data_3HRO
# 
_entry.id   3HRO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HRO         
RCSB  RCSB053500   
WWPDB D_1000053500 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3HRN 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3HRO 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-09 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yu, Y.'        1 
'Ulbrich, M.H.' 2 
'Li, M.-H.'     3 
'Buraei, Z.'    4 
'Chen, X.-Z.'   5 
'Ong, A.C.M.'   6 
'Tong, L.'      7 
'Isacoff, E.Y.' 8 
'Yang, J.'      9 
# 
_citation.id                        primary 
_citation.title                     'Structural and molecular basis of the assembly of the TRPP2/PKD1 complex.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            106 
_citation.page_first                11558 
_citation.page_last                 11563 
_citation.year                      2009 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19556541 
_citation.pdbx_database_id_DOI      10.1073/pnas.0903684106 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yu, Y.'        1 
primary 'Ulbrich, M.H.' 2 
primary 'Li, M.H.'      3 
primary 'Buraei, Z.'    4 
primary 'Chen, X.Z.'    5 
primary 'Ong, A.C.'     6 
primary 'Tong, L.'      7 
primary 'Isacoff, E.Y.' 8 
primary 'Yang, J.'      9 
# 
_cell.length_a           32.388 
_cell.length_b           32.388 
_cell.length_c           70.300 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3HRO 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.entry_id                         3HRO 
_symmetry.Int_Tables_number                173 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 
;Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2), also called Polycystin-2 or polycystic kidney disease 2(PKD2)
;
5052.893 1  ? ? 'C-terminal of Coiled Coil Domain, UNP residues 833-872' ? 
2 water   nat water 18.015   32 ? ? ?                                                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Polycystin-2, Polycystic kidney disease 2 protein, Autosomal dominant polycystic kidney disease type II protein, Polycystwin, R48321
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSHMGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMER 
_entity_poly.pdbx_seq_one_letter_code_can   GSHMGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMER 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  HIS n 
1 4  MET n 
1 5  GLY n 
1 6  VAL n 
1 7  SER n 
1 8  TYR n 
1 9  GLU n 
1 10 GLU n 
1 11 PHE n 
1 12 GLN n 
1 13 VAL n 
1 14 LEU n 
1 15 VAL n 
1 16 ARG n 
1 17 ARG n 
1 18 VAL n 
1 19 ASP n 
1 20 ARG n 
1 21 MET n 
1 22 GLU n 
1 23 HIS n 
1 24 SER n 
1 25 ILE n 
1 26 GLY n 
1 27 SER n 
1 28 ILE n 
1 29 VAL n 
1 30 SER n 
1 31 LYS n 
1 32 ILE n 
1 33 ASP n 
1 34 ALA n 
1 35 VAL n 
1 36 ILE n 
1 37 VAL n 
1 38 LYS n 
1 39 LEU n 
1 40 GLU n 
1 41 ILE n 
1 42 MET n 
1 43 GLU n 
1 44 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PKD2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta 2(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET-28a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PKD2_HUMAN 
_struct_ref.pdbx_db_accession          Q13563 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   GVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMER 
_struct_ref.pdbx_align_begin           833 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3HRO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 44 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q13563 
_struct_ref_seq.db_align_beg                  833 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  872 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       833 
_struct_ref_seq.pdbx_auth_seq_align_end       872 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3HRO GLY A 1 ? UNP Q13563 ? ? 'EXPRESSION TAG' -3 1 
1 3HRO SER A 2 ? UNP Q13563 ? ? 'EXPRESSION TAG' -2 2 
1 3HRO HIS A 3 ? UNP Q13563 ? ? 'EXPRESSION TAG' -1 3 
1 3HRO MET A 4 ? UNP Q13563 ? ? 'EXPRESSION TAG' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3HRO 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.61 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    'PEG 6000, LiCl, Citric Acid, pH 4.0, vapor diffusion, hanging drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2006-03-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97927 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4C' 
_diffrn_source.pdbx_wavelength_list        0.97927 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4C 
# 
_reflns.entry_id                     3HRO 
_reflns.d_resolution_high            1.900 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   3273 
_reflns.pdbx_Rmerge_I_obs            0.052 
_reflns.pdbx_netI_over_sigmaI        32.805 
_reflns.pdbx_chi_squared             1.124 
_reflns.pdbx_redundancy              5.700 
_reflns.percent_possible_obs         98.700 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.228 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.226 
