data_3HS5
# 
_entry.id   3HS5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3HS5         pdb_00003hs5 10.2210/pdb3hs5/pdb 
RCSB  RCSB053517   ?            ?                   
WWPDB D_1000053517 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1CVU 'Arachidonic Acid Bound to COX-2'                                               unspecified 
PDB 1DDX 'PGG2 Bound to COX-2'                                                           unspecified 
PDB 1DIY 'Arachidonic Acid Bound to COX-1'                                               unspecified 
PDB 5COX 'Uninhibited COX-2'                                                             unspecified 
PDB 3HS6 'Eicosapentaenoic Acid Bound To The Cyclooxygenase Channel of Cyclooxygenase-2' unspecified 
PDB 3HS7 'Docosahexaenoic Acid Bound To The Cyclooxygenase Channel of Cyclooxygenase-2'  unspecified 
# 
_pdbx_database_status.entry_id                        3HS5 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-10 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vecchio, A.J.'   1 
'Simmons, D.M.'   2 
'Malkowski, M.G.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of fatty acid substrate binding to cyclooxygenase-2.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                22152 
_citation.page_last                 22163 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20463020 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.119867 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vecchio, A.J.'   1 ? 
primary 'Simmons, D.M.'   2 ? 
primary 'Malkowski, M.G.' 3 ? 
# 
_cell.entry_id           3HS5 
_cell.length_a           119.983 
_cell.length_b           132.553 
_cell.length_c           180.516 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HS5 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Prostaglandin G/H synthase 2' 67933.391 2   1.14.99.1 N580A ? ? 
2  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   3   ? ?     
? ? 
3  branched    man 
'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1 
?         ?     ? ? 
4  non-polymer syn 'ARACHIDONIC ACID' 304.467   2   ?         ?     ? ? 
5  non-polymer syn 'ACRYLIC ACID' 72.063    2   ?         ?     ? ? 
6  non-polymer syn 'PROTOPORPHYRIN IX CONTAINING CO' 619.575   2   ?         ?     ? ? 
7  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?         ?     ? ? 
8  non-polymer man 'octyl beta-D-glucopyranoside' 292.369   2   ?         ?     ? ? 
9  non-polymer syn 1,2-ETHANEDIOL 62.068    12  ?         ?     ? ? 
10 water       nat water 18.015    907 ?         ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Cyclooxygenase-2, COX-2, Prostaglandin-endoperoxide synthase 2, Prostaglandin H2 synthase 2, PGH synthase 2, PGHS-2, PHS II, Glucocorticoid-regulated inflammatory cyclooxygenase, Gripghs, TIS10 protein, Macrophage activation-associated marker protein P71/73, PES-2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPF
LRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREF
IPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVK
DTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIED
YVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFT
RQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPAL
LVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQP
TKTATIAASASHSRLDDINPTVLIKRRSTEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPF
LRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREF
IPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVK
DTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIED
YVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFT
RQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPAL
LVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQP
TKTATIAASASHSRLDDINPTVLIKRRSTEL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   PRO n 
1 8   CYS n 
1 9   CYS n 
1 10  SER n 
1 11  ASN n 
1 12  PRO n 
1 13  CYS n 
1 14  GLN n 
1 15  ASN n 
1 16  ARG n 
1 17  GLY n 
1 18  GLU n 
1 19  CYS n 
1 20  MET n 
1 21  SER n 
1 22  THR n 
1 23  GLY n 
1 24  PHE n 
1 25  ASP n 
1 26  GLN n 
1 27  TYR n 
1 28  LYS n 
1 29  CYS n 
1 30  ASP n 
1 31  CYS n 
1 32  THR n 
1 33  ARG n 
1 34  THR n 
1 35  GLY n 
1 36  PHE n 
1 37  TYR n 
1 38  GLY n 
1 39  GLU n 
1 40  ASN n 
1 41  CYS n 
1 42  THR n 
1 43  THR n 
1 44  PRO n 
1 45  GLU n 
1 46  PHE n 
1 47  LEU n 
1 48  THR n 
1 49  ARG n 
1 50  ILE n 
1 51  LYS n 
1 52  LEU n 
1 53  LEU n 
1 54  LEU n 
1 55  LYS n 
1 56  PRO n 
1 57  THR n 
1 58  PRO n 
1 59  ASN n 
1 60  THR n 
1 61  VAL n 
1 62  HIS n 
1 63  TYR n 
1 64  ILE n 
1 65  LEU n 
1 66  THR n 
1 67  HIS n 
1 68  PHE n 
1 69  LYS n 
1 70  GLY n 
1 71  VAL n 
1 72  TRP n 
1 73  ASN n 
1 74  ILE n 
1 75  VAL n 
1 76  ASN n 
1 77  ASN n 
1 78  ILE n 
1 79  PRO n 
1 80  PHE n 
1 81  LEU n 
1 82  ARG n 
1 83  SER n 
1 84  LEU n 
1 85  ILE n 
1 86  MET n 
1 87  LYS n 
1 88  TYR n 
1 89  VAL n 
1 90  LEU n 
1 91  THR n 
1 92  SER n 
1 93  ARG n 
1 94  SER n 
1 95  TYR n 
1 96  LEU n 
1 97  ILE n 
1 98  ASP n 
1 99  SER n 
1 100 PRO n 
1 101 PRO n 
1 102 THR n 
1 103 TYR n 
1 104 ASN n 
1 105 VAL n 
1 106 HIS n 
1 107 TYR n 
1 108 GLY n 
1 109 TYR n 
1 110 LYS n 
1 111 SER n 
1 112 TRP n 
1 113 GLU n 
1 114 ALA n 
1 115 PHE n 
1 116 SER n 
1 117 ASN n 
1 118 LEU n 
1 119 SER n 
1 120 TYR n 
1 121 TYR n 
1 122 THR n 
1 123 ARG n 
1 124 ALA n 
1 125 LEU n 
1 126 PRO n 
1 127 PRO n 
1 128 VAL n 
1 129 ALA n 
1 130 ASP n 
1 131 ASP n 
1 132 CYS n 
1 133 PRO n 
1 134 THR n 
1 135 PRO n 
1 136 MET n 
1 137 GLY n 
1 138 VAL n 
1 139 LYS n 
1 140 GLY n 
1 141 ASN n 
1 142 LYS n 
1 143 GLU n 
1 144 LEU n 
1 145 PRO n 
1 146 ASP n 
1 147 SER n 
1 148 LYS n 
1 149 GLU n 
1 150 VAL n 
1 151 LEU n 
1 152 GLU n 
1 153 LYS n 
1 154 VAL n 
1 155 LEU n 
1 156 LEU n 
1 157 ARG n 
1 158 ARG n 
1 159 GLU n 
1 160 PHE n 
1 161 ILE n 
1 162 PRO n 
1 163 ASP n 
1 164 PRO n 
1 165 GLN n 
1 166 GLY n 
1 167 SER n 
1 168 ASN n 
1 169 MET n 
1 170 MET n 
1 171 PHE n 
1 172 ALA n 
1 173 PHE n 
1 174 PHE n 
1 175 ALA n 
1 176 GLN n 
1 177 HIS n 
1 178 PHE n 
1 179 THR n 
1 180 HIS n 
1 181 GLN n 
1 182 PHE n 
1 183 PHE n 
1 184 LYS n 
1 185 THR n 
1 186 ASP n 
1 187 HIS n 
1 188 LYS n 
1 189 ARG n 
1 190 GLY n 
1 191 PRO n 
1 192 GLY n 
1 193 PHE n 
1 194 THR n 
1 195 ARG n 
1 196 GLY n 
1 197 LEU n 
1 198 GLY n 
1 199 HIS n 
1 200 GLY n 
1 201 VAL n 
1 202 ASP n 
1 203 LEU n 
1 204 ASN n 
1 205 HIS n 
1 206 ILE n 
1 207 TYR n 
1 208 GLY n 
1 209 GLU n 
1 210 THR n 
1 211 LEU n 
1 212 ASP n 
1 213 ARG n 
1 214 GLN n 
1 215 HIS n 
1 216 LYS n 
1 217 LEU n 
1 218 ARG n 
1 219 LEU n 
1 220 PHE n 
1 221 LYS n 
1 222 ASP n 
1 223 GLY n 
1 224 LYS n 
1 225 LEU n 
1 226 LYS n 
1 227 TYR n 
1 228 GLN n 
1 229 VAL n 
1 230 ILE n 
1 231 GLY n 
1 232 GLY n 
1 233 GLU n 
1 234 VAL n 
1 235 TYR n 
1 236 PRO n 
1 237 PRO n 
1 238 THR n 
1 239 VAL n 
1 240 LYS n 
1 241 ASP n 
1 242 THR n 
1 243 GLN n 
1 244 VAL n 
1 245 GLU n 
1 246 MET n 
1 247 ILE n 
1 248 TYR n 
1 249 PRO n 
1 250 PRO n 
1 251 HIS n 
1 252 ILE n 
1 253 PRO n 
1 254 GLU n 
1 255 ASN n 
1 256 LEU n 
1 257 GLN n 
1 258 PHE n 
1 259 ALA n 
1 260 VAL n 
1 261 GLY n 
1 262 GLN n 
1 263 GLU n 
1 264 VAL n 
1 265 PHE n 
1 266 GLY n 
1 267 LEU n 
1 268 VAL n 
1 269 PRO n 
1 270 GLY n 
1 271 LEU n 
1 272 MET n 
1 273 MET n 
1 274 TYR n 
1 275 ALA n 
1 276 THR n 
1 277 ILE n 
1 278 TRP n 
1 279 LEU n 
1 280 ARG n 
1 281 GLU n 
1 282 HIS n 
1 283 ASN n 
1 284 ARG n 
1 285 VAL n 
1 286 CYS n 
1 287 ASP n 
1 288 ILE n 
1 289 LEU n 
1 290 LYS n 
1 291 GLN n 
1 292 GLU n 
1 293 HIS n 
1 294 PRO n 
1 295 GLU n 
1 296 TRP n 
1 297 GLY n 
1 298 ASP n 
1 299 GLU n 
1 300 GLN n 
1 301 LEU n 
1 302 PHE n 
1 303 GLN n 
1 304 THR n 
1 305 SER n 
1 306 ARG n 
1 307 LEU n 
1 308 ILE n 
1 309 LEU n 
1 310 ILE n 
1 311 GLY n 
1 312 GLU n 
1 313 THR n 
1 314 ILE n 
1 315 LYS n 
1 316 ILE n 
1 317 VAL n 
1 318 ILE n 
1 319 GLU n 
1 320 ASP n 
1 321 TYR n 
1 322 VAL n 
1 323 GLN n 
1 324 HIS n 
1 325 LEU n 
1 326 SER n 
1 327 GLY n 
1 328 TYR n 
1 329 HIS n 
1 330 PHE n 
1 331 LYS n 
1 332 LEU n 
1 333 LYS n 
1 334 PHE n 
1 335 ASP n 
1 336 PRO n 
1 337 GLU n 
1 338 LEU n 
1 339 LEU n 
1 340 PHE n 
1 341 ASN n 
1 342 GLN n 
1 343 GLN n 
1 344 PHE n 
1 345 GLN n 
1 346 TYR n 
1 347 GLN n 
1 348 ASN n 
1 349 ARG n 
1 350 ILE n 
1 351 ALA n 
1 352 SER n 
1 353 GLU n 
1 354 PHE n 
1 355 ASN n 
1 356 THR n 
1 357 LEU n 
1 358 TYR n 
1 359 HIS n 
1 360 TRP n 
1 361 HIS n 
1 362 PRO n 
1 363 LEU n 
1 364 LEU n 
1 365 PRO n 
1 366 ASP n 
1 367 THR n 
1 368 PHE n 
1 369 ASN n 
1 370 ILE n 
1 371 GLU n 
1 372 ASP n 
1 373 GLN n 
1 374 GLU n 
1 375 TYR n 
1 376 SER n 
1 377 PHE n 
1 378 LYS n 
1 379 GLN n 
1 380 PHE n 
1 381 LEU n 
1 382 TYR n 
1 383 ASN n 
1 384 ASN n 
1 385 SER n 
1 386 ILE n 
1 387 LEU n 
1 388 LEU n 
1 389 GLU n 
1 390 HIS n 
1 391 GLY n 
1 392 LEU n 
1 393 THR n 
1 394 GLN n 
1 395 PHE n 
1 396 VAL n 
1 397 GLU n 
1 398 SER n 
1 399 PHE n 
1 400 THR n 
1 401 ARG n 
1 402 GLN n 
1 403 ILE n 
1 404 ALA n 
1 405 GLY n 
1 406 ARG n 
1 407 VAL n 
1 408 ALA n 
1 409 GLY n 
1 410 GLY n 
1 411 ARG n 
1 412 ASN n 
1 413 VAL n 
1 414 PRO n 
1 415 ILE n 
1 416 ALA n 
1 417 VAL n 
1 418 GLN n 
1 419 ALA n 
1 420 VAL n 
1 421 ALA n 
1 422 LYS n 
1 423 ALA n 
1 424 SER n 
1 425 ILE n 
1 426 ASP n 
1 427 GLN n 
1 428 SER n 
1 429 ARG n 
1 430 GLU n 
1 431 MET n 
1 432 LYS n 
1 433 TYR n 
1 434 GLN n 
1 435 SER n 
1 436 LEU n 
1 437 ASN n 
1 438 GLU n 
1 439 TYR n 
1 440 ARG n 
1 441 LYS n 
1 442 ARG n 
1 443 PHE n 
1 444 SER n 
1 445 LEU n 
1 446 LYS n 
1 447 PRO n 
1 448 TYR n 
1 449 THR n 
1 450 SER n 
1 451 PHE n 
1 452 GLU n 
1 453 GLU n 
1 454 LEU n 
1 455 THR n 
1 456 GLY n 
1 457 GLU n 
1 458 LYS n 
1 459 GLU n 
1 460 MET n 
1 461 ALA n 
1 462 ALA n 
1 463 GLU n 
1 464 LEU n 
1 465 LYS n 
1 466 ALA n 
1 467 LEU n 
1 468 TYR n 
1 469 SER n 
1 470 ASP n 
1 471 ILE n 
1 472 ASP n 
1 473 VAL n 
1 474 MET n 
1 475 GLU n 
1 476 LEU n 
1 477 TYR n 
1 478 PRO n 
1 479 ALA n 
1 480 LEU n 
1 481 LEU n 
1 482 VAL n 
1 483 GLU n 
1 484 LYS n 
1 485 PRO n 
1 486 ARG n 
1 487 PRO n 
1 488 ASP n 
1 489 ALA n 
1 490 ILE n 
1 491 PHE n 
1 492 GLY n 
1 493 GLU n 
1 494 THR n 
1 495 MET n 
1 496 VAL n 
1 497 GLU n 
1 498 LEU n 
1 499 GLY n 
1 500 ALA n 
1 501 PRO n 
1 502 PHE n 
1 503 SER n 
1 504 LEU n 
1 505 LYS n 
1 506 GLY n 
1 507 LEU n 
1 508 MET n 
1 509 GLY n 
1 510 ASN n 
1 511 PRO n 
1 512 ILE n 
1 513 CYS n 
1 514 SER n 
1 515 PRO n 
1 516 GLN n 
1 517 TYR n 
1 518 TRP n 
1 519 LYS n 
1 520 PRO n 
1 521 SER n 
1 522 THR n 
1 523 PHE n 
1 524 GLY n 
1 525 GLY n 
1 526 GLU n 
1 527 VAL n 
1 528 GLY n 
1 529 PHE n 
1 530 LYS n 
1 531 ILE n 
1 532 ILE n 
1 533 ASN n 
1 534 THR n 
1 535 ALA n 
1 536 SER n 
1 537 ILE n 
1 538 GLN n 
1 539 SER n 
1 540 LEU n 
1 541 ILE n 
1 542 CYS n 
1 543 ASN n 
1 544 ASN n 
1 545 VAL n 
1 546 LYS n 
1 547 GLY n 
1 548 CYS n 
1 549 PRO n 
1 550 PHE n 
1 551 THR n 
1 552 SER n 
1 553 PHE n 
1 554 ASN n 
1 555 VAL n 
1 556 GLN n 
1 557 ASP n 
1 558 PRO n 
1 559 GLN n 
1 560 PRO n 
1 561 THR n 
1 562 LYS n 
1 563 THR n 
1 564 ALA n 
1 565 THR n 
1 566 ILE n 
1 567 ALA n 
1 568 ALA n 
1 569 SER n 
1 570 ALA n 
1 571 SER n 
1 572 HIS n 
1 573 SER n 
1 574 ARG n 
1 575 LEU n 
1 576 ASP n 
1 577 ASP n 
1 578 ILE n 
1 579 ASN n 
1 580 PRO n 
1 581 THR n 
1 582 VAL n 
1 583 LEU n 
1 584 ILE n 
1 585 LYS n 
1 586 ARG n 
1 587 ARG n 
1 588 SER n 
1 589 THR n 
1 590 GLU n 
1 591 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Ptgs2, Cox-2, Cox2, Pghs-b, Tis10' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SF21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFASTBac1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGH2_MOUSE 
_struct_ref.pdbx_db_accession          Q05769 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIM
KYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQG
SNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEM
IYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLS
GYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGR
VAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEKPR
PDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATI
NASASHSRLDDINPTVLIKRRSTEL
;
_struct_ref.pdbx_align_begin           20 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3HS5 A 7 ? 591 ? Q05769 20 ? 604 ? 35 618 
2 1 3HS5 B 7 ? 591 ? Q05769 20 ? 604 ? 35 618 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3HS5 HIS A 1   ? UNP Q05769 ?   ?   'expression tag'      29  1  
1 3HS5 HIS A 2   ? UNP Q05769 ?   ?   'expression tag'      30  2  
1 3HS5 HIS A 3   ? UNP Q05769 ?   ?   'expression tag'      31  3  
1 3HS5 HIS A 4   ? UNP Q05769 ?   ?   'expression tag'      32  4  
1 3HS5 HIS A 5   ? UNP Q05769 ?   ?   'expression tag'      33  5  
1 3HS5 HIS A 6   ? UNP Q05769 ?   ?   'expression tag'      34  6  
1 3HS5 ALA A 567 ? UNP Q05769 ASN 580 'engineered mutation' 594 7  
2 3HS5 HIS B 1   ? UNP Q05769 ?   ?   'expression tag'      29  8  
2 3HS5 HIS B 2   ? UNP Q05769 ?   ?   'expression tag'      30  9  
2 3HS5 HIS B 3   ? UNP Q05769 ?   ?   'expression tag'      31  10 
2 3HS5 HIS B 4   ? UNP Q05769 ?   ?   'expression tag'      32  11 
2 3HS5 HIS B 5   ? UNP Q05769 ?   ?   'expression tag'      33  12 
2 3HS5 HIS B 6   ? UNP Q05769 ?   ?   'expression tag'      34  13 
2 3HS5 ALA B 567 ? UNP Q05769 ASN 580 'engineered mutation' 594 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACD non-polymer                   . 'ARACHIDONIC ACID'                       ? 'C20 H32 O2'       304.467 
AKR non-polymer                   . 'ACRYLIC ACID'                           ? 'C3 H4 O2'         72.063  
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'       133.103 
BOG D-saccharide                  n 'octyl beta-D-glucopyranoside'           
'Beta-Octylglucoside; octyl beta-D-glucoside; octyl D-glucoside; octyl glucoside' 'C14 H28 O6'       292.369 
COH non-polymer                   . 'PROTOPORPHYRIN IX CONTAINING CO'        ? 'C34 H32 Co N4 O4' 619.575 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'     121.158 
EDO non-polymer                   . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL' 'C2 H6 O2'         62.068  
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'             18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1'   147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 
180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'      221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          3HS5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.43 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'23-34% Polyacrylic acid 5100, 100mM HEPES pH 7.5, 20mM MgCl2, VAPOR DIFFUSION, SITTING DROP, temperature 296K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2008-12-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9789 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9789 
# 
_reflns.entry_id                     3HS5 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   83526 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.9 
_reflns.B_iso_Wilson_estimate        28.50 
_reflns.pdbx_redundancy              5.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.21 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           0.582 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        4.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3HS5 
_refine.ls_number_reflns_obs                     83526 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.75 
_refine.ls_R_factor_obs                          0.17074 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16867 
_refine.ls_R_factor_R_free                       0.21005 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4175 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.50 
_refine.occupancy_max                            1.00 
_refine.correlation_coeff_Fo_to_Fc               .963 
_refine.correlation_coeff_Fo_to_Fc_free          .947 
_refine.B_iso_mean                               33.632 
_refine.aniso_B[1][1]                            .09 
_refine.aniso_B[2][2]                            .09 
_refine.aniso_B[3][3]                            -.18 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             .80 
_refine.pdbx_solvent_shrinkage_radii             .80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 1CVU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       .186 
_refine.pdbx_overall_ESU_R_Free                  .161 
_refine.overall_SU_ML                            .111 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.139 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3HS5 
_refine_analyze.Luzzati_coordinate_error_obs    0.284 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8875 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         379 
_refine_hist.number_atoms_solvent             907 
_refine_hist.number_atoms_total               10161 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             .008   .022   ? 9610  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.121  2.008  ? 13053 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.179  5.000  ? 1117  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.503 23.986 ? 444   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.465 15.000 ? 1510  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.777 15.000 ? 44    'X-RAY DIFFRACTION' ? 
r_chiral_restr               .081   .200   ? 1386  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         .005   .021   ? 7366  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  .318   1.500  ? 5546  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 .638   2.000  ? 9018  'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.248  3.000  ? 4064  'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.136  4.500  ? 4028  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.100 
_refine_ls_shell.d_res_low                        2.154 
_refine_ls_shell.number_reflns_R_work             5736 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               99.31 
_refine_ls_shell.R_factor_R_free                  0.293 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             314 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  3HS5 
_struct.title                     
'X-ray crystal structure of arachidonic acid bound to the cyclooxygenase channel of cyclooxygenase-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HS5 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;Oxidoreductase, Dioxygenase, Disulfide bond, Endoplasmic reticulum, Fatty acid biosynthesis, Glycoprotein, Heme, Iron, Lipid synthesis, Membrane, Metal-binding, Microsome, Peroxidase, Phosphoprotein, Prostaglandin biosynthesis
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 2  ? 
F  N N 2  ? 
G  N N 4  ? 
H  N N 5  ? 
I  N N 5  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 8  ? 
M  N N 9  ? 
N  N N 9  ? 
O  N N 9  ? 
P  N N 9  ? 
Q  N N 4  ? 
R  N N 6  ? 
S  N N 7  ? 
T  N N 8  ? 
U  N N 9  ? 
V  N N 9  ? 
W  N N 9  ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 9  ? 
AA N N 9  ? 
BA N N 9  ? 
CA N N 10 ? 
DA N N 10 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 45  ? LYS A 55  ? GLU A 73  LYS A 83  1 ? 11 
HELX_P HELX_P2  2  THR A 57  ? THR A 66  ? THR A 85  THR A 94  1 ? 10 
HELX_P HELX_P3  3  PHE A 68  ? ASN A 77  ? PHE A 96  ASN A 105 1 ? 10 
HELX_P HELX_P4  4  ILE A 78  A ARG A 93  ? ILE A 105 ARG A 120 1 ? 16 
HELX_P HELX_P5  5  SER A 94  ? ILE A 97  ? SER A 121 ILE A 124 5 ? 4  
HELX_P HELX_P6  6  SER A 111 ? ASN A 117 ? SER A 138 ASN A 144 1 ? 7  
HELX_P HELX_P7  7  ASP A 146 ? LEU A 155 ? ASP A 173 LEU A 182 1 ? 10 
HELX_P HELX_P8  8  ASN A 168 ? HIS A 180 ? ASN A 195 HIS A 207 1 ? 13 
HELX_P HELX_P9  9  LEU A 203 ? GLY A 208 ? LEU A 230 GLY A 235 1 ? 6  
HELX_P HELX_P10 10 THR A 210 ? ARG A 218 ? THR A 237 ARG A 245 1 ? 9  
HELX_P HELX_P11 11 THR A 238 ? GLN A 243 ? THR A 265 GLN A 270 1 ? 6  
HELX_P HELX_P12 12 PRO A 253 ? GLN A 257 ? PRO A 280 GLN A 284 5 ? 5  
HELX_P HELX_P13 13 VAL A 264 ? LEU A 267 ? VAL A 291 LEU A 294 5 ? 4  
HELX_P HELX_P14 14 VAL A 268 ? HIS A 293 ? VAL A 295 HIS A 320 1 ? 26 
HELX_P HELX_P15 15 GLY A 297 ? ASP A 320 ? GLY A 324 ASP A 347 1 ? 24 
HELX_P HELX_P16 16 ASP A 320 ? GLY A 327 ? ASP A 347 GLY A 354 1 ? 8  
HELX_P HELX_P17 17 ASP A 335 ? PHE A 340 ? ASP A 362 PHE A 367 5 ? 6  
HELX_P HELX_P18 18 ALA A 351 ? TYR A 358 ? ALA A 378 TYR A 385 1 ? 8  
HELX_P HELX_P19 19 TRP A 360 ? LEU A 364 ? TRP A 387 LEU A 391 5 ? 5  
HELX_P HELX_P20 20 SER A 376 ? LEU A 381 ? SER A 403 LEU A 408 1 ? 6  
HELX_P HELX_P21 21 ASN A 383 ? GLN A 402 ? ASN A 410 GLN A 429 1 ? 20 
HELX_P HELX_P22 22 PRO A 414 ? ALA A 416 ? PRO A 441 ALA A 443 5 ? 3  
HELX_P HELX_P23 23 VAL A 417 ? MET A 431 ? VAL A 444 MET A 458 1 ? 15 
HELX_P HELX_P24 24 SER A 435 ? PHE A 443 ? SER A 462 PHE A 470 1 ? 9  
HELX_P HELX_P25 25 SER A 450 ? GLY A 456 ? SER A 477 GLY A 483 1 ? 7  
HELX_P HELX_P26 26 LYS A 458 ? SER A 469 ? LYS A 485 SER A 496 1 ? 12 
HELX_P HELX_P27 27 ASP A 470 ? MET A 474 ? ASP A 497 MET A 501 5 ? 5  
HELX_P HELX_P28 28 GLU A 475 ? GLU A 483 ? GLU A 502 GLU A 510 1 ? 9  
HELX_P HELX_P29 29 GLY A 492 ? GLY A 509 ? GLY A 519 GLY A 536 1 ? 18 
HELX_P HELX_P30 30 ASN A 510 ? SER A 514 ? ASN A 537 SER A 541 5 ? 5  
HELX_P HELX_P31 31 LYS A 519 ? GLY A 524 ? LYS A 546 GLY A 551 5 ? 6  
HELX_P HELX_P32 32 GLY A 525 ? THR A 534 ? GLY A 552 THR A 561 1 ? 10 
HELX_P HELX_P33 33 SER A 536 ? VAL A 545 ? SER A 563 VAL A 572 1 ? 10 
HELX_P HELX_P34 34 GLU B 45  ? LYS B 55  ? GLU B 73  LYS B 83  1 ? 11 
HELX_P HELX_P35 35 THR B 57  ? HIS B 67  ? THR B 85  HIS B 95  1 ? 11 
HELX_P HELX_P36 36 PHE B 68  ? ASN B 76  ? PHE B 96  ASN B 104 1 ? 9  
HELX_P HELX_P37 37 ILE B 78  A ARG B 93  ? ILE B 105 ARG B 120 1 ? 16 
HELX_P HELX_P38 38 SER B 111 ? ASN B 117 ? SER B 138 ASN B 144 1 ? 7  
HELX_P HELX_P39 39 ASP B 146 ? LEU B 155 ? ASP B 173 LEU B 182 1 ? 10 
HELX_P HELX_P40 40 ASN B 168 ? HIS B 180 ? ASN B 195 HIS B 207 1 ? 13 
HELX_P HELX_P41 41 LEU B 203 ? GLY B 208 ? LEU B 230 GLY B 235 1 ? 6  
HELX_P HELX_P42 42 THR B 210 ? ARG B 218 ? THR B 237 ARG B 245 1 ? 9  
HELX_P HELX_P43 43 THR B 238 ? GLN B 243 ? THR B 265 GLN B 270 1 ? 6  
HELX_P HELX_P44 44 PRO B 253 ? GLN B 257 ? PRO B 280 GLN B 284 5 ? 5  
HELX_P HELX_P45 45 VAL B 264 ? LEU B 267 ? VAL B 291 LEU B 294 5 ? 4  
HELX_P HELX_P46 46 VAL B 268 ? HIS B 293 ? VAL B 295 HIS B 320 1 ? 26 
HELX_P HELX_P47 47 GLY B 297 ? ASP B 320 ? GLY B 324 ASP B 347 1 ? 24 
HELX_P HELX_P48 48 ASP B 320 ? GLY B 327 ? ASP B 347 GLY B 354 1 ? 8  
HELX_P HELX_P49 49 ASP B 335 ? PHE B 340 ? ASP B 362 PHE B 367 5 ? 6  
HELX_P HELX_P50 50 ALA B 351 ? TYR B 358 ? ALA B 378 TYR B 385 1 ? 8  
HELX_P HELX_P51 51 HIS B 359 ? LEU B 364 ? HIS B 386 LEU B 391 5 ? 6  
HELX_P HELX_P52 52 SER B 376 ? LEU B 381 ? SER B 403 LEU B 408 1 ? 6  
HELX_P HELX_P53 53 ASN B 384 ? GLY B 391 ? ASN B 411 GLY B 418 1 ? 8  
HELX_P HELX_P54 54 GLY B 391 ? GLN B 402 ? GLY B 418 GLN B 429 1 ? 12 
HELX_P HELX_P55 55 PRO B 414 ? ALA B 416 ? PRO B 441 ALA B 443 5 ? 3  
HELX_P HELX_P56 56 VAL B 417 ? MET B 431 ? VAL B 444 MET B 458 1 ? 15 
HELX_P HELX_P57 57 SER B 435 ? PHE B 443 ? SER B 462 PHE B 470 1 ? 9  
HELX_P HELX_P58 58 SER B 450 ? GLY B 456 ? SER B 477 GLY B 483 1 ? 7  
HELX_P HELX_P59 59 LYS B 458 ? SER B 469 ? LYS B 485 SER B 496 1 ? 12 
HELX_P HELX_P60 60 ASP B 470 ? MET B 474 ? ASP B 497 MET B 501 5 ? 5  
HELX_P HELX_P61 61 GLU B 475 ? GLU B 483 ? GLU B 502 GLU B 510 1 ? 9  
HELX_P HELX_P62 62 GLY B 492 ? GLY B 509 ? GLY B 519 GLY B 536 1 ? 18 
HELX_P HELX_P63 63 ASN B 510 ? SER B 514 ? ASN B 537 SER B 541 5 ? 5  
HELX_P HELX_P64 64 LYS B 519 ? GLY B 524 ? LYS B 546 GLY B 551 5 ? 6  
HELX_P HELX_P65 65 GLY B 525 ? THR B 534 ? GLY B 552 THR B 561 1 ? 10 
HELX_P HELX_P66 66 SER B 536 ? VAL B 545 ? SER B 563 VAL B 572 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 8   SG  ? ? ? 1_555 A CYS 19  SG ? ? A CYS 36  A CYS 47  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf2  disulf ?    ? A CYS 9   SG  ? ? ? 1_555 A CYS 132 SG ? ? A CYS 37  A CYS 159 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf3  disulf ?    ? A CYS 13  SG  ? ? ? 1_555 A CYS 29  SG ? ? A CYS 41  A CYS 57  1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf4  disulf ?    ? A CYS 31  SG  ? ? ? 1_555 A CYS 41  SG ? ? A CYS 59  A CYS 69  1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf5  disulf ?    ? A CYS 542 SG  ? ? ? 1_555 A CYS 548 SG ? ? A CYS 569 A CYS 575 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf6  disulf ?    ? B CYS 8   SG  ? ? ? 1_555 B CYS 19  SG ? ? B CYS 36  B CYS 47  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf7  disulf ?    ? B CYS 9   SG  ? ? ? 1_555 B CYS 132 SG ? ? B CYS 37  B CYS 159 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf8  disulf ?    ? B CYS 13  SG  ? ? ? 1_555 B CYS 29  SG ? ? B CYS 41  B CYS 57  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf9  disulf ?    ? B CYS 31  SG  ? ? ? 1_555 B CYS 41  SG ? ? B CYS 59  B CYS 69  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf10 disulf ?    ? B CYS 542 SG  ? ? ? 1_555 B CYS 548 SG ? ? B CYS 569 B CYS 575 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
covale1  covale one  ? A ASN 40  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 68  C NAG 1   1_555 ? ? ? ? ? ? ? 1.415 ? N-Glycosylation 
covale2  covale one  ? A ASN 117 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 144 D NAG 1   1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale3  covale one  ? A ASN 383 ND2 ? ? ? 1_555 K NAG .   C1 ? ? A ASN 410 A NAG 681 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale4  covale one  ? B ASN 40  ND2 ? ? ? 1_555 E NAG .   C1 ? ? B ASN 68  E NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale5  covale one  ? B ASN 117 ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 144 F NAG 1   1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale6  covale one  ? B ASN 383 ND2 ? ? ? 1_555 S NAG .   C1 ? ? B ASN 410 B NAG 681 1_555 ? ? ? ? ? ? ? 1.437 ? N-Glycosylation 
covale7  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale8  covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale9  covale both ? D NAG .   O4  ? ? ? 1_555 D MAN .   C1 ? ? D NAG 2   D MAN 3   1_555 ? ? ? ? ? ? ? 1.453 ? ?               
covale10 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.432 ? ?               
covale11 covale both ? F NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
metalc1  metalc ?    ? A HIS 361 NE2 A ? ? 1_555 J COH .   CO ? ? A HIS 388 A COH 619 1_555 ? ? ? ? ? ? ? 2.711 ? ?               
metalc2  metalc ?    ? B HIS 361 NE2 A ? ? 1_555 R COH .   CO ? ? B HIS 388 B COH 619 1_555 ? ? ? ? ? ? ? 2.276 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 99 A . ? SER 126 A PRO 100 A ? PRO 127 A 1 -0.38 
2 SER 99 B . ? SER 126 B PRO 100 B ? PRO 127 B 1 1.67  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 18  ? SER A 21  ? GLU A 46  SER A 49  
A 2 TYR A 27  ? ASP A 30  ? TYR A 55  ASP A 58  
B 1 PHE A 36  ? TYR A 37  ? PHE A 64  TYR A 65  
B 2 THR A 43  ? PRO A 44  ? THR A 71  PRO A 72  
C 1 GLN A 228 ? ILE A 230 ? GLN A 255 ILE A 257 
C 2 GLU A 233 ? TYR A 235 ? GLU A 260 TYR A 262 
D 1 PHE A 368 ? ILE A 370 ? PHE A 395 ILE A 397 
D 2 GLN A 373 ? TYR A 375 ? GLN A 400 TYR A 402 
E 1 GLU B 18  ? SER B 21  ? GLU B 46  SER B 49  
E 2 TYR B 27  ? ASP B 30  ? TYR B 55  ASP B 58  
F 1 PHE B 36  ? TYR B 37  ? PHE B 64  TYR B 65  
F 2 THR B 43  ? PRO B 44  ? THR B 71  PRO B 72  
G 1 TYR B 103 ? ASN B 104 ? TYR B 130 ASN B 131 
G 2 THR B 122 ? ARG B 123 ? THR B 149 ARG B 150 
H 1 GLN B 228 ? ILE B 230 ? GLN B 255 ILE B 257 
H 2 GLU B 233 ? TYR B 235 ? GLU B 260 TYR B 262 
I 1 PHE B 368 ? ILE B 370 ? PHE B 395 ILE B 397 
I 2 GLN B 373 ? TYR B 375 ? GLN B 400 TYR B 402 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 20  ? N MET A 48  O LYS A 28  ? O LYS A 56  
B 1 2 N TYR A 37  ? N TYR A 65  O THR A 43  ? O THR A 71  
C 1 2 N GLN A 228 ? N GLN A 255 O TYR A 235 ? O TYR A 262 
D 1 2 N PHE A 368 ? N PHE A 395 O TYR A 375 ? O TYR A 402 
E 1 2 N GLU B 18  ? N GLU B 46  O ASP B 30  ? O ASP B 58  
F 1 2 N TYR B 37  ? N TYR B 65  O THR B 43  ? O THR B 71  
G 1 2 N TYR B 103 ? N TYR B 130 O ARG B 123 ? O ARG B 150 
H 1 2 N GLN B 228 ? N GLN B 255 O TYR B 235 ? O TYR B 262 
I 1 2 N PHE B 368 ? N PHE B 395 O TYR B 375 ? O TYR B 402 
# 
_atom_sites.entry_id                    3HS5 
_atom_sites.fract_transf_matrix[1][1]   0.008335 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007544 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005540 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CO 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A  1  5   ? 6.328   52.324 65.437 1.00 42.71 ? 33   HIS A N     1 
ATOM   2     C  CA    . HIS A  1  5   ? 7.130   51.070 65.336 1.00 41.46 ? 33   HIS A CA    1 
ATOM   3     C  C     . HIS A  1  5   ? 6.526   50.044 64.372 1.00 39.92 ? 33   HIS A C     1 
ATOM   4     O  O     . HIS A  1  5   ? 5.344   50.110 64.041 1.00 39.98 ? 33   HIS A O     1 
ATOM   5     C  CB    . HIS A  1  5   ? 7.359   50.452 66.726 1.00 41.78 ? 33   HIS A CB    1 
ATOM   6     C  CG    . HIS A  1  5   ? 6.133   49.861 67.355 1.00 42.23 ? 33   HIS A CG    1 
ATOM   7     N  ND1   . HIS A  1  5   ? 5.538   48.705 66.893 1.00 42.31 ? 33   HIS A ND1   1 
ATOM   8     C  CD2   . HIS A  1  5   ? 5.417   50.241 68.440 1.00 43.79 ? 33   HIS A CD2   1 
ATOM   9     C  CE1   . HIS A  1  5   ? 4.493   48.414 67.648 1.00 41.63 ? 33   HIS A CE1   1 
ATOM   10    N  NE2   . HIS A  1  5   ? 4.399   49.329 68.595 1.00 43.40 ? 33   HIS A NE2   1 
ATOM   11    N  N     . HIS A  1  6   ? 7.350   49.100 63.923 1.00 38.79 ? 34   HIS A N     1 
ATOM   12    C  CA    . HIS A  1  6   ? 6.905   48.040 63.022 1.00 37.58 ? 34   HIS A CA    1 
ATOM   13    C  C     . HIS A  1  6   ? 5.690   47.299 63.596 1.00 37.11 ? 34   HIS A C     1 
ATOM   14    O  O     . HIS A  1  6   ? 5.713   46.889 64.753 1.00 37.25 ? 34   HIS A O     1 
ATOM   15    C  CB    . HIS A  1  6   ? 8.042   47.058 62.750 1.00 36.88 ? 34   HIS A CB    1 
ATOM   16    C  CG    . HIS A  1  6   ? 7.882   46.297 61.474 1.00 36.35 ? 34   HIS A CG    1 
ATOM   17    N  ND1   . HIS A  1  6   ? 6.988   45.258 61.333 1.00 34.47 ? 34   HIS A ND1   1 
ATOM   18    C  CD2   . HIS A  1  6   ? 8.507   46.422 60.277 1.00 37.59 ? 34   HIS A CD2   1 
ATOM   19    C  CE1   . HIS A  1  6   ? 7.062   44.781 60.102 1.00 35.41 ? 34   HIS A CE1   1 
ATOM   20    N  NE2   . HIS A  1  6   ? 7.979   45.467 59.442 1.00 36.50 ? 34   HIS A NE2   1 
ATOM   21    N  N     . PRO A  1  7   ? 4.615   47.153 62.796 1.00 36.92 ? 35   PRO A N     1 
ATOM   22    C  CA    . PRO A  1  7   ? 3.372   46.535 63.291 1.00 37.01 ? 35   PRO A CA    1 
ATOM   23    C  C     . PRO A  1  7   ? 3.483   45.027 63.499 1.00 36.09 ? 35   PRO A C     1 
ATOM   24    O  O     . PRO A  1  7   ? 2.585   44.416 64.072 1.00 36.14 ? 35   PRO A O     1 
ATOM   25    C  CB    . PRO A  1  7   ? 2.346   46.849 62.195 1.00 37.54 ? 35   PRO A CB    1 
ATOM   26    C  CG    . PRO A  1  7   ? 3.128   47.200 60.999 1.00 37.07 ? 35   PRO A CG    1 
ATOM   27    C  CD    . PRO A  1  7   ? 4.467   47.694 61.432 1.00 37.14 ? 35   PRO A CD    1 
ATOM   28    N  N     . CYS A  1  8   ? 4.582   44.434 63.046 1.00 35.19 ? 36   CYS A N     1 
ATOM   29    C  CA    . CYS A  1  8   ? 4.801   43.015 63.269 1.00 34.93 ? 36   CYS A CA    1 
ATOM   30    C  C     . CYS A  1  8   ? 5.556   42.759 64.574 1.00 35.13 ? 36   CYS A C     1 
ATOM   31    O  O     . CYS A  1  8   ? 5.789   41.607 64.932 1.00 34.67 ? 36   CYS A O     1 
ATOM   32    C  CB    . CYS A  1  8   ? 5.513   42.372 62.071 1.00 34.22 ? 36   CYS A CB    1 
ATOM   33    S  SG    . CYS A  1  8   ? 4.508   42.329 60.559 1.00 35.99 ? 36   CYS A SG    1 
ATOM   34    N  N     . CYS A  1  9   ? 5.911   43.831 65.290 1.00 35.88 ? 37   CYS A N     1 
ATOM   35    C  CA    . CYS A  1  9   ? 6.714   43.722 66.522 1.00 36.86 ? 37   CYS A CA    1 
ATOM   36    C  C     . CYS A  1  9   ? 6.207   42.681 67.525 1.00 37.12 ? 37   CYS A C     1 
ATOM   37    O  O     . CYS A  1  9   ? 7.010   41.966 68.131 1.00 37.58 ? 37   CYS A O     1 
ATOM   38    C  CB    . CYS A  1  9   ? 6.880   45.084 67.208 1.00 37.99 ? 37   CYS A CB    1 
ATOM   39    S  SG    . CYS A  1  9   ? 8.121   46.164 66.432 1.00 39.66 ? 37   CYS A SG    1 
ATOM   40    N  N     . SER A  1  10  ? 4.888   42.577 67.674 1.00 37.01 ? 38   SER A N     1 
ATOM   41    C  CA    . SER A  1  10  ? 4.290   41.621 68.608 1.00 37.70 ? 38   SER A CA    1 
ATOM   42    C  C     . SER A  1  10  ? 4.361   40.160 68.143 1.00 36.65 ? 38   SER A C     1 
ATOM   43    O  O     . SER A  1  10  ? 3.942   39.261 68.877 1.00 37.39 ? 38   SER A O     1 
ATOM   44    C  CB    . SER A  1  10  ? 2.836   41.991 68.888 1.00 38.52 ? 38   SER A CB    1 
ATOM   45    O  OG    . SER A  1  10  ? 2.032   41.706 67.758 1.00 38.83 ? 38   SER A OG    1 
ATOM   46    N  N     . ASN A  1  11  ? 4.899   39.928 66.945 1.00 35.01 ? 39   ASN A N     1 
ATOM   47    C  CA    . ASN A  1  11  ? 4.893   38.601 66.316 1.00 34.23 ? 39   ASN A CA    1 
ATOM   48    C  C     . ASN A  1  11  ? 3.476   38.003 66.236 1.00 34.26 ? 39   ASN A C     1 
ATOM   49    O  O     . ASN A  1  11  ? 3.224   36.914 66.758 1.00 34.95 ? 39   ASN A O     1 
ATOM   50    C  CB    . ASN A  1  11  ? 5.865   37.651 67.038 1.00 34.81 ? 39   ASN A CB    1 
ATOM   51    C  CG    . ASN A  1  11  ? 7.268   38.237 67.162 1.00 35.10 ? 39   ASN A CG    1 
ATOM   52    O  OD1   . ASN A  1  11  ? 7.863   38.666 66.175 1.00 33.56 ? 39   ASN A OD1   1 
ATOM   53    N  ND2   . ASN A  1  11  ? 7.789   38.271 68.382 1.00 35.73 ? 39   ASN A ND2   1 
ATOM   54    N  N     . PRO A  1  12  ? 2.545   38.718 65.576 1.00 33.96 ? 40   PRO A N     1 
ATOM   55    C  CA    . PRO A  1  12  ? 1.137   38.307 65.606 1.00 34.63 ? 40   PRO A CA    1 
ATOM   56    C  C     . PRO A  1  12  ? 0.821   37.011 64.841 1.00 34.10 ? 40   PRO A C     1 
ATOM   57    O  O     . PRO A  1  12  ? -0.123  36.312 65.206 1.00 34.68 ? 40   PRO A O     1 
ATOM   58    C  CB    . PRO A  1  12  ? 0.417   39.493 64.962 1.00 34.67 ? 40   PRO A CB    1 
ATOM   59    C  CG    . PRO A  1  12  ? 1.432   40.083 64.039 1.00 33.82 ? 40   PRO A CG    1 
ATOM   60    C  CD    . PRO A  1  12  ? 2.755   39.909 64.728 1.00 33.14 ? 40   PRO A CD    1 
ATOM   61    N  N     . CYS A  1  13  ? 1.604   36.696 63.806 1.00 32.96 ? 41   CYS A N     1 
ATOM   62    C  CA    . CYS A  1  13  ? 1.326   35.546 62.942 1.00 32.75 ? 41   CYS A CA    1 
ATOM   63    C  C     . CYS A  1  13  ? 1.840   34.244 63.534 1.00 33.04 ? 41   CYS A C     1 
ATOM   64    O  O     . CYS A  1  13  ? 3.021   34.117 63.843 1.00 33.23 ? 41   CYS A O     1 
ATOM   65    C  CB    . CYS A  1  13  ? 1.930   35.748 61.551 1.00 32.11 ? 41   CYS A CB    1 
ATOM   66    S  SG    . CYS A  1  13  ? 1.553   37.344 60.791 1.00 32.14 ? 41   CYS A SG    1 
ATOM   67    N  N     . GLN A  1  14  ? 0.947   33.272 63.662 1.00 33.73 ? 42   GLN A N     1 
ATOM   68    C  CA    . GLN A  1  14  ? 1.258   31.997 64.305 1.00 34.27 ? 42   GLN A CA    1 
ATOM   69    C  C     . GLN A  1  14  ? 1.455   30.899 63.270 1.00 33.37 ? 42   GLN A C     1 
ATOM   70    O  O     . GLN A  1  14  ? 1.217   31.111 62.085 1.00 32.65 ? 42   GLN A O     1 
ATOM   71    C  CB    . GLN A  1  14  ? 0.120   31.605 65.266 1.00 35.93 ? 42   GLN A CB    1 
ATOM   72    C  CG    . GLN A  1  14  ? -0.266  32.681 66.287 1.00 37.30 ? 42   GLN A CG    1 
ATOM   73    C  CD    . GLN A  1  14  ? 0.901   33.108 67.161 1.00 39.06 ? 42   GLN A CD    1 
ATOM   74    O  OE1   . GLN A  1  14  ? 1.540   32.279 67.815 1.00 40.46 ? 42   GLN A OE1   1 
ATOM   75    N  NE2   . GLN A  1  14  ? 1.194   34.406 67.164 1.00 37.71 ? 42   GLN A NE2   1 
ATOM   76    N  N     . ASN A  1  15  ? 1.899   29.732 63.734 1.00 33.96 ? 43   ASN A N     1 
ATOM   77    C  CA    . ASN A  1  15  ? 1.952   28.497 62.933 1.00 33.78 ? 43   ASN A CA    1 
ATOM   78    C  C     . ASN A  1  15  ? 2.724   28.618 61.609 1.00 32.99 ? 43   ASN A C     1 
ATOM   79    O  O     . ASN A  1  15  ? 2.332   28.025 60.595 1.00 32.81 ? 43   ASN A O     1 
ATOM   80    C  CB    . ASN A  1  15  ? 0.536   27.945 62.701 1.00 33.93 ? 43   ASN A CB    1 
ATOM   81    C  CG    . ASN A  1  15  ? -0.190  27.623 63.997 1.00 35.13 ? 43   ASN A CG    1 
ATOM   82    O  OD1   . ASN A  1  15  ? 0.293   26.844 64.813 1.00 36.70 ? 43   ASN A OD1   1 
ATOM   83    N  ND2   . ASN A  1  15  ? -1.363  28.213 64.187 1.00 34.34 ? 43   ASN A ND2   1 
ATOM   84    N  N     . ARG A  1  16  ? 3.819   29.384 61.652 1.00 32.52 ? 44   ARG A N     1 
ATOM   85    C  CA    . ARG A  1  16  ? 4.713   29.668 60.504 1.00 32.68 ? 44   ARG A CA    1 
ATOM   86    C  C     . ARG A  1  16  ? 4.100   30.602 59.446 1.00 31.96 ? 44   ARG A C     1 
ATOM   87    O  O     . ARG A  1  16  ? 4.635   30.726 58.351 1.00 32.14 ? 44   ARG A O     1 
ATOM   88    C  CB    . ARG A  1  16  ? 5.262   28.392 59.835 1.00 33.19 ? 44   ARG A CB    1 
ATOM   89    C  CG    . ARG A  1  16  ? 5.772   27.286 60.771 1.00 35.25 ? 44   ARG A CG    1 
ATOM   90    C  CD    . ARG A  1  16  ? 7.249   27.393 61.114 1.00 36.76 ? 44   ARG A CD    1 
ATOM   91    N  NE    . ARG A  1  16  ? 8.016   28.204 60.171 1.00 37.94 ? 44   ARG A NE    1 
ATOM   92    C  CZ    . ARG A  1  16  ? 8.745   27.732 59.163 1.00 39.18 ? 44   ARG A CZ    1 
ATOM   93    N  NH1   . ARG A  1  16  ? 8.818   26.425 58.925 1.00 39.45 ? 44   ARG A NH1   1 
ATOM   94    N  NH2   . ARG A  1  16  ? 9.401   28.582 58.384 1.00 38.50 ? 44   ARG A NH2   1 
ATOM   95    N  N     . GLY A  1  17  ? 2.988   31.260 59.770 1.00 32.22 ? 45   GLY A N     1 
ATOM   96    C  CA    . GLY A  1  17  ? 2.480   32.335 58.919 1.00 31.63 ? 45   GLY A CA    1 
ATOM   97    C  C     . GLY A  1  17  ? 3.501   33.458 58.904 1.00 31.25 ? 45   GLY A C     1 
ATOM   98    O  O     . GLY A  1  17  ? 4.250   33.620 59.857 1.00 30.78 ? 45   GLY A O     1 
ATOM   99    N  N     . GLU A  1  18  ? 3.546   34.236 57.826 1.00 31.62 ? 46   GLU A N     1 
ATOM   100   C  CA    . GLU A  1  18  ? 4.584   35.273 57.700 1.00 32.40 ? 46   GLU A CA    1 
ATOM   101   C  C     . GLU A  1  18  ? 3.999   36.673 57.806 1.00 32.27 ? 46   GLU A C     1 
ATOM   102   O  O     . GLU A  1  18  ? 2.984   36.973 57.177 1.00 32.86 ? 46   GLU A O     1 
ATOM   103   C  CB    . GLU A  1  18  ? 5.368   35.095 56.400 1.00 32.65 ? 46   GLU A CB    1 
ATOM   104   C  CG    . GLU A  1  18  ? 5.937   33.683 56.257 1.00 36.37 ? 46   GLU A CG    1 
ATOM   105   C  CD    . GLU A  1  18  ? 6.773   33.512 55.019 1.00 40.92 ? 46   GLU A CD    1 
ATOM   106   O  OE1   . GLU A  1  18  ? 6.972   34.521 54.306 1.00 43.56 ? 46   GLU A OE1   1 
ATOM   107   O  OE2   . GLU A  1  18  ? 7.238   32.375 54.756 1.00 43.34 ? 46   GLU A OE2   1 
ATOM   108   N  N     . CYS A  1  19  ? 4.628   37.520 58.617 1.00 31.98 ? 47   CYS A N     1 
ATOM   109   C  CA    . CYS A  1  19  ? 4.092   38.855 58.868 1.00 32.26 ? 47   CYS A CA    1 
ATOM   110   C  C     . CYS A  1  19  ? 4.675   39.875 57.906 1.00 32.23 ? 47   CYS A C     1 
ATOM   111   O  O     . CYS A  1  19  ? 5.867   39.855 57.594 1.00 32.71 ? 47   CYS A O     1 
ATOM   112   C  CB    . CYS A  1  19  ? 4.291   39.293 60.328 1.00 32.57 ? 47   CYS A CB    1 
ATOM   113   S  SG    . CYS A  1  19  ? 3.251   40.733 60.836 1.00 34.23 ? 47   CYS A SG    1 
ATOM   114   N  N     . MET A  1  20  ? 3.802   40.744 57.420 1.00 31.96 ? 48   MET A N     1 
ATOM   115   C  CA    . MET A  1  20  ? 4.163   41.798 56.492 1.00 32.08 ? 48   MET A CA    1 
ATOM   116   C  C     . MET A  1  20  ? 3.363   43.026 56.912 1.00 32.34 ? 48   MET A C     1 
ATOM   117   O  O     . MET A  1  20  ? 2.168   42.918 57.189 1.00 32.38 ? 48   MET A O     1 
ATOM   118   C  CB    . MET A  1  20  ? 3.785   41.380 55.064 1.00 32.27 ? 48   MET A CB    1 
ATOM   119   C  CG    . MET A  1  20  ? 3.977   42.468 54.019 1.00 34.18 ? 48   MET A CG    1 
ATOM   120   S  SD    . MET A  1  20  ? 3.388   42.051 52.362 1.00 35.63 ? 48   MET A SD    1 
ATOM   121   C  CE    . MET A  1  20  ? 1.646   42.416 52.536 1.00 35.13 ? 48   MET A CE    1 
ATOM   122   N  N     . SER A  1  21  ? 4.010   44.184 56.973 1.00 32.58 ? 49   SER A N     1 
ATOM   123   C  CA    . SER A  1  21  ? 3.280   45.430 57.231 1.00 33.64 ? 49   SER A CA    1 
ATOM   124   C  C     . SER A  1  21  ? 2.491   45.820 55.982 1.00 35.11 ? 49   SER A C     1 
ATOM   125   O  O     . SER A  1  21  ? 2.926   45.538 54.866 1.00 34.93 ? 49   SER A O     1 
ATOM   126   C  CB    . SER A  1  21  ? 4.236   46.555 57.632 1.00 33.93 ? 49   SER A CB    1 
ATOM   127   O  OG    . SER A  1  21  ? 5.163   46.835 56.601 1.00 33.75 ? 49   SER A OG    1 
ATOM   128   N  N     . THR A  1  22  ? 1.331   46.447 56.172 1.00 36.59 ? 50   THR A N     1 
ATOM   129   C  CA    . THR A  1  22  ? 0.488   46.888 55.053 1.00 39.00 ? 50   THR A CA    1 
ATOM   130   C  C     . THR A  1  22  ? 0.186   48.370 55.168 1.00 40.94 ? 50   THR A C     1 
ATOM   131   O  O     . THR A  1  22  ? -0.614  48.914 54.412 1.00 43.53 ? 50   THR A O     1 
ATOM   132   C  CB    . THR A  1  22  ? -0.840  46.119 54.994 1.00 39.58 ? 50   THR A CB    1 
ATOM   133   O  OG1   . THR A  1  22  ? -1.442  46.123 56.293 1.00 40.66 ? 50   THR A OG1   1 
ATOM   134   C  CG2   . THR A  1  22  ? -0.606  44.680 54.556 1.00 39.13 ? 50   THR A CG2   1 
ATOM   135   N  N     . GLY A  1  23  ? 0.833   49.008 56.133 1.00 40.56 ? 51   GLY A N     1 
ATOM   136   C  CA    . GLY A  1  23  ? 0.727   50.436 56.377 1.00 42.14 ? 51   GLY A CA    1 
ATOM   137   C  C     . GLY A  1  23  ? 1.572   50.695 57.601 1.00 41.05 ? 51   GLY A C     1 
ATOM   138   O  O     . GLY A  1  23  ? 2.249   49.789 58.087 1.00 39.41 ? 51   GLY A O     1 
ATOM   139   N  N     . PHE A  1  24  ? 1.536   51.920 58.108 1.00 42.52 ? 52   PHE A N     1 
ATOM   140   C  CA    . PHE A  1  24  ? 2.316   52.278 59.291 1.00 42.06 ? 52   PHE A CA    1 
ATOM   141   C  C     . PHE A  1  24  ? 1.866   51.554 60.563 1.00 41.67 ? 52   PHE A C     1 
ATOM   142   O  O     . PHE A  1  24  ? 2.684   51.259 61.433 1.00 40.61 ? 52   PHE A O     1 
ATOM   143   C  CB    . PHE A  1  24  ? 2.287   53.790 59.512 1.00 43.88 ? 52   PHE A CB    1 
ATOM   144   C  CG    . PHE A  1  24  ? 3.054   54.564 58.483 1.00 44.14 ? 52   PHE A CG    1 
ATOM   145   C  CD1   . PHE A  1  24  ? 4.443   54.678 58.573 1.00 43.05 ? 52   PHE A CD1   1 
ATOM   146   C  CD2   . PHE A  1  24  ? 2.396   55.170 57.419 1.00 44.82 ? 52   PHE A CD2   1 
ATOM   147   C  CE1   . PHE A  1  24  ? 5.165   55.393 57.619 1.00 43.32 ? 52   PHE A CE1   1 
ATOM   148   C  CE2   . PHE A  1  24  ? 3.105   55.890 56.458 1.00 46.43 ? 52   PHE A CE2   1 
ATOM   149   C  CZ    . PHE A  1  24  ? 4.493   56.003 56.558 1.00 45.56 ? 52   PHE A CZ    1 
ATOM   150   N  N     . ASP A  1  25  ? 0.574   51.255 60.661 1.00 42.95 ? 53   ASP A N     1 
ATOM   151   C  CA    . ASP A  1  25  ? 0.021   50.664 61.878 1.00 43.50 ? 53   ASP A CA    1 
ATOM   152   C  C     . ASP A  1  25  ? -0.749  49.365 61.639 1.00 42.83 ? 53   ASP A C     1 
ATOM   153   O  O     . ASP A  1  25  ? -1.501  48.920 62.508 1.00 43.52 ? 53   ASP A O     1 
ATOM   154   C  CB    . ASP A  1  25  ? -0.880  51.682 62.588 1.00 46.45 ? 53   ASP A CB    1 
ATOM   155   C  CG    . ASP A  1  25  ? -0.121  52.924 63.044 1.00 48.76 ? 53   ASP A CG    1 
ATOM   156   O  OD1   . ASP A  1  25  ? 0.880   52.787 63.786 1.00 49.61 ? 53   ASP A OD1   1 
ATOM   157   O  OD2   . ASP A  1  25  ? -0.534  54.040 62.665 1.00 52.24 ? 53   ASP A OD2   1 
ATOM   158   N  N     . GLN A  1  26  ? -0.552  48.753 60.472 1.00 41.70 ? 54   GLN A N     1 
ATOM   159   C  CA    . GLN A  1  26  ? -1.301  47.551 60.094 1.00 41.13 ? 54   GLN A CA    1 
ATOM   160   C  C     . GLN A  1  26  ? -0.397  46.432 59.572 1.00 38.66 ? 54   GLN A C     1 
ATOM   161   O  O     . GLN A  1  26  ? 0.657   46.690 58.990 1.00 37.45 ? 54   GLN A O     1 
ATOM   162   C  CB    . GLN A  1  26  ? -2.369  47.888 59.044 1.00 43.08 ? 54   GLN A CB    1 
ATOM   163   C  CG    . GLN A  1  26  ? -3.297  49.053 59.399 1.00 46.64 ? 54   GLN A CG    1 
ATOM   164   C  CD    . GLN A  1  26  ? -4.042  48.842 60.708 1.00 48.83 ? 54   GLN A CD    1 
ATOM   165   N  N     . TYR A  1  27  ? -0.822  45.190 59.782 1.00 37.66 ? 55   TYR A N     1 
ATOM   166   C  CA    . TYR A  1  27  ? -0.092  44.034 59.277 1.00 36.14 ? 55   TYR A CA    1 
ATOM   167   C  C     . TYR A  1  27  ? -1.034  43.069 58.574 1.00 36.67 ? 55   TYR A C     1 
ATOM   168   O  O     . TYR A  1  27  ? -2.256  43.117 58.756 1.00 37.79 ? 55   TYR A O     1 
ATOM   169   C  CB    . TYR A  1  27  ? 0.654   43.298 60.405 1.00 34.62 ? 55   TYR A CB    1 
ATOM   170   C  CG    . TYR A  1  27  ? -0.261  42.573 61.380 1.00 35.51 ? 55   TYR A CG    1 
ATOM   171   C  CD1   . TYR A  1  27  ? -0.685  41.264 61.133 1.00 34.69 ? 55   TYR A CD1   1 
ATOM   172   C  CD2   . TYR A  1  27  ? -0.716  43.207 62.542 1.00 36.18 ? 55   TYR A CD2   1 
ATOM   173   C  CE1   . TYR A  1  27  ? -1.552  40.597 62.026 1.00 35.59 ? 55   TYR A CE1   1 
ATOM   174   C  CE2   . TYR A  1  27  ? -1.569  42.551 63.443 1.00 36.88 ? 55   TYR A CE2   1 
ATOM   175   C  CZ    . TYR A  1  27  ? -1.979  41.249 63.180 1.00 36.88 ? 55   TYR A CZ    1 
ATOM   176   O  OH    . TYR A  1  27  ? -2.814  40.604 64.067 1.00 37.45 ? 55   TYR A OH    1 
ATOM   177   N  N     . LYS A  1  28  ? -0.435  42.184 57.788 1.00 35.81 ? 56   LYS A N     1 
ATOM   178   C  CA    . LYS A  1  28  ? -1.121  41.071 57.164 1.00 36.51 ? 56   LYS A CA    1 
ATOM   179   C  C     . LYS A  1  28  ? -0.266  39.838 57.418 1.00 34.81 ? 56   LYS A C     1 
ATOM   180   O  O     . LYS A  1  28  ? 0.961   39.914 57.350 1.00 33.81 ? 56   LYS A O     1 
ATOM   181   C  CB    . LYS A  1  28  ? -1.248  41.336 55.662 1.00 37.63 ? 56   LYS A CB    1 
ATOM   182   C  CG    . LYS A  1  28  ? -1.525  40.124 54.786 1.00 39.52 ? 56   LYS A CG    1 
ATOM   183   C  CD    . LYS A  1  28  ? -2.992  39.736 54.814 1.00 43.05 ? 56   LYS A CD    1 
ATOM   184   C  CE    . LYS A  1  28  ? -3.294  38.736 53.715 1.00 44.43 ? 56   LYS A CE    1 
ATOM   185   N  NZ    . LYS A  1  28  ? -4.729  38.797 53.333 1.00 47.24 ? 56   LYS A NZ    1 
ATOM   186   N  N     . CYS A  1  29  ? -0.913  38.717 57.733 1.00 34.65 ? 57   CYS A N     1 
ATOM   187   C  CA    . CYS A  1  29  ? -0.237  37.432 57.811 1.00 33.43 ? 57   CYS A CA    1 
ATOM   188   C  C     . CYS A  1  29  ? -0.465  36.649 56.536 1.00 33.66 ? 57   CYS A C     1 
ATOM   189   O  O     . CYS A  1  29  ? -1.576  36.605 56.014 1.00 34.89 ? 57   CYS A O     1 
ATOM   190   C  CB    . CYS A  1  29  ? -0.734  36.602 58.990 1.00 33.65 ? 57   CYS A CB    1 
ATOM   191   S  SG    . CYS A  1  29  ? -0.463  37.349 60.589 1.00 34.42 ? 57   CYS A SG    1 
ATOM   192   N  N     . ASP A  1  30  ? 0.599   36.025 56.046 1.00 32.57 ? 58   ASP A N     1 
ATOM   193   C  CA    . ASP A  1  30  ? 0.505   35.134 54.908 1.00 32.83 ? 58   ASP A CA    1 
ATOM   194   C  C     . ASP A  1  30  ? 0.468   33.685 55.411 1.00 32.29 ? 58   ASP A C     1 
ATOM   195   O  O     . ASP A  1  30  ? 1.479   33.151 55.871 1.00 31.40 ? 58   ASP A O     1 
ATOM   196   C  CB    . ASP A  1  30  ? 1.690   35.372 53.961 1.00 32.54 ? 58   ASP A CB    1 
ATOM   197   C  CG    . ASP A  1  30  ? 1.605   34.549 52.692 1.00 33.44 ? 58   ASP A CG    1 
ATOM   198   O  OD1   . ASP A  1  30  ? 0.715   33.678 52.592 1.00 34.24 ? 58   ASP A OD1   1 
ATOM   199   O  OD2   . ASP A  1  30  ? 2.442   34.770 51.793 1.00 34.25 ? 58   ASP A OD2   1 
ATOM   200   N  N     . CYS A  1  31  ? -0.698  33.052 55.301 1.00 32.90 ? 59   CYS A N     1 
ATOM   201   C  CA    . CYS A  1  31  ? -0.909  31.713 55.859 1.00 32.85 ? 59   CYS A CA    1 
ATOM   202   C  C     . CYS A  1  31  ? -0.682  30.562 54.864 1.00 32.52 ? 59   CYS A C     1 
ATOM   203   O  O     . CYS A  1  31  ? -1.026  29.412 55.156 1.00 32.99 ? 59   CYS A O     1 
ATOM   204   C  CB    . CYS A  1  31  ? -2.308  31.613 56.481 1.00 34.32 ? 59   CYS A CB    1 
ATOM   205   S  SG    . CYS A  1  31  ? -2.716  32.888 57.713 1.00 36.26 ? 59   CYS A SG    1 
ATOM   206   N  N     . THR A  1  32  ? -0.087  30.876 53.712 1.00 31.88 ? 60   THR A N     1 
ATOM   207   C  CA    . THR A  1  32  ? 0.179   29.907 52.642 1.00 31.52 ? 60   THR A CA    1 
ATOM   208   C  C     . THR A  1  32  ? 0.867   28.627 53.135 1.00 31.34 ? 60   THR A C     1 
ATOM   209   O  O     . THR A  1  32  ? 1.942   28.676 53.753 1.00 31.16 ? 60   THR A O     1 
ATOM   210   C  CB    . THR A  1  32  ? 1.021   30.550 51.494 1.00 31.74 ? 60   THR A CB    1 
ATOM   211   O  OG1   . THR A  1  32  ? 0.383   31.747 51.030 1.00 31.14 ? 60   THR A OG1   1 
ATOM   212   C  CG2   . THR A  1  32  ? 1.186   29.593 50.319 1.00 32.05 ? 60   THR A CG2   1 
ATOM   213   N  N     . ARG A  1  33  ? 0.232   27.491 52.855 1.00 31.76 ? 61   ARG A N     1 
ATOM   214   C  CA    . ARG A  1  33  ? 0.737   26.149 53.211 1.00 31.93 ? 61   ARG A CA    1 
ATOM   215   C  C     . ARG A  1  33  ? 1.021   25.910 54.701 1.00 31.32 ? 61   ARG A C     1 
ATOM   216   O  O     . ARG A  1  33  ? 1.734   24.971 55.036 1.00 32.09 ? 61   ARG A O     1 
ATOM   217   C  CB    . ARG A  1  33  ? 1.962   25.757 52.354 1.00 31.90 ? 61   ARG A CB    1 
ATOM   218   C  CG    . ARG A  1  33  ? 1.624   25.479 50.895 1.00 33.02 ? 61   ARG A CG    1 
ATOM   219   C  CD    . ARG A  1  33  ? 2.871   25.222 50.045 1.00 32.70 ? 61   ARG A CD    1 
ATOM   220   N  NE    . ARG A  1  33  ? 3.700   26.415 49.827 1.00 31.49 ? 61   ARG A NE    1 
ATOM   221   C  CZ    . ARG A  1  33  ? 3.467   27.341 48.899 1.00 31.80 ? 61   ARG A CZ    1 
ATOM   222   N  NH1   . ARG A  1  33  ? 2.409   27.246 48.099 1.00 32.58 ? 61   ARG A NH1   1 
ATOM   223   N  NH2   . ARG A  1  33  ? 4.289   28.374 48.771 1.00 30.17 ? 61   ARG A NH2   1 
ATOM   224   N  N     . THR A  1  34  ? 0.461   26.734 55.587 1.00 30.74 ? 62   THR A N     1 
ATOM   225   C  CA    . THR A  1  34  ? 0.626   26.519 57.037 1.00 30.61 ? 62   THR A CA    1 
ATOM   226   C  C     . THR A  1  34  ? -0.327  25.455 57.580 1.00 31.77 ? 62   THR A C     1 
ATOM   227   O  O     . THR A  1  34  ? -0.080  24.869 58.636 1.00 32.10 ? 62   THR A O     1 
ATOM   228   C  CB    . THR A  1  34  ? 0.427   27.813 57.869 1.00 30.10 ? 62   THR A CB    1 
ATOM   229   O  OG1   . THR A  1  34  ? -0.929  28.259 57.762 1.00 31.04 ? 62   THR A OG1   1 
ATOM   230   C  CG2   . THR A  1  34  ? 1.379   28.920 57.414 1.00 29.09 ? 62   THR A CG2   1 
ATOM   231   N  N     . GLY A  1  35  ? -1.419  25.220 56.857 1.00 32.52 ? 63   GLY A N     1 
ATOM   232   C  CA    . GLY A  1  35  ? -2.499  24.360 57.345 1.00 34.43 ? 63   GLY A CA    1 
ATOM   233   C  C     . GLY A  1  35  ? -3.449  25.117 58.259 1.00 35.45 ? 63   GLY A C     1 
ATOM   234   O  O     . GLY A  1  35  ? -4.369  24.532 58.838 1.00 37.20 ? 63   GLY A O     1 
ATOM   235   N  N     . PHE A  1  36  ? -3.220  26.422 58.397 1.00 34.57 ? 64   PHE A N     1 
ATOM   236   C  CA    . PHE A  1  36  ? -4.097  27.284 59.179 1.00 35.52 ? 64   PHE A CA    1 
