042 ? 55.525  -157.324 142.504 1.00 43.59  ? 1042 PHE A C     1 
ATOM   8129  O  O     . PHE A  1  1042 ? 55.626  -156.200 142.016 1.00 44.34  ? 1042 PHE A O     1 
ATOM   8130  C  CB    . PHE A  1  1042 ? 57.267  -158.678 143.665 1.00 39.86  ? 1042 PHE A CB    1 
ATOM   8131  C  CG    . PHE A  1  1042 ? 58.397  -158.220 142.785 1.00 37.07  ? 1042 PHE A CG    1 
ATOM   8132  C  CD1   . PHE A  1  1042 ? 59.449  -157.478 143.312 1.00 34.83  ? 1042 PHE A CD1   1 
ATOM   8133  C  CD2   . PHE A  1  1042 ? 58.418  -158.548 141.426 1.00 35.37  ? 1042 PHE A CD2   1 
ATOM   8134  C  CE1   . PHE A  1  1042 ? 60.505  -157.074 142.500 1.00 33.45  ? 1042 PHE A CE1   1 
ATOM   8135  C  CE2   . PHE A  1  1042 ? 59.467  -158.148 140.610 1.00 32.99  ? 1042 PHE A CE2   1 
ATOM   8136  C  CZ    . PHE A  1  1042 ? 60.510  -157.412 141.146 1.00 32.71  ? 1042 PHE A CZ    1 
ATOM   8137  N  N     . ASP A  1  1043 ? 54.874  -158.308 141.894 1.00 43.92  ? 1043 ASP A N     1 
ATOM   8138  C  CA    . ASP A  1  1043 ? 54.240  -158.092 140.595 1.00 45.16  ? 1043 ASP A CA    1 
ATOM   8139  C  C     . ASP A  1  1043 ? 53.290  -156.907 140.629 1.00 45.01  ? 1043 ASP A C     1 
ATOM   8140  O  O     . ASP A  1  1043 ? 53.020  -156.279 139.604 1.00 45.55  ? 1043 ASP A O     1 
ATOM   8141  C  CB    . ASP A  1  1043 ? 53.448  -159.324 140.160 1.00 47.64  ? 1043 ASP A CB    1 
ATOM   8142  C  CG    . ASP A  1  1043 ? 54.314  -160.549 139.982 1.00 49.76  ? 1043 ASP A CG    1 
ATOM   8143  O  OD1   . ASP A  1  1043 ? 55.439  -160.407 139.453 1.00 51.70  ? 1043 ASP A OD1   1 
ATOM   8144  O  OD2   . ASP A  1  1043 ? 53.859  -161.653 140.356 1.00 50.59  ? 1043 ASP A OD2   1 
ATOM   8145  N  N     . TRP A  1  1044 ? 52.770  -156.620 141.815 1.00 44.41  ? 1044 TRP A N     1 
ATOM   8146  C  CA    . TRP A  1  1044 ? 51.834  -155.514 142.014 1.00 43.37  ? 1044 TRP A CA    1 
ATOM   8147  C  C     . TRP A  1  1044 ? 52.582  -154.185 141.963 1.00 41.92  ? 1044 TRP A C     1 
ATOM   8148  O  O     . TRP A  1  1044 ? 52.181  -153.273 141.246 1.00 41.14  ? 1044 TRP A O     1 
ATOM   8149  C  CB    . TRP A  1  1044 ? 51.152  -155.672 143.372 1.00 44.97  ? 1044 TRP A CB    1 
ATOM   8150  C  CG    . TRP A  1  1044 ? 50.003  -154.768 143.598 1.00 44.84  ? 1044 TRP A CG    1 
ATOM   8151  C  CD1   . TRP A  1  1044 ? 48.774  -154.843 143.016 1.00 44.79  ? 1044 TRP A CD1   1 
ATOM   8152  C  CD2   . TRP A  1  1044 ? 49.947  -153.686 144.522 1.00 45.10  ? 1044 TRP A CD2   1 
ATOM   8153  N  NE1   . TRP A  1  1044 ? 47.946  -153.875 143.530 1.00 45.04  ? 1044 TRP A NE1   1 
ATOM   8154  C  CE2   . TRP A  1  1044 ? 48.641  -153.150 144.458 1.00 44.77  ? 1044 TRP A CE2   1 
ATOM   8155  C  CE3   . TRP A  1  1044 ? 50.872  -153.114 145.400 1.00 44.35  ? 1044 TRP A CE3   1 
ATOM   8156  C  CZ2   . TRP A  1  1044 ? 48.235  -152.075 145.241 1.00 45.09  ? 1044 TRP A CZ2   1 
ATOM   8157  C  CZ3   . TRP A  1  1044 ? 50.467  -152.040 146.177 1.00 45.18  ? 1044 TRP A CZ3   1 
ATOM   8158  C  CH2   . TRP A  1  1044 ? 49.160  -151.532 146.094 1.00 45.14  ? 1044 TRP A CH2   1 
ATOM   8159  N  N     . VAL A  1  1045 ? 53.662  -154.093 142.741 1.00 39.94  ? 1045 VAL A N     1 
ATOM   8160  C  CA    . VAL A  1  1045 ? 54.499  -152.904 142.795 1.00 36.94  ? 1045 VAL A CA    1 
ATOM   8161  C  C     . VAL A  1  1045 ? 55.001  -152.608 141.403 1.00 35.92  ? 1045 VAL A C     1 
ATOM   8162  O  O     . VAL A  1  1045 ? 55.108  -151.462 141.002 1.00 35.08  ? 1045 VAL A O     1 
ATOM   8163  C  CB    . VAL A  1  1045 ? 55.701  -153.121 143.697 1.00 35.09  ? 1045 VAL A CB    1 
ATOM   8164  C  CG1   . VAL A  1  1045 ? 56.566  -151.889 143.710 1.00 34.36  ? 1045 VAL A CG1   1 
ATOM   8165  C  CG2   . VAL A  1  1045 ? 55.231  -153.442 145.079 1.00 34.83  ? 1045 VAL A CG2   1 
ATOM   8166  N  N     . LEU A  1  1046 ? 55.320  -153.650 140.661 1.00 35.90  ? 1046 LEU A N     1 
ATOM   8167  C  CA    . LEU A  1  1046 ? 55.787  -153.434 139.314 1.00 37.96  ? 1046 LEU A CA    1 
ATOM   8168  C  C     . LEU A  1  1046 ? 54.662  -152.881 138.446 1.00 39.00  ? 1046 LEU A C     1 
ATOM   8169  O  O     . LEU A  1  1046 ? 54.887  -152.016 137.603 1.00 40.29  ? 1046 LEU A O     1 
ATOM   8170  C  CB    . LEU A  1  1046 ? 56.319  -154.733 138.702 1.00 38.11  ? 1046 LEU A CB    1 
ATOM   8171  C  CG    . LEU A  1  1046 ? 57.665  -155.293 139.164 1.00 38.20  ? 1046 LEU A CG    1 
ATOM   8172  C  CD1   . LEU A  1  1046 ? 58.159  -156.334 138.165 1.00 38.00  ? 1046 LEU A CD1   1 