_reflns_shell.pdbx_redundancy        3.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      290 
_reflns_shell.percent_possible_all   92.90 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3HRO 
_refine.ls_d_res_high                            1.900 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    90.000 
_refine.ls_number_reflns_obs                     2991 
_refine.ls_number_reflns_all                     3190 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          0.217 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_R_work                       0.194 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 8.500 
_refine.ls_number_reflns_R_free                  281 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               26.404 
_refine.solvent_model_param_bsol                 56.794 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            5.439 
_refine.aniso_B[2][2]                            5.439 
_refine.aniso_B[3][3]                            -10.877 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1ZIJ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.872 
_refine.B_iso_max                                52.47 
_refine.B_iso_min                                14.36 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        299 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               331 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.012 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_d    ? 1.227 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.486 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 3.079 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.131 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 4.331 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water_rep.param   CNS_TOPPAR:water.top   'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param         CNS_TOPPAR:ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HRO 
_struct.title                     
;Crystal structure of a C-terminal coiled coil domain of Transient receptor potential (TRP) channel subfamily P member 2 (TRPP2, polycystic kidney disease 2)
;
_struct.pdbx_descriptor           Polycystin-2 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HRO 
_struct_keywords.text            
;coiled coil, helix bundle, trimer, Calcium, Disease mutation, Glycoprotein, Ion transport, Ionic channel, Membrane, Phosphoprotein, Polymorphism, Transmembrane, Transport, TRANSPORT PROTEIN
;
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        7 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ILE 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        41 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         835 
_struct_conf.end_auth_comp_id        ILE 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         869 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   35 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    3HRO 
_atom_sites.fract_transf_matrix[1][1]   0.030876 
_atom_sites.fract_transf_matrix[1][2]   0.017826 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.035652 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014225 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . VAL A 1 6  ? 1.541   21.665 72.255 1.00 30.36 ? 834 VAL A N   1 
ATOM   2   C CA  . VAL A 1 6  ? 0.783   22.107 71.037 1.00 29.54 ? 834 VAL A CA  1 
ATOM   3   C C   . VAL A 1 6  ? -0.715  22.193 71.294 1.00 29.90 ? 834 VAL A C   1 
ATOM   4   O O   . VAL A 1 6  ? -1.373  21.190 71.587 1.00 30.54 ? 834 VAL A O   1 
ATOM   5   C CB  . VAL A 1 6  ? 1.023   21.159 69.846 1.00 30.04 ? 834 VAL A CB  1 
ATOM   6   C CG1 . VAL A 1 6  ? 0.082   21.516 68.684 1.00 28.67 ? 834 VAL A CG1 1 
ATOM   7   C CG2 . VAL A 1 6  ? 2.479   21.267 69.396 1.00 31.39 ? 834 VAL A CG2 1 
ATOM   8   N N   . SER A 1 7  ? -1.262  23.393 71.143 1.00 28.67 ? 835 SER A N   1 
ATOM   9   C CA  . SER A 1 7  ? -2.675  23.623 71.393 1.00 27.60 ? 835 SER A CA  1 
ATOM   10  C C   . SER A 1 7  ? -3.567  23.254 70.220 1.00 26.38 ? 835 SER A C   1 
ATOM   11  O O   . SER A 1 7  ? -3.109  23.138 69.081 1.00 24.06 ? 835 SER A O   1 
ATOM   12  C CB  . SER A 1 7  ? -2.900  25.095 71.739 1.00 28.68 ? 835 SER A CB  1 
ATOM   13  O OG  . SER A 1 7  ? -2.611  25.890 70.609 1.00 31.63 ? 835 SER A OG  1 
ATOM   14  N N   . TYR A 1 8  ? -4.847  23.067 70.531 1.00 25.60 ? 836 TYR A N   1 
ATOM   15  C CA  . TYR A 1 8  ? -5.858  22.725 69.544 1.00 27.45 ? 836 TYR A CA  1 
ATOM   16  C C   . TYR A 1 8  ? -5.950  23.757 68.429 1.00 26.08 ? 836 TYR A C   1 
ATOM   17  O O   . TYR A 1 8  ? -6.010  23.394 67.260 1.00 25.68 ? 836 TYR A O   1 
ATOM   18  C CB  . TYR A 1 8  ? -7.218  22.599 70.229 1.00 31.48 ? 836 TYR A CB  1 
ATOM   19  C CG  . TYR A 1 8  ? -8.406  22.611 69.290 1.00 35.96 ? 836 TYR A CG  1 
ATOM   20  C CD1 . TYR A 1 8  ? -9.003  23.815 68.893 1.00 36.34 ? 836 TYR A CD1 1 
ATOM   21  C CD2 . TYR A 1 8  ? -8.934  21.415 68.799 1.00 36.85 ? 836 TYR A CD2 1 
ATOM   22  C CE1 . TYR A 1 8  ? -10.104 23.818 68.023 1.00 40.57 ? 836 TYR A CE1 1 