ATOM   237   C  C     . PHE A  1  36  ? -4.551  28.463 58.327 1.00 35.86 ? 64   PHE A C     1 
ATOM   238   O  O     . PHE A  1  36  ? -3.964  28.738 57.285 1.00 35.26 ? 64   PHE A O     1 
ATOM   239   C  CB    . PHE A  1  36  ? -3.377  27.805 60.422 1.00 34.42 ? 64   PHE A CB    1 
ATOM   240   C  CG    . PHE A  1  36  ? -3.060  26.748 61.444 1.00 34.90 ? 64   PHE A CG    1 
ATOM   241   C  CD1   . PHE A  1  36  ? -3.870  26.583 62.562 1.00 36.26 ? 64   PHE A CD1   1 
ATOM   242   C  CD2   . PHE A  1  36  ? -1.935  25.933 61.306 1.00 34.04 ? 64   PHE A CD2   1 
ATOM   243   C  CE1   . PHE A  1  36  ? -3.574  25.612 63.529 1.00 37.47 ? 64   PHE A CE1   1 
ATOM   244   C  CE2   . PHE A  1  36  ? -1.629  24.954 62.263 1.00 35.59 ? 64   PHE A CE2   1 
ATOM   245   C  CZ    . PHE A  1  36  ? -2.452  24.793 63.377 1.00 36.53 ? 64   PHE A CZ    1 
ATOM   246   N  N     . TYR A  1  37  ? -5.592  29.157 58.777 1.00 37.52 ? 65   TYR A N     1 
ATOM   247   C  CA    . TYR A  1  37  ? -6.039  30.397 58.141 1.00 38.43 ? 65   TYR A CA    1 
ATOM   248   C  C     . TYR A  1  37  ? -6.610  31.373 59.175 1.00 39.84 ? 65   TYR A C     1 
ATOM   249   O  O     . TYR A  1  37  ? -6.489  31.152 60.386 1.00 40.04 ? 65   TYR A O     1 
ATOM   250   C  CB    . TYR A  1  37  ? -7.060  30.111 57.030 1.00 39.78 ? 65   TYR A CB    1 
ATOM   251   C  CG    . TYR A  1  37  ? -8.327  29.446 57.503 1.00 42.61 ? 65   TYR A CG    1 
ATOM   252   C  CD1   . TYR A  1  37  ? -9.474  30.197 57.761 1.00 44.82 ? 65   TYR A CD1   1 
ATOM   253   C  CD2   . TYR A  1  37  ? -8.388  28.062 57.685 1.00 43.33 ? 65   TYR A CD2   1 
ATOM   254   C  CE1   . TYR A  1  37  ? -10.644 29.591 58.196 1.00 47.70 ? 65   TYR A CE1   1 
ATOM   255   C  CE2   . TYR A  1  37  ? -9.551  27.448 58.116 1.00 44.75 ? 65   TYR A CE2   1 
ATOM   256   C  CZ    . TYR A  1  37  ? -10.675 28.217 58.368 1.00 48.04 ? 65   TYR A CZ    1 
ATOM   257   O  OH    . TYR A  1  37  ? -11.833 27.611 58.791 1.00 49.38 ? 65   TYR A OH    1 
ATOM   258   N  N     . GLY A  1  38  ? -7.236  32.445 58.692 1.00 41.05 ? 66   GLY A N     1 
ATOM   259   C  CA    . GLY A  1  38  ? -7.734  33.502 59.567 1.00 42.56 ? 66   GLY A CA    1 
ATOM   260   C  C     . GLY A  1  38  ? -6.672  34.564 59.749 1.00 40.93 ? 66   GLY A C     1 
ATOM   261   O  O     . GLY A  1  38  ? -5.541  34.391 59.294 1.00 38.91 ? 66   GLY A O     1 
ATOM   262   N  N     . GLU A  1  39  ? -7.028  35.647 60.435 1.00 42.22 ? 67   GLU A N     1 
ATOM   263   C  CA    . GLU A  1  39  ? -6.174  36.831 60.550 1.00 41.69 ? 67   GLU A CA    1 
ATOM   264   C  C     . GLU A  1  39  ? -4.731  36.559 61.002 1.00 39.43 ? 67   GLU A C     1 
ATOM   265   O  O     . GLU A  1  39  ? -3.799  37.172 60.482 1.00 38.36 ? 67   GLU A O     1 
ATOM   266   C  CB    . GLU A  1  39  ? -6.815  37.878 61.468 1.00 43.55 ? 67   GLU A CB    1 
ATOM   267   C  CG    . GLU A  1  39  ? -6.040  39.198 61.520 1.00 43.71 ? 67   GLU A CG    1 
ATOM   268   C  CD    . GLU A  1  39  ? -6.633  40.217 62.479 1.00 47.56 ? 67   GLU A CD    1 
ATOM   269   O  OE1   . GLU A  1  39  ? -7.553  39.873 63.252 1.00 48.78 ? 67   GLU A OE1   1 
ATOM   270   O  OE2   . GLU A  1  39  ? -6.165  41.373 62.458 1.00 49.28 ? 67   GLU A OE2   1 
ATOM   271   N  N     . ASN A  1  40  ? -4.560  35.656 61.966 1.00 39.61 ? 68   ASN A N     1 
ATOM   272   C  CA    . ASN A  1  40  ? -3.246  35.364 62.539 1.00 40.02 ? 68   ASN A CA    1 
ATOM   273   C  C     . ASN A  1  40  ? -2.774  33.934 62.288 1.00 38.11 ? 68   ASN A C     1 
ATOM   274   O  O     . ASN A  1  40  ? -1.879  33.449 62.980 1.00 37.89 ? 68   ASN A O     1 
ATOM   275   C  CB    . ASN A  1  40  ? -3.256  35.633 64.048 1.00 42.10 ? 68   ASN A CB    1 
ATOM   276   C  CG    . ASN A  1  40  ? -3.553  37.083 64.394 1.00 47.78 ? 68   ASN A CG    1 
ATOM   277   O  OD1   . ASN A  1  40  ? -3.029  38.010 63.771 1.00 47.35 ? 68   ASN A OD1   1 
ATOM   278   N  ND2   . ASN A  1  40  ? -4.401  37.280 65.405 1.00 57.55 ? 68   ASN A ND2   1 
ATOM   279   N  N     . CYS A  1  41  ? -3.381  33.276 61.299 1.00 36.69 ? 69   CYS A N     1 
ATOM   280   C  CA    . CYS A  1  41  ? -3.140  31.861 60.986 1.00 35.95 ? 69   CYS A CA    1 
ATOM   281   C  C     . CYS A  1  41  ? -3.365  30.947 62.212 1.00 36.03 ? 69   CYS A C     1 
ATOM   282   O  O     . CYS A  1  41  ? -2.571  30.042 62.477 1.00 35.52 ? 69   CYS A O     1 
ATOM   283   C  CB    . CYS A  1  41  ? -1.742  31.639 60.363 1.00 35.94 ? 69   CYS A CB    1 
ATOM   284   S  SG    . CYS A  1  41  ? -1.195  32.839 59.101 1.00 35.98 ? 69   CYS A SG    1 
ATOM   285   N  N     . THR A  1  42  ? -4.449  31.190 62.954 1.00 36.60 ? 70   THR A N     1 
ATOM   286   C  CA    . THR A  1  42  ? -4.759  30.394 64.152 1.00 37.43 ? 70   THR A CA    1 
ATOM   287   C  C     . THR A  1  42  ? -5.962  29.461 64.000 1.00 38.63 ? 70   THR A C     1 
ATOM   288   O  O     . THR A  1  42  ? -6.152  28.567 64.826 1.00 39.69 ? 70   THR A O     1 
ATOM   289   C  CB    . THR A  1  42  ? -4.931  31.270 65.427 1.00 38.45 ? 70   THR A CB    1 
ATOM   290   O  OG1   . THR A  1  42  ? -5.930  32.272 65.210 1.00 38.60 ? 70   THR A OG1   1 
ATOM   291   C  CG2   . THR A  1  42  ? -3.626  31.945 65.791 1.00 37.66 ? 70   THR A CG2   1 
ATOM   292   N  N     . THR A  1  43  ? -6.773  29.661 62.961 1.00 38.89 ? 71   THR A N     1 
ATOM   293   C  CA    . THR A  1  43  ? -7.882  28.742 62.694 1.00 40.72 ? 71   THR A CA    1 
ATOM   294   C  C     . THR A  1  43  ? -7.378  27.542 61.889 1.00 40.62 ? 71   THR A C     1 
ATOM   295   O  O     . THR A  1  43  ? -6.986  27.697 60.731 1.00 40.13 ? 71   THR A O     1 
ATOM   296   C  CB    . THR A  1  43  ? -9.056  29.416 61.942 1.00 41.70 ? 71   THR A CB    1 
ATOM   297   O  OG1   . THR A  1  43  ? -9.392  30.662 62.565 1.00 42.47 ? 71   THR A OG1   1 
ATOM   298   C  CG2   . THR A  1  43  ? -10.288 28.507 61.943 1.00 43.86 ? 71   THR A CG2   1 
ATOM   299   N  N     . PRO A  1  44  ? -7.392  26.341 62.497 1.00 41.55 ? 72   PRO A N     1 
ATOM   300   C  CA    . PRO A  1  44  ? -6.885  25.168 61.784 1.00 41.88 ? 72   PRO A CA    1 
ATOM   301   C  C     . PRO A  1  44  ? -7.833  24.695 60.687 1.00 43.77 ? 72   PRO A C     1 
ATOM   302   O  O     . PRO A  1  44  ? -9.050  24.855 60.803 1.00 45.40 ? 72   PRO A O     1 
ATOM   303   C  CB    . PRO A  1  44  ? -6.767  24.111 62.887 1.00 42.67 ? 72   PRO A CB    1 
ATOM   304   C  CG    . PRO A  1  44  ? -7.793  24.495 63.894 1.00 43.98 ? 72   PRO A CG    1 
ATOM   305   C  CD    . PRO A  1  44  ? -7.937  25.992 63.825 1.00 43.14 ? 72   PRO A CD    1 
ATOM   306   N  N     . GLU A  1  45  ? -7.266  24.139 59.621 1.00 43.95 ? 73   GLU A N     1 
ATOM   307   C  CA    . GLU A  1  45  ? -8.052  23.453 58.606 1.00 46.77 ? 73   GLU A CA    1 
ATOM   308   C  C     . GLU A  1  45  ? -8.468  22.109 59.185 1.00 48.91 ? 73   GLU A C     1 
ATOM   309   O  O     . GLU A  1  45  ? -7.872  21.647 60.161 1.00 47.96 ? 73   GLU A O     1 
ATOM   310   C  CB    . GLU A  1  45  ? -7.238  23.264 57.324 1.00 47.00 ? 73   GLU A CB    1 
ATOM   311   C  CG    . GLU A  1  45  ? -7.105  24.532 56.482 1.00 46.57 ? 73   GLU A CG    1 
ATOM   312   C  CD    . GLU A  1  45  ? -5.959  24.478 55.476 1.00 47.29 ? 73   GLU A CD    1 
ATOM   313   O  OE1   . GLU A  1  45  ? -5.248  23.451 55.409 1.00 48.58 ? 73   GLU A OE1   1 
ATOM   314   O  OE2   . GLU A  1  45  ? -5.767  25.474 54.747 1.00 47.50 ? 73   GLU A OE2   1 
ATOM   315   N  N     . PHE A  1  46  ? -9.482  21.485 58.594 1.00 52.19 ? 74   PHE A N     1 
ATOM   316   C  CA    . PHE A  1  46  ? -10.017 20.234 59.129 1.00 55.28 ? 74   PHE A CA    1 
ATOM   317   C  C     . PHE A  1  46  ? -8.947  19.154 59.280 1.00 55.00 ? 74   PHE A C     1 
ATOM   318   O  O     . PHE A  1  46  ? -8.818  18.559 60.351 1.00 55.03 ? 74   PHE A O     1 
ATOM   319   C  CB    . PHE A  1  46  ? -11.206 19.723 58.301 1.00 59.58 ? 74   PHE A CB    1 
ATOM   320   C  CG    . PHE A  1  46  ? -11.795 18.440 58.819 1.00 63.77 ? 74   PHE A CG    1 
ATOM   321   C  CD1   . PHE A  1  46  ? -12.511 18.419 60.013 1.00 65.21 ? 74   PHE A CD1   1 
ATOM   322   C  CD2   . PHE A  1  46  ? -11.623 17.250 58.120 1.00 67.40 ? 74   PHE A CD2   1 
ATOM   323   C  CE1   . PHE A  1  46  ? -13.051 17.233 60.500 1.00 69.55 ? 74   PHE A CE1   1 
ATOM   324   C  CE2   . PHE A  1  46  ? -12.161 16.057 58.597 1.00 71.62 ? 74   PHE A CE2   1 
ATOM   325   C  CZ    . PHE A  1  46  ? -12.877 16.049 59.791 1.00 72.66 ? 74   PHE A CZ    1 
ATOM   326   N  N     . LEU A  1  47  ? -8.178  18.921 58.217 1.00 55.07 ? 75   LEU A N     1 
ATOM   327   C  CA    . LEU A  1  47  ? -7.106  17.918 58.233 1.00 55.19 ? 75   LEU A CA    1 
ATOM   328   C  C     . LEU A  1  47  ? -6.038  18.231 59.283 1.00 51.53 ? 75   LEU A C     1 
ATOM   329   O  O     . LEU A  1  47  ? -5.532  17.321 59.949 1.00 51.74 ? 75   LEU A O     1 
ATOM   330   C  CB    . LEU A  1  47  ? -6.473  17.765 56.842 1.00 56.40 ? 75   LEU A CB    1 
ATOM   331   C  CG    . LEU A  1  47  ? -5.266  16.826 56.675 1.00 57.24 ? 75   LEU A CG    1 
ATOM   332   C  CD1   . LEU A  1  47  ? -5.629  15.352 56.900 1.00 60.96 ? 75   LEU A CD1   1 
ATOM   333   C  CD2   . LEU A  1  47  ? -4.606  17.020 55.313 1.00 58.81 ? 75   LEU A CD2   1 
ATOM   334   N  N     . THR A  1  48  ? -5.706  19.514 59.426 1.00 48.45 ? 76   THR A N     1 
ATOM   335   C  CA    . THR A  1  48  ? -4.758  19.970 60.440 1.00 45.28 ? 76   THR A CA    1 
ATOM   336   C  C     . THR A  1  48  ? -5.253  19.628 61.842 1.00 45.66 ? 76   THR A C     1 
ATOM   337   O  O     . THR A  1  48  ? -4.484  19.148 62.672 1.00 44.56 ? 76   THR A O     1 
ATOM   338   C  CB    . THR A  1  48  ? -4.518  21.491 60.354 1.00 42.85 ? 76   THR A CB    1 
ATOM   339   O  OG1   . THR A  1  48  ? -4.287  21.867 58.992 1.00 42.96 ? 76   THR A OG1   1 
ATOM   340   C  CG2   . THR A  1  48  ? -3.319  21.893 61.200 1.00 40.47 ? 76   THR A CG2   1 
ATOM   341   N  N     . ARG A  1  49  ? -6.538  19.881 62.088 1.00 47.66 ? 77   ARG A N     1 
ATOM   342   C  CA    . ARG A  1  49  ? -7.173  19.608 63.378 1.00 49.37 ? 77   ARG A CA    1 
ATOM   343   C  C     . ARG A  1  49  ? -7.063  18.130 63.754 1.00 51.38 ? 77   ARG A C     1 
ATOM   344   O  O     . ARG A  1  49  ? -6.762  17.804 64.901 1.00 51.18 ? 77   ARG A O     1 
ATOM   345   C  CB    . ARG A  1  49  ? -8.637  20.065 63.369 1.00 51.54 ? 77   ARG A CB    1 
ATOM   346   C  CG    . ARG A  1  49  ? -9.130  20.557 64.722 1.00 52.99 ? 77   ARG A CG    1 
ATOM   347   C  CD    . ARG A  1  49  ? -10.635 20.830 64.730 1.00 58.01 ? 77   ARG A CD    1 
ATOM   348   N  NE    . ARG A  1  49  ? -11.001 22.065 64.031 1.00 57.77 ? 77   ARG A NE    1 
ATOM   349   C  CZ    . ARG A  1  49  ? -11.065 23.271 64.597 1.00 56.93 ? 77   ARG A CZ    1 
ATOM   350   N  NH1   . ARG A  1  49  ? -10.778 23.431 65.884 1.00 57.06 ? 77   ARG A NH1   1 
ATOM   351   N  NH2   . ARG A  1  49  ? -11.411 24.327 63.870 1.00 55.90 ? 77   ARG A NH2   1 
ATOM   352   N  N     . ILE A  1  50  ? -7.286  17.250 62.777 1.00 53.93 ? 78   ILE A N     1 
ATOM   353   C  CA    . ILE A  1  50  ? -7.125  15.803 62.957 1.00 56.51 ? 78   ILE A CA    1 
ATOM   354   C  C     . ILE A  1  50  ? -5.652  15.427 63.155 1.00 54.51 ? 78   ILE A C     1 
ATOM   355   O  O     . ILE A  1  50  ? -5.337  14.581 63.995 1.00 54.87 ? 78   ILE A O     1 
ATOM   356   C  CB    . ILE A  1  50  ? -7.739  14.998 61.769 1.00 60.18 ? 78   ILE A CB    1 
ATOM   357   C  CG1   . ILE A  1  50  ? -9.219  15.363 61.545 1.00 63.00 ? 78   ILE A CG1   1 
ATOM   358   C  CG2   . ILE A  1  50  ? -7.578  13.489 61.964 1.00 62.88 ? 78   ILE A CG2   1 
ATOM   359   C  CD1   . ILE A  1  50  ? -10.115 15.253 62.783 1.00 64.36 ? 78   ILE A CD1   1 
ATOM   360   N  N     . LYS A  1  51  ? -4.763  16.069 62.393 1.00 52.73 ? 79   LYS A N     1 
ATOM   361   C  CA    . LYS A  1  51  ? -3.315  15.835 62.488 1.00 51.21 ? 79   LYS A CA    1 
ATOM   362   C  C     . LYS A  1  51  ? -2.742  16.234 63.843 1.00 48.95 ? 79   LYS A C     1 
ATOM   363   O  O     . LYS A  1  51  ? -1.860  15.553 64.367 1.00 48.48 ? 79   LYS A O     1 
ATOM   364   C  CB    . LYS A  1  51  ? -2.560  16.576 61.379 1.00 50.04 ? 79   LYS A CB    1 
ATOM   365   C  CG    . LYS A  1  51  ? -2.502  15.836 60.051 1.00 53.62 ? 79   LYS A CG    1 
ATOM   366   C  CD    . LYS A  1  51  ? -1.819  16.685 58.984 1.00 54.21 ? 79   LYS A CD    1 
ATOM   367   C  CE    . LYS A  1  51  ? -1.766  15.958 57.646 1.00 58.22 ? 79   LYS A CE    1 
ATOM   368   N  NZ    . LYS A  1  51  ? -1.285  16.850 56.552 1.00 58.82 ? 79   LYS A NZ    1 
ATOM   369   N  N     . LEU A  1  52  ? -3.238  17.344 64.392 1.00 48.14 ? 80   LEU A N     1 
ATOM   370   C  CA    . LEU A  1  52  ? -2.845  17.810 65.722 1.00 46.70 ? 80   LEU A CA    1 
ATOM   371   C  C     . LEU A  1  52  ? -3.300  16.847 66.823 1.00 48.62 ? 80   LEU A C     1 
ATOM   372   O  O     . LEU A  1  52  ? -2.548  16.574 67.762 1.00 47.75 ? 80   LEU A O     1 
ATOM   373   C  CB    . LEU A  1  52  ? -3.395  19.214 65.996 1.00 45.96 ? 80   LEU A CB    1 
ATOM   374   C  CG    . LEU A  1  52  ? -2.699  20.404 65.326 1.00 43.88 ? 80   LEU A CG    1 
ATOM   375   C  CD1   . LEU A  1  52  ? -3.543  21.660 65.488 1.00 43.99 ? 80   LEU A CD1   1 
ATOM   376   C  CD2   . LEU A  1  52  ? -1.294  20.618 65.874 1.00 41.49 ? 80   LEU A CD2   1 
ATOM   377   N  N     . LEU A  1  53  ? -4.521  16.329 66.697 1.00 51.57 ? 81   LEU A N     1 
ATOM   378   C  CA    . LEU A  1  53  ? -5.060  15.383 67.676 1.00 54.19 ? 81   LEU A CA    1 
ATOM   379   C  C     . LEU A  1  53  ? -4.294  14.060 67.698 1.00 54.49 ? 81   LEU A C     1 
ATOM   380   O  O     . LEU A  1  53  ? -4.245  13.384 68.725 1.00 55.66 ? 81   LEU A O     1 
ATOM   381   C  CB    . LEU A  1  53  ? -6.553  15.135 67.431 1.00 57.87 ? 81   LEU A CB    1 
ATOM   382   C  CG    . LEU A  1  53  ? -7.515  16.256 67.843 1.00 58.91 ? 81   LEU A CG    1 
ATOM   383   C  CD1   . LEU A  1  53  ? -8.902  16.044 67.245 1.00 62.66 ? 81   LEU A CD1   1 
ATOM   384   C  CD2   . LEU A  1  53  ? -7.597  16.390 69.362 1.00 59.97 ? 81   LEU A CD2   1 
ATOM   385   N  N     . LEU A  1  54  ? -3.686  13.711 66.567 1.00 53.82 ? 82   LEU A N     1 
ATOM   386   C  CA    . LEU A  1  54  ? -3.001  12.431 66.403 1.00 54.32 ? 82   LEU A CA    1 
ATOM   387   C  C     . LEU A  1  54  ? -1.497  12.498 66.651 1.00 51.05 ? 82   LEU A C     1 
ATOM   388   O  O     . LEU A  1  54  ? -0.841  11.463 66.752 1.00 51.47 ? 82   LEU A O     1 
ATOM   389   C  CB    . LEU A  1  54  ? -3.274  11.867 65.003 1.00 56.68 ? 82   LEU A CB    1 
ATOM   390   C  CG    . LEU A  1  54  ? -4.465  10.929 64.764 1.00 61.33 ? 82   LEU A CG    1 
ATOM   391   C  CD1   . LEU A  1  54  ? -5.804  11.535 65.183 1.00 63.34 ? 82   LEU A CD1   1 
ATOM   392   C  CD2   . LEU A  1  54  ? -4.504  10.528 63.296 1.00 63.71 ? 82   LEU A CD2   1 
ATOM   393   N  N     . LYS A  1  55  ? -0.955  13.710 66.747 1.00 48.14 ? 83   LYS A N     1 
ATOM   394   C  CA    . LYS A  1  55  ? 0.480   13.907 66.936 1.00 45.42 ? 83   LYS A CA    1 
ATOM   395   C  C     . LYS A  1  55  ? 0.889   13.718 68.401 1.00 44.42 ? 83   LYS A C     1 
ATOM   396   O  O     . LYS A  1  55  ? 0.356   14.397 69.282 1.00 44.37 ? 83   LYS A O     1 
ATOM   397   C  CB    . LYS A  1  55  ? 0.902   15.296 66.437 1.00 43.64 ? 83   LYS A CB    1 
ATOM   398   C  CG    . LYS A  1  55  ? 2.402   15.529 66.415 1.00 41.90 ? 83   LYS A CG    1 
ATOM   399   C  CD    . LYS A  1  55  ? 2.755   16.890 65.823 1.00 41.60 ? 83   LYS A CD    1 
ATOM   400   N  N     . PRO A  1  56  ? 1.828   12.788 68.667 1.00 43.65 ? 84   PRO A N     1 
ATOM   401   C  CA    . PRO A  1  56  ? 2.369   12.677 70.022 1.00 42.67 ? 84   PRO A CA    1 
ATOM   402   C  C     . PRO A  1  56  ? 3.402   13.776 70.282 1.00 40.13 ? 84   PRO A C     1 
ATOM   403   O  O     . PRO A  1  56  ? 4.067   14.231 69.350 1.00 39.14 ? 84   PRO A O     1 
ATOM   404   C  CB    . PRO A  1  56  ? 3.029   11.293 70.027 1.00 43.04 ? 84   PRO A CB    1 
ATOM   405   C  CG    . PRO A  1  56  ? 3.401   11.045 68.612 1.00 43.41 ? 84   PRO A CG    1 
ATOM   406   C  CD    . PRO A  1  56  ? 2.364   11.745 67.769 1.00 44.52 ? 84   PRO A CD    1 
ATOM   407   N  N     . THR A  1  57  ? 3.521   14.201 71.537 1.00 39.65 ? 85   THR A N     1 
ATOM   408   C  CA    . THR A  1  57  ? 4.481   15.247 71.913 1.00 37.86 ? 85   THR A CA    1 
ATOM   409   C  C     . THR A  1  57  ? 5.923   14.762 71.763 1.00 36.42 ? 85   THR A C     1 
ATOM   410   O  O     . THR A  1  57  ? 6.168   13.555 71.702 1.00 36.56 ? 85   THR A O     1 
ATOM   411   C  CB    . THR A  1  57  ? 4.278   15.718 73.368 1.00 38.62 ? 85   THR A CB    1 
ATOM   412   O  OG1   . THR A  1  57  ? 4.472   14.616 74.261 1.00 39.79 ? 85   THR A OG1   1 
ATOM   413   C  CG2   . THR A  1  57  ? 2.884   16.320 73.565 1.00 39.94 ? 85   THR A CG2   1 
ATOM   414   N  N     . PRO A  1  58  ? 6.887   15.699 71.688 1.00 35.34 ? 86   PRO A N     1 
ATOM   415   C  CA    . PRO A  1  58  ? 8.282   15.253 71.698 1.00 34.57 ? 86   PRO A CA    1 
ATOM   416   C  C     . PRO A  1  58  ? 8.637   14.430 72.945 1.00 34.51 ? 86   PRO A C     1 
ATOM   417   O  O     . PRO A  1  58  ? 9.384   13.452 72.839 1.00 34.37 ? 86   PRO A O     1 
ATOM   418   C  CB    . PRO A  1  58  ? 9.063   16.567 71.661 1.00 34.31 ? 86   PRO A CB    1 
ATOM   419   C  CG    . PRO A  1  58  ? 8.163   17.481 70.903 1.00 34.76 ? 86   PRO A CG    1 
ATOM   420   C  CD    . PRO A  1  58  ? 6.771   17.124 71.325 1.00 34.86 ? 86   PRO A CD    1 
ATOM   421   N  N     . ASN A  1  59  ? 8.085   14.809 74.100 1.00 34.89 ? 87   ASN A N     1 
ATOM   422   C  CA    . ASN A  1  59  ? 8.374   14.119 75.362 1.00 34.90 ? 87   ASN A CA    1 
ATOM   423   C  C     . ASN A  1  59  ? 7.853   12.690 75.391 1.00 34.92 ? 87   ASN A C     1 
ATOM   424   O  O     . ASN A  1  59  ? 8.457   11.822 76.017 1.00 34.77 ? 87   ASN A O     1 
ATOM   425   C  CB    . ASN A  1  59  ? 7.832   14.903 76.562 1.00 36.26 ? 87   ASN A CB    1 
ATOM   426   C  CG    . ASN A  1  59  ? 8.641   16.154 76.863 1.00 36.34 ? 87   ASN A CG    1 
ATOM   427   O  OD1   . ASN A  1  59  ? 9.754   16.332 76.362 1.00 34.31 ? 87   ASN A OD1   1 
ATOM   428   N  ND2   . ASN A  1  59  ? 8.076   17.036 77.685 1.00 37.51 ? 87   ASN A ND2   1 
ATOM   429   N  N     . THR A  1  60  ? 6.735   12.458 74.708 1.00 35.03 ? 88   THR A N     1 
ATOM   430   C  CA    . THR A  1  60  ? 6.157   11.120 74.580 1.00 35.74 ? 88   THR A CA    1 
ATOM   431   C  C     . THR A  1  60  ? 7.006   10.234 73.672 1.00 34.79 ? 88   THR A C     1 
ATOM   432   O  O     . THR A  1  60  ? 7.276   9.075  73.997 1.00 35.20 ? 88   THR A O     1 
ATOM   433   C  CB    . THR A  1  60  ? 4.728   11.178 74.014 1.00 37.04 ? 88   THR A CB    1 
ATOM   434   O  OG1   . THR A  1  60  ? 3.880   11.860 74.941 1.00 38.29 ? 88   THR A OG1   1 
ATOM   435   C  CG2   . THR A  1  60  ? 4.184   9.779  73.765 1.00 38.37 ? 88   THR A CG2   1 
ATOM   436   N  N     . VAL A  1  61  ? 7.400   10.783 72.528 1.00 33.80 ? 89   VAL A N     1 
ATOM   437   C  CA    . VAL A  1  61  ? 8.251   10.072 71.580 1.00 33.72 ? 89   VAL A CA    1 
ATOM   438   C  C     . VAL A  1  61  ? 9.589   9.731  72.243 1.00 32.72 ? 89   VAL A C     1 
ATOM   439   O  O     . VAL A  1  61  ? 10.072  8.600  72.132 1.00 32.95 ? 89   VAL A O     1 
ATOM   440   C  CB    . VAL A  1  61  ? 8.463   10.894 70.276 1.00 33.62 ? 89   VAL A CB    1 
ATOM   441   C  CG1   . VAL A  1  61  ? 9.426   10.188 69.332 1.00 34.06 ? 89   VAL A CG1   1 
ATOM   442   C  CG2   . VAL A  1  61  ? 7.125   11.145 69.578 1.00 34.52 ? 89   VAL A CG2   1 
ATOM   443   N  N     . HIS A  1  62  ? 10.170  10.708 72.943 1.00 31.82 ? 90   HIS A N     1 
ATOM   444   C  CA    . HIS A  1  62  ? 11.406  10.491 73.694 1.00 31.17 ? 90   HIS A CA    1 
ATOM   445   C  C     . HIS A  1  62  ? 11.247  9.352  74.701 1.00 31.49 ? 90   HIS A C     1 
ATOM   446   O  O     . HIS A  1  62  ? 12.140  8.516  74.834 1.00 30.98 ? 90   HIS A O     1 
ATOM   447   C  CB    . HIS A  1  62  ? 11.848  11.764 74.413 1.00 30.92 ? 90   HIS A CB    1 
ATOM   448   C  CG    . HIS A  1  62  ? 13.044  11.570 75.289 1.00 31.37 ? 90   HIS A CG    1 
ATOM   449   N  ND1   . HIS A  1  62  ? 14.335  11.679 74.819 1.00 31.51 ? 90   HIS A ND1   1 
ATOM   450   C  CD2   . HIS A  1  62  ? 13.146  11.251 76.601 1.00 32.24 ? 90   HIS A CD2   1 
ATOM   451   C  CE1   . HIS A  1  62  ? 15.182  11.447 75.806 1.00 32.03 ? 90   HIS A CE1   1 
ATOM   452   N  NE2   . HIS A  1  62  ? 14.486  11.186 76.899 1.00 32.05 ? 90   HIS A NE2   1 
ATOM   453   N  N     . TYR A  1  63  ? 10.110  9.325  75.401 1.00 32.04 ? 91   TYR A N     1 
ATOM   454   C  CA    . TYR A  1  63  ? 9.834   8.267  76.372 1.00 33.04 ? 91   TYR A CA    1 
ATOM   455   C  C     . TYR A  1  63  ? 9.863   6.887  75.714 1.00 33.31 ? 91   TYR A C     1 
ATOM   456   O  O     . TYR A  1  63  ? 10.509  5.968  76.222 1.00 33.28 ? 91   TYR A O     1 
ATOM   457   C  CB    . TYR A  1  63  ? 8.488   8.470  77.085 1.00 34.56 ? 91   TYR A CB    1 
ATOM   458   C  CG    . TYR A  1  63  ? 8.198   7.346  78.062 1.00 36.34 ? 91   TYR A CG    1 
ATOM   459   C  CD1   . TYR A  1  63  ? 8.566   7.455  79.400 1.00 37.57 ? 91   TYR A CD1   1 
ATOM   460   C  CD2   . TYR A  1  63  ? 7.603   6.159  77.635 1.00 37.12 ? 91   TYR A CD2   1 
ATOM   461   C  CE1   . TYR A  1  63  ? 8.327   6.417  80.299 1.00 39.71 ? 91   TYR A CE1   1 
ATOM   462   C  CE2   . TYR A  1  63  ? 7.366   5.117  78.518 1.00 40.14 ? 91   TYR A CE2   1 
ATOM   463   C  CZ    . TYR A  1  63  ? 7.729   5.252  79.852 1.00 41.09 ? 91   TYR A CZ    1 
ATOM   464   O  OH    . TYR A  1  63  ? 7.494   4.223  80.740 1.00 43.16 ? 91   TYR A OH    1 
ATOM   465   N  N     . ILE A  1  64  ? 9.155   6.757  74.594 1.00 33.75 ? 92   ILE A N     1 
ATOM   466   C  CA    . ILE A  1  64  ? 9.098   5.510  73.827 1.00 34.77 ? 92   ILE A CA    1 
ATOM   467   C  C     . ILE A  1  64  ? 10.496  5.062  73.376 1.00 33.89 ? 92   ILE A C     1 
ATOM   468   O  O     . ILE A  1  64  ? 10.853  3.883  73.503 1.00 34.25 ? 92   ILE A O     1 
ATOM   469   C  CB    . ILE A  1  64  ? 8.146   5.646  72.604 1.00 35.91 ? 92   ILE A CB    1 
ATOM   470   C  CG1   . ILE A  1  64  ? 6.710   5.920  73.076 1.00 36.51 ? 92   ILE A CG1   1 
ATOM   471   C  CG2   . ILE A  1  64  ? 8.201   4.395  71.724 1.00 37.44 ? 92   ILE A CG2   1 
ATOM   472   C  CD1   . ILE A  1  64  ? 5.749   6.331  71.968 1.00 36.63 ? 92   ILE A CD1   1 
ATOM   473   N  N     . LEU A  1  65  ? 11.283  6.015  72.874 1.00 32.79 ? 93   LEU A N     1 
ATOM   474   C  CA    . LEU A  1  65  ? 12.626  5.735  72.365 1.00 32.43 ? 93   LEU A CA    1 
ATOM   475   C  C     . LEU A  1  65  ? 13.642  5.409  73.457 1.00 31.68 ? 93   LEU A C     1 
ATOM   476   O  O     . LEU A  1  65  ? 14.702  4.844  73.171 1.00 31.87 ? 93   LEU A O     1 
ATOM   477   C  CB    . LEU A  1  65  ? 13.135  6.902  71.512 1.00 31.97 ? 93   LEU A CB    1 
ATOM   478   C  CG    . LEU A  1  65  ? 12.534  7.065  70.112 1.00 33.27 ? 93   LEU A CG    1 
ATOM   479   C  CD1   . LEU A  1  65  ? 12.754  8.476  69.590 1.00 32.23 ? 93   LEU A CD1   1 
ATOM   480   C  CD2   . LEU A  1  65  ? 13.091  6.028  69.136 1.00 35.31 ? 93   LEU A CD2   1 
ATOM   481   N  N     . THR A  1  66  ? 13.323  5.772  74.698 1.00 31.28 ? 94   THR A N     1 
ATOM   482   C  CA    . THR A  1  66  ? 14.217  5.521  75.832 1.00 31.02 ? 94   THR A CA    1 
ATOM   483   C  C     . THR A  1  66  ? 13.670  4.463  76.795 1.00 32.05 ? 94   THR A C     1 
ATOM   484   O  O     . THR A  1  66  ? 14.177  4.299  77.911 1.00 32.06 ? 94   THR A O     1 
ATOM   485   C  CB    . THR A  1  66  ? 14.536  6.817  76.605 1.00 30.67 ? 94   THR A CB    1 
ATOM   486   O  OG1   . THR A  1  66  ? 13.315  7.406  77.070 1.00 30.25 ? 94   THR A OG1   1 
ATOM   487   C  CG2   . THR A  1  66  ? 15.292  7.804  75.712 1.00 29.71 ? 94   THR A CG2   1 
ATOM   488   N  N     . HIS A  1  67  ? 12.631  3.755  76.358 1.00 36.56 ? 95   HIS A N     1 
ATOM   489   C  CA    . HIS A  1  67  ? 12.102  2.614  77.093 1.00 37.75 ? 95   HIS A CA    1 
ATOM   490   C  C     . HIS A  1  67  ? 11.872  1.451  76.141 1.00 37.91 ? 95   HIS A C     1 
ATOM   491   O  O     . HIS A  1  67  ? 12.238  1.536  74.966 1.00 37.22 ? 95   HIS A O     1 
ATOM   492   C  CB    . HIS A  1  67  ? 10.826  3.003  77.836 1.00 39.35 ? 95   HIS A CB    1 
ATOM   493   C  CG    . HIS A  1  67  ? 11.067  3.977  78.943 1.00 40.04 ? 95   HIS A CG    1 
ATOM   494   N  ND1   . HIS A  1  67  ? 11.327  5.310  78.716 1.00 39.48 ? 95   HIS A ND1   1 
ATOM   495   C  CD2   . HIS A  1  67  ? 11.128  3.804  80.283 1.00 41.55 ? 95   HIS A CD2   1 
ATOM   496   C  CE1   . HIS A  1  67  ? 11.526  5.920  79.870 1.00 41.51 ? 95   HIS A CE1   1 
ATOM   497   N  NE2   . HIS A  1  67  ? 11.402  5.030  80.837 1.00 42.46 ? 95   HIS A NE2   1 
ATOM   498   N  N     . PHE A  1  68  ? 11.298  0.365  76.662 1.00 39.53 ? 96   PHE A N     1 
ATOM   499   C  CA    . PHE A  1  68  ? 10.978  -0.841 75.887 1.00 40.45 ? 96   PHE A CA    1 
ATOM   500   C  C     . PHE A  1  68  ? 12.197  -1.423 75.160 1.00 40.12 ? 96   PHE A C     1 
ATOM   501   O  O     . PHE A  1  68  ? 12.128  -1.746 73.965 1.00 40.16 ? 96   PHE A O     1 
ATOM   502   C  CB    . PHE A  1  68  ? 9.818   -0.573 74.915 1.00 41.07 ? 96   PHE A CB    1 
ATOM   503   C  CG    . PHE A  1  68  ? 8.680   0.204  75.528 1.00 42.23 ? 96   PHE A CG    1 
ATOM   504   C  CD1   . PHE A  1  68  ? 8.480   1.544  75.203 1.00 41.06 ? 96   PHE A CD1   1 
ATOM   505   C  CD2   . PHE A  1  68  ? 7.821   -0.398 76.440 1.00 43.97 ? 96   PHE A CD2   1 
ATOM   506   C  CE1   . PHE A  1  68  ? 7.433   2.268  75.770 1.00 43.27 ? 96   PHE A CE1   1 
ATOM   507   C  CE2   . PHE A  1  68  ? 6.763   0.320  77.016 1.00 45.80 ? 96   PHE A CE2   1 
ATOM   508   C  CZ    . PHE A  1  68  ? 6.572   1.653  76.680 1.00 45.39 ? 96   PHE A CZ    1 
ATOM   509   N  N     . LYS A  1  69  ? 13.303  -1.561 75.893 1.00 40.20 ? 97   LYS A N     1 
ATOM   510   C  CA    . LYS A  1  69  ? 14.569  -2.022 75.317 1.00 41.01 ? 97   LYS A CA    1 
ATOM   511   C  C     . LYS A  1  69  ? 14.426  -3.378 74.635 1.00 42.96 ? 97   LYS A C     1 
ATOM   512   O  O     . LYS A  1  69  ? 15.082  -3.639 73.632 1.00 43.14 ? 97   LYS A O     1 
ATOM   513   C  CB    . LYS A  1  69  ? 15.675  -2.070 76.375 1.00 42.20 ? 97   LYS A CB    1 
ATOM   514   C  CG    . LYS A  1  69  ? 17.081  -2.108 75.791 1.00 43.96 ? 97   LYS A CG    1 
ATOM   515   C  CD    . LYS A  1  69  ? 18.127  -2.335 76.872 1.00 48.02 ? 97   LYS A CD    1 
ATOM   516   C  CE    . LYS A  1  69  ? 19.530  -2.193 76.312 1.00 50.04 ? 97   LYS A CE    1 
ATOM   517   N  NZ    . LYS A  1  69  ? 20.547  -2.629 77.314 1.00 55.36 ? 97   LYS A NZ    1 
ATOM   518   N  N     . GLY A  1  70  ? 13.560  -4.225 75.190 1.00 45.33 ? 98   GLY A N     1 
ATOM   519   C  CA    . GLY A  1  70  ? 13.231  -5.522 74.606 1.00 48.21 ? 98   GLY A CA    1 
ATOM   520   C  C     . GLY A  1  70  ? 12.719  -5.406 73.183 1.00 47.80 ? 98   GLY A C     1 
ATOM   521   O  O     . GLY A  1  70  ? 13.151  -6.152 72.302 1.00 49.48 ? 98   GLY A O     1 
ATOM   522   N  N     . VAL A  1  71  ? 11.797  -4.469 72.963 1.00 46.11 ? 99   VAL A N     1 
ATOM   523   C  CA    . VAL A  1  71  ? 11.254  -4.198 71.630 1.00 46.18 ? 99   VAL A CA    1 
ATOM   524   C  C     . VAL A  1  71  ? 12.330  -3.632 70.688 1.00 44.09 ? 99   VAL A C     1 
ATOM   525   O  O     . VAL A  1  71  ? 12.438  -4.060 69.535 1.00 45.07 ? 99   VAL A O     1 
ATOM   526   C  CB    . VAL A  1  71  ? 10.008  -3.259 71.689 1.00 46.11 ? 99   VAL A CB    1 
ATOM   527   C  CG1   . VAL A  1  71  ? 9.502   -2.924 70.287 1.00 46.85 ? 99   VAL A CG1   1 
ATOM   528   C  CG2   . VAL A  1  71  ? 8.889   -3.899 72.508 1.00 48.30 ? 99   VAL A CG2   1 
ATOM   529   N  N     . TRP A  1  72  ? 13.130  -2.687 71.183 1.00 41.40 ? 100  TRP A N     1 
ATOM   530   C  CA    . TRP A  1  72  ? 14.161  -2.062 70.350 1.00 40.17 ? 100  TRP A CA    1 
ATOM   531   C  C     . TRP A  1  72  ? 15.262  -3.043 69.951 1.00 41.82 ? 100  TRP A C     1 
ATOM   532   O  O     . TRP A  1  72  ? 15.829  -2.920 68.866 1.00 41.32 ? 100  TRP A O     1 
ATOM   533   C  CB    . TRP A  1  72  ? 14.739  -0.798 71.003 1.00 37.94 ? 100  TRP A CB    1 
ATOM   534   C  CG    . TRP A  1  72  ? 13.719  0.288  71.135 1.00 37.65 ? 100  TRP A CG    1 
ATOM   535   C  CD1   . TRP A  1  72  ? 13.192  0.778  72.289 1.00 37.92 ? 100  TRP A CD1   1 
ATOM   536   C  CD2   . TRP A  1  72  ? 13.074  0.995  70.066 1.00 38.45 ? 100  TRP A CD2   1 
ATOM   537   N  NE1   . TRP A  1  72  ? 12.261  1.753  72.013 1.00 37.96 ? 100  TRP A NE1   1 
ATOM   538   C  CE2   . TRP A  1  72  ? 12.171  1.906  70.654 1.00 38.37 ? 100  TRP A CE2   1 
ATOM   539   C  CE3   . TRP A  1  72  ? 13.171  0.945  68.667 1.00 38.54 ? 100  TRP A CE3   1 
ATOM   540   C  CZ2   . TRP A  1  72  ? 11.371  2.763  69.893 1.00 39.95 ? 100  TRP A CZ2   1 
ATOM   541   C  CZ3   . TRP A  1  72  ? 12.376  1.799  67.911 1.00 38.52 ? 100  TRP A CZ3   1 
ATOM   542   C  CH2   . TRP A  1  72  ? 11.490  2.695  68.525 1.00 39.39 ? 100  TRP A CH2   1 
ATOM   543   N  N     . ASN A  1  73  ? 15.537  -4.020 70.818 1.00 43.94 ? 101  ASN A N     1 
ATOM   544   C  CA    . ASN A  1  73  ? 16.480  -5.092 70.501 1.00 47.04 ? 101  ASN A CA    1 
ATOM   545   C  C     . ASN A  1  73  ? 16.055  -5.887 69.274 1.00 49.09 ? 101  ASN A C     1 
ATOM   546   O  O     . ASN A  1  73  ? 16.895  -6.245 68.453 1.00 50.59 ? 101  ASN A O     1 
ATOM   547   C  CB    . ASN A  1  73  ? 16.692  -6.027 71.697 1.00 49.89 ? 101  ASN A CB    1 
ATOM   548   C  CG    . ASN A  1  73  ? 17.544  -5.398 72.787 1.00 49.93 ? 101  ASN A CG    1 
ATOM   549   O  OD1   . ASN A  1  73  ? 18.288  -4.445 72.546 1.00 49.78 ? 101  ASN A OD1   1 
ATOM   550   N  ND2   . ASN A  1  73  ? 17.441  -5.934 73.996 1.00 53.04 ? 101  ASN A ND2   1 
ATOM   551   N  N     . ILE A  1  74  ? 14.753  -6.143 69.151 1.00 49.82 ? 102  ILE A N     1 
ATOM   552   C  CA    . ILE A  1  74  ? 14.198  -6.804 67.967 1.00 52.53 ? 102  ILE A CA    1 
ATOM   553   C  C     . ILE A  1  74  ? 14.255  -5.874 66.744 1.00 50.57 ? 102  ILE A C     1 
ATOM   554   O  O     . ILE A  1  74  ? 14.744  -6.271 65.681 1.00 52.20 ? 102  ILE A O     1 
ATOM   555   C  CB    . ILE A  1  74  ? 12.756  -7.335 68.216 1.00 55.09 ? 102  ILE A CB    1 
ATOM   556   C  CG1   . ILE A  1  74  ? 12.753  -8.359 69.358 1.00 57.56 ? 102  ILE A CG1   1 
ATOM   557   C  CG2   . ILE A  1  74  ? 12.172  -7.958 66.944 1.00 58.12 ? 102  ILE A CG2   1 
ATOM   558   C  CD1   . ILE A  1  74  ? 11.397  -8.589 69.988 1.00 59.96 ? 102  ILE A CD1   1 
ATOM   559   N  N     . VAL A  1  75  ? 13.782  -4.640 66.909 1.00 47.35 ? 103  VAL A N     1 
ATOM   560   C  CA    . VAL A  1  75  ? 13.780  -3.648 65.825 1.00 45.64 ? 103  VAL A CA    1 
ATOM   561   C  C     . VAL A  1  75  ? 15.186  -3.414 65.257 1.00 44.74 ? 103  VAL A C     1 
ATOM   562   O  O     . VAL A  1  75  ? 15.371  -3.429 64.037 1.00 45.50 ? 103  VAL A O     1 
ATOM   563   C  CB    . VAL A  1  75  ? 13.120  -2.311 66.265 1.00 43.03 ? 103  VAL A CB    1 
ATOM   564   C  CG1   . VAL A  1  75  ? 13.324  -1.213 65.217 1.00 41.98 ? 103  VAL A CG1   1 
ATOM   565   C  CG2   . VAL A  1  75  ? 11.637  -2.518 66.526 1.00 44.90 ? 103  VAL A CG2   1 
ATOM   566   N  N     . ASN A  1  76  ? 16.167  -3.221 66.139 1.00 43.71 ? 104  ASN A N     1 
ATOM   567   C  CA    . ASN A  1  76  ? 17.554  -3.002 65.720 1.00 43.88 ? 104  ASN A CA    1 
ATOM   568   C  C     . ASN A  1  76  ? 18.154  -4.159 64.925 1.00 47.77 ? 104  ASN A C     1 
ATOM   569   O  O     . ASN A  1  76  ? 18.981  -3.938 64.041 1.00 48.16 ? 104  ASN A O     1 
ATOM   570   C  CB    . ASN A  1  76  ? 18.452  -2.671 66.918 1.00 43.06 ? 104  ASN A CB    1 
ATOM   571   C  CG    . ASN A  1  76  ? 18.030  -1.395 67.639 1.00 40.18 ? 104  ASN A CG    1 
ATOM   572   O  OD1   . ASN A  1  76  ? 17.362  -0.528 67.069 1.00 38.32 ? 104  ASN A OD1   1 
ATOM   573   N  ND2   . ASN A  1  76  ? 18.412  -1.284 68.902 1.00 39.97 ? 104  ASN A ND2   1 
ATOM   574   N  N     . ASN A  1  77  ? 17.738  -5.385 65.234 1.00 51.27 ? 105  ASN A N     1 
ATOM   575   C  CA    . ASN A  1  77  ? 18.279  -6.563 64.558 1.00 56.23 ? 105  ASN A CA    1 
ATOM   576   C  C     . ASN A  1  77  ? 17.466  -7.033 63.345 1.00 58.71 ? 105  ASN A C     1 
ATOM   577   O  O     . ASN A  1  77  ? 17.789  -8.054 62.730 1.00 63.34 ? 105  ASN A O     1 
ATOM   578   C  CB    . ASN A  1  77  ? 18.523  -7.693 65.563 1.00 59.79 ? 105  ASN A CB    1 
ATOM   579   C  CG    . ASN A  1  77  ? 19.610  -7.346 66.568 1.00 59.56 ? 105  ASN A CG    1 
ATOM   580   O  OD1   . ASN A  1  77  ? 20.728  -6.989 66.195 1.00 60.66 ? 105  ASN A OD1   1 
ATOM   581   N  ND2   . ASN A  1  77  ? 19.285  -7.447 67.848 1.00 60.19 ? 105  ASN A ND2   1 
ATOM   582   N  N     . ILE A  1  78  A 16.418  -6.284 63.010 1.00 56.75 ? 105  ILE A N     1 
ATOM   583   C  CA    . ILE A  1  78  A 15.670  -6.491 61.770 1.00 59.35 ? 105  ILE A CA    1 
ATOM   584   C  C     . ILE A  1  78  A 15.917  -5.274 60.862 1.00 56.67 ? 105  ILE A C     1 
ATOM   585   O  O     . ILE A  1  78  A 15.309  -4.217 61.056 1.00 53.95 ? 105  ILE A O     1 
ATOM   586   C  CB    . ILE A  1  78  A 14.143  -6.704 62.021 1.00 60.76 ? 105  ILE A CB    1 
ATOM   587   C  CG1   . ILE A  1  78  A 13.884  -7.841 63.024 1.00 63.61 ? 105  ILE A CG1   1 
ATOM   588   C  CG2   . ILE A  1  78  A 13.390  -6.937 60.705 1.00 64.17 ? 105  ILE A CG2   1 
ATOM   589   C  CD1   . ILE A  1  78  A 14.301  -9.237 62.563 1.00 69.94 ? 105  ILE A CD1   1 
ATOM   590   N  N     . PRO A  1  79  ? 16.821  -5.421 59.873 1.00 58.13 ? 106  PRO A N     1 
ATOM   591   C  CA    . PRO A  1  79  ? 17.253  -4.315 59.010 1.00 55.77 ? 106  PRO A CA    1 
ATOM   592   C  C     . PRO A  1  79  ? 16.113  -3.521 58.363 1.00 55.04 ? 106  PRO A C     1 
ATOM   593   O  O     . PRO A  1  79  ? 16.202  -2.297 58.272 1.00 51.75 ? 106  PRO A O     1 
ATOM   594   C  CB    . PRO A  1  79  ? 18.100  -5.013 57.943 1.00 59.03 ? 106  PRO A CB    1 
ATOM   595   C  CG    . PRO A  1  79  ? 18.623  -6.230 58.632 1.00 62.59 ? 106  PRO A CG    1 
ATOM   596   C  CD    . PRO A  1  79  ? 17.515  -6.680 59.537 1.00 62.68 ? 106  PRO A CD    1 
ATOM   597   N  N     . PHE A  1  80  ? 15.060  -4.208 57.928 1.00 58.80 ? 107  PHE A N     1 
ATOM   598   C  CA    . PHE A  1  80  ? 13.905  -3.551 57.306 1.00 59.77 ? 107  PHE A CA    1 
ATOM   599   C  C     . PHE A  1  80  ? 13.167  -2.611 58.262 1.00 56.69 ? 107  PHE A C     1 
ATOM   600   O  O     . PHE A  1  80  ? 12.760  -1.519 57.866 1.00 55.70 ? 107  PHE A O     1 
ATOM   601   C  CB    . PHE A  1  80  ? 12.926  -4.580 56.717 1.00 65.60 ? 107  PHE A CB    1 
ATOM   602   C  CG    . PHE A  1  80  ? 11.653  -3.969 56.185 1.00 68.40 ? 107  PHE A CG    1 
ATOM   603   C  CD1   . PHE A  1  80  ? 11.629  -3.353 54.936 1.00 70.57 ? 107  PHE A CD1   1 
ATOM   604   C  CD2   . PHE A  1  80  ? 10.482  -3.996 56.942 1.00 70.63 ? 107  PHE A CD2   1 
ATOM   605   C  CE1   . PHE A  1  80  ? 10.454  -2.782 54.442 1.00 73.75 ? 107  PHE A CE1   1 
ATOM   606   C  CE2   . PHE A  1  80  ? 9.301   -3.428 56.458 1.00 73.74 ? 107  PHE A CE2   1 
ATOM   607   C  CZ    . PHE A  1  80  ? 9.288   -2.820 55.205 1.00 75.32 ? 107  PHE A CZ    1 
ATOM   608   N  N     . LEU A  1  81  ? 12.985  -3.047 59.507 1.00 55.92 ? 108  LEU A N     1 
ATOM   609   C  CA    . LEU A  1  81  ? 12.323  -2.227 60.522 1.00 53.51 ? 108  LEU A CA    1 
ATOM   610   C  C     . LEU A  1  81  ? 13.200  -1.048 60.946 1.00 49.00 ? 108  LEU A C     1 
ATOM   611   O  O     . LEU A  1  81  ? 12.714  0.078  61.072 1.00 47.71 ? 108  LEU A O     1 
ATOM   612   C  CB    . LEU A  1  81  ? 11.944  -3.065 61.745 1.00 54.47 ? 108  LEU A CB    1 
ATOM   613   C  CG    . LEU A  1  81  ? 10.846  -4.118 61.599 1.00 59.68 ? 108  LEU A CG    1 
ATOM   614   C  CD1   . LEU A  1  81  ? 10.791  -4.997 62.843 1.00 60.76 ? 108  LEU A CD1   1 
ATOM   615   C  CD2   . LEU A  1  81  ? 9.488   -3.475 61.327 1.00 61.93 ? 108  LEU A CD2   1 
ATOM   616   N  N     . ARG A  1  82  ? 14.486  -1.320 61.162 1.00 47.33 ? 109  ARG A N     1 
ATOM   617   C  CA    . ARG A  1  82  ? 15.451  -0.293 61.541 1.00 43.95 ? 109  ARG A CA    1 
ATOM   618   C  C     . ARG A  1  82  ? 15.466  0.833  60.504 1.00 42.94 ? 109  ARG A C     1 
ATOM   619   O  O     . ARG A  1  82  ? 15.367  2.006  60.863 1.00 41.04 ? 109  ARG A O     1 
ATOM   620   C  CB    . ARG A  1  82  ? 16.850  -0.898 61.707 1.00 44.18 ? 109  ARG A CB    1 
ATOM   621   C  CG    . ARG A  1  82  ? 17.881  0.051  62.317 1.00 42.05 ? 109  ARG A CG    1 
ATOM   622   C  CD    . ARG A  1  82  ? 19.292  -0.480 62.154 1.00 43.80 ? 109  ARG A CD    1 
ATOM   623   N  NE    . ARG A  1  82  ? 20.307  0.439  62.678 1.00 42.50 ? 109  ARG A NE    1 
ATOM   624   C  CZ    . ARG A  1  82  ? 21.608  0.361  62.398 1.00 44.10 ? 109  ARG A CZ    1 
ATOM   625   N  NH1   . ARG A  1  82  ? 22.064  -0.585 61.587 1.00 46.33 ? 109  ARG A NH1   1 
ATOM   626   N  NH2   . ARG A  1  82  ? 22.459  1.233  62.922 1.00 43.41 ? 109  ARG A NH2   1 
ATOM   627   N  N     . SER A  1  83  ? 15.570  0.463  59.225 1.00 44.51 ? 110  SER A N     1 
ATOM   628   C  CA    . SER A  1  83  ? 15.519  1.425  58.115 1.00 44.15 ? 110  SER A CA    1 
ATOM   629   C  C     . SER A  1  83  ? 14.219  2.222  58.097 1.00 44.54 ? 110  SER A C     1 
ATOM   630   O  O     . SER A  1  83  ? 14.226  3.426  57.833 1.00 43.67 ? 110  SER A O     1 
ATOM   631   C  CB    . SER A  1  83  ? 15.695  0.711  56.777 1.00 46.76 ? 110  SER A CB    1 
ATOM   632   O  OG    . SER A  1  83  ? 16.973  0.118  56.691 1.00 47.22 ? 110  SER A OG    1 
ATOM   633   N  N     . LEU A  1  84  ? 13.108  1.542  58.378 1.00 46.50 ? 111  LEU A N     1 
ATOM   634   C  CA    . LEU A  1  84  ? 11.796  2.178  58.408 1.00 48.08 ? 111  LEU A CA    1 
ATOM   635   C  C     . LEU A  1  84  ? 11.723  3.229  59.518 1.00 45.65 ? 111  LEU A C     1 
ATOM   636   O  O     . LEU A  1  84  ? 11.272  4.352  59.280 1.00 46.22 ? 111  LEU A O     1 
ATOM   637   C  CB    . LEU A  1  84  ? 10.692  1.124  58.577 1.00 51.42 ? 111  LEU A CB    1 
ATOM   638   C  CG    . LEU A  1  84  ? 9.270   1.417  58.092 1.00 55.47 ? 111  LEU A CG    1 
ATOM   639   C  CD1   . LEU A  1  84  ? 8.498   0.109  57.938 1.00 59.55 ? 111  LEU A CD1   1 
ATOM   640   C  CD2   . LEU A  1  84  ? 8.521   2.362  59.019 1.00 55.25 ? 111  LEU A CD2   1 
ATOM   641   N  N     . ILE A  1  85  ? 12.164  2.865  60.722 1.00 43.62 ? 112  ILE A N     1 
ATOM   642   C  CA    . ILE A  1  85  ? 12.160  3.797  61.850 1.00 42.12 ? 112  ILE A CA    1 
ATOM   643   C  C     . ILE A  1  85  ? 13.111  4.969  61.586 1.00 40.40 ? 112  ILE A C     1 
ATOM   644   O  O     . ILE A  1  85  ? 12.749  6.119  61.825 1.00 41.02 ? 112  ILE A O     1 
ATOM   645   C  CB    . ILE A  1  85  ? 12.502  3.111  63.210 1.00 40.90 ? 112  ILE A CB    1 
ATOM   646   C  CG1   . ILE A  1  85  ? 11.554  1.936  63.514 1.00 43.20 ? 112  ILE A CG1   1 
ATOM   647   C  CG2   . ILE A  1  85  ? 12.519  4.137  64.360 1.00 39.48 ? 112  ILE A CG2   1 
ATOM   648   C  CD1   . ILE A  1  85  ? 10.095  2.309  63.770 1.00 45.60 ? 112  ILE A CD1   1 
ATOM   649   N  N     . MET A  1  86  ? 14.310  4.676  61.077 1.00 39.15 ? 113  MET A N     1 
ATOM   650   C  CA    . MET A  1  86  ? 15.287  5.718  60.752 1.00 37.89 ? 113  MET A CA    1 
ATOM   651   C  C     . MET A  1  86  ? 14.775  6.674  59.679 1.00 39.62 ? 113  MET A C     1 
ATOM   652   O  O     . MET A  1  86  ? 15.028  7.874  59.753 1.00 39.38 ? 113  MET A O     1 
ATOM   653   C  CB    . MET A  1  86  ? 16.636  5.118  60.331 1.00 37.02 ? 113  MET A CB    1 
ATOM   654   C  CG    . MET A  1  86  ? 17.770  6.137  60.281 1.00 34.89 ? 113  MET A CG    1 
ATOM   655   S  SD    . MET A  1  86  ? 18.073  6.850  61.907 1.00 32.00 ? 113  MET A SD    1 
ATOM   656   C  CE    . MET A  1  86  ? 18.890  8.397  61.511 1.00 32.37 ? 113  MET A CE    1 
ATOM   657   N  N     . LYS A  1  87  ? 14.052  6.134  58.696 1.00 42.46 ? 114  LYS A N     1 
ATOM   658   C  CA    . LYS A  1  87  ? 13.399  6.949  57.668 1.00 45.34 ? 114  LYS A CA    1 
ATOM   659   C  C     . LYS A  1  87  ? 12.383  7.907  58.300 1.00 47.40 ? 114  LYS A C     1 
ATOM   660   O  O     . LYS A  1  87  ? 12.289  9.067  57.895 1.00 48.82 ? 114  LYS A O     1 
ATOM   661   C  CB    . LYS A  1  87  ? 12.738  6.073  56.593 1.00 48.08 ? 114  LYS A CB    1 
ATOM   662   C  CG    . LYS A  1  87  ? 12.331  6.834  55.328 1.00 50.69 ? 114  LYS A CG    1 
ATOM   663   C  CD    . LYS A  1  87  ? 12.073  5.908  54.142 1.00 54.23 ? 114  LYS A CD    1 
ATOM   664   C  CE    . LYS A  1  87  ? 10.618  5.464  54.067 1.00 58.76 ? 114  LYS A CE    1 
ATOM   665   N  N     . TYR A  1  88  ? 11.637  7.418  59.291 1.00 48.41 ? 115  TYR A N     1 
ATOM   666   C  CA    . TYR A  1  88  ? 10.715  8.259  60.055 1.00 51.01 ? 115  TYR A CA    1 
ATOM   667   C  C     . TYR A  1  88  ? 11.471  9.370  60.784 1.00 49.34 ? 115  TYR A C     1 
ATOM   668   O  O     . TYR A  1  88  ? 11.124  10.545 60.647 1.00 51.59 ? 115  TYR A O     1 
ATOM   669   C  CB    . TYR A  1  88  ? 9.885   7.421  61.043 1.00 52.09 ? 115  TYR A CB    1 
ATOM   670   C  CG    . TYR A  1  88  ? 9.314   8.209  62.216 1.00 54.53 ? 115  TYR A CG    1 
ATOM   671   C  CD1   . TYR A  1  88  ? 8.202   9.041  62.051 1.00 60.25 ? 115  TYR A CD1   1 
ATOM   672   C  CD2   . TYR A  1  88  ? 9.886   8.116  63.494 1.00 53.25 ? 115  TYR A CD2   1 
ATOM   673   C  CE1   . TYR A  1  88  ? 7.676   9.765  63.126 1.00 62.63 ? 115  TYR A CE1   1 
ATOM   674   C  CE2   . TYR A  1  88  ? 9.368   8.838  64.577 1.00 54.93 ? 115  TYR A CE2   1 
ATOM   675   C  CZ    . TYR A  1  88  ? 8.264   9.659  64.382 1.00 59.76 ? 115  TYR A CZ    1 
ATOM   676   O  OH    . TYR A  1  88  ? 7.744   10.375 65.439 1.00 62.86 ? 115  TYR A OH    1 
ATOM   677   N  N     . VAL A  1  89  ? 12.505  8.989  61.538 1.00 46.25 ? 116  VAL A N     1 
ATOM   678   C  CA    . VAL A  1  89  ? 13.335  9.942  62.280 1.00 45.27 ? 116  VAL A CA    1 
ATOM   679   C  C     . VAL A  1  89  ? 13.812  11.073 61.363 1.00 46.60 ? 116  VAL A C     1 
ATOM   680   O  O     . VAL A  1  89  ? 13.614  12.255 61.672 1.00 48.58 ? 116  VAL A O     1 
ATOM   681   C  CB    . VAL A  1  89  ? 14.546  9.249  62.965 1.00 42.64 ? 116  VAL A CB    1 
ATOM   682   C  CG1   . VAL A  1  89  ? 15.489  10.282 63.588 1.00 42.22 ? 116  VAL A CG1   1 
ATOM   683   C  CG2   . VAL A  1  89  ? 14.077  8.244  64.011 1.00 41.33 ? 116  VAL A CG2   1 
ATOM   684   N  N     . LEU A  1  90  ? 14.401  10.697 60.226 1.00 45.93 ? 117  LEU A N     1 
ATOM   685   C  CA    . LEU A  1  90  ? 14.941  11.650 59.258 1.00 47.33 ? 117  LEU A CA    1 
ATOM   686   C  C     . LEU A  1  90  ? 13.889  12.605 58.690 1.00 51.37 ? 117  LEU A C     1 
ATOM   687   O  O     . LEU A  1  90  ? 14.116  13.816 58.630 1.00 53.16 ? 117  LEU A O     1 
ATOM   688   C  CB    . LEU A  1  90  ? 15.667  10.923 58.113 1.00 46.18 ? 117  LEU A CB    1 
ATOM   689   C  CG    . LEU A  1  90  ? 16.941  10.116 58.413 1.00 43.44 ? 117  LEU A CG    1 
ATOM   690   C  CD1   . LEU A  1  90  ? 17.416  9.364  57.178 1.00 42.17 ? 117  LEU A CD1   1 
ATOM   691   C  CD2   . LEU A  1  90  ? 18.070  10.982 58.973 1.00 42.14 ? 117  LEU A CD2   1 
ATOM   692   N  N     . THR A  1  91  ? 12.742  12.058 58.287 1.00 53.65 ? 118  THR A N     1 
ATOM   693   C  CA    . THR A  1  91  ? 11.720  12.845 57.592 1.00 58.71 ? 118  THR A CA    1 
ATOM   694   C  C     . THR A  1  91  ? 10.863  13.717 58.513 1.00 62.05 ? 118  THR A C     1 
ATOM   695   O  O     . THR A  1  91  ? 10.406  14.782 58.101 1.00 66.39 ? 118  THR A O     1 
ATOM   696   C  CB    . THR A  1  91  ? 10.805  11.967 56.700 1.00 60.83 ? 118  THR A CB    1 
ATOM   697   O  OG1   . THR A  1  91  ? 10.308  10.858 57.460 1.00 59.48 ? 118  THR A OG1   1 
ATOM   698   C  CG2   . THR A  1  91  ? 11.566  11.457 55.474 1.00 59.62 ? 118  THR A CG2   1 
ATOM   699   N  N     . SER A  1  92  ? 10.655  13.275 59.750 1.00 61.09 ? 119  SER A N     1 
ATOM   700   C  CA    . SER A  1  92  ? 9.841   14.026 60.710 1.00 64.88 ? 119  SER A CA    1 
ATOM   701   C  C     . SER A  1  92  ? 10.492  15.337 61.156 1.00 66.39 ? 119  SER A C     1 
ATOM   702   O  O     . SER A  1  92  ? 9.799   16.315 61.453 1.00 70.99 ? 119  SER A O     1 
ATOM   703   C  CB    . SER A  1  92  ? 9.529   13.166 61.928 1.00 62.85 ? 119  SER A CB    1 
ATOM   704   O  OG    . SER A  1  92  ? 10.720  12.789 62.586 1.00 58.81 ? 119  SER A OG    1 
ATOM   705   N  N     . ARG A  1  93  ? 11.821  15.347 61.198 1.00 63.54 ? 120  ARG A N     1 
ATOM   706   C  CA    . ARG A  1  93  ? 12.584  16.517 61.632 1.00 65.52 ? 120  ARG A CA    1 
ATOM   707   C  C     . ARG A  1  93  ? 13.000  17.388 60.448 1.00 68.21 ? 120  ARG A C     1 
ATOM   708   O  O     . ARG A  1  93  ? 13.519  18.494 60.623 1.00 70.64 ? 120  ARG A O     1 
ATOM   709   C  CB    . ARG A  1  93  ? 13.811  16.074 62.432 1.00 61.50 ? 120  ARG A CB    1 
ATOM   710   C  CG    . ARG A  1  93  ? 13.459  15.217 63.638 1.00 59.95 ? 120  ARG A CG    1 
ATOM   711   C  CD    . ARG A  1  93  ? 14.640  15.023 64.565 1.00 57.37 ? 120  ARG A CD    1 
ATOM   712   N  NE    . ARG A  1  93  ? 14.240  14.532 65.886 1.00 55.88 ? 120  ARG A NE    1 
ATOM   713   C  CZ    . ARG A  1  93  ? 13.763  15.297 66.868 1.00 58.14 ? 120  ARG A CZ    1 
ATOM   714   N  NH1   . ARG A  1  93  ? 13.603  16.604 66.696 1.00 62.14 ? 120  ARG A NH1   1 
ATOM   715   N  NH2   . ARG A  1  93  ? 13.441  14.750 68.029 1.00 57.11 ? 120  ARG A NH2   1 
ATOM   716   N  N     . SER A  1  94  ? 12.738  16.887 59.244 1.00 68.60 ? 121  SER A N     1 
ATOM   717   C  CA    . SER A  1  94  ? 13.210  17.509 58.014 1.00 70.62 ? 121  SER A CA    1 
ATOM   718   C  C     . SER A  1  94  ? 12.462  18.794 57.645 1.00 76.90 ? 121  SER A C     1 
ATOM   719   O  O     . SER A  1  94  ? 13.096  19.798 57.307 1.00 79.02 ? 121  SER A O     1 
ATOM   720   C  CB    . SER A  1  94  ? 13.152  16.503 56.863 1.00 68.97 ? 121  SER A CB    1 
ATOM   721   O  OG    . SER A  1  94  ? 14.267  16.663 56.006 1.00 68.30 ? 121  SER A OG    1 
ATOM   722   N  N     . TYR A  1  95  ? 11.129  18.765 57.732 1.00 43.24 ? 122  TYR A N     1 
ATOM   723   C  CA    . TYR A  1  95  ? 10.282  19.877 57.264 1.00 42.90 ? 122  TYR A CA    1 
ATOM   724   C  C     . TYR A  1  95  ? 10.462  21.196 58.034 1.00 40.67 ? 122  TYR A C     1 
ATOM   725   O  O     . TYR A  1  95  ? 9.979   22.241 57.593 1.00 40.80 ? 122  TYR A O     1 
ATOM   726   C  CB    . TYR A  1  95  ? 8.797   19.464 57.255 1.00 45.20 ? 122  TYR A CB    1 
ATOM   727   C  CG    . TYR A  1  95  ? 8.144   19.480 58.623 1.00 48.31 ? 122  TYR A CG    1 
ATOM   728   C  CD1   . TYR A  1  95  ? 8.198   18.360 59.460 1.00 51.46 ? 122  TYR A CD1   1 
ATOM   729   C  CD2   . TYR A  1  95  ? 7.480   20.622 59.089 1.00 50.14 ? 122  TYR A CD2   1 
ATOM   730   C  CE1   . TYR A  1  95  ? 7.602   18.376 60.729 1.00 53.51 ? 122  TYR A CE1   1 
ATOM   731   C  CE2   . TYR A  1  95  ? 6.886   20.650 60.356 1.00 51.78 ? 122  TYR A CE2   1 
ATOM   732   C  CZ    . TYR A  1  95  ? 6.949   19.525 61.168 1.00 53.68 ? 122  TYR A CZ    1 
ATOM   733   O  OH    . TYR A  1  95  ? 6.362   19.548 62.418 1.00 55.56 ? 122  TYR A OH    1 
ATOM   734   N  N     . LEU A  1  96  ? 11.163  21.148 59.164 1.00 38.87 ? 123  LEU A N     1 
ATOM   735   C  CA    . LEU A  1  96  ? 11.275  22.298 60.068 1.00 36.44 ? 123  LEU A CA    1 
ATOM   736   C  C     . LEU A  1  96  ? 12.278  23.372 59.656 1.00 34.08 ? 123  LEU A C     1 
ATOM   737   O  O     . LEU A  1  96  ? 12.234  24.482 60.169 1.00 33.30 ? 123  LEU A O     1 
ATOM   738   C  CB    . LEU A  1  96  ? 11.575  21.822 61.489 1.00 36.53 ? 123  LEU A CB    1 
ATOM   739   C  CG    . LEU A  1  96  ? 10.363  21.276 62.248 1.00 37.89 ? 123  LEU A CG    1 
ATOM   740   C  CD1   . LEU A  1  96  ? 10.788  20.267 63.300 1.00 38.09 ? 123  LEU A CD1   1 
ATOM   741   C  CD2   . LEU A  1  96  ? 9.558   22.419 62.872 1.00 37.07 ? 123  LEU A CD2   1 
ATOM   742   N  N     . ILE A  1  97  ? 13.174  23.050 58.732 1.00 32.83 ? 124  ILE A N     1 
ATOM   743   C  CA    . ILE A  1  97  ? 14.216  23.989 58.314 1.00 30.75 ? 124  ILE A CA    1 
ATOM   744   C  C     . ILE A  1  97  ? 13.903  24.575 56.931 1.00 30.19 ? 124  ILE A C     1 
ATOM   745   O  O     . ILE A  1  97  ? 13.634  23.835 55.991 1.00 30.89 ? 124  ILE A O     1 
ATOM   746   C  CB    . ILE A  1  97  ? 15.630  23.302 58.328 1.00 30.44 ? 124  ILE A CB    1 
ATOM   747   C  CG1   . ILE A  1  97  ? 15.899  22.633 59.689 1.00 31.06 ? 124  ILE A CG1   1 
ATOM   748   C  CG2   . ILE A  1  97  ? 16.758  24.289 57.934 1.00 28.57 ? 124  ILE A CG2   1 
ATOM   749   C  CD1   . ILE A  1  97  ? 15.850  23.574 60.904 1.00 29.46 ? 124  ILE A CD1   1 
ATOM   750   N  N     . ASP A  1  98  ? 13.928  25.900 56.816 1.00 28.87 ? 125  ASP A N     1 
ATOM   751   C  CA    . ASP A  1  98  ? 13.792  26.560 55.513 1.00 28.31 ? 125  ASP A CA    1 
ATOM   752   C  C     . ASP A  1  98  ? 14.994  26.210 54.632 1.00 27.53 ? 125  ASP A C     1 
ATOM   753   O  O     . ASP A  1  98  ? 16.135  26.442 55.016 1.00 26.18 ? 125  ASP A O     1 
ATOM   754   C  CB    . ASP A  1  98  ? 13.724  28.082 55.680 1.00 27.93 ? 125  ASP A CB    1 
ATOM   755   C  CG    . ASP A  1  98  ? 12.405  28.564 56.290 1.00 30.15 ? 125  ASP A CG    1 
ATOM   756   O  OD1   . ASP A  1  98  ? 11.445  27.773 56.417 1.00 30.38 ? 125  ASP A OD1   1 
ATOM   757   O  OD2   . ASP A  1  98  ? 12.335  29.765 56.644 1.00 33.60 ? 125  ASP A OD2   1 
ATOM   758   N  N     . SER A  1  99  ? 14.733  25.640 53.459 1.00 27.39 ? 126  SER A N     1 
ATOM   759   C  CA    . SER A  1  99  ? 15.800  25.222 52.561 1.00 26.87 ? 126  SER A CA    1 
ATOM   760   C  C     . SER A  1  99  ? 15.266  25.173 51.128 1.00 26.90 ? 126  SER A C     1 
ATOM   761   O  O     . SER A  1  99  ? 14.424  24.333 50.827 1.00 28.00 ? 126  SER A O     1 
ATOM   762   C  CB    . SER A  1  99  ? 16.352  23.854 52.994 1.00 27.45 ? 126  SER A CB    1 
ATOM   763   O  OG    . SER A  1  99  ? 17.478  23.480 52.221 1.00 27.96 ? 126  SER A OG    1 
ATOM   764   N  N     . PRO A  1  100 ? 15.720  26.095 50.244 1.00 25.82 ? 127  PRO A N     1 
ATOM   765   C  CA    . PRO A  1  100 ? 16.679  27.204 50.408 1.00 24.46 ? 127  PRO A CA    1 
ATOM   766   C  C     . PRO A  1  100 ? 16.408  28.129 51.600 1.00 23.49 ? 127  PRO A C     1 
ATOM   767   O  O     . PRO A  1  100 ? 15.251  28.346 51.963 1.00 23.97 ? 127  PRO A O     1 
ATOM   768   C  CB    . PRO A  1  100 ? 16.527  27.995 49.095 1.00 24.61 ? 127  PRO A CB    1 
ATOM   769   C  CG    . PRO A  1  100 ? 16.098  26.971 48.100 1.00 25.86 ? 127  PRO A CG    1 
ATOM   770   C  CD    . PRO A  1  100 ? 15.186  26.044 48.865 1.00 26.48 ? 127  PRO A CD    1 
ATOM   771   N  N     . PRO A  1  101 ? 17.477  28.689 52.198 1.00 22.69 ? 128  PRO A N     1 
ATOM   772   C  CA    . PRO A  1  101 ? 17.348  29.463 53.420 1.00 21.84 ? 128  PRO A CA    1 
ATOM   773   C  C     . PRO A  1  101 ? 16.721  30.839 53.156 1.00 21.65 ? 128  PRO A C     1 
ATOM   774   O  O     . PRO A  1  101 ? 16.647  31.278 52.004 1.00 21.56 ? 128  PRO A O     1 
ATOM   775   C  CB    . PRO A  1  101 ? 18.795  29.615 53.867 1.00 21.41 ? 128  PRO A CB    1 