ATOM   8173  C  CD2   . LEU A  1  1046 ? 58.674  -154.169 139.249 1.00 39.37  ? 1046 LEU A CD2   1 
ATOM   8174  N  N     . SER A  1  1047 ? 53.443  -153.363 138.653 1.00 40.42  ? 1047 SER A N     1 
ATOM   8175  C  CA    . SER A  1  1047 ? 52.322  -152.901 137.834 1.00 41.61  ? 1047 SER A CA    1 
ATOM   8176  C  C     . SER A  1  1047 ? 51.971  -151.428 138.052 1.00 41.28  ? 1047 SER A C     1 
ATOM   8177  O  O     . SER A  1  1047 ? 51.802  -150.672 137.091 1.00 41.41  ? 1047 SER A O     1 
ATOM   8178  C  CB    . SER A  1  1047 ? 51.087  -153.768 138.081 1.00 41.58  ? 1047 SER A CB    1 
ATOM   8179  O  OG    . SER A  1  1047 ? 50.324  -153.865 136.884 1.00 42.54  ? 1047 SER A OG    1 
ATOM   8180  N  N     . ASN A  1  1048 ? 51.858  -151.033 139.316 1.00 41.07  ? 1048 ASN A N     1 
ATOM   8181  C  CA    . ASN A  1  1048 ? 51.542  -149.657 139.672 1.00 40.31  ? 1048 ASN A CA    1 
ATOM   8182  C  C     . ASN A  1  1048 ? 52.665  -148.730 139.231 1.00 38.71  ? 1048 ASN A C     1 
ATOM   8183  O  O     . ASN A  1  1048 ? 52.413  -147.681 138.642 1.00 38.72  ? 1048 ASN A O     1 
ATOM   8184  C  CB    . ASN A  1  1048 ? 51.328  -149.528 141.186 1.00 42.59  ? 1048 ASN A CB    1 
ATOM   8185  C  CG    . ASN A  1  1048 ? 50.096  -150.288 141.681 1.00 45.10  ? 1048 ASN A CG    1 
ATOM   8186  O  OD1   . ASN A  1  1048 ? 49.668  -150.109 142.823 1.00 45.11  ? 1048 ASN A OD1   1 
ATOM   8187  N  ND2   . ASN A  1  1048 ? 49.524  -151.139 140.822 1.00 46.53  ? 1048 ASN A ND2   1 
ATOM   8188  N  N     . ILE A  1  1049 ? 53.905  -149.111 139.527 1.00 36.88  ? 1049 ILE A N     1 
ATOM   8189  C  CA    . ILE A  1  1049 ? 55.037  -148.297 139.126 1.00 34.57  ? 1049 ILE A CA    1 
ATOM   8190  C  C     . ILE A  1  1049 ? 54.893  -148.014 137.651 1.00 34.48  ? 1049 ILE A C     1 
ATOM   8191  O  O     . ILE A  1  1049 ? 55.141  -146.899 137.217 1.00 35.57  ? 1049 ILE A O     1 
ATOM   8192  C  CB    . ILE A  1  1049 ? 56.378  -148.992 139.390 1.00 33.23  ? 1049 ILE A CB    1 
ATOM   8193  C  CG1   . ILE A  1  1049 ? 56.890  -148.600 140.771 1.00 33.36  ? 1049 ILE A CG1   1 
ATOM   8194  C  CG2   . ILE A  1  1049 ? 57.393  -148.576 138.368 1.00 31.96  ? 1049 ILE A CG2   1 
ATOM   8195  C  CD1   . ILE A  1  1049 ? 58.175  -149.284 141.176 1.00 33.67  ? 1049 ILE A CD1   1 
ATOM   8196  N  N     . GLU A  1  1050 ? 54.479  -149.004 136.870 1.00 33.49  ? 1050 GLU A N     1 
ATOM   8197  C  CA    . GLU A  1  1050 ? 54.314  -148.738 135.456 1.00 33.61  ? 1050 GLU A CA    1 
ATOM   8198  C  C     . GLU A  1  1050 ? 53.213  -147.719 135.183 1.00 33.90  ? 1050 GLU A C     1 
ATOM   8199  O  O     . GLU A  1  1050 ? 53.472  -146.690 134.570 1.00 34.95  ? 1050 GLU A O     1 
ATOM   8200  C  CB    . GLU A  1  1050 ? 53.994  -149.986 134.656 1.00 34.36  ? 1050 GLU A CB    1 
ATOM   8201  C  CG    . GLU A  1  1050 ? 53.602  -149.556 133.255 1.00 37.55  ? 1050 GLU A CG    1 
ATOM   8202  C  CD    . GLU A  1  1050 ? 53.573  -150.668 132.252 1.00 40.29  ? 1050 GLU A CD    1 
ATOM   8203  O  OE1   . GLU A  1  1050 ? 54.541  -151.454 132.213 1.00 43.72  ? 1050 GLU A OE1   1 
ATOM   8204  O  OE2   . GLU A  1  1050 ? 52.591  -150.747 131.485 1.00 40.55  ? 1050 GLU A OE2   1 
ATOM   8205  N  N     . ALA A  1  1051 ? 51.983  -148.006 135.609 1.00 33.42  ? 1051 ALA A N     1 
ATOM   8206  C  CA    . ALA A  1  1051 ? 50.861  -147.083 135.388 1.00 31.61  ? 1051 ALA A CA    1 
ATOM   8207  C  C     . ALA A  1  1051 ? 51.167  -145.684 135.905 1.00 30.34  ? 1051 ALA A C     1 
ATOM   8208  O  O     . ALA A  1  1051 ? 51.193  -144.709 135.141 1.00 29.80  ? 1051 ALA A O     1 
ATOM   8209  C  CB    . ALA A  1  1051 ? 49.626  -147.599 136.060 1.00 31.88  ? 1051 ALA A CB    1 
ATOM   8210  N  N     . GLN A  1  1052 ? 51.384  -145.590 137.211 1.00 28.25  ? 1052 GLN A N     1 
ATOM   8211  C  CA    . GLN A  1  1052 ? 51.695  -144.319 137.817 1.00 27.24  ? 1052 GLN A CA    1 
ATOM   8212  C  C     . GLN A  1  1052 ? 52.699  -143.522 136.975 1.00 26.39  ? 1052 GLN A C     1 
ATOM   8213  O  O     . GLN A  1  1052 ? 52.643  -142.293 136.922 1.00 26.55  ? 1052 GLN A O     1 
ATOM   8214  C  CB    . GLN A  1  1052 ? 52.176  -144.548 139.252 1.00 27.82  ? 1052 GLN A CB    1 
ATOM   8215  C  CG    . GLN A  1  1052 ? 51.002  -144.573 140.232 1.00 29.23  ? 1052 GLN A CG    1 
ATOM   8216  C  CD    . GLN A  1  1052 ? 51.381  -144.913 141.667 1.00 31.48  ? 1052 GLN A CD    1 
ATOM   8217  O  OE1   . GLN A  1  1052 ? 52.402  -144.450 142.194 1.00 32.47  ? 1052 GLN A OE1   1 
ATOM   8218  N  NE2   . GLN A  1  1052 ? 50.539  -145.715 142.318 1.00 32.43  ? 1052 GLN A NE2   1 