ATOM   23  C CE2 . TYR A 1 8  ? -10.023 21.406 67.937 1.00 39.10 ? 836 TYR A CE2 1 
ATOM   24  C CZ  . TYR A 1 8  ? -10.604 22.606 67.550 1.00 39.41 ? 836 TYR A CZ  1 
ATOM   25  O OH  . TYR A 1 8  ? -11.666 22.583 66.670 1.00 43.08 ? 836 TYR A OH  1 
ATOM   26  N N   . GLU A 1 9  ? -5.966  25.037 68.790 1.00 24.15 ? 837 GLU A N   1 
ATOM   27  C CA  . GLU A 1 9  ? -6.084  26.100 67.794 1.00 25.94 ? 837 GLU A CA  1 
ATOM   28  C C   . GLU A 1 9  ? -5.018  26.043 66.723 1.00 22.83 ? 837 GLU A C   1 
ATOM   29  O O   . GLU A 1 9  ? -5.333  26.087 65.543 1.00 22.26 ? 837 GLU A O   1 
ATOM   30  C CB  . GLU A 1 9  ? -6.033  27.483 68.454 1.00 30.03 ? 837 GLU A CB  1 
ATOM   31  C CG  . GLU A 1 9  ? -7.296  27.886 69.165 1.00 37.93 ? 837 GLU A CG  1 
ATOM   32  C CD  . GLU A 1 9  ? -7.091  29.130 70.022 1.00 41.84 ? 837 GLU A CD  1 
ATOM   33  O OE1 . GLU A 1 9  ? -6.177  29.116 70.875 1.00 44.69 ? 837 GLU A OE1 1 
ATOM   34  O OE2 . GLU A 1 9  ? -7.841  30.114 69.840 1.00 45.33 ? 837 GLU A OE2 1 
ATOM   35  N N   . GLU A 1 10 ? -3.759  25.941 67.126 1.00 21.41 ? 838 GLU A N   1 
ATOM   36  C CA  . GLU A 1 10 ? -2.693  25.896 66.136 1.00 21.96 ? 838 GLU A CA  1 
ATOM   37  C C   . GLU A 1 10 ? -2.752  24.615 65.316 1.00 18.61 ? 838 GLU A C   1 
ATOM   38  O O   . GLU A 1 10 ? -2.500  24.642 64.123 1.00 16.86 ? 838 GLU A O   1 
ATOM   39  C CB  . GLU A 1 10 ? -1.321  26.033 66.805 1.00 22.91 ? 838 GLU A CB  1 
ATOM   40  C CG  . GLU A 1 10 ? -0.885  24.890 67.662 1.00 27.21 ? 838 GLU A CG  1 
ATOM   41  C CD  . GLU A 1 10 ? 0.404   25.208 68.397 1.00 27.79 ? 838 GLU A CD  1 
ATOM   42  O OE1 . GLU A 1 10 ? 1.368   25.670 67.754 1.00 28.56 ? 838 GLU A OE1 1 
ATOM   43  O OE2 . GLU A 1 10 ? 0.444   25.000 69.625 1.00 34.30 ? 838 GLU A OE2 1 
ATOM   44  N N   . PHE A 1 11 ? -3.102  23.502 65.956 1.00 18.51 ? 839 PHE A N   1 
ATOM   45  C CA  . PHE A 1 11 ? -3.193  22.228 65.238 1.00 19.53 ? 839 PHE A CA  1 
ATOM   46  C C   . PHE A 1 11 ? -4.298  22.322 64.181 1.00 20.03 ? 839 PHE A C   1 
ATOM   47  O O   . PHE A 1 11 ? -4.102  21.886 63.049 1.00 19.73 ? 839 PHE A O   1 
ATOM   48  C CB  . PHE A 1 11 ? -3.461  21.082 66.226 1.00 19.66 ? 839 PHE A CB  1 
ATOM   49  C CG  . PHE A 1 11 ? -3.584  19.719 65.574 1.00 21.95 ? 839 PHE A CG  1 
ATOM   50  C CD1 . PHE A 1 11 ? -4.815  19.079 65.497 1.00 23.51 ? 839 PHE A CD1 1 
ATOM   51  C CD2 . PHE A 1 11 ? -2.476  19.086 65.032 1.00 21.89 ? 839 PHE A CD2 1 
ATOM   52  C CE1 . PHE A 1 11 ? -4.931  17.817 64.883 1.00 25.50 ? 839 PHE A CE1 1 
ATOM   53  C CE2 . PHE A 1 11 ? -2.581  17.829 64.416 1.00 22.78 ? 839 PHE A CE2 1 
ATOM   54  C CZ  . PHE A 1 11 ? -3.803  17.196 64.341 1.00 24.84 ? 839 PHE A CZ  1 
ATOM   55  N N   . GLN A 1 12 ? -5.447  22.917 64.527 1.00 18.88 ? 840 GLN A N   1 
ATOM   56  C CA  . GLN A 1 12 ? -6.533  23.059 63.549 1.00 20.46 ? 840 GLN A CA  1 
ATOM   57  C C   . GLN A 1 12 ? -6.156  23.933 62.373 1.00 19.59 ? 840 GLN A C   1 
ATOM   58  O O   . GLN A 1 12 ? -6.640  23.731 61.282 1.00 20.66 ? 840 GLN A O   1 
ATOM   59  C CB  . GLN A 1 12 ? -7.805  23.593 64.209 1.00 21.89 ? 840 GLN A CB  1 
ATOM   60  C CG  . GLN A 1 12 ? -8.480  22.527 65.059 1.00 27.23 ? 840 GLN A CG  1 
ATOM   61  C CD  . GLN A 1 12 ? -9.055  21.395 64.217 1.00 27.45 ? 840 GLN A CD  1 
ATOM   62  O OE1 . GLN A 1 12 ? -9.669  21.639 63.183 1.00 31.18 ? 840 GLN A OE1 1 
ATOM   63  N NE2 . GLN A 1 12 ? -8.871  20.155 64.666 1.00 32.67 ? 840 GLN A NE2 1 
ATOM   64  N N   . VAL A 1 13 ? -5.295  24.914 62.589 1.00 19.42 ? 841 VAL A N   1 
ATOM   65  C CA  . VAL A 1 13 ? -4.848  25.738 61.473 1.00 18.99 ? 841 VAL A CA  1 
ATOM   66  C C   . VAL A 1 13 ? -4.202  24.822 60.427 1.00 19.20 ? 841 VAL A C   1 
ATOM   67  O O   . VAL A 1 13 ? -4.437  24.964 59.226 1.00 17.62 ? 841 VAL A O   1 
ATOM   68  C CB  . VAL A 1 13 ? -3.790  26.770 61.926 1.00 17.65 ? 841 VAL A CB  1 
ATOM   69  C CG1 . VAL A 1 13 ? -3.126  27.399 60.715 1.00 20.68 ? 841 VAL A CG1 1 
ATOM   70  C CG2 . VAL A 1 13 ? -4.457  27.869 62.801 1.00 19.62 ? 841 VAL A CG2 1 
ATOM   71  N N   . LEU A 1 14 ? -3.400  23.868 60.892 1.00 17.02 ? 842 LEU A N   1 
ATOM   72  C CA  . LEU A 1 14 ? -2.707  22.977 59.979 1.00 15.86 ? 842 LEU A CA  1 
ATOM   73  C C   . LEU A 1 14 ? -3.658  21.972 59.340 1.00 15.93 ? 842 LEU A C   1 
ATOM   74  O O   . LEU A 1 14 ? -3.535  21.687 58.164 1.00 14.36 ? 842 LEU A O   1 
ATOM   75  C CB  . LEU A 1 14 ? -1.554  22.263 60.701 1.00 15.27 ? 842 LEU A CB  1 
ATOM   76  C CG  . LEU A 1 14 ? -0.492  21.703 59.747 1.00 17.35 ? 842 LEU A CG  1 
ATOM   77  C CD1 . LEU A 1 14 ? 0.131   22.867 58.892 1.00 15.53 ? 842 LEU A CD1 1 
ATOM   78  C CD2 . LEU A 1 14 ? 0.593   20.976 60.560 1.00 16.35 ? 842 LEU A CD2 1 
ATOM   79  N N   . VAL A 1 15 ? -4.620  21.468 60.110 1.00 17.55 ? 843 VAL A N   1 
ATOM   80  C CA  . VAL A 1 15 ? -5.610  20.523 59.597 1.00 17.76 ? 843 VAL A CA  1 
ATOM   81  C C   . VAL A 1 15 ? -6.407  21.199 58.473 1.00 19.36 ? 843 VAL A C   1 