ATOM   776   C  CG    . PRO A  1  101 ? 19.532  29.718 52.582 1.00 21.63 ? 128  PRO A CG    1 
ATOM   777   C  CD    . PRO A  1  101 ? 18.865  28.710 51.692 1.00 22.03 ? 128  PRO A CD    1 
ATOM   778   N  N     . THR A  1  102 ? 16.277  31.490 54.236 1.00 21.18 ? 129  THR A N     1 
ATOM   779   C  CA    . THR A  1  102 ? 15.521  32.740 54.136 1.00 21.51 ? 129  THR A CA    1 
ATOM   780   C  C     . THR A  1  102 ? 16.207  33.886 54.893 1.00 21.31 ? 129  THR A C     1 
ATOM   781   O  O     . THR A  1  102 ? 17.098  34.530 54.354 1.00 21.04 ? 129  THR A O     1 
ATOM   782   C  CB    . THR A  1  102 ? 14.070  32.540 54.639 1.00 22.13 ? 129  THR A CB    1 
ATOM   783   O  OG1   . THR A  1  102 ? 14.103  31.868 55.906 1.00 22.49 ? 129  THR A OG1   1 
ATOM   784   C  CG2   . THR A  1  102 ? 13.263  31.680 53.653 1.00 22.04 ? 129  THR A CG2   1 
ATOM   785   N  N     . TYR A  1  103 ? 15.832  34.123 56.139 1.00 21.54 ? 130  TYR A N     1 
ATOM   786   C  CA    . TYR A  1  103 ? 16.229  35.334 56.877 1.00 21.60 ? 130  TYR A CA    1 
ATOM   787   C  C     . TYR A  1  103 ? 17.678  35.340 57.343 1.00 20.73 ? 130  TYR A C     1 
ATOM   788   O  O     . TYR A  1  103 ? 18.324  34.293 57.405 1.00 20.67 ? 130  TYR A O     1 
ATOM   789   C  CB    . TYR A  1  103 ? 15.289  35.551 58.076 1.00 22.03 ? 130  TYR A CB    1 
ATOM   790   C  CG    . TYR A  1  103 ? 13.833  35.411 57.695 1.00 24.29 ? 130  TYR A CG    1 
ATOM   791   C  CD1   . TYR A  1  103 ? 13.231  36.320 56.815 1.00 25.68 ? 130  TYR A CD1   1 
ATOM   792   C  CD2   . TYR A  1  103 ? 13.064  34.354 58.187 1.00 24.75 ? 130  TYR A CD2   1 
ATOM   793   C  CE1   . TYR A  1  103 ? 11.907  36.181 56.450 1.00 28.23 ? 130  TYR A CE1   1 
ATOM   794   C  CE2   . TYR A  1  103 ? 11.742  34.205 57.825 1.00 27.72 ? 130  TYR A CE2   1 
ATOM   795   C  CZ    . TYR A  1  103 ? 11.167  35.119 56.964 1.00 28.83 ? 130  TYR A CZ    1 
ATOM   796   O  OH    . TYR A  1  103 ? 9.861   34.963 56.595 1.00 31.68 ? 130  TYR A OH    1 
ATOM   797   N  N     . ASN A  1  104 ? 18.194  36.529 57.647 1.00 20.35 ? 131  ASN A N     1 
ATOM   798   C  CA    . ASN A  1  104 ? 19.448  36.636 58.384 1.00 20.19 ? 131  ASN A CA    1 
ATOM   799   C  C     . ASN A  1  104 ? 19.409  37.832 59.337 1.00 20.52 ? 131  ASN A C     1 
ATOM   800   O  O     . ASN A  1  104 ? 18.353  38.466 59.488 1.00 21.63 ? 131  ASN A O     1 
ATOM   801   C  CB    . ASN A  1  104 ? 20.694  36.590 57.455 1.00 19.79 ? 131  ASN A CB    1 
ATOM   802   C  CG    . ASN A  1  104 ? 20.839  37.822 56.562 1.00 19.28 ? 131  ASN A CG    1 
ATOM   803   O  OD1   . ASN A  1  104 ? 20.471  38.940 56.939 1.00 18.59 ? 131  ASN A OD1   1 
ATOM   804   N  ND2   . ASN A  1  104 ? 21.417  37.620 55.377 1.00 18.87 ? 131  ASN A ND2   1 
ATOM   805   N  N     . VAL A  1  105 ? 20.531  38.139 59.983 1.00 20.50 ? 132  VAL A N     1 
ATOM   806   C  CA    . VAL A  1  105 ? 20.566  39.227 60.964 1.00 20.90 ? 132  VAL A CA    1 
ATOM   807   C  C     . VAL A  1  105 ? 20.132  40.583 60.386 1.00 21.81 ? 132  VAL A C     1 
ATOM   808   O  O     . VAL A  1  105 ? 19.579  41.414 61.105 1.00 22.17 ? 132  VAL A O     1 
ATOM   809   C  CB    . VAL A  1  105 ? 21.948  39.341 61.687 1.00 20.73 ? 132  VAL A CB    1 
ATOM   810   C  CG1   . VAL A  1  105 ? 23.050  39.800 60.738 1.00 20.50 ? 132  VAL A CG1   1 
ATOM   811   C  CG2   . VAL A  1  105 ? 21.851  40.278 62.901 1.00 20.01 ? 132  VAL A CG2   1 
ATOM   812   N  N     . HIS A  1  106 ? 20.371  40.799 59.094 1.00 22.05 ? 133  HIS A N     1 
ATOM   813   C  CA    . HIS A  1  106 ? 20.041  42.086 58.481 1.00 23.40 ? 133  HIS A CA    1 
ATOM   814   C  C     . HIS A  1  106 ? 18.715  42.093 57.725 1.00 23.45 ? 133  HIS A C     1 
ATOM   815   O  O     . HIS A  1  106 ? 18.231  43.154 57.350 1.00 24.38 ? 133  HIS A O     1 
ATOM   816   C  CB    . HIS A  1  106 ? 21.169  42.560 57.555 1.00 23.68 ? 133  HIS A CB    1 
ATOM   817   C  CG    . HIS A  1  106 ? 22.371  43.074 58.278 1.00 25.23 ? 133  HIS A CG    1 
ATOM   818   N  ND1   . HIS A  1  106 ? 23.613  43.161 57.683 1.00 26.06 ? 133  HIS A ND1   1 
ATOM   819   C  CD2   . HIS A  1  106 ? 22.526  43.531 59.545 1.00 25.55 ? 133  HIS A CD2   1 
ATOM   820   C  CE1   . HIS A  1  106 ? 24.476  43.658 58.552 1.00 26.90 ? 133  HIS A CE1   1 
ATOM   821   N  NE2   . HIS A  1  106 ? 23.845  43.882 59.690 1.00 25.98 ? 133  HIS A NE2   1 
ATOM   822   N  N     . TYR A  1  107 ? 18.135  40.915 57.504 1.00 22.97 ? 134  TYR A N     1 
ATOM   823   C  CA    . TYR A  1  107 ? 16.914  40.803 56.705 1.00 23.13 ? 134  TYR A CA    1 
ATOM   824   C  C     . TYR A  1  107 ? 15.832  40.001 57.415 1.00 23.36 ? 134  TYR A C     1 
ATOM   825   O  O     . TYR A  1  107 ? 15.952  38.784 57.589 1.00 22.69 ? 134  TYR A O     1 
ATOM   826   C  CB    . TYR A  1  107 ? 17.227  40.240 55.309 1.00 22.92 ? 134  TYR A CB    1 
ATOM   827   C  CG    . TYR A  1  107 ? 18.093  41.192 54.504 1.00 22.91 ? 134  TYR A CG    1 
ATOM   828   C  CD1   . TYR A  1  107 ? 17.523  42.247 53.787 1.00 23.14 ? 134  TYR A CD1   1 
ATOM   829   C  CD2   . TYR A  1  107 ? 19.483  41.064 54.498 1.00 21.80 ? 134  TYR A CD2   1 
ATOM   830   C  CE1   . TYR A  1  107 ? 18.318  43.142 53.069 1.00 23.30 ? 134  TYR A CE1   1 
ATOM   831   C  CE2   . TYR A  1  107 ? 20.288  41.955 53.790 1.00 21.41 ? 134  TYR A CE2   1 
ATOM   832   C  CZ    . TYR A  1  107 ? 19.703  42.987 53.079 1.00 23.05 ? 134  TYR A CZ    1 
ATOM   833   O  OH    . TYR A  1  107 ? 20.496  43.863 52.379 1.00 23.95 ? 134  TYR A OH    1 
ATOM   834   N  N     . GLY A  1  108 ? 14.792  40.709 57.847 1.00 23.74 ? 135  GLY A N     1 
ATOM   835   C  CA    . GLY A  1  108 ? 13.620  40.091 58.459 1.00 24.14 ? 135  GLY A CA    1 
ATOM   836   C  C     . GLY A  1  108 ? 12.536  39.771 57.441 1.00 24.69 ? 135  GLY A C     1 
ATOM   837   O  O     . GLY A  1  108 ? 11.435  39.353 57.801 1.00 25.39 ? 135  GLY A O     1 
ATOM   838   N  N     . TYR A  1  109 ? 12.858  39.981 56.167 1.00 24.40 ? 136  TYR A N     1 
ATOM   839   C  CA    . TYR A  1  109 ? 12.007  39.606 55.032 1.00 24.70 ? 136  TYR A CA    1 
ATOM   840   C  C     . TYR A  1  109 ? 12.932  38.919 54.038 1.00 24.22 ? 136  TYR A C     1 
ATOM   841   O  O     . TYR A  1  109 ? 14.151  39.159 54.057 1.00 23.15 ? 136  TYR A O     1 
ATOM   842   C  CB    . TYR A  1  109 ? 11.395  40.857 54.387 1.00 25.45 ? 136  TYR A CB    1 
ATOM   843   C  CG    . TYR A  1  109 ? 12.433  41.918 54.034 1.00 25.67 ? 136  TYR A CG    1 
ATOM   844   C  CD1   . TYR A  1  109 ? 13.052  41.939 52.779 1.00 24.21 ? 136  TYR A CD1   1 
ATOM   845   C  CD2   . TYR A  1  109 ? 12.805  42.892 54.967 1.00 25.85 ? 136  TYR A CD2   1 
ATOM   846   C  CE1   . TYR A  1  109 ? 14.010  42.907 52.471 1.00 24.18 ? 136  TYR A CE1   1 
ATOM   847   C  CE2   . TYR A  1  109 ? 13.757  43.852 54.666 1.00 23.87 ? 136  TYR A CE2   1 
ATOM   848   C  CZ    . TYR A  1  109 ? 14.354  43.856 53.423 1.00 24.08 ? 136  TYR A CZ    1 
ATOM   849   O  OH    . TYR A  1  109 ? 15.304  44.816 53.139 1.00 24.47 ? 136  TYR A OH    1 
ATOM   850   N  N     . LYS A  1  110 ? 12.377  38.064 53.184 1.00 24.26 ? 137  LYS A N     1 
ATOM   851   C  CA    . LYS A  1  110 ? 13.188  37.380 52.171 1.00 24.34 ? 137  LYS A CA    1 
ATOM   852   C  C     . LYS A  1  110 ? 13.765  38.357 51.151 1.00 23.87 ? 137  LYS A C     1 
ATOM   853   O  O     . LYS A  1  110 ? 13.080  39.284 50.723 1.00 23.97 ? 137  LYS A O     1 
ATOM   854   C  CB    . LYS A  1  110 ? 12.388  36.287 51.469 1.00 24.94 ? 137  LYS A CB    1 
ATOM   855   C  CG    . LYS A  1  110 ? 12.078  35.114 52.393 1.00 27.20 ? 137  LYS A CG    1 
ATOM   856   C  CD    . LYS A  1  110 ? 11.044  34.216 51.791 1.00 30.37 ? 137  LYS A CD    1 
ATOM   857   C  CE    . LYS A  1  110 ? 10.319  33.451 52.869 1.00 33.37 ? 137  LYS A CE    1 
ATOM   858   N  NZ    . LYS A  1  110 ? 9.412   34.321 53.644 1.00 35.33 ? 137  LYS A NZ    1 
ATOM   859   N  N     . SER A  1  111 ? 15.029  38.144 50.782 1.00 23.10 ? 138  SER A N     1 
ATOM   860   C  CA    . SER A  1  111 ? 15.710  38.989 49.797 1.00 23.62 ? 138  SER A CA    1 
ATOM   861   C  C     . SER A  1  111 ? 16.807  38.207 49.086 1.00 23.05 ? 138  SER A C     1 
ATOM   862   O  O     . SER A  1  111 ? 17.315  37.224 49.629 1.00 22.59 ? 138  SER A O     1 
ATOM   863   C  CB    . SER A  1  111 ? 16.318  40.225 50.466 1.00 23.48 ? 138  SER A CB    1 
ATOM   864   O  OG    . SER A  1  111 ? 17.392  39.856 51.322 1.00 24.74 ? 138  SER A OG    1 
ATOM   865   N  N     . TRP A  1  112 ? 17.169  38.649 47.877 1.00 23.26 ? 139  TRP A N     1 
ATOM   866   C  CA    . TRP A  1  112 ? 18.276  38.041 47.152 1.00 22.81 ? 139  TRP A CA    1 
ATOM   867   C  C     . TRP A  1  112 ? 19.600  38.204 47.899 1.00 22.47 ? 139  TRP A C     1 
ATOM   868   O  O     . TRP A  1  112 ? 20.473  37.338 47.802 1.00 22.27 ? 139  TRP A O     1 
ATOM   869   C  CB    . TRP A  1  112 ? 18.409  38.551 45.699 1.00 23.19 ? 139  TRP A CB    1 
ATOM   870   C  CG    . TRP A  1  112 ? 19.284  37.621 44.926 1.00 22.51 ? 139  TRP A CG    1 
ATOM   871   C  CD1   . TRP A  1  112 ? 20.623  37.760 44.680 1.00 21.91 ? 139  TRP A CD1   1 
ATOM   872   C  CD2   . TRP A  1  112 ? 18.906  36.349 44.385 1.00 23.38 ? 139  TRP A CD2   1 
ATOM   873   N  NE1   . TRP A  1  112 ? 21.094  36.662 43.995 1.00 23.03 ? 139  TRP A NE1   1 
ATOM   874   C  CE2   . TRP A  1  112 ? 20.063  35.778 43.807 1.00 23.05 ? 139  TRP A CE2   1 
ATOM   875   C  CE3   . TRP A  1  112 ? 17.694  35.636 44.327 1.00 22.75 ? 139  TRP A CE3   1 
ATOM   876   C  CZ2   . TRP A  1  112 ? 20.044  34.534 43.162 1.00 23.52 ? 139  TRP A CZ2   1 
ATOM   877   C  CZ3   . TRP A  1  112 ? 17.674  34.412 43.682 1.00 22.67 ? 139  TRP A CZ3   1 
ATOM   878   C  CH2   . TRP A  1  112 ? 18.844  33.869 43.109 1.00 24.86 ? 139  TRP A CH2   1 
ATOM   879   N  N     . GLU A  1  113 ? 19.761  39.305 48.631 1.00 22.48 ? 140  GLU A N     1 
ATOM   880   C  CA    . GLU A  1  113 ? 20.988  39.504 49.412 1.00 22.68 ? 140  GLU A CA    1 
ATOM   881   C  C     . GLU A  1  113 ? 21.113  38.450 50.519 1.00 22.31 ? 140  GLU A C     1 
ATOM   882   O  O     . GLU A  1  113 ? 22.189  37.880 50.724 1.00 22.36 ? 140  GLU A O     1 
ATOM   883   C  CB    . GLU A  1  113 ? 21.081  40.927 49.982 1.00 23.01 ? 140  GLU A CB    1 
ATOM   884   C  CG    . GLU A  1  113 ? 22.277  41.149 50.926 1.00 24.07 ? 140  GLU A CG    1 
ATOM   885   C  CD    . GLU A  1  113 ? 23.626  41.159 50.220 1.00 25.50 ? 140  GLU A CD    1 
ATOM   886   O  OE1   . GLU A  1  113 ? 23.668  41.288 48.971 1.00 26.35 ? 140  GLU A OE1   1 
ATOM   887   O  OE2   . GLU A  1  113 ? 24.656  41.061 50.922 1.00 25.39 ? 140  GLU A OE2   1 
ATOM   888   N  N     . ALA A  1  114 ? 20.010  38.185 51.217 1.00 22.29 ? 141  ALA A N     1 
ATOM   889   C  CA    . ALA A  1  114 ? 19.990  37.165 52.260 1.00 22.01 ? 141  ALA A CA    1 
ATOM   890   C  C     . ALA A  1  114 ? 20.230  35.772 51.681 1.00 21.88 ? 141  ALA A C     1 
ATOM   891   O  O     . ALA A  1  114 ? 21.028  35.008 52.223 1.00 21.29 ? 141  ALA A O     1 
ATOM   892   C  CB    . ALA A  1  114 ? 18.685  37.212 53.043 1.00 22.02 ? 141  ALA A CB    1 
ATOM   893   N  N     . PHE A  1  115 ? 19.553  35.444 50.576 1.00 22.04 ? 142  PHE A N     1 
ATOM   894   C  CA    . PHE A  1  115 ? 19.796  34.164 49.916 1.00 21.59 ? 142  PHE A CA    1 
ATOM   895   C  C     . PHE A  1  115 ? 21.240  33.983 49.439 1.00 21.52 ? 142  PHE A C     1 
ATOM   896   O  O     . PHE A  1  115 ? 21.841  32.920 49.626 1.00 21.27 ? 142  PHE A O     1 
ATOM   897   C  CB    . PHE A  1  115 ? 18.856  33.929 48.727 1.00 21.71 ? 142  PHE A CB    1 
ATOM   898   C  CG    . PHE A  1  115 ? 19.286  32.770 47.875 1.00 22.28 ? 142  PHE A CG    1 
ATOM   899   C  CD1   . PHE A  1  115 ? 19.097  31.464 48.321 1.00 20.89 ? 142  PHE A CD1   1 
ATOM   900   C  CD2   . PHE A  1  115 ? 19.959  32.982 46.664 1.00 21.14 ? 142  PHE A CD2   1 
ATOM   901   C  CE1   . PHE A  1  115 ? 19.537  30.387 47.561 1.00 22.09 ? 142  PHE A CE1   1 
ATOM   902   C  CE2   . PHE A  1  115 ? 20.399  31.915 45.895 1.00 22.36 ? 142  PHE A CE2   1 
ATOM   903   C  CZ    . PHE A  1  115 ? 20.184  30.606 46.341 1.00 22.41 ? 142  PHE A CZ    1 
ATOM   904   N  N     . SER A  1  116 ? 21.776  35.006 48.783 1.00 21.58 ? 143  SER A N     1 
ATOM   905   C  CA    . SER A  1  116 ? 22.997  34.825 48.005 1.00 21.59 ? 143  SER A CA    1 
ATOM   906   C  C     . SER A  1  116 ? 24.270  35.035 48.809 1.00 21.58 ? 143  SER A C     1 
ATOM   907   O  O     . SER A  1  116 ? 25.314  34.484 48.466 1.00 21.31 ? 143  SER A O     1 
ATOM   908   C  CB    . SER A  1  116 ? 23.001  35.720 46.757 1.00 21.87 ? 143  SER A CB    1 
ATOM   909   O  OG    . SER A  1  116 ? 23.028  37.096 47.103 1.00 20.71 ? 143  SER A OG    1 
ATOM   910   N  N     . ASN A  1  117 ? 24.193  35.830 49.872 1.00 21.38 ? 144  ASN A N     1 
ATOM   911   C  CA    . ASN A  1  117 ? 25.410  36.180 50.608 1.00 21.83 ? 144  ASN A CA    1 
ATOM   912   C  C     . ASN A  1  117 ? 25.774  35.100 51.632 1.00 21.04 ? 144  ASN A C     1 
ATOM   913   O  O     . ASN A  1  117 ? 25.162  34.992 52.694 1.00 20.87 ? 144  ASN A O     1 
ATOM   914   C  CB    . ASN A  1  117 ? 25.279  37.575 51.235 1.00 21.86 ? 144  ASN A CB    1 
ATOM   915   C  CG    . ASN A  1  117 ? 26.590  38.128 51.746 1.00 24.31 ? 144  ASN A CG    1 
ATOM   916   O  OD1   . ASN A  1  117 ? 27.481  37.392 52.192 1.00 23.07 ? 144  ASN A OD1   1 
ATOM   917   N  ND2   . ASN A  1  117 ? 26.712  39.447 51.688 1.00 27.55 ? 144  ASN A ND2   1 
ATOM   918   N  N     . LEU A  1  118 ? 26.783  34.304 51.292 1.00 20.95 ? 145  LEU A N     1 
ATOM   919   C  CA    . LEU A  1  118 ? 27.193  33.157 52.106 1.00 20.61 ? 145  LEU A CA    1 
ATOM   920   C  C     . LEU A  1  118 ? 27.925  33.550 53.393 1.00 20.74 ? 145  LEU A C     1 
ATOM   921   O  O     . LEU A  1  118 ? 28.123  32.710 54.274 1.00 20.18 ? 145  LEU A O     1 
ATOM   922   C  CB    . LEU A  1  118 ? 28.040  32.178 51.276 1.00 21.04 ? 145  LEU A CB    1 
ATOM   923   C  CG    . LEU A  1  118 ? 27.362  31.557 50.039 1.00 21.49 ? 145  LEU A CG    1 
ATOM   924   C  CD1   . LEU A  1  118 ? 28.351  30.696 49.229 1.00 21.56 ? 145  LEU A CD1   1 
ATOM   925   C  CD2   . LEU A  1  118 ? 26.147  30.726 50.435 1.00 19.38 ? 145  LEU A CD2   1 
ATOM   926   N  N     . SER A  1  119 ? 28.311  34.825 53.502 1.00 21.07 ? 146  SER A N     1 
ATOM   927   C  CA    . SER A  1  119 ? 29.041  35.314 54.673 1.00 21.68 ? 146  SER A CA    1 
ATOM   928   C  C     . SER A  1  119 ? 28.171  35.416 55.917 1.00 20.91 ? 146  SER A C     1 
ATOM   929   O  O     . SER A  1  119 ? 28.690  35.482 57.028 1.00 21.40 ? 146  SER A O     1 
ATOM   930   C  CB    . SER A  1  119 ? 29.692  36.661 54.386 1.00 21.99 ? 146  SER A CB    1 
ATOM   931   O  OG    . SER A  1  119 ? 30.839  36.466 53.593 1.00 25.30 ? 146  SER A OG    1 
ATOM   932   N  N     . TYR A  1  120 ? 26.857  35.437 55.725 1.00 20.29 ? 147  TYR A N     1 
ATOM   933   C  CA    . TYR A  1  120 ? 25.911  35.442 56.839 1.00 19.93 ? 147  TYR A CA    1 
ATOM   934   C  C     . TYR A  1  120 ? 25.598  34.027 57.335 1.00 19.46 ? 147  TYR A C     1 
ATOM   935   O  O     . TYR A  1  120 ? 25.495  33.077 56.547 1.00 19.05 ? 147  TYR A O     1 
ATOM   936   C  CB    . TYR A  1  120 ? 24.581  36.041 56.401 1.00 19.79 ? 147  TYR A CB    1 
ATOM   937   C  CG    . TYR A  1  120 ? 24.531  37.530 56.147 1.00 21.01 ? 147  TYR A CG    1 
ATOM   938   C  CD1   . TYR A  1  120 ? 24.184  38.416 57.173 1.00 21.31 ? 147  TYR A CD1   1 
ATOM   939   C  CD2   . TYR A  1  120 ? 24.747  38.050 54.865 1.00 20.95 ? 147  TYR A CD2   1 
ATOM   940   C  CE1   . TYR A  1  120 ? 24.075  39.782 56.942 1.00 21.29 ? 147  TYR A CE1   1 
ATOM   941   C  CE2   . TYR A  1  120 ? 24.652  39.426 54.624 1.00 22.97 ? 147  TYR A CE2   1 
ATOM   942   C  CZ    . TYR A  1  120 ? 24.307  40.285 55.674 1.00 21.89 ? 147  TYR A CZ    1 
ATOM   943   O  OH    . TYR A  1  120 ? 24.206  41.639 55.458 1.00 22.56 ? 147  TYR A OH    1 
ATOM   944   N  N     . TYR A  1  121 ? 25.429  33.895 58.645 1.00 19.27 ? 148  TYR A N     1 
ATOM   945   C  CA    . TYR A  1  121 ? 24.657  32.787 59.180 1.00 19.18 ? 148  TYR A CA    1 
ATOM   946   C  C     . TYR A  1  121 ? 23.204  33.062 58.801 1.00 19.28 ? 148  TYR A C     1 
ATOM   947   O  O     . TYR A  1  121 ? 22.765  34.214 58.809 1.00 18.11 ? 148  TYR A O     1 
ATOM   948   C  CB    . TYR A  1  121 ? 24.747  32.758 60.705 1.00 19.29 ? 148  TYR A CB    1 
ATOM   949   C  CG    . TYR A  1  121 ? 26.051  32.266 61.286 1.00 19.53 ? 148  TYR A CG    1 
ATOM   950   C  CD1   . TYR A  1  121 ? 26.494  30.962 61.057 1.00 19.86 ? 148  TYR A CD1   1 
ATOM   951   C  CD2   . TYR A  1  121 ? 26.819  33.092 62.108 1.00 20.77 ? 148  TYR A CD2   1 
ATOM   952   C  CE1   . TYR A  1  121 ? 27.688  30.497 61.618 1.00 21.50 ? 148  TYR A CE1   1 
ATOM   953   C  CE2   . TYR A  1  121 ? 28.015  32.643 62.671 1.00 21.14 ? 148  TYR A CE2   1 
ATOM   954   C  CZ    . TYR A  1  121 ? 28.439  31.344 62.426 1.00 22.29 ? 148  TYR A CZ    1 
ATOM   955   O  OH    . TYR A  1  121 ? 29.616  30.890 62.980 1.00 24.41 ? 148  TYR A OH    1 
ATOM   956   N  N     . THR A  1  122 ? 22.449  32.015 58.483 1.00 19.52 ? 149  THR A N     1 
ATOM   957   C  CA    . THR A  1  122 ? 21.028  32.202 58.233 1.00 19.96 ? 149  THR A CA    1 
ATOM   958   C  C     . THR A  1  122 ? 20.287  32.265 59.578 1.00 20.42 ? 149  THR A C     1 
ATOM   959   O  O     . THR A  1  122 ? 20.895  32.074 60.643 1.00 20.59 ? 149  THR A O     1 
ATOM   960   C  CB    . THR A  1  122 ? 20.456  31.124 57.278 1.00 20.46 ? 149  THR A CB    1 
ATOM   961   O  OG1   . THR A  1  122 ? 19.153  31.520 56.829 1.00 21.28 ? 149  THR A OG1   1 
ATOM   962   C  CG2   . THR A  1  122 ? 20.391  29.737 57.950 1.00 20.26 ? 149  THR A CG2   1 
ATOM   963   N  N     . ARG A  1  123 ? 18.990  32.553 59.533 1.00 20.56 ? 150  ARG A N     1 
ATOM   964   C  CA    . ARG A  1  123 ? 18.194  32.686 60.741 1.00 21.34 ? 150  ARG A CA    1 
ATOM   965   C  C     . ARG A  1  123 ? 16.896  31.893 60.638 1.00 21.88 ? 150  ARG A C     1 
ATOM   966   O  O     . ARG A  1  123 ? 16.179  32.001 59.645 1.00 22.45 ? 150  ARG A O     1 
ATOM   967   C  CB    . ARG A  1  123 ? 17.920  34.170 61.031 1.00 21.23 ? 150  ARG A CB    1 
ATOM   968   C  CG    . ARG A  1  123 ? 19.108  34.870 61.703 1.00 21.53 ? 150  ARG A CG    1 
ATOM   969   C  CD    . ARG A  1  123 ? 19.120  34.579 63.222 1.00 21.78 ? 150  ARG A CD    1 
ATOM   970   N  NE    . ARG A  1  123 ? 18.143  35.406 63.940 1.00 21.19 ? 150  ARG A NE    1 
ATOM   971   C  CZ    . ARG A  1  123 ? 18.388  36.644 64.368 1.00 22.47 ? 150  ARG A CZ    1 
ATOM   972   N  NH1   . ARG A  1  123 ? 19.580  37.194 64.150 1.00 20.18 ? 150  ARG A NH1   1 
ATOM   973   N  NH2   . ARG A  1  123 ? 17.446  37.335 65.018 1.00 19.51 ? 150  ARG A NH2   1 
ATOM   974   N  N     . ALA A  1  124 ? 16.618  31.082 61.655 1.00 22.23 ? 151  ALA A N     1 
ATOM   975   C  CA    . ALA A  1  124 ? 15.371  30.309 61.722 1.00 22.84 ? 151  ALA A CA    1 
ATOM   976   C  C     . ALA A  1  124 ? 14.167  31.202 62.019 1.00 23.16 ? 151  ALA A C     1 
ATOM   977   O  O     . ALA A  1  124 ? 13.046  30.911 61.583 1.00 24.15 ? 151  ALA A O     1 
ATOM   978   C  CB    . ALA A  1  124 ? 15.483  29.200 62.765 1.00 23.21 ? 151  ALA A CB    1 
ATOM   979   N  N     . LEU A  1  125 ? 14.392  32.263 62.790 1.00 22.54 ? 152  LEU A N     1 
ATOM   980   C  CA    . LEU A  1  125 ? 13.387  33.313 62.966 1.00 23.02 ? 152  LEU A CA    1 
ATOM   981   C  C     . LEU A  1  125 ? 13.990  34.653 62.593 1.00 22.75 ? 152  LEU A C     1 
ATOM   982   O  O     . LEU A  1  125 ? 15.159  34.898 62.889 1.00 21.74 ? 152  LEU A O     1 
ATOM   983   C  CB    . LEU A  1  125 ? 12.866  33.375 64.410 1.00 23.02 ? 152  LEU A CB    1 
ATOM   984   C  CG    . LEU A  1  125 ? 11.866  32.328 64.896 1.00 23.56 ? 152  LEU A CG    1 
ATOM   985   C  CD1   . LEU A  1  125 ? 11.550  32.570 66.369 1.00 22.33 ? 152  LEU A CD1   1 
ATOM   986   C  CD2   . LEU A  1  125 ? 10.584  32.325 64.056 1.00 23.71 ? 152  LEU A CD2   1 
ATOM   987   N  N     . PRO A  1  126 ? 13.191  35.537 61.964 1.00 23.36 ? 153  PRO A N     1 
ATOM   988   C  CA    . PRO A  1  126 ? 13.722  36.862 61.637 1.00 23.63 ? 153  PRO A CA    1 
ATOM   989   C  C     . PRO A  1  126 ? 14.115  37.637 62.907 1.00 23.81 ? 153  PRO A C     1 
ATOM   990   O  O     . PRO A  1  126 ? 13.614  37.318 63.987 1.00 24.26 ? 153  PRO A O     1 
ATOM   991   C  CB    . PRO A  1  126 ? 12.554  37.545 60.909 1.00 24.28 ? 153  PRO A CB    1 
ATOM   992   C  CG    . PRO A  1  126 ? 11.323  36.820 61.363 1.00 25.35 ? 153  PRO A CG    1 
ATOM   993   C  CD    . PRO A  1  126 ? 11.761  35.402 61.628 1.00 24.50 ? 153  PRO A CD    1 
ATOM   994   N  N     . PRO A  1  127 ? 15.021  38.633 62.789 1.00 23.68 ? 154  PRO A N     1 
ATOM   995   C  CA    . PRO A  1  127 ? 15.312  39.457 63.964 1.00 23.96 ? 154  PRO A CA    1 
ATOM   996   C  C     . PRO A  1  127 ? 14.123  40.318 64.383 1.00 25.39 ? 154  PRO A C     1 
ATOM   997   O  O     . PRO A  1  127 ? 13.259  40.641 63.558 1.00 25.63 ? 154  PRO A O     1 
ATOM   998   C  CB    . PRO A  1  127 ? 16.474  40.354 63.502 1.00 23.79 ? 154  PRO A CB    1 
ATOM   999   C  CG    . PRO A  1  127 ? 16.416  40.334 62.012 1.00 23.60 ? 154  PRO A CG    1 
ATOM   1000  C  CD    . PRO A  1  127 ? 15.871  38.991 61.636 1.00 23.24 ? 154  PRO A CD    1 
ATOM   1001  N  N     . VAL A  1  128 ? 14.083  40.674 65.666 1.00 26.06 ? 155  VAL A N     1 
ATOM   1002  C  CA    . VAL A  1  128 ? 13.160  41.689 66.149 1.00 27.58 ? 155  VAL A CA    1 
ATOM   1003  C  C     . VAL A  1  128 ? 13.527  42.997 65.440 1.00 28.21 ? 155  VAL A C     1 
ATOM   1004  O  O     . VAL A  1  128 ? 14.701  43.368 65.389 1.00 27.72 ? 155  VAL A O     1 
ATOM   1005  C  CB    . VAL A  1  128 ? 13.236  41.832 67.694 1.00 28.11 ? 155  VAL A CB    1 
ATOM   1006  C  CG1   . VAL A  1  128 ? 12.314  42.931 68.190 1.00 28.88 ? 155  VAL A CG1   1 
ATOM   1007  C  CG2   . VAL A  1  128 ? 12.887  40.491 68.389 1.00 27.72 ? 155  VAL A CG2   1 
ATOM   1008  N  N     . ALA A  1  129 ? 12.532  43.673 64.871 1.00 29.70 ? 156  ALA A N     1 
ATOM   1009  C  CA    . ALA A  1  129 ? 12.761  44.946 64.177 1.00 30.85 ? 156  ALA A CA    1 
ATOM   1010  C  C     . ALA A  1  129 ? 13.453  45.980 65.075 1.00 31.92 ? 156  ALA A C     1 
ATOM   1011  O  O     . ALA A  1  129 ? 13.277  45.970 66.298 1.00 32.26 ? 156  ALA A O     1 
ATOM   1012  C  CB    . ALA A  1  129 ? 11.455  45.502 63.623 1.00 31.80 ? 156  ALA A CB    1 
ATOM   1013  N  N     . ASP A  1  130 ? 14.226  46.874 64.461 1.00 32.70 ? 157  ASP A N     1 
ATOM   1014  C  CA    . ASP A  1  130 ? 15.036  47.847 65.208 1.00 34.35 ? 157  ASP A CA    1 
ATOM   1015  C  C     . ASP A  1  130 ? 14.235  48.841 66.035 1.00 35.80 ? 157  ASP A C     1 
ATOM   1016  O  O     . ASP A  1  130 ? 14.729  49.341 67.042 1.00 36.40 ? 157  ASP A O     1 
ATOM   1017  C  CB    . ASP A  1  130 ? 15.961  48.618 64.266 1.00 34.87 ? 157  ASP A CB    1 
ATOM   1018  C  CG    . ASP A  1  130 ? 16.956  47.722 63.569 1.00 35.70 ? 157  ASP A CG    1 
ATOM   1019  O  OD1   . ASP A  1  130 ? 17.229  46.605 64.072 1.00 37.52 ? 157  ASP A OD1   1 
ATOM   1020  O  OD2   . ASP A  1  130 ? 17.465  48.137 62.509 1.00 38.10 ? 157  ASP A OD2   1 
ATOM   1021  N  N     . ASP A  1  131 ? 13.012  49.135 65.606 1.00 36.62 ? 158  ASP A N     1 
ATOM   1022  C  CA    . ASP A  1  131 ? 12.203  50.156 66.271 1.00 38.51 ? 158  ASP A CA    1 
ATOM   1023  C  C     . ASP A  1  131 ? 11.147  49.625 67.255 1.00 38.71 ? 158  ASP A C     1 
ATOM   1024  O  O     . ASP A  1  131 ? 10.328  50.395 67.746 1.00 40.38 ? 158  ASP A O     1 
ATOM   1025  C  CB    . ASP A  1  131 ? 11.555  51.084 65.230 1.00 39.62 ? 158  ASP A CB    1 
ATOM   1026  C  CG    . ASP A  1  131 ? 10.517  50.376 64.371 1.00 40.24 ? 158  ASP A CG    1 
ATOM   1027  O  OD1   . ASP A  1  131 ? 10.200  49.191 64.631 1.00 39.47 ? 158  ASP A OD1   1 
ATOM   1028  O  OD2   . ASP A  1  131 ? 10.009  51.012 63.427 1.00 42.03 ? 158  ASP A OD2   1 
ATOM   1029  N  N     . CYS A  1  132 ? 11.160  48.325 67.543 1.00 37.39 ? 159  CYS A N     1 
ATOM   1030  C  CA    . CYS A  1  132 ? 10.200  47.758 68.497 1.00 37.73 ? 159  CYS A CA    1 
ATOM   1031  C  C     . CYS A  1  132 ? 10.375  48.364 69.893 1.00 38.76 ? 159  CYS A C     1 
ATOM   1032  O  O     . CYS A  1  132 ? 11.506  48.606 70.320 1.00 38.76 ? 159  CYS A O     1 
ATOM   1033  C  CB    . CYS A  1  132 ? 10.319  46.237 68.562 1.00 36.25 ? 159  CYS A CB    1 
ATOM   1034  S  SG    . CYS A  1  132 ? 9.899   45.387 67.025 1.00 35.58 ? 159  CYS A SG    1 
ATOM   1035  N  N     . PRO A  1  133 ? 9.258   48.610 70.605 1.00 39.76 ? 160  PRO A N     1 
ATOM   1036  C  CA    . PRO A  1  133 ? 9.303   49.266 71.915 1.00 41.06 ? 160  PRO A CA    1 
ATOM   1037  C  C     . PRO A  1  133 ? 10.062  48.495 73.000 1.00 40.23 ? 160  PRO A C     1 
ATOM   1038  O  O     . PRO A  1  133 ? 10.602  49.109 73.921 1.00 41.13 ? 160  PRO A O     1 
ATOM   1039  C  CB    . PRO A  1  133 ? 7.820   49.412 72.294 1.00 42.60 ? 160  PRO A CB    1 
ATOM   1040  C  CG    . PRO A  1  133 ? 7.119   48.363 71.497 1.00 41.92 ? 160  PRO A CG    1 
ATOM   1041  C  CD    . PRO A  1  133 ? 7.877   48.299 70.199 1.00 40.37 ? 160  PRO A CD    1 
ATOM   1042  N  N     . THR A  1  134 ? 10.092  47.171 72.906 1.00 38.70 ? 161  THR A N     1 
ATOM   1043  C  CA    . THR A  1  134 ? 10.849  46.356 73.859 1.00 37.76 ? 161  THR A CA    1 
ATOM   1044  C  C     . THR A  1  134 ? 11.823  45.444 73.110 1.00 35.87 ? 161  THR A C     1 
ATOM   1045  O  O     . THR A  1  134 ? 11.627  45.187 71.919 1.00 35.31 ? 161  THR A O     1 
ATOM   1046  C  CB    . THR A  1  134 ? 9.923   45.491 74.737 1.00 38.12 ? 161  THR A CB    1 
ATOM   1047  O  OG1   . THR A  1  134 ? 9.274   44.511 73.920 1.00 37.81 ? 161  THR A OG1   1 
ATOM   1048  C  CG2   . THR A  1  134 ? 8.874   46.337 75.465 1.00 39.55 ? 161  THR A CG2   1 
ATOM   1049  N  N     . PRO A  1  135 ? 12.867  44.934 73.802 1.00 35.05 ? 162  PRO A N     1 
ATOM   1050  C  CA    . PRO A  1  135 ? 13.855  44.088 73.119 1.00 33.26 ? 162  PRO A CA    1 
ATOM   1051  C  C     . PRO A  1  135 ? 13.263  42.849 72.444 1.00 32.57 ? 162  PRO A C     1 
ATOM   1052  O  O     . PRO A  1  135 ? 13.772  42.420 71.406 1.00 31.44 ? 162  PRO A O     1 
ATOM   1053  C  CB    . PRO A  1  135 ? 14.805  43.676 74.246 1.00 32.94 ? 162  PRO A CB    1 
ATOM   1054  C  CG    . PRO A  1  135 ? 14.676  44.758 75.265 1.00 34.53 ? 162  PRO A CG    1 
ATOM   1055  C  CD    . PRO A  1  135 ? 13.237  45.175 75.210 1.00 35.55 ? 162  PRO A CD    1 
ATOM   1056  N  N     . MET A  1  136 ? 12.201  42.286 73.022 1.00 33.11 ? 163  MET A N     1 
ATOM   1057  C  CA    . MET A  1  136 ? 11.567  41.099 72.454 1.00 32.89 ? 163  MET A CA    1 
ATOM   1058  C  C     . MET A  1  136 ? 10.387  41.397 71.526 1.00 33.55 ? 163  MET A C     1 
ATOM   1059  O  O     . MET A  1  136 ? 9.816   40.477 70.941 1.00 33.44 ? 163  MET A O     1 
ATOM   1060  C  CB    . MET A  1  136 ? 11.145  40.123 73.554 1.00 33.25 ? 163  MET A CB    1 
ATOM   1061  C  CG    . MET A  1  136 ? 12.315  39.449 74.248 1.00 33.24 ? 163  MET A CG    1 
ATOM   1062  S  SD    . MET A  1  136 ? 13.450  38.690 73.078 1.00 34.98 ? 163  MET A SD    1 
ATOM   1063  C  CE    . MET A  1  136 ? 14.613  37.916 74.197 1.00 31.16 ? 163  MET A CE    1 
ATOM   1064  N  N     . GLY A  1  137 ? 10.122  42.644 71.249 1.00 33.97 ? 164  GLY A N     1 
ATOM   1065  C  CA    . GLY A  1  137 ? 8.929   43.081 70.538 1.00 35.32 ? 164  GLY A CA    1 
ATOM   1066  C  C     . GLY A  1  137 ? 8.109   44.032 71.384 1.00 37.12 ? 164  GLY A C     1 
ATOM   1067  O  O     . GLY A  1  137 ? 8.330   45.243 71.346 1.00 37.89 ? 164  GLY A O     1 
ATOM   1068  N  N     . VAL A  1  138 ? 7.047   43.642 71.958 1.00 37.86 ? 165  VAL A N     1 
ATOM   1069  C  CA    . VAL A  1  138 ? 6.179   44.533 72.734 1.00 39.79 ? 165  VAL A CA    1 
ATOM   1070  C  C     . VAL A  1  138 ? 6.071   44.125 74.214 1.00 40.61 ? 165  VAL A C     1 
ATOM   1071  O  O     . VAL A  1  138 ? 5.715   44.943 75.059 1.00 42.14 ? 165  VAL A O     1 
ATOM   1072  C  CB    . VAL A  1  138 ? 4.756   44.695 72.096 1.00 40.82 ? 165  VAL A CB    1 
ATOM   1073  C  CG1   . VAL A  1  138 ? 4.856   45.252 70.667 1.00 40.41 ? 165  VAL A CG1   1 
ATOM   1074  C  CG2   . VAL A  1  138 ? 3.963   43.378 72.122 1.00 39.89 ? 165  VAL A CG2   1 
ATOM   1075  N  N     . LYS A  1  139 ? 6.378   42.865 74.518 1.00 39.98 ? 166  LYS A N     1 
ATOM   1076  C  CA    . LYS A  1  139 ? 6.277   42.340 75.889 1.00 40.82 ? 166  LYS A CA    1 
ATOM   1077  C  C     . LYS A  1  139 ? 7.518   42.656 76.728 1.00 40.23 ? 166  LYS A C     1 
ATOM   1078  O  O     . LYS A  1  139 ? 8.591   42.912 76.185 1.00 38.73 ? 166  LYS A O     1 
ATOM   1079  C  CB    . LYS A  1  139 ? 6.043   40.827 75.865 1.00 40.23 ? 166  LYS A CB    1 
ATOM   1080  C  CG    . LYS A  1  139 ? 4.666   40.399 75.374 1.00 42.85 ? 166  LYS A CG    1 
ATOM   1081  C  CD    . LYS A  1  139 ? 4.530   38.888 75.452 1.00 44.56 ? 166  LYS A CD    1 
ATOM   1082  C  CE    . LYS A  1  139 ? 3.291   38.375 74.724 1.00 46.10 ? 166  LYS A CE    1 
ATOM   1083  N  NZ    . LYS A  1  139 ? 2.046   38.551 75.512 1.00 48.36 ? 166  LYS A NZ    1 
ATOM   1084  N  N     . GLY A  1  140 ? 7.362   42.631 78.051 1.00 41.39 ? 167  GLY A N     1 
ATOM   1085  C  CA    . GLY A  1  140 ? 8.485   42.814 78.974 1.00 41.30 ? 167  GLY A CA    1 
ATOM   1086  C  C     . GLY A  1  140 ? 8.862   44.261 79.252 1.00 42.52 ? 167  GLY A C     1 
ATOM   1087  O  O     . GLY A  1  140 ? 8.176   45.192 78.822 1.00 43.29 ? 167  GLY A O     1 
ATOM   1088  N  N     . ASN A  1  141 ? 9.956   44.442 79.987 1.00 42.60 ? 168  ASN A N     1 
ATOM   1089  C  CA    . ASN A  1  141 ? 10.464  45.769 80.325 1.00 43.91 ? 168  ASN A CA    1 
ATOM   1090  C  C     . ASN A  1  141 ? 11.221  46.413 79.168 1.00 43.36 ? 168  ASN A C     1 
ATOM   1091  O  O     . ASN A  1  141 ? 11.586  45.741 78.198 1.00 41.93 ? 168  ASN A O     1 
ATOM   1092  C  CB    . ASN A  1  141 ? 11.366  45.703 81.566 1.00 44.19 ? 168  ASN A CB    1 
ATOM   1093  C  CG    . ASN A  1  141 ? 10.644  45.168 82.799 1.00 45.53 ? 168  ASN A CG    1 
ATOM   1094  O  OD1   . ASN A  1  141 ? 11.163  44.303 83.510 1.00 45.50 ? 168  ASN A OD1   1 
ATOM   1095  N  ND2   . ASN A  1  141 ? 9.452   45.680 83.057 1.00 45.88 ? 168  ASN A ND2   1 
ATOM   1096  N  N     . LYS A  1  142 ? 11.459  47.718 79.286 1.00 44.86 ? 169  LYS A N     1 
ATOM   1097  C  CA    . LYS A  1  142 ? 12.215  48.491 78.296 1.00 44.61 ? 169  LYS A CA    1 
ATOM   1098  C  C     . LYS A  1  142 ? 13.616  47.910 78.057 1.00 43.01 ? 169  LYS A C     1 
ATOM   1099  O  O     . LYS A  1  142 ? 14.138  47.954 76.945 1.00 42.09 ? 169  LYS A O     1 
ATOM   1100  C  CB    . LYS A  1  142 ? 12.313  49.951 78.752 1.00 46.57 ? 169  LYS A CB    1 
ATOM   1101  C  CG    . LYS A  1  142 ? 12.307  50.966 77.618 1.00 48.00 ? 169  LYS A CG    1 
ATOM   1102  N  N     . GLU A  1  143 ? 14.221  47.375 79.112 1.00 43.11 ? 170  GLU A N     1 
ATOM   1103  C  CA    . GLU A  1  143 ? 15.509  46.704 79.007 1.00 41.99 ? 170  GLU A CA    1 
ATOM   1104  C  C     . GLU A  1  143 ? 15.388  45.266 79.476 1.00 40.63 ? 170  GLU A C     1 
ATOM   1105  O  O     . GLU A  1  143 ? 14.589  44.959 80.372 1.00 41.49 ? 170  GLU A O     1 
ATOM   1106  C  CB    . GLU A  1  143 ? 16.560  47.416 79.856 1.00 43.31 ? 170  GLU A CB    1 
ATOM   1107  C  CG    . GLU A  1  143 ? 17.168  48.657 79.220 1.00 46.32 ? 170  GLU A CG    1 
ATOM   1108  C  CD    . GLU A  1  143 ? 18.434  49.108 79.942 1.00 50.05 ? 170  GLU A CD    1 
ATOM   1109  O  OE1   . GLU A  1  143 ? 18.331  49.639 81.071 1.00 52.42 ? 170  GLU A OE1   1 
ATOM   1110  O  OE2   . GLU A  1  143 ? 19.536  48.926 79.379 1.00 50.52 ? 170  GLU A OE2   1 
ATOM   1111  N  N     . LEU A  1  144 ? 16.175  44.386 78.858 1.00 38.41 ? 171  LEU A N     1 
ATOM   1112  C  CA    . LEU A  1  144 ? 16.372  43.043 79.378 1.00 36.93 ? 171  LEU A CA    1 
ATOM   1113  C  C     . LEU A  1  144 ? 17.282  43.136 80.610 1.00 37.43 ? 171  LEU A C     1 
ATOM   1114  O  O     . LEU A  1  144 ? 18.018  44.119 80.764 1.00 37.82 ? 171  LEU A O     1 
ATOM   1115  C  CB    . LEU A  1  144 ? 16.986  42.131 78.307 1.00 35.10 ? 171  LEU A CB    1 
ATOM   1116  C  CG    . LEU A  1  144 ? 16.067  41.607 77.193 1.00 34.22 ? 171  LEU A CG    1 
ATOM   1117  C  CD1   . LEU A  1  144 ? 16.883  41.082 75.998 1.00 32.85 ? 171  LEU A CD1   1 
ATOM   1118  C  CD2   . LEU A  1  144 ? 15.094  40.544 77.703 1.00 31.61 ? 171  LEU A CD2   1 
ATOM   1119  N  N     . PRO A  1  145 ? 17.231  42.123 81.498 1.00 37.23 ? 172  PRO A N     1 
ATOM   1120  C  CA    . PRO A  1  145 ? 18.123  42.145 82.662 1.00 37.76 ? 172  PRO A CA    1 
ATOM   1121  C  C     . PRO A  1  145 ? 19.610  42.162 82.292 1.00 37.11 ? 172  PRO A C     1 
ATOM   1122  O  O     . PRO A  1  145 ? 20.006  41.646 81.236 1.00 35.77 ? 172  PRO A O     1 
ATOM   1123  C  CB    . PRO A  1  145 ? 17.786  40.837 83.395 1.00 37.41 ? 172  PRO A CB    1 
ATOM   1124  C  CG    . PRO A  1  145 ? 17.131  39.966 82.371 1.00 36.66 ? 172  PRO A CG    1 
ATOM   1125  C  CD    . PRO A  1  145 ? 16.381  40.918 81.482 1.00 36.68 ? 172  PRO A CD    1 
ATOM   1126  N  N     . ASP A  1  146 ? 20.406  42.769 83.170 1.00 37.90 ? 173  ASP A N     1 
ATOM   1127  C  CA    . ASP A  1  146 ? 21.860  42.765 83.097 1.00 37.82 ? 173  ASP A CA    1 
ATOM   1128  C  C     . ASP A  1  146 ? 22.340  41.346 82.815 1.00 36.18 ? 173  ASP A C     1 
ATOM   1129  O  O     . ASP A  1  146 ? 22.030  40.428 83.572 1.00 36.21 ? 173  ASP A O     1 
ATOM   1130  C  CB    . ASP A  1  146 ? 22.413  43.264 84.436 1.00 39.80 ? 173  ASP A CB    1 
ATOM   1131  C  CG    . ASP A  1  146 ? 23.894  43.595 84.391 1.00 41.91 ? 173  ASP A CG    1 
ATOM   1132  O  OD1   . ASP A  1  146 ? 24.275  44.620 84.997 1.00 45.41 ? 173  ASP A OD1   1 
ATOM   1133  O  OD2   . ASP A  1  146 ? 24.682  42.841 83.781 1.00 42.69 ? 173  ASP A OD2   1 
ATOM   1134  N  N     . SER A  1  147 ? 23.075  41.163 81.718 1.00 34.65 ? 174  SER A N     1 
ATOM   1135  C  CA    . SER A  1  147 ? 23.532  39.826 81.313 1.00 33.04 ? 174  SER A CA    1 
ATOM   1136  C  C     . SER A  1  147 ? 24.465  39.185 82.341 1.00 32.94 ? 174  SER A C     1 
ATOM   1137  O  O     . SER A  1  147 ? 24.455  37.969 82.511 1.00 31.97 ? 174  SER A O     1 
ATOM   1138  C  CB    . SER A  1  147 ? 24.196  39.855 79.934 1.00 31.97 ? 174  SER A CB    1 
ATOM   1139  O  OG    . SER A  1  147 ? 25.291  40.758 79.903 1.00 33.42 ? 174  SER A OG    1 
ATOM   1140  N  N     . LYS A  1  148 ? 25.257  40.006 83.028 1.00 33.73 ? 175  LYS A N     1 
ATOM   1141  C  CA    . LYS A  1  148 ? 26.131  39.518 84.095 1.00 34.29 ? 175  LYS A CA    1 
ATOM   1142  C  C     . LYS A  1  148 ? 25.331  38.916 85.262 1.00 34.48 ? 175  LYS A C     1 
ATOM   1143  O  O     . LYS A  1  148 ? 25.726  37.898 85.839 1.00 34.03 ? 175  LYS A O     1 
ATOM   1144  C  CB    . LYS A  1  148 ? 27.071  40.629 84.582 1.00 35.64 ? 175  LYS A CB    1 
ATOM   1145  C  CG    . LYS A  1  148 ? 28.087  40.181 85.638 1.00 37.34 ? 175  LYS A CG    1 
ATOM   1146  C  CD    . LYS A  1  148 ? 28.816  41.374 86.245 1.00 39.41 ? 175  LYS A CD    1 
ATOM   1147  C  CE    . LYS A  1  148 ? 29.353  41.054 87.627 1.00 42.03 ? 175  LYS A CE    1 
ATOM   1148  N  N     . GLU A  1  149 ? 24.203  39.542 85.590 1.00 34.93 ? 176  GLU A N     1 
ATOM   1149  C  CA    . GLU A  1  149 ? 23.305  39.040 86.631 1.00 35.50 ? 176  GLU A CA    1 
ATOM   1150  C  C     . GLU A  1  149 ? 22.672  37.702 86.277 1.00 33.97 ? 176  GLU A C     1 
ATOM   1151  O  O     . GLU A  1  149 ? 22.561  36.821 87.133 1.00 33.89 ? 176  GLU A O     1 
ATOM   1152  C  CB    . GLU A  1  149 ? 22.192  40.037 86.907 1.00 36.65 ? 176  GLU A CB    1 
ATOM   1153  C  CG    . GLU A  1  149 ? 22.441  40.926 88.081 1.00 40.20 ? 176  GLU A CG    1 
ATOM   1154  C  CD    . GLU A  1  149 ? 21.207  41.707 88.443 1.00 44.34 ? 176  GLU A CD    1 
ATOM   1155  O  OE1   . GLU A  1  149 ? 20.403  41.197 89.257 1.00 47.33 ? 176  GLU A OE1   1 
ATOM   1156  O  OE2   . GLU A  1  149 ? 21.042  42.826 87.909 1.00 45.89 ? 176  GLU A OE2   1 
ATOM   1157  N  N     . VAL A  1  150 ? 22.231  37.568 85.030 1.00 32.07 ? 177  VAL A N     1 
ATOM   1158  C  CA    . VAL A  1  150 ? 21.659  36.312 84.564 1.00 31.19 ? 177  VAL A CA    1 
ATOM   1159  C  C     . VAL A  1  150 ? 22.735  35.240 84.693 1.00 30.78 ? 177  VAL A C     1 
ATOM   1160  O  O     . VAL A  1  150 ? 22.504  34.189 85.288 1.00 30.67 ? 177  VAL A O     1 
ATOM   1161  C  CB    . VAL A  1  150 ? 21.161  36.408 83.107 1.00 30.33 ? 177  VAL A CB    1 
ATOM   1162  C  CG1   . VAL A  1  150 ? 20.757  35.034 82.581 1.00 28.97 ? 177  VAL A CG1   1 
ATOM   1163  C  CG2   . VAL A  1  150 ? 19.991  37.408 83.004 1.00 30.45 ? 177  VAL A CG2   1 
ATOM   1164  N  N     . LEU A  1  151 ? 23.918  35.558 84.165 1.00 30.21 ? 178  LEU A N     1 
ATOM   1165  C  CA    . LEU A  1  151 ? 25.072  34.683 84.195 1.00 30.17 ? 178  LEU A CA    1 
ATOM   1166  C  C     . LEU A  1  151 ? 25.367  34.173 85.616 1.00 30.99 ? 178  LEU A C     1 
ATOM   1167  O  O     . LEU A  1  151 ? 25.355  32.966 85.863 1.00 30.65 ? 178  LEU A O     1 
ATOM   1168  C  CB    . LEU A  1  151 ? 26.286  35.424 83.614 1.00 29.96 ? 178  LEU A CB    1 
ATOM   1169  C  CG    . LEU A  1  151 ? 27.645  34.730 83.671 1.00 30.57 ? 178  LEU A CG    1 
ATOM   1170  C  CD1   . LEU A  1  151 ? 27.792  33.786 82.491 1.00 29.67 ? 178  LEU A CD1   1 
ATOM   1171  C  CD2   . LEU A  1  151 ? 28.761  35.763 83.688 1.00 31.26 ? 178  LEU A CD2   1 
ATOM   1172  N  N     . GLU A  1  152 ? 25.611  35.102 86.539 1.00 31.86 ? 179  GLU A N     1 
ATOM   1173  C  CA    . GLU A  1  152 ? 25.980  34.757 87.917 1.00 33.24 ? 179  GLU A CA    1 
ATOM   1174  C  C     . GLU A  1  152 ? 24.880  34.037 88.704 1.00 33.68 ? 179  GLU A C     1 
ATOM   1175  O  O     . GLU A  1  152 ? 25.160  33.073 89.423 1.00 34.05 ? 179  GLU A O     1 
ATOM   1176  C  CB    . GLU A  1  152 ? 26.446  36.000 88.673 1.00 34.20 ? 179  GLU A CB    1 
ATOM   1177  C  CG    . GLU A  1  152 ? 27.756  36.563 88.157 1.00 35.18 ? 179  GLU A CG    1 
ATOM   1178  C  CD    . GLU A  1  152 ? 28.284  37.700 89.008 1.00 38.36 ? 179  GLU A CD    1 
ATOM   1179  O  OE1   . GLU A  1  152 ? 27.471  38.430 89.618 1.00 39.47 ? 179  GLU A OE1   1 
ATOM   1180  O  OE2   . GLU A  1  152 ? 29.519  37.863 89.066 1.00 39.12 ? 179  GLU A OE2   1 
ATOM   1181  N  N     . LYS A  1  153 ? 23.636  34.488 88.555 1.00 33.62 ? 180  LYS A N     1 
ATOM   1182  C  CA    . LYS A  1  153 ? 22.532  33.917 89.322 1.00 34.59 ? 180  LYS A CA    1 
ATOM   1183  C  C     . LYS A  1  153 ? 22.123  32.503 88.909 1.00 33.96 ? 180  LYS A C     1 
ATOM   1184  O  O     . LYS A  1  153 ? 21.845  31.671 89.775 1.00 34.94 ? 180  LYS A O     1 
ATOM   1185  C  CB    . LYS A  1  153 ? 21.322  34.851 89.319 1.00 35.30 ? 180  LYS A CB    1 
ATOM   1186  C  CG    . LYS A  1  153 ? 21.454  36.015 90.293 1.00 37.55 ? 180  LYS A CG    1 
ATOM   1187  C  CD    . LYS A  1  153 ? 20.345  37.029 90.092 1.00 39.81 ? 180  LYS A CD    1 
ATOM   1188  C  CE    . LYS A  1  153 ? 20.464  38.183 91.080 1.00 42.78 ? 180  LYS A CE    1 
ATOM   1189  N  NZ    . LYS A  1  153 ? 19.939  37.815 92.419 1.00 45.83 ? 180  LYS A NZ    1 
ATOM   1190  N  N     . VAL A  1  154 ? 22.093  32.223 87.604 1.00 32.56 ? 181  VAL A N     1 
ATOM   1191  C  CA    . VAL A  1  154 ? 21.552  30.943 87.124 1.00 31.67 ? 181  VAL A CA    1 
ATOM   1192  C  C     . VAL A  1  154 ? 22.462  30.119 86.195 1.00 30.38 ? 181  VAL A C     1 
ATOM   1193  O  O     . VAL A  1  154 ? 22.130  28.979 85.867 1.00 30.27 ? 181  VAL A O     1 
ATOM   1194  C  CB    . VAL A  1  154 ? 20.147  31.107 86.453 1.00 31.71 ? 181  VAL A CB    1 
ATOM   1195  C  CG1   . VAL A  1  154 ? 19.137  31.716 87.418 1.00 33.09 ? 181  VAL A CG1   1 
ATOM   1196  C  CG2   . VAL A  1  154 ? 20.230  31.917 85.144 1.00 30.33 ? 181  VAL A CG2   1 
ATOM   1197  N  N     . LEU A  1  155 ? 23.588  30.680 85.759 1.00 29.58 ? 182  LEU A N     1 
ATOM   1198  C  CA    . LEU A  1  155 ? 24.457  29.961 84.818 1.00 28.59 ? 182  LEU A CA    1 
ATOM   1199  C  C     . LEU A  1  155 ? 25.776  29.444 85.399 1.00 29.07 ? 182  LEU A C     1 
ATOM   1200  O  O     . LEU A  1  155 ? 26.195  28.323 85.076 1.00 28.94 ? 182  LEU A O     1 
ATOM   1201  C  CB    . LEU A  1  155 ? 24.728  30.778 83.550 1.00 27.65 ? 182  LEU A CB    1 
ATOM   1202  C  CG    . LEU A  1  155 ? 23.552  31.185 82.659 1.00 27.46 ? 182  LEU A CG    1 
ATOM   1203  C  CD1   . LEU A  1  155 ? 24.074  31.703 81.319 1.00 27.26 ? 182  LEU A CD1   1 
ATOM   1204  C  CD2   . LEU A  1  155 ? 22.579  30.038 82.447 1.00 28.13 ? 182  LEU A CD2   1 
ATOM   1205  N  N     . LEU A  1  156 ? 26.431  30.251 86.232 1.00 29.35 ? 183  LEU A N     1 
ATOM   1206  C  CA    . LEU A  1  156 ? 27.767  29.901 86.726 1.00 29.68 ? 183  LEU A CA    1 
ATOM   1207  C  C     . LEU A  1  156 ? 27.767  28.688 87.647 1.00 29.96 ? 183  LEU A C     1 
ATOM   1208  O  O     . LEU A  1  156 ? 26.851  28.499 88.451 1.00 29.74 ? 183  LEU A O     1 
ATOM   1209  C  CB    . LEU A  1  156 ? 28.457  31.091 87.403 1.00 30.58 ? 183  LEU A CB    1 
ATOM   1210  C  CG    . LEU A  1  156 ? 28.960  32.235 86.505 1.00 31.71 ? 183  LEU A CG    1 
ATOM   1211  C  CD1   . LEU A  1  156 ? 29.889  33.168 87.286 1.00 33.49 ? 183  LEU A CD1   1 
ATOM   1212  C  CD2   . LEU A  1  156 ? 29.651  31.736 85.239 1.00 29.83 ? 183  LEU A CD2   1 
ATOM   1213  N  N     . ARG A  1  157 ? 28.807  27.868 87.499 1.00 29.83 ? 184  ARG A N     1 
ATOM   1214  C  CA    . ARG A  1  157 ? 28.988  26.656 88.291 1.00 30.63 ? 184  ARG A CA    1 
ATOM   1215  C  C     . ARG A  1  157 ? 29.289  27.006 89.740 1.00 31.77 ? 184  ARG A C     1 
ATOM   1216  O  O     . ARG A  1  157 ? 30.175  27.811 90.022 1.00 32.02 ? 184  ARG A O     1 
ATOM   1217  C  CB    . ARG A  1  157 ? 30.119  25.809 87.696 1.00 30.42 ? 184  ARG A CB    1 
ATOM   1218  C  CG    . ARG A  1  157 ? 30.433  24.511 88.417 1.00 31.39 ? 184  ARG A CG    1 
ATOM   1219  C  CD    . ARG A  1  157 ? 31.454  23.691 87.628 1.00 31.28 ? 184  ARG A CD    1 
ATOM   1220  N  NE    . ARG A  1  157 ? 30.890  23.168 86.380 1.00 30.30 ? 184  ARG A NE    1 
ATOM   1221  C  CZ    . ARG A  1  157 ? 31.604  22.730 85.345 1.00 30.78 ? 184  ARG A CZ    1 
ATOM   1222  N  NH1   . ARG A  1  157 ? 32.933  22.741 85.374 1.00 30.70 ? 184  ARG A NH1   1 
ATOM   1223  N  NH2   . ARG A  1  157 ? 30.981  22.272 84.270 1.00 30.47 ? 184  ARG A NH2   1 
ATOM   1224  N  N     . ARG A  1  158 ? 28.526  26.420 90.652 1.00 32.85 ? 185  ARG A N     1 
ATOM   1225  C  CA    . ARG A  1  158 ? 28.885  26.455 92.068 1.00 34.74 ? 185  ARG A CA    1 
ATOM   1226  C  C     . ARG A  1  158 ? 29.730  25.219 92.297 1.00 35.86 ? 185  ARG A C     1 
ATOM   1227  O  O     . ARG A  1  158 ? 30.926  25.314 92.553 1.00 37.25 ? 185  ARG A O     1 
ATOM   1228  C  CB    . ARG A  1  158 ? 27.644  26.437 92.966 1.00 34.99 ? 185  ARG A CB    1 
ATOM   1229  C  CG    . ARG A  1  158 ? 27.011  27.805 93.207 1.00 35.32 ? 185  ARG A CG    1 
ATOM   1230  C  CD    . ARG A  1  158 ? 26.335  28.349 91.952 1.00 33.68 ? 185  ARG A CD    1 
ATOM   1231  N  NE    . ARG A  1  158 ? 25.514  29.517 92.254 1.00 34.71 ? 185  ARG A NE    1 
ATOM   1232  C  CZ    . ARG A  1  158 ? 25.114  30.415 91.357 1.00 33.95 ? 185  ARG A CZ    1 
ATOM   1233  N  NH1   . ARG A  1  158 ? 25.462  30.299 90.072 1.00 31.32 ? 185  ARG A NH1   1 
ATOM   1234  N  NH2   . ARG A  1  158 ? 24.370  31.442 91.751 1.00 33.69 ? 185  ARG A NH2   1 
ATOM   1235  N  N     . GLU A  1  159 ? 29.099  24.059 92.157 1.00 35.84 ? 186  GLU A N     1 
ATOM   1236  C  CA    . GLU A  1  159 ? 29.770  22.781 92.271 1.00 36.20 ? 186  GLU A CA    1 
ATOM   1237  C  C     . GLU A  1  159 ? 29.597  22.057 90.944 1.00 34.49 ? 186  GLU A C     1 
ATOM   1238  O  O     . GLU A  1  159 ? 28.552  22.187 90.301 1.00 33.53 ? 186  GLU A O     1 
ATOM   1239  C  CB    . GLU A  1  159 ? 29.126  21.990 93.397 1.00 37.66 ? 186  GLU A CB    1 
ATOM   1240  C  CG    . GLU A  1  159 ? 29.773  20.662 93.695 1.00 41.29 ? 186  GLU A CG    1 
ATOM   1241  C  CD    . GLU A  1  159 ? 29.225  20.042 94.960 1.00 45.70 ? 186  GLU A CD    1 
ATOM   1242  O  OE1   . GLU A  1  159 ? 28.169  20.514 95.443 1.00 46.70 ? 186  GLU A OE1   1 
ATOM   1243  O  OE2   . GLU A  1  159 ? 29.853  19.087 95.473 1.00 48.26 ? 186  GLU A OE2   1 
ATOM   1244  N  N     . PHE A  1  160 ? 30.621  21.311 90.536 1.00 34.13 ? 187  PHE A N     1 
ATOM   1245  C  CA    . PHE A  1  160 ? 30.589  20.558 89.280 1.00 31.54 ? 187  PHE A CA    1 
ATOM   1246  C  C     . PHE A  1  160 ? 29.418  19.590 89.257 1.00 30.93 ? 187  PHE A C     1 
ATOM   1247  O  O     . PHE A  1  160 ? 29.257  18.780 90.163 1.00 31.58 ? 187  PHE A O     1 
ATOM   1248  C  CB    . PHE A  1  160 ? 31.910  19.811 89.059 1.00 30.64 ? 187  PHE A CB    1 
ATOM   1249  C  CG    . PHE A  1  160 ? 31.929  18.926 87.823 1.00 29.08 ? 187  PHE A CG    1 
ATOM   1250  C  CD1   . PHE A  1  160 ? 31.909  19.482 86.542 1.00 26.82 ? 187  PHE A CD1   1 
ATOM   1251  C  CD2   . PHE A  1  160 ? 32.001  17.538 87.947 1.00 28.64 ? 187  PHE A CD2   1 
ATOM   1252  C  CE1   . PHE A  1  160 ? 31.941  18.675 85.402 1.00 25.09 ? 187  PHE A CE1   1 
ATOM   1253  C  CE2   . PHE A  1  160 ? 32.036  16.710 86.809 1.00 27.30 ? 187  PHE A CE2   1 
ATOM   1254  C  CZ    . PHE A  1  160 ? 32.007  17.284 85.534 1.00 26.67 ? 187  PHE A CZ    1 
ATOM   1255  N  N     . ILE A  1  161 ? 28.587  19.703 88.230 1.00 29.69 ? 188  ILE A N     1 
ATOM   1256  C  CA    . ILE A  1  161 ? 27.483  18.776 88.043 1.00 29.43 ? 188  ILE A CA    1 
ATOM   1257  C  C     . ILE A  1  161 ? 27.859  17.820 86.910 1.00 28.01 ? 188  ILE A C     1 
ATOM   1258  O  O     . ILE A  1  161 ? 28.032  18.254 85.770 1.00 26.81 ? 188  ILE A O     1 
ATOM   1259  C  CB    . ILE A  1  161 ? 26.152  19.521 87.764 1.00 29.85 ? 188  ILE A CB    1 
ATOM   1260  C  CG1   . ILE A  1  161 ? 25.800  20.420 88.958 1.00 31.55 ? 188  ILE A CG1   1 
ATOM   1261  C  CG2   . ILE A  1  161 ? 25.018  18.531 87.479 1.00 29.19 ? 188  ILE A CG2   1 
ATOM   1262  C  CD1   . ILE A  1  161 ? 24.839  21.543 88.636 1.00 32.47 ? 188  ILE A CD1   1 
ATOM   1263  N  N     . PRO A  1  162 ? 28.024  16.519 87.229 1.00 27.99 ? 189  PRO A N     1 
ATOM   1264  C  CA    . PRO A  1  162 ? 28.381  15.567 86.186 1.00 26.99 ? 189  PRO A CA    1 
ATOM   1265  C  C     . PRO A  1  162 ? 27.196  15.255 85.277 1.00 26.75 ? 189  PRO A C     1 
ATOM   1266  O  O     . PRO A  1  162 ? 26.045  15.337 85.701 1.00 27.53 ? 189  PRO A O     1 
ATOM   1267  C  CB    . PRO A  1  162 ? 28.807  14.311 86.960 1.00 27.57 ? 189  PRO A CB    1 
ATOM   1268  C  CG    . PRO A  1  162 ? 28.565  14.592 88.411 1.00 29.05 ? 189  PRO A CG    1 
ATOM   1269  C  CD    . PRO A  1  162 ? 27.787  15.859 88.526 1.00 29.51 ? 189  PRO A CD    1 
ATOM   1270  N  N     . ASP A  1  163 ? 27.489  14.914 84.029 1.00 25.75 ? 190  ASP A N     1 
ATOM   1271  C  CA    . ASP A  1  163 ? 26.465  14.475 83.096 1.00 26.15 ? 190  ASP A CA    1 
ATOM   1272  C  C     . ASP A  1  163 ? 25.949  13.093 83.510 1.00 26.89 ? 190  ASP A C     1 
ATOM   1273  O  O     . ASP A  1  163 ? 26.722  12.133 83.546 1.00 26.56 ? 190  ASP A O     1 
ATOM   1274  C  CB    . ASP A  1  163 ? 27.019  14.418 81.665 1.00 25.20 ? 190  ASP A CB    1 
ATOM   1275  C  CG    . ASP A  1  163 ? 26.020  13.828 80.677 1.00 26.45 ? 190  ASP A CG    1 
ATOM   1276  O  OD1   . ASP A  1  163 ? 24.805  14.011 80.886 1.00 28.46 ? 190  ASP A OD1   1 
ATOM   1277  O  OD2   . ASP A  1  163 ? 26.442  13.176 79.698 1.00 28.06 ? 190  ASP A OD2   1 
ATOM   1278  N  N     . PRO A  1  164 ? 24.638  12.990 83.814 1.00 28.04 ? 191  PRO A N     1 
ATOM   1279  C  CA    . PRO A  1  164 ? 24.091  11.689 84.213 1.00 29.47 ? 191  PRO A CA    1 
ATOM   1280  C  C     . PRO A  1  164 ? 24.053  10.691 83.052 1.00 29.23 ? 191  PRO A C     1 
ATOM   1281  O  O     . PRO A  1  164 ? 23.942  9.493  83.289 1.00 30.43 ? 191  PRO A O     1 
ATOM   1282  C  CB    . PRO A  1  164 ? 22.675  12.030 84.706 1.00 30.45 ? 191  PRO A CB    1 
ATOM   1283  C  CG    . PRO A  1  164 ? 22.326  13.302 83.984 1.00 29.84 ? 191  PRO A CG    1 
ATOM   1284  C  CD    . PRO A  1  164 ? 23.620  14.059 83.854 1.00 28.17 ? 191  PRO A CD    1 
ATOM   1285  N  N     . GLN A  1  165 ? 24.163  11.182 81.816 1.00 28.32 ? 192  GLN A N     1 
ATOM   1286  C  CA    . GLN A  1  165 ? 24.228  10.314 80.639 1.00 28.04 ? 192  GLN A CA    1 
ATOM   1287  C  C     . GLN A  1  165 ? 25.624  9.748  80.428 1.00 27.45 ? 192  GLN A C     1 
ATOM   1288  O  O     . GLN A  1  165 ? 25.822  8.872  79.584 1.00 27.57 ? 192  GLN A O     1 
ATOM   1289  C  CB    . GLN A  1  165 ? 23.776  11.054 79.379 1.00 27.44 ? 192  GLN A CB    1 
ATOM   1290  C  CG    . GLN A  1  165 ? 22.328  10.801 79.010 1.00 28.83 ? 192  GLN A CG    1 
ATOM   1291  C  CD    . GLN A  1  165 ? 21.903  11.593 77.793 1.00 28.72 ? 192  GLN A CD    1 
ATOM   1292  O  OE1   . GLN A  1  165 ? 21.262  12.631 77.916 1.00 28.33 ? 192  GLN A OE1   1 
ATOM   1293  N  NE2   . GLN A  1  165 ? 22.268  11.113 76.609 1.00 29.22 ? 192  GLN A NE2   1 
ATOM   1294  N  N     . GLY A  1  166 ? 26.590  10.257 81.187 1.00 26.99 ? 193  GLY A N     1 
ATOM   1295  C  CA    . GLY A  1  166 ? 27.932  9.698  81.181 1.00 26.31 ? 193  GLY A CA    1 
ATOM   1296  C  C     . GLY A  1  166 ? 28.859  10.192 80.080 1.00 24.95 ? 193  GLY A C     1 
ATOM   1297  O  O     . GLY A  1  166 ? 29.887  9.574  79.837 1.00 24.52 ? 193  GLY A O     1 
ATOM   1298  N  N     . SER A  1  167 ? 28.513  11.303 79.423 1.00 24.13 ? 194  SER A N     1 
ATOM   1299  C  CA    . SER A  1  167 ? 29.407  11.899 78.421 1.00 23.32 ? 194  SER A CA    1 
ATOM   1300  C  C     . SER A  1  167 ? 30.804  12.114 78.999 1.00 23.15 ? 194  SER A C     1 
ATOM   1301  O  O     . SER A  1  167 ? 30.952  12.564 80.138 1.00 23.63 ? 194  SER A O     1 
ATOM   1302  C  CB    . SER A  1  167 ? 28.866  13.236 77.895 1.00 22.90 ? 194  SER A CB    1 
ATOM   1303  O  OG    . SER A  1  167 ? 27.545  13.109 77.395 1.00 23.02 ? 194  SER A OG    1 
ATOM   1304  N  N     . ASN A  1  168 ? 31.820  11.773 78.214 1.00 22.42 ? 195  ASN A N     1 
ATOM   1305  C  CA    . ASN A  1  168 ? 33.207  11.961 78.629 1.00 22.51 ? 195  ASN A CA    1 
ATOM   1306  C  C     . ASN A  1  168 ? 33.920  13.080 77.861 1.00 21.99 ? 195  ASN A C     1 
ATOM   1307  O  O     . ASN A  1  168 ? 33.310  13.771 77.050 1.00 21.38 ? 195  ASN A O     1 
ATOM   1308  C  CB    . ASN A  1  168 ? 33.979  10.639 78.521 1.00 22.43 ? 195  ASN A CB    1 
ATOM   1309  C  CG    . ASN A  1  168 ? 34.030  10.095 77.102 1.00 22.52 ? 195  ASN A CG    1 
ATOM   1310  O  OD1   . ASN A  1  168 ? 33.787  10.813 76.123 1.00 20.02 ? 195  ASN A OD1   1 
ATOM   1311  N  ND2   . ASN A  1  168 ? 34.345  8.809  76.986 1.00 23.43 ? 195  ASN A ND2   1 
ATOM   1312  N  N     . MET A  1  169 ? 35.214  13.246 78.124 1.00 22.90 ? 196  MET A N     1 
ATOM   1313  C  CA    . MET A  1  169 ? 36.021  14.265 77.465 1.00 22.93 ? 196  MET A CA    1 