ATOM   8219  N  N     . PHE A  1  1053 ? 53.603  -144.214 136.296 1.00 25.39  ? 1053 PHE A N     1 
ATOM   8220  C  CA    . PHE A  1  1053 ? 54.574  -143.541 135.435 1.00 24.88  ? 1053 PHE A CA    1 
ATOM   8221  C  C     . PHE A  1  1053 ? 53.821  -142.960 134.230 1.00 25.40  ? 1053 PHE A C     1 
ATOM   8222  O  O     . PHE A  1  1053 ? 53.725  -141.748 134.062 1.00 26.41  ? 1053 PHE A O     1 
ATOM   8223  C  CB    . PHE A  1  1053 ? 55.644  -144.537 134.950 1.00 23.51  ? 1053 PHE A CB    1 
ATOM   8224  C  CG    . PHE A  1  1053 ? 56.655  -143.943 134.014 1.00 21.44  ? 1053 PHE A CG    1 
ATOM   8225  C  CD1   . PHE A  1  1053 ? 57.825  -143.376 134.502 1.00 22.57  ? 1053 PHE A CD1   1 
ATOM   8226  C  CD2   . PHE A  1  1053 ? 56.419  -143.911 132.645 1.00 20.79  ? 1053 PHE A CD2   1 
ATOM   8227  C  CE1   . PHE A  1  1053 ? 58.750  -142.777 133.636 1.00 22.88  ? 1053 PHE A CE1   1 
ATOM   8228  C  CE2   . PHE A  1  1053 ? 57.335  -143.314 131.768 1.00 21.88  ? 1053 PHE A CE2   1 
ATOM   8229  C  CZ    . PHE A  1  1053 ? 58.501  -142.745 132.263 1.00 22.43  ? 1053 PHE A CZ    1 
ATOM   8230  N  N     . LEU A  1  1054 ? 53.280  -143.836 133.398 1.00 25.43  ? 1054 LEU A N     1 
ATOM   8231  C  CA    . LEU A  1  1054 ? 52.552  -143.414 132.217 1.00 25.75  ? 1054 LEU A CA    1 
ATOM   8232  C  C     . LEU A  1  1054 ? 51.601  -142.274 132.494 1.00 27.36  ? 1054 LEU A C     1 
ATOM   8233  O  O     . LEU A  1  1054 ? 51.311  -141.477 131.598 1.00 26.57  ? 1054 LEU A O     1 
ATOM   8234  C  CB    . LEU A  1  1054 ? 51.773  -144.582 131.663 1.00 25.07  ? 1054 LEU A CB    1 
ATOM   8235  C  CG    . LEU A  1  1054 ? 52.682  -145.706 131.217 1.00 22.90  ? 1054 LEU A CG    1 
ATOM   8236  C  CD1   . LEU A  1  1054 ? 52.217  -146.987 131.856 1.00 20.90  ? 1054 LEU A CD1   1 
ATOM   8237  C  CD2   . LEU A  1  1054 ? 52.681  -145.776 129.689 1.00 23.59  ? 1054 LEU A CD2   1 
ATOM   8238  N  N     . ARG A  1  1055 ? 51.104  -142.208 133.728 1.00 29.83  ? 1055 ARG A N     1 
ATOM   8239  C  CA    . ARG A  1  1055 ? 50.181  -141.137 134.129 1.00 32.60  ? 1055 ARG A CA    1 
ATOM   8240  C  C     . ARG A  1  1055 ? 50.898  -139.810 134.374 1.00 31.51  ? 1055 ARG A C     1 
ATOM   8241  O  O     . ARG A  1  1055 ? 50.316  -138.731 134.206 1.00 31.41  ? 1055 ARG A O     1 
ATOM   8242  C  CB    . ARG A  1  1055 ? 49.441  -141.493 135.417 1.00 34.80  ? 1055 ARG A CB    1 
ATOM   8243  C  CG    . ARG A  1  1055 ? 48.587  -142.716 135.345 1.00 40.34  ? 1055 ARG A CG    1 
ATOM   8244  C  CD    . ARG A  1  1055 ? 47.307  -142.510 136.148 1.00 44.62  ? 1055 ARG A CD    1 
ATOM   8245  N  NE    . ARG A  1  1055 ? 46.885  -143.765 136.749 1.00 48.97  ? 1055 ARG A NE    1 
ATOM   8246  C  CZ    . ARG A  1  1055 ? 47.325  -144.193 137.924 1.00 51.71  ? 1055 ARG A CZ    1 
ATOM   8247  N  NH1   . ARG A  1  1055 ? 48.182  -143.442 138.615 1.00 51.91  ? 1055 ARG A NH1   1 
ATOM   8248  N  NH2   . ARG A  1  1055 ? 46.947  -145.384 138.380 1.00 53.32  ? 1055 ARG A NH2   1 
ATOM   8249  N  N     . SER A  1  1056 ? 52.159  -139.906 134.782 1.00 29.89  ? 1056 SER A N     1 
ATOM   8250  C  CA    . SER A  1  1056 ? 52.961  -138.741 135.089 1.00 27.82  ? 1056 SER A CA    1 
ATOM   8251  C  C     . SER A  1  1056 ? 53.524  -138.054 133.858 1.00 26.16  ? 1056 SER A C     1 
ATOM   8252  O  O     . SER A  1  1056 ? 54.118  -136.997 133.963 1.00 26.95  ? 1056 SER A O     1 
ATOM   8253  C  CB    . SER A  1  1056 ? 54.086  -139.134 136.057 1.00 27.48  ? 1056 SER A CB    1 
ATOM   8254  O  OG    . SER A  1  1056 ? 53.566  -139.716 137.255 1.00 25.57  ? 1056 SER A OG    1 
ATOM   8255  N  N     . VAL A  1  1057 ? 53.322  -138.637 132.687 1.00 24.51  ? 1057 VAL A N     1 
ATOM   8256  C  CA    . VAL A  1  1057 ? 53.825  -138.025 131.462 1.00 23.53  ? 1057 VAL A CA    1 
ATOM   8257  C  C     . VAL A  1  1057 ? 52.988  -136.818 131.049 1.00 22.22  ? 1057 VAL A C     1 
ATOM   8258  O  O     . VAL A  1  1057 ? 51.794  -136.782 131.304 1.00 22.88  ? 1057 VAL A O     1 
ATOM   8259  C  CB    . VAL A  1  1057 ? 53.821  -139.033 130.328 1.00 23.93  ? 1057 VAL A CB    1 
ATOM   8260  C  CG1   . VAL A  1  1057 ? 54.335  -138.396 129.048 1.00 24.41  ? 1057 VAL A CG1   1 
ATOM   8261  C  CG2   . VAL A  1  1057 ? 54.666  -140.219 130.722 1.00 24.85  ? 1057 VAL A CG2   1 
ATOM   8262  N  N     . VAL A  1  1058 ? 53.621  -135.843 130.403 1.00 20.63  ? 1058 VAL A N     1 
ATOM   8263  C  CA    . VAL A  1  1058 ? 52.948  -134.621 129.959 1.00 19.11  ? 1058 VAL A CA    1 