ATOM   82  O O   . VAL A 1 15 ? -6.664  20.599 57.422 1.00 19.18 ? 843 VAL A O   1 
ATOM   83  C CB  . VAL A 1 15 ? -6.600  20.082 60.716 1.00 17.36 ? 843 VAL A CB  1 
ATOM   84  C CG1 . VAL A 1 15 ? -7.702  19.184 60.136 1.00 19.62 ? 843 VAL A CG1 1 
ATOM   85  C CG2 . VAL A 1 15 ? -5.855  19.367 61.815 1.00 15.27 ? 843 VAL A CG2 1 
ATOM   86  N N   . ARG A 1 16 ? -6.795  22.454 58.692 1.00 20.24 ? 844 ARG A N   1 
ATOM   87  C CA  . ARG A 1 16 ? -7.548  23.206 57.686 1.00 20.30 ? 844 ARG A CA  1 
ATOM   88  C C   . ARG A 1 16 ? -6.745  23.384 56.417 1.00 18.42 ? 844 ARG A C   1 
ATOM   89  O O   . ARG A 1 16 ? -7.287  23.285 55.321 1.00 18.82 ? 844 ARG A O   1 
ATOM   90  C CB  . ARG A 1 16 ? -7.915  24.600 58.203 1.00 23.91 ? 844 ARG A CB  1 
ATOM   91  C CG  . ARG A 1 16 ? -9.254  24.675 58.893 1.00 28.98 ? 844 ARG A CG  1 
ATOM   92  C CD  . ARG A 1 16 ? -9.560  26.123 59.288 1.00 33.43 ? 844 ARG A CD  1 
ATOM   93  N NE  . ARG A 1 16 ? -9.056  26.449 60.620 1.00 37.26 ? 844 ARG A NE  1 
ATOM   94  C CZ  . ARG A 1 16 ? -8.226  27.453 60.902 1.00 40.09 ? 844 ARG A CZ  1 
ATOM   95  N NH1 . ARG A 1 16 ? -7.769  28.257 59.942 1.00 39.34 ? 844 ARG A NH1 1 
ATOM   96  N NH2 . ARG A 1 16 ? -7.879  27.670 62.163 1.00 39.50 ? 844 ARG A NH2 1 
ATOM   97  N N   . ARG A 1 17 ? -5.450  23.657 56.564 1.00 17.29 ? 845 ARG A N   1 
ATOM   98  C CA  . ARG A 1 17 ? -4.569  23.849 55.414 1.00 17.04 ? 845 ARG A CA  1 
ATOM   99  C C   . ARG A 1 17 ? -4.371  22.577 54.609 1.00 15.99 ? 845 ARG A C   1 
ATOM   100 O O   . ARG A 1 17 ? -4.353  22.620 53.378 1.00 15.97 ? 845 ARG A O   1 
ATOM   101 C CB  . ARG A 1 17 ? -3.191  24.378 55.836 1.00 18.82 ? 845 ARG A CB  1 
ATOM   102 C CG  . ARG A 1 17 ? -2.267  24.631 54.624 1.00 20.48 ? 845 ARG A CG  1 
ATOM   103 C CD  . ARG A 1 17 ? -2.994  25.423 53.507 1.00 25.84 ? 845 ARG A CD  1 
ATOM   104 N NE  . ARG A 1 17 ? -3.662  26.634 54.010 1.00 29.10 ? 845 ARG A NE  1 
ATOM   105 C CZ  . ARG A 1 17 ? -3.078  27.825 54.142 1.00 31.98 ? 845 ARG A CZ  1 
ATOM   106 N NH1 . ARG A 1 17 ? -1.804  27.984 53.804 1.00 32.22 ? 845 ARG A NH1 1 
ATOM   107 N NH2 . ARG A 1 17 ? -3.763  28.864 54.614 1.00 31.85 ? 845 ARG A NH2 1 
ATOM   108 N N   . VAL A 1 18 ? -4.197  21.456 55.297 1.00 16.97 ? 846 VAL A N   1 
ATOM   109 C CA  . VAL A 1 18 ? -4.041  20.152 54.635 1.00 15.24 ? 846 VAL A CA  1 
ATOM   110 C C   . VAL A 1 18 ? -5.328  19.847 53.887 1.00 16.17 ? 846 VAL A C   1 
ATOM   111 O O   . VAL A 1 18 ? -5.295  19.435 52.742 1.00 15.61 ? 846 VAL A O   1 
ATOM   112 C CB  . VAL A 1 18 ? -3.765  19.047 55.664 1.00 16.84 ? 846 VAL A CB  1 
ATOM   113 C CG1 . VAL A 1 18 ? -4.025  17.655 55.076 1.00 15.83 ? 846 VAL A CG1 1 
ATOM   114 C CG2 . VAL A 1 18 ? -2.338  19.160 56.096 1.00 17.47 ? 846 VAL A CG2 1 
ATOM   115 N N   . ASP A 1 19 ? -6.474  20.066 54.514 1.00 18.04 ? 847 ASP A N   1 
ATOM   116 C CA  . ASP A 1 19 ? -7.712  19.808 53.791 1.00 20.85 ? 847 ASP A CA  1 
ATOM   117 C C   . ASP A 1 19 ? -7.771  20.696 52.544 1.00 20.62 ? 847 ASP A C   1 
ATOM   118 O O   . ASP A 1 19 ? -8.172  20.253 51.457 1.00 19.73 ? 847 ASP A O   1 
ATOM   119 C CB  . ASP A 1 19 ? -8.920  20.058 54.699 1.00 25.38 ? 847 ASP A CB  1 
ATOM   120 C CG  . ASP A 1 19 ? -10.237 19.648 54.040 1.00 30.99 ? 847 ASP A CG  1 
ATOM   121 O OD1 . ASP A 1 19 ? -10.342 18.484 53.593 1.00 32.02 ? 847 ASP A OD1 1 
ATOM   122 O OD2 . ASP A 1 19 ? -11.159 20.488 53.972 1.00 33.17 ? 847 ASP A OD2 1 
ATOM   123 N N   . ARG A 1 20 ? -7.344  21.948 52.672 1.00 20.68 ? 848 ARG A N   1 
ATOM   124 C CA  . ARG A 1 20 ? -7.386  22.824 51.514 1.00 22.49 ? 848 ARG A CA  1 
ATOM   125 C C   . ARG A 1 20 ? -6.494  22.295 50.399 1.00 23.87 ? 848 ARG A C   1 
ATOM   126 O O   . ARG A 1 20 ? -6.880  22.297 49.219 1.00 22.22 ? 848 ARG A O   1 
ATOM   127 C CB  . ARG A 1 20 ? -6.946  24.234 51.876 1.00 24.55 ? 848 ARG A CB  1 
ATOM   128 C CG  . ARG A 1 20 ? -7.171  25.210 50.728 1.00 30.07 ? 848 ARG A CG  1 
ATOM   129 C CD  . ARG A 1 20 ? -5.874  25.876 50.336 1.00 33.43 ? 848 ARG A CD  1 
ATOM   130 N NE  . ARG A 1 20 ? -5.634  27.079 51.114 1.00 35.11 ? 848 ARG A NE  1 
ATOM   131 C CZ  . ARG A 1 20 ? -4.517  27.795 51.057 1.00 35.39 ? 848 ARG A CZ  1 
ATOM   132 N NH1 . ARG A 1 20 ? -3.525  27.427 50.263 1.00 38.61 ? 848 ARG A NH1 1 
ATOM   133 N NH2 . ARG A 1 20 ? -4.407  28.897 51.783 1.00 38.02 ? 848 ARG A NH2 1 
ATOM   134 N N   . MET A 1 21 ? -5.296  21.851 50.774 1.00 21.87 ? 849 MET A N   1 
ATOM   135 C CA  . MET A 1 21 ? -4.353  21.315 49.815 1.00 21.75 ? 849 MET A CA  1 
ATOM   136 C C   . MET A 1 21 ? -4.849  20.051 49.145 1.00 19.25 ? 849 MET A C   1 
ATOM   137 O O   . MET A 1 21 ? -4.522  19.807 47.996 1.00 18.12 ? 849 MET A O   1 
ATOM   138 C CB  . MET A 1 21 ? -3.004  21.040 50.484 1.00 23.47 ? 849 MET A CB  1 
ATOM   139 C CG  . MET A 1 21 ? -2.320  22.318 50.915 1.00 25.79 ? 849 MET A CG  1 
ATOM   140 S SD  . MET A 1 21 ? -0.950  21.954 51.995 1.00 33.07 ? 849 MET A SD  1 
ATOM   141 C CE  . MET A 1 21 ? 0.060   21.070 50.920 1.00 19.53 ? 849 MET A CE  1 