ATOM   1314  C  C     . MET A  1  169 ? 36.329  13.945 75.998 1.00 22.61 ? 196  MET A C     1 
ATOM   1315  O  O     . MET A  1  169 ? 36.550  14.860 75.194 1.00 22.31 ? 196  MET A O     1 
ATOM   1316  C  CB    . MET A  1  169 ? 37.303  14.519 78.255 1.00 24.08 ? 196  MET A CB    1 
ATOM   1317  C  CG    . MET A  1  169 ? 37.090  15.227 79.584 1.00 26.31 ? 196  MET A CG    1 
ATOM   1318  S  SD    . MET A  1  169 ? 36.319  16.853 79.401 1.00 31.27 ? 196  MET A SD    1 
ATOM   1319  C  CE    . MET A  1  169 ? 34.624  16.492 79.668 1.00 28.26 ? 196  MET A CE    1 
ATOM   1320  N  N     . MET A  1  170 ? 36.347  12.657 75.648 1.00 22.47 ? 197  MET A N     1 
ATOM   1321  C  CA    . MET A  1  170 ? 36.401  12.265 74.237 1.00 22.36 ? 197  MET A CA    1 
ATOM   1322  C  C     . MET A  1  170 ? 35.197  12.856 73.493 1.00 21.64 ? 197  MET A C     1 
ATOM   1323  O  O     . MET A  1  170 ? 35.336  13.378 72.382 1.00 21.00 ? 197  MET A O     1 
ATOM   1324  C  CB    . MET A  1  170 ? 36.445  10.736 74.060 1.00 22.74 ? 197  MET A CB    1 
ATOM   1325  C  CG    . MET A  1  170 ? 37.774  10.074 74.449 1.00 23.56 ? 197  MET A CG    1 
ATOM   1326  S  SD    . MET A  1  170 ? 39.225  10.658 73.529 1.00 24.27 ? 197  MET A SD    1 
ATOM   1327  C  CE    . MET A  1  170 ? 38.916  9.991  71.893 1.00 22.64 ? 197  MET A CE    1 
ATOM   1328  N  N     . PHE A  1  171 ? 34.023  12.784 74.120 1.00 21.36 ? 198  PHE A N     1 
ATOM   1329  C  CA    . PHE A  1  171 ? 32.814  13.375 73.547 1.00 20.81 ? 198  PHE A CA    1 
ATOM   1330  C  C     . PHE A  1  171 ? 32.878  14.899 73.481 1.00 20.33 ? 198  PHE A C     1 
ATOM   1331  O  O     . PHE A  1  171 ? 32.526  15.497 72.460 1.00 19.66 ? 198  PHE A O     1 
ATOM   1332  C  CB    . PHE A  1  171 ? 31.569  12.956 74.327 1.00 21.49 ? 198  PHE A CB    1 
ATOM   1333  C  CG    . PHE A  1  171 ? 30.317  13.665 73.880 1.00 22.43 ? 198  PHE A CG    1 
ATOM   1334  C  CD1   . PHE A  1  171 ? 29.544  13.152 72.842 1.00 23.31 ? 198  PHE A CD1   1 
ATOM   1335  C  CD2   . PHE A  1  171 ? 29.925  14.853 74.480 1.00 22.09 ? 198  PHE A CD2   1 
ATOM   1336  C  CE1   . PHE A  1  171 ? 28.392  13.813 72.422 1.00 24.44 ? 198  PHE A CE1   1 
ATOM   1337  C  CE2   . PHE A  1  171 ? 28.775  15.520 74.060 1.00 23.90 ? 198  PHE A CE2   1 
ATOM   1338  C  CZ    . PHE A  1  171 ? 28.016  15.000 73.033 1.00 23.53 ? 198  PHE A CZ    1 
ATOM   1339  N  N     . ALA A  1  172 ? 33.292  15.516 74.587 1.00 20.10 ? 199  ALA A N     1 
ATOM   1340  C  CA    . ALA A  1  172 ? 33.317  16.966 74.704 1.00 19.80 ? 199  ALA A CA    1 
ATOM   1341  C  C     . ALA A  1  172 ? 34.254  17.580 73.663 1.00 19.63 ? 199  ALA A C     1 
ATOM   1342  O  O     . ALA A  1  172 ? 33.904  18.572 73.016 1.00 19.08 ? 199  ALA A O     1 
ATOM   1343  C  CB    . ALA A  1  172 ? 33.727  17.388 76.120 1.00 20.25 ? 199  ALA A CB    1 
ATOM   1344  N  N     . PHE A  1  173 ? 35.431  16.978 73.496 1.00 19.32 ? 200  PHE A N     1 
ATOM   1345  C  CA    . PHE A  1  173 ? 36.394  17.477 72.523 1.00 19.36 ? 200  PHE A CA    1 
ATOM   1346  C  C     . PHE A  1  173 ? 36.026  17.118 71.089 1.00 18.93 ? 200  PHE A C     1 
ATOM   1347  O  O     . PHE A  1  173 ? 36.393  17.842 70.169 1.00 18.99 ? 200  PHE A O     1 
ATOM   1348  C  CB    . PHE A  1  173 ? 37.826  17.060 72.872 1.00 19.77 ? 200  PHE A CB    1 
ATOM   1349  C  CG    . PHE A  1  173 ? 38.415  17.851 74.008 1.00 21.02 ? 200  PHE A CG    1 
ATOM   1350  C  CD1   . PHE A  1  173 ? 38.555  19.235 73.912 1.00 21.63 ? 200  PHE A CD1   1 
ATOM   1351  C  CD2   . PHE A  1  173 ? 38.804  17.224 75.184 1.00 22.24 ? 200  PHE A CD2   1 
ATOM   1352  C  CE1   . PHE A  1  173 ? 39.084  19.975 74.974 1.00 23.61 ? 200  PHE A CE1   1 
ATOM   1353  C  CE2   . PHE A  1  173 ? 39.337  17.967 76.259 1.00 23.52 ? 200  PHE A CE2   1 
ATOM   1354  C  CZ    . PHE A  1  173 ? 39.477  19.332 76.149 1.00 23.11 ? 200  PHE A CZ    1 
ATOM   1355  N  N     . PHE A  1  174 ? 35.302  16.013 70.895 1.00 18.42 ? 201  PHE A N     1 
ATOM   1356  C  CA    . PHE A  1  174 ? 34.778  15.703 69.568 1.00 18.34 ? 201  PHE A CA    1 
ATOM   1357  C  C     . PHE A  1  174 ? 33.776  16.779 69.155 1.00 18.20 ? 201  PHE A C     1 
ATOM   1358  O  O     . PHE A  1  174 ? 33.834  17.276 68.027 1.00 17.91 ? 201  PHE A O     1 
ATOM   1359  C  CB    . PHE A  1  174 ? 34.121  14.321 69.493 1.00 18.15 ? 201  PHE A CB    1 
ATOM   1360  C  CG    . PHE A  1  174 ? 33.800  13.882 68.080 1.00 18.20 ? 201  PHE A CG    1 
ATOM   1361  C  CD1   . PHE A  1  174 ? 34.673  13.053 67.382 1.00 17.01 ? 201  PHE A CD1   1 
ATOM   1362  C  CD2   . PHE A  1  174 ? 32.628  14.310 67.445 1.00 16.81 ? 201  PHE A CD2   1 
ATOM   1363  C  CE1   . PHE A  1  174 ? 34.387  12.644 66.074 1.00 18.01 ? 201  PHE A CE1   1 
ATOM   1364  C  CE2   . PHE A  1  174 ? 32.337  13.919 66.148 1.00 16.99 ? 201  PHE A CE2   1 
ATOM   1365  C  CZ    . PHE A  1  174 ? 33.218  13.080 65.454 1.00 17.43 ? 201  PHE A CZ    1 
ATOM   1366  N  N     . ALA A  1  175 ? 32.891  17.147 70.084 1.00 18.05 ? 202  ALA A N     1 
ATOM   1367  C  CA    . ALA A  1  175 ? 31.871  18.163 69.829 1.00 18.29 ? 202  ALA A CA    1 
ATOM   1368  C  C     . ALA A  1  175 ? 32.529  19.474 69.414 1.00 18.69 ? 202  ALA A C     1 
ATOM   1369  O  O     . ALA A  1  175 ? 32.124  20.093 68.430 1.00 18.90 ? 202  ALA A O     1 
ATOM   1370  C  CB    . ALA A  1  175 ? 31.002  18.377 71.059 1.00 18.11 ? 202  ALA A CB    1 
ATOM   1371  N  N     . GLN A  1  176 ? 33.546  19.882 70.163 1.00 18.98 ? 203  GLN A N     1 
ATOM   1372  C  CA    . GLN A  1  176 ? 34.251  21.123 69.873 1.00 20.11 ? 203  GLN A CA    1 
ATOM   1373  C  C     . GLN A  1  176 ? 34.993  21.060 68.531 1.00 19.76 ? 203  GLN A C     1 
ATOM   1374  O  O     . GLN A  1  176 ? 34.860  21.964 67.717 1.00 20.03 ? 203  GLN A O     1 
ATOM   1375  C  CB    . GLN A  1  176 ? 35.200  21.493 71.013 1.00 20.83 ? 203  GLN A CB    1 
ATOM   1376  C  CG    . GLN A  1  176 ? 35.642  22.951 70.967 1.00 24.69 ? 203  GLN A CG    1 
ATOM   1377  C  CD    . GLN A  1  176 ? 36.704  23.293 71.997 1.00 28.39 ? 203  GLN A CD    1 
ATOM   1378  O  OE1   . GLN A  1  176 ? 37.148  22.438 72.769 1.00 30.28 ? 203  GLN A OE1   1 
ATOM   1379  N  NE2   . GLN A  1  176 ? 37.119  24.556 72.012 1.00 31.20 ? 203  GLN A NE2   1 
ATOM   1380  N  N     . HIS A  1  177 ? 35.750  19.985 68.300 1.00 19.18 ? 204  HIS A N     1 
ATOM   1381  C  CA    . HIS A  1  177 ? 36.479  19.808 67.042 1.00 18.91 ? 204  HIS A CA    1 
ATOM   1382  C  C     . HIS A  1  177 ? 35.521  19.773 65.842 1.00 18.63 ? 204  HIS A C     1 
ATOM   1383  O  O     . HIS A  1  177 ? 35.702  20.526 64.878 1.00 19.22 ? 204  HIS A O     1 
ATOM   1384  C  CB    . HIS A  1  177 ? 37.363  18.551 67.099 1.00 18.58 ? 204  HIS A CB    1 
ATOM   1385  C  CG    . HIS A  1  177 ? 38.244  18.370 65.903 1.00 17.58 ? 204  HIS A CG    1 
ATOM   1386  N  ND1   . HIS A  1  177 ? 37.881  17.595 64.824 1.00 16.65 ? 204  HIS A ND1   1 
ATOM   1387  C  CD2   . HIS A  1  177 ? 39.479  18.848 65.624 1.00 17.38 ? 204  HIS A CD2   1 
ATOM   1388  C  CE1   . HIS A  1  177 ? 38.846  17.615 63.924 1.00 17.73 ? 204  HIS A CE1   1 
ATOM   1389  N  NE2   . HIS A  1  177 ? 39.829  18.368 64.385 1.00 17.66 ? 204  HIS A NE2   1 
ATOM   1390  N  N     . PHE A  1  178 ? 34.491  18.932 65.929 1.00 17.93 ? 205  PHE A N     1 
ATOM   1391  C  CA    . PHE A  1  178 ? 33.541  18.739 64.835 1.00 17.46 ? 205  PHE A CA    1 
ATOM   1392  C  C     . PHE A  1  178 ? 32.795  20.022 64.460 1.00 17.44 ? 205  PHE A C     1 
ATOM   1393  O  O     . PHE A  1  178 ? 32.767  20.390 63.275 1.00 17.62 ? 205  PHE A O     1 
ATOM   1394  C  CB    . PHE A  1  178 ? 32.560  17.599 65.144 1.00 17.06 ? 205  PHE A CB    1 
ATOM   1395  C  CG    . PHE A  1  178 ? 31.409  17.484 64.151 1.00 17.22 ? 205  PHE A CG    1 
ATOM   1396  C  CD1   . PHE A  1  178 ? 31.643  17.139 62.819 1.00 16.42 ? 205  PHE A CD1   1 
ATOM   1397  C  CD2   . PHE A  1  178 ? 30.093  17.716 64.563 1.00 17.54 ? 205  PHE A CD2   1 
ATOM   1398  C  CE1   . PHE A  1  178 ? 30.585  17.040 61.901 1.00 16.52 ? 205  PHE A CE1   1 
ATOM   1399  C  CE2   . PHE A  1  178 ? 29.020  17.611 63.664 1.00 16.46 ? 205  PHE A CE2   1 
ATOM   1400  C  CZ    . PHE A  1  178 ? 29.263  17.273 62.330 1.00 16.72 ? 205  PHE A CZ    1 
ATOM   1401  N  N     . THR A  1  179 ? 32.215  20.704 65.455 1.00 16.90 ? 206  THR A N     1 
ATOM   1402  C  CA    . THR A  1  179 ? 31.378  21.875 65.180 1.00 17.35 ? 206  THR A CA    1 
ATOM   1403  C  C     . THR A  1  179 ? 32.160  23.089 64.718 1.00 18.10 ? 206  THR A C     1 
ATOM   1404  O  O     . THR A  1  179 ? 31.608  23.961 64.046 1.00 18.77 ? 206  THR A O     1 
ATOM   1405  C  CB    . THR A  1  179 ? 30.471  22.297 66.378 1.00 16.98 ? 206  THR A CB    1 
ATOM   1406  O  OG1   . THR A  1  179 ? 31.283  22.647 67.504 1.00 16.18 ? 206  THR A OG1   1 
ATOM   1407  C  CG2   . THR A  1  179 ? 29.512  21.191 66.743 1.00 16.00 ? 206  THR A CG2   1 
ATOM   1408  N  N     . HIS A  1  180 ? 33.436  23.159 65.076 1.00 18.98 ? 207  HIS A N     1 
ATOM   1409  C  CA    . HIS A  1  180 ? 34.226  24.326 64.708 1.00 19.92 ? 207  HIS A CA    1 
ATOM   1410  C  C     . HIS A  1  180 ? 34.641  24.367 63.236 1.00 19.16 ? 207  HIS A C     1 
ATOM   1411  O  O     . HIS A  1  180 ? 35.285  25.317 62.809 1.00 19.90 ? 207  HIS A O     1 
ATOM   1412  C  CB    . HIS A  1  180 ? 35.407  24.530 65.665 1.00 21.40 ? 207  HIS A CB    1 
ATOM   1413  C  CG    . HIS A  1  180 ? 35.005  25.151 66.970 1.00 25.30 ? 207  HIS A CG    1 
ATOM   1414  N  ND1   . HIS A  1  180 ? 35.820  26.016 67.670 1.00 29.29 ? 207  HIS A ND1   1 
ATOM   1415  C  CD2   . HIS A  1  180 ? 33.854  25.057 67.682 1.00 27.66 ? 207  HIS A CD2   1 
ATOM   1416  C  CE1   . HIS A  1  180 ? 35.200  26.408 68.770 1.00 30.80 ? 207  HIS A CE1   1 
ATOM   1417  N  NE2   . HIS A  1  180 ? 34.001  25.848 68.798 1.00 30.55 ? 207  HIS A NE2   1 
ATOM   1418  N  N     . GLN A  1  181 ? 34.258  23.356 62.458 1.00 18.22 ? 208  GLN A N     1 
ATOM   1419  C  CA    . GLN A  1  181 ? 34.362  23.480 60.998 1.00 18.09 ? 208  GLN A CA    1 
ATOM   1420  C  C     . GLN A  1  181 ? 33.248  24.373 60.446 1.00 17.81 ? 208  GLN A C     1 
ATOM   1421  O  O     . GLN A  1  181 ? 33.439  25.038 59.430 1.00 18.14 ? 208  GLN A O     1 
ATOM   1422  C  CB    . GLN A  1  181 ? 34.382  22.121 60.284 1.00 17.95 ? 208  GLN A CB    1 
ATOM   1423  C  CG    . GLN A  1  181 ? 33.041  21.416 60.151 1.00 16.73 ? 208  GLN A CG    1 
ATOM   1424  C  CD    . GLN A  1  181 ? 33.200  19.964 59.729 1.00 18.23 ? 208  GLN A CD    1 
ATOM   1425  O  OE1   . GLN A  1  181 ? 33.482  19.677 58.571 1.00 19.39 ? 208  GLN A OE1   1 
ATOM   1426  N  NE2   . GLN A  1  181 ? 33.044  19.042 60.680 1.00 15.94 ? 208  GLN A NE2   1 
ATOM   1427  N  N     . PHE A  1  182 ? 32.099  24.401 61.120 1.00 16.96 ? 209  PHE A N     1 
ATOM   1428  C  CA    . PHE A  1  182 ? 30.973  25.189 60.610 1.00 17.05 ? 209  PHE A CA    1 
ATOM   1429  C  C     . PHE A  1  182 ? 30.487  26.351 61.487 1.00 17.38 ? 209  PHE A C     1 
ATOM   1430  O  O     . PHE A  1  182 ? 29.700  27.172 61.031 1.00 17.48 ? 209  PHE A O     1 
ATOM   1431  C  CB    . PHE A  1  182 ? 29.800  24.301 60.132 1.00 15.93 ? 209  PHE A CB    1 
ATOM   1432  C  CG    . PHE A  1  182 ? 29.346  23.257 61.128 1.00 14.75 ? 209  PHE A CG    1 
ATOM   1433  C  CD1   . PHE A  1  182 ? 28.589  23.608 62.245 1.00 13.86 ? 209  PHE A CD1   1 
ATOM   1434  C  CD2   . PHE A  1  182 ? 29.608  21.909 60.899 1.00 15.08 ? 209  PHE A CD2   1 
ATOM   1435  C  CE1   . PHE A  1  182 ? 28.145  22.633 63.152 1.00 13.13 ? 209  PHE A CE1   1 
ATOM   1436  C  CE2   . PHE A  1  182 ? 29.151  20.920 61.801 1.00 13.56 ? 209  PHE A CE2   1 
ATOM   1437  C  CZ    . PHE A  1  182 ? 28.428  21.282 62.914 1.00 12.07 ? 209  PHE A CZ    1 
ATOM   1438  N  N     . PHE A  1  183 ? 30.938  26.408 62.736 1.00 18.16 ? 210  PHE A N     1 
ATOM   1439  C  CA    . PHE A  1  183 ? 30.752  27.607 63.544 1.00 18.89 ? 210  PHE A CA    1 
ATOM   1440  C  C     . PHE A  1  183 ? 32.097  28.323 63.590 1.00 20.06 ? 210  PHE A C     1 
ATOM   1441  O  O     . PHE A  1  183 ? 32.969  27.968 64.382 1.00 20.95 ? 210  PHE A O     1 
ATOM   1442  C  CB    . PHE A  1  183 ? 30.240  27.283 64.960 1.00 18.33 ? 210  PHE A CB    1 
ATOM   1443  C  CG    . PHE A  1  183 ? 28.941  26.490 64.994 1.00 17.38 ? 210  PHE A CG    1 
ATOM   1444  C  CD1   . PHE A  1  183 ? 27.899  26.764 64.116 1.00 16.54 ? 210  PHE A CD1   1 
ATOM   1445  C  CD2   . PHE A  1  183 ? 28.763  25.482 65.936 1.00 16.04 ? 210  PHE A CD2   1 
ATOM   1446  C  CE1   . PHE A  1  183 ? 26.704  26.017 64.157 1.00 16.52 ? 210  PHE A CE1   1 
ATOM   1447  C  CE2   . PHE A  1  183 ? 27.578  24.740 65.995 1.00 15.72 ? 210  PHE A CE2   1 
ATOM   1448  C  CZ    . PHE A  1  183 ? 26.543  25.013 65.112 1.00 15.09 ? 210  PHE A CZ    1 
ATOM   1449  N  N     . LYS A  1  184 ? 32.272  29.298 62.699 1.00 20.93 ? 211  LYS A N     1 
ATOM   1450  C  CA    . LYS A  1  184 ? 33.523  30.051 62.573 1.00 22.19 ? 211  LYS A CA    1 
ATOM   1451  C  C     . LYS A  1  184 ? 33.157  31.512 62.410 1.00 22.92 ? 211  LYS A C     1 
ATOM   1452  O  O     . LYS A  1  184 ? 33.184  32.055 61.301 1.00 22.44 ? 211  LYS A O     1 
ATOM   1453  C  CB    . LYS A  1  184 ? 34.324  29.592 61.350 1.00 22.54 ? 211  LYS A CB    1 
ATOM   1454  C  CG    . LYS A  1  184 ? 34.645  28.094 61.328 1.00 23.00 ? 211  LYS A CG    1 
ATOM   1455  C  CD    . LYS A  1  184 ? 35.855  27.796 60.442 1.00 24.69 ? 211  LYS A CD    1 
ATOM   1456  C  CE    . LYS A  1  184 ? 35.565  28.086 58.991 1.00 24.36 ? 211  LYS A CE    1 
ATOM   1457  N  NZ    . LYS A  1  184 ? 36.771  27.884 58.159 1.00 26.30 ? 211  LYS A NZ    1 
ATOM   1458  N  N     . THR A  1  185 ? 32.804  32.141 63.524 1.00 23.46 ? 212  THR A N     1 
ATOM   1459  C  CA    . THR A  1  185 ? 32.274  33.495 63.496 1.00 24.93 ? 212  THR A CA    1 
ATOM   1460  C  C     . THR A  1  185 ? 33.307  34.503 63.021 1.00 26.80 ? 212  THR A C     1 
ATOM   1461  O  O     . THR A  1  185 ? 34.437  34.530 63.505 1.00 27.74 ? 212  THR A O     1 
ATOM   1462  C  CB    . THR A  1  185 ? 31.672  33.880 64.859 1.00 24.95 ? 212  THR A CB    1 
ATOM   1463  O  OG1   . THR A  1  185 ? 30.645  32.934 65.173 1.00 24.47 ? 212  THR A OG1   1 
ATOM   1464  C  CG2   . THR A  1  185 ? 31.065  35.280 64.819 1.00 24.99 ? 212  THR A CG2   1 
ATOM   1465  N  N     . ASP A  1  186 ? 32.904  35.308 62.042 1.00 27.88 ? 213  ASP A N     1 
ATOM   1466  C  CA    . ASP A  1  186 ? 33.746  36.354 61.503 1.00 30.20 ? 213  ASP A CA    1 
ATOM   1467  C  C     . ASP A  1  186 ? 33.690  37.587 62.404 1.00 31.95 ? 213  ASP A C     1 
ATOM   1468  O  O     . ASP A  1  186 ? 32.913  38.516 62.172 1.00 32.26 ? 213  ASP A O     1 
ATOM   1469  C  CB    . ASP A  1  186 ? 33.299  36.686 60.083 1.00 30.40 ? 213  ASP A CB    1 
ATOM   1470  C  CG    . ASP A  1  186 ? 34.315  37.501 59.331 1.00 32.68 ? 213  ASP A CG    1 
ATOM   1471  O  OD1   . ASP A  1  186 ? 35.232  38.075 59.961 1.00 34.97 ? 213  ASP A OD1   1 
ATOM   1472  O  OD2   . ASP A  1  186 ? 34.194  37.566 58.095 1.00 34.72 ? 213  ASP A OD2   1 
ATOM   1473  N  N     . HIS A  1  187 ? 34.529  37.590 63.434 1.00 33.54 ? 214  HIS A N     1 
ATOM   1474  C  CA    . HIS A  1  187 ? 34.515  38.657 64.435 1.00 35.73 ? 214  HIS A CA    1 
ATOM   1475  C  C     . HIS A  1  187 ? 34.870  40.038 63.876 1.00 37.47 ? 214  HIS A C     1 
ATOM   1476  O  O     . HIS A  1  187 ? 34.549  41.054 64.489 1.00 39.08 ? 214  HIS A O     1 
ATOM   1477  C  CB    . HIS A  1  187 ? 35.386  38.287 65.644 1.00 36.64 ? 214  HIS A CB    1 
ATOM   1478  C  CG    . HIS A  1  187 ? 34.870  37.111 66.415 1.00 36.59 ? 214  HIS A CG    1 
ATOM   1479  N  ND1   . HIS A  1  187 ? 33.692  37.150 67.131 1.00 37.92 ? 214  HIS A ND1   1 
ATOM   1480  C  CD2   . HIS A  1  187 ? 35.364  35.858 66.571 1.00 37.77 ? 214  HIS A CD2   1 
ATOM   1481  C  CE1   . HIS A  1  187 ? 33.479  35.972 67.693 1.00 37.36 ? 214  HIS A CE1   1 
ATOM   1482  N  NE2   . HIS A  1  187 ? 34.479  35.170 67.369 1.00 37.04 ? 214  HIS A NE2   1 
ATOM   1483  N  N     . LYS A  1  188 ? 35.503  40.074 62.704 1.00 37.64 ? 215  LYS A N     1 
ATOM   1484  C  CA    . LYS A  1  188 ? 35.761  41.332 61.999 1.00 39.00 ? 215  LYS A CA    1 
ATOM   1485  C  C     . LYS A  1  188 ? 34.467  41.977 61.476 1.00 38.30 ? 215  LYS A C     1 
ATOM   1486  O  O     . LYS A  1  188 ? 34.394  43.198 61.336 1.00 39.95 ? 215  LYS A O     1 
ATOM   1487  C  CB    . LYS A  1  188 ? 36.742  41.112 60.838 1.00 39.73 ? 215  LYS A CB    1 
ATOM   1488  N  N     . ARG A  1  189 ? 33.460  41.153 61.185 1.00 35.61 ? 216  ARG A N     1 
ATOM   1489  C  CA    . ARG A  1  189 ? 32.187  41.634 60.639 1.00 34.80 ? 216  ARG A CA    1 
ATOM   1490  C  C     . ARG A  1  189 ? 31.072  41.705 61.684 1.00 33.23 ? 216  ARG A C     1 
ATOM   1491  O  O     . ARG A  1  189 ? 30.256  42.619 61.656 1.00 33.86 ? 216  ARG A O     1 
ATOM   1492  C  CB    . ARG A  1  189 ? 31.722  40.755 59.476 1.00 33.82 ? 216  ARG A CB    1 
ATOM   1493  C  CG    . ARG A  1  189 ? 32.521  40.871 58.190 1.00 36.63 ? 216  ARG A CG    1 
ATOM   1494  C  CD    . ARG A  1  189 ? 31.703  40.327 57.032 1.00 38.99 ? 216  ARG A CD    1 
ATOM   1495  N  NE    . ARG A  1  189 ? 32.529  39.836 55.930 1.00 42.13 ? 216  ARG A NE    1 
ATOM   1496  C  CZ    . ARG A  1  189 ? 32.836  40.536 54.843 1.00 44.74 ? 216  ARG A CZ    1 
ATOM   1497  N  NH1   . ARG A  1  189 ? 32.394  41.777 54.688 1.00 46.89 ? 216  ARG A NH1   1 
ATOM   1498  N  NH2   . ARG A  1  189 ? 33.589  39.991 53.902 1.00 46.65 ? 216  ARG A NH2   1 
ATOM   1499  N  N     . GLY A  1  190 ? 31.031  40.734 62.589 1.00 31.20 ? 217  GLY A N     1 
ATOM   1500  C  CA    . GLY A  1  190 ? 29.997  40.684 63.619 1.00 29.99 ? 217  GLY A CA    1 
ATOM   1501  C  C     . GLY A  1  190 ? 29.536  39.260 63.880 1.00 27.81 ? 217  GLY A C     1 
ATOM   1502  O  O     . GLY A  1  190 ? 29.857  38.358 63.106 1.00 26.63 ? 217  GLY A O     1 
ATOM   1503  N  N     . PRO A  1  191 ? 28.762  39.052 64.965 1.00 27.28 ? 218  PRO A N     1 
ATOM   1504  C  CA    . PRO A  1  191 ? 28.336  37.704 65.391 1.00 25.53 ? 218  PRO A CA    1 
ATOM   1505  C  C     . PRO A  1  191 ? 27.407  36.998 64.402 1.00 24.50 ? 218  PRO A C     1 
ATOM   1506  O  O     . PRO A  1  191 ? 27.260  35.777 64.462 1.00 22.51 ? 218  PRO A O     1 
ATOM   1507  C  CB    . PRO A  1  191 ? 27.611  37.955 66.721 1.00 25.88 ? 218  PRO A CB    1 
ATOM   1508  C  CG    . PRO A  1  191 ? 27.211  39.411 66.686 1.00 27.10 ? 218  PRO A CG    1 
ATOM   1509  C  CD    . PRO A  1  191 ? 28.252  40.112 65.858 1.00 28.33 ? 218  PRO A CD    1 
ATOM   1510  N  N     . GLY A  1  192 ? 26.796  37.759 63.498 1.00 19.17 ? 219  GLY A N     1 
ATOM   1511  C  CA    . GLY A  1  192 ? 25.905  37.177 62.495 1.00 19.86 ? 219  GLY A CA    1 
ATOM   1512  C  C     . GLY A  1  192 ? 26.598  36.733 61.222 1.00 19.91 ? 219  GLY A C     1 
ATOM   1513  O  O     . GLY A  1  192 ? 25.936  36.344 60.253 1.00 19.67 ? 219  GLY A O     1 
ATOM   1514  N  N     . PHE A  1  193 ? 27.932  36.783 61.222 1.00 20.72 ? 220  PHE A N     1 
ATOM   1515  C  CA    . PHE A  1  193 ? 28.722  36.455 60.039 1.00 20.47 ? 220  PHE A CA    1 
ATOM   1516  C  C     . PHE A  1  193 ? 29.637  35.272 60.290 1.00 20.65 ? 220  PHE A C     1 
ATOM   1517  O  O     . PHE A  1  193 ? 30.183  35.118 61.382 1.00 20.76 ? 220  PHE A O     1 
ATOM   1518  C  CB    . PHE A  1  193 ? 29.551  37.658 59.595 1.00 21.53 ? 220  PHE A CB    1 
ATOM   1519  C  CG    . PHE A  1  193 ? 28.729  38.786 59.060 1.00 22.59 ? 220  PHE A CG    1 
ATOM   1520  C  CD1   . PHE A  1  193 ? 28.392  38.837 57.704 1.00 22.95 ? 220  PHE A CD1   1 
ATOM   1521  C  CD2   . PHE A  1  193 ? 28.281  39.796 59.902 1.00 22.80 ? 220  PHE A CD2   1 
ATOM   1522  C  CE1   . PHE A  1  193 ? 27.620  39.879 57.202 1.00 22.71 ? 220  PHE A CE1   1 
ATOM   1523  C  CE2   . PHE A  1  193 ? 27.499  40.841 59.407 1.00 24.39 ? 220  PHE A CE2   1 
ATOM   1524  C  CZ    . PHE A  1  193 ? 27.172  40.878 58.053 1.00 23.63 ? 220  PHE A CZ    1 
ATOM   1525  N  N     . THR A  1  194 ? 29.817  34.454 59.259 1.00 20.43 ? 221  THR A N     1 
ATOM   1526  C  CA    . THR A  1  194 ? 30.641  33.261 59.347 1.00 20.38 ? 221  THR A CA    1 
ATOM   1527  C  C     . THR A  1  194 ? 31.771  33.289 58.320 1.00 20.88 ? 221  THR A C     1 
ATOM   1528  O  O     . THR A  1  194 ? 31.650  33.907 57.254 1.00 21.46 ? 221  THR A O     1 
ATOM   1529  C  CB    . THR A  1  194 ? 29.798  31.973 59.157 1.00 19.49 ? 221  THR A CB    1 
ATOM   1530  O  OG1   . THR A  1  194 ? 30.649  30.829 59.245 1.00 19.86 ? 221  THR A OG1   1 
ATOM   1531  C  CG2   . THR A  1  194 ? 29.068  31.958 57.785 1.00 19.74 ? 221  THR A CG2   1 
ATOM   1532  N  N     . ARG A  1  195 ? 32.866  32.621 58.664 1.00 20.86 ? 222  ARG A N     1 
ATOM   1533  C  CA    . ARG A  1  195 ? 33.981  32.404 57.753 1.00 21.83 ? 222  ARG A CA    1 
ATOM   1534  C  C     . ARG A  1  195 ? 33.905  31.019 57.103 1.00 21.45 ? 222  ARG A C     1 
ATOM   1535  O  O     . ARG A  1  195 ? 34.713  30.700 56.229 1.00 22.20 ? 222  ARG A O     1 
ATOM   1536  C  CB    . ARG A  1  195 ? 35.313  32.556 58.499 1.00 22.15 ? 222  ARG A CB    1 
ATOM   1537  C  CG    . ARG A  1  195 ? 35.654  33.997 58.868 1.00 24.35 ? 222  ARG A CG    1 
ATOM   1538  C  CD    . ARG A  1  195 ? 36.797  34.030 59.885 1.00 27.64 ? 222  ARG A CD    1 
ATOM   1539  N  N     . GLY A  1  196 ? 32.946  30.201 57.539 1.00 20.96 ? 223  GLY A N     1 
ATOM   1540  C  CA    . GLY A  1  196 ? 32.769  28.851 56.997 1.00 20.48 ? 223  GLY A CA    1 
ATOM   1541  C  C     . GLY A  1  196 ? 31.789  28.848 55.845 1.00 20.79 ? 223  GLY A C     1 
ATOM   1542  O  O     . GLY A  1  196 ? 30.638  28.465 56.010 1.00 20.33 ? 223  GLY A O     1 
ATOM   1543  N  N     . LEU A  1  197 ? 32.260  29.277 54.676 1.00 21.26 ? 224  LEU A N     1 
ATOM   1544  C  CA    . LEU A  1  197 ? 31.420  29.435 53.492 1.00 21.61 ? 224  LEU A CA    1 
ATOM   1545  C  C     . LEU A  1  197 ? 30.890  28.140 52.893 1.00 21.27 ? 224  LEU A C     1 
ATOM   1546  O  O     . LEU A  1  197 ? 29.948  28.181 52.111 1.00 21.69 ? 224  LEU A O     1 
ATOM   1547  C  CB    . LEU A  1  197 ? 32.135  30.275 52.419 1.00 22.59 ? 224  LEU A CB    1 
ATOM   1548  C  CG    . LEU A  1  197 ? 32.732  31.612 52.893 1.00 23.75 ? 224  LEU A CG    1 
ATOM   1549  C  CD1   . LEU A  1  197 ? 33.288  32.420 51.725 1.00 24.32 ? 224  LEU A CD1   1 
ATOM   1550  C  CD2   . LEU A  1  197 ? 31.723  32.432 53.687 1.00 23.29 ? 224  LEU A CD2   1 
ATOM   1551  N  N     . GLY A  1  198 ? 31.477  27.002 53.262 1.00 20.60 ? 225  GLY A N     1 
ATOM   1552  C  CA    . GLY A  1  198 ? 30.939  25.699 52.866 1.00 20.67 ? 225  GLY A CA    1 
ATOM   1553  C  C     . GLY A  1  198 ? 29.661  25.339 53.616 1.00 20.47 ? 225  GLY A C     1 
ATOM   1554  O  O     . GLY A  1  198 ? 28.936  24.429 53.220 1.00 20.19 ? 225  GLY A O     1 
ATOM   1555  N  N     . HIS A  1  199 ? 29.392  26.044 54.715 1.00 20.35 ? 226  HIS A N     1 
ATOM   1556  C  CA    . HIS A  1  199 ? 28.148  25.861 55.477 1.00 20.21 ? 226  HIS A CA    1 
ATOM   1557  C  C     . HIS A  1  199 ? 27.792  24.416 55.830 1.00 20.29 ? 226  HIS A C     1 
ATOM   1558  O  O     . HIS A  1  199 ? 26.638  23.992 55.676 1.00 20.60 ? 226  HIS A O     1 
ATOM   1559  C  CB    . HIS A  1  199 ? 26.970  26.548 54.760 1.00 20.05 ? 226  HIS A CB    1 
ATOM   1560  C  CG    . HIS A  1  199 ? 26.943  28.028 54.962 1.00 20.10 ? 226  HIS A CG    1 
ATOM   1561  N  ND1   . HIS A  1  199 ? 26.297  28.620 56.025 1.00 18.11 ? 226  HIS A ND1   1 
ATOM   1562  C  CD2   . HIS A  1  199 ? 27.511  29.034 54.256 1.00 19.38 ? 226  HIS A CD2   1 
ATOM   1563  C  CE1   . HIS A  1  199 ? 26.459  29.928 55.959 1.00 18.59 ? 226  HIS A CE1   1 
ATOM   1564  N  NE2   . HIS A  1  199 ? 27.197  30.205 54.898 1.00 17.87 ? 226  HIS A NE2   1 
ATOM   1565  N  N     . GLY A  1  200 ? 28.774  23.661 56.316 1.00 20.35 ? 227  GLY A N     1 
ATOM   1566  C  CA    . GLY A  1  200 ? 28.516  22.283 56.711 1.00 20.15 ? 227  GLY A CA    1 
ATOM   1567  C  C     . GLY A  1  200 ? 29.758  21.436 56.878 1.00 19.92 ? 227  GLY A C     1 
ATOM   1568  O  O     . GLY A  1  200 ? 30.843  21.935 57.210 1.00 19.91 ? 227  GLY A O     1 
ATOM   1569  N  N     . VAL A  1  201 ? 29.594  20.145 56.626 1.00 19.74 ? 228  VAL A N     1 
ATOM   1570  C  CA    . VAL A  1  201 ? 30.654  19.176 56.864 1.00 19.39 ? 228  VAL A CA    1 
ATOM   1571  C  C     . VAL A  1  201 ? 31.547  19.050 55.617 1.00 19.44 ? 228  VAL A C     1 
ATOM   1572  O  O     . VAL A  1  201 ? 31.377  18.134 54.813 1.00 19.73 ? 228  VAL A O     1 
ATOM   1573  C  CB    . VAL A  1  201 ? 30.073  17.812 57.315 1.00 19.91 ? 228  VAL A CB    1 
ATOM   1574  C  CG1   . VAL A  1  201 ? 31.191  16.861 57.781 1.00 19.22 ? 228  VAL A CG1   1 
ATOM   1575  C  CG2   . VAL A  1  201 ? 29.066  18.016 58.449 1.00 19.21 ? 228  VAL A CG2   1 
ATOM   1576  N  N     . ASP A  1  202 ? 32.473  19.995 55.461 1.00 18.94 ? 229  ASP A N     1 
ATOM   1577  C  CA    . ASP A  1  202 ? 33.449  19.964 54.360 1.00 19.26 ? 229  ASP A CA    1 
ATOM   1578  C  C     . ASP A  1  202 ? 34.861  19.611 54.829 1.00 18.74 ? 229  ASP A C     1 
ATOM   1579  O  O     . ASP A  1  202 ? 35.775  19.485 54.019 1.00 19.23 ? 229  ASP A O     1 
ATOM   1580  C  CB    . ASP A  1  202 ? 33.437  21.273 53.538 1.00 19.47 ? 229  ASP A CB    1 
ATOM   1581  C  CG    . ASP A  1  202 ? 33.778  22.519 54.362 1.00 21.39 ? 229  ASP A CG    1 
ATOM   1582  O  OD1   . ASP A  1  202 ? 34.244  22.395 55.514 1.00 21.27 ? 229  ASP A OD1   1 
ATOM   1583  O  OD2   . ASP A  1  202 ? 33.574  23.647 53.837 1.00 24.38 ? 229  ASP A OD2   1 
ATOM   1584  N  N     . LEU A  1  203 ? 35.019  19.440 56.140 1.00 18.20 ? 230  LEU A N     1 
ATOM   1585  C  CA    . LEU A  1  203 ? 36.317  19.145 56.762 1.00 17.93 ? 230  LEU A CA    1 
ATOM   1586  C  C     . LEU A  1  203 ? 37.367  20.211 56.494 1.00 17.81 ? 230  LEU A C     1 
ATOM   1587  O  O     . LEU A  1  203 ? 38.553  19.909 56.393 1.00 18.30 ? 230  LEU A O     1 
ATOM   1588  C  CB    . LEU A  1  203 ? 36.829  17.744 56.369 1.00 17.89 ? 230  LEU A CB    1 
ATOM   1589  C  CG    . LEU A  1  203 ? 36.390  16.575 57.261 1.00 18.52 ? 230  LEU A CG    1 
ATOM   1590  C  CD1   . LEU A  1  203 ? 34.873  16.508 57.435 1.00 15.81 ? 230  LEU A CD1   1 
ATOM   1591  C  CD2   . LEU A  1  203 ? 36.941  15.255 56.720 1.00 16.99 ? 230  LEU A CD2   1 
ATOM   1592  N  N     . ASN A  1  204 ? 36.934  21.466 56.409 1.00 18.04 ? 231  ASN A N     1 
ATOM   1593  C  CA    . ASN A  1  204 ? 37.867  22.584 56.296 1.00 18.73 ? 231  ASN A CA    1 
ATOM   1594  C  C     . ASN A  1  204 ? 38.716  22.748 57.561 1.00 18.94 ? 231  ASN A C     1 
ATOM   1595  O  O     . ASN A  1  204 ? 39.773  23.373 57.519 1.00 19.90 ? 231  ASN A O     1 
ATOM   1596  C  CB    . ASN A  1  204 ? 37.134  23.894 55.958 1.00 18.45 ? 231  ASN A CB    1 
ATOM   1597  C  CG    . ASN A  1  204 ? 36.423  24.488 57.158 1.00 18.62 ? 231  ASN A CG    1 
ATOM   1598  O  OD1   . ASN A  1  204 ? 37.059  25.064 58.046 1.00 18.86 ? 231  ASN A OD1   1 
ATOM   1599  N  ND2   . ASN A  1  204 ? 35.101  24.330 57.207 1.00 16.32 ? 231  ASN A ND2   1 
ATOM   1600  N  N     . HIS A  1  205 ? 38.255  22.188 58.683 1.00 18.80 ? 232  HIS A N     1 
ATOM   1601  C  CA    . HIS A  1  205 ? 39.036  22.229 59.928 1.00 19.19 ? 232  HIS A CA    1 
ATOM   1602  C  C     . HIS A  1  205 ? 40.269  21.314 59.867 1.00 19.63 ? 232  HIS A C     1 
ATOM   1603  O  O     . HIS A  1  205 ? 41.156  21.386 60.725 1.00 19.86 ? 232  HIS A O     1 
ATOM   1604  C  CB    . HIS A  1  205 ? 38.160  21.945 61.162 1.00 18.51 ? 232  HIS A CB    1 
ATOM   1605  C  CG    . HIS A  1  205 ? 37.533  20.583 61.180 1.00 19.12 ? 232  HIS A CG    1 
ATOM   1606  N  ND1   . HIS A  1  205 ? 37.162  19.908 60.033 1.00 18.78 ? 232  HIS A ND1   1 
ATOM   1607  C  CD2   . HIS A  1  205 ? 37.173  19.788 62.215 1.00 18.55 ? 232  HIS A CD2   1 
ATOM   1608  C  CE1   . HIS A  1  205 ? 36.626  18.746 60.362 1.00 18.42 ? 232  HIS A CE1   1 
ATOM   1609  N  NE2   . HIS A  1  205 ? 36.611  18.653 61.679 1.00 18.43 ? 232  HIS A NE2   1 
ATOM   1610  N  N     . ILE A  1  206 ? 40.308  20.469 58.839 1.00 19.59 ? 233  ILE A N     1 
ATOM   1611  C  CA    . ILE A  1  206 ? 41.455  19.613 58.558 1.00 20.09 ? 233  ILE A CA    1 
ATOM   1612  C  C     . ILE A  1  206 ? 42.232  20.151 57.346 1.00 20.44 ? 233  ILE A C     1 
ATOM   1613  O  O     . ILE A  1  206 ? 43.471  20.250 57.372 1.00 20.17 ? 233  ILE A O     1 
ATOM   1614  C  CB    . ILE A  1  206 ? 41.003  18.148 58.308 1.00 20.56 ? 233  ILE A CB    1 
ATOM   1615  C  CG1   . ILE A  1  206 ? 40.316  17.586 59.564 1.00 21.11 ? 233  ILE A CG1   1 
ATOM   1616  C  CG2   . ILE A  1  206 ? 42.179  17.264 57.908 1.00 20.91 ? 233  ILE A CG2   1 
ATOM   1617  C  CD1   . ILE A  1  206 ? 39.442  16.366 59.310 1.00 22.07 ? 233  ILE A CD1   1 
ATOM   1618  N  N     . TYR A  1  207 ? 41.494  20.521 56.302 1.00 19.96 ? 234  TYR A N     1 
ATOM   1619  C  CA    . TYR A  1  207 ? 42.080  20.810 54.996 1.00 20.63 ? 234  TYR A CA    1 
ATOM   1620  C  C     . TYR A  1  207 ? 42.291  22.288 54.703 1.00 21.46 ? 234  TYR A C     1 
ATOM   1621  O  O     . TYR A  1  207 ? 42.999  22.634 53.749 1.00 22.31 ? 234  TYR A O     1 
ATOM   1622  C  CB    . TYR A  1  207 ? 41.232  20.165 53.885 1.00 20.49 ? 234  TYR A CB    1 
ATOM   1623  C  CG    . TYR A  1  207 ? 41.136  18.648 53.989 1.00 19.52 ? 234  TYR A CG    1 
ATOM   1624  C  CD1   . TYR A  1  207 ? 42.257  17.837 53.774 1.00 18.30 ? 234  TYR A CD1   1 
ATOM   1625  C  CD2   . TYR A  1  207 ? 39.925  18.026 54.302 1.00 17.57 ? 234  TYR A CD2   1 
ATOM   1626  C  CE1   . TYR A  1  207 ? 42.169  16.439 53.871 1.00 17.73 ? 234  TYR A CE1   1 
ATOM   1627  C  CE2   . TYR A  1  207 ? 39.832  16.640 54.403 1.00 18.08 ? 234  TYR A CE2   1 
ATOM   1628  C  CZ    . TYR A  1  207 ? 40.952  15.853 54.182 1.00 18.15 ? 234  TYR A CZ    1 
ATOM   1629  O  OH    . TYR A  1  207 ? 40.835  14.483 54.281 1.00 19.85 ? 234  TYR A OH    1 
ATOM   1630  N  N     . GLY A  1  208 ? 41.696  23.156 55.517 1.00 21.67 ? 235  GLY A N     1 
ATOM   1631  C  CA    . GLY A  1  208 ? 41.748  24.600 55.278 1.00 22.38 ? 235  GLY A CA    1 
ATOM   1632  C  C     . GLY A  1  208 ? 40.523  25.089 54.521 1.00 22.92 ? 235  GLY A C     1 
ATOM   1633  O  O     . GLY A  1  208 ? 39.986  24.373 53.666 1.00 22.12 ? 235  GLY A O     1 
ATOM   1634  N  N     . GLU A  1  209 ? 40.097  26.315 54.827 1.00 23.33 ? 236  GLU A N     1 
ATOM   1635  C  CA    . GLU A  1  209 ? 38.929  26.924 54.191 1.00 24.61 ? 236  GLU A CA    1 
ATOM   1636  C  C     . GLU A  1  209 ? 39.226  27.294 52.735 1.00 25.60 ? 236  GLU A C     1 
ATOM   1637  O  O     . GLU A  1  209 ? 38.373  27.147 51.867 1.00 25.73 ? 236  GLU A O     1 
ATOM   1638  C  CB    . GLU A  1  209 ? 38.462  28.157 54.995 1.00 24.94 ? 236  GLU A CB    1 
ATOM   1639  C  CG    . GLU A  1  209 ? 37.290  28.946 54.391 1.00 25.53 ? 236  GLU A CG    1 
ATOM   1640  C  CD    . GLU A  1  209 ? 35.941  28.244 54.541 1.00 26.02 ? 236  GLU A CD    1 
ATOM   1641  O  OE1   . GLU A  1  209 ? 35.774  27.443 55.496 1.00 23.65 ? 236  GLU A OE1   1 
ATOM   1642  O  OE2   . GLU A  1  209 ? 35.040  28.517 53.707 1.00 24.84 ? 236  GLU A OE2   1 
ATOM   1643  N  N     . THR A  1  210 ? 40.444  27.752 52.470 1.00 26.44 ? 237  THR A N     1 
ATOM   1644  C  CA    . THR A  1  210 ? 40.809  28.210 51.135 1.00 27.46 ? 237  THR A CA    1 
ATOM   1645  C  C     . THR A  1  210 ? 41.803  27.269 50.462 1.00 27.82 ? 237  THR A C     1 
ATOM   1646  O  O     . THR A  1  210 ? 42.576  26.575 51.129 1.00 27.60 ? 237  THR A O     1 
ATOM   1647  C  CB    . THR A  1  210 ? 41.415  29.643 51.158 1.00 28.41 ? 237  THR A CB    1 
ATOM   1648  O  OG1   . THR A  1  210 ? 42.607  29.636 51.939 1.00 28.78 ? 237  THR A OG1   1 
ATOM   1649  C  CG2   . THR A  1  210 ? 40.434  30.654 51.775 1.00 28.57 ? 237  THR A CG2   1 
ATOM   1650  N  N     . LEU A  1  211 ? 41.779  27.274 49.133 1.00 28.22 ? 238  LEU A N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? 42.701  26.509 48.315 1.00 28.99 ? 238  LEU A CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? 44.157  26.815 48.677 1.00 29.57 ? 238  LEU A C     1 
ATOM   1653  O  O     . LEU A  1  211 ? 44.997  25.918 48.723 1.00 29.75 ? 238  LEU A O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? 42.442  26.806 46.830 1.00 29.13 ? 238  LEU A CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? 43.019  25.832 45.801 1.00 30.36 ? 238  LEU A CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? 42.535  24.392 46.033 1.00 28.75 ? 238  LEU A CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? 42.694  26.275 44.379 1.00 28.95 ? 238  LEU A CD2   1 
ATOM   1658  N  N     . ASP A  1  212 ? 44.443  28.089 48.927 1.00 30.27 ? 239  ASP A N     1 
ATOM   1659  C  CA    . ASP A  1  212 ? 45.783  28.538 49.276 1.00 31.25 ? 239  ASP A CA    1 
ATOM   1660  C  C     . ASP A  1  212 ? 46.308  27.876 50.564 1.00 29.49 ? 239  ASP A C     1 
ATOM   1661  O  O     . ASP A  1  212 ? 47.454  27.404 50.614 1.00 29.45 ? 239  ASP A O     1 
ATOM   1662  C  CB    . ASP A  1  212 ? 45.792  30.070 49.351 1.00 33.42 ? 239  ASP A CB    1 
ATOM   1663  C  CG    . ASP A  1  212 ? 46.773  30.603 50.358 1.00 37.26 ? 239  ASP A CG    1 
ATOM   1664  O  OD1   . ASP A  1  212 ? 47.986  30.657 50.045 1.00 42.07 ? 239  ASP A OD1   1 
ATOM   1665  O  OD2   . ASP A  1  212 ? 46.316  30.982 51.463 1.00 41.16 ? 239  ASP A OD2   1 
ATOM   1666  N  N     . ARG A  1  213 ? 45.453  27.815 51.583 1.00 27.30 ? 240  ARG A N     1 
ATOM   1667  C  CA    . ARG A  1  213 ? 45.787  27.173 52.851 1.00 25.48 ? 240  ARG A CA    1 
ATOM   1668  C  C     . ARG A  1  213 ? 45.940  25.652 52.672 1.00 24.27 ? 240  ARG A C     1 
ATOM   1669  O  O     . ARG A  1  213 ? 46.882  25.051 53.203 1.00 23.31 ? 240  ARG A O     1 
ATOM   1670  C  CB    . ARG A  1  213 ? 44.708  27.494 53.886 1.00 25.02 ? 240  ARG A CB    1 
ATOM   1671  C  CG    . ARG A  1  213 ? 45.044  27.128 55.313 1.00 24.54 ? 240  ARG A CG    1 
ATOM   1672  C  CD    . ARG A  1  213 ? 43.984  27.697 56.272 1.00 23.90 ? 240  ARG A CD    1 
ATOM   1673  N  NE    . ARG A  1  213 ? 44.222  27.239 57.640 1.00 24.78 ? 240  ARG A NE    1 
ATOM   1674  C  CZ    . ARG A  1  213 ? 44.967  27.896 58.529 1.00 24.99 ? 240  ARG A CZ    1 
ATOM   1675  N  NH1   . ARG A  1  213 ? 45.542  29.049 58.206 1.00 25.99 ? 240  ARG A NH1   1 
ATOM   1676  N  NH2   . ARG A  1  213 ? 45.142  27.400 59.744 1.00 24.23 ? 240  ARG A NH2   1 
ATOM   1677  N  N     . GLN A  1  214 ? 45.019  25.050 51.919 1.00 22.78 ? 241  GLN A N     1 
ATOM   1678  C  CA    . GLN A  1  214 ? 45.056  23.616 51.616 1.00 22.35 ? 241  GLN A CA    1 
ATOM   1679  C  C     . GLN A  1  214 ? 46.389  23.210 51.014 1.00 23.21 ? 241  GLN A C     1 
ATOM   1680  O  O     . GLN A  1  214 ? 47.011  22.249 51.452 1.00 23.02 ? 241  GLN A O     1 
ATOM   1681  C  CB    . GLN A  1  214 ? 43.934  23.232 50.641 1.00 21.89 ? 241  GLN A CB    1 
ATOM   1682  C  CG    . GLN A  1  214 ? 43.868  21.738 50.337 1.00 21.53 ? 241  GLN A CG    1 
ATOM   1683  C  CD    . GLN A  1  214 ? 43.128  21.428 49.047 1.00 21.69 ? 241  GLN A CD    1 
ATOM   1684  O  OE1   . GLN A  1  214 ? 43.731  21.018 48.064 1.00 21.09 ? 241  GLN A OE1   1 
ATOM   1685  N  NE2   . GLN A  1  214 ? 41.819  21.631 49.045 1.00 20.41 ? 241  GLN A NE2   1 
ATOM   1686  N  N     . HIS A  1  215 ? 46.813  23.945 49.995 1.00 24.21 ? 242  HIS A N     1 
ATOM   1687  C  CA    . HIS A  1  215 ? 48.050  23.631 49.296 1.00 25.63 ? 242  HIS A CA    1 
ATOM   1688  C  C     . HIS A  1  215 ? 49.291  23.786 50.168 1.00 25.90 ? 242  HIS A C     1 
ATOM   1689  O  O     . HIS A  1  215 ? 50.264  23.054 49.997 1.00 26.62 ? 242  HIS A O     1 
ATOM   1690  C  CB    . HIS A  1  215 ? 48.135  24.443 48.001 1.00 26.32 ? 242  HIS A CB    1 
ATOM   1691  C  CG    . HIS A  1  215 ? 47.226  23.922 46.928 1.00 27.21 ? 242  HIS A CG    1 
ATOM   1692  N  ND1   . HIS A  1  215 ? 47.287  24.349 45.620 1.00 28.36 ? 242  HIS A ND1   1 
ATOM   1693  C  CD2   . HIS A  1  215 ? 46.251  22.980 46.971 1.00 26.52 ? 242  HIS A CD2   1 
ATOM   1694  C  CE1   . HIS A  1  215 ? 46.375  23.709 44.908 1.00 29.45 ? 242  HIS A CE1   1 
ATOM   1695  N  NE2   . HIS A  1  215 ? 45.740  22.864 45.702 1.00 27.98 ? 242  HIS A NE2   1 
ATOM   1696  N  N     . LYS A  1  216 ? 49.247  24.723 51.110 1.00 25.48 ? 243  LYS A N     1 
ATOM   1697  C  CA    . LYS A  1  216 ? 50.321  24.871 52.079 1.00 25.86 ? 243  LYS A CA    1 
ATOM   1698  C  C     . LYS A  1  216 ? 50.377  23.690 53.048 1.00 24.89 ? 243  LYS A C     1 
ATOM   1699  O  O     . LYS A  1  216 ? 51.451  23.370 53.565 1.00 24.94 ? 243  LYS A O     1 
ATOM   1700  C  CB    . LYS A  1  216 ? 50.160  26.169 52.860 1.00 26.30 ? 243  LYS A CB    1 
ATOM   1701  C  CG    . LYS A  1  216 ? 50.602  27.410 52.129 1.00 29.13 ? 243  LYS A CG    1 
ATOM   1702  C  CD    . LYS A  1  216 ? 50.305  28.617 52.996 1.00 32.55 ? 243  LYS A CD    1 
ATOM   1703  C  CE    . LYS A  1  216 ? 50.811  29.879 52.382 1.00 36.07 ? 243  LYS A CE    1 
ATOM   1704  N  NZ    . LYS A  1  216 ? 50.642  30.985 53.365 1.00 40.65 ? 243  LYS A NZ    1 
ATOM   1705  N  N     . LEU A  1  217 ? 49.223  23.051 53.286 1.00 23.37 ? 244  LEU A N     1 
ATOM   1706  C  CA    . LEU A  1  217 ? 49.118  21.891 54.190 1.00 22.67 ? 244  LEU A CA    1 
ATOM   1707  C  C     . LEU A  1  217 ? 49.391  20.537 53.526 1.00 22.60 ? 244  LEU A C     1 
ATOM   1708  O  O     . LEU A  1  217 ? 49.579  19.531 54.219 1.00 22.54 ? 244  LEU A O     1 
ATOM   1709  C  CB    . LEU A  1  217 ? 47.732  21.843 54.851 1.00 21.88 ? 244  LEU A CB    1 
ATOM   1710  C  CG    . LEU A  1  217 ? 47.367  22.960 55.836 1.00 22.74 ? 244  LEU A CG    1 
ATOM   1711  C  CD1   . LEU A  1  217 ? 45.883  22.914 56.158 1.00 21.50 ? 244  LEU A CD1   1 
ATOM   1712  C  CD2   . LEU A  1  217 ? 48.208  22.849 57.115 1.00 23.48 ? 244  LEU A CD2   1 
ATOM   1713  N  N     . ARG A  1  218 ? 49.382  20.499 52.196 1.00 22.19 ? 245  ARG A N     1 
ATOM   1714  C  CA    . ARG A  1  218 ? 49.572  19.240 51.469 1.00 22.08 ? 245  ARG A CA    1 
ATOM   1715  C  C     . ARG A  1  218 ? 51.035  18.937 51.172 1.00 22.95 ? 245  ARG A C     1 
ATOM   1716  O  O     . ARG A  1  218 ? 51.840  19.847 50.960 1.00 23.63 ? 245  ARG A O     1 
ATOM   1717  C  CB    . ARG A  1  218 ? 48.760  19.235 50.164 1.00 22.19 ? 245  ARG A CB    1 
ATOM   1718  C  CG    . ARG A  1  218 ? 47.252  19.060 50.364 1.00 19.98 ? 245  ARG A CG    1 
ATOM   1719  C  CD    . ARG A  1  218 ? 46.506  19.275 49.060 1.00 19.48 ? 245  ARG A CD    1 
ATOM   1720  N  NE    . ARG A  1  218 ? 46.929  18.322 48.024 1.00 19.58 ? 245  ARG A NE    1 
ATOM   1721  C  CZ    . ARG A  1  218 ? 46.432  18.294 46.792 1.00 19.00 ? 245  ARG A CZ    1 
ATOM   1722  N  NH1   . ARG A  1  218 ? 45.502  19.175 46.432 1.00 16.18 ? 245  ARG A NH1   1 
ATOM   1723  N  NH2   . ARG A  1  218 ? 46.870  17.395 45.917 1.00 17.44 ? 245  ARG A NH2   1 
ATOM   1724  N  N     . LEU A  1  219 ? 51.359  17.644 51.172 1.00 23.23 ? 246  LEU A N     1 
ATOM   1725  C  CA    . LEU A  1  219 ? 52.676  17.141 50.803 1.00 24.40 ? 246  LEU A CA    1 
ATOM   1726  C  C     . LEU A  1  219 ? 52.909  17.137 49.286 1.00 24.99 ? 246  LEU A C     1 
ATOM   1727  O  O     . LEU A  1  219 ? 54.046  17.281 48.839 1.00 25.29 ? 246  LEU A O     1 
ATOM   1728  C  CB    . LEU A  1  219 ? 52.875  15.724 51.374 1.00 24.50 ? 246  LEU A CB    1 
ATOM   1729  C  CG    . LEU A  1  219 ? 54.234  15.035 51.260 1.00 25.82 ? 246  LEU A CG    1 
ATOM   1730  C  CD1   . LEU A  1  219 ? 55.335  15.848 51.945 1.00 26.92 ? 246  LEU A CD1   1 
ATOM   1731  C  CD2   . LEU A  1  219 ? 54.182  13.604 51.838 1.00 25.80 ? 246  LEU A CD2   1 
ATOM   1732  N  N     . PHE A  1  220 ? 51.828  16.986 48.513 1.00 24.85 ? 247  PHE A N     1 
ATOM   1733  C  CA    . PHE A  1  220 ? 51.878  16.780 47.046 1.00 25.80 ? 247  PHE A CA    1 
ATOM   1734  C  C     . PHE A  1  220 ? 52.601  15.498 46.616 1.00 26.84 ? 247  PHE A C     1 
ATOM   1735  O  O     . PHE A  1  220 ? 53.097  15.377 45.488 1.00 27.65 ? 247  PHE A O     1 
ATOM   1736  C  CB    . PHE A  1  220 ? 52.347  18.031 46.284 1.00 26.50 ? 247  PHE A CB    1 
ATOM   1737  C  CG    . PHE A  1  220 ? 51.381  19.173 46.390 1.00 26.43 ? 247  PHE A CG    1 
ATOM   1738  C  CD1   . PHE A  1  220 ? 50.268  19.242 45.551 1.00 26.53 ? 247  PHE A CD1   1 
ATOM   1739  C  CD2   . PHE A  1  220 ? 51.556  20.155 47.357 1.00 25.90 ? 247  PHE A CD2   1 
ATOM   1740  C  CE1   . PHE A  1  220 ? 49.351  20.293 45.661 1.00 26.42 ? 247  PHE A CE1   1 
ATOM   1741  C  CE2   . PHE A  1  220 ? 50.652  21.202 47.479 1.00 24.99 ? 247  PHE A CE2   1 
ATOM   1742  C  CZ    . PHE A  1  220 ? 49.544  21.271 46.634 1.00 25.98 ? 247  PHE A CZ    1 
ATOM   1743  N  N     . LYS A  1  221 ? 52.624  14.535 47.531 1.00 26.55 ? 248  LYS A N     1 
ATOM   1744  C  CA    . LYS A  1  221 ? 53.019  13.181 47.211 1.00 27.74 ? 248  LYS A CA    1 
ATOM   1745  C  C     . LYS A  1  221 ? 51.974  12.249 47.814 1.00 26.98 ? 248  LYS A C     1 
ATOM   1746  O  O     . LYS A  1  221 ? 51.585  12.415 48.979 1.00 26.23 ? 248  LYS A O     1 
ATOM   1747  C  CB    . LYS A  1  221 ? 54.402  12.880 47.785 1.00 28.33 ? 248  LYS A CB    1 
ATOM   1748  C  CG    . LYS A  1  221 ? 54.922  11.492 47.445 1.00 31.33 ? 248  LYS A CG    1 
ATOM   1749  C  CD    . LYS A  1  221 ? 56.196  11.172 48.210 1.00 34.58 ? 248  LYS A CD    1 
ATOM   1750  C  CE    . LYS A  1  221 ? 56.737  9.798  47.841 1.00 36.92 ? 248  LYS A CE    1 
ATOM   1751  N  NZ    . LYS A  1  221 ? 58.016  9.573  48.569 1.00 37.81 ? 248  LYS A NZ    1 
ATOM   1752  N  N     . ASP A  1  222 ? 51.500  11.298 47.007 1.00 27.25 ? 249  ASP A N     1 
ATOM   1753  C  CA    . ASP A  1  222 ? 50.624  10.213 47.478 1.00 26.78 ? 249  ASP A CA    1 
ATOM   1754  C  C     . ASP A  1  222 ? 49.271  10.688 48.042 1.00 25.38 ? 249  ASP A C     1 
ATOM   1755  O  O     . ASP A  1  222 ? 48.583  9.936  48.736 1.00 24.63 ? 249  ASP A O     1 
ATOM   1756  C  CB    . ASP A  1  222 ? 51.371  9.324  48.508 1.00 27.09 ? 249  ASP A CB    1 
ATOM   1757  C  CG    . ASP A  1  222 ? 52.556  8.578  47.894 1.00 29.43 ? 249  ASP A CG    1 
ATOM   1758  O  OD1   . ASP A  1  222 ? 52.474  8.236  46.702 1.00 31.31 ? 249  ASP A OD1   1 
ATOM   1759  O  OD2   . ASP A  1  222 ? 53.569  8.334  48.597 1.00 31.25 ? 249  ASP A OD2   1 
ATOM   1760  N  N     . GLY A  1  223 ? 48.897  11.928 47.732 1.00 24.64 ? 250  GLY A N     1 
ATOM   1761  C  CA    . GLY A  1  223 ? 47.640  12.513 48.206 1.00 23.56 ? 250  GLY A CA    1 
ATOM   1762  C  C     . GLY A  1  223 ? 47.707  13.062 49.625 1.00 22.85 ? 250  GLY A C     1 
ATOM   1763  O  O     . GLY A  1  223 ? 46.718  13.584 50.150 1.00 22.22 ? 250  GLY A O     1 
ATOM   1764  N  N     . LYS A  1  224 ? 48.885  12.978 50.232 1.00 22.80 ? 251  LYS A N     1 
ATOM   1765  C  CA    . LYS A  1  224 ? 49.020  13.158 51.674 1.00 22.18 ? 251  LYS A CA    1 
ATOM   1766  C  C     . LYS A  1  224 ? 49.090  14.592 52.169 1.00 21.84 ? 251  LYS A C     1 
ATOM   1767  O  O     . LYS A  1  224 ? 49.343  15.537 51.401 1.00 21.90 ? 251  LYS A O     1 
ATOM   1768  C  CB    . LYS A  1  224 ? 50.199  12.335 52.213 1.00 22.72 ? 251  LYS A CB    1 
ATOM   1769  C  CG    . LYS A  1  224 ? 49.962  10.826 52.161 1.00 22.72 ? 251  LYS A CG    1 
ATOM   1770  C  CD    . LYS A  1  224 ? 51.168  10.044 52.685 1.00 22.90 ? 251  LYS A CD    1 
ATOM   1771  C  CE    . LYS A  1  224 ? 50.864  8.566  52.776 1.00 22.69 ? 251  LYS A CE    1 
ATOM   1772  N  NZ    . LYS A  1  224 ? 52.079  7.773  53.192 1.00 24.16 ? 251  LYS A NZ    1 
ATOM   1773  N  N     . LEU A  1  225 ? 48.822  14.739 53.465 1.00 21.08 ? 252  LEU A N     1 
ATOM   1774  C  CA    . LEU A  1  225 ? 49.033  15.982 54.189 1.00 20.87 ? 252  LEU A CA    1 
ATOM   1775  C  C     . LEU A  1  225 ? 50.428  15.978 54.779 1.00 21.74 ? 252  LEU A C     1 
ATOM   1776  O  O     . LEU A  1  225 ? 50.918  14.925 55.217 1.00 21.56 ? 252  LEU A O     1 
ATOM   1777  C  CB    . LEU A  1  225 ? 48.012  16.103 55.328 1.00 20.46 ? 252  LEU A CB    1 
ATOM   1778  C  CG    . LEU A  1  225 ? 46.563  16.356 54.928 1.00 19.68 ? 252  LEU A CG    1 
ATOM   1779  C  CD1   . LEU A  1  225 ? 45.650  16.216 56.146 1.00 20.72 ? 252  LEU A CD1   1 
ATOM   1780  C  CD2   . LEU A  1  225 ? 46.429  17.728 54.286 1.00 19.72 ? 252  LEU A CD2   1 
ATOM   1781  N  N     . LYS A  1  226 ? 51.067  17.150 54.801 1.00 22.32 ? 253  LYS A N     1 
ATOM   1782  C  CA    . LYS A  1  226 ? 52.378  17.301 55.446 1.00 23.27 ? 253  LYS A CA    1 
ATOM   1783  C  C     . LYS A  1  226 ? 52.289  16.930 56.926 1.00 23.25 ? 253  LYS A C     1 
ATOM   1784  O  O     . LYS A  1  226 ? 51.218  17.048 57.552 1.00 22.65 ? 253  LYS A O     1 
ATOM   1785  C  CB    . LYS A  1  226 ? 52.913  18.738 55.302 1.00 23.95 ? 253  LYS A CB    1 
ATOM   1786  C  CG    . LYS A  1  226 ? 53.397  19.079 53.895 1.00 26.27 ? 253  LYS A CG    1 
ATOM   1787  C  CD    . LYS A  1  226 ? 53.923  20.505 53.771 1.00 29.97 ? 253  LYS A CD    1 
ATOM   1788  C  CE    . LYS A  1  226 ? 55.439  20.509 53.707 1.00 34.21 ? 253  LYS A CE    1 
ATOM   1789  N  NZ    . LYS A  1  226 ? 55.954  21.564 52.785 1.00 38.34 ? 253  LYS A NZ    1 
ATOM   1790  N  N     . TYR A  1  227 ? 53.414  16.501 57.483 1.00 23.69 ? 254  TYR A N     1 
ATOM   1791  C  CA    . TYR A  1  227 ? 53.473  16.097 58.882 1.00 24.15 ? 254  TYR A CA    1 
ATOM   1792  C  C     . TYR A  1  227 ? 54.907  16.134 59.381 1.00 24.87 ? 254  TYR A C     1 
ATOM   1793  O  O     . TYR A  1  227 ? 55.855  16.245 58.595 1.00 24.90 ? 254  TYR A O     1 
ATOM   1794  C  CB    . TYR A  1  227 ? 52.883  14.685 59.067 1.00 23.76 ? 254  TYR A CB    1 
ATOM   1795  C  CG    . TYR A  1  227 ? 53.646  13.597 58.342 1.00 25.12 ? 254  TYR A CG    1 
ATOM   1796  C  CD1   . TYR A  1  227 ? 54.660  12.878 58.986 1.00 25.20 ? 254  TYR A CD1   1 
ATOM   1797  C  CD2   . TYR A  1  227 ? 53.363  13.293 57.008 1.00 25.12 ? 254  TYR A CD2   1 
ATOM   1798  C  CE1   . TYR A  1  227 ? 55.375  11.884 58.314 1.00 27.23 ? 254  TYR A CE1   1 
ATOM   1799  C  CE2   . TYR A  1  227 ? 54.068  12.308 56.329 1.00 26.24 ? 254  TYR A CE2   1 
ATOM   1800  C  CZ    . TYR A  1  227 ? 55.067  11.603 56.989 1.00 28.04 ? 254  TYR A CZ    1 
ATOM   1801  O  OH    . TYR A  1  227 ? 55.758  10.620 56.320 1.00 30.46 ? 254  TYR A OH    1 
ATOM   1802  N  N     . GLN A  1  228 ? 55.060  16.040 60.694 1.00 25.02 ? 255  GLN A N     1 
ATOM   1803  C  CA    . GLN A  1  228 ? 56.374  15.826 61.277 1.00 26.42 ? 255  GLN A CA    1 
ATOM   1804  C  C     . GLN A  1  228 ? 56.363  14.564 62.142 1.00 26.41 ? 255  GLN A C     1 
ATOM   1805  O  O     . GLN A  1  228 ? 55.298  14.052 62.508 1.00 26.07 ? 255  GLN A O     1 
ATOM   1806  C  CB    . GLN A  1  228 ? 56.838  17.057 62.071 1.00 26.62 ? 255  GLN A CB    1 
ATOM   1807  C  CG    . GLN A  1  228 ? 55.839  17.540 63.111 1.00 27.33 ? 255  GLN A CG    1 
ATOM   1808  C  CD    . GLN A  1  228 ? 56.352  18.707 63.936 1.00 28.89 ? 255  GLN A CD    1 
ATOM   1809  O  OE1   . GLN A  1  228 ? 57.553  18.880 64.106 1.00 30.59 ? 255  GLN A OE1   1 
ATOM   1810  N  NE2   . GLN A  1  228 ? 55.435  19.504 64.464 1.00 28.92 ? 255  GLN A NE2   1 
ATOM   1811  N  N     . VAL A  1  229 ? 57.549  14.060 62.445 1.00 27.15 ? 256  VAL A N     1 
ATOM   1812  C  CA    . VAL A  1  229 ? 57.690  12.874 63.279 1.00 27.96 ? 256  VAL A CA    1 
ATOM   1813  C  C     . VAL A  1  229 ? 58.495  13.276 64.517 1.00 28.63 ? 256  VAL A C     1 
ATOM   1814  O  O     . VAL A  1  229 ? 59.680  13.547 64.422 1.00 29.16 ? 256  VAL A O     1 
ATOM   1815  C  CB    . VAL A  1  229 ? 58.371  11.705 62.504 1.00 28.58 ? 256  VAL A CB    1 
ATOM   1816  C  CG1   . VAL A  1  229 ? 58.480  10.450 63.372 1.00 29.16 ? 256  VAL A CG1   1 
ATOM   1817  C  CG2   . VAL A  1  229 ? 57.596  11.382 61.232 1.00 27.94 ? 256  VAL A CG2   1 
ATOM   1818  N  N     . ILE A  1  230 ? 57.827  13.350 65.666 1.00 28.82 ? 257  ILE A N     1 
ATOM   1819  C  CA    . ILE A  1  230 ? 58.489  13.674 66.930 1.00 30.11 ? 257  ILE A CA    1 
ATOM   1820  C  C     . ILE A  1  230 ? 58.497  12.429 67.821 1.00 30.96 ? 257  ILE A C     1 
ATOM   1821  O  O     . ILE A  1  230 ? 57.443  11.884 68.142 1.00 30.83 ? 257  ILE A O     1 
ATOM   1822  C  CB    . ILE A  1  230 ? 57.810  14.874 67.649 1.00 29.92 ? 257  ILE A CB    1 
ATOM   1823  C  CG1   . ILE A  1  230 ? 57.757  16.099 66.721 1.00 29.43 ? 257  ILE A CG1   1 
ATOM   1824  C  CG2   . ILE A  1  230 ? 58.528  15.202 68.963 1.00 30.65 ? 257  ILE A CG2   1 
ATOM   1825  C  CD1   . ILE A  1  230 ? 56.781  17.175 67.160 1.00 29.14 ? 257  ILE A CD1   1 
ATOM   1826  N  N     . GLY A  1  231 ? 59.692  11.972 68.190 1.00 32.47 ? 258  GLY A N     1 
ATOM   1827  C  CA    . GLY A  1  231 ? 59.854  10.742 68.979 1.00 33.58 ? 258  GLY A CA    1 
ATOM   1828  C  C     . GLY A  1  231 ? 59.118  9.549  68.376 1.00 33.24 ? 258  GLY A C     1 
ATOM   1829  O  O     . GLY A  1  231 ? 58.479  8.775  69.091 1.00 33.45 ? 258  GLY A O     1 
ATOM   1830  N  N     . GLY A  1  232 ? 59.194  9.420  67.052 1.00 32.60 ? 259  GLY A N     1 
ATOM   1831  C  CA    . GLY A  1  232 ? 58.570  8.311  66.334 1.00 32.08 ? 259  GLY A CA    1 
ATOM   1832  C  C     . GLY A  1  232 ? 57.070  8.446  66.149 1.00 30.89 ? 259  GLY A C     1 
ATOM   1833  O  O     . GLY A  1  232 ? 56.438  7.549  65.610 1.00 30.67 ? 259  GLY A O     1 
ATOM   1834  N  N     . GLU A  1  233 ? 56.500  9.567  66.588 1.00 30.46 ? 260  GLU A N     1 
ATOM   1835  C  CA    . GLU A  1  233 ? 55.057  9.794  66.489 1.00 29.65 ? 260  GLU A CA    1 
ATOM   1836  C  C     . GLU A  1  233 ? 54.719  10.871 65.467 1.00 28.32 ? 260  GLU A C     1 
ATOM   1837  O  O     . GLU A  1  233 ? 55.357  11.926 65.439 1.00 28.37 ? 260  GLU A O     1 
ATOM   1838  C  CB    . GLU A  1  233 ? 54.493  10.180 67.856 1.00 30.37 ? 260  GLU A CB    1 
ATOM   1839  C  CG    . GLU A  1  233 ? 54.520  9.059  68.892 1.00 33.23 ? 260  GLU A CG    1 
ATOM   1840  C  CD    . GLU A  1  233 ? 53.431  8.033  68.659 1.00 35.27 ? 260  GLU A CD    1 
ATOM   1841  O  OE1   . GLU A  1  233 ? 52.250  8.420  68.501 1.00 36.11 ? 260  GLU A OE1   1 
ATOM   1842  O  OE2   . GLU A  1  233 ? 53.756  6.833  68.623 1.00 38.28 ? 260  GLU A OE2   1 
ATOM   1843  N  N     . VAL A  1  234 ? 53.698  10.611 64.651 1.00 27.20 ? 261  VAL A N     1 
ATOM   1844  C  CA    . VAL A  1  234 ? 53.268  11.551 63.613 1.00 25.89 ? 261  VAL A CA    1 
ATOM   1845  C  C     . VAL A  1  234 ? 52.386  12.671 64.178 1.00 25.26 ? 261  VAL A C     1 
ATOM   1846  O  O     . VAL A  1  234 ? 51.344  12.422 64.792 1.00 24.80 ? 261  VAL A O     1 
ATOM   1847  C  CB    . VAL A  1  234 ? 52.558  10.834 62.428 1.00 25.17 ? 261  VAL A CB    1 
ATOM   1848  C  CG1   . VAL A  1  234 ? 52.012  11.852 61.432 1.00 24.34 ? 261  VAL A CG1   1 
ATOM   1849  C  CG2   . VAL A  1  234 ? 53.522  9.870  61.728 1.00 26.25 ? 261  VAL A CG2   1 
ATOM   1850  N  N     . TYR A  1  235 ? 52.829  13.904 63.964 1.00 25.16 ? 262  TYR A N     1 
ATOM   1851  C  CA    . TYR A  1  235 ? 52.094  15.081 64.389 1.00 25.03 ? 262  TYR A CA    1 