ATOM   8264  C  C     . VAL A  1  1058 ? 51.958  -134.825 128.819 1.00 18.68  ? 1058 VAL A C     1 
ATOM   8265  O  O     . VAL A  1  1058 ? 52.228  -135.551 127.854 1.00 18.57  ? 1058 VAL A O     1 
ATOM   8266  C  CB    . VAL A  1  1058 ? 53.970  -133.552 129.528 1.00 18.20  ? 1058 VAL A CB    1 
ATOM   8267  C  CG1   . VAL A  1  1058 ? 53.274  -132.336 128.999 1.00 15.86  ? 1058 VAL A CG1   1 
ATOM   8268  C  CG2   . VAL A  1  1058 ? 54.790  -133.154 130.702 1.00 19.24  ? 1058 VAL A CG2   1 
ATOM   8269  N  N     . HIS A  1  1059 ? 50.815  -134.153 128.934 1.00 16.96  ? 1059 HIS A N     1 
ATOM   8270  C  CA    . HIS A  1  1059 ? 49.762  -134.246 127.934 1.00 15.98  ? 1059 HIS A CA    1 
ATOM   8271  C  C     . HIS A  1  1059 ? 49.914  -133.305 126.749 1.00 14.49  ? 1059 HIS A C     1 
ATOM   8272  O  O     . HIS A  1  1059 ? 49.881  -132.095 126.904 1.00 15.52  ? 1059 HIS A O     1 
ATOM   8273  C  CB    . HIS A  1  1059 ? 48.418  -133.955 128.572 1.00 16.90  ? 1059 HIS A CB    1 
ATOM   8274  C  CG    . HIS A  1  1059 ? 47.960  -135.000 129.534 1.00 19.06  ? 1059 HIS A CG    1 
ATOM   8275  N  ND1   . HIS A  1  1059 ? 46.833  -135.762 129.315 1.00 19.35  ? 1059 HIS A ND1   1 
ATOM   8276  C  CD2   . HIS A  1  1059 ? 48.445  -135.378 130.740 1.00 20.78  ? 1059 HIS A CD2   1 
ATOM   8277  C  CE1   . HIS A  1  1059 ? 46.642  -136.564 130.346 1.00 21.38  ? 1059 HIS A CE1   1 
ATOM   8278  N  NE2   . HIS A  1  1059 ? 47.605  -136.352 131.225 1.00 21.82  ? 1059 HIS A NE2   1 
ATOM   8279  N  N     . PRO A  1  1060 ? 50.080  -133.846 125.546 1.00 12.93  ? 1060 PRO A N     1 
ATOM   8280  C  CA    . PRO A  1  1060 ? 50.211  -132.951 124.409 1.00 11.86  ? 1060 PRO A CA    1 
ATOM   8281  C  C     . PRO A  1  1060 ? 49.005  -132.044 124.374 1.00 12.32  ? 1060 PRO A C     1 
ATOM   8282  O  O     . PRO A  1  1060 ? 47.860  -132.494 124.280 1.00 11.75  ? 1060 PRO A O     1 
ATOM   8283  C  CB    . PRO A  1  1060 ? 50.240  -133.901 123.244 1.00 12.06  ? 1060 PRO A CB    1 
ATOM   8284  C  CG    . PRO A  1  1060 ? 51.013  -135.017 123.788 1.00 14.38  ? 1060 PRO A CG    1 
ATOM   8285  C  CD    . PRO A  1  1060 ? 50.409  -135.220 125.160 1.00 13.34  ? 1060 PRO A CD    1 
ATOM   8286  N  N     . GLY A  1  1061 ? 49.284  -130.755 124.468 1.00 13.62  ? 1061 GLY A N     1 
ATOM   8287  C  CA    . GLY A  1  1061 ? 48.245  -129.745 124.475 1.00 15.64  ? 1061 GLY A CA    1 
ATOM   8288  C  C     . GLY A  1  1061 ? 48.667  -128.696 125.481 1.00 17.23  ? 1061 GLY A C     1 
ATOM   8289  O  O     . GLY A  1  1061 ? 48.599  -127.493 125.205 1.00 16.15  ? 1061 GLY A O     1 
ATOM   8290  N  N     . GLU A  1  1062 ? 49.123  -129.185 126.638 1.00 18.44  ? 1062 GLU A N     1 
ATOM   8291  C  CA    . GLU A  1  1062 ? 49.583  -128.367 127.750 1.00 21.01  ? 1062 GLU A CA    1 
ATOM   8292  C  C     . GLU A  1  1062 ? 50.267  -127.106 127.308 1.00 23.44  ? 1062 GLU A C     1 
ATOM   8293  O  O     . GLU A  1  1062 ? 51.289  -127.160 126.626 1.00 26.37  ? 1062 GLU A O     1 
ATOM   8294  C  CB    . GLU A  1  1062 ? 50.563  -129.137 128.619 1.00 22.31  ? 1062 GLU A CB    1 
ATOM   8295  C  CG    . GLU A  1  1062 ? 49.912  -130.006 129.675 1.00 28.49  ? 1062 GLU A CG    1 
ATOM   8296  C  CD    . GLU A  1  1062 ? 49.589  -129.243 130.944 1.00 30.19  ? 1062 GLU A CD    1 
ATOM   8297  O  OE1   . GLU A  1  1062 ? 50.483  -128.536 131.455 1.00 31.04  ? 1062 GLU A OE1   1 
ATOM   8298  O  OE2   . GLU A  1  1062 ? 48.450  -129.359 131.443 1.00 32.56  ? 1062 GLU A OE2   1 
ATOM   8299  N  N     . MET A  1  1063 ? 49.707  -125.971 127.715 1.00 23.62  ? 1063 MET A N     1 
ATOM   8300  C  CA    . MET A  1  1063 ? 50.265  -124.679 127.387 1.00 23.15  ? 1063 MET A CA    1 
ATOM   8301  C  C     . MET A  1  1063 ? 51.446  -124.367 128.269 1.00 24.17  ? 1063 MET A C     1 
ATOM   8302  O  O     . MET A  1  1063 ? 51.459  -123.399 129.018 1.00 24.45  ? 1063 MET A O     1 
ATOM   8303  C  CB    . MET A  1  1063 ? 49.196  -123.629 127.523 1.00 23.19  ? 1063 MET A CB    1 
ATOM   8304  C  CG    . MET A  1  1063 ? 48.227  -123.732 126.387 1.00 27.95  ? 1063 MET A CG    1 
ATOM   8305  S  SD    . MET A  1  1063 ? 49.154  -123.965 124.860 1.00 29.07  ? 1063 MET A SD    1 
ATOM   8306  C  CE    . MET A  1  1063 ? 50.277  -122.522 125.022 1.00 26.67  ? 1063 MET A CE    1 
ATOM   8307  N  N     . VAL A  1  1064 ? 52.442  -125.229 128.160 1.00 24.54  ? 1064 VAL A N     1 
ATOM   8308  C  CA    . VAL A  1  1064 ? 53.673  -125.144 128.910 1.00 26.65  ? 1064 VAL A CA    1 