ATOM   142 N N   . GLU A 1 22 ? -5.628  19.235 49.841 1.00 20.01 ? 850 GLU A N   1 
ATOM   143 C CA  . GLU A 1 22 ? -6.144  18.038 49.189 1.00 21.19 ? 850 GLU A CA  1 
ATOM   144 C C   . GLU A 1 22 ? -7.064  18.470 48.045 1.00 21.94 ? 850 GLU A C   1 
ATOM   145 O O   . GLU A 1 22 ? -7.146  17.803 47.011 1.00 20.77 ? 850 GLU A O   1 
ATOM   146 C CB  . GLU A 1 22 ? -6.946  17.191 50.170 1.00 24.30 ? 850 GLU A CB  1 
ATOM   147 C CG  . GLU A 1 22 ? -6.168  16.728 51.375 1.00 28.62 ? 850 GLU A CG  1 
ATOM   148 C CD  . GLU A 1 22 ? -7.027  15.849 52.284 1.00 28.81 ? 850 GLU A CD  1 
ATOM   149 O OE1 . GLU A 1 22 ? -8.130  16.286 52.656 1.00 31.27 ? 850 GLU A OE1 1 
ATOM   150 O OE2 . GLU A 1 22 ? -6.603  14.731 52.614 1.00 30.68 ? 850 GLU A OE2 1 
ATOM   151 N N   . HIS A 1 23 ? -7.763  19.585 48.239 1.00 22.88 ? 851 HIS A N   1 
ATOM   152 C CA  . HIS A 1 23 ? -8.680  20.087 47.216 1.00 25.64 ? 851 HIS A CA  1 
ATOM   153 C C   . HIS A 1 23 ? -7.883  20.627 46.046 1.00 25.80 ? 851 HIS A C   1 
ATOM   154 O O   . HIS A 1 23 ? -8.230  20.396 44.886 1.00 25.18 ? 851 HIS A O   1 
ATOM   155 C CB  . HIS A 1 23 ? -9.592  21.159 47.818 1.00 29.90 ? 851 HIS A CB  1 
ATOM   156 C CG  . HIS A 1 23 ? -10.418 20.646 48.957 1.00 32.16 ? 851 HIS A CG  1 
ATOM   157 N ND1 . HIS A 1 23 ? -11.134 21.468 49.798 1.00 36.00 ? 851 HIS A ND1 1 
ATOM   158 C CD2 . HIS A 1 23 ? -10.630 19.383 49.398 1.00 35.49 ? 851 HIS A CD2 1 
ATOM   159 C CE1 . HIS A 1 23 ? -11.752 20.735 50.710 1.00 36.30 ? 851 HIS A CE1 1 
ATOM   160 N NE2 . HIS A 1 23 ? -11.462 19.466 50.488 1.00 36.86 ? 851 HIS A NE2 1 
ATOM   161 N N   . SER A 1 24 ? -6.801  21.332 46.359 1.00 23.70 ? 852 SER A N   1 
ATOM   162 C CA  . SER A 1 24 ? -5.908  21.861 45.343 1.00 24.12 ? 852 SER A CA  1 
ATOM   163 C C   . SER A 1 24 ? -5.309  20.698 44.539 1.00 21.66 ? 852 SER A C   1 
ATOM   164 O O   . SER A 1 24 ? -5.212  20.764 43.323 1.00 23.39 ? 852 SER A O   1 
ATOM   165 C CB  . SER A 1 24 ? -4.795  22.669 46.010 1.00 23.25 ? 852 SER A CB  1 
ATOM   166 O OG  . SER A 1 24 ? -5.345  23.819 46.632 1.00 28.12 ? 852 SER A OG  1 
ATOM   167 N N   . ILE A 1 25 ? -4.919  19.629 45.218 1.00 20.84 ? 853 ILE A N   1 
ATOM   168 C CA  . ILE A 1 25 ? -4.360  18.468 44.526 1.00 21.07 ? 853 ILE A CA  1 
ATOM   169 C C   . ILE A 1 25 ? -5.406  17.802 43.618 1.00 20.12 ? 853 ILE A C   1 
ATOM   170 O O   . ILE A 1 25 ? -5.094  17.365 42.512 1.00 20.73 ? 853 ILE A O   1 
ATOM   171 C CB  . ILE A 1 25 ? -3.814  17.457 45.549 1.00 20.28 ? 853 ILE A CB  1 
ATOM   172 C CG1 . ILE A 1 25 ? -2.560  18.049 46.212 1.00 22.39 ? 853 ILE A CG1 1 
ATOM   173 C CG2 . ILE A 1 25 ? -3.482  16.129 44.882 1.00 23.62 ? 853 ILE A CG2 1 
ATOM   174 C CD1 . ILE A 1 25 ? -1.951  17.171 47.284 1.00 21.50 ? 853 ILE A CD1 1 
ATOM   175 N N   . GLY A 1 26 ? -6.639  17.707 44.095 1.00 19.96 ? 854 GLY A N   1 
ATOM   176 C CA  . GLY A 1 26 ? -7.681  17.114 43.282 1.00 23.39 ? 854 GLY A CA  1 
ATOM   177 C C   . GLY A 1 26 ? -7.874  17.928 42.013 1.00 23.56 ? 854 GLY A C   1 
ATOM   178 O O   . GLY A 1 26 ? -8.012  17.381 40.927 1.00 23.98 ? 854 GLY A O   1 
ATOM   179 N N   . SER A 1 27 ? -7.863  19.250 42.126 1.00 24.50 ? 855 SER A N   1 
ATOM   180 C CA  . SER A 1 27 ? -8.051  20.076 40.939 1.00 25.51 ? 855 SER A CA  1 
ATOM   181 C C   . SER A 1 27 ? -6.916  19.936 39.932 1.00 24.21 ? 855 SER A C   1 
ATOM   182 O O   . SER A 1 27 ? -7.136  19.929 38.726 1.00 24.05 ? 855 SER A O   1 
ATOM   183 C CB  . SER A 1 27 ? -8.239  21.530 41.350 1.00 28.11 ? 855 SER A CB  1 
ATOM   184 O OG  . SER A 1 27 ? -9.421  21.623 42.128 1.00 33.98 ? 855 SER A OG  1 
ATOM   185 N N   . ILE A 1 28 ? -5.698  19.837 40.441 1.00 23.17 ? 856 ILE A N   1 
ATOM   186 C CA  . ILE A 1 28 ? -4.517  19.655 39.623 1.00 22.40 ? 856 ILE A CA  1 
ATOM   187 C C   . ILE A 1 28 ? -4.601  18.307 38.901 1.00 21.00 ? 856 ILE A C   1 
ATOM   188 O O   . ILE A 1 28 ? -4.254  18.190 37.725 1.00 21.20 ? 856 ILE A O   1 
ATOM   189 C CB  . ILE A 1 28 ? -3.253  19.653 40.504 1.00 22.14 ? 856 ILE A CB  1 
ATOM   190 C CG1 . ILE A 1 28 ? -2.929  21.075 40.982 1.00 25.64 ? 856 ILE A CG1 1 
ATOM   191 C CG2 . ILE A 1 28 ? -2.113  19.069 39.747 1.00 23.38 ? 856 ILE A CG2 1 
ATOM   192 C CD1 . ILE A 1 28 ? -1.763  21.128 41.970 1.00 26.46 ? 856 ILE A CD1 1 
ATOM   193 N N   . VAL A 1 29 ? -5.044  17.281 39.615 1.00 19.99 ? 857 VAL A N   1 
ATOM   194 C CA  . VAL A 1 29 ? -5.164  15.963 39.012 1.00 20.85 ? 857 VAL A CA  1 
ATOM   195 C C   . VAL A 1 29 ? -6.201  16.012 37.896 1.00 21.43 ? 857 VAL A C   1 
ATOM   196 O O   . VAL A 1 29 ? -6.012  15.403 36.848 1.00 21.40 ? 857 VAL A O   1 
ATOM   197 C CB  . VAL A 1 29 ? -5.591  14.890 40.048 1.00 21.57 ? 857 VAL A CB  1 
ATOM   198 C CG1 . VAL A 1 29 ? -5.776  13.540 39.354 1.00 24.82 ? 857 VAL A CG1 1 
ATOM   199 C CG2 . VAL A 1 29 ? -4.532  14.761 41.123 1.00 21.75 ? 857 VAL A CG2 1 
ATOM   200 N N   . SER A 1 30 ? -7.288  16.744 38.114 1.00 21.04 ? 858 SER A N   1 
ATOM   201 C CA  . SER A 1 30 ? -8.325  16.849 37.092 1.00 24.23 ? 858 SER A CA  1 