ATOM   1852  C  C     . TYR A  1  235 ? 51.906  16.033 63.197 1.00 24.65 ? 262  TYR A C     1 
ATOM   1853  O  O     . TYR A  1  235 ? 52.569  15.869 62.165 1.00 24.33 ? 262  TYR A O     1 
ATOM   1854  C  CB    . TYR A  1  235 ? 52.835  15.767 65.537 1.00 25.90 ? 262  TYR A CB    1 
ATOM   1855  C  CG    . TYR A  1  235 ? 52.762  14.996 66.842 1.00 27.65 ? 262  TYR A CG    1 
ATOM   1856  C  CD1   . TYR A  1  235 ? 51.586  14.980 67.595 1.00 28.06 ? 262  TYR A CD1   1 
ATOM   1857  C  CD2   . TYR A  1  235 ? 53.862  14.285 67.324 1.00 28.54 ? 262  TYR A CD2   1 
ATOM   1858  C  CE1   . TYR A  1  235 ? 51.508  14.278 68.796 1.00 29.22 ? 262  TYR A CE1   1 
ATOM   1859  C  CE2   . TYR A  1  235 ? 53.789  13.575 68.527 1.00 30.18 ? 262  TYR A CE2   1 
ATOM   1860  C  CZ    . TYR A  1  235 ? 52.607  13.578 69.253 1.00 31.13 ? 262  TYR A CZ    1 
ATOM   1861  O  OH    . TYR A  1  235 ? 52.513  12.888 70.444 1.00 33.76 ? 262  TYR A OH    1 
ATOM   1862  N  N     . PRO A  1  236 ? 50.995  17.014 63.324 1.00 23.81 ? 263  PRO A N     1 
ATOM   1863  C  CA    . PRO A  1  236 ? 50.858  17.995 62.251 1.00 23.70 ? 263  PRO A CA    1 
ATOM   1864  C  C     . PRO A  1  236 ? 52.139  18.804 62.090 1.00 24.12 ? 263  PRO A C     1 
ATOM   1865  O  O     . PRO A  1  236 ? 52.913  18.905 63.038 1.00 25.39 ? 263  PRO A O     1 
ATOM   1866  C  CB    . PRO A  1  236 ? 49.716  18.895 62.744 1.00 22.87 ? 263  PRO A CB    1 
ATOM   1867  C  CG    . PRO A  1  236 ? 48.925  18.017 63.659 1.00 23.04 ? 263  PRO A CG    1 
ATOM   1868  C  CD    . PRO A  1  236 ? 49.975  17.211 64.372 1.00 24.03 ? 263  PRO A CD    1 
ATOM   1869  N  N     . PRO A  1  237 ? 52.367  19.379 60.901 1.00 24.12 ? 264  PRO A N     1 
ATOM   1870  C  CA    . PRO A  1  237 ? 53.615  20.104 60.668 1.00 24.94 ? 264  PRO A CA    1 
ATOM   1871  C  C     . PRO A  1  237 ? 53.565  21.452 61.398 1.00 25.20 ? 264  PRO A C     1 
ATOM   1872  O  O     . PRO A  1  237 ? 52.541  21.786 61.991 1.00 24.44 ? 264  PRO A O     1 
ATOM   1873  C  CB    . PRO A  1  237 ? 53.587  20.328 59.156 1.00 24.55 ? 264  PRO A CB    1 
ATOM   1874  C  CG    . PRO A  1  237 ? 52.130  20.553 58.876 1.00 24.04 ? 264  PRO A CG    1 
ATOM   1875  C  CD    . PRO A  1  237 ? 51.392  19.605 59.811 1.00 23.43 ? 264  PRO A CD    1 
ATOM   1876  N  N     . THR A  1  238 ? 54.633  22.234 61.340 1.00 26.00 ? 265  THR A N     1 
ATOM   1877  C  CA    . THR A  1  238 ? 54.633  23.517 62.051 1.00 26.69 ? 265  THR A CA    1 
ATOM   1878  C  C     . THR A  1  238 ? 54.236  24.693 61.173 1.00 26.81 ? 265  THR A C     1 
ATOM   1879  O  O     . THR A  1  238 ? 54.267  24.606 59.940 1.00 26.89 ? 265  THR A O     1 
ATOM   1880  C  CB    . THR A  1  238 ? 56.006  23.843 62.649 1.00 27.69 ? 265  THR A CB    1 
ATOM   1881  O  OG1   . THR A  1  238 ? 56.922  24.094 61.582 1.00 28.21 ? 265  THR A OG1   1 
ATOM   1882  C  CG2   . THR A  1  238 ? 56.511  22.694 63.508 1.00 28.42 ? 265  THR A CG2   1 
ATOM   1883  N  N     . VAL A  1  239 ? 53.883  25.794 61.835 1.00 27.32 ? 266  VAL A N     1 
ATOM   1884  C  CA    . VAL A  1  239 ? 53.633  27.081 61.201 1.00 27.87 ? 266  VAL A CA    1 
ATOM   1885  C  C     . VAL A  1  239 ? 54.814  27.510 60.332 1.00 29.35 ? 266  VAL A C     1 
ATOM   1886  O  O     . VAL A  1  239 ? 54.622  27.928 59.189 1.00 29.23 ? 266  VAL A O     1 
ATOM   1887  C  CB    . VAL A  1  239 ? 53.301  28.161 62.262 1.00 28.48 ? 266  VAL A CB    1 
ATOM   1888  C  CG1   . VAL A  1  239 ? 53.484  29.581 61.714 1.00 29.14 ? 266  VAL A CG1   1 
ATOM   1889  C  CG2   . VAL A  1  239 ? 51.875  27.952 62.813 1.00 26.68 ? 266  VAL A CG2   1 
ATOM   1890  N  N     . LYS A  1  240 ? 56.029  27.386 60.867 1.00 30.77 ? 267  LYS A N     1 
ATOM   1891  C  CA    . LYS A  1  240 ? 57.223  27.767 60.122 1.00 32.69 ? 267  LYS A CA    1 
ATOM   1892  C  C     . LYS A  1  240 ? 57.478  26.894 58.886 1.00 32.69 ? 267  LYS A C     1 
ATOM   1893  O  O     . LYS A  1  240 ? 57.924  27.406 57.859 1.00 33.55 ? 267  LYS A O     1 
ATOM   1894  C  CB    . LYS A  1  240 ? 58.460  27.819 61.027 1.00 33.98 ? 267  LYS A CB    1 
ATOM   1895  C  CG    . LYS A  1  240 ? 59.636  28.512 60.367 1.00 37.11 ? 267  LYS A CG    1 
ATOM   1896  C  CD    . LYS A  1  240 ? 60.323  29.509 61.285 1.00 40.46 ? 267  LYS A CD    1 
ATOM   1897  C  CE    . LYS A  1  240 ? 61.144  30.466 60.457 1.00 42.93 ? 267  LYS A CE    1 
ATOM   1898  N  NZ    . LYS A  1  240 ? 61.898  31.459 61.279 1.00 46.56 ? 267  LYS A NZ    1 
ATOM   1899  N  N     . ASP A  1  241 ? 57.189  25.593 58.983 1.00 31.71 ? 268  ASP A N     1 
ATOM   1900  C  CA    . ASP A  1  241 ? 57.370  24.680 57.851 1.00 31.76 ? 268  ASP A CA    1 
ATOM   1901  C  C     . ASP A  1  241 ? 56.395  24.965 56.720 1.00 30.78 ? 268  ASP A C     1 
ATOM   1902  O  O     . ASP A  1  241 ? 56.734  24.811 55.548 1.00 31.09 ? 268  ASP A O     1 
ATOM   1903  C  CB    . ASP A  1  241 ? 57.197  23.215 58.277 1.00 31.54 ? 268  ASP A CB    1 
ATOM   1904  C  CG    . ASP A  1  241 ? 57.453  22.230 57.124 1.00 34.20 ? 268  ASP A CG    1 
ATOM   1905  O  OD1   . ASP A  1  241 ? 58.389  22.464 56.326 1.00 38.75 ? 268  ASP A OD1   1 
ATOM   1906  O  OD2   . ASP A  1  241 ? 56.734  21.212 57.014 1.00 36.71 ? 268  ASP A OD2   1 
ATOM   1907  N  N     . THR A  1  242 ? 55.178  25.360 57.081 1.00 29.52 ? 269  THR A N     1 
ATOM   1908  C  CA    . THR A  1  242 ? 54.077  25.417 56.121 1.00 28.59 ? 269  THR A CA    1 
ATOM   1909  C  C     . THR A  1  242 ? 53.761  26.830 55.650 1.00 28.97 ? 269  THR A C     1 
ATOM   1910  O  O     . THR A  1  242 ? 53.249  27.008 54.552 1.00 28.94 ? 269  THR A O     1 
ATOM   1911  C  CB    . THR A  1  242 ? 52.785  24.804 56.706 1.00 27.17 ? 269  THR A CB    1 
ATOM   1912  O  OG1   . THR A  1  242 ? 52.501  25.412 57.972 1.00 26.45 ? 269  THR A OG1   1 
ATOM   1913  C  CG2   . THR A  1  242 ? 52.925  23.298 56.878 1.00 26.21 ? 269  THR A CG2   1 
ATOM   1914  N  N     . GLN A  1  243 ? 54.083  27.821 56.475 1.00 29.95 ? 270  GLN A N     1 
ATOM   1915  C  CA    . GLN A  1  243 ? 53.619  29.210 56.288 1.00 31.61 ? 270  GLN A CA    1 
ATOM   1916  C  C     . GLN A  1  243 ? 52.095  29.303 56.430 1.00 30.26 ? 270  GLN A C     1 
ATOM   1917  O  O     . GLN A  1  243 ? 51.461  30.200 55.870 1.00 31.01 ? 270  GLN A O     1 
ATOM   1918  C  CB    . GLN A  1  243 ? 54.081  29.812 54.947 1.00 32.68 ? 270  GLN A CB    1 
ATOM   1919  C  CG    . GLN A  1  243 ? 55.567  29.667 54.661 1.00 36.44 ? 270  GLN A CG    1 
ATOM   1920  C  CD    . GLN A  1  243 ? 56.070  30.674 53.639 1.00 41.55 ? 270  GLN A CD    1 
ATOM   1921  O  OE1   . GLN A  1  243 ? 56.490  30.309 52.541 1.00 43.41 ? 270  GLN A OE1   1 
ATOM   1922  N  NE2   . GLN A  1  243 ? 56.030  31.951 53.999 1.00 44.86 ? 270  GLN A NE2   1 
ATOM   1923  N  N     . VAL A  1  244 ? 51.528  28.364 57.180 1.00 37.48 ? 271  VAL A N     1 
ATOM   1924  C  CA    . VAL A  1  244 ? 50.108  28.344 57.489 1.00 36.34 ? 271  VAL A CA    1 
ATOM   1925  C  C     . VAL A  1  244 ? 49.882  29.139 58.776 1.00 37.29 ? 271  VAL A C     1 
ATOM   1926  O  O     . VAL A  1  244 ? 50.397  28.772 59.838 1.00 37.73 ? 271  VAL A O     1 
ATOM   1927  C  CB    . VAL A  1  244 ? 49.595  26.880 57.634 1.00 34.44 ? 271  VAL A CB    1 
ATOM   1928  C  CG1   . VAL A  1  244 ? 48.245  26.815 58.355 1.00 32.79 ? 271  VAL A CG1   1 
ATOM   1929  C  CG2   . VAL A  1  244 ? 49.514  26.210 56.276 1.00 33.16 ? 271  VAL A CG2   1 
ATOM   1930  N  N     . GLU A  1  245 ? 49.124  30.229 58.670 1.00 38.10 ? 272  GLU A N     1 
ATOM   1931  C  CA    . GLU A  1  245 ? 48.749  31.059 59.823 1.00 38.66 ? 272  GLU A CA    1 
ATOM   1932  C  C     . GLU A  1  245 ? 47.908  30.313 60.881 1.00 37.21 ? 272  GLU A C     1 
ATOM   1933  O  O     . GLU A  1  245 ? 46.909  29.655 60.557 1.00 35.39 ? 272  GLU A O     1 
ATOM   1934  C  CB    . GLU A  1  245 ? 48.015  32.313 59.346 1.00 39.86 ? 272  GLU A CB    1 
ATOM   1935  C  CG    . GLU A  1  245 ? 48.912  33.314 58.621 1.00 42.46 ? 272  GLU A CG    1 
ATOM   1936  N  N     . MET A  1  246 ? 48.348  30.400 62.138 1.00 37.56 ? 273  MET A N     1 
ATOM   1937  C  CA    . MET A  1  246 ? 47.617  29.843 63.285 1.00 36.51 ? 273  MET A CA    1 
ATOM   1938  C  C     . MET A  1  246 ? 47.561  30.906 64.382 1.00 37.88 ? 273  MET A C     1 
ATOM   1939  O  O     . MET A  1  246 ? 48.345  31.851 64.358 1.00 39.70 ? 273  MET A O     1 
ATOM   1940  C  CB    . MET A  1  246 ? 48.311  28.587 63.829 1.00 35.37 ? 273  MET A CB    1 
ATOM   1941  C  CG    . MET A  1  246 ? 48.358  27.390 62.877 1.00 33.53 ? 273  MET A CG    1 
ATOM   1942  S  SD    . MET A  1  246 ? 46.785  26.533 62.655 1.00 29.35 ? 273  MET A SD    1 
ATOM   1943  C  CE    . MET A  1  246 ? 46.385  26.042 64.337 1.00 28.60 ? 273  MET A CE    1 
ATOM   1944  N  N     . ILE A  1  247 ? 46.635  30.754 65.326 1.00 37.41 ? 274  ILE A N     1 
ATOM   1945  C  CA    . ILE A  1  247 ? 46.576  31.616 66.503 1.00 39.07 ? 274  ILE A CA    1 
ATOM   1946  C  C     . ILE A  1  247 ? 47.359  30.945 67.635 1.00 39.30 ? 274  ILE A C     1 
ATOM   1947  O  O     . ILE A  1  247 ? 46.974  29.879 68.127 1.00 37.91 ? 274  ILE A O     1 
ATOM   1948  C  CB    . ILE A  1  247 ? 45.103  31.923 66.967 1.00 39.11 ? 274  ILE A CB    1 
ATOM   1949  C  CG1   . ILE A  1  247 ? 44.222  32.433 65.810 1.00 39.06 ? 274  ILE A CG1   1 
ATOM   1950  C  CG2   . ILE A  1  247 ? 45.085  32.895 68.158 1.00 40.48 ? 274  ILE A CG2   1 
ATOM   1951  C  CD1   . ILE A  1  247 ? 44.587  33.818 65.249 1.00 40.40 ? 274  ILE A CD1   1 
ATOM   1952  N  N     . TYR A  1  248 ? 48.469  31.572 68.020 1.00 41.05 ? 275  TYR A N     1 
ATOM   1953  C  CA    . TYR A  1  248 ? 49.292  31.132 69.147 1.00 41.80 ? 275  TYR A CA    1 
ATOM   1954  C  C     . TYR A  1  248 ? 49.850  32.354 69.868 1.00 44.94 ? 275  TYR A C     1 
ATOM   1955  O  O     . TYR A  1  248 ? 50.213  33.337 69.218 1.00 46.27 ? 275  TYR A O     1 
ATOM   1956  C  CB    . TYR A  1  248 ? 50.469  30.276 68.674 1.00 40.93 ? 275  TYR A CB    1 
ATOM   1957  C  CG    . TYR A  1  248 ? 50.122  28.851 68.310 1.00 37.81 ? 275  TYR A CG    1 
ATOM   1958  C  CD1   . TYR A  1  248 ? 49.782  27.921 69.295 1.00 35.30 ? 275  TYR A CD1   1 
ATOM   1959  C  CD2   . TYR A  1  248 ? 50.159  28.421 66.981 1.00 35.31 ? 275  TYR A CD2   1 
ATOM   1960  C  CE1   . TYR A  1  248 ? 49.473  26.606 68.965 1.00 32.81 ? 275  TYR A CE1   1 
ATOM   1961  C  CE2   . TYR A  1  248 ? 49.839  27.096 66.640 1.00 32.17 ? 275  TYR A CE2   1 
ATOM   1962  C  CZ    . TYR A  1  248 ? 49.504  26.200 67.637 1.00 31.45 ? 275  TYR A CZ    1 
ATOM   1963  O  OH    . TYR A  1  248 ? 49.197  24.892 67.313 1.00 29.81 ? 275  TYR A OH    1 
ATOM   1964  N  N     . PRO A  1  249 ? 49.936  32.295 71.212 1.00 46.43 ? 276  PRO A N     1 
ATOM   1965  C  CA    . PRO A  1  249 ? 50.645  33.324 71.967 1.00 49.31 ? 276  PRO A CA    1 
ATOM   1966  C  C     . PRO A  1  249 ? 52.106  33.409 71.514 1.00 50.86 ? 276  PRO A C     1 
ATOM   1967  O  O     . PRO A  1  249 ? 52.650  32.411 71.027 1.00 49.76 ? 276  PRO A O     1 
ATOM   1968  C  CB    . PRO A  1  249 ? 50.571  32.809 73.407 1.00 49.77 ? 276  PRO A CB    1 
ATOM   1969  C  CG    . PRO A  1  249 ? 49.382  31.937 73.440 1.00 47.48 ? 276  PRO A CG    1 
ATOM   1970  C  CD    . PRO A  1  249 ? 49.359  31.270 72.101 1.00 45.35 ? 276  PRO A CD    1 
ATOM   1971  N  N     . PRO A  1  250 ? 52.742  34.589 71.666 1.00 53.68 ? 277  PRO A N     1 
ATOM   1972  C  CA    . PRO A  1  250 ? 54.128  34.775 71.207 1.00 55.45 ? 277  PRO A CA    1 
ATOM   1973  C  C     . PRO A  1  250 ? 55.142  33.818 71.843 1.00 56.07 ? 277  PRO A C     1 
ATOM   1974  O  O     . PRO A  1  250 ? 56.174  33.534 71.236 1.00 56.75 ? 277  PRO A O     1 
ATOM   1975  C  CB    . PRO A  1  250 ? 54.450  36.214 71.627 1.00 58.19 ? 277  PRO A CB    1 
ATOM   1976  C  CG    . PRO A  1  250 ? 53.135  36.888 71.738 1.00 57.99 ? 277  PRO A CG    1 
ATOM   1977  C  CD    . PRO A  1  250 ? 52.173  35.836 72.211 1.00 55.53 ? 277  PRO A CD    1 
ATOM   1978  N  N     . HIS A  1  251 ? 54.843  33.323 73.043 1.00 56.40 ? 278  HIS A N     1 
ATOM   1979  C  CA    . HIS A  1  251 ? 55.805  32.544 73.832 1.00 57.53 ? 278  HIS A CA    1 
ATOM   1980  C  C     . HIS A  1  251 ? 55.867  31.039 73.520 1.00 55.39 ? 278  HIS A C     1 
ATOM   1981  O  O     . HIS A  1  251 ? 56.640  30.310 74.149 1.00 56.08 ? 278  HIS A O     1 
ATOM   1982  C  CB    . HIS A  1  251 ? 55.552  32.763 75.330 1.00 59.20 ? 278  HIS A CB    1 
ATOM   1983  C  CG    . HIS A  1  251 ? 54.144  32.474 75.753 1.00 58.47 ? 278  HIS A CG    1 
ATOM   1984  N  ND1   . HIS A  1  251 ? 53.714  31.210 76.095 1.00 57.65 ? 278  HIS A ND1   1 
ATOM   1985  C  CD2   . HIS A  1  251 ? 53.070  33.288 75.891 1.00 59.23 ? 278  HIS A CD2   1 
ATOM   1986  C  CE1   . HIS A  1  251 ? 52.433  31.254 76.420 1.00 56.89 ? 278  HIS A CE1   1 
ATOM   1987  N  NE2   . HIS A  1  251 ? 52.018  32.503 76.305 1.00 58.23 ? 278  HIS A NE2   1 
ATOM   1988  N  N     . ILE A  1  252 ? 55.068  30.578 72.556 1.00 52.80 ? 279  ILE A N     1 
ATOM   1989  C  CA    . ILE A  1  252 ? 54.997  29.147 72.222 1.00 50.70 ? 279  ILE A CA    1 
ATOM   1990  C  C     . ILE A  1  252 ? 56.176  28.712 71.339 1.00 50.90 ? 279  ILE A C     1 
ATOM   1991  O  O     . ILE A  1  252 ? 56.410  29.308 70.286 1.00 50.99 ? 279  ILE A O     1 
ATOM   1992  C  CB    . ILE A  1  252 ? 53.636  28.773 71.541 1.00 48.18 ? 279  ILE A CB    1 
ATOM   1993  C  CG1   . ILE A  1  252 ? 52.444  29.084 72.464 1.00 48.18 ? 279  ILE A CG1   1 
ATOM   1994  C  CG2   . ILE A  1  252 ? 53.617  27.309 71.079 1.00 46.26 ? 279  ILE A CG2   1 
ATOM   1995  C  CD1   . ILE A  1  252 ? 52.416  28.311 73.791 1.00 48.36 ? 279  ILE A CD1   1 
ATOM   1996  N  N     . PRO A  1  253 ? 56.922  27.672 71.768 1.00 51.22 ? 280  PRO A N     1 
ATOM   1997  C  CA    . PRO A  1  253 ? 58.062  27.129 71.010 1.00 51.72 ? 280  PRO A CA    1 
ATOM   1998  C  C     . PRO A  1  253 ? 57.704  26.725 69.574 1.00 49.80 ? 280  PRO A C     1 
ATOM   1999  O  O     . PRO A  1  253 ? 56.623  26.170 69.338 1.00 47.47 ? 280  PRO A O     1 
ATOM   2000  C  CB    . PRO A  1  253 ? 58.458  25.894 71.822 1.00 51.88 ? 280  PRO A CB    1 
ATOM   2001  C  CG    . PRO A  1  253 ? 58.078  26.242 73.212 1.00 53.01 ? 280  PRO A CG    1 
ATOM   2002  C  CD    . PRO A  1  253 ? 56.794  27.021 73.086 1.00 51.55 ? 280  PRO A CD    1 
ATOM   2003  N  N     . GLU A  1  254 ? 58.614  26.999 68.635 1.00 50.75 ? 281  GLU A N     1 
ATOM   2004  C  CA    . GLU A  1  254 ? 58.372  26.772 67.203 1.00 49.27 ? 281  GLU A CA    1 
ATOM   2005  C  C     . GLU A  1  254 ? 57.810  25.401 66.848 1.00 47.00 ? 281  GLU A C     1 
ATOM   2006  O  O     . GLU A  1  254 ? 56.845  25.314 66.082 1.00 44.92 ? 281  GLU A O     1 
ATOM   2007  C  CB    . GLU A  1  254 ? 59.627  27.042 66.360 1.00 51.25 ? 281  GLU A CB    1 
ATOM   2008  C  CG    . GLU A  1  254 ? 59.427  26.708 64.870 1.00 50.22 ? 281  GLU A CG    1 
ATOM   2009  C  CD    . GLU A  1  254 ? 60.696  26.795 64.042 1.00 52.39 ? 281  GLU A CD    1 
ATOM   2010  O  OE1   . GLU A  1  254 ? 61.466  27.762 64.212 1.00 55.30 ? 281  GLU A OE1   1 
ATOM   2011  O  OE2   . GLU A  1  254 ? 60.912  25.897 63.203 1.00 51.61 ? 281  GLU A OE2   1 
ATOM   2012  N  N     . ASN A  1  255 ? 58.406  24.331 67.371 1.00 47.42 ? 282  ASN A N     1 
ATOM   2013  C  CA    . ASN A  1  255 ? 57.910  22.986 67.024 1.00 46.23 ? 282  ASN A CA    1 
ATOM   2014  C  C     . ASN A  1  255 ? 56.591  22.612 67.678 1.00 43.88 ? 282  ASN A C     1 
ATOM   2015  O  O     . ASN A  1  255 ? 55.974  21.615 67.297 1.00 42.92 ? 282  ASN A O     1 
ATOM   2016  C  CB    . ASN A  1  255 ? 58.960  21.892 67.242 1.00 48.20 ? 282  ASN A CB    1 
ATOM   2017  C  CG    . ASN A  1  255 ? 59.463  21.285 65.928 1.00 50.02 ? 282  ASN A CG    1 
ATOM   2018  O  OD1   . ASN A  1  255 ? 59.426  21.927 64.871 1.00 52.01 ? 282  ASN A OD1   1 
ATOM   2019  N  ND2   . ASN A  1  255 ? 59.951  20.045 65.997 1.00 51.38 ? 282  ASN A ND2   1 
ATOM   2020  N  N     . LEU A  1  256 ? 56.147  23.411 68.645 1.00 43.41 ? 283  LEU A N     1 
ATOM   2021  C  CA    . LEU A  1  256 ? 54.826  23.202 69.237 1.00 41.39 ? 283  LEU A CA    1 
ATOM   2022  C  C     . LEU A  1  256 ? 53.757  24.056 68.566 1.00 39.78 ? 283  LEU A C     1 
ATOM   2023  O  O     . LEU A  1  256 ? 52.584  23.977 68.921 1.00 38.67 ? 283  LEU A O     1 
ATOM   2024  C  CB    . LEU A  1  256 ? 54.856  23.425 70.753 1.00 42.68 ? 283  LEU A CB    1 
ATOM   2025  C  CG    . LEU A  1  256 ? 55.656  22.373 71.530 1.00 43.51 ? 283  LEU A CG    1 
ATOM   2026  C  CD1   . LEU A  1  256 ? 55.997  22.863 72.932 1.00 45.47 ? 283  LEU A CD1   1 
ATOM   2027  C  CD2   . LEU A  1  256 ? 54.919  21.025 71.563 1.00 42.24 ? 283  LEU A CD2   1 
ATOM   2028  N  N     . GLN A  1  257 ? 54.161  24.864 67.587 1.00 39.54 ? 284  GLN A N     1 
ATOM   2029  C  CA    . GLN A  1  257 ? 53.204  25.636 66.804 1.00 38.33 ? 284  GLN A CA    1 
ATOM   2030  C  C     . GLN A  1  257 ? 52.689  24.814 65.629 1.00 36.14 ? 284  GLN A C     1 
ATOM   2031  O  O     . GLN A  1  257 ? 53.027  25.083 64.476 1.00 35.88 ? 284  GLN A O     1 
ATOM   2032  C  CB    . GLN A  1  257 ? 53.820  26.945 66.317 1.00 39.81 ? 284  GLN A CB    1 
ATOM   2033  C  CG    . GLN A  1  257 ? 54.002  27.984 67.406 1.00 41.63 ? 284  GLN A CG    1 
ATOM   2034  C  CD    . GLN A  1  257 ? 54.600  29.271 66.882 1.00 44.14 ? 284  GLN A CD    1 
ATOM   2035  O  OE1   . GLN A  1  257 ? 54.377  29.651 65.732 1.00 44.47 ? 284  GLN A OE1   1 
ATOM   2036  N  NE2   . GLN A  1  257 ? 55.374  29.949 67.721 1.00 46.38 ? 284  GLN A NE2   1 
ATOM   2037  N  N     . PHE A  1  258 ? 51.875  23.806 65.938 1.00 34.53 ? 285  PHE A N     1 
ATOM   2038  C  CA    . PHE A  1  258 ? 51.297  22.931 64.918 1.00 32.98 ? 285  PHE A CA    1 
ATOM   2039  C  C     . PHE A  1  258 ? 50.348  23.675 63.991 1.00 31.81 ? 285  PHE A C     1 
ATOM   2040  O  O     . PHE A  1  258 ? 49.548  24.506 64.437 1.00 32.22 ? 285  PHE A O     1 
ATOM   2041  C  CB    . PHE A  1  258 ? 50.569  21.742 65.549 1.00 32.35 ? 285  PHE A CB    1 
ATOM   2042  C  CG    . PHE A  1  258 ? 51.426  20.910 66.461 1.00 35.06 ? 285  PHE A CG    1 
ATOM   2043  C  CD1   . PHE A  1  258 ? 52.717  20.541 66.096 1.00 38.58 ? 285  PHE A CD1   1 
ATOM   2044  C  CD2   . PHE A  1  258 ? 50.935  20.479 67.687 1.00 38.13 ? 285  PHE A CD2   1 
ATOM   2045  C  CE1   . PHE A  1  258 ? 53.510  19.770 66.949 1.00 40.37 ? 285  PHE A CE1   1 
ATOM   2046  C  CE2   . PHE A  1  258 ? 51.718  19.698 68.535 1.00 40.31 ? 285  PHE A CE2   1 
ATOM   2047  C  CZ    . PHE A  1  258 ? 53.010  19.350 68.163 1.00 40.45 ? 285  PHE A CZ    1 
ATOM   2048  N  N     . ALA A  1  259 ? 50.452  23.374 62.700 1.00 30.55 ? 286  ALA A N     1 
ATOM   2049  C  CA    . ALA A  1  259 ? 49.578  23.957 61.692 1.00 29.73 ? 286  ALA A CA    1 
ATOM   2050  C  C     . ALA A  1  259 ? 48.566  22.926 61.200 1.00 27.95 ? 286  ALA A C     1 
ATOM   2051  O  O     . ALA A  1  259 ? 48.938  21.837 60.742 1.00 27.19 ? 286  ALA A O     1 
ATOM   2052  C  CB    . ALA A  1  259 ? 50.390  24.509 60.528 1.00 30.34 ? 286  ALA A CB    1 
ATOM   2053  N  N     . VAL A  1  260 ? 47.289  23.288 61.300 1.00 26.58 ? 287  VAL A N     1 
ATOM   2054  C  CA    . VAL A  1  260 ? 46.182  22.439 60.864 1.00 25.11 ? 287  VAL A CA    1 
ATOM   2055  C  C     . VAL A  1  260 ? 45.160  23.307 60.118 1.00 25.04 ? 287  VAL A C     1 
ATOM   2056  O  O     . VAL A  1  260 ? 45.306  24.533 60.051 1.00 25.65 ? 287  VAL A O     1 
ATOM   2057  C  CB    . VAL A  1  260 ? 45.518  21.699 62.064 1.00 24.68 ? 287  VAL A CB    1 
ATOM   2058  C  CG1   . VAL A  1  260 ? 46.469  20.647 62.651 1.00 24.24 ? 287  VAL A CG1   1 
ATOM   2059  C  CG2   . VAL A  1  260 ? 45.117  22.684 63.142 1.00 24.94 ? 287  VAL A CG2   1 
ATOM   2060  N  N     . GLY A  1  261 ? 44.129  22.673 59.566 1.00 24.16 ? 288  GLY A N     1 
ATOM   2061  C  CA    . GLY A  1  261 ? 43.112  23.372 58.780 1.00 24.06 ? 288  GLY A CA    1 
ATOM   2062  C  C     . GLY A  1  261 ? 42.456  24.546 59.480 1.00 24.98 ? 288  GLY A C     1 
ATOM   2063  O  O     . GLY A  1  261 ? 42.295  25.611 58.888 1.00 25.49 ? 288  GLY A O     1 
ATOM   2064  N  N     . GLN A  1  262 ? 42.083  24.350 60.741 1.00 25.44 ? 289  GLN A N     1 
ATOM   2065  C  CA    . GLN A  1  262 ? 41.424  25.386 61.528 1.00 27.08 ? 289  GLN A CA    1 
ATOM   2066  C  C     . GLN A  1  262 ? 42.435  26.163 62.373 1.00 28.93 ? 289  GLN A C     1 
ATOM   2067  O  O     . GLN A  1  262 ? 43.163  25.578 63.179 1.00 28.77 ? 289  GLN A O     1 
ATOM   2068  C  CB    . GLN A  1  262 ? 40.350  24.761 62.422 1.00 26.74 ? 289  GLN A CB    1 
ATOM   2069  C  CG    . GLN A  1  262 ? 38.962  25.399 62.298 1.00 27.58 ? 289  GLN A CG    1 
ATOM   2070  C  CD    . GLN A  1  262 ? 38.808  26.676 63.112 1.00 27.49 ? 289  GLN A CD    1 
ATOM   2071  O  OE1   . GLN A  1  262 ? 39.788  27.355 63.415 1.00 28.23 ? 289  GLN A OE1   1 
ATOM   2072  N  NE2   . GLN A  1  262 ? 37.567  27.005 63.469 1.00 26.44 ? 289  GLN A NE2   1 
ATOM   2073  N  N     . GLU A  1  263 ? 42.449  27.485 62.188 1.00 31.07 ? 290  GLU A N     1 
ATOM   2074  C  CA    . GLU A  1  263 ? 43.416  28.389 62.817 1.00 33.49 ? 290  GLU A CA    1 
ATOM   2075  C  C     . GLU A  1  263 ? 43.398  28.413 64.348 1.00 33.88 ? 290  GLU A C     1 
ATOM   2076  O  O     . GLU A  1  263 ? 44.372  28.841 64.962 1.00 34.78 ? 290  GLU A O     1 
ATOM   2077  C  CB    . GLU A  1  263 ? 43.207  29.828 62.319 1.00 35.41 ? 290  GLU A CB    1 
ATOM   2078  C  CG    . GLU A  1  263 ? 43.528  30.063 60.841 1.00 38.96 ? 290  GLU A CG    1 
ATOM   2079  C  CD    . GLU A  1  263 ? 42.298  30.016 59.918 1.00 43.30 ? 290  GLU A CD    1 
ATOM   2080  O  OE1   . GLU A  1  263 ? 41.358  29.213 60.162 1.00 44.17 ? 290  GLU A OE1   1 
ATOM   2081  O  OE2   . GLU A  1  263 ? 42.285  30.784 58.929 1.00 45.14 ? 290  GLU A OE2   1 
ATOM   2082  N  N     . VAL A  1  264 ? 42.296  27.988 64.964 1.00 33.36 ? 291  VAL A N     1 
ATOM   2083  C  CA    . VAL A  1  264 ? 42.167  28.128 66.421 1.00 34.09 ? 291  VAL A CA    1 
ATOM   2084  C  C     . VAL A  1  264 ? 42.452  26.854 67.220 1.00 33.01 ? 291  VAL A C     1 
ATOM   2085  O  O     . VAL A  1  264 ? 42.417  26.873 68.448 1.00 33.71 ? 291  VAL A O     1 
ATOM   2086  C  CB    . VAL A  1  264 ? 40.800  28.770 66.848 1.00 35.10 ? 291  VAL A CB    1 
ATOM   2087  C  CG1   . VAL A  1  264 ? 40.569  30.069 66.100 1.00 36.65 ? 291  VAL A CG1   1 
ATOM   2088  C  CG2   . VAL A  1  264 ? 39.624  27.803 66.636 1.00 33.77 ? 291  VAL A CG2   1 
ATOM   2089  N  N     . PHE A  1  265 ? 42.764  25.764 66.519 1.00 31.39 ? 292  PHE A N     1 
ATOM   2090  C  CA    . PHE A  1  265 ? 42.885  24.433 67.125 1.00 30.07 ? 292  PHE A CA    1 
ATOM   2091  C  C     . PHE A  1  265 ? 44.132  24.220 68.006 1.00 30.80 ? 292  PHE A C     1 
ATOM   2092  O  O     . PHE A  1  265 ? 44.206  23.253 68.763 1.00 30.33 ? 292  PHE A O     1 
ATOM   2093  C  CB    . PHE A  1  265 ? 42.779  23.336 66.051 1.00 28.69 ? 292  PHE A CB    1 
ATOM   2094  C  CG    . PHE A  1  265 ? 41.362  23.034 65.608 1.00 26.81 ? 292  PHE A CG    1 
ATOM   2095  C  CD1   . PHE A  1  265 ? 40.270  23.681 66.184 1.00 26.96 ? 292  PHE A CD1   1 
ATOM   2096  C  CD2   . PHE A  1  265 ? 41.123  22.068 64.632 1.00 25.40 ? 292  PHE A CD2   1 
ATOM   2097  C  CE1   . PHE A  1  265 ? 38.960  23.394 65.784 1.00 26.23 ? 292  PHE A CE1   1 
ATOM   2098  C  CE2   . PHE A  1  265 ? 39.809  21.762 64.228 1.00 26.05 ? 292  PHE A CE2   1 
ATOM   2099  C  CZ    . PHE A  1  265 ? 38.726  22.428 64.808 1.00 25.04 ? 292  PHE A CZ    1 
ATOM   2100  N  N     . GLY A  1  266 ? 45.102  25.121 67.922 1.00 31.50 ? 293  GLY A N     1 
ATOM   2101  C  CA    . GLY A  1  266 ? 46.195  25.130 68.899 1.00 33.11 ? 293  GLY A CA    1 
ATOM   2102  C  C     . GLY A  1  266 ? 45.761  25.622 70.279 1.00 34.41 ? 293  GLY A C     1 
ATOM   2103  O  O     . GLY A  1  266 ? 46.544  25.575 71.226 1.00 35.47 ? 293  GLY A O     1 
ATOM   2104  N  N     . LEU A  1  267 ? 44.510  26.083 70.388 1.00 34.32 ? 294  LEU A N     1 
ATOM   2105  C  CA    . LEU A  1  267 ? 43.962  26.622 71.638 1.00 35.91 ? 294  LEU A CA    1 
ATOM   2106  C  C     . LEU A  1  267 ? 43.965  25.605 72.772 1.00 35.60 ? 294  LEU A C     1 
ATOM   2107  O  O     . LEU A  1  267 ? 44.316  25.943 73.900 1.00 36.70 ? 294  LEU A O     1 
ATOM   2108  C  CB    . LEU A  1  267 ? 42.531  27.172 71.430 1.00 36.21 ? 294  LEU A CB    1 
ATOM   2109  C  CG    . LEU A  1  267 ? 41.640  27.570 72.622 1.00 38.63 ? 294  LEU A CG    1 
ATOM   2110  C  CD1   . LEU A  1  267 ? 42.262  28.707 73.436 1.00 41.37 ? 294  LEU A CD1   1 
ATOM   2111  C  CD2   . LEU A  1  267 ? 40.221  27.950 72.171 1.00 39.18 ? 294  LEU A CD2   1 
ATOM   2112  N  N     . VAL A  1  268 ? 43.532  24.381 72.484 1.00 34.14 ? 295  VAL A N     1 
ATOM   2113  C  CA    . VAL A  1  268 ? 43.566  23.319 73.494 1.00 34.49 ? 295  VAL A CA    1 
ATOM   2114  C  C     . VAL A  1  268 ? 44.075  21.989 72.959 1.00 32.63 ? 295  VAL A C     1 
ATOM   2115  O  O     . VAL A  1  268 ? 43.751  21.613 71.832 1.00 31.07 ? 295  VAL A O     1 
ATOM   2116  C  CB    . VAL A  1  268 ? 42.215  23.117 74.235 1.00 35.11 ? 295  VAL A CB    1 
ATOM   2117  C  CG1   . VAL A  1  268 ? 42.076  24.133 75.385 1.00 37.86 ? 295  VAL A CG1   1 
ATOM   2118  C  CG2   . VAL A  1  268 ? 41.043  23.179 73.287 1.00 34.26 ? 295  VAL A CG2   1 
ATOM   2119  N  N     . PRO A  1  269 ? 44.878  21.276 73.777 1.00 32.83 ? 296  PRO A N     1 
ATOM   2120  C  CA    . PRO A  1  269 ? 45.422  19.966 73.419 1.00 32.14 ? 296  PRO A CA    1 
ATOM   2121  C  C     . PRO A  1  269 ? 44.336  18.967 73.042 1.00 30.79 ? 296  PRO A C     1 
ATOM   2122  O  O     . PRO A  1  269 ? 44.602  18.067 72.262 1.00 30.46 ? 296  PRO A O     1 
ATOM   2123  C  CB    . PRO A  1  269 ? 46.133  19.503 74.698 1.00 33.54 ? 296  PRO A CB    1 
ATOM   2124  C  CG    . PRO A  1  269 ? 46.365  20.717 75.494 1.00 35.11 ? 296  PRO A CG    1 
ATOM   2125  C  CD    . PRO A  1  269 ? 45.366  21.744 75.087 1.00 34.68 ? 296  PRO A CD    1 
ATOM   2126  N  N     . GLY A  1  270 ? 43.130  19.124 73.591 1.00 30.96 ? 297  GLY A N     1 
ATOM   2127  C  CA    . GLY A  1  270 ? 42.002  18.261 73.236 1.00 30.14 ? 297  GLY A CA    1 
ATOM   2128  C  C     . GLY A  1  270 ? 41.622  18.362 71.762 1.00 28.98 ? 297  GLY A C     1 
ATOM   2129  O  O     . GLY A  1  270 ? 41.264  17.362 71.132 1.00 28.39 ? 297  GLY A O     1 
ATOM   2130  N  N     . LEU A  1  271 ? 41.706  19.569 71.207 1.00 28.57 ? 298  LEU A N     1 
ATOM   2131  C  CA    . LEU A  1  271 ? 41.432  19.781 69.782 1.00 27.23 ? 298  LEU A CA    1 
ATOM   2132  C  C     . LEU A  1  271 ? 42.591  19.287 68.918 1.00 26.43 ? 298  LEU A C     1 
ATOM   2133  O  O     . LEU A  1  271 ? 42.378  18.686 67.858 1.00 24.90 ? 298  LEU A O     1 
ATOM   2134  C  CB    . LEU A  1  271 ? 41.158  21.261 69.493 1.00 27.89 ? 298  LEU A CB    1 
ATOM   2135  C  CG    . LEU A  1  271 ? 39.916  21.912 70.109 1.00 29.24 ? 298  LEU A CG    1 
ATOM   2136  C  CD1   . LEU A  1  271 ? 39.904  23.414 69.812 1.00 30.10 ? 298  LEU A CD1   1 
ATOM   2137  C  CD2   . LEU A  1  271 ? 38.645  21.258 69.599 1.00 28.25 ? 298  LEU A CD2   1 
ATOM   2138  N  N     . MET A  1  272 ? 43.816  19.544 69.375 1.00 26.96 ? 299  MET A N     1 
ATOM   2139  C  CA    . MET A  1  272 ? 45.000  19.057 68.687 1.00 27.11 ? 299  MET A CA    1 
ATOM   2140  C  C     . MET A  1  272 ? 45.072  17.529 68.660 1.00 26.20 ? 299  MET A C     1 
ATOM   2141  O  O     . MET A  1  272 ? 45.588  16.957 67.699 1.00 25.63 ? 299  MET A O     1 
ATOM   2142  C  CB    . MET A  1  272 ? 46.293  19.640 69.283 1.00 28.72 ? 299  MET A CB    1 
ATOM   2143  C  CG    . MET A  1  272 ? 46.727  20.986 68.669 1.00 32.03 ? 299  MET A CG    1 
ATOM   2144  S  SD    . MET A  1  272 ? 46.901  21.005 66.853 1.00 36.47 ? 299  MET A SD    1 
ATOM   2145  C  CE    . MET A  1  272 ? 47.830  19.513 66.605 1.00 33.03 ? 299  MET A CE    1 
ATOM   2146  N  N     . MET A  1  273 ? 44.571  16.882 69.714 1.00 25.78 ? 300  MET A N     1 
ATOM   2147  C  CA    . MET A  1  273 ? 44.464  15.419 69.740 1.00 25.29 ? 300  MET A CA    1 
ATOM   2148  C  C     . MET A  1  273 ? 43.663  14.928 68.528 1.00 23.48 ? 300  MET A C     1 
ATOM   2149  O  O     . MET A  1  273 ? 44.115  14.051 67.799 1.00 22.73 ? 300  MET A O     1 
ATOM   2150  C  CB    . MET A  1  273 ? 43.828  14.920 71.051 1.00 25.92 ? 300  MET A CB    1 
ATOM   2151  C  CG    . MET A  1  273 ? 43.547  13.404 71.075 1.00 26.31 ? 300  MET A CG    1 
ATOM   2152  S  SD    . MET A  1  273 ? 42.459  12.877 72.417 1.00 28.03 ? 300  MET A SD    1 
ATOM   2153  C  CE    . MET A  1  273 ? 40.895  13.571 71.884 1.00 27.78 ? 300  MET A CE    1 
ATOM   2154  N  N     . TYR A  1  274 ? 42.487  15.516 68.318 1.00 22.59 ? 301  TYR A N     1 
ATOM   2155  C  CA    . TYR A  1  274 ? 41.623  15.148 67.201 1.00 21.22 ? 301  TYR A CA    1 
ATOM   2156  C  C     . TYR A  1  274 ? 42.177  15.598 65.842 1.00 20.62 ? 301  TYR A C     1 
ATOM   2157  O  O     . TYR A  1  274 ? 42.082  14.853 64.857 1.00 20.48 ? 301  TYR A O     1 
ATOM   2158  C  CB    . TYR A  1  274 ? 40.201  15.682 67.414 1.00 21.34 ? 301  TYR A CB    1 
ATOM   2159  C  CG    . TYR A  1  274 ? 39.321  14.765 68.255 1.00 21.57 ? 301  TYR A CG    1 
ATOM   2160  C  CD1   . TYR A  1  274 ? 38.864  15.161 69.511 1.00 20.98 ? 301  TYR A CD1   1 
ATOM   2161  C  CD2   . TYR A  1  274 ? 38.962  13.493 67.792 1.00 20.44 ? 301  TYR A CD2   1 
ATOM   2162  C  CE1   . TYR A  1  274 ? 38.043  14.316 70.288 1.00 23.10 ? 301  TYR A CE1   1 
ATOM   2163  C  CE2   . TYR A  1  274 ? 38.150  12.644 68.554 1.00 21.62 ? 301  TYR A CE2   1 
ATOM   2164  C  CZ    . TYR A  1  274 ? 37.691  13.061 69.800 1.00 22.71 ? 301  TYR A CZ    1 
ATOM   2165  O  OH    . TYR A  1  274 ? 36.892  12.222 70.550 1.00 23.32 ? 301  TYR A OH    1 
ATOM   2166  N  N     . ALA A  1  275 ? 42.747  16.805 65.787 1.00 19.98 ? 302  ALA A N     1 
ATOM   2167  C  CA    . ALA A  1  275 ? 43.453  17.264 64.588 1.00 19.86 ? 302  ALA A CA    1 
ATOM   2168  C  C     . ALA A  1  275 ? 44.509  16.250 64.130 1.00 19.70 ? 302  ALA A C     1 
ATOM   2169  O  O     . ALA A  1  275 ? 44.635  15.974 62.926 1.00 19.12 ? 302  ALA A O     1 
ATOM   2170  C  CB    . ALA A  1  275 ? 44.113  18.639 64.823 1.00 20.11 ? 302  ALA A CB    1 
ATOM   2171  N  N     . THR A  1  276 ? 45.271  15.726 65.096 1.00 19.89 ? 303  THR A N     1 
ATOM   2172  C  CA    . THR A  1  276 ? 46.323  14.741 64.836 1.00 19.91 ? 303  THR A CA    1 
ATOM   2173  C  C     . THR A  1  276 ? 45.723  13.412 64.386 1.00 19.69 ? 303  THR A C     1 
ATOM   2174  O  O     . THR A  1  276 ? 46.189  12.826 63.408 1.00 19.48 ? 303  THR A O     1 
ATOM   2175  C  CB    . THR A  1  276 ? 47.218  14.532 66.071 1.00 21.06 ? 303  THR A CB    1 
ATOM   2176  O  OG1   . THR A  1  276 ? 47.813  15.780 66.439 1.00 22.11 ? 303  THR A OG1   1 
ATOM   2177  C  CG2   . THR A  1  276 ? 48.340  13.508 65.788 1.00 21.40 ? 303  THR A CG2   1 
ATOM   2178  N  N     . ILE A  1  277 ? 44.690  12.952 65.093 1.00 19.70 ? 304  ILE A N     1 
ATOM   2179  C  CA    . ILE A  1  277 ? 43.985  11.721 64.733 1.00 20.10 ? 304  ILE A CA    1 
ATOM   2180  C  C     . ILE A  1  277 ? 43.480  11.762 63.279 1.00 19.74 ? 304  ILE A C     1 
ATOM   2181  O  O     . ILE A  1  277 ? 43.734  10.838 62.510 1.00 19.79 ? 304  ILE A O     1 
ATOM   2182  C  CB    . ILE A  1  277 ? 42.827  11.418 65.714 1.00 20.42 ? 304  ILE A CB    1 
ATOM   2183  C  CG1   . ILE A  1  277 ? 43.380  10.887 67.049 1.00 21.60 ? 304  ILE A CG1   1 
ATOM   2184  C  CG2   . ILE A  1  277 ? 41.856  10.392 65.105 1.00 19.76 ? 304  ILE A CG2   1 
ATOM   2185  C  CD1   . ILE A  1  277 ? 42.370  10.871 68.188 1.00 22.91 ? 304  ILE A CD1   1 
ATOM   2186  N  N     . TRP A  1  278 ? 42.796  12.843 62.908 1.00 19.64 ? 305  TRP A N     1 
ATOM   2187  C  CA    . TRP A  1  278 ? 42.254  12.980 61.558 1.00 19.66 ? 305  TRP A CA    1 
ATOM   2188  C  C     . TRP A  1  278 ? 43.329  13.146 60.475 1.00 19.44 ? 305  TRP A C     1 
ATOM   2189  O  O     . TRP A  1  278 ? 43.155  12.682 59.341 1.00 19.47 ? 305  TRP A O     1 
ATOM   2190  C  CB    . TRP A  1  278 ? 41.223  14.106 61.488 1.00 19.37 ? 305  TRP A CB    1 
ATOM   2191  C  CG    . TRP A  1  278 ? 39.884  13.753 62.105 1.00 19.64 ? 305  TRP A CG    1 
ATOM   2192  C  CD1   . TRP A  1  278 ? 39.372  14.219 63.289 1.00 19.48 ? 305  TRP A CD1   1 
ATOM   2193  C  CD2   . TRP A  1  278 ? 38.893  12.867 61.564 1.00 20.57 ? 305  TRP A CD2   1 
ATOM   2194  N  NE1   . TRP A  1  278 ? 38.137  13.671 63.521 1.00 20.20 ? 305  TRP A NE1   1 
ATOM   2195  C  CE2   . TRP A  1  278 ? 37.808  12.848 62.476 1.00 19.99 ? 305  TRP A CE2   1 
ATOM   2196  C  CE3   . TRP A  1  278 ? 38.814  12.088 60.398 1.00 19.58 ? 305  TRP A CE3   1 
ATOM   2197  C  CZ2   . TRP A  1  278 ? 36.653  12.084 62.255 1.00 20.52 ? 305  TRP A CZ2   1 
ATOM   2198  C  CZ3   . TRP A  1  278 ? 37.659  11.314 60.182 1.00 18.93 ? 305  TRP A CZ3   1 
ATOM   2199  C  CH2   . TRP A  1  278 ? 36.599  11.324 61.107 1.00 20.36 ? 305  TRP A CH2   1 
ATOM   2200  N  N     . LEU A  1  279 ? 44.433  13.810 60.814 1.00 19.76 ? 306  LEU A N     1 
ATOM   2201  C  CA    . LEU A  1  279 ? 45.547  13.951 59.874 1.00 19.60 ? 306  LEU A CA    1 
ATOM   2202  C  C     . LEU A  1  279 ? 46.103  12.559 59.540 1.00 19.54 ? 306  LEU A C     1 
ATOM   2203  O  O     . LEU A  1  279 ? 46.296  12.220 58.365 1.00 19.16 ? 306  LEU A O     1 
ATOM   2204  C  CB    . LEU A  1  279 ? 46.642  14.858 60.445 1.00 20.38 ? 306  LEU A CB    1 
ATOM   2205  C  CG    . LEU A  1  279 ? 47.854  15.163 59.548 1.00 22.36 ? 306  LEU A CG    1 
ATOM   2206  C  CD1   . LEU A  1  279 ? 48.521  16.462 59.962 1.00 23.46 ? 306  LEU A CD1   1 
ATOM   2207  C  CD2   . LEU A  1  279 ? 48.880  14.034 59.561 1.00 22.82 ? 306  LEU A CD2   1 
ATOM   2208  N  N     . ARG A  1  280 ? 46.341  11.767 60.584 1.00 19.31 ? 307  ARG A N     1 
ATOM   2209  C  CA    . ARG A  1  280 ? 46.763  10.375 60.441 1.00 20.02 ? 307  ARG A CA    1 
ATOM   2210  C  C     . ARG A  1  280 ? 45.769  9.548  59.637 1.00 19.88 ? 307  ARG A C     1 
ATOM   2211  O  O     . ARG A  1  280 ? 46.183  8.753  58.793 1.00 20.44 ? 307  ARG A O     1 
ATOM   2212  C  CB    . ARG A  1  280 ? 46.987  9.721  61.805 1.00 20.24 ? 307  ARG A CB    1 
ATOM   2213  C  CG    . ARG A  1  280 ? 48.145  10.301 62.594 1.00 20.46 ? 307  ARG A CG    1 
ATOM   2214  C  CD    . ARG A  1  280 ? 48.277  9.605  63.936 1.00 20.15 ? 307  ARG A CD    1 
ATOM   2215  N  NE    . ARG A  1  280 ? 49.356  10.167 64.746 1.00 20.82 ? 307  ARG A NE    1 
ATOM   2216  C  CZ    . ARG A  1  280 ? 49.710  9.702  65.939 1.00 22.26 ? 307  ARG A CZ    1 
ATOM   2217  N  NH1   . ARG A  1  280 ? 49.074  8.661  66.466 1.00 22.92 ? 307  ARG A NH1   1 
ATOM   2218  N  NH2   . ARG A  1  280 ? 50.707  10.269 66.605 1.00 23.47 ? 307  ARG A NH2   1 
ATOM   2219  N  N     . GLU A  1  281 ? 44.471  9.724  59.914 1.00 19.40 ? 308  GLU A N     1 
ATOM   2220  C  CA    . GLU A  1  281 ? 43.415  9.046  59.150 1.00 19.63 ? 308  GLU A CA    1 
ATOM   2221  C  C     . GLU A  1  281 ? 43.465  9.375  57.648 1.00 19.25 ? 308  GLU A C     1 
ATOM   2222  O  O     . GLU A  1  281 ? 43.341  8.477  56.812 1.00 19.50 ? 308  GLU A O     1 
ATOM   2223  C  CB    . GLU A  1  281 ? 42.028  9.341  59.737 1.00 19.25 ? 308  GLU A CB    1 
ATOM   2224  C  CG    . GLU A  1  281 ? 40.841  8.672  59.015 1.00 20.46 ? 308  GLU A CG    1 
ATOM   2225  C  CD    . GLU A  1  281 ? 40.903  7.140  58.972 1.00 23.12 ? 308  GLU A CD    1 
ATOM   2226  O  OE1   . GLU A  1  281 ? 41.641  6.516  59.768 1.00 24.36 ? 308  GLU A OE1   1 
ATOM   2227  O  OE2   . GLU A  1  281 ? 40.203  6.550  58.118 1.00 23.79 ? 308  GLU A OE2   1 
ATOM   2228  N  N     . HIS A  1  282 ? 43.656  10.649 57.306 1.00 19.23 ? 309  HIS A N     1 
ATOM   2229  C  CA    . HIS A  1  282 ? 43.761  11.035 55.899 1.00 19.14 ? 309  HIS A CA    1 
ATOM   2230  C  C     . HIS A  1  282 ? 44.916  10.317 55.198 1.00 19.63 ? 309  HIS A C     1 
ATOM   2231  O  O     . HIS A  1  282 ? 44.750  9.778  54.097 1.00 19.55 ? 309  HIS A O     1 
ATOM   2232  C  CB    . HIS A  1  282 ? 43.913  12.549 55.727 1.00 19.59 ? 309  HIS A CB    1 
ATOM   2233  C  CG    . HIS A  1  282 ? 44.181  12.951 54.311 1.00 20.67 ? 309  HIS A CG    1 
ATOM   2234  N  ND1   . HIS A  1  282 ? 43.173  13.273 53.428 1.00 20.06 ? 309  HIS A ND1   1 
ATOM   2235  C  CD2   . HIS A  1  282 ? 45.337  13.025 53.609 1.00 20.58 ? 309  HIS A CD2   1 
ATOM   2236  C  CE1   . HIS A  1  282 ? 43.698  13.557 52.250 1.00 21.03 ? 309  HIS A CE1   1 
ATOM   2237  N  NE2   . HIS A  1  282 ? 45.009  13.409 52.332 1.00 22.14 ? 309  HIS A NE2   1 
ATOM   2238  N  N     . ASN A  1  283 ? 46.082  10.305 55.841 1.00 19.75 ? 310  ASN A N     1 
ATOM   2239  C  CA    . ASN A  1  283 ? 47.256  9.682  55.251 1.00 20.42 ? 310  ASN A CA    1 
ATOM   2240  C  C     . ASN A  1  283 ? 47.156  8.157  55.176 1.00 21.08 ? 310  ASN A C     1 
ATOM   2241  O  O     . ASN A  1  283 ? 47.689  7.544  54.247 1.00 21.83 ? 310  ASN A O     1 
ATOM   2242  C  CB    . ASN A  1  283 ? 48.528  10.147 55.959 1.00 21.12 ? 310  ASN A CB    1 
ATOM   2243  C  CG    . ASN A  1  283 ? 48.859  11.612 55.665 1.00 20.01 ? 310  ASN A CG    1 
ATOM   2244  O  OD1   . ASN A  1  283 ? 48.194  12.263 54.859 1.00 19.96 ? 310  ASN A OD1   1 
ATOM   2245  N  ND2   . ASN A  1  283 ? 49.898  12.128 56.313 1.00 20.89 ? 310  ASN A ND2   1 
ATOM   2246  N  N     . ARG A  1  284 ? 46.454  7.561  56.139 1.00 20.42 ? 311  ARG A N     1 
ATOM   2247  C  CA    . ARG A  1  284 ? 46.198  6.123  56.157 1.00 21.02 ? 311  ARG A CA    1 
ATOM   2248  C  C     . ARG A  1  284 ? 45.307  5.737  54.965 1.00 20.80 ? 311  ARG A C     1 
ATOM   2249  O  O     . ARG A  1  284 ? 45.564  4.747  54.278 1.00 21.47 ? 311  ARG A O     1 
ATOM   2250  C  CB    . ARG A  1  284 ? 45.523  5.732  57.481 1.00 21.00 ? 311  ARG A CB    1 
ATOM   2251  C  CG    . ARG A  1  284 ? 45.362  4.222  57.725 1.00 22.42 ? 311  ARG A CG    1 
ATOM   2252  C  CD    . ARG A  1  284 ? 44.447  3.935  58.938 1.00 22.29 ? 311  ARG A CD    1 
ATOM   2253  N  NE    . ARG A  1  284 ? 43.038  4.157  58.598 1.00 21.14 ? 311  ARG A NE    1 
ATOM   2254  C  CZ    . ARG A  1  284 ? 42.222  3.211  58.127 1.00 22.66 ? 311  ARG A CZ    1 
ATOM   2255  N  NH1   . ARG A  1  284 ? 42.664  1.966  57.952 1.00 21.36 ? 311  ARG A NH1   1 
ATOM   2256  N  NH2   . ARG A  1  284 ? 40.961  3.510  57.827 1.00 20.99 ? 311  ARG A NH2   1 
ATOM   2257  N  N     . VAL A  1  285 ? 44.255  6.521  54.741 1.00 19.71 ? 312  VAL A N     1 
ATOM   2258  C  CA    . VAL A  1  285 ? 43.356  6.332  53.599 1.00 19.91 ? 312  VAL A CA    1 
ATOM   2259  C  C     . VAL A  1  285 ? 44.096  6.526  52.270 1.00 20.40 ? 312  VAL A C     1 
ATOM   2260  O  O     . VAL A  1  285 ? 43.832  5.805  51.305 1.00 21.13 ? 312  VAL A O     1 
ATOM   2261  C  CB    . VAL A  1  285 ? 42.085  7.248  53.709 1.00 19.29 ? 312  VAL A CB    1 
ATOM   2262  C  CG1   . VAL A  1  285 ? 41.243  7.212  52.444 1.00 19.53 ? 312  VAL A CG1   1 
ATOM   2263  C  CG2   . VAL A  1  285 ? 41.231  6.819  54.895 1.00 18.52 ? 312  VAL A CG2   1 
ATOM   2264  N  N     . CYS A  1  286 ? 45.027  7.483  52.227 1.00 20.45 ? 313  CYS A N     1 
ATOM   2265  C  CA    . CYS A  1  286 ? 45.907  7.663  51.068 1.00 21.51 ? 313  CYS A CA    1 
ATOM   2266  C  C     . CYS A  1  286 ? 46.710  6.397  50.744 1.00 22.71 ? 313  CYS A C     1 
ATOM   2267  O  O     . CYS A  1  286 ? 46.804  6.007  49.575 1.00 23.11 ? 313  CYS A O     1 
ATOM   2268  C  CB    . CYS A  1  286 ? 46.869  8.838  51.269 1.00 21.38 ? 313  CYS A CB    1 
ATOM   2269  S  SG    . CYS A  1  286 ? 46.132  10.467 51.030 1.00 22.52 ? 313  CYS A SG    1 
ATOM   2270  N  N     . ASP A  1  287 ? 47.280  5.767  51.776 1.00 23.16 ? 314  ASP A N     1 
ATOM   2271  C  CA    . ASP A  1  287 ? 48.012  4.503  51.620 1.00 25.07 ? 314  ASP A CA    1 
ATOM   2272  C  C     . ASP A  1  287 ? 47.119  3.399  51.030 1.00 25.46 ? 314  ASP A C     1 
ATOM   2273  O  O     . ASP A  1  287 ? 47.530  2.679  50.114 1.00 26.60 ? 314  ASP A O     1 
ATOM   2274  C  CB    . ASP A  1  287 ? 48.595  4.037  52.968 1.00 25.64 ? 314  ASP A CB    1 
ATOM   2275  C  CG    . ASP A  1  287 ? 49.806  4.857  53.414 1.00 27.10 ? 314  ASP A CG    1 
ATOM   2276  O  OD1   . ASP A  1  287 ? 50.480  5.485  52.566 1.00 28.25 ? 314  ASP A OD1   1 
ATOM   2277  O  OD2   . ASP A  1  287 ? 50.101  4.854  54.629 1.00 29.05 ? 314  ASP A OD2   1 
ATOM   2278  N  N     . ILE A  1  288 ? 45.900  3.283  51.551 1.00 24.74 ? 315  ILE A N     1 
ATOM   2279  C  CA    . ILE A  1  288 ? 44.940  2.271  51.091 1.00 25.38 ? 315  ILE A CA    1 
ATOM   2280  C  C     . ILE A  1  288 ? 44.583  2.470  49.608 1.00 25.69 ? 315  ILE A C     1 
ATOM   2281  O  O     . ILE A  1  288 ? 44.618  1.514  48.813 1.00 26.98 ? 315  ILE A O     1 
ATOM   2282  C  CB    . ILE A  1  288 ? 43.670  2.238  51.986 1.00 24.65 ? 315  ILE A CB    1 
ATOM   2283  C  CG1   . ILE A  1  288 ? 43.991  1.602  53.350 1.00 25.53 ? 315  ILE A CG1   1 
ATOM   2284  C  CG2   . ILE A  1  288 ? 42.528  1.471  51.308 1.00 24.70 ? 315  ILE A CG2   1 
ATOM   2285  C  CD1   . ILE A  1  288 ? 42.978  1.924  54.451 1.00 24.31 ? 315  ILE A CD1   1 
ATOM   2286  N  N     . LEU A  1  289 ? 44.275  3.712  49.245 1.00 24.40 ? 316  LEU A N     1 
ATOM   2287  C  CA    . LEU A  1  289 ? 43.916  4.057  47.871 1.00 25.05 ? 316  LEU A CA    1 
ATOM   2288  C  C     . LEU A  1  289 ? 45.078  3.913  46.896 1.00 26.00 ? 316  LEU A C     1 
ATOM   2289  O  O     . LEU A  1  289 ? 44.873  3.576  45.733 1.00 26.94 ? 316  LEU A O     1 
ATOM   2290  C  CB    . LEU A  1  289 ? 43.333  5.475  47.790 1.00 23.75 ? 316  LEU A CB    1 
ATOM   2291  C  CG    . LEU A  1  289 ? 41.936  5.670  48.399 1.00 23.31 ? 316  LEU A CG    1 
ATOM   2292  C  CD1   . LEU A  1  289 ? 41.591  7.156  48.487 1.00 20.19 ? 316  LEU A CD1   1 
ATOM   2293  C  CD2   . LEU A  1  289 ? 40.867  4.905  47.626 1.00 23.35 ? 316  LEU A CD2   1 
ATOM   2294  N  N     . LYS A  1  290 ? 46.290  4.189  47.362 1.00 26.29 ? 317  LYS A N     1 
ATOM   2295  C  CA    . LYS A  1  290 ? 47.470  4.004  46.526 1.00 28.31 ? 317  LYS A CA    1 
ATOM   2296  C  C     . LYS A  1  290 ? 47.681  2.521  46.200 1.00 29.64 ? 317  LYS A C     1 
ATOM   2297  O  O     . LYS A  1  290 ? 48.074  2.180  45.084 1.00 30.78 ? 317  LYS A O     1 
ATOM   2298  C  CB    . LYS A  1  290 ? 48.719  4.597  47.175 1.00 28.13 ? 317  LYS A CB    1 
ATOM   2299  C  CG    . LYS A  1  290 ? 49.948  4.472  46.296 1.00 31.80 ? 317  LYS A CG    1 
ATOM   2300  C  CD    . LYS A  1  290 ? 51.089  5.351  46.767 1.00 34.57 ? 317  LYS A CD    1 
ATOM   2301  C  CE    . LYS A  1  290 ? 52.232  5.312  45.752 1.00 38.12 ? 317  LYS A CE    1 
ATOM   2302  N  NZ    . LYS A  1  290 ? 51.824  5.932  44.442 1.00 39.19 ? 317  LYS A NZ    1 
ATOM   2303  N  N     . GLN A  1  291 ? 47.414  1.658  47.181 1.00 29.68 ? 318  GLN A N     1 
ATOM   2304  C  CA    . GLN A  1  291 ? 47.486  0.213  46.998 1.00 31.42 ? 318  GLN A CA    1 
ATOM   2305  C  C     . GLN A  1  291 ? 46.427  -0.251 45.989 1.00 31.64 ? 318  GLN A C     1 
ATOM   2306  O  O     . GLN A  1  291 ? 46.731  -1.039 45.094 1.00 32.28 ? 318  GLN A O     1 
ATOM   2307  C  CB    . GLN A  1  291 ? 47.335  -0.522 48.340 1.00 32.06 ? 318  GLN A CB    1 
ATOM   2308  C  CG    . GLN A  1  291 ? 47.586  -2.022 48.253 1.00 34.85 ? 318  GLN A CG    1 
ATOM   2309  C  CD    . GLN A  1  291 ? 47.761  -2.686 49.610 1.00 37.52 ? 318  GLN A CD    1 
ATOM   2310  O  OE1   . GLN A  1  291 ? 47.056  -2.376 50.568 1.00 38.48 ? 318  GLN A OE1   1 
ATOM   2311  N  NE2   . GLN A  1  291 ? 48.697  -3.618 49.689 1.00 39.00 ? 318  GLN A NE2   1 
ATOM   2312  N  N     . GLU A  1  292 ? 45.201  0.255  46.137 1.00 30.96 ? 319  GLU A N     1 
ATOM   2313  C  CA    . GLU A  1  292 ? 44.107  -0.015 45.198 1.00 31.36 ? 319  GLU A CA    1 
ATOM   2314  C  C     . GLU A  1  292 ? 44.375  0.542  43.804 1.00 30.97 ? 319  GLU A C     1 
ATOM   2315  O  O     . GLU A  1  292 ? 44.090  -0.114 42.806 1.00 31.88 ? 319  GLU A O     1 
ATOM   2316  C  CB    . GLU A  1  292 ? 42.786  0.574  45.708 1.00 30.92 ? 319  GLU A CB    1 
ATOM   2317  C  CG    . GLU A  1  292 ? 42.089  -0.223 46.795 1.00 33.21 ? 319  GLU A CG    1 
ATOM   2318  C  CD    . GLU A  1  292 ? 41.840  -1.671 46.396 1.00 37.32 ? 319  GLU A CD    1 
ATOM   2319  O  OE1   . GLU A  1  292 ? 41.133  -1.915 45.391 1.00 38.88 ? 319  GLU A OE1   1 
ATOM   2320  O  OE2   . GLU A  1  292 ? 42.352  -2.564 47.101 1.00 39.62 ? 319  GLU A OE2   1 
ATOM   2321  N  N     . HIS A  1  293 ? 44.911  1.756  43.743 1.00 29.64 ? 320  HIS A N     1 
ATOM   2322  C  CA    . HIS A  1  293 ? 45.098  2.454  42.479 1.00 29.17 ? 320  HIS A CA    1 
ATOM   2323  C  C     . HIS A  1  293 ? 46.551  2.905  42.315 1.00 29.38 ? 320  HIS A C     1 
ATOM   2324  O  O     . HIS A  1  293 ? 46.860  4.081  42.540 1.00 28.11 ? 320  HIS A O     1 
ATOM   2325  C  CB    . HIS A  1  293 ? 44.169  3.676  42.392 1.00 28.05 ? 320  HIS A CB    1 
ATOM   2326  C  CG    . HIS A  1  293 ? 42.711  3.351  42.525 1.00 28.32 ? 320  HIS A CG    1 
ATOM   2327  N  ND1   . HIS A  1  293 ? 41.950  2.886  41.471 1.00 29.08 ? 320  HIS A ND1   1 
ATOM   2328  C  CD2   . HIS A  1  293 ? 41.869  3.445  43.582 1.00 28.42 ? 320  HIS A CD2   1 
ATOM   2329  C  CE1   . HIS A  1  293 ? 40.706  2.696  41.877 1.00 29.50 ? 320  HIS A CE1   1 
ATOM   2330  N  NE2   . HIS A  1  293 ? 40.630  3.023  43.155 1.00 28.86 ? 320  HIS A NE2   1 
ATOM   2331  N  N     . PRO A  1  294 ? 47.457  1.976  41.924 1.00 30.47 ? 321  PRO A N     1 
ATOM   2332  C  CA    . PRO A  1  294 ? 48.837  2.416  41.684 1.00 30.76 ? 321  PRO A CA    1 
ATOM   2333  C  C     . PRO A  1  294 ? 48.925  3.408  40.522 1.00 30.54 ? 321  PRO A C     1 
ATOM   2334  O  O     . PRO A  1  294 ? 49.902  4.145  40.412 1.00 30.81 ? 321  PRO A O     1 
ATOM   2335  C  CB    . PRO A  1  294 ? 49.591  1.112  41.357 1.00 32.34 ? 321  PRO A CB    1 
ATOM   2336  C  CG    . PRO A  1  294 ? 48.541  0.096  41.048 1.00 32.61 ? 321  PRO A CG    1 
ATOM   2337  C  CD    . PRO A  1  294 ? 47.301  0.517  41.789 1.00 31.47 ? 321  PRO A CD    1 
ATOM   2338  N  N     . GLU A  1  295 ? 47.896  3.433  39.680 1.00 30.37 ? 322  GLU A N     1 
ATOM   2339  C  CA    . GLU A  1  295 ? 47.848  4.315  38.514 1.00 30.40 ? 322  GLU A CA    1 
ATOM   2340  C  C     . GLU A  1  295 ? 47.416  5.765  38.812 1.00 29.28 ? 322  GLU A C     1 
ATOM   2341  O  O     . GLU A  1  295 ? 47.572  6.641  37.964 1.00 29.40 ? 322  GLU A O     1 
ATOM   2342  C  CB    . GLU A  1  295 ? 46.949  3.696  37.430 1.00 31.08 ? 322  GLU A CB    1 
ATOM   2343  C  CG    . GLU A  1  295 ? 45.442  3.889  37.638 1.00 30.80 ? 322  GLU A CG    1 
ATOM   2344  C  CD    . GLU A  1  295 ? 44.822  2.990  38.710 1.00 31.37 ? 322  GLU A CD    1 
ATOM   2345  O  OE1   . GLU A  1  295 ? 45.539  2.192  39.366 1.00 32.19 ? 322  GLU A OE1   1 
ATOM   2346  O  OE2   . GLU A  1  295 ? 43.589  3.078  38.888 1.00 30.13 ? 322  GLU A OE2   1 
ATOM   2347  N  N     . TRP A  1  296 ? 46.867  6.010  40.002 1.00 28.33 ? 323  TRP A N     1 
ATOM   2348  C  CA    . TRP A  1  296 ? 46.387  7.345  40.384 1.00 27.34 ? 323  TRP A CA    1 
ATOM   2349  C  C     . TRP A  1  296 ? 47.525  8.284  40.739 1.00 26.90 ? 323  TRP A C     1 
ATOM   2350  O  O     . TRP A  1  296 ? 48.555  7.845  41.252 1.00 28.02 ? 323  TRP A O     1 
ATOM   2351  C  CB    . TRP A  1  296 ? 45.465  7.236  41.594 1.00 26.60 ? 323  TRP A CB    1 
ATOM   2352  C  CG    . TRP A  1  296 ? 44.038  6.913  41.268 1.00 26.40 ? 323  TRP A CG    1 
ATOM   2353  C  CD1   . TRP A  1  296 ? 43.539  6.483  40.069 1.00 27.46 ? 323  TRP A CD1   1 
ATOM   2354  C  CD2   . TRP A  1  296 ? 42.932  6.945  42.175 1.00 25.30 ? 323  TRP A CD2   1 
ATOM   2355  N  NE1   . TRP A  1  296 ? 42.187  6.265  40.170 1.00 26.95 ? 323  TRP A NE1   1 
ATOM   2356  C  CE2   . TRP A  1  296 ? 41.786  6.542  41.452 1.00 25.31 ? 323  TRP A CE2   1 
ATOM   2357  C  CE3   . TRP A  1  296 ? 42.796  7.279  43.531 1.00 24.83 ? 323  TRP A CE3   1 
ATOM   2358  C  CZ2   . TRP A  1  296 ? 40.515  6.471  42.035 1.00 23.48 ? 323  TRP A CZ2   1 
ATOM   2359  C  CZ3   . TRP A  1  296 ? 41.521  7.212  44.112 1.00 24.04 ? 323  TRP A CZ3   1 
ATOM   2360  C  CH2   . TRP A  1  296 ? 40.404  6.811  43.359 1.00 23.43 ? 323  TRP A CH2   1 
ATOM   2361  N  N     . GLY A  1  297 ? 47.327  9.573  40.483 1.00 26.23 ? 324  GLY A N     1 
ATOM   2362  C  CA    . GLY A  1  297 ? 48.264  10.616 40.907 1.00 25.76 ? 324  GLY A CA    1 
ATOM   2363  C  C     . GLY A  1  297 ? 47.906  11.236 42.253 1.00 25.07 ? 324  GLY A C     1 
ATOM   2364  O  O     . GLY A  1  297 ? 46.866  10.918 42.836 1.00 24.55 ? 324  GLY A O     1 
ATOM   2365  N  N     . ASP A  1  298 ? 48.764  12.138 42.727 1.00 24.98 ? 325  ASP A N     1 
ATOM   2366  C  CA    . ASP A  1  298 ? 48.594  12.825 44.011 1.00 24.67 ? 325  ASP A CA    1 
ATOM   2367  C  C     . ASP A  1  298 ? 47.242  13.546 44.151 1.00 23.90 ? 325  ASP A C     1 
ATOM   2368  O  O     . ASP A  1  298 ? 46.590  13.447 45.194 1.00 23.03 ? 325  ASP A O     1 
ATOM   2369  C  CB    . ASP A  1  298 ? 49.735  13.831 44.228 1.00 25.02 ? 325  ASP A CB    1 
ATOM   2370  C  CG    . ASP A  1  298 ? 49.486  14.757 45.420 1.00 24.98 ? 325  ASP A CG    1 
ATOM   2371  O  OD1   . ASP A  1  298 ? 49.697  14.328 46.577 1.00 23.28 ? 325  ASP A OD1   1 
ATOM   2372  O  OD2   . ASP A  1  298 ? 49.083  15.921 45.196 1.00 24.33 ? 325  ASP A OD2   1 
ATOM   2373  N  N     . GLU A  1  299 ? 46.832  14.273 43.112 1.00 23.52 ? 326  GLU A N     1 
ATOM   2374  C  CA    . GLU A  1  299 ? 45.604  15.068 43.188 1.00 22.76 ? 326  GLU A CA    1 
ATOM   2375  C  C     . GLU A  1  299 ? 44.363  14.207 43.435 1.00 22.29 ? 326  GLU A C     1 
ATOM   2376  O  O     . GLU A  1  299 ? 43.570  14.512 44.326 1.00 22.22 ? 326  GLU A O     1 
ATOM   2377  C  CB    . GLU A  1  299 ? 45.427  15.961 41.948 1.00 22.91 ? 326  GLU A CB    1 
ATOM   2378  C  CG    . GLU A  1  299 ? 44.219  16.915 42.006 1.00 22.77 ? 326  GLU A CG    1 
ATOM   2379  C  CD    . GLU A  1  299 ? 44.334  18.026 43.047 1.00 23.65 ? 326  GLU A CD    1 
ATOM   2380  O  OE1   . GLU A  1  299 ? 45.447  18.303 43.555 1.00 23.46 ? 326  GLU A OE1   1 
ATOM   2381  O  OE2   . GLU A  1  299 ? 43.286  18.639 43.361 1.00 25.04 ? 326  GLU A OE2   1 
ATOM   2382  N  N     . GLN A  1  300 ? 44.201  13.132 42.667 1.00 22.38 ? 327  GLN A N     1 
ATOM   2383  C  CA    . GLN A  1  300 ? 43.040  12.251 42.833 1.00 22.19 ? 327  GLN A CA    1 
ATOM   2384  C  C     . GLN A  1  300 ? 43.080  11.500 44.160 1.00 21.88 ? 327  GLN A C     1 
ATOM   2385  O  O     . GLN A  1  300 ? 42.040  11.277 44.772 1.00 22.08 ? 327  GLN A O     1 
ATOM   2386  C  CB    . GLN A  1  300 ? 42.898  11.273 41.665 1.00 22.64 ? 327  GLN A CB    1 
ATOM   2387  C  CG    . GLN A  1  300 ? 41.558  10.532 41.632 1.00 23.71 ? 327  GLN A CG    1 
ATOM   2388  C  CD    . GLN A  1  300 ? 41.324  9.771  40.330 1.00 25.15 ? 327  GLN A CD    1 
ATOM   2389  O  OE1   . GLN A  1  300 ? 42.216  9.662  39.489 1.00 25.52 ? 327  GLN A OE1   1 
ATOM   2390  N  NE2   . GLN A  1  300 ? 40.116  9.245  40.163 1.00 25.96 ? 327  GLN A NE2   1 