ATOM   8309  C  C     . VAL A  1  1064 ? 54.325  -123.754 129.017 1.00 28.07  ? 1064 VAL A C     1 
ATOM   8310  O  O     . VAL A  1  1064 ? 54.900  -123.394 130.057 1.00 28.72  ? 1064 VAL A O     1 
ATOM   8311  C  CB    . VAL A  1  1064 ? 54.670  -126.112 128.303 1.00 26.16  ? 1064 VAL A CB    1 
ATOM   8312  C  CG1   . VAL A  1  1064 ? 56.063  -125.744 128.745 1.00 28.44  ? 1064 VAL A CG1   1 
ATOM   8313  C  CG2   . VAL A  1  1064 ? 54.316  -127.524 128.710 1.00 26.60  ? 1064 VAL A CG2   1 
ATOM   8314  N  N     . GLY A  1  1065 ? 54.249  -122.983 127.935 1.00 28.56  ? 1065 GLY A N     1 
ATOM   8315  C  CA    . GLY A  1  1065 ? 54.847  -121.657 127.920 1.00 26.82  ? 1065 GLY A CA    1 
ATOM   8316  C  C     . GLY A  1  1065 ? 54.277  -120.763 128.998 1.00 24.77  ? 1065 GLY A C     1 
ATOM   8317  O  O     . GLY A  1  1065 ? 54.971  -120.413 129.959 1.00 22.98  ? 1065 GLY A O     1 
ATOM   8318  N  N     . VAL A  1  1066 ? 53.008  -120.396 128.835 1.00 22.60  ? 1066 VAL A N     1 
ATOM   8319  C  CA    . VAL A  1  1066 ? 52.346  -119.541 129.808 1.00 20.85  ? 1066 VAL A CA    1 
ATOM   8320  C  C     . VAL A  1  1066 ? 52.510  -120.089 131.210 1.00 20.86  ? 1066 VAL A C     1 
ATOM   8321  O  O     . VAL A  1  1066 ? 52.756  -119.337 132.143 1.00 20.02  ? 1066 VAL A O     1 
ATOM   8322  C  CB    . VAL A  1  1066 ? 50.859  -119.416 129.530 1.00 19.44  ? 1066 VAL A CB    1 
ATOM   8323  C  CG1   . VAL A  1  1066 ? 50.206  -118.587 130.626 1.00 15.18  ? 1066 VAL A CG1   1 
ATOM   8324  C  CG2   . VAL A  1  1066 ? 50.651  -118.804 128.151 1.00 17.92  ? 1066 VAL A CG2   1 
ATOM   8325  N  N     . LEU A  1  1067 ? 52.357  -121.401 131.358 1.00 20.69  ? 1067 LEU A N     1 
ATOM   8326  C  CA    . LEU A  1  1067 ? 52.509  -122.007 132.665 1.00 21.16  ? 1067 LEU A CA    1 
ATOM   8327  C  C     . LEU A  1  1067 ? 53.866  -121.590 133.185 1.00 21.53  ? 1067 LEU A C     1 
ATOM   8328  O  O     . LEU A  1  1067 ? 53.967  -120.891 134.187 1.00 22.41  ? 1067 LEU A O     1 
ATOM   8329  C  CB    . LEU A  1  1067 ? 52.420  -123.548 132.603 1.00 20.26  ? 1067 LEU A CB    1 
ATOM   8330  C  CG    . LEU A  1  1067 ? 52.706  -124.306 133.925 1.00 19.37  ? 1067 LEU A CG    1 
ATOM   8331  C  CD1   . LEU A  1  1067 ? 51.963  -123.718 135.110 1.00 18.23  ? 1067 LEU A CD1   1 
ATOM   8332  C  CD2   . LEU A  1  1067 ? 52.295  -125.731 133.774 1.00 21.24  ? 1067 LEU A CD2   1 
ATOM   8333  N  N     . ALA A  1  1068 ? 54.910  -122.002 132.485 1.00 22.16  ? 1068 ALA A N     1 
ATOM   8334  C  CA    . ALA A  1  1068 ? 56.255  -121.670 132.903 1.00 23.06  ? 1068 ALA A CA    1 
ATOM   8335  C  C     . ALA A  1  1068 ? 56.391  -120.176 133.271 1.00 23.67  ? 1068 ALA A C     1 
ATOM   8336  O  O     . ALA A  1  1068 ? 56.943  -119.833 134.331 1.00 22.60  ? 1068 ALA A O     1 
ATOM   8337  C  CB    . ALA A  1  1068 ? 57.227  -122.058 131.804 1.00 23.08  ? 1068 ALA A CB    1 
ATOM   8338  N  N     . ALA A  1  1069 ? 55.877  -119.290 132.414 1.00 23.23  ? 1069 ALA A N     1 
ATOM   8339  C  CA    . ALA A  1  1069 ? 55.954  -117.851 132.673 1.00 21.92  ? 1069 ALA A CA    1 
ATOM   8340  C  C     . ALA A  1  1069 ? 55.405  -117.510 134.068 1.00 20.98  ? 1069 ALA A C     1 
ATOM   8341  O  O     . ALA A  1  1069 ? 56.134  -117.024 134.925 1.00 19.41  ? 1069 ALA A O     1 
ATOM   8342  C  CB    . ALA A  1  1069 ? 55.191  -117.092 131.596 1.00 21.06  ? 1069 ALA A CB    1 
ATOM   8343  N  N     . GLN A  1  1070 ? 54.123  -117.788 134.286 1.00 20.66  ? 1070 GLN A N     1 
ATOM   8344  C  CA    . GLN A  1  1070 ? 53.465  -117.532 135.561 1.00 21.08  ? 1070 GLN A CA    1 
ATOM   8345  C  C     . GLN A  1  1070 ? 54.165  -118.203 136.747 1.00 22.99  ? 1070 GLN A C     1 
ATOM   8346  O  O     . GLN A  1  1070 ? 54.210  -117.661 137.851 1.00 23.75  ? 1070 GLN A O     1 
ATOM   8347  C  CB    . GLN A  1  1070 ? 52.038  -118.045 135.524 1.00 19.91  ? 1070 GLN A CB    1 
ATOM   8348  C  CG    . GLN A  1  1070 ? 51.260  -117.691 134.303 1.00 19.27  ? 1070 GLN A CG    1 
ATOM   8349  C  CD    . GLN A  1  1070 ? 49.870  -118.265 134.384 1.00 21.93  ? 1070 GLN A CD    1 
ATOM   8350  O  OE1   . GLN A  1  1070 ? 49.687  -119.426 134.802 1.00 23.47  ? 1070 GLN A OE1   1 
ATOM   8351  N  NE2   . GLN A  1  1070 ? 48.872  -117.469 133.994 1.00 20.50  ? 1070 GLN A NE2   1 
ATOM   8352  N  N     . SER A  1  1071 ? 54.693  -119.398 136.536 1.00 24.02  ? 1071 SER A N     1 
ATOM   8353  C  CA    . SER A  1  1071 ? 55.369  -120.098 137.612 1.00 24.61  ? 1071 SER A CA    1 