ATOM   202 C C   . SER A 1 30 ? -7.810  17.550 35.845 1.00 22.86 ? 858 SER A C   1 
ATOM   203 O O   . SER A 1 30 ? -8.132  17.154 34.721 1.00 20.11 ? 858 SER A O   1 
ATOM   204 C CB  . SER A 1 30 ? -9.542  17.589 37.632 1.00 26.32 ? 858 SER A CB  1 
ATOM   205 O OG  . SER A 1 30 ? -10.123 16.838 38.683 1.00 32.41 ? 858 SER A OG  1 
ATOM   206 N N   . LYS A 1 31 ? -7.017  18.594 36.052 1.00 22.37 ? 859 LYS A N   1 
ATOM   207 C CA  . LYS A 1 31 ? -6.449  19.334 34.942 1.00 23.24 ? 859 LYS A CA  1 
ATOM   208 C C   . LYS A 1 31 ? -5.433  18.513 34.180 1.00 20.57 ? 859 LYS A C   1 
ATOM   209 O O   . LYS A 1 31 ? -5.416  18.537 32.962 1.00 18.53 ? 859 LYS A O   1 
ATOM   210 C CB  . LYS A 1 31 ? -5.737  20.595 35.412 1.00 27.22 ? 859 LYS A CB  1 
ATOM   211 C CG  . LYS A 1 31 ? -6.595  21.749 35.881 1.00 29.03 ? 859 LYS A CG  1 
ATOM   212 C CD  . LYS A 1 31 ? -5.627  22.864 36.334 1.00 31.85 ? 859 LYS A CD  1 
ATOM   213 C CE  . LYS A 1 31 ? -6.286  24.210 36.587 1.00 33.34 ? 859 LYS A CE  1 
ATOM   214 N NZ  . LYS A 1 31 ? -5.256  25.265 36.890 1.00 31.26 ? 859 LYS A NZ  1 
ATOM   215 N N   . ILE A 1 32 ? -4.555  17.810 34.892 1.00 20.71 ? 860 ILE A N   1 
ATOM   216 C CA  . ILE A 1 32 ? -3.548  17.027 34.202 1.00 20.51 ? 860 ILE A CA  1 
ATOM   217 C C   . ILE A 1 32 ? -4.175  15.860 33.449 1.00 18.59 ? 860 ILE A C   1 
ATOM   218 O O   . ILE A 1 32 ? -3.734  15.489 32.355 1.00 19.50 ? 860 ILE A O   1 
ATOM   219 C CB  . ILE A 1 32 ? -2.422  16.537 35.171 1.00 24.05 ? 860 ILE A CB  1 
ATOM   220 C CG1 . ILE A 1 32 ? -1.365  15.806 34.362 1.00 27.25 ? 860 ILE A CG1 1 
ATOM   221 C CG2 . ILE A 1 32 ? -2.961  15.613 36.252 1.00 24.76 ? 860 ILE A CG2 1 
ATOM   222 C CD1 . ILE A 1 32 ? -0.731  16.680 33.302 1.00 27.96 ? 860 ILE A CD1 1 
ATOM   223 N N   . ASP A 1 33 ? -5.212  15.277 34.011 1.00 17.36 ? 861 ASP A N   1 
ATOM   224 C CA  . ASP A 1 33 ? -5.856  14.179 33.326 1.00 19.65 ? 861 ASP A CA  1 
ATOM   225 C C   . ASP A 1 33 ? -6.551  14.679 32.064 1.00 19.92 ? 861 ASP A C   1 
ATOM   226 O O   . ASP A 1 33 ? -6.645  13.953 31.085 1.00 21.86 ? 861 ASP A O   1 
ATOM   227 C CB  . ASP A 1 33 ? -6.847  13.500 34.254 1.00 20.52 ? 861 ASP A CB  1 
ATOM   228 C CG  . ASP A 1 33 ? -6.157  12.643 35.309 1.00 24.00 ? 861 ASP A CG  1 
ATOM   229 O OD1 . ASP A 1 33 ? -4.944  12.356 35.165 1.00 27.90 ? 861 ASP A OD1 1 
ATOM   230 O OD2 . ASP A 1 33 ? -6.829  12.244 36.277 1.00 26.72 ? 861 ASP A OD2 1 
ATOM   231 N N   . ALA A 1 34 ? -7.029  15.923 32.091 1.00 18.28 ? 862 ALA A N   1 
ATOM   232 C CA  . ALA A 1 34 ? -7.705  16.498 30.923 1.00 18.70 ? 862 ALA A CA  1 
ATOM   233 C C   . ALA A 1 34 ? -6.672  16.723 29.826 1.00 17.85 ? 862 ALA A C   1 
ATOM   234 O O   . ALA A 1 34 ? -6.918  16.444 28.652 1.00 16.28 ? 862 ALA A O   1 
ATOM   235 C CB  . ALA A 1 34 ? -8.369  17.809 31.293 1.00 18.04 ? 862 ALA A CB  1 
ATOM   236 N N   . VAL A 1 35 ? -5.502  17.214 30.221 1.00 17.23 ? 863 VAL A N   1 
ATOM   237 C CA  . VAL A 1 35 ? -4.428  17.446 29.269 1.00 16.61 ? 863 VAL A CA  1 
ATOM   238 C C   . VAL A 1 35 ? -3.999  16.112 28.682 1.00 17.03 ? 863 VAL A C   1 
ATOM   239 O O   . VAL A 1 35 ? -3.786  15.999 27.483 1.00 17.90 ? 863 VAL A O   1 
ATOM   240 C CB  . VAL A 1 35 ? -3.223  18.131 29.951 1.00 20.30 ? 863 VAL A CB  1 
ATOM   241 C CG1 . VAL A 1 35 ? -1.953  17.957 29.094 1.00 22.21 ? 863 VAL A CG1 1 
ATOM   242 C CG2 . VAL A 1 35 ? -3.535  19.600 30.149 1.00 20.46 ? 863 VAL A CG2 1 
ATOM   243 N N   . ILE A 1 36 ? -3.859  15.094 29.522 1.00 16.26 ? 864 ILE A N   1 
ATOM   244 C CA  . ILE A 1 36 ? -3.472  13.789 29.019 1.00 17.36 ? 864 ILE A CA  1 
ATOM   245 C C   . ILE A 1 36 ? -4.448  13.309 27.942 1.00 16.04 ? 864 ILE A C   1 
ATOM   246 O O   . ILE A 1 36 ? -4.033  12.780 26.907 1.00 19.63 ? 864 ILE A O   1 
ATOM   247 C CB  . ILE A 1 36 ? -3.377  12.760 30.176 1.00 17.95 ? 864 ILE A CB  1 
ATOM   248 C CG1 . ILE A 1 36 ? -2.113  13.047 30.995 1.00 20.58 ? 864 ILE A CG1 1 
ATOM   249 C CG2 . ILE A 1 36 ? -3.329  11.354 29.620 1.00 20.08 ? 864 ILE A CG2 1 
ATOM   250 C CD1 . ILE A 1 36 ? -1.913  12.157 32.225 1.00 20.92 ? 864 ILE A CD1 1 
ATOM   251 N N   . VAL A 1 37 ? -5.742  13.516 28.141 1.00 15.99 ? 865 VAL A N   1 
ATOM   252 C CA  . VAL A 1 37 ? -6.695  13.079 27.111 1.00 16.63 ? 865 VAL A CA  1 
ATOM   253 C C   . VAL A 1 37 ? -6.567  13.872 25.824 1.00 16.21 ? 865 VAL A C   1 
ATOM   254 O O   . VAL A 1 37 ? -6.683  13.309 24.735 1.00 17.96 ? 865 VAL A O   1 
ATOM   255 C CB  . VAL A 1 37 ? -8.137  13.139 27.636 1.00 17.08 ? 865 VAL A CB  1 
ATOM   256 C CG1 . VAL A 1 37 ? -9.139  12.858 26.513 1.00 19.03 ? 865 VAL A CG1 1 
ATOM   257 C CG2 . VAL A 1 37 ? -8.284  12.093 28.689 1.00 18.12 ? 865 VAL A CG2 1 
ATOM   258 N N   . LYS A 1 38 ? -6.317  15.176 25.932 1.00 17.52 ? 866 LYS A N   1 
ATOM   259 C CA  . LYS A 1 38 ? -6.141  16.004 24.746 1.00 18.39 ? 866 LYS A CA  1 
ATOM   260 C C   . LYS A 1 38 ? -4.958  15.484 23.918 1.00 18.23 ? 866 LYS A C   1 
ATOM   261 O O   . LYS A 1 38 ? -5.004  15.465 22.698 1.00 19.41 ? 866 LYS A O   1 