ATOM   2391  N  N     . LEU A  1  301 ? 44.276  11.124 44.603 1.00 21.72 ? 328  LEU A N     1 
ATOM   2392  C  CA    . LEU A  1  301 ? 44.436  10.458 45.900 1.00 21.81 ? 328  LEU A CA    1 
ATOM   2393  C  C     . LEU A  1  301 ? 44.008  11.391 47.028 1.00 21.06 ? 328  LEU A C     1 
ATOM   2394  O  O     . LEU A  1  301 ? 43.291  10.978 47.933 1.00 21.05 ? 328  LEU A O     1 
ATOM   2395  C  CB    . LEU A  1  301 ? 45.876  9.982  46.105 1.00 21.60 ? 328  LEU A CB    1 
ATOM   2396  C  CG    . LEU A  1  301 ? 46.338  8.766  45.296 1.00 22.75 ? 328  LEU A CG    1 
ATOM   2397  C  CD1   . LEU A  1  301 ? 47.873  8.702  45.283 1.00 22.93 ? 328  LEU A CD1   1 
ATOM   2398  C  CD2   . LEU A  1  301 ? 45.739  7.463  45.847 1.00 21.02 ? 328  LEU A CD2   1 
ATOM   2399  N  N     . PHE A  1  302 ? 44.446  12.648 46.964 1.00 20.93 ? 329  PHE A N     1 
ATOM   2400  C  CA    . PHE A  1  302 ? 44.039  13.640 47.952 1.00 20.40 ? 329  PHE A CA    1 
ATOM   2401  C  C     . PHE A  1  302 ? 42.527  13.817 47.978 1.00 20.00 ? 329  PHE A C     1 
ATOM   2402  O  O     . PHE A  1  302 ? 41.907  13.700 49.037 1.00 20.35 ? 329  PHE A O     1 
ATOM   2403  C  CB    . PHE A  1  302 ? 44.718  15.005 47.724 1.00 20.41 ? 329  PHE A CB    1 
ATOM   2404  C  CG    . PHE A  1  302 ? 44.154  16.101 48.597 1.00 20.23 ? 329  PHE A CG    1 
ATOM   2405  C  CD1   . PHE A  1  302 ? 44.587  16.248 49.912 1.00 20.50 ? 329  PHE A CD1   1 
ATOM   2406  C  CD2   . PHE A  1  302 ? 43.151  16.950 48.119 1.00 19.35 ? 329  PHE A CD2   1 
ATOM   2407  C  CE1   . PHE A  1  302 ? 44.046  17.244 50.737 1.00 20.76 ? 329  PHE A CE1   1 
ATOM   2408  C  CE2   . PHE A  1  302 ? 42.602  17.945 48.938 1.00 19.03 ? 329  PHE A CE2   1 
ATOM   2409  C  CZ    . PHE A  1  302 ? 43.054  18.089 50.249 1.00 19.74 ? 329  PHE A CZ    1 
ATOM   2410  N  N     . GLN A  1  303 ? 41.934  14.090 46.815 1.00 20.04 ? 330  GLN A N     1 
ATOM   2411  C  CA    . GLN A  1  303 ? 40.509  14.451 46.743 1.00 19.57 ? 330  GLN A CA    1 
ATOM   2412  C  C     . GLN A  1  303 ? 39.605  13.292 47.167 1.00 19.87 ? 330  GLN A C     1 
ATOM   2413  O  O     . GLN A  1  303 ? 38.619  13.492 47.872 1.00 19.87 ? 330  GLN A O     1 
ATOM   2414  C  CB    . GLN A  1  303 ? 40.125  14.946 45.339 1.00 19.57 ? 330  GLN A CB    1 
ATOM   2415  C  CG    . GLN A  1  303 ? 40.899  16.199 44.844 1.00 19.36 ? 330  GLN A CG    1 
ATOM   2416  C  CD    . GLN A  1  303 ? 40.471  17.508 45.519 1.00 19.41 ? 330  GLN A CD    1 
ATOM   2417  O  OE1   . GLN A  1  303 ? 39.491  17.557 46.263 1.00 18.63 ? 330  GLN A OE1   1 
ATOM   2418  N  NE2   . GLN A  1  303 ? 41.222  18.572 45.262 1.00 19.70 ? 330  GLN A NE2   1 
ATOM   2419  N  N     . THR A  1  304 ? 39.954  12.085 46.735 1.00 20.49 ? 331  THR A N     1 
ATOM   2420  C  CA    . THR A  1  304 ? 39.175  10.892 47.061 1.00 20.93 ? 331  THR A CA    1 
ATOM   2421  C  C     . THR A  1  304 ? 39.231  10.592 48.560 1.00 21.12 ? 331  THR A C     1 
ATOM   2422  O  O     . THR A  1  304 ? 38.217  10.230 49.151 1.00 21.23 ? 331  THR A O     1 
ATOM   2423  C  CB    . THR A  1  304 ? 39.662  9.671  46.248 1.00 21.59 ? 331  THR A CB    1 
ATOM   2424  O  OG1   . THR A  1  304 ? 39.736  10.023 44.857 1.00 20.72 ? 331  THR A OG1   1 
ATOM   2425  C  CG2   . THR A  1  304 ? 38.715  8.474  46.433 1.00 21.32 ? 331  THR A CG2   1 
ATOM   2426  N  N     . SER A  1  305 ? 40.413  10.755 49.163 1.00 21.23 ? 332  SER A N     1 
ATOM   2427  C  CA    . SER A  1  305 ? 40.575  10.597 50.606 1.00 21.49 ? 332  SER A CA    1 
ATOM   2428  C  C     . SER A  1  305 ? 39.729  11.598 51.378 1.00 20.70 ? 332  SER A C     1 
ATOM   2429  O  O     . SER A  1  305 ? 39.120  11.237 52.372 1.00 21.01 ? 332  SER A O     1 
ATOM   2430  C  CB    . SER A  1  305 ? 42.044  10.709 51.030 1.00 21.65 ? 332  SER A CB    1 
ATOM   2431  O  OG    . SER A  1  305 ? 42.805  9.645  50.498 1.00 23.73 ? 332  SER A OG    1 
ATOM   2432  N  N     . ARG A  1  306 ? 39.687  12.850 50.918 1.00 20.66 ? 333  ARG A N     1 
ATOM   2433  C  CA    . ARG A  1  306 ? 38.832  13.874 51.541 1.00 20.16 ? 333  ARG A CA    1 
ATOM   2434  C  C     . ARG A  1  306 ? 37.357  13.481 51.555 1.00 20.08 ? 333  ARG A C     1 
ATOM   2435  O  O     . ARG A  1  306 ? 36.694  13.622 52.582 1.00 19.90 ? 333  ARG A O     1 
ATOM   2436  C  CB    . ARG A  1  306 ? 39.013  15.258 50.884 1.00 20.08 ? 333  ARG A CB    1 
ATOM   2437  C  CG    . ARG A  1  306 ? 38.082  16.354 51.427 1.00 19.09 ? 333  ARG A CG    1 
ATOM   2438  C  CD    . ARG A  1  306 ? 38.455  17.764 50.907 1.00 20.30 ? 333  ARG A CD    1 
ATOM   2439  N  NE    . ARG A  1  306 ? 37.807  18.812 51.705 1.00 19.37 ? 333  ARG A NE    1 
ATOM   2440  C  CZ    . ARG A  1  306 ? 38.137  20.104 51.689 1.00 20.69 ? 333  ARG A CZ    1 
ATOM   2441  N  NH1   . ARG A  1  306 ? 39.114  20.555 50.897 1.00 18.59 ? 333  ARG A NH1   1 
ATOM   2442  N  NH2   . ARG A  1  306 ? 37.488  20.951 52.483 1.00 19.07 ? 333  ARG A NH2   1 
ATOM   2443  N  N     . LEU A  1  307 ? 36.850  12.998 50.419 1.00 20.25 ? 334  LEU A N     1 
ATOM   2444  C  CA    . LEU A  1  307 ? 35.445  12.571 50.320 1.00 20.07 ? 334  LEU A CA    1 
ATOM   2445  C  C     . LEU A  1  307 ? 35.154  11.394 51.250 1.00 20.12 ? 334  LEU A C     1 
ATOM   2446  O  O     . LEU A  1  307 ? 34.096  11.335 51.877 1.00 19.87 ? 334  LEU A O     1 
ATOM   2447  C  CB    . LEU A  1  307 ? 35.064  12.216 48.869 1.00 20.29 ? 334  LEU A CB    1 
ATOM   2448  C  CG    . LEU A  1  307 ? 34.971  13.340 47.815 1.00 20.58 ? 334  LEU A CG    1 
ATOM   2449  C  CD1   . LEU A  1  307 ? 34.392  12.841 46.485 1.00 18.35 ? 334  LEU A CD1   1 
ATOM   2450  C  CD2   . LEU A  1  307 ? 34.181  14.572 48.324 1.00 20.37 ? 334  LEU A CD2   1 
ATOM   2451  N  N     . ILE A  1  308 ? 36.100  10.455 51.315 1.00 20.26 ? 335  ILE A N     1 
ATOM   2452  C  CA    . ILE A  1  308 ? 36.024  9.313  52.230 1.00 20.15 ? 335  ILE A CA    1 
ATOM   2453  C  C     . ILE A  1  308 ? 35.950  9.786  53.694 1.00 19.81 ? 335  ILE A C     1 
ATOM   2454  O  O     . ILE A  1  308 ? 35.126  9.294  54.460 1.00 20.22 ? 335  ILE A O     1 
ATOM   2455  C  CB    . ILE A  1  308 ? 37.198  8.310  51.996 1.00 20.59 ? 335  ILE A CB    1 
ATOM   2456  C  CG1   . ILE A  1  308 ? 36.925  7.482  50.738 1.00 20.65 ? 335  ILE A CG1   1 
ATOM   2457  C  CG2   . ILE A  1  308 ? 37.398  7.370  53.198 1.00 20.31 ? 335  ILE A CG2   1 
ATOM   2458  C  CD1   . ILE A  1  308 ? 38.107  6.699  50.228 1.00 19.67 ? 335  ILE A CD1   1 
ATOM   2459  N  N     . LEU A  1  309 ? 36.785  10.749 54.071 1.00 18.94 ? 336  LEU A N     1 
ATOM   2460  C  CA    . LEU A  1  309 ? 36.782  11.251 55.454 1.00 19.04 ? 336  LEU A CA    1 
ATOM   2461  C  C     . LEU A  1  309 ? 35.524  12.042 55.798 1.00 19.02 ? 336  LEU A C     1 
ATOM   2462  O  O     . LEU A  1  309 ? 35.058  12.007 56.940 1.00 18.67 ? 336  LEU A O     1 
ATOM   2463  C  CB    . LEU A  1  309 ? 38.035  12.073 55.762 1.00 18.81 ? 336  LEU A CB    1 
ATOM   2464  C  CG    . LEU A  1  309 ? 39.219  11.288 56.355 1.00 19.38 ? 336  LEU A CG    1 
ATOM   2465  C  CD1   . LEU A  1  309 ? 39.803  10.271 55.359 1.00 19.30 ? 336  LEU A CD1   1 
ATOM   2466  C  CD2   . LEU A  1  309 ? 40.305  12.254 56.849 1.00 18.51 ? 336  LEU A CD2   1 
ATOM   2467  N  N     . ILE A  1  310 ? 34.989  12.764 54.813 1.00 18.94 ? 337  ILE A N     1 
ATOM   2468  C  CA    . ILE A  1  310 ? 33.710  13.420 54.983 1.00 19.28 ? 337  ILE A CA    1 
ATOM   2469  C  C     . ILE A  1  310 ? 32.659  12.366 55.329 1.00 20.03 ? 337  ILE A C     1 
ATOM   2470  O  O     . ILE A  1  310 ? 31.934  12.532 56.306 1.00 20.36 ? 337  ILE A O     1 
ATOM   2471  C  CB    . ILE A  1  310 ? 33.311  14.259 53.749 1.00 19.09 ? 337  ILE A CB    1 
ATOM   2472  C  CG1   . ILE A  1  310 ? 34.180  15.525 53.683 1.00 18.61 ? 337  ILE A CG1   1 
ATOM   2473  C  CG2   . ILE A  1  310 ? 31.825  14.629 53.799 1.00 18.64 ? 337  ILE A CG2   1 
ATOM   2474  C  CD1   . ILE A  1  310 ? 34.034  16.317 52.397 1.00 20.78 ? 337  ILE A CD1   1 
ATOM   2475  N  N     . GLY A  1  311 ? 32.605  11.292 54.540 1.00 20.26 ? 338  GLY A N     1 
ATOM   2476  C  CA    . GLY A  1  311 ? 31.726  10.155 54.818 1.00 21.56 ? 338  GLY A CA    1 
ATOM   2477  C  C     . GLY A  1  311 ? 31.937  9.556  56.201 1.00 22.44 ? 338  GLY A C     1 
ATOM   2478  O  O     . GLY A  1  311 ? 30.965  9.288  56.915 1.00 22.48 ? 338  GLY A O     1 
ATOM   2479  N  N     . GLU A  1  312 ? 33.203  9.334  56.571 1.00 22.47 ? 339  GLU A N     1 
ATOM   2480  C  CA    . GLU A  1  312 ? 33.549  8.795  57.893 1.00 23.45 ? 339  GLU A CA    1 
ATOM   2481  C  C     . GLU A  1  312 ? 32.991  9.690  58.987 1.00 22.85 ? 339  GLU A C     1 
ATOM   2482  O  O     . GLU A  1  312 ? 32.443  9.208  59.973 1.00 23.43 ? 339  GLU A O     1 
ATOM   2483  C  CB    . GLU A  1  312 ? 35.066  8.724  58.081 1.00 23.66 ? 339  GLU A CB    1 
ATOM   2484  C  CG    . GLU A  1  312 ? 35.784  7.642  57.319 1.00 25.32 ? 339  GLU A CG    1 
ATOM   2485  C  CD    . GLU A  1  312 ? 37.256  7.578  57.705 1.00 27.96 ? 339  GLU A CD    1 
ATOM   2486  O  OE1   . GLU A  1  312 ? 37.574  7.761  58.897 1.00 30.60 ? 339  GLU A OE1   1 
ATOM   2487  O  OE2   . GLU A  1  312 ? 38.098  7.344  56.826 1.00 27.88 ? 339  GLU A OE2   1 
ATOM   2488  N  N     . THR A  1  313 ? 33.144  10.997 58.803 1.00 22.37 ? 340  THR A N     1 
ATOM   2489  C  CA    . THR A  1  313 ? 32.688  11.983 59.779 1.00 21.96 ? 340  THR A CA    1 
ATOM   2490  C  C     . THR A  1  313 ? 31.168  11.898 59.986 1.00 21.98 ? 340  THR A C     1 
ATOM   2491  O  O     . THR A  1  313 ? 30.695  11.806 61.128 1.00 22.02 ? 340  THR A O     1 
ATOM   2492  C  CB    . THR A  1  313 ? 33.127  13.398 59.376 1.00 21.51 ? 340  THR A CB    1 
ATOM   2493  O  OG1   . THR A  1  313 ? 34.556  13.424 59.250 1.00 21.89 ? 340  THR A OG1   1 
ATOM   2494  C  CG2   . THR A  1  313 ? 32.684  14.439 60.422 1.00 21.27 ? 340  THR A CG2   1 
ATOM   2495  N  N     . ILE A  1  314 ? 30.414  11.890 58.889 1.00 21.68 ? 341  ILE A N     1 
ATOM   2496  C  CA    . ILE A  1  314 ? 28.949  11.832 58.973 1.00 21.97 ? 341  ILE A CA    1 
ATOM   2497  C  C     . ILE A  1  314 ? 28.496  10.514 59.616 1.00 22.75 ? 341  ILE A C     1 
ATOM   2498  O  O     . ILE A  1  314 ? 27.575  10.494 60.436 1.00 23.47 ? 341  ILE A O     1 
ATOM   2499  C  CB    . ILE A  1  314 ? 28.278  12.047 57.590 1.00 21.72 ? 341  ILE A CB    1 
ATOM   2500  C  CG1   . ILE A  1  314 ? 28.578  13.460 57.069 1.00 21.68 ? 341  ILE A CG1   1 
ATOM   2501  C  CG2   . ILE A  1  314 ? 26.749  11.830 57.681 1.00 21.31 ? 341  ILE A CG2   1 
ATOM   2502  C  CD1   . ILE A  1  314 ? 28.331  13.632 55.572 1.00 21.86 ? 341  ILE A CD1   1 
ATOM   2503  N  N     . LYS A  1  315 ? 29.159  9.422  59.243 1.00 23.10 ? 342  LYS A N     1 
ATOM   2504  C  CA    . LYS A  1  315 ? 28.912  8.109  59.828 1.00 23.60 ? 342  LYS A CA    1 
ATOM   2505  C  C     . LYS A  1  315 ? 29.095  8.111  61.348 1.00 23.98 ? 342  LYS A C     1 
ATOM   2506  O  O     . LYS A  1  315 ? 28.220  7.644  62.086 1.00 24.39 ? 342  LYS A O     1 
ATOM   2507  C  CB    . LYS A  1  315 ? 29.835  7.068  59.181 1.00 24.01 ? 342  LYS A CB    1 
ATOM   2508  C  CG    . LYS A  1  315 ? 29.841  5.699  59.863 1.00 24.00 ? 342  LYS A CG    1 
ATOM   2509  C  CD    . LYS A  1  315 ? 28.627  4.897  59.458 1.00 24.04 ? 342  LYS A CD    1 
ATOM   2510  C  CE    . LYS A  1  315 ? 28.780  3.431  59.846 1.00 25.38 ? 342  LYS A CE    1 
ATOM   2511  N  NZ    . LYS A  1  315 ? 27.587  2.661  59.395 1.00 24.93 ? 342  LYS A NZ    1 
ATOM   2512  N  N     . ILE A  1  316 ? 30.238  8.624  61.810 1.00 23.44 ? 343  ILE A N     1 
ATOM   2513  C  CA    . ILE A  1  316 ? 30.560  8.649  63.242 1.00 23.08 ? 343  ILE A CA    1 
ATOM   2514  C  C     . ILE A  1  316 ? 29.613  9.584  63.995 1.00 22.66 ? 343  ILE A C     1 
ATOM   2515  O  O     . ILE A  1  316 ? 29.120  9.245  65.076 1.00 23.15 ? 343  ILE A O     1 
ATOM   2516  C  CB    . ILE A  1  316 ? 32.049  9.034  63.492 1.00 22.62 ? 343  ILE A CB    1 
ATOM   2517  C  CG1   . ILE A  1  316 ? 32.969  7.881  63.063 1.00 23.40 ? 343  ILE A CG1   1 
ATOM   2518  C  CG2   . ILE A  1  316 ? 32.281  9.399  64.966 1.00 22.41 ? 343  ILE A CG2   1 
ATOM   2519  C  CD1   . ILE A  1  316 ? 34.431  8.301  62.785 1.00 22.74 ? 343  ILE A CD1   1 
ATOM   2520  N  N     . VAL A  1  317 ? 29.339  10.744 63.409 1.00 22.01 ? 344  VAL A N     1 
ATOM   2521  C  CA    . VAL A  1  317 ? 28.456  11.730 64.041 1.00 21.82 ? 344  VAL A CA    1 
ATOM   2522  C  C     . VAL A  1  317 ? 27.060  11.150 64.292 1.00 22.68 ? 344  VAL A C     1 
ATOM   2523  O  O     . VAL A  1  317 ? 26.520  11.281 65.389 1.00 23.26 ? 344  VAL A O     1 
ATOM   2524  C  CB    . VAL A  1  317 ? 28.383  13.055 63.242 1.00 21.50 ? 344  VAL A CB    1 
ATOM   2525  C  CG1   . VAL A  1  317 ? 27.222  13.951 63.740 1.00 21.00 ? 344  VAL A CG1   1 
ATOM   2526  C  CG2   . VAL A  1  317 ? 29.705  13.816 63.350 1.00 20.88 ? 344  VAL A CG2   1 
ATOM   2527  N  N     . ILE A  1  318 ? 26.488  10.490 63.292 1.00 22.73 ? 345  ILE A N     1 
ATOM   2528  C  CA    . ILE A  1  318 ? 25.155  9.907  63.446 1.00 23.64 ? 345  ILE A CA    1 
ATOM   2529  C  C     . ILE A  1  318 ? 25.153  8.701  64.404 1.00 24.97 ? 345  ILE A C     1 
ATOM   2530  O  O     . ILE A  1  318 ? 24.429  8.688  65.409 1.00 25.59 ? 345  ILE A O     1 
ATOM   2531  C  CB    . ILE A  1  318 ? 24.547  9.523  62.070 1.00 24.09 ? 345  ILE A CB    1 
ATOM   2532  C  CG1   . ILE A  1  318 ? 24.273  10.792 61.248 1.00 23.61 ? 345  ILE A CG1   1 
ATOM   2533  C  CG2   . ILE A  1  318 ? 23.272  8.670  62.251 1.00 23.98 ? 345  ILE A CG2   1 
ATOM   2534  C  CD1   . ILE A  1  318 ? 23.917  10.542 59.773 1.00 24.30 ? 345  ILE A CD1   1 
ATOM   2535  N  N     . GLU A  1  319 ? 25.994  7.714  64.111 1.00 25.35 ? 346  GLU A N     1 
ATOM   2536  C  CA    . GLU A  1  319 ? 25.882  6.396  64.741 1.00 26.88 ? 346  GLU A CA    1 
ATOM   2537  C  C     . GLU A  1  319 ? 26.552  6.269  66.107 1.00 27.14 ? 346  GLU A C     1 
ATOM   2538  O  O     . GLU A  1  319 ? 26.209  5.381  66.879 1.00 27.85 ? 346  GLU A O     1 
ATOM   2539  C  CB    . GLU A  1  319 ? 26.361  5.303  63.778 1.00 27.23 ? 346  GLU A CB    1 
ATOM   2540  C  CG    . GLU A  1  319 ? 25.466  5.196  62.541 1.00 29.37 ? 346  GLU A CG    1 
ATOM   2541  C  CD    . GLU A  1  319 ? 25.672  3.928  61.732 1.00 32.69 ? 346  GLU A CD    1 
ATOM   2542  O  OE1   . GLU A  1  319 ? 26.460  3.046  62.155 1.00 35.51 ? 346  GLU A OE1   1 
ATOM   2543  O  OE2   . GLU A  1  319 ? 25.038  3.812  60.662 1.00 32.39 ? 346  GLU A OE2   1 
ATOM   2544  N  N     . ASP A  1  320 ? 27.494  7.162  66.400 1.00 26.77 ? 347  ASP A N     1 
ATOM   2545  C  CA    . ASP A  1  320 ? 28.158  7.178  67.696 1.00 26.91 ? 347  ASP A CA    1 
ATOM   2546  C  C     . ASP A  1  320 ? 27.793  8.418  68.513 1.00 26.35 ? 347  ASP A C     1 
ATOM   2547  O  O     . ASP A  1  320 ? 27.387  8.303  69.661 1.00 27.12 ? 347  ASP A O     1 
ATOM   2548  C  CB    . ASP A  1  320 ? 29.683  7.101  67.528 1.00 26.96 ? 347  ASP A CB    1 
ATOM   2549  C  CG    . ASP A  1  320 ? 30.153  5.759  66.969 1.00 28.67 ? 347  ASP A CG    1 
ATOM   2550  O  OD1   . ASP A  1  320 ? 29.604  4.710  67.367 1.00 31.06 ? 347  ASP A OD1   1 
ATOM   2551  O  OD2   . ASP A  1  320 ? 31.086  5.755  66.137 1.00 28.39 ? 347  ASP A OD2   1 
ATOM   2552  N  N     . TYR A  1  321 ? 27.954  9.591  67.910 1.00 25.44 ? 348  TYR A N     1 
ATOM   2553  C  CA    . TYR A  1  321 ? 27.879  10.882 68.601 1.00 25.16 ? 348  TYR A CA    1 
ATOM   2554  C  C     . TYR A  1  321 ? 26.447  11.265 68.942 1.00 25.28 ? 348  TYR A C     1 
ATOM   2555  O  O     . TYR A  1  321 ? 26.111  11.460 70.112 1.00 25.34 ? 348  TYR A O     1 
ATOM   2556  C  CB    . TYR A  1  321 ? 28.543  11.949 67.732 1.00 24.18 ? 348  TYR A CB    1 
ATOM   2557  C  CG    . TYR A  1  321 ? 28.507  13.375 68.243 1.00 25.08 ? 348  TYR A CG    1 
ATOM   2558  C  CD1   . TYR A  1  321 ? 29.530  13.868 69.049 1.00 25.70 ? 348  TYR A CD1   1 
ATOM   2559  C  CD2   . TYR A  1  321 ? 27.481  14.244 67.871 1.00 25.74 ? 348  TYR A CD2   1 
ATOM   2560  C  CE1   . TYR A  1  321 ? 29.528  15.183 69.490 1.00 26.93 ? 348  TYR A CE1   1 
ATOM   2561  C  CE2   . TYR A  1  321 ? 27.457  15.566 68.315 1.00 26.39 ? 348  TYR A CE2   1 
ATOM   2562  C  CZ    . TYR A  1  321 ? 28.484  16.029 69.122 1.00 26.66 ? 348  TYR A CZ    1 
ATOM   2563  O  OH    . TYR A  1  321 ? 28.477  17.330 69.558 1.00 25.85 ? 348  TYR A OH    1 
ATOM   2564  N  N     . VAL A  1  322 ? 25.611  11.355 67.912 1.00 25.04 ? 349  VAL A N     1 
ATOM   2565  C  CA    . VAL A  1  322 ? 24.185  11.613 68.086 1.00 25.65 ? 349  VAL A CA    1 
ATOM   2566  C  C     . VAL A  1  322 ? 23.508  10.458 68.835 1.00 26.95 ? 349  VAL A C     1 
ATOM   2567  O  O     . VAL A  1  322 ? 22.721  10.696 69.747 1.00 27.53 ? 349  VAL A O     1 
ATOM   2568  C  CB    . VAL A  1  322 ? 23.481  11.911 66.738 1.00 25.01 ? 349  VAL A CB    1 
ATOM   2569  C  CG1   . VAL A  1  322 ? 21.972  12.010 66.923 1.00 25.83 ? 349  VAL A CG1   1 
ATOM   2570  C  CG2   . VAL A  1  322 ? 24.001  13.215 66.165 1.00 24.27 ? 349  VAL A CG2   1 
ATOM   2571  N  N     . GLN A  1  323 ? 23.846  9.221  68.468 1.00 27.65 ? 350  GLN A N     1 
ATOM   2572  C  CA    . GLN A  1  323 ? 23.374  8.035  69.196 1.00 28.79 ? 350  GLN A CA    1 
ATOM   2573  C  C     . GLN A  1  323 ? 23.594  8.172  70.707 1.00 29.24 ? 350  GLN A C     1 
ATOM   2574  O  O     . GLN A  1  323 ? 22.672  7.925  71.500 1.00 29.99 ? 350  GLN A O     1 
ATOM   2575  C  CB    . GLN A  1  323 ? 24.078  6.773  68.689 1.00 29.22 ? 350  GLN A CB    1 
ATOM   2576  C  CG    . GLN A  1  323 ? 23.585  5.472  69.336 1.00 30.88 ? 350  GLN A CG    1 
ATOM   2577  C  CD    . GLN A  1  323 ? 22.194  5.082  68.878 1.00 32.19 ? 350  GLN A CD    1 
ATOM   2578  O  OE1   . GLN A  1  323 ? 21.913  5.053  67.683 1.00 34.29 ? 350  GLN A OE1   1 
ATOM   2579  N  NE2   . GLN A  1  323 ? 21.320  4.778  69.823 1.00 32.89 ? 350  GLN A NE2   1 
ATOM   2580  N  N     . HIS A  1  324 ? 24.810  8.557  71.096 1.00 28.58 ? 351  HIS A N     1 
ATOM   2581  C  CA    . HIS A  1  324 ? 25.131  8.749  72.511 1.00 29.03 ? 351  HIS A CA    1 
ATOM   2582  C  C     . HIS A  1  324 ? 24.263  9.840  73.144 1.00 28.82 ? 351  HIS A C     1 
ATOM   2583  O  O     . HIS A  1  324 ? 23.643  9.620  74.185 1.00 29.23 ? 351  HIS A O     1 
ATOM   2584  C  CB    . HIS A  1  324 ? 26.616  9.074  72.729 1.00 28.46 ? 351  HIS A CB    1 
ATOM   2585  C  CG    . HIS A  1  324 ? 26.895  9.676  74.072 1.00 29.24 ? 351  HIS A CG    1 
ATOM   2586  N  ND1   . HIS A  1  324 ? 26.829  8.949  75.240 1.00 30.28 ? 351  HIS A ND1   1 
ATOM   2587  C  CD2   . HIS A  1  324 ? 27.192  10.945 74.437 1.00 30.07 ? 351  HIS A CD2   1 
ATOM   2588  C  CE1   . HIS A  1  324 ? 27.093  9.737  76.266 1.00 30.95 ? 351  HIS A CE1   1 
ATOM   2589  N  NE2   . HIS A  1  324 ? 27.320  10.954 75.806 1.00 30.43 ? 351  HIS A NE2   1 
ATOM   2590  N  N     . LEU A  1  325 ? 24.232  11.007 72.505 1.00 28.33 ? 352  LEU A N     1 
ATOM   2591  C  CA    . LEU A  1  325 ? 23.457  12.161 72.979 1.00 28.78 ? 352  LEU A CA    1 
ATOM   2592  C  C     . LEU A  1  325 ? 21.980  11.862 73.174 1.00 29.08 ? 352  LEU A C     1 
ATOM   2593  O  O     . LEU A  1  325 ? 21.367  12.312 74.144 1.00 29.54 ? 352  LEU A O     1 
ATOM   2594  C  CB    . LEU A  1  325 ? 23.569  13.318 71.984 1.00 28.01 ? 352  LEU A CB    1 
ATOM   2595  C  CG    . LEU A  1  325 ? 24.761  14.243 72.134 1.00 29.13 ? 352  LEU A CG    1 
ATOM   2596  C  CD1   . LEU A  1  325 ? 24.716  15.333 71.047 1.00 27.96 ? 352  LEU A CD1   1 
ATOM   2597  C  CD2   . LEU A  1  325 ? 24.793  14.852 73.546 1.00 30.44 ? 352  LEU A CD2   1 
ATOM   2598  N  N     . SER A  1  326 ? 21.427  11.119 72.221 1.00 28.98 ? 353  SER A N     1 
ATOM   2599  C  CA    . SER A  1  326 ? 20.014  10.813 72.157 1.00 29.45 ? 353  SER A CA    1 
ATOM   2600  C  C     . SER A  1  326 ? 19.539  10.007 73.370 1.00 30.55 ? 353  SER A C     1 
ATOM   2601  O  O     . SER A  1  326 ? 18.461  10.255 73.893 1.00 31.11 ? 353  SER A O     1 
ATOM   2602  C  CB    . SER A  1  326 ? 19.720  10.039 70.866 1.00 29.53 ? 353  SER A CB    1 
ATOM   2603  O  OG    . SER A  1  326 ? 20.119  8.674  70.965 1.00 30.18 ? 353  SER A OG    1 
ATOM   2604  N  N     . GLY A  1  327 ? 20.349  9.042  73.801 1.00 30.86 ? 354  GLY A N     1 
ATOM   2605  C  CA    . GLY A  1  327 ? 19.952  8.115  74.863 1.00 32.07 ? 354  GLY A CA    1 
ATOM   2606  C  C     . GLY A  1  327 ? 18.971  7.057  74.375 1.00 32.96 ? 354  GLY A C     1 
ATOM   2607  O  O     . GLY A  1  327 ? 18.414  6.307  75.173 1.00 34.07 ? 354  GLY A O     1 
ATOM   2608  N  N     . TYR A  1  328 ? 18.754  6.991  73.064 1.00 32.68 ? 355  TYR A N     1 
ATOM   2609  C  CA    . TYR A  1  328 ? 17.793  6.045  72.513 1.00 33.91 ? 355  TYR A CA    1 
ATOM   2610  C  C     . TYR A  1  328 ? 18.326  4.623  72.587 1.00 34.95 ? 355  TYR A C     1 
ATOM   2611  O  O     . TYR A  1  328 ? 19.541  4.392  72.493 1.00 34.34 ? 355  TYR A O     1 
ATOM   2612  C  CB    . TYR A  1  328 ? 17.458  6.346  71.052 1.00 33.23 ? 355  TYR A CB    1 
ATOM   2613  C  CG    . TYR A  1  328 ? 16.903  7.728  70.732 1.00 34.20 ? 355  TYR A CG    1 
ATOM   2614  C  CD1   . TYR A  1  328 ? 16.254  8.505  71.695 1.00 34.13 ? 355  TYR A CD1   1 
ATOM   2615  C  CD2   . TYR A  1  328 ? 16.999  8.234  69.434 1.00 34.44 ? 355  TYR A CD2   1 
ATOM   2616  C  CE1   . TYR A  1  328 ? 15.733  9.757  71.376 1.00 33.99 ? 355  TYR A CE1   1 
ATOM   2617  C  CE2   . TYR A  1  328 ? 16.488  9.485  69.106 1.00 35.38 ? 355  TYR A CE2   1 
ATOM   2618  C  CZ    . TYR A  1  328 ? 15.856  10.237 70.081 1.00 34.70 ? 355  TYR A CZ    1 
ATOM   2619  O  OH    . TYR A  1  328 ? 15.356  11.471 69.742 1.00 35.31 ? 355  TYR A OH    1 
ATOM   2620  N  N     . HIS A  1  329 ? 17.400  3.685  72.747 1.00 36.22 ? 356  HIS A N     1 
ATOM   2621  C  CA    . HIS A  1  329 ? 17.678  2.264  72.606 1.00 37.77 ? 356  HIS A CA    1 
ATOM   2622  C  C     . HIS A  1  329 ? 17.696  1.865  71.133 1.00 37.64 ? 356  HIS A C     1 
ATOM   2623  O  O     . HIS A  1  329 ? 18.378  0.916  70.752 1.00 38.06 ? 356  HIS A O     1 
ATOM   2624  C  CB    . HIS A  1  329 ? 16.630  1.443  73.347 1.00 39.28 ? 356  HIS A CB    1 
ATOM   2625  C  CG    . HIS A  1  329 ? 16.725  1.545  74.835 1.00 41.19 ? 356  HIS A CG    1 
ATOM   2626  N  ND1   . HIS A  1  329 ? 17.932  1.541  75.506 1.00 42.06 ? 356  HIS A ND1   1 
ATOM   2627  C  CD2   . HIS A  1  329 ? 15.765  1.663  75.784 1.00 42.87 ? 356  HIS A CD2   1 
ATOM   2628  C  CE1   . HIS A  1  329 ? 17.709  1.656  76.803 1.00 43.39 ? 356  HIS A CE1   1 
ATOM   2629  N  NE2   . HIS A  1  329 ? 16.403  1.731  76.999 1.00 44.08 ? 356  HIS A NE2   1 
ATOM   2630  N  N     . PHE A  1  330 ? 16.938  2.592  70.317 1.00 37.05 ? 357  PHE A N     1 
ATOM   2631  C  CA    . PHE A  1  330 ? 16.964  2.412  68.872 1.00 37.00 ? 357  PHE A CA    1 
ATOM   2632  C  C     . PHE A  1  330 ? 18.322  2.837  68.316 1.00 35.99 ? 357  PHE A C     1 
ATOM   2633  O  O     . PHE A  1  330 ? 18.856  3.894  68.685 1.00 34.61 ? 357  PHE A O     1 
ATOM   2634  C  CB    . PHE A  1  330 ? 15.841  3.210  68.196 1.00 36.42 ? 357  PHE A CB    1 
ATOM   2635  C  CG    . PHE A  1  330 ? 15.941  3.240  66.694 1.00 36.72 ? 357  PHE A CG    1 
ATOM   2636  C  CD1   . PHE A  1  330 ? 15.749  2.075  65.940 1.00 37.27 ? 357  PHE A CD1   1 
ATOM   2637  C  CD2   . PHE A  1  330 ? 16.231  4.429  66.028 1.00 34.74 ? 357  PHE A CD2   1 
ATOM   2638  C  CE1   . PHE A  1  330 ? 15.844  2.097  64.547 1.00 36.44 ? 357  PHE A CE1   1 
ATOM   2639  C  CE2   . PHE A  1  330 ? 16.331  4.462  64.632 1.00 35.53 ? 357  PHE A CE2   1 
ATOM   2640  C  CZ    . PHE A  1  330 ? 16.135  3.289  63.892 1.00 36.78 ? 357  PHE A CZ    1 
ATOM   2641  N  N     . LYS A  1  331 ? 18.873  2.008  67.433 1.00 36.33 ? 358  LYS A N     1 
ATOM   2642  C  CA    . LYS A  1  331 ? 20.160  2.302  66.805 1.00 35.83 ? 358  LYS A CA    1 
ATOM   2643  C  C     . LYS A  1  331 ? 20.007  3.131  65.534 1.00 34.52 ? 358  LYS A C     1 
ATOM   2644  O  O     . LYS A  1  331 ? 19.593  2.620  64.488 1.00 34.70 ? 358  LYS A O     1 
ATOM   2645  C  CB    . LYS A  1  331 ? 20.918  1.009  66.503 1.00 36.83 ? 358  LYS A CB    1 
ATOM   2646  C  CG    . LYS A  1  331 ? 21.908  0.595  67.577 1.00 39.47 ? 358  LYS A CG    1 
ATOM   2647  C  CD    . LYS A  1  331 ? 22.503  -0.778 67.264 1.00 44.31 ? 358  LYS A CD    1 
ATOM   2648  C  CE    . LYS A  1  331 ? 23.409  -0.748 66.018 1.00 45.65 ? 358  LYS A CE    1 
ATOM   2649  N  NZ    . LYS A  1  331 ? 23.885  -2.132 65.669 1.00 49.52 ? 358  LYS A NZ    1 
ATOM   2650  N  N     . LEU A  1  332 ? 20.342  4.414  65.639 1.00 33.31 ? 359  LEU A N     1 
ATOM   2651  C  CA    . LEU A  1  332 ? 20.340  5.319  64.491 1.00 32.57 ? 359  LEU A CA    1 
ATOM   2652  C  C     . LEU A  1  332 ? 21.307  4.825  63.420 1.00 32.33 ? 359  LEU A C     1 
ATOM   2653  O  O     . LEU A  1  332 ? 22.301  4.172  63.726 1.00 32.21 ? 359  LEU A O     1 
ATOM   2654  C  CB    . LEU A  1  332 ? 20.717  6.740  64.915 1.00 31.50 ? 359  LEU A CB    1 
ATOM   2655  C  CG    . LEU A  1  332 ? 19.891  7.402  66.015 1.00 31.84 ? 359  LEU A CG    1 
ATOM   2656  C  CD1   . LEU A  1  332 ? 20.616  8.628  66.531 1.00 31.23 ? 359  LEU A CD1   1 
ATOM   2657  C  CD2   . LEU A  1  332 ? 18.486  7.753  65.532 1.00 32.07 ? 359  LEU A CD2   1 
ATOM   2658  N  N     . LYS A  1  333 ? 21.004  5.144  62.165 1.00 32.19 ? 360  LYS A N     1 
ATOM   2659  C  CA    . LYS A  1  333 ? 21.736  4.597  61.030 1.00 32.17 ? 360  LYS A CA    1 
ATOM   2660  C  C     . LYS A  1  333 ? 22.070  5.696  60.028 1.00 31.16 ? 360  LYS A C     1 
ATOM   2661  O  O     . LYS A  1  333 ? 21.210  6.522  59.707 1.00 31.16 ? 360  LYS A O     1 
ATOM   2662  C  CB    . LYS A  1  333 ? 20.886  3.520  60.352 1.00 33.15 ? 360  LYS A CB    1 
ATOM   2663  C  CG    . LYS A  1  333 ? 21.548  2.829  59.182 1.00 34.70 ? 360  LYS A CG    1 
ATOM   2664  C  CD    . LYS A  1  333 ? 20.594  1.849  58.518 1.00 37.27 ? 360  LYS A CD    1 
ATOM   2665  C  CE    . LYS A  1  333 ? 21.333  0.983  57.512 1.00 39.46 ? 360  LYS A CE    1 
ATOM   2666  N  NZ    . LYS A  1  333 ? 20.405  0.137  56.710 1.00 40.88 ? 360  LYS A NZ    1 
ATOM   2667  N  N     . PHE A  1  334 ? 23.313  5.705  59.548 1.00 30.25 ? 361  PHE A N     1 
ATOM   2668  C  CA    . PHE A  1  334 ? 23.693  6.553  58.423 1.00 29.11 ? 361  PHE A CA    1 
ATOM   2669  C  C     . PHE A  1  334 ? 23.507  5.770  57.128 1.00 29.95 ? 361  PHE A C     1 
ATOM   2670  O  O     . PHE A  1  334 ? 24.258  4.829  56.841 1.00 30.19 ? 361  PHE A O     1 
ATOM   2671  C  CB    . PHE A  1  334 ? 25.132  7.059  58.560 1.00 28.25 ? 361  PHE A CB    1 
ATOM   2672  C  CG    . PHE A  1  334 ? 25.641  7.796  57.343 1.00 27.26 ? 361  PHE A CG    1 
ATOM   2673  C  CD1   . PHE A  1  334 ? 24.867  8.786  56.724 1.00 25.99 ? 361  PHE A CD1   1 
ATOM   2674  C  CD2   . PHE A  1  334 ? 26.893  7.501  56.816 1.00 26.82 ? 361  PHE A CD2   1 
ATOM   2675  C  CE1   . PHE A  1  334 ? 25.331  9.462  55.601 1.00 25.58 ? 361  PHE A CE1   1 
ATOM   2676  C  CE2   . PHE A  1  334 ? 27.373  8.181  55.694 1.00 26.74 ? 361  PHE A CE2   1 
ATOM   2677  C  CZ    . PHE A  1  334 ? 26.589  9.161  55.083 1.00 25.50 ? 361  PHE A CZ    1 
ATOM   2678  N  N     . ASP A  1  335 ? 22.475  6.146  56.372 1.00 30.11 ? 362  ASP A N     1 
ATOM   2679  C  CA    . ASP A  1  335 ? 22.147  5.504  55.100 1.00 30.89 ? 362  ASP A CA    1 
ATOM   2680  C  C     . ASP A  1  335 ? 21.434  6.502  54.178 1.00 30.62 ? 362  ASP A C     1 
ATOM   2681  O  O     . ASP A  1  335 ? 20.211  6.655  54.256 1.00 30.82 ? 362  ASP A O     1 
ATOM   2682  C  CB    . ASP A  1  335 ? 21.286  4.250  55.321 1.00 32.25 ? 362  ASP A CB    1 
ATOM   2683  C  CG    . ASP A  1  335 ? 21.038  3.465  54.030 1.00 33.59 ? 362  ASP A CG    1 
ATOM   2684  O  OD1   . ASP A  1  335 ? 21.574  3.842  52.963 1.00 33.42 ? 362  ASP A OD1   1 
ATOM   2685  O  OD2   . ASP A  1  335 ? 20.303  2.461  54.087 1.00 35.32 ? 362  ASP A OD2   1 
ATOM   2686  N  N     . PRO A  1  336 ? 22.208  7.200  53.315 1.00 29.99 ? 363  PRO A N     1 
ATOM   2687  C  CA    . PRO A  1  336 ? 21.682  8.170  52.350 1.00 29.99 ? 363  PRO A CA    1 
ATOM   2688  C  C     . PRO A  1  336 ? 20.518  7.622  51.521 1.00 31.32 ? 363  PRO A C     1 
ATOM   2689  O  O     . PRO A  1  336 ? 19.631  8.376  51.140 1.00 31.54 ? 363  PRO A O     1 
ATOM   2690  C  CB    . PRO A  1  336 ? 22.893  8.453  51.455 1.00 29.51 ? 363  PRO A CB    1 
ATOM   2691  C  CG    . PRO A  1  336 ? 24.053  8.302  52.377 1.00 28.47 ? 363  PRO A CG    1 
ATOM   2692  C  CD    . PRO A  1  336 ? 23.682  7.145  53.275 1.00 29.22 ? 363  PRO A CD    1 
ATOM   2693  N  N     . GLU A  1  337 ? 20.532  6.314  51.278 1.00 32.57 ? 364  GLU A N     1 
ATOM   2694  C  CA    . GLU A  1  337 ? 19.517  5.611  50.499 1.00 34.58 ? 364  GLU A CA    1 
ATOM   2695  C  C     . GLU A  1  337 ? 18.095  5.781  51.043 1.00 35.10 ? 364  GLU A C     1 
ATOM   2696  O  O     . GLU A  1  337 ? 17.128  5.775  50.281 1.00 35.72 ? 364  GLU A O     1 
ATOM   2697  C  CB    . GLU A  1  337 ? 19.868  4.128  50.481 1.00 35.83 ? 364  GLU A CB    1 
ATOM   2698  C  CG    . GLU A  1  337 ? 19.764  3.453  49.153 1.00 39.35 ? 364  GLU A CG    1 
ATOM   2699  C  CD    . GLU A  1  337 ? 20.398  2.079  49.190 1.00 43.40 ? 364  GLU A CD    1 
ATOM   2700  O  OE1   . GLU A  1  337 ? 21.550  1.950  48.718 1.00 44.12 ? 364  GLU A OE1   1 
ATOM   2701  O  OE2   . GLU A  1  337 ? 19.760  1.141  49.726 1.00 45.76 ? 364  GLU A OE2   1 
ATOM   2702  N  N     . LEU A  1  338 ? 17.976  5.926  52.360 1.00 34.63 ? 365  LEU A N     1 
ATOM   2703  C  CA    . LEU A  1  338 ? 16.684  6.135  53.014 1.00 35.54 ? 365  LEU A CA    1 
ATOM   2704  C  C     . LEU A  1  338 ? 15.930  7.367  52.512 1.00 35.35 ? 365  LEU A C     1 
ATOM   2705  O  O     . LEU A  1  338 ? 14.712  7.447  52.651 1.00 36.15 ? 365  LEU A O     1 
ATOM   2706  C  CB    . LEU A  1  338 ? 16.861  6.242  54.532 1.00 35.22 ? 365  LEU A CB    1 
ATOM   2707  C  CG    . LEU A  1  338 ? 17.481  5.066  55.291 1.00 36.01 ? 365  LEU A CG    1 
ATOM   2708  C  CD1   . LEU A  1  338 ? 17.740  5.490  56.721 1.00 36.31 ? 365  LEU A CD1   1 
ATOM   2709  C  CD2   . LEU A  1  338 ? 16.600  3.828  55.242 1.00 37.19 ? 365  LEU A CD2   1 
ATOM   2710  N  N     . LEU A  1  339 ? 16.650  8.330  51.940 1.00 34.22 ? 366  LEU A N     1 
ATOM   2711  C  CA    . LEU A  1  339 ? 16.012  9.550  51.453 1.00 34.00 ? 366  LEU A CA    1 
ATOM   2712  C  C     . LEU A  1  339 ? 15.773  9.567  49.942 1.00 34.63 ? 366  LEU A C     1 
ATOM   2713  O  O     . LEU A  1  339 ? 15.111  10.474 49.444 1.00 34.57 ? 366  LEU A O     1 
ATOM   2714  C  CB    . LEU A  1  339 ? 16.814  10.790 51.876 1.00 32.45 ? 366  LEU A CB    1 
ATOM   2715  C  CG    . LEU A  1  339 ? 16.939  11.086 53.376 1.00 31.73 ? 366  LEU A CG    1 
ATOM   2716  C  CD1   . LEU A  1  339 ? 17.936  12.211 53.609 1.00 31.37 ? 366  LEU A CD1   1 
ATOM   2717  C  CD2   . LEU A  1  339 ? 15.589  11.418 54.011 1.00 32.63 ? 366  LEU A CD2   1 
ATOM   2718  N  N     . PHE A  1  340 ? 16.288  8.566  49.223 1.00 35.22 ? 367  PHE A N     1 
ATOM   2719  C  CA    . PHE A  1  340 ? 16.258  8.581  47.751 1.00 35.98 ? 367  PHE A CA    1 
ATOM   2720  C  C     . PHE A  1  340 ? 14.857  8.608  47.129 1.00 38.00 ? 367  PHE A C     1 
ATOM   2721  O  O     . PHE A  1  340 ? 14.688  9.063  45.993 1.00 38.59 ? 367  PHE A O     1 
ATOM   2722  C  CB    . PHE A  1  340 ? 17.088  7.440  47.145 1.00 36.01 ? 367  PHE A CB    1 
ATOM   2723  C  CG    . PHE A  1  340 ? 18.575  7.593  47.332 1.00 33.29 ? 367  PHE A CG    1 
ATOM   2724  C  CD1   . PHE A  1  340 ? 19.130  8.793  47.792 1.00 31.37 ? 367  PHE A CD1   1 
ATOM   2725  C  CD2   . PHE A  1  340 ? 19.430  6.544  47.006 1.00 32.19 ? 367  PHE A CD2   1 
ATOM   2726  C  CE1   . PHE A  1  340 ? 20.510  8.928  47.960 1.00 28.75 ? 367  PHE A CE1   1 
ATOM   2727  C  CE2   . PHE A  1  340 ? 20.810  6.671  47.165 1.00 30.52 ? 367  PHE A CE2   1 
ATOM   2728  C  CZ    . PHE A  1  340 ? 21.348  7.870  47.640 1.00 29.36 ? 367  PHE A CZ    1 
ATOM   2729  N  N     . ASN A  1  341 ? 13.861  8.106  47.853 1.00 39.48 ? 368  ASN A N     1 
ATOM   2730  C  CA    . ASN A  1  341 ? 12.476  8.195  47.379 1.00 41.60 ? 368  ASN A CA    1 
ATOM   2731  C  C     . ASN A  1  341 ? 11.657  9.233  48.162 1.00 41.34 ? 368  ASN A C     1 
ATOM   2732  O  O     . ASN A  1  341 ? 10.423  9.222  48.140 1.00 42.50 ? 368  ASN A O     1 
ATOM   2733  C  CB    . ASN A  1  341 ? 11.807  6.809  47.335 1.00 43.18 ? 368  ASN A CB    1 
ATOM   2734  C  CG    . ASN A  1  341 ? 11.298  6.340  48.693 1.00 45.12 ? 368  ASN A CG    1 
ATOM   2735  O  OD1   . ASN A  1  341 ? 11.854  6.675  49.743 1.00 45.76 ? 368  ASN A OD1   1 
ATOM   2736  N  ND2   . ASN A  1  341 ? 10.228  5.549  48.672 1.00 47.70 ? 368  ASN A ND2   1 
ATOM   2737  N  N     . GLN A  1  342 ? 12.372  10.126 48.847 1.00 39.86 ? 369  GLN A N     1 
ATOM   2738  C  CA    . GLN A  1  342 ? 11.767  11.183 49.654 1.00 39.64 ? 369  GLN A CA    1 
ATOM   2739  C  C     . GLN A  1  342 ? 12.059  12.542 49.038 1.00 38.53 ? 369  GLN A C     1 
ATOM   2740  O  O     . GLN A  1  342 ? 12.896  12.662 48.146 1.00 38.09 ? 369  GLN A O     1 
ATOM   2741  C  CB    . GLN A  1  342 ? 12.307  11.149 51.096 1.00 38.81 ? 369  GLN A CB    1 
ATOM   2742  C  CG    . GLN A  1  342 ? 11.989  9.865  51.860 1.00 40.88 ? 369  GLN A CG    1 
ATOM   2743  C  CD    . GLN A  1  342 ? 10.494  9.614  51.999 1.00 43.77 ? 369  GLN A CD    1 
ATOM   2744  O  OE1   . GLN A  1  342 ? 9.771   10.415 52.593 1.00 44.64 ? 369  GLN A OE1   1 
ATOM   2745  N  NE2   . GLN A  1  342 ? 10.025  8.492  51.451 1.00 45.16 ? 369  GLN A NE2   1 
ATOM   2746  N  N     . GLN A  1  343 ? 11.358  13.561 49.519 1.00 38.21 ? 370  GLN A N     1 
ATOM   2747  C  CA    . GLN A  1  343 ? 11.629  14.932 49.130 1.00 37.22 ? 370  GLN A CA    1 
ATOM   2748  C  C     . GLN A  1  343 ? 12.623  15.523 50.115 1.00 35.19 ? 370  GLN A C     1 
ATOM   2749  O  O     . GLN A  1  343 ? 12.363  15.572 51.321 1.00 35.42 ? 370  GLN A O     1 
ATOM   2750  C  CB    . GLN A  1  343 ? 10.337  15.740 49.113 1.00 38.07 ? 370  GLN A CB    1 
ATOM   2751  C  CG    . GLN A  1  343 ? 9.486   15.489 47.893 1.00 40.78 ? 370  GLN A CG    1 
ATOM   2752  C  CD    . GLN A  1  343 ? 8.223   16.323 47.898 1.00 43.11 ? 370  GLN A CD    1 
ATOM   2753  O  OE1   . GLN A  1  343 ? 7.385   16.191 48.789 1.00 45.33 ? 370  GLN A OE1   1 
ATOM   2754  N  NE2   . GLN A  1  343 ? 8.078   17.184 46.903 1.00 43.47 ? 370  GLN A NE2   1 
ATOM   2755  N  N     . PHE A  1  344 ? 13.774  15.944 49.602 1.00 33.34 ? 371  PHE A N     1 
ATOM   2756  C  CA    . PHE A  1  344 ? 14.861  16.433 50.433 1.00 30.87 ? 371  PHE A CA    1 
ATOM   2757  C  C     . PHE A  1  344 ? 15.787  17.293 49.584 1.00 29.54 ? 371  PHE A C     1 
ATOM   2758  O  O     . PHE A  1  344 ? 16.042  16.983 48.415 1.00 30.00 ? 371  PHE A O     1 
ATOM   2759  C  CB    . PHE A  1  344 ? 15.629  15.252 51.038 1.00 30.92 ? 371  PHE A CB    1 
ATOM   2760  C  CG    . PHE A  1  344 ? 16.639  15.645 52.082 1.00 30.48 ? 371  PHE A CG    1 
ATOM   2761  C  CD1   . PHE A  1  344 ? 16.231  16.022 53.363 1.00 31.22 ? 371  PHE A CD1   1 
ATOM   2762  C  CD2   . PHE A  1  344 ? 18.000  15.611 51.795 1.00 29.91 ? 371  PHE A CD2   1 
ATOM   2763  C  CE1   . PHE A  1  344 ? 17.165  16.377 54.337 1.00 30.86 ? 371  PHE A CE1   1 
ATOM   2764  C  CE2   . PHE A  1  344 ? 18.948  15.969 52.763 1.00 30.09 ? 371  PHE A CE2   1 
ATOM   2765  C  CZ    . PHE A  1  344 ? 18.530  16.353 54.034 1.00 30.00 ? 371  PHE A CZ    1 
ATOM   2766  N  N     . GLN A  1  345 ? 16.272  18.380 50.175 1.00 27.24 ? 372  GLN A N     1 
ATOM   2767  C  CA    . GLN A  1  345 ? 17.161  19.307 49.498 1.00 25.34 ? 372  GLN A CA    1 
ATOM   2768  C  C     . GLN A  1  345 ? 18.572  19.027 49.967 1.00 24.11 ? 372  GLN A C     1 
ATOM   2769  O  O     . GLN A  1  345 ? 18.864  19.153 51.162 1.00 23.49 ? 372  GLN A O     1 
ATOM   2770  C  CB    . GLN A  1  345 ? 16.781  20.767 49.813 1.00 25.14 ? 372  GLN A CB    1 
ATOM   2771  C  CG    . GLN A  1  345 ? 15.405  21.193 49.310 1.00 24.75 ? 372  GLN A CG    1 
ATOM   2772  C  CD    . GLN A  1  345 ? 15.273  21.131 47.796 1.00 25.00 ? 372  GLN A CD    1 
ATOM   2773  O  OE1   . GLN A  1  345 ? 16.093  21.694 47.059 1.00 24.43 ? 372  GLN A OE1   1 
ATOM   2774  N  NE2   . GLN A  1  345 ? 14.234  20.452 47.323 1.00 24.18 ? 372  GLN A NE2   1 
ATOM   2775  N  N     . TYR A  1  346 ? 19.433  18.628 49.032 1.00 23.05 ? 373  TYR A N     1 
ATOM   2776  C  CA    . TYR A  1  346 ? 20.843  18.401 49.324 1.00 22.51 ? 373  TYR A CA    1 
ATOM   2777  C  C     . TYR A  1  346 ? 21.602  19.724 49.317 1.00 22.37 ? 373  TYR A C     1 
ATOM   2778  O  O     . TYR A  1  346 ? 22.349  20.024 48.391 1.00 21.80 ? 373  TYR A O     1 
ATOM   2779  C  CB    . TYR A  1  346 ? 21.442  17.378 48.346 1.00 22.56 ? 373  TYR A CB    1 
ATOM   2780  C  CG    . TYR A  1  346 ? 20.813  16.017 48.515 1.00 23.17 ? 373  TYR A CG    1 
ATOM   2781  C  CD1   . TYR A  1  346 ? 21.191  15.190 49.574 1.00 22.79 ? 373  TYR A CD1   1 
ATOM   2782  C  CD2   . TYR A  1  346 ? 19.811  15.574 47.653 1.00 24.44 ? 373  TYR A CD2   1 
ATOM   2783  C  CE1   . TYR A  1  346 ? 20.604  13.951 49.759 1.00 23.41 ? 373  TYR A CE1   1 
ATOM   2784  C  CE2   . TYR A  1  346 ? 19.208  14.319 47.828 1.00 24.02 ? 373  TYR A CE2   1 
ATOM   2785  C  CZ    . TYR A  1  346 ? 19.614  13.523 48.889 1.00 24.73 ? 373  TYR A CZ    1 
ATOM   2786  O  OH    . TYR A  1  346 ? 19.050  12.290 49.096 1.00 25.58 ? 373  TYR A OH    1 
ATOM   2787  N  N     . GLN A  1  347 ? 21.356  20.514 50.359 1.00 22.62 ? 374  GLN A N     1 
ATOM   2788  C  CA    . GLN A  1  347 ? 22.004  21.801 50.579 1.00 22.86 ? 374  GLN A CA    1 
ATOM   2789  C  C     . GLN A  1  347 ? 21.771  22.190 52.031 1.00 22.58 ? 374  GLN A C     1 
ATOM   2790  O  O     . GLN A  1  347 ? 20.885  21.633 52.695 1.00 23.06 ? 374  GLN A O     1 
ATOM   2791  C  CB    . GLN A  1  347 ? 21.462  22.891 49.631 1.00 23.14 ? 374  GLN A CB    1 
ATOM   2792  C  CG    . GLN A  1  347 ? 19.956  23.141 49.718 1.00 26.47 ? 374  GLN A CG    1 
ATOM   2793  C  CD    . GLN A  1  347 ? 19.495  24.274 48.806 1.00 30.83 ? 374  GLN A CD    1 
ATOM   2794  O  OE1   . GLN A  1  347 ? 19.562  25.452 49.171 1.00 31.51 ? 374  GLN A OE1   1 
ATOM   2795  N  NE2   . GLN A  1  347 ? 19.009  23.919 47.620 1.00 31.82 ? 374  GLN A NE2   1 
ATOM   2796  N  N     . ASN A  1  348 ? 22.559  23.147 52.511 1.00 21.75 ? 375  ASN A N     1 
ATOM   2797  C  CA    . ASN A  1  348 ? 22.490  23.606 53.892 1.00 21.43 ? 375  ASN A CA    1 
ATOM   2798  C  C     . ASN A  1  348 ? 23.086  24.998 54.005 1.00 20.71 ? 375  ASN A C     1 
ATOM   2799  O  O     . ASN A  1  348 ? 24.003  25.354 53.259 1.00 20.72 ? 375  ASN A O     1 
ATOM   2800  C  CB    . ASN A  1  348 ? 23.236  22.633 54.824 1.00 21.30 ? 375  ASN A CB    1 
ATOM   2801  C  CG    . ASN A  1  348 ? 23.007  22.929 56.308 1.00 21.74 ? 375  ASN A CG    1 
ATOM   2802  O  OD1   . ASN A  1  348 ? 21.871  23.063 56.761 1.00 22.72 ? 375  ASN A OD1   1 
ATOM   2803  N  ND2   . ASN A  1  348 ? 24.095  23.019 57.067 1.00 20.49 ? 375  ASN A ND2   1 
ATOM   2804  N  N     . ARG A  1  349 ? 22.530  25.780 54.918 1.00 20.27 ? 376  ARG A N     1 
ATOM   2805  C  CA    . ARG A  1  349 ? 23.075  27.068 55.324 1.00 19.79 ? 376  ARG A CA    1 
ATOM   2806  C  C     . ARG A  1  349 ? 23.049  27.046 56.846 1.00 19.59 ? 376  ARG A C     1 
ATOM   2807  O  O     . ARG A  1  349 ? 22.004  26.763 57.438 1.00 20.19 ? 376  ARG A O     1 
ATOM   2808  C  CB    . ARG A  1  349 ? 22.211  28.214 54.787 1.00 19.87 ? 376  ARG A CB    1 
ATOM   2809  C  CG    . ARG A  1  349 ? 22.895  29.601 54.787 1.00 19.27 ? 376  ARG A CG    1 
ATOM   2810  C  CD    . ARG A  1  349 ? 23.949  29.746 53.661 1.00 18.59 ? 376  ARG A CD    1 
ATOM   2811  N  NE    . ARG A  1  349 ? 23.379  29.589 52.317 1.00 18.32 ? 376  ARG A NE    1 
ATOM   2812  C  CZ    . ARG A  1  349 ? 22.734  30.548 51.655 1.00 17.93 ? 376  ARG A CZ    1 
ATOM   2813  N  NH1   . ARG A  1  349 ? 22.575  31.752 52.201 1.00 18.04 ? 376  ARG A NH1   1 
ATOM   2814  N  NH2   . ARG A  1  349 ? 22.242  30.307 50.445 1.00 17.18 ? 376  ARG A NH2   1 
ATOM   2815  N  N     . ILE A  1  350 ? 24.194  27.311 57.474 1.00 18.90 ? 377  ILE A N     1 
ATOM   2816  C  CA    . ILE A  1  350 ? 24.315  27.224 58.929 1.00 18.67 ? 377  ILE A CA    1 
ATOM   2817  C  C     . ILE A  1  350 ? 23.528  28.357 59.614 1.00 18.98 ? 377  ILE A C     1 
ATOM   2818  O  O     . ILE A  1  350 ? 23.758  29.529 59.342 1.00 18.91 ? 377  ILE A O     1 
ATOM   2819  C  CB    . ILE A  1  350 ? 25.815  27.218 59.404 1.00 18.39 ? 377  ILE A CB    1 
ATOM   2820  C  CG1   . ILE A  1  350 ? 26.579  25.987 58.870 1.00 18.16 ? 377  ILE A CG1   1 
ATOM   2821  C  CG2   . ILE A  1  350 ? 25.906  27.286 60.918 1.00 17.59 ? 377  ILE A CG2   1 
ATOM   2822  C  CD1   . ILE A  1  350 ? 26.114  24.614 59.424 1.00 18.13 ? 377  ILE A CD1   1 
ATOM   2823  N  N     . ALA A  1  351 ? 22.609  27.983 60.499 1.00 19.20 ? 378  ALA A N     1 
ATOM   2824  C  CA    . ALA A  1  351 ? 21.797  28.939 61.248 1.00 19.81 ? 378  ALA A CA    1 
ATOM   2825  C  C     . ALA A  1  351 ? 22.505  29.506 62.469 1.00 19.97 ? 378  ALA A C     1 
ATOM   2826  O  O     . ALA A  1  351 ? 23.132  28.775 63.236 1.00 19.80 ? 378  ALA A O     1 
ATOM   2827  C  CB    . ALA A  1  351 ? 20.467  28.294 61.666 1.00 20.23 ? 378  ALA A CB    1 
ATOM   2828  N  N     . SER A  1  352 ? 22.393  30.821 62.636 1.00 21.00 ? 379  SER A N     1 
ATOM   2829  C  CA    . SER A  1  352 ? 22.879  31.516 63.818 1.00 21.27 ? 379  SER A CA    1 
ATOM   2830  C  C     . SER A  1  352 ? 22.433  30.845 65.120 1.00 21.37 ? 379  SER A C     1 
ATOM   2831  O  O     . SER A  1  352 ? 23.235  30.682 66.038 1.00 21.62 ? 379  SER A O     1 
ATOM   2832  C  CB    . SER A  1  352 ? 22.404  32.968 63.804 1.00 21.99 ? 379  SER A CB    1 
ATOM   2833  O  OG    . SER A  1  352 ? 22.840  33.644 64.971 1.00 22.98 ? 379  SER A OG    1 
ATOM   2834  N  N     . GLU A  1  353 ? 21.163  30.455 65.192 1.00 21.22 ? 380  GLU A N     1 
ATOM   2835  C  CA    . GLU A  1  353 ? 20.611  29.841 66.398 1.00 21.72 ? 380  GLU A CA    1 
ATOM   2836  C  C     . GLU A  1  353 ? 21.198  28.455 66.688 1.00 21.21 ? 380  GLU A C     1 
ATOM   2837  O  O     . GLU A  1  353 ? 21.243  28.029 67.848 1.00 20.83 ? 380  GLU A O     1 
ATOM   2838  C  CB    . GLU A  1  353 ? 19.079  29.753 66.331 1.00 21.95 ? 380  GLU A CB    1 
ATOM   2839  C  CG    . GLU A  1  353 ? 18.383  31.088 66.155 1.00 22.66 ? 380  GLU A CG    1 
ATOM   2840  C  CD    . GLU A  1  353 ? 18.048  31.415 64.700 1.00 22.69 ? 380  GLU A CD    1 
ATOM   2841  O  OE1   . GLU A  1  353 ? 18.745  30.907 63.793 1.00 21.66 ? 380  GLU A OE1   1 
ATOM   2842  O  OE2   . GLU A  1  353 ? 17.081  32.187 64.471 1.00 21.72 ? 380  GLU A OE2   1 
ATOM   2843  N  N     . PHE A  1  354 ? 21.618  27.753 65.633 1.00 20.69 ? 381  PHE A N     1 
ATOM   2844  C  CA    . PHE A  1  354 ? 22.299  26.457 65.762 1.00 20.63 ? 381  PHE A CA    1 
ATOM   2845  C  C     . PHE A  1  354 ? 23.639  26.643 66.466 1.00 20.75 ? 381  PHE A C     1 
ATOM   2846  O  O     . PHE A  1  354 ? 23.992  25.887 67.380 1.00 20.72 ? 381  PHE A O     1 
ATOM   2847  C  CB    . PHE A  1  354 ? 22.505  25.826 64.378 1.00 20.29 ? 381  PHE A CB    1 
ATOM   2848  C  CG    . PHE A  1  354 ? 23.000  24.399 64.409 1.00 20.15 ? 381  PHE A CG    1 
ATOM   2849  C  CD1   . PHE A  1  354 ? 22.646  23.533 65.447 1.00 19.68 ? 381  PHE A CD1   1 
ATOM   2850  C  CD2   . PHE A  1  354 ? 23.772  23.904 63.363 1.00 19.64 ? 381  PHE A CD2   1 
ATOM   2851  C  CE1   . PHE A  1  354 ? 23.070  22.204 65.451 1.00 20.20 ? 381  PHE A CE1   1 
ATOM   2852  C  CE2   . PHE A  1  354 ? 24.220  22.567 63.366 1.00 20.45 ? 381  PHE A CE2   1 
ATOM   2853  C  CZ    . PHE A  1  354 ? 23.865  21.721 64.407 1.00 19.85 ? 381  PHE A CZ    1 
ATOM   2854  N  N     . ASN A  1  355 ? 24.378  27.655 66.022 1.00 21.30 ? 382  ASN A N     1 
ATOM   2855  C  CA    . ASN A  1  355 ? 25.579  28.118 66.706 1.00 21.81 ? 382  ASN A CA    1 
ATOM   2856  C  C     . ASN A  1  355 ? 25.299  28.418 68.181 1.00 22.24 ? 382  ASN A C     1 
ATOM   2857  O  O     . ASN A  1  355 ? 25.998  27.908 69.061 1.00 22.48 ? 382  ASN A O     1 
ATOM   2858  C  CB    . ASN A  1  355 ? 26.125  29.360 65.991 1.00 22.38 ? 382  ASN A CB    1 
ATOM   2859  C  CG    . ASN A  1  355 ? 27.512  29.772 66.476 1.00 23.88 ? 382  ASN A CG    1 
ATOM   2860  O  OD1   . ASN A  1  355 ? 28.134  29.109 67.295 1.00 26.61 ? 382  ASN A OD1   1 
ATOM   2861  N  ND2   . ASN A  1  355 ? 27.997  30.880 65.955 1.00 27.68 ? 382  ASN A ND2   1 
ATOM   2862  N  N     . THR A  1  356 ? 24.269  29.226 68.443 1.00 22.30 ? 383  THR A N     1 
ATOM   2863  C  CA    . THR A  1  356 ? 23.916  29.628 69.807 1.00 22.83 ? 383  THR A CA    1 
ATOM   2864  C  C     . THR A  1  356 ? 23.601  28.437 70.708 1.00 23.09 ? 383  THR A C     1 
ATOM   2865  O  O     . THR A  1  356 ? 24.143  28.344 71.804 1.00 23.87 ? 383  THR A O     1 
ATOM   2866  C  CB    . THR A  1  356 ? 22.750  30.656 69.827 1.00 23.26 ? 383  THR A CB    1 
ATOM   2867  O  OG1   . THR A  1  356 ? 23.130  31.813 69.076 1.00 23.46 ? 383  THR A OG1   1 
ATOM   2868  C  CG2   . THR A  1  356 ? 22.409  31.090 71.252 1.00 23.69 ? 383  THR A CG2   1 
ATOM   2869  N  N     . LEU A  1  357 ? 22.747  27.519 70.249 1.00 22.93 ? 384  LEU A N     1 
ATOM   2870  C  CA    . LEU A  1  357 ? 22.355  26.378 71.079 1.00 23.12 ? 384  LEU A CA    1 
ATOM   2871  C  C     . LEU A  1  357 ? 23.549  25.475 71.399 1.00 22.99 ? 384  LEU A C     1 
ATOM   2872  O  O     . LEU A  1  357 ? 23.550  24.790 72.414 1.00 22.68 ? 384  LEU A O     1 
ATOM   2873  C  CB    . LEU A  1  357 ? 21.199  25.580 70.453 1.00 23.28 ? 384  LEU A CB    1 
ATOM   2874  C  CG    . LEU A  1  357 ? 21.353  24.740 69.177 1.00 22.73 ? 384  LEU A CG    1 
ATOM   2875  C  CD1   . LEU A  1  357 ? 21.923  23.345 69.491 1.00 21.30 ? 384  LEU A CD1   1 
ATOM   2876  C  CD2   . LEU A  1  357 ? 19.986  24.599 68.522 1.00 22.37 ? 384  LEU A CD2   1 
ATOM   2877  N  N     . TYR A  1  358 ? 24.562  25.511 70.531 1.00 22.63 ? 385  TYR A N     1 
ATOM   2878  C  CA    . TYR A  1  358 ? 25.729  24.647 70.637 1.00 22.86 ? 385  TYR A CA    1 
ATOM   2879  C  C     . TYR A  1  358 ? 26.833  25.170 71.555 1.00 23.92 ? 385  TYR A C     1 
ATOM   2880  O  O     . TYR A  1  358 ? 27.922  24.587 71.621 1.00 24.09 ? 385  TYR A O     1 
ATOM   2881  C  CB    . TYR A  1  358 ? 26.316  24.390 69.251 1.00 22.27 ? 385  TYR A CB    1 
ATOM   2882  C  CG    . TYR A  1  358 ? 26.422  22.931 68.926 1.00 21.81 ? 385  TYR A CG    1 
ATOM   2883  C  CD1   . TYR A  1  358 ? 25.693  22.378 67.874 1.00 23.79 ? 385  TYR A CD1   1 
ATOM   2884  C  CD2   . TYR A  1  358 ? 27.241  22.094 69.672 1.00 23.43 ? 385  TYR A CD2   1 
ATOM   2885  C  CE1   . TYR A  1  358 ? 25.796  21.022 67.566 1.00 24.04 ? 385  TYR A CE1   1 
ATOM   2886  C  CE2   . TYR A  1  358 ? 27.344  20.749 69.382 1.00 24.32 ? 385  TYR A CE2   1 
ATOM   2887  C  CZ    . TYR A  1  358 ? 26.618  20.214 68.337 1.00 24.79 ? 385  TYR A CZ    1 
ATOM   2888  O  OH    . TYR A  1  358 ? 26.741  18.868 68.067 1.00 25.99 ? 385  TYR A OH    1 
ATOM   2889  N  N     . HIS A  1  359 ? 26.559  26.262 72.260 1.00 24.81 ? 386  HIS A N     1 
ATOM   2890  C  CA    . HIS A  1  359 ? 27.487  26.771 73.265 1.00 26.30 ? 386  HIS A CA    1 
ATOM   2891  C  C     . HIS A  1  359 ? 27.395  25.929 74.534 1.00 26.50 ? 386  HIS A C     1 
ATOM   2892  O  O     . HIS A  1  359 ? 26.874  26.367 75.562 1.00 26.75 ? 386  HIS A O     1 
ATOM   2893  C  CB    . HIS A  1  359 ? 27.231  28.261 73.522 1.00 27.17 ? 386  HIS A CB    1 
ATOM   2894  C  CG    . HIS A  1  359 ? 27.681  29.131 72.391 1.00 28.84 ? 386  HIS A CG    1 
ATOM   2895  N  ND1   . HIS A  1  359 ? 27.240  28.961 71.097 1.00 31.30 ? 386  HIS A ND1   1 
ATOM   2896  C  CD2   . HIS A  1  359 ? 28.486  30.218 72.373 1.00 30.80 ? 386  HIS A CD2   1 
ATOM   2897  C  CE1   . HIS A  1  359 ? 27.781  29.889 70.327 1.00 32.28 ? 386  HIS A CE1   1 
ATOM   2898  N  NE2   . HIS A  1  359 ? 28.535  30.669 71.078 1.00 30.89 ? 386  HIS A NE2   1 
ATOM   2899  N  N     . TRP A  1  360 ? 27.902  24.702 74.432 1.00 26.15 ? 387  TRP A N     1 
ATOM   2900  C  CA    . TRP A  1  360 ? 27.786  23.717 75.503 1.00 26.74 ? 387  TRP A CA    1 
ATOM   2901  C  C     . TRP A  1  360 ? 28.921  23.831 76.505 1.00 28.08 ? 387  TRP A C     1 
ATOM   2902  O  O     . TRP A  1  360 ? 29.568  22.826 76.839 1.00 28.54 ? 387  TRP A O     1 
ATOM   2903  C  CB    . TRP A  1  360 ? 27.753  22.301 74.928 1.00 25.77 ? 387  TRP A CB    1 
ATOM   2904  C  CG    . TRP A  1  360 ? 26.576  22.023 74.055 1.00 24.17 ? 387  TRP A CG    1 
ATOM   2905  C  CD1   . TRP A  1  360 ? 25.453  22.797 73.904 1.00 22.51 ? 387  TRP A CD1   1 
ATOM   2906  C  CD2   . TRP A  1  360 ? 26.385  20.872 73.237 1.00 22.81 ? 387  TRP A CD2   1 
ATOM   2907  N  NE1   . TRP A  1  360 ? 24.587  22.200 73.024 1.00 22.23 ? 387  TRP A NE1   1 
ATOM   2908  C  CE2   . TRP A  1  360 ? 25.134  21.019 72.595 1.00 22.35 ? 387  TRP A CE2   1 
ATOM   2909  C  CE3   . TRP A  1  360 ? 27.156  19.727 72.971 1.00 22.68 ? 387  TRP A CE3   1 
ATOM   2910  C  CZ2   . TRP A  1  360 ? 24.635  20.063 71.698 1.00 22.20 ? 387  TRP A CZ2   1 
ATOM   2911  C  CZ3   . TRP A  1  360 ? 26.657  18.773 72.085 1.00 22.08 ? 387  TRP A CZ3   1 
ATOM   2912  C  CH2   . TRP A  1  360 ? 25.408  18.947 71.463 1.00 21.70 ? 387  TRP A CH2   1 
ATOM   2913  N  N     . HIS A  1  361 ? 29.148  25.047 76.992 1.00 29.07 ? 388  HIS A N     1 
ATOM   2914  C  CA    A HIS A  1  361 ? 30.275  25.231 77.878 0.50 30.22 ? 388  HIS A CA    1 
ATOM   2915  C  CA    B HIS A  1  361 ? 30.195  25.390 77.976 0.50 30.42 ? 388  HIS A CA    1 
ATOM   2916  C  C     . HIS A  1  361 ? 30.159  24.500 79.223 1.00 31.08 ? 388  HIS A C     1 
ATOM   2917  O  O     . HIS A  1  361 ? 31.194  24.199 79.813 1.00 31.68 ? 388  HIS A O     1 
ATOM   2918  C  CB    A HIS A  1  361 ? 30.654  26.705 78.002 0.50 30.74 ? 388  HIS A CB    1 
ATOM   2919  C  CB    B HIS A  1  361 ? 30.039  26.844 78.463 0.50 31.12 ? 388  HIS A CB    1 
ATOM   2920  C  CG    A HIS A  1  361 ? 31.192  27.279 76.729 0.50 30.03 ? 388  HIS A CG    1 
ATOM   2921  C  CG    B HIS A  1  361 ? 29.958  27.868 77.372 0.50 31.26 ? 388  HIS A CG    1 
ATOM   2922  N  ND1   A HIS A  1  361 ? 30.379  27.817 75.755 0.50 29.38 ? 388  HIS A ND1   1 
ATOM   2923  N  ND1   B HIS A  1  361 ? 28.930  28.783 77.290 0.50 31.18 ? 388  HIS A ND1   1 
ATOM   2924  C  CD2   A HIS A  1  361 ? 32.457  27.365 76.252 0.50 29.94 ? 388  HIS A CD2   1 
ATOM   2925  C  CD2   B HIS A  1  361 ? 30.793  28.147 76.343 0.50 31.01 ? 388  HIS A CD2   1 
ATOM   2926  C  CE1   A HIS A  1  361 ? 31.122  28.229 74.742 0.50 29.20 ? 388  HIS A CE1   1 
ATOM   2927  C  CE1   B HIS A  1  361 ? 29.128  29.574 76.251 0.50 31.19 ? 388  HIS A CE1   1 
ATOM   2928  N  NE2   A HIS A  1  361 ? 32.386  27.966 75.019 0.50 29.25 ? 388  HIS A NE2   1 