ATOM   8354  C  C     . SER A  1  1071 ? 56.587  -119.337 138.130 1.00 25.78  ? 1071 SER A C     1 
ATOM   8355  O  O     . SER A  1  1071 ? 57.016  -119.540 139.263 1.00 26.02  ? 1071 SER A O     1 
ATOM   8356  C  CB    . SER A  1  1071 ? 55.770  -121.479 137.135 1.00 23.31  ? 1071 SER A CB    1 
ATOM   8357  O  OG    . SER A  1  1071 ? 54.610  -122.174 136.743 1.00 24.54  ? 1071 SER A OG    1 
ATOM   8358  N  N     . ILE A  1  1072 ? 57.145  -118.462 137.299 1.00 26.75  ? 1072 ILE A N     1 
ATOM   8359  C  CA    . ILE A  1  1072 ? 58.297  -117.672 137.707 1.00 27.54  ? 1072 ILE A CA    1 
ATOM   8360  C  C     . ILE A  1  1072 ? 57.804  -116.337 138.212 1.00 29.38  ? 1072 ILE A C     1 
ATOM   8361  O  O     . ILE A  1  1072 ? 58.179  -115.891 139.283 1.00 29.33  ? 1072 ILE A O     1 
ATOM   8362  C  CB    . ILE A  1  1072 ? 59.243  -117.388 136.543 1.00 27.00  ? 1072 ILE A CB    1 
ATOM   8363  C  CG1   . ILE A  1  1072 ? 59.756  -118.707 135.958 1.00 27.60  ? 1072 ILE A CG1   1 
ATOM   8364  C  CG2   . ILE A  1  1072 ? 60.371  -116.501 137.030 1.00 23.48  ? 1072 ILE A CG2   1 
ATOM   8365  C  CD1   . ILE A  1  1072 ? 60.663  -118.552 134.760 1.00 27.30  ? 1072 ILE A CD1   1 
ATOM   8366  N  N     . GLY A  1  1073 ? 56.950  -115.705 137.416 1.00 31.49  ? 1073 GLY A N     1 
ATOM   8367  C  CA    . GLY A  1  1073 ? 56.413  -114.406 137.767 1.00 33.59  ? 1073 GLY A CA    1 
ATOM   8368  C  C     . GLY A  1  1073 ? 55.698  -114.362 139.098 1.00 35.06  ? 1073 GLY A C     1 
ATOM   8369  O  O     . GLY A  1  1073 ? 55.997  -113.537 139.947 1.00 34.49  ? 1073 GLY A O     1 
ATOM   8370  N  N     . GLU A  1  1074 ? 54.746  -115.257 139.281 1.00 37.63  ? 1074 GLU A N     1 
ATOM   8371  C  CA    . GLU A  1  1074 ? 53.973  -115.305 140.509 1.00 41.41  ? 1074 GLU A CA    1 
ATOM   8372  C  C     . GLU A  1  1074 ? 54.859  -115.188 141.764 1.00 41.97  ? 1074 GLU A C     1 
ATOM   8373  O  O     . GLU A  1  1074 ? 54.641  -114.315 142.607 1.00 41.54  ? 1074 GLU A O     1 
ATOM   8374  C  CB    . GLU A  1  1074 ? 53.138  -116.593 140.516 1.00 44.48  ? 1074 GLU A CB    1 
ATOM   8375  C  CG    . GLU A  1  1074 ? 52.025  -116.653 141.546 1.00 47.00  ? 1074 GLU A CG    1 
ATOM   8376  C  CD    . GLU A  1  1074 ? 52.541  -116.907 142.935 1.00 48.80  ? 1074 GLU A CD    1 
ATOM   8377  O  OE1   . GLU A  1  1074 ? 53.374  -117.823 143.107 1.00 49.84  ? 1074 GLU A OE1   1 
ATOM   8378  O  OE2   . GLU A  1  1074 ? 52.105  -116.195 143.858 1.00 51.01  ? 1074 GLU A OE2   1 
ATOM   8379  N  N     . PRO A  1  1075 ? 55.865  -116.064 141.913 1.00 43.00  ? 1075 PRO A N     1 
ATOM   8380  C  CA    . PRO A  1  1075 ? 56.698  -115.925 143.112 1.00 43.15  ? 1075 PRO A CA    1 
ATOM   8381  C  C     . PRO A  1  1075 ? 57.517  -114.617 143.171 1.00 44.17  ? 1075 PRO A C     1 
ATOM   8382  O  O     . PRO A  1  1075 ? 57.862  -114.144 144.247 1.00 43.56  ? 1075 PRO A O     1 
ATOM   8383  C  CB    . PRO A  1  1075 ? 57.575  -117.184 143.073 1.00 42.48  ? 1075 PRO A CB    1 
ATOM   8384  C  CG    . PRO A  1  1075 ? 57.576  -117.592 141.643 1.00 42.24  ? 1075 PRO A CG    1 
ATOM   8385  C  CD    . PRO A  1  1075 ? 56.162  -117.328 141.216 1.00 42.86  ? 1075 PRO A CD    1 
ATOM   8386  N  N     . ALA A  1  1076 ? 57.828  -114.029 142.023 1.00 45.38  ? 1076 ALA A N     1 
ATOM   8387  C  CA    . ALA A  1  1076 ? 58.593  -112.793 142.020 1.00 46.97  ? 1076 ALA A CA    1 
ATOM   8388  C  C     . ALA A  1  1076 ? 57.733  -111.684 142.591 1.00 49.61  ? 1076 ALA A C     1 
ATOM   8389  O  O     . ALA A  1  1076 ? 58.238  -110.712 143.136 1.00 50.02  ? 1076 ALA A O     1 
ATOM   8390  C  CB    . ALA A  1  1076 ? 59.019  -112.448 140.616 1.00 45.48  ? 1076 ALA A CB    1 
ATOM   8391  N  N     . THR A  1  1077 ? 56.422  -111.835 142.456 1.00 53.23  ? 1077 THR A N     1 
ATOM   8392  C  CA    . THR A  1  1077 ? 55.473  -110.853 142.957 1.00 56.77  ? 1077 THR A CA    1 
ATOM   8393  C  C     . THR A  1  1077 ? 55.545  -110.788 144.474 1.00 60.74  ? 1077 THR A C     1 
ATOM   8394  O  O     . THR A  1  1077 ? 55.504  -109.715 145.062 1.00 61.56  ? 1077 THR A O     1 
ATOM   8395  C  CB    . THR A  1  1077 ? 54.057  -111.227 142.525 1.00 55.66  ? 1077 THR A CB    1 
ATOM   8396  O  OG1   . THR A  1  1077 ? 53.906  -110.951 141.129 1.00 56.32  ? 1077 THR A OG1   1 
ATOM   8397  C  CG2   . THR A  1  1077 ? 53.034  -110.457 143.305 1.00 56.30  ? 1077 THR A CG2   1 
ATOM   8398  N  N     . GLN A  1  1078 ? 55.671  -111.949 145.103 1.00 65.63  ? 1078 GLN A N     1 