ATOM   262 C CB  . LYS A 1 38 ? -5.876  17.469 25.130 1.00 21.69 ? 866 LYS A CB  1 
ATOM   263 C CG  . LYS A 1 38 ? -7.027  18.150 25.884 1.00 26.22 ? 866 LYS A CG  1 
ATOM   264 C CD  . LYS A 1 38 ? -6.678  19.592 26.311 1.00 32.61 ? 866 LYS A CD  1 
ATOM   265 C CE  . LYS A 1 38 ? -7.740  20.189 27.250 1.00 35.29 ? 866 LYS A CE  1 
ATOM   266 N NZ  . LYS A 1 38 ? -7.383  21.550 27.777 1.00 39.30 ? 866 LYS A NZ  1 
ATOM   267 N N   . LEU A 1 39 ? -3.896  15.062 24.578 1.00 21.50 ? 867 LEU A N   1 
ATOM   268 C CA  . LEU A 1 39 ? -2.724  14.573 23.847 1.00 23.45 ? 867 LEU A CA  1 
ATOM   269 C C   . LEU A 1 39 ? -2.963  13.207 23.198 1.00 25.13 ? 867 LEU A C   1 
ATOM   270 O O   . LEU A 1 39 ? -2.488  12.936 22.087 1.00 24.93 ? 867 LEU A O   1 
ATOM   271 C CB  . LEU A 1 39 ? -1.516  14.531 24.781 1.00 23.61 ? 867 LEU A CB  1 
ATOM   272 C CG  . LEU A 1 39 ? -0.806  15.878 24.990 1.00 24.60 ? 867 LEU A CG  1 
ATOM   273 C CD1 . LEU A 1 39 ? 0.266   15.741 26.080 1.00 25.95 ? 867 LEU A CD1 1 
ATOM   274 C CD2 . LEU A 1 39 ? -0.161  16.325 23.672 1.00 22.53 ? 867 LEU A CD2 1 
ATOM   275 N N   . GLU A 1 40 ? -3.706  12.355 23.893 1.00 23.75 ? 868 GLU A N   1 
ATOM   276 C CA  . GLU A 1 40 ? -4.027  11.039 23.376 1.00 27.12 ? 868 GLU A CA  1 
ATOM   277 C C   . GLU A 1 40 ? -4.910  11.106 22.139 1.00 27.77 ? 868 GLU A C   1 
ATOM   278 O O   . GLU A 1 40 ? -4.821  10.247 21.280 1.00 28.12 ? 868 GLU A O   1 
ATOM   279 C CB  . GLU A 1 40 ? -4.765  10.201 24.425 1.00 27.15 ? 868 GLU A CB  1 
ATOM   280 C CG  . GLU A 1 40 ? -3.967  9.921  25.684 1.00 28.75 ? 868 GLU A CG  1 
ATOM   281 C CD  . GLU A 1 40 ? -4.709  9.031  26.665 1.00 31.45 ? 868 GLU A CD  1 
ATOM   282 O OE1 . GLU A 1 40 ? -5.852  9.360  27.023 1.00 30.57 ? 868 GLU A OE1 1 
ATOM   283 O OE2 . GLU A 1 40 ? -4.146  8.001  27.094 1.00 36.44 ? 868 GLU A OE2 1 
ATOM   284 N N   . ILE A 1 41 ? -5.777  12.110 22.048 1.00 27.13 ? 869 ILE A N   1 
ATOM   285 C CA  . ILE A 1 41 ? -6.670  12.185 20.905 1.00 28.07 ? 869 ILE A CA  1 
ATOM   286 C C   . ILE A 1 41 ? -6.185  13.196 19.878 1.00 30.75 ? 869 ILE A C   1 
ATOM   287 O O   . ILE A 1 41 ? -6.861  13.478 18.896 1.00 28.39 ? 869 ILE A O   1 
ATOM   288 C CB  . ILE A 1 41 ? -8.116  12.572 21.346 1.00 27.86 ? 869 ILE A CB  1 
ATOM   289 C CG1 . ILE A 1 41 ? -8.132  13.991 21.917 1.00 27.41 ? 869 ILE A CG1 1 
ATOM   290 C CG2 . ILE A 1 41 ? -8.629  11.578 22.417 1.00 27.07 ? 869 ILE A CG2 1 
ATOM   291 C CD1 . ILE A 1 41 ? -9.524  14.430 22.443 1.00 29.63 ? 869 ILE A CD1 1 
ATOM   292 N N   . MET A 1 42 ? -5.001  13.744 20.089 1.00 32.83 ? 870 MET A N   1 
ATOM   293 C CA  . MET A 1 42 ? -4.560  14.745 19.143 1.00 38.18 ? 870 MET A CA  1 
ATOM   294 C C   . MET A 1 42 ? -4.058  14.172 17.825 1.00 38.26 ? 870 MET A C   1 
ATOM   295 O O   . MET A 1 42 ? -3.472  13.073 17.843 1.00 37.85 ? 870 MET A O   1 
ATOM   296 C CB  . MET A 1 42 ? -3.495  15.606 19.780 1.00 39.18 ? 870 MET A CB  1 
ATOM   297 C CG  . MET A 1 42 ? -3.540  17.032 19.311 1.00 43.32 ? 870 MET A CG  1 
ATOM   298 S SD  . MET A 1 42 ? -2.228  17.856 20.147 1.00 48.03 ? 870 MET A SD  1 
ATOM   299 C CE  . MET A 1 42 ? -0.934  17.066 19.347 1.00 44.68 ? 870 MET A CE  1 
HETATM 300 O O   . HOH B 2 .  ? -6.556  26.947 55.111 1.00 15.12 ? 1   HOH A O   1 
HETATM 301 O O   . HOH B 2 .  ? -3.387  24.727 48.787 1.00 24.67 ? 2   HOH A O   1 
HETATM 302 O O   . HOH B 2 .  ? -5.192  27.118 57.924 1.00 21.36 ? 3   HOH A O   1 
HETATM 303 O O   . HOH B 2 .  ? -5.311  24.164 39.714 1.00 28.54 ? 4   HOH A O   1 
HETATM 304 O O   . HOH B 2 .  ? -6.432  26.241 71.522 1.00 31.17 ? 5   HOH A O   1 
HETATM 305 O O   . HOH B 2 .  ? -6.535  17.792 18.602 1.00 40.27 ? 6   HOH A O   1 
HETATM 306 O O   . HOH B 2 .  ? -9.275  21.285 37.848 1.00 33.83 ? 7   HOH A O   1 
HETATM 307 O O   . HOH B 2 .  ? -7.596  27.151 64.783 1.00 29.83 ? 8   HOH A O   1 
HETATM 308 O O   . HOH B 2 .  ? -1.825  30.589 51.495 1.00 50.80 ? 9   HOH A O   1 
HETATM 309 O O   . HOH B 2 .  ? -6.493  11.008 31.790 1.00 32.37 ? 10  HOH A O   1 
HETATM 310 O O   . HOH B 2 .  ? -5.514  23.079 27.196 1.00 47.04 ? 11  HOH A O   1 
HETATM 311 O O   . HOH B 2 .  ? -5.313  23.047 73.830 1.00 36.09 ? 12  HOH A O   1 
HETATM 312 O O   . HOH B 2 .  ? -12.880 20.320 65.776 1.00 35.30 ? 13  HOH A O   1 
HETATM 313 O O   . HOH B 2 .  ? -9.332  14.664 40.956 1.00 46.22 ? 14  HOH A O   1 
HETATM 314 O O   . HOH B 2 .  ? -6.699  15.029 46.698 1.00 34.22 ? 15  HOH A O   1 
HETATM 315 O O   . HOH B 2 .  ? -9.780  24.173 54.612 1.00 34.92 ? 16  HOH A O   1 
HETATM 316 O O   . HOH B 2 .  ? -9.976  13.341 38.867 1.00 44.91 ? 17  HOH A O   1 
HETATM 317 O O   . HOH B 2 .  ? -0.225  28.181 49.057 1.00 47.11 ? 18  HOH A O   1 
HETATM 318 O O   . HOH B 2 .  ? -4.512  30.074 57.343 1.00 49.95 ? 19  HOH A O   1 
HETATM 319 O O   . HOH B 2 .  ? 3.084   24.702 71.037 1.00 48.68 ? 20  HOH A O   1 
HETATM 320 O O   . HOH B 2 .  ? -10.646 25.099 62.066 1.00 50.71 ? 21  HOH A O   1 
HETATM 321 O O   . HOH B 2 .  ? -8.250  32.368 68.749 1.00 49.35 ? 22  HOH A O   1 