ATOM   2929  N  NE2   B HIS A  1  361 ? 30.251  29.208 75.658 0.50 31.18 ? 388  HIS A NE2   1 
ATOM   2930  N  N     . PRO A  1  362 ? 28.927  24.139 79.680 1.00 29.50 ? 389  PRO A N     1 
ATOM   2931  C  CA    . PRO A  1  362 ? 28.913  23.301 80.890 1.00 29.37 ? 389  PRO A CA    1 
ATOM   2932  C  C     . PRO A  1  362 ? 29.564  21.923 80.768 1.00 28.95 ? 389  PRO A C     1 
ATOM   2933  O  O     . PRO A  1  362 ? 29.896  21.314 81.792 1.00 29.38 ? 389  PRO A O     1 
ATOM   2934  C  CB    . PRO A  1  362 ? 27.421  23.176 81.210 1.00 29.63 ? 389  PRO A CB    1 
ATOM   2935  C  CG    . PRO A  1  362 ? 26.848  24.435 80.731 1.00 29.97 ? 389  PRO A CG    1 
ATOM   2936  C  CD    . PRO A  1  362 ? 27.588  24.728 79.443 1.00 29.41 ? 389  PRO A CD    1 
ATOM   2937  N  N     . LEU A  1  363 ? 29.766  21.438 79.543 1.00 28.36 ? 390  LEU A N     1 
ATOM   2938  C  CA    . LEU A  1  363 ? 30.500  20.185 79.327 1.00 27.54 ? 390  LEU A CA    1 
ATOM   2939  C  C     . LEU A  1  363 ? 31.887  20.206 79.964 1.00 28.27 ? 390  LEU A C     1 
ATOM   2940  O  O     . LEU A  1  363 ? 32.375  19.172 80.411 1.00 28.31 ? 390  LEU A O     1 
ATOM   2941  C  CB    . LEU A  1  363 ? 30.645  19.885 77.831 1.00 26.84 ? 390  LEU A CB    1 
ATOM   2942  C  CG    . LEU A  1  363 ? 29.496  19.207 77.083 1.00 25.32 ? 390  LEU A CG    1 
ATOM   2943  C  CD1   . LEU A  1  363 ? 29.801  19.189 75.596 1.00 24.48 ? 390  LEU A CD1   1 
ATOM   2944  C  CD2   . LEU A  1  363 ? 29.246  17.796 77.602 1.00 24.20 ? 390  LEU A CD2   1 
ATOM   2945  N  N     . LEU A  1  364 ? 32.516  21.381 79.999 1.00 29.05 ? 391  LEU A N     1 
ATOM   2946  C  CA    . LEU A  1  364 ? 33.896  21.504 80.471 1.00 29.81 ? 391  LEU A CA    1 
ATOM   2947  C  C     . LEU A  1  364 ? 34.060  21.169 81.960 1.00 30.69 ? 391  LEU A C     1 
ATOM   2948  O  O     . LEU A  1  364 ? 33.261  21.609 82.790 1.00 30.91 ? 391  LEU A O     1 
ATOM   2949  C  CB    . LEU A  1  364 ? 34.454  22.899 80.163 1.00 30.95 ? 391  LEU A CB    1 
ATOM   2950  C  CG    . LEU A  1  364 ? 34.685  23.241 78.687 1.00 31.30 ? 391  LEU A CG    1 
ATOM   2951  C  CD1   . LEU A  1  364 ? 34.892  24.729 78.491 1.00 32.84 ? 391  LEU A CD1   1 
ATOM   2952  C  CD2   . LEU A  1  364 ? 35.861  22.447 78.109 1.00 32.84 ? 391  LEU A CD2   1 
ATOM   2953  N  N     . PRO A  1  365 ? 35.093  20.373 82.296 1.00 31.06 ? 392  PRO A N     1 
ATOM   2954  C  CA    . PRO A  1  365 ? 35.347  20.011 83.688 1.00 32.44 ? 392  PRO A CA    1 
ATOM   2955  C  C     . PRO A  1  365 ? 36.061  21.147 84.410 1.00 34.22 ? 392  PRO A C     1 
ATOM   2956  O  O     . PRO A  1  365 ? 36.393  22.153 83.778 1.00 34.61 ? 392  PRO A O     1 
ATOM   2957  C  CB    . PRO A  1  365 ? 36.255  18.785 83.563 1.00 32.26 ? 392  PRO A CB    1 
ATOM   2958  C  CG    . PRO A  1  365 ? 36.994  19.001 82.288 1.00 31.73 ? 392  PRO A CG    1 
ATOM   2959  C  CD    . PRO A  1  365 ? 36.059  19.741 81.372 1.00 30.34 ? 392  PRO A CD    1 
ATOM   2960  N  N     . ASP A  1  366 ? 36.275  20.995 85.716 1.00 35.91 ? 393  ASP A N     1 
ATOM   2961  C  CA    . ASP A  1  366 ? 37.030  21.972 86.497 1.00 38.02 ? 393  ASP A CA    1 
ATOM   2962  C  C     . ASP A  1  366 ? 38.534  21.827 86.263 1.00 38.59 ? 393  ASP A C     1 
ATOM   2963  O  O     . ASP A  1  366 ? 39.275  22.811 86.337 1.00 39.59 ? 393  ASP A O     1 
ATOM   2964  C  CB    . ASP A  1  366 ? 36.717  21.833 87.989 1.00 39.96 ? 393  ASP A CB    1 
ATOM   2965  C  CG    . ASP A  1  366 ? 35.318  22.341 88.357 1.00 41.04 ? 393  ASP A CG    1 
ATOM   2966  O  OD1   . ASP A  1  366 ? 34.748  23.182 87.623 1.00 40.97 ? 393  ASP A OD1   1 
ATOM   2967  O  OD2   . ASP A  1  366 ? 34.796  21.894 89.400 1.00 43.07 ? 393  ASP A OD2   1 
ATOM   2968  N  N     . THR A  1  367 ? 38.971  20.592 86.000 1.00 37.86 ? 394  THR A N     1 
ATOM   2969  C  CA    . THR A  1  367 ? 40.364  20.280 85.663 1.00 38.43 ? 394  THR A CA    1 
ATOM   2970  C  C     . THR A  1  367 ? 40.418  19.224 84.565 1.00 37.19 ? 394  THR A C     1 
ATOM   2971  O  O     . THR A  1  367 ? 39.500  18.417 84.418 1.00 36.23 ? 394  THR A O     1 
ATOM   2972  C  CB    . THR A  1  367 ? 41.175  19.754 86.875 1.00 40.29 ? 394  THR A CB    1 
ATOM   2973  O  OG1   . THR A  1  367 ? 40.573  18.553 87.375 1.00 39.93 ? 394  THR A OG1   1 
ATOM   2974  C  CG2   . THR A  1  367 ? 41.261  20.795 87.992 1.00 41.86 ? 394  THR A CG2   1 
ATOM   2975  N  N     . PHE A  1  368 ? 41.499  19.228 83.792 1.00 37.59 ? 395  PHE A N     1 
ATOM   2976  C  CA    . PHE A  1  368 ? 41.667  18.242 82.729 1.00 36.69 ? 395  PHE A CA    1 
ATOM   2977  C  C     . PHE A  1  368 ? 42.648  17.200 83.210 1.00 37.87 ? 395  PHE A C     1 
ATOM   2978  O  O     . PHE A  1  368 ? 43.840  17.478 83.363 1.00 39.33 ? 395  PHE A O     1 
ATOM   2979  C  CB    . PHE A  1  368 ? 42.110  18.905 81.423 1.00 35.80 ? 395  PHE A CB    1 
ATOM   2980  C  CG    . PHE A  1  368 ? 41.146  19.940 80.927 1.00 34.93 ? 395  PHE A CG    1 
ATOM   2981  C  CD1   . PHE A  1  368 ? 41.216  21.255 81.386 1.00 35.85 ? 395  PHE A CD1   1 
ATOM   2982  C  CD2   . PHE A  1  368 ? 40.147  19.598 80.023 1.00 32.62 ? 395  PHE A CD2   1 
ATOM   2983  C  CE1   . PHE A  1  368 ? 40.311  22.218 80.935 1.00 35.10 ? 395  PHE A CE1   1 
ATOM   2984  C  CE2   . PHE A  1  368 ? 39.244  20.550 79.570 1.00 32.50 ? 395  PHE A CE2   1 
ATOM   2985  C  CZ    . PHE A  1  368 ? 39.327  21.864 80.025 1.00 33.32 ? 395  PHE A CZ    1 
ATOM   2986  N  N     . ASN A  1  369 ? 42.122  16.005 83.468 1.00 37.88 ? 396  ASN A N     1 
ATOM   2987  C  CA    . ASN A  1  369 ? 42.869  14.945 84.135 1.00 39.37 ? 396  ASN A CA    1 
ATOM   2988  C  C     . ASN A  1  369 ? 43.504  13.965 83.148 1.00 39.08 ? 396  ASN A C     1 
ATOM   2989  O  O     . ASN A  1  369 ? 42.804  13.167 82.515 1.00 38.05 ? 396  ASN A O     1 
ATOM   2990  C  CB    . ASN A  1  369 ? 41.961  14.202 85.124 1.00 39.88 ? 396  ASN A CB    1 
ATOM   2991  C  CG    . ASN A  1  369 ? 41.146  15.149 86.008 1.00 41.02 ? 396  ASN A CG    1 
ATOM   2992  O  OD1   . ASN A  1  369 ? 41.494  16.321 86.183 1.00 42.19 ? 396  ASN A OD1   1 
ATOM   2993  N  ND2   . ASN A  1  369 ? 40.055  14.637 86.569 1.00 40.41 ? 396  ASN A ND2   1 
ATOM   2994  N  N     . ILE A  1  370 ? 44.829  14.040 83.019 1.00 40.08 ? 397  ILE A N     1 
ATOM   2995  C  CA    . ILE A  1  370 ? 45.578  13.158 82.125 1.00 40.11 ? 397  ILE A CA    1 
ATOM   2996  C  C     . ILE A  1  370 ? 46.548  12.306 82.934 1.00 42.29 ? 397  ILE A C     1 
ATOM   2997  O  O     . ILE A  1  370 ? 47.388  12.837 83.665 1.00 43.18 ? 397  ILE A O     1 
ATOM   2998  C  CB    . ILE A  1  370 ? 46.398  13.936 81.062 1.00 39.61 ? 397  ILE A CB    1 
ATOM   2999  C  CG1   . ILE A  1  370 ? 45.557  15.019 80.368 1.00 38.55 ? 397  ILE A CG1   1 
ATOM   3000  C  CG2   . ILE A  1  370 ? 47.008  12.970 80.048 1.00 38.94 ? 397  ILE A CG2   1 
ATOM   3001  C  CD1   . ILE A  1  370 ? 44.524  14.483 79.420 1.00 37.75 ? 397  ILE A CD1   1 
ATOM   3002  N  N     . GLU A  1  371 ? 46.432  10.987 82.785 1.00 43.18 ? 398  GLU A N     1 
ATOM   3003  C  CA    . GLU A  1  371 ? 47.299  10.044 83.486 1.00 46.25 ? 398  GLU A CA    1 
ATOM   3004  C  C     . GLU A  1  371 ? 47.180  10.327 84.991 1.00 48.23 ? 398  GLU A C     1 
ATOM   3005  O  O     . GLU A  1  371 ? 46.081  10.246 85.553 1.00 48.07 ? 398  GLU A O     1 
ATOM   3006  C  CB    . GLU A  1  371 ? 48.746  10.161 82.966 1.00 46.93 ? 398  GLU A CB    1 
ATOM   3007  C  CG    . GLU A  1  371 ? 49.552  8.862  82.981 1.00 49.81 ? 398  GLU A CG    1 
ATOM   3008  C  CD    . GLU A  1  371 ? 50.864  8.948  82.195 1.00 51.83 ? 398  GLU A CD    1 
ATOM   3009  O  OE1   . GLU A  1  371 ? 51.832  8.252  82.576 1.00 54.75 ? 398  GLU A OE1   1 
ATOM   3010  O  OE2   . GLU A  1  371 ? 50.938  9.699  81.194 1.00 51.08 ? 398  GLU A OE2   1 
ATOM   3011  N  N     . ASP A  1  372 ? 48.286  10.701 85.629 1.00 50.21 ? 399  ASP A N     1 
ATOM   3012  C  CA    . ASP A  1  372 ? 48.272  11.049 87.052 1.00 52.58 ? 399  ASP A CA    1 
ATOM   3013  C  C     . ASP A  1  372 ? 48.103  12.550 87.321 1.00 52.10 ? 399  ASP A C     1 
ATOM   3014  O  O     . ASP A  1  372 ? 47.959  12.967 88.473 1.00 53.78 ? 399  ASP A O     1 
ATOM   3015  C  CB    . ASP A  1  372 ? 49.536  10.518 87.750 1.00 55.56 ? 399  ASP A CB    1 
ATOM   3016  C  CG    . ASP A  1  372 ? 50.821  10.836 86.982 1.00 56.77 ? 399  ASP A CG    1 
ATOM   3017  O  OD1   . ASP A  1  372 ? 50.758  11.395 85.858 1.00 56.22 ? 399  ASP A OD1   1 
ATOM   3018  O  OD2   . ASP A  1  372 ? 51.908  10.510 87.503 1.00 60.84 ? 399  ASP A OD2   1 
ATOM   3019  N  N     . GLN A  1  373 ? 48.116  13.359 86.267 1.00 50.12 ? 400  GLN A N     1 
ATOM   3020  C  CA    . GLN A  1  373 ? 48.062  14.815 86.420 1.00 49.89 ? 400  GLN A CA    1 
ATOM   3021  C  C     . GLN A  1  373 ? 46.642  15.370 86.336 1.00 48.31 ? 400  GLN A C     1 
ATOM   3022  O  O     . GLN A  1  373 ? 45.768  14.788 85.685 1.00 46.37 ? 400  GLN A O     1 
ATOM   3023  C  CB    . GLN A  1  373 ? 48.935  15.498 85.365 1.00 49.42 ? 400  GLN A CB    1 
ATOM   3024  C  CG    . GLN A  1  373 ? 50.383  15.046 85.336 1.00 51.21 ? 400  GLN A CG    1 
ATOM   3025  C  CD    . GLN A  1  373 ? 51.215  15.647 86.449 1.00 54.64 ? 400  GLN A CD    1 
ATOM   3026  O  OE1   . GLN A  1  373 ? 50.861  16.676 87.028 1.00 55.93 ? 400  GLN A OE1   1 
ATOM   3027  N  NE2   . GLN A  1  373 ? 52.337  15.008 86.751 1.00 56.20 ? 400  GLN A NE2   1 
ATOM   3028  N  N     . GLU A  1  374 ? 46.429  16.506 86.998 1.00 48.91 ? 401  GLU A N     1 
ATOM   3029  C  CA    . GLU A  1  374 ? 45.170  17.238 86.927 1.00 47.64 ? 401  GLU A CA    1 
ATOM   3030  C  C     . GLU A  1  374 ? 45.463  18.686 86.554 1.00 47.06 ? 401  GLU A C     1 
ATOM   3031  O  O     . GLU A  1  374 ? 45.888  19.471 87.396 1.00 49.26 ? 401  GLU A O     1 
ATOM   3032  C  CB    . GLU A  1  374 ? 44.417  17.156 88.261 1.00 49.33 ? 401  GLU A CB    1 
ATOM   3033  C  CG    . GLU A  1  374 ? 43.957  15.743 88.624 1.00 51.42 ? 401  GLU A CG    1 
ATOM   3034  C  CD    . GLU A  1  374 ? 43.125  15.681 89.894 1.00 55.20 ? 401  GLU A CD    1 
ATOM   3035  O  OE1   . GLU A  1  374 ? 43.320  16.529 90.792 1.00 58.31 ? 401  GLU A OE1   1 
ATOM   3036  O  OE2   . GLU A  1  374 ? 42.279  14.767 90.000 1.00 55.86 ? 401  GLU A OE2   1 
ATOM   3037  N  N     . TYR A  1  375 ? 45.246  19.030 85.288 1.00 44.40 ? 402  TYR A N     1 
ATOM   3038  C  CA    . TYR A  1  375 ? 45.596  20.353 84.776 1.00 43.82 ? 402  TYR A CA    1 
ATOM   3039  C  C     . TYR A  1  375 ? 44.467  21.367 84.918 1.00 43.16 ? 402  TYR A C     1 
ATOM   3040  O  O     . TYR A  1  375 ? 43.313  21.073 84.593 1.00 41.36 ? 402  TYR A O     1 
ATOM   3041  C  CB    . TYR A  1  375 ? 46.023  20.262 83.304 1.00 42.49 ? 402  TYR A CB    1 
ATOM   3042  C  CG    . TYR A  1  375 ? 47.223  19.374 83.070 1.00 42.14 ? 402  TYR A CG    1 
ATOM   3043  C  CD1   . TYR A  1  375 ? 48.511  19.818 83.359 1.00 43.51 ? 402  TYR A CD1   1 
ATOM   3044  C  CD2   . TYR A  1  375 ? 47.068  18.088 82.554 1.00 40.25 ? 402  TYR A CD2   1 
ATOM   3045  C  CE1   . TYR A  1  375 ? 49.619  19.000 83.144 1.00 44.16 ? 402  TYR A CE1   1 
ATOM   3046  C  CE2   . TYR A  1  375 ? 48.166  17.266 82.331 1.00 41.06 ? 402  TYR A CE2   1 
ATOM   3047  C  CZ    . TYR A  1  375 ? 49.436  17.728 82.630 1.00 42.58 ? 402  TYR A CZ    1 
ATOM   3048  O  OH    . TYR A  1  375 ? 50.520  16.915 82.422 1.00 43.72 ? 402  TYR A OH    1 
ATOM   3049  N  N     . SER A  1  376 ? 44.814  22.564 85.385 1.00 44.47 ? 403  SER A N     1 
ATOM   3050  C  CA    . SER A  1  376 ? 43.878  23.690 85.416 1.00 44.63 ? 403  SER A CA    1 
ATOM   3051  C  C     . SER A  1  376 ? 43.664  24.231 84.003 1.00 43.33 ? 403  SER A C     1 
ATOM   3052  O  O     . SER A  1  376 ? 44.351  23.814 83.064 1.00 42.36 ? 403  SER A O     1 
ATOM   3053  C  CB    . SER A  1  376 ? 44.418  24.807 86.311 1.00 47.31 ? 403  SER A CB    1 
ATOM   3054  O  OG    . SER A  1  376 ? 45.478  25.490 85.666 1.00 48.32 ? 403  SER A OG    1 
ATOM   3055  N  N     . PHE A  1  377 ? 42.726  25.166 83.855 1.00 43.17 ? 404  PHE A N     1 
ATOM   3056  C  CA    . PHE A  1  377 ? 42.480  25.806 82.564 1.00 42.59 ? 404  PHE A CA    1 
ATOM   3057  C  C     . PHE A  1  377 ? 43.704  26.564 82.062 1.00 43.93 ? 404  PHE A C     1 
ATOM   3058  O  O     . PHE A  1  377 ? 44.075  26.447 80.890 1.00 43.23 ? 404  PHE A O     1 
ATOM   3059  C  CB    . PHE A  1  377 ? 41.280  26.745 82.642 1.00 42.99 ? 404  PHE A CB    1 
ATOM   3060  C  CG    . PHE A  1  377 ? 39.988  26.092 82.293 1.00 41.47 ? 404  PHE A CG    1 
ATOM   3061  C  CD1   . PHE A  1  377 ? 39.431  26.264 81.028 1.00 40.93 ? 404  PHE A CD1   1 
ATOM   3062  C  CD2   . PHE A  1  377 ? 39.317  25.300 83.227 1.00 41.69 ? 404  PHE A CD2   1 
ATOM   3063  C  CE1   . PHE A  1  377 ? 38.219  25.658 80.692 1.00 39.84 ? 404  PHE A CE1   1 
ATOM   3064  C  CE2   . PHE A  1  377 ? 38.103  24.689 82.904 1.00 39.93 ? 404  PHE A CE2   1 
ATOM   3065  C  CZ    . PHE A  1  377 ? 37.554  24.866 81.632 1.00 38.91 ? 404  PHE A CZ    1 
ATOM   3066  N  N     . LYS A  1  378 ? 44.326  27.326 82.959 1.00 45.95 ? 405  LYS A N     1 
ATOM   3067  C  CA    . LYS A  1  378 ? 45.509  28.120 82.625 1.00 47.92 ? 405  LYS A CA    1 
ATOM   3068  C  C     . LYS A  1  378 ? 46.662  27.236 82.143 1.00 47.21 ? 405  LYS A C     1 
ATOM   3069  O  O     . LYS A  1  378 ? 47.386  27.605 81.217 1.00 47.58 ? 405  LYS A O     1 
ATOM   3070  C  CB    . LYS A  1  378 ? 45.933  28.987 83.820 1.00 50.74 ? 405  LYS A CB    1 
ATOM   3071  C  CG    . LYS A  1  378 ? 47.060  29.974 83.535 1.00 53.61 ? 405  LYS A CG    1 
ATOM   3072  N  N     . GLN A  1  379 ? 46.811  26.066 82.759 1.00 46.37 ? 406  GLN A N     1 
ATOM   3073  C  CA    . GLN A  1  379 ? 47.881  25.136 82.401 1.00 46.30 ? 406  GLN A CA    1 
ATOM   3074  C  C     . GLN A  1  379 ? 47.575  24.397 81.102 1.00 44.30 ? 406  GLN A C     1 
ATOM   3075  O  O     . GLN A  1  379 ? 48.489  24.006 80.377 1.00 44.06 ? 406  GLN A O     1 
ATOM   3076  C  CB    . GLN A  1  379 ? 48.110  24.121 83.516 1.00 46.38 ? 406  GLN A CB    1 
ATOM   3077  C  CG    . GLN A  1  379 ? 48.667  24.708 84.804 1.00 49.66 ? 406  GLN A CG    1 
ATOM   3078  C  CD    . GLN A  1  379 ? 48.626  23.722 85.955 1.00 51.01 ? 406  GLN A CD    1 
ATOM   3079  O  OE1   . GLN A  1  379 ? 47.709  22.903 86.059 1.00 48.88 ? 406  GLN A OE1   1 
ATOM   3080  N  NE2   . GLN A  1  379 ? 49.619  23.801 86.837 1.00 53.63 ? 406  GLN A NE2   1 
ATOM   3081  N  N     . PHE A  1  380 ? 46.288  24.213 80.819 1.00 42.98 ? 407  PHE A N     1 
ATOM   3082  C  CA    . PHE A  1  380 ? 45.844  23.408 79.688 1.00 41.45 ? 407  PHE A CA    1 
ATOM   3083  C  C     . PHE A  1  380 ? 45.806  24.204 78.385 1.00 42.20 ? 407  PHE A C     1 
ATOM   3084  O  O     . PHE A  1  380 ? 46.180  23.686 77.340 1.00 41.59 ? 407  PHE A O     1 
ATOM   3085  C  CB    . PHE A  1  380 ? 44.478  22.787 79.993 1.00 39.67 ? 407  PHE A CB    1 
ATOM   3086  C  CG    . PHE A  1  380 ? 44.168  21.558 79.186 1.00 37.46 ? 407  PHE A CG    1 
ATOM   3087  C  CD1   . PHE A  1  380 ? 44.926  20.400 79.331 1.00 36.45 ? 407  PHE A CD1   1 
ATOM   3088  C  CD2   . PHE A  1  380 ? 43.100  21.551 78.294 1.00 35.19 ? 407  PHE A CD2   1 
ATOM   3089  C  CE1   . PHE A  1  380 ? 44.634  19.259 78.587 1.00 36.01 ? 407  PHE A CE1   1 
ATOM   3090  C  CE2   . PHE A  1  380 ? 42.798  20.410 77.548 1.00 34.30 ? 407  PHE A CE2   1 
ATOM   3091  C  CZ    . PHE A  1  380 ? 43.565  19.267 77.693 1.00 33.65 ? 407  PHE A CZ    1 
ATOM   3092  N  N     . LEU A  1  381 ? 45.360  25.459 78.455 1.00 44.44 ? 408  LEU A N     1 
ATOM   3093  C  CA    . LEU A  1  381 ? 45.262  26.338 77.280 1.00 45.80 ? 408  LEU A CA    1 
ATOM   3094  C  C     . LEU A  1  381 ? 46.584  26.531 76.548 1.00 47.37 ? 408  LEU A C     1 
ATOM   3095  O  O     . LEU A  1  381 ? 47.599  26.844 77.171 1.00 48.79 ? 408  LEU A O     1 
ATOM   3096  C  CB    . LEU A  1  381 ? 44.712  27.714 77.675 1.00 47.54 ? 408  LEU A CB    1 
ATOM   3097  C  CG    . LEU A  1  381 ? 43.248  28.019 77.351 1.00 47.46 ? 408  LEU A CG    1 
ATOM   3098  C  CD1   . LEU A  1  381 ? 42.290  27.178 78.195 1.00 46.78 ? 408  LEU A CD1   1 
ATOM   3099  C  CD2   . LEU A  1  381 ? 42.973  29.503 77.546 1.00 50.47 ? 408  LEU A CD2   1 
ATOM   3100  N  N     . TYR A  1  382 ? 46.547  26.353 75.225 1.00 47.13 ? 409  TYR A N     1 
ATOM   3101  C  CA    . TYR A  1  382 ? 47.691  26.578 74.327 1.00 49.02 ? 409  TYR A CA    1 
ATOM   3102  C  C     . TYR A  1  382 ? 48.915  25.743 74.664 1.00 49.00 ? 409  TYR A C     1 
ATOM   3103  O  O     . TYR A  1  382 ? 50.040  26.128 74.344 1.00 50.64 ? 409  TYR A O     1 
ATOM   3104  C  CB    . TYR A  1  382 ? 48.090  28.062 74.282 1.00 51.87 ? 409  TYR A CB    1 
ATOM   3105  C  CG    . TYR A  1  382 ? 47.099  28.946 73.573 1.00 53.92 ? 409  TYR A CG    1 
ATOM   3106  C  CD1   . TYR A  1  382 ? 46.935  28.871 72.183 1.00 54.89 ? 409  TYR A CD1   1 
ATOM   3107  C  CD2   . TYR A  1  382 ? 46.326  29.864 74.285 1.00 55.68 ? 409  TYR A CD2   1 
ATOM   3108  C  CE1   . TYR A  1  382 ? 46.021  29.683 71.523 1.00 56.73 ? 409  TYR A CE1   1 
ATOM   3109  C  CE2   . TYR A  1  382 ? 45.410  30.679 73.638 1.00 57.88 ? 409  TYR A CE2   1 
ATOM   3110  C  CZ    . TYR A  1  382 ? 45.262  30.583 72.258 1.00 58.36 ? 409  TYR A CZ    1 
ATOM   3111  O  OH    . TYR A  1  382 ? 44.355  31.388 71.614 1.00 60.84 ? 409  TYR A OH    1 
ATOM   3112  N  N     . ASN A  1  383 ? 48.697  24.601 75.301 1.00 47.59 ? 410  ASN A N     1 
ATOM   3113  C  CA    . ASN A  1  383 ? 49.810  23.806 75.794 1.00 47.97 ? 410  ASN A CA    1 
ATOM   3114  C  C     . ASN A  1  383 ? 49.896  22.446 75.116 1.00 45.45 ? 410  ASN A C     1 
ATOM   3115  O  O     . ASN A  1  383 ? 49.484  21.431 75.678 1.00 44.26 ? 410  ASN A O     1 
ATOM   3116  C  CB    . ASN A  1  383 ? 49.733  23.671 77.321 1.00 49.02 ? 410  ASN A CB    1 
ATOM   3117  C  CG    . ASN A  1  383 ? 51.062  23.275 77.946 1.00 53.29 ? 410  ASN A CG    1 
ATOM   3118  O  OD1   . ASN A  1  383 ? 51.973  22.811 77.256 1.00 52.76 ? 410  ASN A OD1   1 
ATOM   3119  N  ND2   . ASN A  1  383 ? 51.176  23.456 79.262 1.00 59.38 ? 410  ASN A ND2   1 
ATOM   3120  N  N     . ASN A  1  384 ? 50.442  22.439 73.903 1.00 44.65 ? 411  ASN A N     1 
ATOM   3121  C  CA    . ASN A  1  384 ? 50.659  21.200 73.157 1.00 42.65 ? 411  ASN A CA    1 
ATOM   3122  C  C     . ASN A  1  384 ? 51.747  20.295 73.757 1.00 42.43 ? 411  ASN A C     1 
ATOM   3123  O  O     . ASN A  1  384 ? 51.831  19.113 73.416 1.00 41.39 ? 411  ASN A O     1 
ATOM   3124  C  CB    . ASN A  1  384 ? 50.958  21.499 71.685 1.00 43.01 ? 411  ASN A CB    1 
ATOM   3125  C  CG    . ASN A  1  384 ? 49.745  22.038 70.930 1.00 43.10 ? 411  ASN A CG    1 
ATOM   3126  O  OD1   . ASN A  1  384 ? 48.596  21.732 71.257 1.00 41.03 ? 411  ASN A OD1   1 
ATOM   3127  N  ND2   . ASN A  1  384 ? 50.004  22.842 69.906 1.00 44.89 ? 411  ASN A ND2   1 
ATOM   3128  N  N     . SER A  1  385 ? 52.570  20.834 74.654 1.00 43.02 ? 412  SER A N     1 
ATOM   3129  C  CA    . SER A  1  385 ? 53.612  20.015 75.286 1.00 43.23 ? 412  SER A CA    1 
ATOM   3130  C  C     . SER A  1  385 ? 53.006  18.914 76.164 1.00 41.75 ? 412  SER A C     1 
ATOM   3131  O  O     . SER A  1  385 ? 53.594  17.841 76.312 1.00 41.61 ? 412  SER A O     1 
ATOM   3132  C  CB    . SER A  1  385 ? 54.615  20.874 76.061 1.00 45.42 ? 412  SER A CB    1 
ATOM   3133  O  OG    . SER A  1  385 ? 54.060  21.343 77.271 1.00 46.80 ? 412  SER A OG    1 
ATOM   3134  N  N     . ILE A  1  386 ? 51.825  19.189 76.725 1.00 40.38 ? 413  ILE A N     1 
ATOM   3135  C  CA    . ILE A  1  386 ? 51.038  18.192 77.451 1.00 39.34 ? 413  ILE A CA    1 
ATOM   3136  C  C     . ILE A  1  386 ? 50.704  17.009 76.532 1.00 37.72 ? 413  ILE A C     1 
ATOM   3137  O  O     . ILE A  1  386 ? 50.841  15.850 76.923 1.00 37.62 ? 413  ILE A O     1 
ATOM   3138  C  CB    . ILE A  1  386 ? 49.725  18.806 78.052 1.00 38.64 ? 413  ILE A CB    1 
ATOM   3139  C  CG1   . ILE A  1  386 ? 50.052  19.890 79.090 1.00 40.61 ? 413  ILE A CG1   1 
ATOM   3140  C  CG2   . ILE A  1  386 ? 48.849  17.724 78.680 1.00 37.83 ? 413  ILE A CG2   1 
ATOM   3141  C  CD1   . ILE A  1  386 ? 48.826  20.688 79.598 1.00 39.68 ? 413  ILE A CD1   1 
ATOM   3142  N  N     . LEU A  1  387 ? 50.279  17.319 75.311 1.00 36.78 ? 414  LEU A N     1 
ATOM   3143  C  CA    . LEU A  1  387 ? 49.967  16.298 74.307 1.00 35.94 ? 414  LEU A CA    1 
ATOM   3144  C  C     . LEU A  1  387 ? 51.171  15.415 73.996 1.00 36.51 ? 414  LEU A C     1 
ATOM   3145  O  O     . LEU A  1  387 ? 51.046  14.197 73.963 1.00 36.26 ? 414  LEU A O     1 
ATOM   3146  C  CB    . LEU A  1  387 ? 49.418  16.932 73.021 1.00 35.26 ? 414  LEU A CB    1 
ATOM   3147  C  CG    . LEU A  1  387 ? 48.924  15.998 71.903 1.00 35.37 ? 414  LEU A CG    1 
ATOM   3148  C  CD1   . LEU A  1  387 ? 47.849  15.028 72.400 1.00 34.79 ? 414  LEU A CD1   1 
ATOM   3149  C  CD2   . LEU A  1  387 ? 48.396  16.807 70.734 1.00 34.96 ? 414  LEU A CD2   1 
ATOM   3150  N  N     . LEU A  1  388 ? 52.329  16.036 73.783 1.00 37.57 ? 415  LEU A N     1 
ATOM   3151  C  CA    . LEU A  1  388 ? 53.548  15.304 73.441 1.00 38.85 ? 415  LEU A CA    1 
ATOM   3152  C  C     . LEU A  1  388 ? 54.124  14.531 74.616 1.00 39.64 ? 415  LEU A C     1 
ATOM   3153  O  O     . LEU A  1  388 ? 54.685  13.453 74.432 1.00 40.16 ? 415  LEU A O     1 
ATOM   3154  C  CB    . LEU A  1  388 ? 54.606  16.244 72.862 1.00 40.16 ? 415  LEU A CB    1 
ATOM   3155  C  CG    . LEU A  1  388 ? 54.614  16.332 71.332 1.00 40.54 ? 415  LEU A CG    1 
ATOM   3156  C  CD1   . LEU A  1  388 ? 53.317  16.953 70.783 1.00 40.14 ? 415  LEU A CD1   1 
ATOM   3157  C  CD2   . LEU A  1  388 ? 55.814  17.114 70.884 1.00 41.76 ? 415  LEU A CD2   1 
ATOM   3158  N  N     . GLU A  1  389 ? 53.979  15.089 75.816 1.00 40.05 ? 416  GLU A N     1 
ATOM   3159  C  CA    . GLU A  1  389 ? 54.464  14.444 77.028 1.00 41.34 ? 416  GLU A CA    1 
ATOM   3160  C  C     . GLU A  1  389 ? 53.723  13.137 77.307 1.00 40.33 ? 416  GLU A C     1 
ATOM   3161  O  O     . GLU A  1  389 ? 54.354  12.093 77.493 1.00 41.29 ? 416  GLU A O     1 
ATOM   3162  C  CB    . GLU A  1  389 ? 54.354  15.381 78.231 1.00 42.32 ? 416  GLU A CB    1 
ATOM   3163  C  CG    . GLU A  1  389 ? 54.520  14.663 79.566 1.00 45.47 ? 416  GLU A CG    1 
ATOM   3164  C  CD    . GLU A  1  389 ? 55.038  15.559 80.661 1.00 50.00 ? 416  GLU A CD    1 
ATOM   3165  O  OE1   . GLU A  1  389 ? 54.408  16.602 80.929 1.00 50.64 ? 416  GLU A OE1   1 
ATOM   3166  O  OE2   . GLU A  1  389 ? 56.075  15.205 81.264 1.00 53.80 ? 416  GLU A OE2   1 
ATOM   3167  N  N     . HIS A  1  390 ? 52.392  13.205 77.335 1.00 38.30 ? 417  HIS A N     1 
ATOM   3168  C  CA    . HIS A  1  390 ? 51.578  12.041 77.664 1.00 37.38 ? 417  HIS A CA    1 
ATOM   3169  C  C     . HIS A  1  390 ? 51.388  11.128 76.455 1.00 36.30 ? 417  HIS A C     1 
ATOM   3170  O  O     . HIS A  1  390 ? 51.313  9.908  76.601 1.00 36.72 ? 417  HIS A O     1 
ATOM   3171  C  CB    . HIS A  1  390 ? 50.228  12.463 78.256 1.00 36.42 ? 417  HIS A CB    1 
ATOM   3172  C  CG    . HIS A  1  390 ? 50.345  13.201 79.555 1.00 37.60 ? 417  HIS A CG    1 
ATOM   3173  N  ND1   . HIS A  1  390 ? 50.662  12.574 80.742 1.00 40.61 ? 417  HIS A ND1   1 
ATOM   3174  C  CD2   . HIS A  1  390 ? 50.195  14.512 79.852 1.00 37.42 ? 417  HIS A CD2   1 
ATOM   3175  C  CE1   . HIS A  1  390 ? 50.701  13.467 81.714 1.00 40.78 ? 417  HIS A CE1   1 
ATOM   3176  N  NE2   . HIS A  1  390 ? 50.416  14.650 81.201 1.00 39.93 ? 417  HIS A NE2   1 
ATOM   3177  N  N     . GLY A  1  391 ? 51.329  11.720 75.265 1.00 34.98 ? 418  GLY A N     1 
ATOM   3178  C  CA    . GLY A  1  391 ? 51.097  10.957 74.036 1.00 34.28 ? 418  GLY A CA    1 
ATOM   3179  C  C     . GLY A  1  391 ? 49.612  10.753 73.801 1.00 32.76 ? 418  GLY A C     1 
ATOM   3180  O  O     . GLY A  1  391 ? 48.810  10.888 74.730 1.00 32.13 ? 418  GLY A O     1 
ATOM   3181  N  N     . LEU A  1  392 ? 49.248  10.425 72.561 1.00 32.08 ? 419  LEU A N     1 
ATOM   3182  C  CA    . LEU A  1  392 ? 47.846  10.256 72.175 1.00 30.93 ? 419  LEU A CA    1 
ATOM   3183  C  C     . LEU A  1  392 ? 47.152  9.073  72.847 1.00 30.83 ? 419  LEU A C     1 
ATOM   3184  O  O     . LEU A  1  392 ? 45.954  9.140  73.136 1.00 30.21 ? 419  LEU A O     1 
ATOM   3185  C  CB    . LEU A  1  392 ? 47.719  10.106 70.657 1.00 31.35 ? 419  LEU A CB    1 
ATOM   3186  C  CG    . LEU A  1  392 ? 47.140  11.239 69.803 1.00 31.86 ? 419  LEU A CG    1 
ATOM   3187  C  CD1   . LEU A  1  392 ? 47.971  12.514 69.922 1.00 32.54 ? 419  LEU A CD1   1 
ATOM   3188  C  CD2   . LEU A  1  392 ? 47.080  10.777 68.348 1.00 32.14 ? 419  LEU A CD2   1 
ATOM   3189  N  N     . THR A  1  393 ? 47.894  7.989  73.066 1.00 31.64 ? 420  THR A N     1 
ATOM   3190  C  CA    . THR A  1  393 ? 47.346  6.796  73.707 1.00 31.99 ? 420  THR A CA    1 
ATOM   3191  C  C     . THR A  1  393 ? 46.833  7.153  75.104 1.00 31.88 ? 420  THR A C     1 
ATOM   3192  O  O     . THR A  1  393 ? 45.680  6.872  75.439 1.00 30.90 ? 420  THR A O     1 
ATOM   3193  C  CB    . THR A  1  393 ? 48.381  5.653  73.761 1.00 33.85 ? 420  THR A CB    1 
ATOM   3194  O  OG1   . THR A  1  393 ? 48.904  5.422  72.447 1.00 33.45 ? 420  THR A OG1   1 
ATOM   3195  C  CG2   . THR A  1  393 ? 47.746  4.362  74.292 1.00 34.86 ? 420  THR A CG2   1 
ATOM   3196  N  N     . GLN A  1  394 ? 47.683  7.806  75.894 1.00 32.42 ? 421  GLN A N     1 
ATOM   3197  C  CA    . GLN A  1  394 ? 47.294  8.257  77.227 1.00 33.13 ? 421  GLN A CA    1 
ATOM   3198  C  C     . GLN A  1  394 ? 46.155  9.272  77.193 1.00 31.09 ? 421  GLN A C     1 
ATOM   3199  O  O     . GLN A  1  394 ? 45.257  9.213  78.027 1.00 30.65 ? 421  GLN A O     1 
ATOM   3200  C  CB    . GLN A  1  394 ? 48.487  8.814  78.006 1.00 34.15 ? 421  GLN A CB    1 
ATOM   3201  C  CG    . GLN A  1  394 ? 49.046  7.845  79.034 1.00 39.43 ? 421  GLN A CG    1 
ATOM   3202  C  CD    . GLN A  1  394 ? 47.995  7.369  80.039 1.00 41.64 ? 421  GLN A CD    1 
ATOM   3203  O  OE1   . GLN A  1  394 ? 47.147  8.141  80.496 1.00 42.63 ? 421  GLN A OE1   1 
ATOM   3204  N  NE2   . GLN A  1  394 ? 48.049  6.091  80.378 1.00 44.23 ? 421  GLN A NE2   1 
ATOM   3205  N  N     . PHE A  1  395 ? 46.200  10.195 76.232 1.00 30.17 ? 422  PHE A N     1 
ATOM   3206  C  CA    . PHE A  1  395 ? 45.101  11.145 76.028 1.00 28.89 ? 422  PHE A CA    1 
ATOM   3207  C  C     . PHE A  1  395 ? 43.755  10.440 75.846 1.00 28.41 ? 422  PHE A C     1 
ATOM   3208  O  O     . PHE A  1  395 ? 42.780  10.783 76.520 1.00 28.07 ? 422  PHE A O     1 
ATOM   3209  C  CB    . PHE A  1  395 ? 45.395  12.092 74.854 1.00 28.42 ? 422  PHE A CB    1 
ATOM   3210  C  CG    . PHE A  1  395 ? 45.834  13.478 75.284 1.00 28.94 ? 422  PHE A CG    1 
ATOM   3211  C  CD1   . PHE A  1  395 ? 46.972  13.657 76.071 1.00 29.10 ? 422  PHE A CD1   1 
ATOM   3212  C  CD2   . PHE A  1  395 ? 45.094  14.604 74.909 1.00 27.80 ? 422  PHE A CD2   1 
ATOM   3213  C  CE1   . PHE A  1  395 ? 47.373  14.947 76.481 1.00 30.70 ? 422  PHE A CE1   1 
ATOM   3214  C  CE2   . PHE A  1  395 ? 45.482  15.894 75.309 1.00 28.81 ? 422  PHE A CE2   1 
ATOM   3215  C  CZ    . PHE A  1  395 ? 46.629  16.063 76.096 1.00 29.88 ? 422  PHE A CZ    1 
ATOM   3216  N  N     . VAL A  1  396 ? 43.708  9.453  74.950 1.00 28.21 ? 423  VAL A N     1 
ATOM   3217  C  CA    . VAL A  1  396 ? 42.470  8.716  74.694 1.00 28.38 ? 423  VAL A CA    1 
ATOM   3218  C  C     . VAL A  1  396 ? 41.999  8.001  75.971 1.00 29.27 ? 423  VAL A C     1 
ATOM   3219  O  O     . VAL A  1  396 ? 40.836  8.145  76.379 1.00 28.39 ? 423  VAL A O     1 
ATOM   3220  C  CB    . VAL A  1  396 ? 42.613  7.716  73.511 1.00 28.85 ? 423  VAL A CB    1 
ATOM   3221  C  CG1   . VAL A  1  396 ? 41.423  6.773  73.446 1.00 28.66 ? 423  VAL A CG1   1 
ATOM   3222  C  CG2   . VAL A  1  396 ? 42.769  8.471  72.193 1.00 28.46 ? 423  VAL A CG2   1 
ATOM   3223  N  N     . GLU A  1  397 ? 42.915  7.266  76.599 1.00 30.44 ? 424  GLU A N     1 
ATOM   3224  C  CA    . GLU A  1  397 ? 42.614  6.514  77.817 1.00 32.56 ? 424  GLU A CA    1 
ATOM   3225  C  C     . GLU A  1  397 ? 42.064  7.403  78.934 1.00 31.96 ? 424  GLU A C     1 
ATOM   3226  O  O     . GLU A  1  397 ? 41.083  7.040  79.578 1.00 32.37 ? 424  GLU A O     1 
ATOM   3227  C  CB    . GLU A  1  397 ? 43.845  5.719  78.295 1.00 34.51 ? 424  GLU A CB    1 
ATOM   3228  C  CG    . GLU A  1  397 ? 44.190  4.541  77.376 1.00 37.66 ? 424  GLU A CG    1 
ATOM   3229  C  CD    . GLU A  1  397 ? 45.478  3.817  77.744 1.00 43.76 ? 424  GLU A CD    1 
ATOM   3230  O  OE1   . GLU A  1  397 ? 46.341  4.411  78.432 1.00 46.44 ? 424  GLU A OE1   1 
ATOM   3231  O  OE2   . GLU A  1  397 ? 45.635  2.648  77.322 1.00 45.90 ? 424  GLU A OE2   1 
ATOM   3232  N  N     . SER A  1  398 ? 42.680  8.569  79.134 1.00 31.34 ? 425  SER A N     1 
ATOM   3233  C  CA    . SER A  1  398 ? 42.303  9.478  80.214 1.00 31.35 ? 425  SER A CA    1 
ATOM   3234  C  C     . SER A  1  398 ? 40.997  10.203 79.910 1.00 30.05 ? 425  SER A C     1 
ATOM   3235  O  O     . SER A  1  398 ? 40.117  10.296 80.768 1.00 29.76 ? 425  SER A O     1 
ATOM   3236  C  CB    . SER A  1  398 ? 43.419  10.489 80.483 1.00 31.48 ? 425  SER A CB    1 
ATOM   3237  O  OG    . SER A  1  398 ? 44.572  9.833  80.966 1.00 33.51 ? 425  SER A OG    1 
ATOM   3238  N  N     . PHE A  1  399 ? 40.876  10.705 78.684 1.00 29.21 ? 426  PHE A N     1 
ATOM   3239  C  CA    . PHE A  1  399 ? 39.662  11.395 78.258 1.00 28.63 ? 426  PHE A CA    1 
ATOM   3240  C  C     . PHE A  1  399 ? 38.448  10.485 78.189 1.00 27.93 ? 426  PHE A C     1 
ATOM   3241  O  O     . PHE A  1  399 ? 37.328  10.935 78.432 1.00 26.96 ? 426  PHE A O     1 
ATOM   3242  C  CB    . PHE A  1  399 ? 39.867  12.103 76.921 1.00 28.45 ? 426  PHE A CB    1 
ATOM   3243  C  CG    . PHE A  1  399 ? 40.662  13.373 77.028 1.00 31.13 ? 426  PHE A CG    1 
ATOM   3244  C  CD1   . PHE A  1  399 ? 40.865  13.982 78.262 1.00 33.66 ? 426  PHE A CD1   1 
ATOM   3245  C  CD2   . PHE A  1  399 ? 41.173  13.981 75.887 1.00 34.33 ? 426  PHE A CD2   1 
ATOM   3246  C  CE1   . PHE A  1  399 ? 41.587  15.161 78.363 1.00 35.97 ? 426  PHE A CE1   1 
ATOM   3247  C  CE2   . PHE A  1  399 ? 41.892  15.166 75.979 1.00 36.48 ? 426  PHE A CE2   1 
ATOM   3248  C  CZ    . PHE A  1  399 ? 42.109  15.748 77.222 1.00 36.05 ? 426  PHE A CZ    1 
ATOM   3249  N  N     . THR A  1  400 ? 38.671  9.211  77.867 1.00 28.63 ? 427  THR A N     1 
ATOM   3250  C  CA    . THR A  1  400 ? 37.586  8.230  77.846 1.00 29.04 ? 427  THR A CA    1 
ATOM   3251  C  C     . THR A  1  400 ? 37.024  8.002  79.252 1.00 30.22 ? 427  THR A C     1 
ATOM   3252  O  O     . THR A  1  400 ? 35.830  7.748  79.411 1.00 30.38 ? 427  THR A O     1 
ATOM   3253  C  CB    . THR A  1  400 ? 38.024  6.888  77.183 1.00 30.32 ? 427  THR A CB    1 
ATOM   3254  O  OG1   . THR A  1  400 ? 38.480  7.139  75.842 1.00 28.54 ? 427  THR A OG1   1 
ATOM   3255  C  CG2   . THR A  1  400 ? 36.862  5.878  77.138 1.00 29.57 ? 427  THR A CG2   1 
ATOM   3256  N  N     . ARG A  1  401 ? 37.891  8.121  80.256 1.00 31.41 ? 428  ARG A N     1 
ATOM   3257  C  CA    . ARG A  1  401 ? 37.544  7.854  81.654 1.00 33.23 ? 428  ARG A CA    1 
ATOM   3258  C  C     . ARG A  1  401 ? 36.982  9.073  82.377 1.00 32.23 ? 428  ARG A C     1 
ATOM   3259  O  O     . ARG A  1  401 ? 36.344  8.912  83.413 1.00 32.97 ? 428  ARG A O     1 
ATOM   3260  C  CB    . ARG A  1  401 ? 38.766  7.351  82.439 1.00 35.13 ? 428  ARG A CB    1 
ATOM   3261  C  CG    . ARG A  1  401 ? 39.181  5.911  82.159 1.00 39.51 ? 428  ARG A CG    1 
ATOM   3262  C  CD    . ARG A  1  401 ? 40.299  5.441  83.118 1.00 45.96 ? 428  ARG A CD    1 
ATOM   3263  N  NE    . ARG A  1  401 ? 41.442  6.360  83.154 1.00 48.01 ? 428  ARG A NE    1 
ATOM   3264  C  CZ    . ARG A  1  401 ? 42.645  6.116  82.627 1.00 50.00 ? 428  ARG A CZ    1 
ATOM   3265  N  NH1   . ARG A  1  401 ? 42.904  4.961  82.018 1.00 51.96 ? 428  ARG A NH1   1 
ATOM   3266  N  NH2   . ARG A  1  401 ? 43.603  7.031  82.724 1.00 49.16 ? 428  ARG A NH2   1 
ATOM   3267  N  N     . GLN A  1  402 ? 37.225  10.277 81.847 1.00 30.67 ? 429  GLN A N     1 
ATOM   3268  C  CA    . GLN A  1  402 ? 36.829  11.516 82.543 1.00 30.37 ? 429  GLN A CA    1 
ATOM   3269  C  C     . GLN A  1  402 ? 35.430  12.036 82.193 1.00 28.96 ? 429  GLN A C     1 
ATOM   3270  O  O     . GLN A  1  402 ? 35.138  12.349 81.040 1.00 27.54 ? 429  GLN A O     1 
ATOM   3271  C  CB    . GLN A  1  402 ? 37.858  12.643 82.352 1.00 30.23 ? 429  GLN A CB    1 
ATOM   3272  C  CG    . GLN A  1  402 ? 37.524  13.875 83.214 1.00 31.33 ? 429  GLN A CG    1 
ATOM   3273  C  CD    . GLN A  1  402 ? 38.536  15.006 83.130 1.00 32.73 ? 429  GLN A CD    1 
ATOM   3274  O  OE1   . GLN A  1  402 ? 39.569  14.903 82.468 1.00 33.19 ? 429  GLN A OE1   1 
ATOM   3275  N  NE2   . GLN A  1  402 ? 38.242  16.095 83.824 1.00 33.43 ? 429  GLN A NE2   1 
ATOM   3276  N  N     . ILE A  1  403 ? 34.591  12.158 83.216 1.00 29.28 ? 430  ILE A N     1 
ATOM   3277  C  CA    . ILE A  1  403 ? 33.218  12.631 83.055 1.00 28.30 ? 430  ILE A CA    1 
ATOM   3278  C  C     . ILE A  1  403 ? 33.142  14.119 82.669 1.00 27.08 ? 430  ILE A C     1 
ATOM   3279  O  O     . ILE A  1  403 ? 33.915  14.947 83.163 1.00 27.12 ? 430  ILE A O     1 
ATOM   3280  C  CB    . ILE A  1  403 ? 32.349  12.309 84.324 1.00 29.73 ? 430  ILE A CB    1 
ATOM   3281  C  CG1   . ILE A  1  403 ? 30.862  12.568 84.069 1.00 30.35 ? 430  ILE A CG1   1 
ATOM   3282  C  CG2   . ILE A  1  403 ? 32.824  13.090 85.557 1.00 30.18 ? 430  ILE A CG2   1 
ATOM   3283  C  CD1   . ILE A  1  403 ? 30.169  11.497 83.277 1.00 32.34 ? 430  ILE A CD1   1 
ATOM   3284  N  N     . ALA A  1  404 ? 32.221  14.429 81.754 1.00 25.97 ? 431  ALA A N     1 
ATOM   3285  C  CA    . ALA A  1  404 ? 31.902  15.804 81.364 1.00 25.21 ? 431  ALA A CA    1 
ATOM   3286  C  C     . ALA A  1  404 ? 30.723  16.332 82.171 1.00 25.49 ? 431  ALA A C     1 
ATOM   3287  O  O     . ALA A  1  404 ? 30.045  15.567 82.865 1.00 26.07 ? 431  ALA A O     1 
ATOM   3288  C  CB    . ALA A  1  404 ? 31.588  15.871 79.882 1.00 24.19 ? 431  ALA A CB    1 
ATOM   3289  N  N     . GLY A  1  405 ? 30.481  17.639 82.074 1.00 24.88 ? 432  GLY A N     1 
ATOM   3290  C  CA    . GLY A  1  405 ? 29.416  18.284 82.828 1.00 25.54 ? 432  GLY A CA    1 
ATOM   3291  C  C     . GLY A  1  405 ? 28.049  18.249 82.159 1.00 25.26 ? 432  GLY A C     1 
ATOM   3292  O  O     . GLY A  1  405 ? 27.944  18.112 80.930 1.00 24.61 ? 432  GLY A O     1 
ATOM   3293  N  N     . ARG A  1  406 ? 27.006  18.359 82.980 1.00 25.52 ? 433  ARG A N     1 
ATOM   3294  C  CA    . ARG A  1  406 ? 25.626  18.450 82.503 1.00 25.31 ? 433  ARG A CA    1 
ATOM   3295  C  C     . ARG A  1  406 ? 25.359  19.840 81.916 1.00 25.28 ? 433  ARG A C     1 
ATOM   3296  O  O     . ARG A  1  406 ? 25.739  20.855 82.515 1.00 26.17 ? 433  ARG A O     1 
ATOM   3297  C  CB    . ARG A  1  406 ? 24.643  18.172 83.648 1.00 25.67 ? 433  ARG A CB    1 
ATOM   3298  C  CG    . ARG A  1  406 ? 23.220  17.901 83.187 1.00 25.66 ? 433  ARG A CG    1 
ATOM   3299  C  CD    . ARG A  1  406 ? 22.302  17.628 84.359 1.00 27.85 ? 433  ARG A CD    1 
ATOM   3300  N  NE    . ARG A  1  406 ? 21.273  16.650 84.009 1.00 27.62 ? 433  ARG A NE    1 
ATOM   3301  C  CZ    . ARG A  1  406 ? 20.346  16.199 84.852 1.00 28.42 ? 433  ARG A CZ    1 
ATOM   3302  N  NH1   . ARG A  1  406 ? 20.297  16.649 86.107 1.00 27.70 ? 433  ARG A NH1   1 
ATOM   3303  N  NH2   . ARG A  1  406 ? 19.460  15.302 84.436 1.00 26.24 ? 433  ARG A NH2   1 
ATOM   3304  N  N     . VAL A  1  407 ? 24.685  19.877 80.769 1.00 24.74 ? 434  VAL A N     1 
ATOM   3305  C  CA    . VAL A  1  407 ? 24.444  21.134 80.036 1.00 24.92 ? 434  VAL A CA    1 
ATOM   3306  C  C     . VAL A  1  407 ? 23.164  21.834 80.484 1.00 25.73 ? 434  VAL A C     1 
ATOM   3307  O  O     . VAL A  1  407 ? 23.199  23.023 80.814 1.00 26.92 ? 434  VAL A O     1 
ATOM   3308  C  CB    . VAL A  1  407 ? 24.460  20.931 78.502 1.00 24.36 ? 434  VAL A CB    1 
ATOM   3309  C  CG1   . VAL A  1  407 ? 24.127  22.247 77.761 1.00 25.33 ? 434  VAL A CG1   1 
ATOM   3310  C  CG2   . VAL A  1  407 ? 25.810  20.396 78.056 1.00 23.47 ? 434  VAL A CG2   1 
ATOM   3311  N  N     . ALA A  1  408 ? 22.045  21.111 80.510 1.00 25.44 ? 435  ALA A N     1 
ATOM   3312  C  CA    . ALA A  1  408 ? 20.808  21.673 81.059 1.00 26.55 ? 435  ALA A CA    1 
ATOM   3313  C  C     . ALA A  1  408 ? 20.827  21.597 82.588 1.00 27.15 ? 435  ALA A C     1 
ATOM   3314  O  O     . ALA A  1  408 ? 21.799  21.118 83.181 1.00 27.27 ? 435  ALA A O     1 
ATOM   3315  C  CB    . ALA A  1  408 ? 19.585  20.961 80.492 1.00 26.31 ? 435  ALA A CB    1 
ATOM   3316  N  N     . GLY A  1  409 ? 19.771  22.091 83.224 1.00 27.97 ? 436  GLY A N     1 
ATOM   3317  C  CA    . GLY A  1  409 ? 19.611  21.944 84.667 1.00 28.96 ? 436  GLY A CA    1 
ATOM   3318  C  C     . GLY A  1  409 ? 20.115  23.125 85.480 1.00 30.28 ? 436  GLY A C     1 
ATOM   3319  O  O     . GLY A  1  409 ? 19.838  23.218 86.677 1.00 31.20 ? 436  GLY A O     1 
ATOM   3320  N  N     . GLY A  1  410 ? 20.867  24.014 84.831 1.00 29.39 ? 437  GLY A N     1 
ATOM   3321  C  CA    . GLY A  1  410 ? 21.323  25.258 85.456 1.00 29.46 ? 437  GLY A CA    1 
ATOM   3322  C  C     . GLY A  1  410 ? 22.656  25.175 86.171 1.00 30.06 ? 437  GLY A C     1 
ATOM   3323  O  O     . GLY A  1  410 ? 23.115  24.087 86.536 1.00 30.27 ? 437  GLY A O     1 
ATOM   3324  N  N     . ARG A  1  411 ? 23.274  26.346 86.343 1.00 29.92 ? 438  ARG A N     1 
ATOM   3325  C  CA    . ARG A  1  411 ? 24.404  26.556 87.249 1.00 30.36 ? 438  ARG A CA    1 
ATOM   3326  C  C     . ARG A  1  411 ? 25.569  25.585 87.055 1.00 30.45 ? 438  ARG A C     1 
ATOM   3327  O  O     . ARG A  1  411 ? 26.081  24.999 88.019 1.00 31.14 ? 438  ARG A O     1 
ATOM   3328  C  CB    . ARG A  1  411 ? 23.921  26.559 88.710 1.00 31.63 ? 438  ARG A CB    1 
ATOM   3329  C  CG    . ARG A  1  411 ? 22.890  27.641 88.998 1.00 31.46 ? 438  ARG A CG    1 
ATOM   3330  C  CD    . ARG A  1  411 ? 22.460  27.673 90.449 1.00 33.75 ? 438  ARG A CD    1 
ATOM   3331  N  NE    . ARG A  1  411 ? 21.709  28.897 90.716 1.00 34.77 ? 438  ARG A NE    1 
ATOM   3332  C  CZ    . ARG A  1  411 ? 20.919  29.098 91.767 1.00 35.93 ? 438  ARG A CZ    1 
ATOM   3333  N  NH1   . ARG A  1  411 ? 20.750  28.151 92.676 1.00 36.09 ? 438  ARG A NH1   1 
ATOM   3334  N  NH2   . ARG A  1  411 ? 20.283  30.257 91.898 1.00 35.51 ? 438  ARG A NH2   1 
ATOM   3335  N  N     . ASN A  1  412 ? 25.990  25.416 85.807 1.00 29.30 ? 439  ASN A N     1 
ATOM   3336  C  CA    . ASN A  1  412 ? 27.086  24.504 85.526 1.00 29.35 ? 439  ASN A CA    1 
ATOM   3337  C  C     . ASN A  1  412 ? 28.091  25.040 84.507 1.00 29.00 ? 439  ASN A C     1 
ATOM   3338  O  O     . ASN A  1  412 ? 28.898  24.283 83.965 1.00 29.27 ? 439  ASN A O     1 
ATOM   3339  C  CB    . ASN A  1  412 ? 26.557  23.114 85.143 1.00 28.84 ? 439  ASN A CB    1 
ATOM   3340  C  CG    . ASN A  1  412 ? 27.549  22.003 85.469 1.00 29.28 ? 439  ASN A CG    1 
ATOM   3341  O  OD1   . ASN A  1  412 ? 28.290  22.082 86.452 1.00 29.98 ? 439  ASN A OD1   1 
ATOM   3342  N  ND2   . ASN A  1  412 ? 27.568  20.964 84.641 1.00 28.02 ? 439  ASN A ND2   1 
ATOM   3343  N  N     . VAL A  1  413 ? 28.054  26.349 84.263 1.00 28.92 ? 440  VAL A N     1 
ATOM   3344  C  CA    . VAL A  1  413 ? 29.052  26.995 83.408 1.00 29.15 ? 440  VAL A CA    1 
ATOM   3345  C  C     . VAL A  1  413 ? 30.304  27.292 84.237 1.00 30.10 ? 440  VAL A C     1 
ATOM   3346  O  O     . VAL A  1  413 ? 30.231  28.034 85.216 1.00 30.77 ? 440  VAL A O     1 
ATOM   3347  C  CB    . VAL A  1  413 ? 28.510  28.289 82.736 1.00 28.69 ? 440  VAL A CB    1 
ATOM   3348  C  CG1   . VAL A  1  413 ? 29.601  28.987 81.919 1.00 28.70 ? 440  VAL A CG1   1 
ATOM   3349  C  CG2   . VAL A  1  413 ? 27.321  27.965 81.848 1.00 28.01 ? 440  VAL A CG2   1 
ATOM   3350  N  N     . PRO A  1  414 ? 31.453  26.697 83.859 1.00 30.66 ? 441  PRO A N     1 
ATOM   3351  C  CA    . PRO A  1  414 ? 32.705  26.912 84.601 1.00 32.05 ? 441  PRO A CA    1 
ATOM   3352  C  C     . PRO A  1  414 ? 33.113  28.387 84.576 1.00 32.83 ? 441  PRO A C     1 
ATOM   3353  O  O     . PRO A  1  414 ? 32.980  29.027 83.535 1.00 31.81 ? 441  PRO A O     1 
ATOM   3354  C  CB    . PRO A  1  414 ? 33.731  26.072 83.826 1.00 32.21 ? 441  PRO A CB    1 
ATOM   3355  C  CG    . PRO A  1  414 ? 32.950  25.200 82.911 1.00 30.68 ? 441  PRO A CG    1 
ATOM   3356  C  CD    . PRO A  1  414 ? 31.654  25.866 82.657 1.00 29.99 ? 441  PRO A CD    1 
ATOM   3357  N  N     . ILE A  1  415 ? 33.615  28.908 85.700 1.00 34.72 ? 442  ILE A N     1 
ATOM   3358  C  CA    . ILE A  1  415 ? 33.972  30.336 85.815 1.00 36.25 ? 442  ILE A CA    1 
ATOM   3359  C  C     . ILE A  1  415 ? 35.054  30.750 84.811 1.00 36.43 ? 442  ILE A C     1 
ATOM   3360  O  O     . ILE A  1  415 ? 35.092  31.904 84.373 1.00 36.68 ? 442  ILE A O     1 
ATOM   3361  C  CB    . ILE A  1  415 ? 34.469  30.747 87.251 1.00 38.36 ? 442  ILE A CB    1 
ATOM   3362  C  CG1   . ILE A  1  415 ? 33.839  29.893 88.363 1.00 40.08 ? 442  ILE A CG1   1 
ATOM   3363  C  CG2   . ILE A  1  415 ? 34.260  32.261 87.497 1.00 38.80 ? 442  ILE A CG2   1 
ATOM   3364  C  CD1   . ILE A  1  415 ? 32.336  30.112 88.579 1.00 41.34 ? 442  ILE A CD1   1 
ATOM   3365  N  N     . ALA A  1  416 ? 35.932  29.810 84.461 1.00 36.46 ? 443  ALA A N     1 
ATOM   3366  C  CA    . ALA A  1  416 ? 37.045  30.077 83.547 1.00 36.87 ? 443  ALA A CA    1 
ATOM   3367  C  C     . ALA A  1  416 ? 36.579  30.619 82.193 1.00 35.86 ? 443  ALA A C     1 
ATOM   3368  O  O     . ALA A  1  416 ? 37.307  31.365 81.533 1.00 36.20 ? 443  ALA A O     1 
ATOM   3369  C  CB    . ALA A  1  416 ? 37.887  28.826 83.360 1.00 37.18 ? 443  ALA A CB    1 
ATOM   3370  N  N     . VAL A  1  417 ? 35.365  30.248 81.796 1.00 34.57 ? 444  VAL A N     1 
ATOM   3371  C  CA    . VAL A  1  417 ? 34.795  30.683 80.519 1.00 34.01 ? 444  VAL A CA    1 
ATOM   3372  C  C     . VAL A  1  417 ? 33.552  31.571 80.688 1.00 33.60 ? 444  VAL A C     1 
ATOM   3373  O  O     . VAL A  1  417 ? 32.730  31.681 79.779 1.00 33.08 ? 444  VAL A O     1 
ATOM   3374  C  CB    . VAL A  1  417 ? 34.481  29.474 79.574 1.00 33.27 ? 444  VAL A CB    1 
ATOM   3375  C  CG1   . VAL A  1  417 ? 35.778  28.776 79.143 1.00 33.47 ? 444  VAL A CG1   1 
ATOM   3376  C  CG2   . VAL A  1  417 ? 33.509  28.486 80.230 1.00 31.79 ? 444  VAL A CG2   1 
ATOM   3377  N  N     . GLN A  1  418 ? 33.418  32.206 81.848 1.00 34.73 ? 445  GLN A N     1 
ATOM   3378  C  CA    . GLN A  1  418 ? 32.266  33.090 82.116 1.00 34.67 ? 445  GLN A CA    1 
ATOM   3379  C  C     . GLN A  1  418 ? 32.087  34.196 81.064 1.00 34.37 ? 445  GLN A C     1 
ATOM   3380  O  O     . GLN A  1  418 ? 30.954  34.546 80.714 1.00 33.59 ? 445  GLN A O     1 
ATOM   3381  C  CB    . GLN A  1  418 ? 32.356  33.703 83.519 1.00 35.80 ? 445  GLN A CB    1 
ATOM   3382  C  CG    . GLN A  1  418 ? 33.514  34.661 83.726 1.00 37.67 ? 445  GLN A CG    1 
ATOM   3383  C  CD    . GLN A  1  418 ? 33.472  35.348 85.081 1.00 41.33 ? 445  GLN A CD    1 
ATOM   3384  O  OE1   . GLN A  1  418 ? 32.407  35.505 85.682 1.00 41.89 ? 445  GLN A OE1   1 
ATOM   3385  N  NE2   . GLN A  1  418 ? 34.636  35.768 85.566 1.00 41.56 ? 445  GLN A NE2   1 
ATOM   3386  N  N     . ALA A  1  419 ? 33.210  34.727 80.571 1.00 35.11 ? 446  ALA A N     1 
ATOM   3387  C  CA    . ALA A  1  419 ? 33.215  35.777 79.553 1.00 35.31 ? 446  ALA A CA    1 
ATOM   3388  C  C     . ALA A  1  419 ? 32.610  35.303 78.232 1.00 34.19 ? 446  ALA A C     1 
ATOM   3389  O  O     . ALA A  1  419 ? 31.911  36.067 77.568 1.00 33.77 ? 446  ALA A O     1 
ATOM   3390  C  CB    . ALA A  1  419 ? 34.626  36.307 79.331 1.00 36.37 ? 446  ALA A CB    1 
ATOM   3391  N  N     . VAL A  1  420 ? 32.888  34.052 77.861 1.00 33.91 ? 447  VAL A N     1 
ATOM   3392  C  CA    . VAL A  1  420 ? 32.341  33.447 76.641 1.00 33.21 ? 447  VAL A CA    1 
ATOM   3393  C  C     . VAL A  1  420 ? 30.839  33.261 76.782 1.00 32.55 ? 447  VAL A C     1 
ATOM   3394  O  O     . VAL A  1  420 ? 30.079  33.578 75.867 1.00 32.05 ? 447  VAL A O     1 
ATOM   3395  C  CB    . VAL A  1  420 ? 33.025  32.094 76.304 1.00 32.98 ? 447  VAL A CB    1 
ATOM   3396  C  CG1   . VAL A  1  420 ? 32.556  31.576 74.958 1.00 32.19 ? 447  VAL A CG1   1 
ATOM   3397  C  CG2   . VAL A  1  420 ? 34.545  32.253 76.289 1.00 34.62 ? 447  VAL A CG2   1 
ATOM   3398  N  N     . ALA A  1  421 ? 30.420  32.758 77.942 1.00 33.15 ? 448  ALA A N     1 
ATOM   3399  C  CA    . ALA A  1  421 ? 29.000  32.608 78.268 1.00 32.61 ? 448  ALA A CA    1 
ATOM   3400  C  C     . ALA A  1  421 ? 28.252  33.948 78.291 1.00 32.97 ? 448  ALA A C     1 
ATOM   3401  O  O     . ALA A  1  421 ? 27.117  34.039 77.815 1.00 32.47 ? 448  ALA A O     1 
ATOM   3402  C  CB    . ALA A  1  421 ? 28.837  31.879 79.591 1.00 33.08 ? 448  ALA A CB    1 
ATOM   3403  N  N     . LYS A  1  422 ? 28.880  34.984 78.842 1.00 33.76 ? 449  LYS A N     1 
ATOM   3404  C  CA    . LYS A  1  422 ? 28.277  36.312 78.828 1.00 33.96 ? 449  LYS A CA    1 
ATOM   3405  C  C     . LYS A  1  422 ? 28.146  36.820 77.391 1.00 33.60 ? 449  LYS A C     1 
ATOM   3406  O  O     . LYS A  1  422 ? 27.143  37.447 77.038 1.00 33.11 ? 449  LYS A O     1 
ATOM   3407  C  CB    . LYS A  1  422 ? 29.090  37.302 79.667 1.00 35.27 ? 449  LYS A CB    1 
ATOM   3408  C  CG    . LYS A  1  422 ? 28.384  38.635 79.904 1.00 35.75 ? 449  LYS A CG    1 
ATOM   3409  C  CD    . LYS A  1  422 ? 29.274  39.617 80.659 1.00 38.14 ? 449  LYS A CD    1 
ATOM   3410  C  CE    . LYS A  1  422 ? 28.573  40.941 80.888 1.00 39.40 ? 449  LYS A CE    1 
ATOM   3411  N  NZ    . LYS A  1  422 ? 28.353  41.710 79.620 1.00 39.47 ? 449  LYS A NZ    1 
ATOM   3412  N  N     . ALA A  1  423 ? 29.163  36.534 76.574 1.00 33.60 ? 450  ALA A N     1 
ATOM   3413  C  CA    . ALA A  1  423 ? 29.171  36.925 75.162 1.00 33.44 ? 450  ALA A CA    1 
ATOM   3414  C  C     . ALA A  1  423 ? 28.023  36.307 74.362 1.00 32.14 ? 450  ALA A C     1 
ATOM   3415  O  O     . ALA A  1  423 ? 27.493  36.950 73.457 1.00 31.88 ? 450  ALA A O     1 
ATOM   3416  C  CB    . ALA A  1  423 ? 30.524  36.608 74.509 1.00 33.70 ? 450  ALA A CB    1 
ATOM   3417  N  N     . SER A  1  424 ? 27.639  35.075 74.705 1.00 31.41 ? 451  SER A N     1 
ATOM   3418  C  CA    . SER A  1  424 ? 26.508  34.402 74.062 1.00 30.61 ? 451  SER A CA    1 
ATOM   3419  C  C     . SER A  1  424 ? 25.197  35.149 74.295 1.00 30.57 ? 451  SER A C     1 
ATOM   3420  O  O     . SER A  1  424 ? 24.374  35.267 73.373 1.00 30.33 ? 451  SER A O     1 
ATOM   3421  C  CB    . SER A  1  424 ? 26.373  32.959 74.546 1.00 30.52 ? 451  SER A CB    1 
ATOM   3422  O  OG    . SER A  1  424 ? 27.541  32.207 74.267 1.00 31.50 ? 451  SER A OG    1 
ATOM   3423  N  N     . ILE A  1  425 ? 25.006  35.639 75.523 1.00 30.18 ? 452  ILE A N     1 
ATOM   3424  C  CA    . ILE A  1  425 ? 23.832  36.440 75.859 1.00 29.93 ? 452  ILE A CA    1 
ATOM   3425  C  C     . ILE A  1  425 ? 23.876  37.793 75.145 1.00 29.95 ? 452  ILE A C     1 
ATOM   3426  O  O     . ILE A  1  425 ? 22.927  38.157 74.458 1.00 29.48 ? 452  ILE A O     1 
ATOM   3427  C  CB    . ILE A  1  425 ? 23.665  36.661 77.392 1.00 30.55 ? 452  ILE A CB    1 
ATOM   3428  C  CG1   . ILE A  1  425 ? 23.465  35.325 78.121 1.00 30.26 ? 452  ILE A CG1   1 
ATOM   3429  C  CG2   . ILE A  1  425 ? 22.486  37.585 77.660 1.00 30.36 ? 452  ILE A CG2   1 
ATOM   3430  C  CD1   . ILE A  1  425 ? 23.595  35.408 79.647 1.00 31.51 ? 452  ILE A CD1   1 
ATOM   3431  N  N     . ASP A  1  426 ? 24.984  38.516 75.298 1.00 30.23 ? 453  ASP A N     1 
ATOM   3432  C  CA    . ASP A  1  426 ? 25.133  39.846 74.708 1.00 31.02 ? 453  ASP A CA    1 
ATOM   3433  C  C     . ASP A  1  426 ? 24.990  39.844 73.180 1.00 30.52 ? 453  ASP A C     1 
ATOM   3434  O  O     . ASP A  1  426 ? 24.359  40.749 72.612 1.00 30.51 ? 453  ASP A O     1 
ATOM   3435  C  CB    . ASP A  1  426 ? 26.464  40.494 75.128 1.00 32.02 ? 453  ASP A CB    1 
ATOM   3436  C  CG    . ASP A  1  426 ? 26.521  40.819 76.620 1.00 34.05 ? 453  ASP A CG    1 
ATOM   3437  O  OD1   . ASP A  1  426 ? 25.460  40.812 77.286 1.00 34.64 ? 453  ASP A OD1   1 
ATOM   3438  O  OD2   . ASP A  1  426 ? 27.633  41.084 77.130 1.00 35.00 ? 453  ASP A OD2   1 
ATOM   3439  N  N     . GLN A  1  427 ? 25.572  38.837 72.526 1.00 29.61 ? 454  GLN A N     1 
ATOM   3440  C  CA    . GLN A  1  427 ? 25.501  38.715 71.066 1.00 29.70 ? 454  GLN A CA    1 
ATOM   3441  C  C     . GLN A  1  427 ? 24.125  38.290 70.549 1.00 28.61 ? 454  GLN A C     1 
ATOM   3442  O  O     . GLN A  1  427 ? 23.691  38.756 69.490 1.00 28.37 ? 454  GLN A O     1 
ATOM   3443  C  CB    . GLN A  1  427 ? 26.608  37.800 70.536 1.00 30.00 ? 454  GLN A CB    1 
ATOM   3444  C  CG    . GLN A  1  427 ? 27.974  38.495 70.523 1.00 32.43 ? 454  GLN A CG    1 
ATOM   3445  C  CD    . GLN A  1  427 ? 29.137  37.544 70.319 1.00 35.64 ? 454  GLN A CD    1 
ATOM   3446  O  OE1   . GLN A  1  427 ? 28.956  36.352 70.054 1.00 37.23 ? 454  GLN A OE1   1 
ATOM   3447  N  NE2   . GLN A  1  427 ? 30.345  38.069 70.446 1.00 37.28 ? 454  GLN A NE2   1 
ATOM   3448  N  N     . SER A  1  428 ? 23.446  37.408 71.287 1.00 28.00 ? 455  SER A N     1 
ATOM   3449  C  CA    . SER A  1  428 ? 22.034  37.101 71.010 1.00 27.78 ? 455  SER A CA    1 
ATOM   3450  C  C     . SER A  1  428 ? 21.245  38.394 70.925 1.00 27.78 ? 455  SER A C     1 
ATOM   3451  O  O     . SER A  1  428 ? 20.421  38.565 70.022 1.00 27.37 ? 455  SER A O     1 
ATOM   3452  C  CB    . SER A  1  428 ? 21.408  36.243 72.109 1.00 27.31 ? 455  SER A CB    1 
ATOM   3453  O  OG    . SER A  1  428 ? 21.905  34.921 72.090 1.00 29.84 ? 455  SER A OG    1 
ATOM   3454  N  N     . ARG A  1  429 ? 21.506  39.292 71.876 1.00 28.19 ? 456  ARG A N     1 
ATOM   3455  C  CA    . ARG A  1  429 ? 20.797  40.569 71.951 1.00 29.16 ? 456  ARG A CA    1 
ATOM   3456  C  C     . ARG A  1  429 ? 21.181  41.503 70.820 1.00 29.66 ? 456  ARG A C     1 
ATOM   3457  O  O     . ARG A  1  429 ? 20.311  42.158 70.242 1.00 29.87 ? 456  ARG A O     1 
ATOM   3458  C  CB    . ARG A  1  429 ? 21.011  41.247 73.304 1.00 29.80 ? 456  ARG A CB    1 
ATOM   3459  C  CG    . ARG A  1  429 ? 20.370  40.490 74.455 1.00 29.64 ? 456  ARG A CG    1 
ATOM   3460  C  CD    . ARG A  1  429 ? 20.750  41.097 75.788 1.00 30.13 ? 456  ARG A CD    1 
ATOM   3461  N  NE    . ARG A  1  429 ? 20.281  40.282 76.908 1.00 29.73 ? 456  ARG A NE    1 
ATOM   3462  C  CZ    . ARG A  1  429 ? 20.408  40.627 78.190 1.00 30.97 ? 456  ARG A CZ    1 
ATOM   3463  N  NH1   . ARG A  1  429 ? 20.987  41.782 78.522 1.00 30.25 ? 456  ARG A NH1   1 
ATOM   3464  N  NH2   . ARG A  1  429 ? 19.950  39.820 79.140 1.00 29.29 ? 456  ARG A NH2   1 
ATOM   3465  N  N     . GLU A  1  430 ? 22.475  41.557 70.503 1.00 29.92 ? 457  GLU A N     1 
ATOM   3466  C  CA    . GLU A  1  430 ? 22.960  42.350 69.378 1.00 31.02 ? 457  GLU A CA    1 
ATOM   3467  C  C     . GLU A  1  430 ? 22.297  41.902 68.079 1.00 29.54 ? 457  GLU A C     1 