ATOM   8399  C  CA    . GLN A  1  1078 ? 55.750  -112.037 146.558 1.00 70.06  ? 1078 GLN A CA    1 
ATOM   8400  C  C     . GLN A  1  1078 ? 57.156  -111.734 147.089 1.00 73.18  ? 1078 GLN A C     1 
ATOM   8401  O  O     . GLN A  1  1078 ? 57.433  -112.011 148.253 1.00 74.41  ? 1078 GLN A O     1 
ATOM   8402  C  CB    . GLN A  1  1078 ? 55.365  -113.449 147.015 1.00 70.21  ? 1078 GLN A CB    1 
ATOM   8403  C  CG    . GLN A  1  1078 ? 54.220  -114.081 146.241 1.00 71.24  ? 1078 GLN A CG    1 
ATOM   8404  C  CD    . GLN A  1  1078 ? 52.852  -113.600 146.689 1.00 71.83  ? 1078 GLN A CD    1 
ATOM   8405  O  OE1   . GLN A  1  1078 ? 52.313  -114.075 147.691 1.00 71.92  ? 1078 GLN A OE1   1 
ATOM   8406  N  NE2   . GLN A  1  1078 ? 52.284  -112.649 145.949 1.00 71.26  ? 1078 GLN A NE2   1 
ATOM   8407  N  N     . MET A  1  1079 ? 58.041  -111.181 146.257 1.00 76.75  ? 1079 MET A N     1 
ATOM   8408  C  CA    . MET A  1  1079 ? 59.414  -110.901 146.694 1.00 80.13  ? 1079 MET A CA    1 
ATOM   8409  C  C     . MET A  1  1079 ? 59.628  -109.611 147.469 1.00 83.63  ? 1079 MET A C     1 
ATOM   8410  O  O     . MET A  1  1079 ? 60.064  -108.595 146.905 1.00 83.95  ? 1079 MET A O     1 
ATOM   8411  C  CB    . MET A  1  1079 ? 60.385  -110.926 145.512 1.00 79.26  ? 1079 MET A CB    1 
ATOM   8412  C  CG    . MET A  1  1079 ? 60.549  -112.291 144.884 1.00 78.27  ? 1079 MET A CG    1 
ATOM   8413  S  SD    . MET A  1  1079 ? 62.193  -112.497 144.201 1.00 78.42  ? 1079 MET A SD    1 
ATOM   8414  C  CE    . MET A  1  1079 ? 62.045  -111.634 142.622 1.00 78.55  ? 1079 MET A CE    1 
ATOM   8415  N  N     . THR A  1  1080 ? 59.332  -109.684 148.772 1.00 87.97  ? 1080 THR A N     1 
ATOM   8416  C  CA    . THR A  1  1080 ? 59.482  -108.575 149.731 1.00 91.35  ? 1080 THR A CA    1 
ATOM   8417  C  C     . THR A  1  1080 ? 60.956  -108.487 150.167 1.00 92.51  ? 1080 THR A C     1 
ATOM   8418  O  O     . THR A  1  1080 ? 61.338  -108.942 151.258 1.00 92.11  ? 1080 THR A O     1 
ATOM   8419  C  CB    . THR A  1  1080 ? 58.581  -108.785 151.011 1.00 92.27  ? 1080 THR A CB    1 
ATOM   8420  O  OG1   . THR A  1  1080 ? 57.191  -108.747 150.646 1.00 92.84  ? 1080 THR A OG1   1 
ATOM   8421  C  CG2   . THR A  1  1080 ? 58.859  -107.697 152.069 1.00 92.64  ? 1080 THR A CG2   1 
ATOM   8422  N  N     . LEU A  1  1081 ? 61.772  -107.901 149.295 1.00 93.95  ? 1081 LEU A N     1 
ATOM   8423  C  CA    . LEU A  1  1081 ? 63.201  -107.742 149.540 1.00 94.70  ? 1081 LEU A CA    1 
ATOM   8424  C  C     . LEU A  1  1081 ? 63.450  -106.568 150.496 1.00 94.46  ? 1081 LEU A C     1 
ATOM   8425  O  O     . LEU A  1  1081 ? 62.840  -106.479 151.569 1.00 93.76  ? 1081 LEU A O     1 
ATOM   8426  C  CB    . LEU A  1  1081 ? 63.929  -107.522 148.195 1.00 95.34  ? 1081 LEU A CB    1 
ATOM   8427  C  CG    . LEU A  1  1081 ? 63.728  -108.579 147.087 1.00 94.90  ? 1081 LEU A CG    1 
ATOM   8428  C  CD1   . LEU A  1  1081 ? 64.059  -107.979 145.729 1.00 94.37  ? 1081 LEU A CD1   1 
ATOM   8429  C  CD2   . LEU A  1  1081 ? 64.585  -109.811 147.369 1.00 94.38  ? 1081 LEU A CD2   1 
ATOM   8430  N  N     . LYS A  1  1092 ? 77.179  -111.525 151.116 1.00 92.36  ? 1092 LYS A N     1 
ATOM   8431  C  CA    . LYS A  1  1092 ? 76.036  -111.693 150.216 1.00 92.24  ? 1092 LYS A CA    1 
ATOM   8432  C  C     . LYS A  1  1092 ? 75.486  -110.359 149.693 1.00 91.72  ? 1092 LYS A C     1 
ATOM   8433  O  O     . LYS A  1  1092 ? 74.270  -110.220 149.487 1.00 92.90  ? 1092 LYS A O     1 
ATOM   8434  C  CB    . LYS A  1  1092 ? 74.904  -112.475 150.912 1.00 91.37  ? 1092 LYS A CB    1 
ATOM   8435  C  CG    . LYS A  1  1092 ? 75.275  -113.902 151.283 1.00 90.96  ? 1092 LYS A CG    1 
ATOM   8436  C  CD    . LYS A  1  1092 ? 74.059  -114.746 151.625 1.00 90.42  ? 1092 LYS A CD    1 
ATOM   8437  C  CE    . LYS A  1  1092 ? 74.490  -116.128 152.096 1.00 90.11  ? 1092 LYS A CE    1 
ATOM   8438  N  NZ    . LYS A  1  1092 ? 75.480  -116.737 151.159 1.00 89.49  ? 1092 LYS A NZ    1 
ATOM   8439  N  N     . LYS A  1  1093 ? 76.375  -109.390 149.468 1.00 89.70  ? 1093 LYS A N     1 
ATOM   8440  C  CA    . LYS A  1  1093 ? 75.960  -108.081 148.974 1.00 86.58  ? 1093 LYS A CA    1 
ATOM   8441  C  C     . LYS A  1  1093 ? 76.188  -107.944 147.467 1.00 84.23  ? 1093 LYS A C     1 
ATOM   8442  O  O     . LYS A  1  1093 ? 77.124  -107.284 146.999 1.00 83.18  ? 1093 LYS A O     1 
ATOM   8443  C  CB    . LYS A  1  1093 ? 76.662  -106.985 149.783 1.00 86.45  ? 1093 LYS A CB    1 