HETATM 322 O O   . HOH B 2 .  ? -9.236  12.883 36.509 1.00 52.32 ? 23  HOH A O   1 
HETATM 323 O O   . HOH B 2 .  ? -1.298  25.429 48.368 1.00 38.33 ? 24  HOH A O   1 
HETATM 324 O O   . HOH B 2 .  ? -10.123 26.447 65.682 1.00 38.07 ? 25  HOH A O   1 
HETATM 325 O O   . HOH B 2 .  ? -6.756  23.016 24.024 1.00 32.22 ? 26  HOH A O   1 
HETATM 326 O O   . HOH B 2 .  ? -13.540 19.783 68.156 1.00 50.86 ? 27  HOH A O   1 
HETATM 327 O O   . HOH B 2 .  ? -11.075 23.266 52.511 1.00 48.97 ? 28  HOH A O   1 
HETATM 328 O O   . HOH B 2 .  ? -10.956 21.204 56.982 1.00 31.75 ? 29  HOH A O   1 
HETATM 329 O O   . HOH B 2 .  ? -6.243  16.846 20.968 1.00 52.47 ? 30  HOH A O   1 
HETATM 330 O O   . HOH B 2 .  ? -2.720  15.610 14.886 1.00 49.09 ? 31  HOH A O   1 
HETATM 331 O O   . HOH B 2 .  ? -6.586  30.664 67.755 1.00 50.89 ? 32  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -3  ?   ?   ?   A . n 
A 1 2  SER 2  -2  ?   ?   ?   A . n 
A 1 3  HIS 3  -1  ?   ?   ?   A . n 
A 1 4  MET 4  0   ?   ?   ?   A . n 
A 1 5  GLY 5  833 ?   ?   ?   A . n 
A 1 6  VAL 6  834 834 VAL VAL A . n 
A 1 7  SER 7  835 835 SER SER A . n 
A 1 8  TYR 8  836 836 TYR TYR A . n 
A 1 9  GLU 9  837 837 GLU GLU A . n 
A 1 10 GLU 10 838 838 GLU GLU A . n 
A 1 11 PHE 11 839 839 PHE PHE A . n 
A 1 12 GLN 12 840 840 GLN GLN A . n 
A 1 13 VAL 13 841 841 VAL VAL A . n 
A 1 14 LEU 14 842 842 LEU LEU A . n 
A 1 15 VAL 15 843 843 VAL VAL A . n 
A 1 16 ARG 16 844 844 ARG ARG A . n 
A 1 17 ARG 17 845 845 ARG ARG A . n 
A 1 18 VAL 18 846 846 VAL VAL A . n 
A 1 19 ASP 19 847 847 ASP ASP A . n 
A 1 20 ARG 20 848 848 ARG ARG A . n 
A 1 21 MET 21 849 849 MET MET A . n 
A 1 22 GLU 22 850 850 GLU GLU A . n 
A 1 23 HIS 23 851 851 HIS HIS A . n 
A 1 24 SER 24 852 852 SER SER A . n 
A 1 25 ILE 25 853 853 ILE ILE A . n 
A 1 26 GLY 26 854 854 GLY GLY A . n 
A 1 27 SER 27 855 855 SER SER A . n 
A 1 28 ILE 28 856 856 ILE ILE A . n 
A 1 29 VAL 29 857 857 VAL VAL A . n 
A 1 30 SER 30 858 858 SER SER A . n 
A 1 31 LYS 31 859 859 LYS LYS A . n 
A 1 32 ILE 32 860 860 ILE ILE A . n 
A 1 33 ASP 33 861 861 ASP ASP A . n 
A 1 34 ALA 34 862 862 ALA ALA A . n 
A 1 35 VAL 35 863 863 VAL VAL A . n 
A 1 36 ILE 36 864 864 ILE ILE A . n 
A 1 37 VAL 37 865 865 VAL VAL A . n 
A 1 38 LYS 38 866 866 LYS LYS A . n 
A 1 39 LEU 39 867 867 LEU LEU A . n 
A 1 40 GLU 40 868 868 GLU GLU A . n 
A 1 41 ILE 41 869 869 ILE ILE A . n 
A 1 42 MET 42 870 870 MET MET A . n 
A 1 43 GLU 43 871 ?   ?   ?   A . n 
A 1 44 ARG 44 872 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1  1  HOH WAT A . 
B 2 HOH 2  2  2  HOH WAT A . 
B 2 HOH 3  3  3  HOH WAT A . 
B 2 HOH 4  4  4  HOH WAT A . 
B 2 HOH 5  5  5  HOH WAT A . 
B 2 HOH 6  6  6  HOH WAT A . 
B 2 HOH 7  7  7  HOH WAT A . 
B 2 HOH 8  8  8  HOH WAT A . 
B 2 HOH 9  9  9  HOH WAT A . 
B 2 HOH 10 10 10 HOH WAT A . 
B 2 HOH 11 11 11 HOH WAT A . 
B 2 HOH 12 12 12 HOH WAT A . 
B 2 HOH 13 13 13 HOH WAT A . 
B 2 HOH 14 14 14 HOH WAT A . 
B 2 HOH 15 15 15 HOH WAT A . 
B 2 HOH 16 16 16 HOH WAT A . 
B 2 HOH 17 17 17 HOH WAT A . 
B 2 HOH 18 18 18 HOH WAT A . 
B 2 HOH 19 19 19 HOH WAT A . 
B 2 HOH 20 20 20 HOH WAT A . 
B 2 HOH 21 21 21 HOH WAT A . 
B 2 HOH 22 22 22 HOH WAT A . 
B 2 HOH 23 23 23 HOH WAT A . 
B 2 HOH 24 24 24 HOH WAT A . 
B 2 HOH 25 25 25 HOH WAT A . 
B 2 HOH 26 26 26 HOH WAT A . 
B 2 HOH 27 27 27 HOH WAT A . 
B 2 HOH 28 28 28 HOH WAT A . 
B 2 HOH 29 29 29 HOH WAT A . 
B 2 HOH 30 30 30 HOH WAT A . 
B 2 HOH 31 31 31 HOH WAT A . 
B 2 HOH 32 32 32 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4120 ? 
1 MORE         -49  ? 
1 'SSA (A^2)'  6790 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 16.1940000000  0.8660254038  
-0.5000000000 0.0000000000 28.0488307778 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_565 -x+y,-x+1,z  -0.5000000000 0.8660254038  0.0000000000 -16.1940000000 -0.8660254038 
-0.5000000000 0.0000000000 28.0488307778 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-28 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .       ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                    ?          ? 
2 SCALEPACK   .       ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                    ?          ? 
3 PHASER      .       ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 
4 CNS         .       ?               package 'Axel T. Brunger'    axel.brunger@yale.edu       refinement        
http://cns-online.org/                      Fortran_77 ? 
5 PDB_EXTRACT 3.005   'June 11, 2008' package PDB                  help@deposit.rcsb.org       'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++        ? 
6 ADSC        Quantum ?               ?       ?                    ?                           'data collection' ? ?          ? 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY -3  ? A GLY 1  
2 1 Y 1 A SER -2  ? A SER 2  
3 1 Y 1 A HIS -1  ? A HIS 3  
4 1 Y 1 A MET 0   ? A MET 4  
5 1 Y 1 A GLY 833 ? A GLY 5  
6 1 Y 1 A GLU 871 ? A GLU 43 
7 1 Y 1 A ARG 872 ? A ARG 44 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#