ATOM   8444  C  CG    . LYS A  1  1093 ? 76.245  -107.053 151.260 1.00 85.80  ? 1093 LYS A CG    1 
ATOM   8445  C  CD    . LYS A  1  1093 ? 77.006  -106.095 152.165 1.00 85.68  ? 1093 LYS A CD    1 
ATOM   8446  C  CE    . LYS A  1  1093 ? 76.589  -106.283 153.628 1.00 84.31  ? 1093 LYS A CE    1 
ATOM   8447  N  NZ    . LYS A  1  1093 ? 77.277  -105.324 154.534 1.00 82.48  ? 1093 LYS A NZ    1 
ATOM   8448  N  N     . VAL A  1  1094 ? 75.296  -108.610 146.733 1.00 81.60  ? 1094 VAL A N     1 
ATOM   8449  C  CA    . VAL A  1  1094 ? 75.270  -108.644 145.276 1.00 79.09  ? 1094 VAL A CA    1 
ATOM   8450  C  C     . VAL A  1  1094 ? 73.817  -108.408 144.875 1.00 77.56  ? 1094 VAL A C     1 
ATOM   8451  O  O     . VAL A  1  1094 ? 72.904  -108.919 145.528 1.00 76.31  ? 1094 VAL A O     1 
ATOM   8452  C  CB    . VAL A  1  1094 ? 75.695  -110.026 144.748 1.00 79.41  ? 1094 VAL A CB    1 
ATOM   8453  C  CG1   . VAL A  1  1094 ? 75.894  -109.979 143.233 1.00 78.28  ? 1094 VAL A CG1   1 
ATOM   8454  C  CG2   . VAL A  1  1094 ? 76.957  -110.483 145.459 1.00 80.31  ? 1094 VAL A CG2   1 
ATOM   8455  N  N     . THR A  1  1095 ? 73.603  -107.629 143.817 1.00 76.12  ? 1095 THR A N     1 
ATOM   8456  C  CA    . THR A  1  1095 ? 72.250  -107.344 143.347 1.00 74.56  ? 1095 THR A CA    1 
ATOM   8457  C  C     . THR A  1  1095 ? 71.406  -108.623 143.319 1.00 74.62  ? 1095 THR A C     1 
ATOM   8458  O  O     . THR A  1  1095 ? 71.631  -109.501 142.483 1.00 75.33  ? 1095 THR A O     1 
ATOM   8459  C  CB    . THR A  1  1095 ? 72.270  -106.705 141.927 1.00 73.70  ? 1095 THR A CB    1 
ATOM   8460  O  OG1   . THR A  1  1095 ? 73.373  -107.221 141.164 1.00 72.99  ? 1095 THR A OG1   1 
ATOM   8461  C  CG2   . THR A  1  1095 ? 72.390  -105.210 142.033 1.00 72.98  ? 1095 THR A CG2   1 
ATOM   8462  N  N     . SER A  1  1096 ? 70.446  -108.735 144.238 1.00 73.77  ? 1096 SER A N     1 
ATOM   8463  C  CA    . SER A  1  1096 ? 69.581  -109.922 144.301 1.00 72.22  ? 1096 SER A CA    1 
ATOM   8464  C  C     . SER A  1  1096 ? 68.090  -109.602 144.459 1.00 70.70  ? 1096 SER A C     1 
ATOM   8465  O  O     . SER A  1  1096 ? 67.706  -108.708 145.220 1.00 71.81  ? 1096 SER A O     1 
ATOM   8466  C  CB    . SER A  1  1096 ? 70.012  -110.836 145.455 1.00 72.94  ? 1096 SER A CB    1 
ATOM   8467  O  OG    . SER A  1  1096 ? 69.723  -110.259 146.723 1.00 73.80  ? 1096 SER A OG    1 
ATOM   8468  N  N     . GLY A  1  1097 ? 67.254  -110.345 143.743 1.00 67.45  ? 1097 GLY A N     1 
ATOM   8469  C  CA    . GLY A  1  1097 ? 65.825  -110.127 143.834 1.00 62.77  ? 1097 GLY A CA    1 
ATOM   8470  C  C     . GLY A  1  1097 ? 65.280  -109.439 142.609 1.00 59.23  ? 1097 GLY A C     1 
ATOM   8471  O  O     . GLY A  1  1097 ? 65.928  -109.418 141.565 1.00 58.73  ? 1097 GLY A O     1 
ATOM   8472  N  N     . VAL A  1  1098 ? 64.084  -108.878 142.748 1.00 56.30  ? 1098 VAL A N     1 
ATOM   8473  C  CA    . VAL A  1  1098 ? 63.407  -108.173 141.666 1.00 53.91  ? 1098 VAL A CA    1 
ATOM   8474  C  C     . VAL A  1  1098 ? 64.351  -107.317 140.812 1.00 53.01  ? 1098 VAL A C     1 
ATOM   8475  O  O     . VAL A  1  1098 ? 64.341  -107.407 139.584 1.00 52.96  ? 1098 VAL A O     1 
ATOM   8476  C  CB    . VAL A  1  1098 ? 62.296  -107.272 142.220 1.00 52.61  ? 1098 VAL A CB    1 
ATOM   8477  C  CG1   . VAL A  1  1098 ? 61.450  -106.744 141.090 1.00 50.69  ? 1098 VAL A CG1   1 
ATOM   8478  C  CG2   . VAL A  1  1098 ? 61.461  -108.041 143.224 1.00 51.91  ? 1098 VAL A CG2   1 
ATOM   8479  N  N     . PRO A  1  1099 ? 65.172  -106.462 141.446 1.00 51.55  ? 1099 PRO A N     1 
ATOM   8480  C  CA    . PRO A  1  1099 ? 66.081  -105.647 140.631 1.00 49.72  ? 1099 PRO A CA    1 
ATOM   8481  C  C     . PRO A  1  1099 ? 67.026  -106.526 139.803 1.00 48.42  ? 1099 PRO A C     1 
ATOM   8482  O  O     . PRO A  1  1099 ? 67.318  -106.224 138.646 1.00 47.59  ? 1099 PRO A O     1 
ATOM   8483  C  CB    . PRO A  1  1099 ? 66.816  -104.811 141.673 1.00 49.67  ? 1099 PRO A CB    1 
ATOM   8484  C  CG    . PRO A  1  1099 ? 66.821  -105.718 142.870 1.00 50.28  ? 1099 PRO A CG    1 
ATOM   8485  C  CD    . PRO A  1  1099 ? 65.411  -106.234 142.880 1.00 50.66  ? 1099 PRO A CD    1 
ATOM   8486  N  N     . ARG A  1  1100 ? 67.493  -107.616 140.405 1.00 46.85  ? 1100 ARG A N     1 
ATOM   8487  C  CA    . ARG A  1  1100 ? 68.392  -108.549 139.729 1.00 44.82  ? 1100 ARG A CA    1 
ATOM   8488  C  C     . ARG A  1  1100 ? 67.671  -109.276 138.598 1.00 43.59  ? 1100 ARG A C     1 
ATOM   8489  O  O     . ARG A  1  1100 ? 68.183  -109.3