ATOM   3468  O  O     . GLU A  1  430 ? 21.942  42.733 67.247 1.00 29.78 ? 457  GLU A O     1 
ATOM   3469  C  CB    . GLU A  1  430 ? 24.476  42.223 69.241 1.00 32.05 ? 457  GLU A CB    1 
ATOM   3470  C  CG    . GLU A  1  430 ? 25.269  43.027 70.251 1.00 36.51 ? 457  GLU A CG    1 
ATOM   3471  C  CD    . GLU A  1  430 ? 26.717  42.550 70.372 1.00 41.14 ? 457  GLU A CD    1 
ATOM   3472  O  OE1   . GLU A  1  430 ? 27.331  42.204 69.336 1.00 42.15 ? 457  GLU A OE1   1 
ATOM   3473  O  OE2   . GLU A  1  430 ? 27.238  42.521 71.515 1.00 44.33 ? 457  GLU A OE2   1 
ATOM   3474  N  N     . MET A  1  431 ? 22.131  40.585 67.928 1.00 28.19 ? 458  MET A N     1 
ATOM   3475  C  CA    . MET A  1  431 ? 21.532  39.982 66.727 1.00 27.26 ? 458  MET A CA    1 
ATOM   3476  C  C     . MET A  1  431 ? 20.001  39.986 66.760 1.00 26.63 ? 458  MET A C     1 
ATOM   3477  O  O     . MET A  1  431 ? 19.344  39.400 65.879 1.00 26.50 ? 458  MET A O     1 
ATOM   3478  C  CB    . MET A  1  431 ? 22.056  38.557 66.526 1.00 26.60 ? 458  MET A CB    1 
ATOM   3479  C  CG    . MET A  1  431 ? 23.532  38.499 66.158 1.00 27.14 ? 458  MET A CG    1 
ATOM   3480  S  SD    . MET A  1  431 ? 24.133  36.836 65.822 1.00 29.00 ? 458  MET A SD    1 
ATOM   3481  C  CE    . MET A  1  431 ? 23.971  36.011 67.416 1.00 25.98 ? 458  MET A CE    1 
ATOM   3482  N  N     . LYS A  1  432 ? 19.457  40.629 67.796 1.00 26.37 ? 459  LYS A N     1 
ATOM   3483  C  CA    A LYS A  1  432 ? 18.005  40.822 67.942 0.50 26.15 ? 459  LYS A CA    1 
ATOM   3484  C  CA    B LYS A  1  432 ? 18.013  40.806 67.990 0.50 26.31 ? 459  LYS A CA    1 
ATOM   3485  C  C     . LYS A  1  432 ? 17.196  39.516 67.854 1.00 25.32 ? 459  LYS A C     1 
ATOM   3486  O  O     . LYS A  1  432 ? 16.203  39.440 67.118 1.00 25.31 ? 459  LYS A O     1 
ATOM   3487  C  CB    A LYS A  1  432 ? 17.482  41.856 66.923 0.50 26.61 ? 459  LYS A CB    1 
ATOM   3488  C  CB    B LYS A  1  432 ? 17.487  41.959 67.122 0.50 26.96 ? 459  LYS A CB    1 
ATOM   3489  C  CG    A LYS A  1  432 ? 18.166  43.220 66.980 0.50 27.11 ? 459  LYS A CG    1 
ATOM   3490  C  CG    B LYS A  1  432 ? 17.819  43.313 67.735 0.50 28.24 ? 459  LYS A CG    1 
ATOM   3491  C  CD    A LYS A  1  432 ? 17.863  43.933 68.288 0.50 27.54 ? 459  LYS A CD    1 
ATOM   3492  C  CD    B LYS A  1  432 ? 17.988  44.413 66.712 0.50 29.54 ? 459  LYS A CD    1 
ATOM   3493  C  CE    A LYS A  1  432 ? 16.416  44.406 68.340 0.50 28.13 ? 459  LYS A CE    1 
ATOM   3494  C  CE    B LYS A  1  432 ? 18.344  45.713 67.418 0.50 31.45 ? 459  LYS A CE    1 
ATOM   3495  N  NZ    A LYS A  1  432 ? 15.976  44.628 69.741 0.50 27.39 ? 459  LYS A NZ    1 
ATOM   3496  N  NZ    B LYS A  1  432 ? 18.496  46.853 66.485 0.50 33.09 ? 459  LYS A NZ    1 
ATOM   3497  N  N     . TYR A  1  433 ? 17.622  38.499 68.600 1.00 24.60 ? 460  TYR A N     1 
ATOM   3498  C  CA    . TYR A  1  433 ? 16.924  37.218 68.677 1.00 24.02 ? 460  TYR A CA    1 
ATOM   3499  C  C     . TYR A  1  433 ? 15.539  37.398 69.293 1.00 24.84 ? 460  TYR A C     1 
ATOM   3500  O  O     . TYR A  1  433 ? 15.371  38.155 70.252 1.00 25.06 ? 460  TYR A O     1 
ATOM   3501  C  CB    . TYR A  1  433 ? 17.699  36.251 69.580 1.00 23.46 ? 460  TYR A CB    1 
ATOM   3502  C  CG    . TYR A  1  433 ? 18.773  35.400 68.915 1.00 22.80 ? 460  TYR A CG    1 
ATOM   3503  C  CD1   . TYR A  1  433 ? 19.440  35.825 67.765 1.00 22.47 ? 460  TYR A CD1   1 
ATOM   3504  C  CD2   . TYR A  1  433 ? 19.145  34.183 69.482 1.00 22.40 ? 460  TYR A CD2   1 
ATOM   3505  C  CE1   . TYR A  1  433 ? 20.439  35.036 67.177 1.00 22.74 ? 460  TYR A CE1   1 
ATOM   3506  C  CE2   . TYR A  1  433 ? 20.130  33.391 68.916 1.00 23.06 ? 460  TYR A CE2   1 
ATOM   3507  C  CZ    . TYR A  1  433 ? 20.778  33.825 67.767 1.00 22.83 ? 460  TYR A CZ    1 
ATOM   3508  O  OH    . TYR A  1  433 ? 21.759  33.034 67.227 1.00 23.14 ? 460  TYR A OH    1 
ATOM   3509  N  N     . GLN A  1  434 ? 14.564  36.671 68.762 1.00 25.03 ? 461  GLN A N     1 
ATOM   3510  C  CA    . GLN A  1  434 ? 13.251  36.558 69.390 1.00 26.05 ? 461  GLN A CA    1 
ATOM   3511  C  C     . GLN A  1  434 ? 13.356  35.722 70.677 1.00 26.09 ? 461  GLN A C     1 
ATOM   3512  O  O     . GLN A  1  434 ? 14.421  35.160 70.983 1.00 25.68 ? 461  GLN A O     1 
ATOM   3513  C  CB    . GLN A  1  434 ? 12.254  35.958 68.400 1.00 26.13 ? 461  GLN A CB    1 
ATOM   3514  C  CG    . GLN A  1  434 ? 11.932  36.912 67.252 1.00 28.51 ? 461  GLN A CG    1 
ATOM   3515  C  CD    . GLN A  1  434 ? 10.841  36.396 66.347 1.00 30.57 ? 461  GLN A CD    1 
ATOM   3516  O  OE1   . GLN A  1  434 ? 9.815   35.908 66.813 1.00 32.14 ? 461  GLN A OE1   1 
ATOM   3517  N  NE2   . GLN A  1  434 ? 11.052  36.508 65.039 1.00 29.75 ? 461  GLN A NE2   1 
ATOM   3518  N  N     . SER A  1  435 ? 12.267  35.654 71.429 1.00 26.73 ? 462  SER A N     1 
ATOM   3519  C  CA    . SER A  1  435 ? 12.277  35.005 72.743 1.00 27.27 ? 462  SER A CA    1 
ATOM   3520  C  C     . SER A  1  435 ? 12.323  33.481 72.654 1.00 26.86 ? 462  SER A C     1 
ATOM   3521  O  O     . SER A  1  435 ? 12.083  32.907 71.589 1.00 26.46 ? 462  SER A O     1 
ATOM   3522  C  CB    . SER A  1  435 ? 11.045  35.425 73.541 1.00 28.37 ? 462  SER A CB    1 
ATOM   3523  O  OG    . SER A  1  435 ? 9.869   34.794 73.043 1.00 29.42 ? 462  SER A OG    1 
ATOM   3524  N  N     . LEU A  1  436 ? 12.632  32.838 73.785 1.00 26.94 ? 463  LEU A N     1 
ATOM   3525  C  CA    . LEU A  1  436 ? 12.545  31.380 73.921 1.00 26.83 ? 463  LEU A CA    1 
ATOM   3526  C  C     . LEU A  1  436 ? 11.209  30.836 73.418 1.00 27.03 ? 463  LEU A C     1 
ATOM   3527  O  O     . LEU A  1  436 ? 11.172  29.885 72.639 1.00 26.91 ? 463  LEU A O     1 
ATOM   3528  C  CB    . LEU A  1  436 ? 12.726  30.960 75.387 1.00 27.15 ? 463  LEU A CB    1 
ATOM   3529  C  CG    . LEU A  1  436 ? 12.301  29.524 75.713 1.00 27.51 ? 463  LEU A CG    1 
ATOM   3530  C  CD1   . LEU A  1  436 ? 13.355  28.518 75.256 1.00 27.17 ? 463  LEU A CD1   1 
ATOM   3531  C  CD2   . LEU A  1  436 ? 11.986  29.365 77.201 1.00 28.74 ? 463  LEU A CD2   1 
ATOM   3532  N  N     . ASN A  1  437 ? 10.116  31.436 73.880 1.00 27.58 ? 464  ASN A N     1 
ATOM   3533  C  CA    . ASN A  1  437 ? 8.792   30.954 73.526 1.00 28.02 ? 464  ASN A CA    1 
ATOM   3534  C  C     . ASN A  1  437 ? 8.472   31.093 72.043 1.00 27.78 ? 464  ASN A C     1 
ATOM   3535  O  O     . ASN A  1  437 ? 7.767   30.256 71.483 1.00 28.41 ? 464  ASN A O     1 
ATOM   3536  C  CB    . ASN A  1  437 ? 7.716   31.562 74.430 1.00 28.87 ? 464  ASN A CB    1 
ATOM   3537  C  CG    . ASN A  1  437 ? 7.605   30.825 75.766 1.00 30.51 ? 464  ASN A CG    1 
ATOM   3538  O  OD1   . ASN A  1  437 ? 8.173   29.739 75.938 1.00 30.15 ? 464  ASN A OD1   1 
ATOM   3539  N  ND2   . ASN A  1  437 ? 6.874   31.406 76.707 1.00 30.25 ? 464  ASN A ND2   1 
ATOM   3540  N  N     . GLU A  1  438 ? 9.018   32.123 71.400 1.00 27.22 ? 465  GLU A N     1 
ATOM   3541  C  CA    . GLU A  1  438 ? 8.887   32.248 69.945 1.00 26.99 ? 465  GLU A CA    1 
ATOM   3542  C  C     . GLU A  1  438 ? 9.640   31.128 69.222 1.00 25.92 ? 465  GLU A C     1 
ATOM   3543  O  O     . GLU A  1  438 ? 9.165   30.607 68.213 1.00 26.12 ? 465  GLU A O     1 
ATOM   3544  C  CB    . GLU A  1  438 ? 9.351   33.623 69.452 1.00 27.16 ? 465  GLU A CB    1 
ATOM   3545  C  CG    . GLU A  1  438 ? 8.548   34.794 70.005 1.00 29.61 ? 465  GLU A CG    1 
ATOM   3546  C  CD    . GLU A  1  438 ? 7.083   34.786 69.595 1.00 33.74 ? 465  GLU A CD    1 
ATOM   3547  O  OE1   . GLU A  1  438 ? 6.731   34.233 68.526 1.00 35.08 ? 465  GLU A OE1   1 
ATOM   3548  O  OE2   . GLU A  1  438 ? 6.273   35.359 70.346 1.00 36.62 ? 465  GLU A OE2   1 
ATOM   3549  N  N     . TYR A  1  439 ? 10.804  30.751 69.744 1.00 24.60 ? 466  TYR A N     1 
ATOM   3550  C  CA    . TYR A  1  439 ? 11.559  29.641 69.173 1.00 24.11 ? 466  TYR A CA    1 
ATOM   3551  C  C     . TYR A  1  439 ? 10.912  28.283 69.435 1.00 24.36 ? 466  TYR A C     1 
ATOM   3552  O  O     . TYR A  1  439 ? 10.911  27.421 68.555 1.00 24.37 ? 466  TYR A O     1 
ATOM   3553  C  CB    . TYR A  1  439 ? 13.020  29.665 69.632 1.00 23.17 ? 466  TYR A CB    1 
ATOM   3554  C  CG    . TYR A  1  439 ? 13.824  30.622 68.796 1.00 23.40 ? 466  TYR A CG    1 
ATOM   3555  C  CD1   . TYR A  1  439 ? 14.154  31.892 69.276 1.00 22.77 ? 466  TYR A CD1   1 
ATOM   3556  C  CD2   . TYR A  1  439 ? 14.212  30.278 67.504 1.00 22.30 ? 466  TYR A CD2   1 
ATOM   3557  C  CE1   . TYR A  1  439 ? 14.879  32.779 68.503 1.00 22.92 ? 466  TYR A CE1   1 
ATOM   3558  C  CE2   . TYR A  1  439 ? 14.930  31.162 66.716 1.00 23.91 ? 466  TYR A CE2   1 
ATOM   3559  C  CZ    . TYR A  1  439 ? 15.256  32.412 67.219 1.00 23.35 ? 466  TYR A CZ    1 
ATOM   3560  O  OH    . TYR A  1  439 ? 15.966  33.287 66.436 1.00 23.75 ? 466  TYR A OH    1 
ATOM   3561  N  N     . ARG A  1  440 ? 10.365  28.102 70.632 1.00 24.35 ? 467  ARG A N     1 
ATOM   3562  C  CA    . ARG A  1  440 ? 9.581   26.906 70.932 1.00 25.68 ? 467  ARG A CA    1 
ATOM   3563  C  C     . ARG A  1  440 ? 8.436   26.730 69.931 1.00 25.88 ? 467  ARG A C     1 
ATOM   3564  O  O     . ARG A  1  440 ? 8.309   25.669 69.322 1.00 26.23 ? 467  ARG A O     1 
ATOM   3565  C  CB    . ARG A  1  440 ? 9.064   26.927 72.379 1.00 26.03 ? 467  ARG A CB    1 
ATOM   3566  C  CG    . ARG A  1  440 ? 10.180  26.671 73.387 1.00 26.54 ? 467  ARG A CG    1 
ATOM   3567  C  CD    . ARG A  1  440 ? 9.683   26.506 74.815 1.00 26.87 ? 467  ARG A CD    1 
ATOM   3568  N  NE    . ARG A  1  440 ? 8.710   25.422 74.999 1.00 28.87 ? 467  ARG A NE    1 
ATOM   3569  C  CZ    . ARG A  1  440 ? 9.018   24.131 75.125 1.00 29.99 ? 467  ARG A CZ    1 
ATOM   3570  N  NH1   . ARG A  1  440 ? 10.287  23.726 75.055 1.00 29.82 ? 467  ARG A NH1   1 
ATOM   3571  N  NH2   . ARG A  1  440 ? 8.050   23.236 75.311 1.00 28.92 ? 467  ARG A NH2   1 
ATOM   3572  N  N     . LYS A  1  441 ? 7.639   27.777 69.734 1.00 26.41 ? 468  LYS A N     1 
ATOM   3573  C  CA    . LYS A  1  441 ? 6.540   27.738 68.747 1.00 27.65 ? 468  LYS A CA    1 
ATOM   3574  C  C     . LYS A  1  441 ? 7.028   27.448 67.323 1.00 27.40 ? 468  LYS A C     1 
ATOM   3575  O  O     . LYS A  1  441 ? 6.425   26.650 66.611 1.00 27.99 ? 468  LYS A O     1 
ATOM   3576  C  CB    . LYS A  1  441 ? 5.725   29.032 68.773 1.00 28.48 ? 468  LYS A CB    1 
ATOM   3577  C  CG    . LYS A  1  441 ? 4.858   29.196 70.030 1.00 30.45 ? 468  LYS A CG    1 
ATOM   3578  C  CD    . LYS A  1  441 ? 3.831   30.306 69.875 1.00 34.01 ? 468  LYS A CD    1 
ATOM   3579  C  CE    . LYS A  1  441 ? 4.442   31.683 70.075 1.00 34.89 ? 468  LYS A CE    1 
ATOM   3580  N  NZ    . LYS A  1  441 ? 3.442   32.755 69.798 1.00 37.72 ? 468  LYS A NZ    1 
ATOM   3581  N  N     . ARG A  1  442 ? 8.135   28.080 66.929 1.00 26.75 ? 469  ARG A N     1 
ATOM   3582  C  CA    . ARG A  1  442 ? 8.747   27.859 65.610 1.00 26.83 ? 469  ARG A CA    1 
ATOM   3583  C  C     . ARG A  1  442 ? 9.109   26.382 65.379 1.00 27.16 ? 469  ARG A C     1 
ATOM   3584  O  O     . ARG A  1  442 ? 9.116   25.909 64.249 1.00 27.58 ? 469  ARG A O     1 
ATOM   3585  C  CB    . ARG A  1  442 ? 9.967   28.779 65.425 1.00 25.52 ? 469  ARG A CB    1 
ATOM   3586  C  CG    . ARG A  1  442 ? 10.847  28.515 64.191 1.00 25.58 ? 469  ARG A CG    1 
ATOM   3587  C  CD    . ARG A  1  442 ? 10.131  28.765 62.844 1.00 26.37 ? 469  ARG A CD    1 
ATOM   3588  N  NE    . ARG A  1  442 ? 11.034  28.470 61.730 1.00 27.08 ? 469  ARG A NE    1 
ATOM   3589  C  CZ    . ARG A  1  442 ? 11.380  27.245 61.330 1.00 27.10 ? 469  ARG A CZ    1 
ATOM   3590  N  NH1   . ARG A  1  442 ? 10.882  26.165 61.927 1.00 24.63 ? 469  ARG A NH1   1 
ATOM   3591  N  NH2   . ARG A  1  442 ? 12.230  27.098 60.321 1.00 27.40 ? 469  ARG A NH2   1 
ATOM   3592  N  N     . PHE A  1  443 ? 9.371   25.653 66.460 1.00 27.72 ? 470  PHE A N     1 
ATOM   3593  C  CA    . PHE A  1  443 ? 9.723   24.244 66.352 1.00 28.48 ? 470  PHE A CA    1 
ATOM   3594  C  C     . PHE A  1  443 ? 8.650   23.297 66.902 1.00 29.76 ? 470  PHE A C     1 
ATOM   3595  O  O     . PHE A  1  443 ? 8.959   22.192 67.362 1.00 30.18 ? 470  PHE A O     1 
ATOM   3596  C  CB    . PHE A  1  443 ? 11.106  24.007 66.967 1.00 27.66 ? 470  PHE A CB    1 
ATOM   3597  C  CG    . PHE A  1  443 ? 12.224  24.547 66.120 1.00 27.29 ? 470  PHE A CG    1 
ATOM   3598  C  CD1   . PHE A  1  443 ? 12.880  23.724 65.209 1.00 27.13 ? 470  PHE A CD1   1 
ATOM   3599  C  CD2   . PHE A  1  443 ? 12.588  25.896 66.196 1.00 27.13 ? 470  PHE A CD2   1 
ATOM   3600  C  CE1   . PHE A  1  443 ? 13.904  24.223 64.402 1.00 26.81 ? 470  PHE A CE1   1 
ATOM   3601  C  CE2   . PHE A  1  443 ? 13.599  26.411 65.394 1.00 26.30 ? 470  PHE A CE2   1 
ATOM   3602  C  CZ    . PHE A  1  443 ? 14.262  25.574 64.491 1.00 26.90 ? 470  PHE A CZ    1 
ATOM   3603  N  N     . SER A  1  444 ? 7.392   23.741 66.816 1.00 30.65 ? 471  SER A N     1 
ATOM   3604  C  CA    . SER A  1  444 ? 6.210   22.946 67.178 1.00 32.33 ? 471  SER A CA    1 
ATOM   3605  C  C     . SER A  1  444 ? 6.190   22.508 68.637 1.00 32.49 ? 471  SER A C     1 
ATOM   3606  O  O     . SER A  1  444 ? 5.734   21.414 68.954 1.00 33.74 ? 471  SER A O     1 
ATOM   3607  C  CB    . SER A  1  444 ? 6.057   21.727 66.257 1.00 33.02 ? 471  SER A CB    1 
ATOM   3608  O  OG    . SER A  1  444 ? 5.972   22.131 64.907 1.00 34.23 ? 471  SER A OG    1 
ATOM   3609  N  N     . LEU A  1  445 ? 6.706   23.360 69.516 1.00 31.85 ? 472  LEU A N     1 
ATOM   3610  C  CA    . LEU A  1  445 ? 6.682   23.096 70.949 1.00 32.34 ? 472  LEU A CA    1 
ATOM   3611  C  C     . LEU A  1  445 ? 5.688   24.045 71.615 1.00 32.88 ? 472  LEU A C     1 
ATOM   3612  O  O     . LEU A  1  445 ? 5.487   25.167 71.145 1.00 32.81 ? 472  LEU A O     1 
ATOM   3613  C  CB    . LEU A  1  445 ? 8.070   23.295 71.569 1.00 30.88 ? 472  LEU A CB    1 
ATOM   3614  C  CG    . LEU A  1  445 ? 9.273   22.564 70.963 1.00 30.88 ? 472  LEU A CG    1 
ATOM   3615  C  CD1   . LEU A  1  445 ? 10.553  22.984 71.673 1.00 28.09 ? 472  LEU A CD1   1 
ATOM   3616  C  CD2   . LEU A  1  445 ? 9.084   21.054 71.023 1.00 30.35 ? 472  LEU A CD2   1 
ATOM   3617  N  N     . LYS A  1  446 ? 5.077   23.586 72.703 1.00 33.54 ? 473  LYS A N     1 
ATOM   3618  C  CA    . LYS A  1  446 ? 4.185   24.414 73.503 1.00 34.44 ? 473  LYS A CA    1 
ATOM   3619  C  C     . LYS A  1  446 ? 5.014   25.458 74.249 1.00 33.50 ? 473  LYS A C     1 
ATOM   3620  O  O     . LYS A  1  446 ? 6.036   25.118 74.849 1.00 33.01 ? 473  LYS A O     1 
ATOM   3621  C  CB    . LYS A  1  446 ? 3.415   23.542 74.494 1.00 35.66 ? 473  LYS A CB    1 
ATOM   3622  C  CG    . LYS A  1  446 ? 2.230   24.220 75.148 1.00 38.11 ? 473  LYS A CG    1 
ATOM   3623  N  N     . PRO A  1  447 ? 4.590   26.737 74.203 1.00 33.60 ? 474  PRO A N     1 
ATOM   3624  C  CA    . PRO A  1  447 ? 5.292   27.766 74.980 1.00 32.95 ? 474  PRO A CA    1 
ATOM   3625  C  C     . PRO A  1  447 ? 5.257   27.456 76.481 1.00 33.67 ? 474  PRO A C     1 
ATOM   3626  O  O     . PRO A  1  447 ? 4.243   26.964 76.983 1.00 34.81 ? 474  PRO A O     1 
ATOM   3627  C  CB    . PRO A  1  447 ? 4.479   29.041 74.712 1.00 33.46 ? 474  PRO A CB    1 
ATOM   3628  C  CG    . PRO A  1  447 ? 3.601   28.740 73.549 1.00 34.03 ? 474  PRO A CG    1 
ATOM   3629  C  CD    . PRO A  1  447 ? 3.394   27.264 73.517 1.00 34.28 ? 474  PRO A CD    1 
ATOM   3630  N  N     . TYR A  1  448 ? 6.347   27.743 77.187 1.00 32.92 ? 475  TYR A N     1 
ATOM   3631  C  CA    . TYR A  1  448 ? 6.338   27.682 78.650 1.00 33.87 ? 475  TYR A CA    1 
ATOM   3632  C  C     . TYR A  1  448 ? 5.412   28.739 79.248 1.00 34.86 ? 475  TYR A C     1 
ATOM   3633  O  O     . TYR A  1  448 ? 5.388   29.882 78.787 1.00 34.16 ? 475  TYR A O     1 
ATOM   3634  C  CB    . TYR A  1  448 ? 7.753   27.837 79.212 1.00 33.21 ? 475  TYR A CB    1 
ATOM   3635  C  CG    . TYR A  1  448 ? 8.597   26.592 79.048 1.00 32.78 ? 475  TYR A CG    1 
ATOM   3636  C  CD1   . TYR A  1  448 ? 9.797   26.629 78.348 1.00 31.34 ? 475  TYR A CD1   1 
ATOM   3637  C  CD2   . TYR A  1  448 ? 8.181   25.372 79.582 1.00 34.26 ? 475  TYR A CD2   1 
ATOM   3638  C  CE1   . TYR A  1  448 ? 10.572  25.489 78.193 1.00 31.16 ? 475  TYR A CE1   1 
ATOM   3639  C  CE2   . TYR A  1  448 ? 8.950   24.218 79.430 1.00 34.25 ? 475  TYR A CE2   1 
ATOM   3640  C  CZ    . TYR A  1  448 ? 10.140  24.287 78.737 1.00 32.00 ? 475  TYR A CZ    1 
ATOM   3641  O  OH    . TYR A  1  448 ? 10.895  23.153 78.576 1.00 32.26 ? 475  TYR A OH    1 
ATOM   3642  N  N     . THR A  1  449 ? 4.656   28.344 80.273 1.00 36.47 ? 476  THR A N     1 
ATOM   3643  C  CA    . THR A  1  449 ? 3.660   29.224 80.898 1.00 37.62 ? 476  THR A CA    1 
ATOM   3644  C  C     . THR A  1  449 ? 4.147   29.820 82.223 1.00 37.81 ? 476  THR A C     1 
ATOM   3645  O  O     . THR A  1  449 ? 3.471   30.655 82.812 1.00 38.69 ? 476  THR A O     1 
ATOM   3646  C  CB    . THR A  1  449 ? 2.305   28.508 81.117 1.00 39.38 ? 476  THR A CB    1 
ATOM   3647  O  OG1   . THR A  1  449 ? 2.500   27.336 81.910 1.00 40.36 ? 476  THR A OG1   1 
ATOM   3648  C  CG2   . THR A  1  449 ? 1.682   28.112 79.788 1.00 39.71 ? 476  THR A CG2   1 
ATOM   3649  N  N     . SER A  1  450 ? 5.322   29.388 82.678 1.00 36.83 ? 477  SER A N     1 
ATOM   3650  C  CA    . SER A  1  450 ? 5.941   29.925 83.890 1.00 37.06 ? 477  SER A CA    1 
ATOM   3651  C  C     . SER A  1  450 ? 7.429   29.601 83.893 1.00 35.84 ? 477  SER A C     1 
ATOM   3652  O  O     . SER A  1  450 ? 7.874   28.713 83.161 1.00 34.58 ? 477  SER A O     1 
ATOM   3653  C  CB    . SER A  1  450 ? 5.280   29.342 85.149 1.00 38.42 ? 477  SER A CB    1 
ATOM   3654  O  OG    . SER A  1  450 ? 5.654   27.990 85.336 1.00 38.69 ? 477  SER A OG    1 
ATOM   3655  N  N     . PHE A  1  451 ? 8.189   30.308 84.729 1.00 36.02 ? 478  PHE A N     1 
ATOM   3656  C  CA    . PHE A  1  451 ? 9.615   30.031 84.888 1.00 35.50 ? 478  PHE A CA    1 
ATOM   3657  C  C     . PHE A  1  451 ? 9.843   28.710 85.621 1.00 36.26 ? 478  PHE A C     1 
ATOM   3658  O  O     . PHE A  1  451 ? 10.832  28.007 85.359 1.00 35.67 ? 478  PHE A O     1 
ATOM   3659  C  CB    . PHE A  1  451 ? 10.311  31.189 85.613 1.00 35.77 ? 478  PHE A CB    1 
ATOM   3660  C  CG    . PHE A  1  451 ? 10.394  32.453 84.794 1.00 35.07 ? 478  PHE A CG    1 
ATOM   3661  C  CD1   . PHE A  1  451 ? 11.448  32.654 83.906 1.00 34.02 ? 478  PHE A CD1   1 
ATOM   3662  C  CD2   . PHE A  1  451 ? 9.422   33.436 84.909 1.00 35.47 ? 478  PHE A CD2   1 
ATOM   3663  C  CE1   . PHE A  1  451 ? 11.530  33.829 83.144 1.00 33.56 ? 478  PHE A CE1   1 
ATOM   3664  C  CE2   . PHE A  1  451 ? 9.496   34.608 84.153 1.00 35.50 ? 478  PHE A CE2   1 
ATOM   3665  C  CZ    . PHE A  1  451 ? 10.553  34.801 83.268 1.00 33.06 ? 478  PHE A CZ    1 
ATOM   3666  N  N     . GLU A  1  452 ? 8.917   28.376 86.526 1.00 37.60 ? 479  GLU A N     1 
ATOM   3667  C  CA    . GLU A  1  452 ? 8.949   27.106 87.246 1.00 38.58 ? 479  GLU A CA    1 
ATOM   3668  C  C     . GLU A  1  452 ? 8.753   25.926 86.304 1.00 37.99 ? 479  GLU A C     1 
ATOM   3669  O  O     . GLU A  1  452 ? 9.367   24.876 86.493 1.00 37.71 ? 479  GLU A O     1 
ATOM   3670  C  CB    . GLU A  1  452 ? 7.912   27.077 88.378 1.00 40.21 ? 479  GLU A CB    1 
ATOM   3671  C  CG    . GLU A  1  452 ? 8.335   27.885 89.604 1.00 42.21 ? 479  GLU A CG    1 
ATOM   3672  C  CD    . GLU A  1  452 ? 7.434   27.692 90.823 1.00 45.64 ? 479  GLU A CD    1 
ATOM   3673  O  OE1   . GLU A  1  452 ? 6.402   26.988 90.733 1.00 46.93 ? 479  GLU A OE1   1 
ATOM   3674  O  OE2   . GLU A  1  452 ? 7.768   28.259 91.884 1.00 46.86 ? 479  GLU A OE2   1 
ATOM   3675  N  N     . GLU A  1  453 ? 7.909   26.105 85.289 1.00 37.85 ? 480  GLU A N     1 
ATOM   3676  C  CA    . GLU A  1  453 ? 7.700   25.077 84.267 1.00 37.81 ? 480  GLU A CA    1 
ATOM   3677  C  C     . GLU A  1  453 ? 8.960   24.872 83.426 1.00 36.18 ? 480  GLU A C     1 
ATOM   3678  O  O     . GLU A  1  453 ? 9.270   23.743 83.035 1.00 35.94 ? 480  GLU A O     1 
ATOM   3679  C  CB    . GLU A  1  453 ? 6.507   25.419 83.363 1.00 38.34 ? 480  GLU A CB    1 
ATOM   3680  C  CG    . GLU A  1  453 ? 6.140   24.312 82.369 1.00 40.06 ? 480  GLU A CG    1 
ATOM   3681  C  CD    . GLU A  1  453 ? 4.951   24.658 81.486 1.00 43.35 ? 480  GLU A CD    1 
ATOM   3682  O  OE1   . GLU A  1  453 ? 4.887   25.784 80.949 1.00 42.71 ? 480  GLU A OE1   1 
ATOM   3683  O  OE2   . GLU A  1  453 ? 4.068   23.789 81.322 1.00 46.99 ? 480  GLU A OE2   1 
ATOM   3684  N  N     . LEU A  1  454 ? 9.679   25.964 83.160 1.00 35.11 ? 481  LEU A N     1 
ATOM   3685  C  CA    . LEU A  1  454 ? 10.922  25.912 82.391 1.00 33.95 ? 481  LEU A CA    1 
ATOM   3686  C  C     . LEU A  1  454 ? 12.026  25.123 83.111 1.00 33.83 ? 481  LEU A C     1 
ATOM   3687  O  O     . LEU A  1  454 ? 12.664  24.255 82.508 1.00 33.23 ? 481  LEU A O     1 
ATOM   3688  C  CB    . LEU A  1  454 ? 11.408  27.331 82.036 1.00 33.23 ? 481  LEU A CB    1 
ATOM   3689  C  CG    . LEU A  1  454 ? 12.871  27.530 81.596 1.00 32.73 ? 481  LEU A CG    1 
ATOM   3690  C  CD1   . LEU A  1  454 ? 13.198  26.842 80.258 1.00 32.18 ? 481  LEU A CD1   1 
ATOM   3691  C  CD2   . LEU A  1  454 ? 13.214  29.002 81.523 1.00 32.02 ? 481  LEU A CD2   1 
ATOM   3692  N  N     . THR A  1  455 ? 12.238  25.424 84.393 1.00 34.32 ? 482  THR A N     1 
ATOM   3693  C  CA    . THR A  1  455 ? 13.358  24.857 85.149 1.00 34.25 ? 482  THR A CA    1 
ATOM   3694  C  C     . THR A  1  455 ? 12.993  23.582 85.903 1.00 35.42 ? 482  THR A C     1 
ATOM   3695  O  O     . THR A  1  455 ? 13.862  22.781 86.232 1.00 35.20 ? 482  THR A O     1 
ATOM   3696  C  CB    . THR A  1  455 ? 13.941  25.865 86.165 1.00 34.58 ? 482  THR A CB    1 
ATOM   3697  O  OG1   . THR A  1  455 ? 13.017  26.051 87.244 1.00 35.45 ? 482  THR A OG1   1 
ATOM   3698  C  CG2   . THR A  1  455 ? 14.239  27.205 85.505 1.00 33.51 ? 482  THR A CG2   1 
ATOM   3699  N  N     . GLY A  1  456 ? 11.707  23.409 86.192 1.00 36.84 ? 483  GLY A N     1 
ATOM   3700  C  CA    . GLY A  1  456 ? 11.244  22.279 86.992 1.00 38.46 ? 483  GLY A CA    1 
ATOM   3701  C  C     . GLY A  1  456 ? 11.599  22.393 88.461 1.00 39.89 ? 483  GLY A C     1 
ATOM   3702  O  O     . GLY A  1  456 ? 11.420  21.436 89.215 1.00 41.24 ? 483  GLY A O     1 
ATOM   3703  N  N     . GLU A  1  457 ? 12.101  23.558 88.870 1.00 39.87 ? 484  GLU A N     1 
ATOM   3704  C  CA    . GLU A  1  457 ? 12.451  23.819 90.275 1.00 41.21 ? 484  GLU A CA    1 
ATOM   3705  C  C     . GLU A  1  457 ? 11.967  25.204 90.716 1.00 41.64 ? 484  GLU A C     1 
ATOM   3706  O  O     . GLU A  1  457 ? 11.285  25.887 89.951 1.00 41.54 ? 484  GLU A O     1 
ATOM   3707  C  CB    . GLU A  1  457 ? 13.959  23.628 90.518 1.00 40.76 ? 484  GLU A CB    1 
ATOM   3708  C  CG    . GLU A  1  457 ? 14.873  24.406 89.579 1.00 40.00 ? 484  GLU A CG    1 
ATOM   3709  C  CD    . GLU A  1  457 ? 15.084  25.842 90.022 1.00 41.62 ? 484  GLU A CD    1 
ATOM   3710  O  OE1   . GLU A  1  457 ? 14.444  26.748 89.439 1.00 41.53 ? 484  GLU A OE1   1 
ATOM   3711  O  OE2   . GLU A  1  457 ? 15.881  26.061 90.962 1.00 42.27 ? 484  GLU A OE2   1 
ATOM   3712  N  N     . LYS A  1  458 ? 12.319  25.618 91.933 1.00 42.53 ? 485  LYS A N     1 
ATOM   3713  C  CA    . LYS A  1  458 ? 11.784  26.857 92.510 1.00 43.24 ? 485  LYS A CA    1 
ATOM   3714  C  C     . LYS A  1  458 ? 12.781  28.018 92.627 1.00 42.75 ? 485  LYS A C     1 
ATOM   3715  O  O     . LYS A  1  458 ? 12.413  29.163 92.371 1.00 42.55 ? 485  LYS A O     1 
ATOM   3716  C  CB    . LYS A  1  458 ? 11.125  26.586 93.876 1.00 45.20 ? 485  LYS A CB    1 
ATOM   3717  C  CG    . LYS A  1  458 ? 9.683   26.069 93.796 1.00 46.32 ? 485  LYS A CG    1 
ATOM   3718  C  CD    . LYS A  1  458 ? 8.994   26.072 95.162 1.00 48.93 ? 485  LYS A CD    1 
ATOM   3719  N  N     . GLU A  1  459 ? 14.025  27.726 93.013 1.00 42.62 ? 486  GLU A N     1 
ATOM   3720  C  CA    . GLU A  1  459 ? 15.013  28.775 93.321 1.00 42.48 ? 486  GLU A CA    1 
ATOM   3721  C  C     . GLU A  1  459 ? 15.465  29.587 92.099 1.00 40.74 ? 486  GLU A C     1 
ATOM   3722  O  O     . GLU A  1  459 ? 15.326  30.817 92.094 1.00 40.89 ? 486  GLU A O     1 
ATOM   3723  C  CB    . GLU A  1  459 ? 16.227  28.214 94.077 1.00 43.02 ? 486  GLU A CB    1 
ATOM   3724  C  CG    . GLU A  1  459 ? 17.065  29.299 94.749 1.00 44.97 ? 486  GLU A CG    1 
ATOM   3725  C  CD    . GLU A  1  459 ? 18.245  28.762 95.545 1.00 46.68 ? 486  GLU A CD    1 
ATOM   3726  O  OE1   . GLU A  1  459 ? 19.209  28.269 94.933 1.00 46.97 ? 486  GLU A OE1   1 
ATOM   3727  O  OE2   . GLU A  1  459 ? 18.223  28.863 96.787 1.00 49.36 ? 486  GLU A OE2   1 
ATOM   3728  N  N     . MET A  1  460 ? 15.998  28.912 91.077 1.00 38.90 ? 487  MET A N     1 
ATOM   3729  C  CA    . MET A  1  460 ? 16.420  29.584 89.845 1.00 37.30 ? 487  MET A CA    1 
ATOM   3730  C  C     . MET A  1  460 ? 15.238  30.262 89.161 1.00 36.67 ? 487  MET A C     1 
ATOM   3731  O  O     . MET A  1  460 ? 15.378  31.350 88.598 1.00 35.98 ? 487  MET A O     1 
ATOM   3732  C  CB    . MET A  1  460 ? 17.083  28.610 88.859 1.00 36.37 ? 487  MET A CB    1 
ATOM   3733  C  CG    . MET A  1  460 ? 18.421  28.041 89.307 1.00 37.72 ? 487  MET A CG    1 
ATOM   3734  S  SD    . MET A  1  460 ? 19.215  27.059 88.014 1.00 39.70 ? 487  MET A SD    1 
ATOM   3735  C  CE    . MET A  1  460 ? 18.104  25.653 87.902 1.00 38.21 ? 487  MET A CE    1 
ATOM   3736  N  N     . ALA A  1  461 ? 14.080  29.608 89.225 1.00 36.66 ? 488  ALA A N     1 
ATOM   3737  C  CA    . ALA A  1  461 ? 12.860  30.097 88.594 1.00 36.34 ? 488  ALA A CA    1 
ATOM   3738  C  C     . ALA A  1  461 ? 12.425  31.430 89.201 1.00 37.15 ? 488  ALA A C     1 
ATOM   3739  O  O     . ALA A  1  461 ? 11.957  32.320 88.484 1.00 36.65 ? 488  ALA A O     1 
ATOM   3740  C  CB    . ALA A  1  461 ? 11.751  29.062 88.725 1.00 36.82 ? 488  ALA A CB    1 
ATOM   3741  N  N     . ALA A  1  462 ? 12.589  31.551 90.522 1.00 38.26 ? 489  ALA A N     1 
ATOM   3742  C  CA    . ALA A  1  462 ? 12.336  32.796 91.243 1.00 39.26 ? 489  ALA A CA    1 
ATOM   3743  C  C     . ALA A  1  462 ? 13.321  33.888 90.837 1.00 38.87 ? 489  ALA A C     1 
ATOM   3744  O  O     . ALA A  1  462 ? 12.922  35.033 90.655 1.00 39.18 ? 489  ALA A O     1 
ATOM   3745  C  CB    . ALA A  1  462 ? 12.375  32.566 92.756 1.00 40.58 ? 489  ALA A CB    1 
ATOM   3746  N  N     . GLU A  1  463 ? 14.601  33.539 90.693 1.00 38.51 ? 490  GLU A N     1 
ATOM   3747  C  CA    . GLU A  1  463 ? 15.603  34.513 90.260 1.00 38.73 ? 490  GLU A CA    1 
ATOM   3748  C  C     . GLU A  1  463 ? 15.268  35.042 88.858 1.00 37.79 ? 490  GLU A C     1 
ATOM   3749  O  O     . GLU A  1  463 ? 15.322  36.251 88.611 1.00 37.96 ? 490  GLU A O     1 
ATOM   3750  C  CB    . GLU A  1  463 ? 17.025  33.930 90.297 1.00 38.53 ? 490  GLU A CB    1 
ATOM   3751  C  CG    . GLU A  1  463 ? 17.511  33.449 91.684 1.00 41.87 ? 490  GLU A CG    1 
ATOM   3752  C  CD    . GLU A  1  463 ? 17.613  34.560 92.737 1.00 45.51 ? 490  GLU A CD    1 
ATOM   3753  O  OE1   . GLU A  1  463 ? 17.552  35.759 92.383 1.00 46.85 ? 490  GLU A OE1   1 
ATOM   3754  O  OE2   . GLU A  1  463 ? 17.768  34.227 93.936 1.00 48.73 ? 490  GLU A OE2   1 
ATOM   3755  N  N     . LEU A  1  464 ? 14.891  34.129 87.962 1.00 36.68 ? 491  LEU A N     1 
ATOM   3756  C  CA    . LEU A  1  464 ? 14.532  34.479 86.593 1.00 35.84 ? 491  LEU A CA    1 
ATOM   3757  C  C     . LEU A  1  464 ? 13.245  35.301 86.506 1.00 36.63 ? 491  LEU A C     1 
ATOM   3758  O  O     . LEU A  1  464 ? 13.144  36.195 85.666 1.00 36.15 ? 491  LEU A O     1 
ATOM   3759  C  CB    . LEU A  1  464 ? 14.419  33.225 85.724 1.00 34.74 ? 491  LEU A CB    1 
ATOM   3760  C  CG    . LEU A  1  464 ? 15.675  32.415 85.392 1.00 34.23 ? 491  LEU A CG    1 
ATOM   3761  C  CD1   . LEU A  1  464 ? 15.253  31.148 84.670 1.00 34.49 ? 491  LEU A CD1   1 
ATOM   3762  C  CD2   . LEU A  1  464 ? 16.683  33.207 84.543 1.00 32.61 ? 491  LEU A CD2   1 
ATOM   3763  N  N     . LYS A  1  465 ? 12.267  34.995 87.363 1.00 37.85 ? 492  LYS A N     1 
ATOM   3764  C  CA    . LYS A  1  465 ? 11.016  35.767 87.417 1.00 38.94 ? 492  LYS A CA    1 
ATOM   3765  C  C     . LYS A  1  465 ? 11.317  37.219 87.783 1.00 39.54 ? 492  LYS A C     1 
ATOM   3766  O  O     . LYS A  1  465 ? 10.832  38.148 87.135 1.00 39.52 ? 492  LYS A O     1 
ATOM   3767  C  CB    . LYS A  1  465 ? 10.021  35.149 88.414 1.00 40.34 ? 492  LYS A CB    1 
ATOM   3768  C  CG    . LYS A  1  465 ? 8.677   35.893 88.564 1.00 42.37 ? 492  LYS A CG    1 
ATOM   3769  C  CD    . LYS A  1  465 ? 7.811   35.756 87.314 1.00 43.74 ? 492  LYS A CD    1 
ATOM   3770  C  CE    . LYS A  1  465 ? 6.365   36.154 87.568 1.00 47.04 ? 492  LYS A CE    1 
ATOM   3771  N  NZ    . LYS A  1  465 ? 6.099   37.576 87.224 1.00 48.73 ? 492  LYS A NZ    1 
ATOM   3772  N  N     . ALA A  1  466 ? 12.136  37.403 88.814 1.00 40.11 ? 493  ALA A N     1 
ATOM   3773  C  CA    . ALA A  1  466 ? 12.555  38.735 89.238 1.00 40.98 ? 493  ALA A CA    1 
ATOM   3774  C  C     . ALA A  1  466 ? 13.411  39.451 88.181 1.00 40.12 ? 493  ALA A C     1 
ATOM   3775  O  O     . ALA A  1  466 ? 13.340  40.671 88.066 1.00 40.89 ? 493  ALA A O     1 
ATOM   3776  C  CB    . ALA A  1  466 ? 13.279  38.673 90.585 1.00 41.61 ? 493  ALA A CB    1 
ATOM   3777  N  N     . LEU A  1  467 ? 14.203  38.702 87.410 1.00 38.64 ? 494  LEU A N     1 
ATOM   3778  C  CA    . LEU A  1  467 ? 15.038  39.306 86.368 1.00 37.98 ? 494  LEU A CA    1 
ATOM   3779  C  C     . LEU A  1  467 ? 14.246  39.706 85.108 1.00 37.54 ? 494  LEU A C     1 
ATOM   3780  O  O     . LEU A  1  467 ? 14.383  40.826 84.614 1.00 37.24 ? 494  LEU A O     1 
ATOM   3781  C  CB    . LEU A  1  467 ? 16.208  38.388 85.987 1.00 37.22 ? 494  LEU A CB    1 
ATOM   3782  C  CG    . LEU A  1  467 ? 17.373  38.181 86.968 1.00 38.08 ? 494  LEU A CG    1 
ATOM   3783  C  CD1   . LEU A  1  467 ? 18.156  36.920 86.611 1.00 36.43 ? 494  LEU A CD1   1 
ATOM   3784  C  CD2   . LEU A  1  467 ? 18.300  39.392 87.043 1.00 39.13 ? 494  LEU A CD2   1 
ATOM   3785  N  N     . TYR A  1  468 ? 13.416  38.807 84.610 1.00 37.08 ? 495  TYR A N     1 
ATOM   3786  C  CA    . TYR A  1  468 ? 12.758  38.945 83.326 1.00 36.57 ? 495  TYR A CA    1 
ATOM   3787  C  C     . TYR A  1  468 ? 11.311  39.404 83.377 1.00 37.55 ? 495  TYR A C     1 
ATOM   3788  O  O     . TYR A  1  468 ? 10.809  39.886 82.399 1.00 37.36 ? 495  TYR A O     1 
ATOM   3789  C  CB    . TYR A  1  468 ? 12.805  37.633 82.561 1.00 35.30 ? 495  TYR A CB    1 
ATOM   3790  C  CG    . TYR A  1  468 ? 14.149  37.295 81.985 1.00 35.32 ? 495  TYR A CG    1 
ATOM   3791  C  CD1   . TYR A  1  468 ? 14.522  37.748 80.749 1.00 33.95 ? 495  TYR A CD1   1 
ATOM   3792  C  CD2   . TYR A  1  468 ? 15.047  36.532 82.692 1.00 34.71 ? 495  TYR A CD2   1 
ATOM   3793  C  CE1   . TYR A  1  468 ? 15.707  37.449 80.242 1.00 34.52 ? 495  TYR A CE1   1 
ATOM   3794  C  CE2   . TYR A  1  468 ? 16.242  36.231 82.185 1.00 34.34 ? 495  TYR A CE2   1 
ATOM   3795  C  CZ    . TYR A  1  468 ? 16.585  36.687 80.963 1.00 33.67 ? 495  TYR A CZ    1 
ATOM   3796  O  OH    . TYR A  1  468 ? 17.797  36.388 80.460 1.00 33.17 ? 495  TYR A OH    1 
ATOM   3797  N  N     . SER A  1  469 ? 10.656  39.191 84.512 1.00 38.74 ? 496  SER A N     1 
ATOM   3798  C  CA    . SER A  1  469 ? 9.231   39.505 84.757 1.00 40.19 ? 496  SER A CA    1 
ATOM   3799  C  C     . SER A  1  469 ? 8.206   38.629 84.037 1.00 39.61 ? 496  SER A C     1 
ATOM   3800  O  O     . SER A  1  469 ? 7.245   38.179 84.656 1.00 40.81 ? 496  SER A O     1 
ATOM   3801  C  CB    . SER A  1  469 ? 8.920   40.988 84.529 1.00 41.02 ? 496  SER A CB    1 
ATOM   3802  O  OG    . SER A  1  469 ? 9.592   41.771 85.493 1.00 43.30 ? 496  SER A OG    1 
ATOM   3803  N  N     . ASP A  1  470 ? 8.388   38.405 82.752 1.00 38.25 ? 497  ASP A N     1 
ATOM   3804  C  CA    . ASP A  1  470 ? 7.450   37.635 81.960 1.00 37.85 ? 497  ASP A CA    1 
ATOM   3805  C  C     . ASP A  1  470 ? 8.166   36.465 81.270 1.00 36.18 ? 497  ASP A C     1 
ATOM   3806  O  O     . ASP A  1  470 ? 9.147   36.650 80.629 1.00 34.95 ? 497  ASP A O     1 
ATOM   3807  C  CB    . ASP A  1  470 ? 6.788   38.582 80.947 1.00 38.44 ? 497  ASP A CB    1 
ATOM   3808  C  CG    . ASP A  1  470 ? 5.704   37.941 80.083 1.00 38.87 ? 497  ASP A CG    1 
ATOM   3809  O  OD1   . ASP A  1  470 ? 5.398   36.769 80.135 1.00 39.84 ? 497  ASP A OD1   1 
ATOM   3810  O  OD2   . ASP A  1  470 ? 5.128   38.673 79.317 1.00 40.40 ? 497  ASP A OD2   1 
ATOM   3811  N  N     . ILE A  1  471 ? 7.645   35.268 81.423 1.00 35.73 ? 498  ILE A N     1 
ATOM   3812  C  CA    . ILE A  1  471 ? 8.176   34.072 80.761 1.00 34.31 ? 498  ILE A CA    1 
ATOM   3813  C  C     . ILE A  1  471 ? 8.260   34.253 79.240 1.00 33.32 ? 498  ILE A C     1 
ATOM   3814  O  O     . ILE A  1  471 ? 9.139   33.687 78.594 1.00 31.64 ? 498  ILE A O     1 
ATOM   3815  C  CB    . ILE A  1  471 ? 7.377   32.776 81.139 1.00 35.02 ? 498  ILE A CB    1 
ATOM   3816  C  CG1   . ILE A  1  471 ? 8.077   31.504 80.625 1.00 33.87 ? 498  ILE A CG1   1 
ATOM   3817  C  CG2   . ILE A  1  471 ? 5.930   32.844 80.638 1.00 35.12 ? 498  ILE A CG2   1 
ATOM   3818  C  CD1   . ILE A  1  471 ? 9.532   31.311 81.102 1.00 33.64 ? 498  ILE A CD1   1 
ATOM   3819  N  N     . ASP A  1  472 ? 7.371   35.076 78.686 1.00 33.68 ? 499  ASP A N     1 
ATOM   3820  C  CA    . ASP A  1  472 ? 7.340   35.305 77.241 1.00 33.51 ? 499  ASP A CA    1 
ATOM   3821  C  C     . ASP A  1  472 ? 8.513   36.131 76.712 1.00 32.44 ? 499  ASP A C     1 
ATOM   3822  O  O     . ASP A  1  472 ? 8.709   36.215 75.503 1.00 32.05 ? 499  ASP A O     1 
ATOM   3823  C  CB    . ASP A  1  472 ? 5.985   35.875 76.788 1.00 34.39 ? 499  ASP A CB    1 
ATOM   3824  C  CG    . ASP A  1  472 ? 4.904   34.800 76.680 1.00 36.43 ? 499  ASP A CG    1 
ATOM   3825  O  OD1   . ASP A  1  472 ? 5.244   33.623 76.430 1.00 37.18 ? 499  ASP A OD1   1 
ATOM   3826  O  OD2   . ASP A  1  472 ? 3.706   35.125 76.851 1.00 38.39 ? 499  ASP A OD2   1 
ATOM   3827  N  N     . VAL A  1  473 ? 9.287   36.739 77.610 1.00 32.58 ? 500  VAL A N     1 
ATOM   3828  C  CA    . VAL A  1  473 ? 10.524  37.425 77.211 1.00 32.04 ? 500  VAL A CA    1 
ATOM   3829  C  C     . VAL A  1  473 ? 11.817  36.748 77.710 1.00 31.53 ? 500  VAL A C     1 
ATOM   3830  O  O     . VAL A  1  473 ? 12.913  37.292 77.547 1.00 31.37 ? 500  VAL A O     1 
ATOM   3831  C  CB    . VAL A  1  473 ? 10.512  38.936 77.564 1.00 32.82 ? 500  VAL A CB    1 
ATOM   3832  C  CG1   . VAL A  1  473 ? 9.257   39.602 77.006 1.00 32.93 ? 500  VAL A CG1   1 
ATOM   3833  C  CG2   . VAL A  1  473 ? 10.653  39.166 79.064 1.00 32.62 ? 500  VAL A CG2   1 
ATOM   3834  N  N     . MET A  1  474 ? 11.691  35.567 78.309 1.00 31.51 ? 501  MET A N     1 
ATOM   3835  C  CA    . MET A  1  474 ? 12.865  34.757 78.617 1.00 31.01 ? 501  MET A CA    1 
ATOM   3836  C  C     . MET A  1  474 ? 13.652  34.527 77.323 1.00 29.93 ? 501  MET A C     1 
ATOM   3837  O  O     . MET A  1  474 ? 13.060  34.319 76.266 1.00 29.97 ? 501  MET A O     1 
ATOM   3838  C  CB    . MET A  1  474 ? 12.458  33.424 79.254 1.00 31.15 ? 501  MET A CB    1 
ATOM   3839  C  CG    . MET A  1  474 ? 13.635  32.558 79.680 1.00 30.91 ? 501  MET A CG    1 
ATOM   3840  S  SD    . MET A  1  474 ? 14.790  33.440 80.766 1.00 33.09 ? 501  MET A SD    1 
ATOM   3841  C  CE    . MET A  1  474 ? 16.184  32.309 80.778 1.00 30.70 ? 501  MET A CE    1 
ATOM   3842  N  N     . GLU A  1  475 ? 14.979  34.579 77.413 1.00 29.41 ? 502  GLU A N     1 
ATOM   3843  C  CA    . GLU A  1  475 ? 15.846  34.459 76.247 1.00 28.33 ? 502  GLU A CA    1 
ATOM   3844  C  C     . GLU A  1  475 ? 16.218  33.005 75.969 1.00 27.68 ? 502  GLU A C     1 
ATOM   3845  O  O     . GLU A  1  475 ? 16.244  32.175 76.886 1.00 27.54 ? 502  GLU A O     1 
ATOM   3846  C  CB    . GLU A  1  475 ? 17.115  35.288 76.449 1.00 28.67 ? 502  GLU A CB    1 
ATOM   3847  C  CG    . GLU A  1  475 ? 16.854  36.767 76.681 1.00 29.49 ? 502  GLU A CG    1 
ATOM   3848  C  CD    . GLU A  1  475 ? 18.117  37.522 77.020 1.00 29.98 ? 502  GLU A CD    1 
ATOM   3849  O  OE1   . GLU A  1  475 ? 18.394  37.725 78.228 1.00 31.19 ? 502  GLU A OE1   1 
ATOM   3850  O  OE2   . GLU A  1  475 ? 18.841  37.895 76.082 1.00 29.90 ? 502  GLU A OE2   1 
ATOM   3851  N  N     . LEU A  1  476 ? 16.519  32.714 74.705 1.00 26.52 ? 503  LEU A N     1 
ATOM   3852  C  CA    . LEU A  1  476 ? 16.855  31.358 74.266 1.00 25.80 ? 503  LEU A CA    1 
ATOM   3853  C  C     . LEU A  1  476 ? 18.103  30.768 74.932 1.00 25.74 ? 503  LEU A C     1 
ATOM   3854  O  O     . LEU A  1  476 ? 18.006  29.743 75.596 1.00 26.33 ? 503  LEU A O     1 
ATOM   3855  C  CB    . LEU A  1  476 ? 16.982  31.297 72.738 1.00 24.88 ? 503  LEU A CB    1 
ATOM   3856  C  CG    . LEU A  1  476 ? 17.338  29.955 72.091 1.00 24.90 ? 503  LEU A CG    1 
ATOM   3857  C  CD1   . LEU A  1  476 ? 16.210  28.913 72.289 1.00 24.01 ? 503  LEU A CD1   1 
ATOM   3858  C  CD2   . LEU A  1  476 ? 17.644  30.172 70.604 1.00 23.73 ? 503  LEU A CD2   1 
ATOM   3859  N  N     . TYR A  1  477 ? 19.264  31.393 74.758 1.00 25.59 ? 504  TYR A N     1 
ATOM   3860  C  CA    . TYR A  1  477 ? 20.514  30.802 75.256 1.00 26.64 ? 504  TYR A CA    1 
ATOM   3861  C  C     . TYR A  1  477 ? 20.485  30.454 76.765 1.00 26.97 ? 504  TYR A C     1 
ATOM   3862  O  O     . TYR A  1  477 ? 20.682  29.293 77.125 1.00 26.90 ? 504  TYR A O     1 
ATOM   3863  C  CB    . TYR A  1  477 ? 21.758  31.637 74.872 1.00 26.84 ? 504  TYR A CB    1 
ATOM   3864  C  CG    . TYR A  1  477 ? 23.006  31.236 75.635 1.00 29.39 ? 504  TYR A CG    1 
ATOM   3865  C  CD1   . TYR A  1  477 ? 23.700  30.061 75.323 1.00 30.17 ? 504  TYR A CD1   1 
ATOM   3866  C  CD2   . TYR A  1  477 ? 23.474  32.019 76.689 1.00 31.94 ? 504  TYR A CD2   1 
ATOM   3867  C  CE1   . TYR A  1  477 ? 24.837  29.690 76.034 1.00 31.60 ? 504  TYR A CE1   1 
ATOM   3868  C  CE2   . TYR A  1  477 ? 24.602  31.659 77.402 1.00 33.98 ? 504  TYR A CE2   1 
ATOM   3869  C  CZ    . TYR A  1  477 ? 25.283  30.497 77.067 1.00 34.12 ? 504  TYR A CZ    1 
ATOM   3870  O  OH    . TYR A  1  477 ? 26.404  30.149 77.793 1.00 37.10 ? 504  TYR A OH    1 
ATOM   3871  N  N     . PRO A  1  478 ? 20.227  31.448 77.648 1.00 27.60 ? 505  PRO A N     1 
ATOM   3872  C  CA    . PRO A  1  478 ? 20.192  31.078 79.076 1.00 28.10 ? 505  PRO A CA    1 
ATOM   3873  C  C     . PRO A  1  478 ? 19.117  30.030 79.413 1.00 28.43 ? 505  PRO A C     1 
ATOM   3874  O  O     . PRO A  1  478 ? 19.336  29.201 80.303 1.00 28.82 ? 505  PRO A O     1 
ATOM   3875  C  CB    . PRO A  1  478 ? 19.903  32.411 79.792 1.00 28.65 ? 505  PRO A CB    1 
ATOM   3876  C  CG    . PRO A  1  478 ? 19.380  33.326 78.740 1.00 28.76 ? 505  PRO A CG    1 
ATOM   3877  C  CD    . PRO A  1  478 ? 20.011  32.894 77.447 1.00 27.36 ? 505  PRO A CD    1 
ATOM   3878  N  N     . ALA A  1  479 ? 17.982  30.052 78.704 1.00 27.81 ? 506  ALA A N     1 
ATOM   3879  C  CA    . ALA A  1  479 ? 16.919  29.058 78.935 1.00 27.95 ? 506  ALA A CA    1 
ATOM   3880  C  C     . ALA A  1  479 ? 17.375  27.620 78.675 1.00 27.82 ? 506  ALA A C     1 
ATOM   3881  O  O     . ALA A  1  479 ? 17.026  26.712 79.434 1.00 28.52 ? 506  ALA A O     1 
ATOM   3882  C  CB    . ALA A  1  479 ? 15.679  29.379 78.117 1.00 27.71 ? 506  ALA A CB    1 
ATOM   3883  N  N     . LEU A  1  480 ? 18.164  27.427 77.617 1.00 26.66 ? 507  LEU A N     1 
ATOM   3884  C  CA    . LEU A  1  480 ? 18.697  26.110 77.259 1.00 26.55 ? 507  LEU A CA    1 
ATOM   3885  C  C     . LEU A  1  480 ? 19.588  25.513 78.354 1.00 26.89 ? 507  LEU A C     1 
ATOM   3886  O  O     . LEU A  1  480 ? 19.624  24.292 78.541 1.00 27.15 ? 507  LEU A O     1 
ATOM   3887  C  CB    . LEU A  1  480 ? 19.486  26.188 75.946 1.00 25.52 ? 507  LEU A CB    1 
ATOM   3888  C  CG    . LEU A  1  480 ? 18.736  26.536 74.654 1.00 26.16 ? 507  LEU A CG    1 
ATOM   3889  C  CD1   . LEU A  1  480 ? 19.709  27.026 73.571 1.00 25.05 ? 507  LEU A CD1   1 
ATOM   3890  C  CD2   . LEU A  1  480 ? 17.908  25.355 74.147 1.00 26.36 ? 507  LEU A CD2   1 
ATOM   3891  N  N     . LEU A  1  481 ? 20.303  26.374 79.071 1.00 27.10 ? 508  LEU A N     1 
ATOM   3892  C  CA    . LEU A  1  481 ? 21.205  25.917 80.133 1.00 27.95 ? 508  LEU A CA    1 
ATOM   3893  C  C     . LEU A  1  481 ? 20.536  25.802 81.501 1.00 28.64 ? 508  LEU A C     1 
ATOM   3894  O  O     . LEU A  1  481 ? 21.111  25.197 82.406 1.00 29.88 ? 508  LEU A O     1 
ATOM   3895  C  CB    . LEU A  1  481 ? 22.450  26.806 80.231 1.00 27.97 ? 508  LEU A CB    1 
ATOM   3896  C  CG    . LEU A  1  481 ? 23.275  27.114 78.975 1.00 28.81 ? 508  LEU A CG    1 
ATOM   3897  C  CD1   . LEU A  1  481 ? 24.594  27.755 79.369 1.00 30.03 ? 508  LEU A CD1   1 
ATOM   3898  C  CD2   . LEU A  1  481 ? 23.527  25.897 78.119 1.00 28.23 ? 508  LEU A CD2   1 
ATOM   3899  N  N     . VAL A  1  482 ? 19.342  26.375 81.661 1.00 28.57 ? 509  VAL A N     1 
ATOM   3900  C  CA    . VAL A  1  482 ? 18.590  26.213 82.919 1.00 29.36 ? 509  VAL A CA    1 
ATOM   3901  C  C     . VAL A  1  482 ? 17.398  25.270 82.804 1.00 29.67 ? 509  VAL A C     1 
ATOM   3902  O  O     . VAL A  1  482 ? 16.801  24.897 83.812 1.00 30.52 ? 509  VAL A O     1 
ATOM   3903  C  CB    . VAL A  1  482 ? 18.101  27.563 83.518 1.00 29.78 ? 509  VAL A CB    1 
ATOM   3904  C  CG1   . VAL A  1  482 ? 19.284  28.462 83.853 1.00 29.83 ? 509  VAL A CG1   1 
ATOM   3905  C  CG2   . VAL A  1  482 ? 17.092  28.264 82.592 1.00 28.46 ? 509  VAL A CG2   1 
ATOM   3906  N  N     . GLU A  1  483 ? 17.054  24.894 81.575 1.00 29.11 ? 510  GLU A N     1 
ATOM   3907  C  CA    . GLU A  1  483 ? 15.880  24.072 81.319 1.00 29.84 ? 510  GLU A CA    1 
ATOM   3908  C  C     . GLU A  1  483 ? 15.941  22.767 82.107 1.00 30.70 ? 510  GLU A C     1 
ATOM   3909  O  O     . GLU A  1  483 ? 17.017  22.185 82.288 1.00 30.84 ? 510  GLU A O     1 
ATOM   3910  C  CB    . GLU A  1  483 ? 15.745  23.778 79.823 1.00 29.08 ? 510  GLU A CB    1 
ATOM   3911  C  CG    . GLU A  1  483 ? 14.451  23.072 79.432 1.00 30.53 ? 510  GLU A CG    1 
ATOM   3912  C  CD    . GLU A  1  483 ? 14.275  22.954 77.929 1.00 31.06 ? 510  GLU A CD    1 
ATOM   3913  O  OE1   . GLU A  1  483 ? 15.275  22.723 77.221 1.00 30.60 ? 510  GLU A OE1   1 
ATOM   3914  O  OE2   . GLU A  1  483 ? 13.128  23.094 77.458 1.00 32.24 ? 510  GLU A OE2   1 
ATOM   3915  N  N     . LYS A  1  484 ? 14.783  22.326 82.584 1.00 31.52 ? 511  LYS A N     1 
ATOM   3916  C  CA    . LYS A  1  484 ? 14.664  21.025 83.206 1.00 32.62 ? 511  LYS A CA    1 
ATOM   3917  C  C     . LYS A  1  484 ? 15.101  19.952 82.208 1.00 32.05 ? 511  LYS A C     1 
ATOM   3918  O  O     . LYS A  1  484 ? 14.552  19.868 81.110 1.00 31.80 ? 511  LYS A O     1 
ATOM   3919  C  CB    . LYS A  1  484 ? 13.222  20.778 83.645 1.00 33.75 ? 511  LYS A CB    1 
ATOM   3920  C  CG    . LYS A  1  484 ? 13.015  19.441 84.339 1.00 36.15 ? 511  LYS A CG    1 
ATOM   3921  C  CD    . LYS A  1  484 ? 11.545  19.174 84.599 1.00 40.21 ? 511  LYS A CD    1 
ATOM   3922  C  CE    . LYS A  1  484 ? 10.778  18.877 83.313 1.00 41.46 ? 511  LYS A CE    1 
ATOM   3923  N  NZ    . LYS A  1  484 ? 9.419   18.328 83.630 1.00 44.68 ? 511  LYS A NZ    1 
ATOM   3924  N  N     . PRO A  1  485 ? 16.101  19.137 82.578 1.00 31.99 ? 512  PRO A N     1 
ATOM   3925  C  CA    . PRO A  1  485 ? 16.520  18.067 81.680 1.00 31.73 ? 512  PRO A CA    1 
ATOM   3926  C  C     . PRO A  1  485 ? 15.478  16.958 81.593 1.00 32.74 ? 512  PRO A C     1 
ATOM   3927  O  O     . PRO A  1  485 ? 14.672  16.787 82.513 1.00 33.84 ? 512  PRO A O     1 
ATOM   3928  C  CB    . PRO A  1  485 ? 17.795  17.529 82.344 1.00 32.06 ? 512  PRO A CB    1 
ATOM   3929  C  CG    . PRO A  1  485 ? 18.231  18.615 83.302 1.00 32.00 ? 512  PRO A CG    1 
ATOM   3930  C  CD    . PRO A  1  485 ? 16.953  19.213 83.777 1.00 32.43 ? 512  PRO A CD    1 
ATOM   3931  N  N     . ARG A  1  486 ? 15.490  16.224 80.484 1.00 32.43 ? 513  ARG A N     1 
ATOM   3932  C  CA    . ARG A  1  486 ? 14.811  14.936 80.407 1.00 33.70 ? 513  ARG A CA    1 
ATOM   3933  C  C     . ARG A  1  486 ? 15.378  14.046 81.520 1.00 34.69 ? 513  ARG A C     1 
ATOM   3934  O  O     . ARG A  1  486 ? 16.485  14.311 82.004 1.00 34.25 ? 513  ARG A O     1 
ATOM   3935  C  CB    . ARG A  1  486 ? 15.037  14.309 79.026 1.00 33.29 ? 513  ARG A CB    1 
ATOM   3936  C  CG    . ARG A  1  486 ? 13.908  14.525 78.032 1.00 33.35 ? 513  ARG A CG    1 
ATOM   3937  C  CD    . ARG A  1  486 ? 13.798  15.967 77.540 1.00 32.52 ? 513  ARG A CD    1 
ATOM   3938  N  NE    . ARG A  1  486 ? 12.739  16.089 76.537 1.00 33.16 ? 513  ARG A NE    1 
ATOM   3939  C  CZ    . ARG A  1  486 ? 12.892  15.835 75.239 1.00 32.80 ? 513  ARG A CZ    1 
ATOM   3940  N  NH1   . ARG A  1  486 ? 14.071  15.449 74.753 1.00 31.08 ? 513  ARG A NH1   1 
ATOM   3941  N  NH2   . ARG A  1  486 ? 11.857  15.972 74.421 1.00 32.92 ? 513  ARG A NH2   1 
ATOM   3942  N  N     . PRO A  1  487 ? 14.624  13.008 81.952 1.00 36.43 ? 514  PRO A N     1 
ATOM   3943  C  CA    . PRO A  1  487 ? 15.069  12.201 83.101 1.00 37.55 ? 514  PRO A CA    1 
ATOM   3944  C  C     . PRO A  1  487 ? 16.473  11.615 82.926 1.00 37.46 ? 514  PRO A C     1 
ATOM   3945  O  O     . PRO A  1  487 ? 16.723  10.886 81.963 1.00 37.25 ? 514  PRO A O     1 
ATOM   3946  C  CB    . PRO A  1  487 ? 14.025  11.080 83.166 1.00 39.33 ? 514  PRO A CB    1 
ATOM   3947  C  CG    . PRO A  1  487 ? 12.799  11.690 82.563 1.00 38.90 ? 514  PRO A CG    1 
ATOM   3948  C  CD    . PRO A  1  487 ? 13.309  12.559 81.452 1.00 37.30 ? 514  PRO A CD    1 
ATOM   3949  N  N     . ASP A  1  488 ? 17.373  11.953 83.853 1.00 37.48 ? 515  ASP A N     1 
ATOM   3950  C  CA    . ASP A  1  488 ? 18.779  11.509 83.819 1.00 37.21 ? 515  ASP A CA    1 
ATOM   3951  C  C     . ASP A  1  488 ? 19.465  11.827 82.482 1.00 35.51 ? 515  ASP A C     1 
ATOM   3952  O  O     . ASP A  1  488 ? 20.319  11.074 82.015 1.00 35.00 ? 515  ASP A O     1 
ATOM   3953  C  CB    . ASP A  1  488 ? 18.887  10.011 84.124 1.00 38.88 ? 515  ASP A CB    1 
ATOM   3954  C  CG    . ASP A  1  488 ? 18.231  9.627  85.443 1.00 41.92 ? 515  ASP A CG    1 
ATOM   3955  O  OD1   . ASP A  1  488 ? 18.446  10.324 86.459 1.00 42.30 ? 515  ASP A OD1   1 
ATOM   3956  O  OD2   . ASP A  1  488 ? 17.510  8.605  85.463 1.00 45.05 ? 515  ASP A OD2   1 
ATOM   3957  N  N     . ALA A  1  489 ? 19.084  12.950 81.877 1.00 34.37 ? 516  ALA A N     1 
ATOM   3958  C  CA    . ALA A  1  489 ? 19.592  13.335 80.562 1.00 32.98 ? 516  ALA A CA    1 
ATOM   3959  C  C     . ALA A  1  489 ? 20.455  14.593 80.629 1.00 32.07 ? 516  ALA A C     1 
ATOM   3960  O  O     . ALA A  1  489 ? 20.389  15.358 81.595 1.00 32.14 ? 516  ALA A O     1 
ATOM   3961  C  CB    . ALA A  1  489 ? 18.440  13.524 79.583 1.00 32.43 ? 516  ALA A CB    1 
ATOM   3962  N  N     . ILE A  1  490 ? 21.258  14.803 79.590 1.00 31.30 ? 517  ILE A N     1 
ATOM   3963  C  CA    . ILE A  1  490 ? 22.155  15.958 79.516 1.00 30.60 ? 517  ILE A CA    1 
ATOM   3964  C  C     . ILE A  1  490 ? 21.422  17.253 79.110 1.00 29.53 ? 517  ILE A C     1 
ATOM   3965  O  O     . ILE A  1  490 ? 21.822  18.348 79.520 1.00 29.40 ? 517  ILE A O     1 
ATOM   3966  C  CB    . ILE A  1  490 ? 23.386  15.656 78.595 1.00 30.43 ? 517  ILE A CB    1 
ATOM   3967  C  CG1   . ILE A  1  490 ? 24.489  16.707 78.775 1.00 30.61 ? 517  ILE A CG1   1 
ATOM   3968  C  CG2   . ILE A  1  490 ? 22.963  15.476 77.129 1.00 30.16 ? 517  ILE A CG2   1 
ATOM   3969  C  CD1   . ILE A  1  490 ? 25.809  16.356 78.093 1.00 31.31 ? 517  ILE A CD1   1 
ATOM   3970  N  N     . PHE A  1  491 ? 20.335  17.112 78.347 1.00 29.09 ? 518  PHE A N     1 
ATOM   3971  C  CA    . PHE A  1  491 ? 19.623  18.245 77.747 1.00 28.36 ? 518  PHE A CA    1 
ATOM   3972  C  C     . PHE A  1  491 ? 18.145  18.275 78.116 1.00 28.77 ? 518  PHE A C     1 
ATOM   3973  O  O     . PHE A  1  491 ? 17.560  17.242 78.434 1.00 30.13 ? 518  PHE A O     1 
ATOM   3974  C  CB    . PHE A  1  491 ? 19.668  18.164 76.211 1.00 27.64 ? 518  PHE A CB    1 
ATOM   3975  C  CG    . PHE A  1  491 ? 21.037  18.241 75.621 1.00 27.24 ? 518  PHE A CG    1 
ATOM   3976  C  CD1   . PHE A  1  491 ? 21.985  19.135 76.112 1.00 26.41 ? 518  PHE A CD1   1 
ATOM   3977  C  CD2   . PHE A  1  491 ? 21.365  17.446 74.523 1.00 27.06 ? 518  PHE A CD2   1 
ATOM   3978  C  CE1   . PHE A  1  491 ? 23.249  19.208 75.544 1.00 26.54 ? 518  PHE A CE1   1 
ATOM   3979  C  CE2   . PHE A  1  491 ? 22.621  17.517 73.950 1.00 26.87 ? 518  PHE A CE2   1 
ATOM   3980  C  CZ    . PHE A  1  491 ? 23.569  18.397 74.460 1.00 26.18 ? 518  PHE A CZ    1 
ATOM   3981  N  N     . GLY A  1  492 ? 17.544  19.460 78.036 1.00 28.04 ? 519  GLY A N     1 
ATOM   3982  C  CA    . GLY A  1  492 ? 16.086  19.600 78.059 1.00 28.31 ? 519  GLY A CA    1 
ATOM   3983  C  C     . GLY A  1  492 ? 15.481  19.459 76.667 1.00 27.79 ? 519  GLY A C     1 
ATOM   3984  O  O     . GLY A  1  492 ? 16.197  19.312 75.676 1.00 27.06 ? 519  GLY A O     1 
ATOM   3985  N  N     . GLU A  1  493 ? 14.156  19.497 76.605 1.00 28.54 ? 520  GLU A N     1 
ATOM   3986  C  CA    . GLU A  1  493 ? 13.395  19.374 75.362 1.00 28.75 ? 520  GLU A CA    1 
ATOM   3987  C  C     . GLU A  1  493 ? 13.810  20.362 74.266 1.00 27.63 ? 520  GLU A C     1 
ATOM   3988  O  O     . GLU A  1  493 ? 14.023  19.963 73.118 1.00 27.43 ? 520  GLU A O     1 
ATOM   3989  C  CB    . GLU A  1  493 ? 11.908  19.542 75.674 1.00 29.86 ? 520  GLU A CB    1 
ATOM   3990  C  CG    . GLU A  1  493 ? 10.985  19.550 74.472 1.00 31.40 ? 520  GLU A CG    1 
ATOM   3991  C  CD    . GLU A  1  493 ? 9.606   20.079 74.826 1.00 35.21 ? 520  GLU A CD    1 
ATOM   3992  O  OE1   . GLU A  1  493 ? 9.500   20.895 75.770 1.00 37.12 ? 520  GLU A OE1   1 
ATOM   3993  O  OE2   . GLU A  1  493 ? 8.627   19.677 74.167 1.00 36.78 ? 520  GLU A OE2   1 
ATOM   3994  N  N     . THR A  1  494 ? 13.922  21.643 74.621 1.00 27.16 ? 521  THR A N     1 
ATOM   3995  C  CA    . THR A  1  494 ? 14.210  22.697 73.641 1.00 26.35 ? 521  THR A CA    1 
ATOM   3996  C  C     . THR A  1  494 ? 15.535  22.462 72.898 1.00 26.18 ? 521  THR A C     1 
ATOM   3997  O  O     . THR A  1  494 ? 15.634  22.730 71.696 1.00 25.60 ? 521  THR A O     1 
ATOM   3998  C  CB    . THR A  1  494 ? 14.203  24.111 74.275 1.00 26.00 ? 521  THR A CB    1 
ATOM   3999  O  OG1   . THR A  1  494 ? 13.047  24.269 75.106 1.00 26.55 ? 521  THR A OG1   1 
ATOM   4000  C  CG2   . THR A  1  494 ? 14.195  25.197 73.188 1.00 24.91 ? 521  THR A CG2   1 
ATOM   4001  N  N     . MET A  1  495 ? 16.537  21.950 73.612 1.00 26.21 ? 522  MET A N     1 
ATOM   4002  C  CA    . MET A  1  495 ? 17.837  21.693 73.012 1.00 25.84 ? 522  MET A CA    1 
ATOM   4003  C  C     . MET A  1  495 ? 17.745  20.630 71.922 1.00 26.27 ? 522  MET A C     1 
ATOM   4004  O  O     . MET A  1  495 ? 18.306  20.793 70.835 1.00 26.06 ? 522  MET A O     1 
ATOM   4005  C  CB    . MET A  1  495 ? 18.853  21.267 74.073 1.00 25.88 ? 522  MET A CB    1 
ATOM   4006  C  CG    . MET A  1  495 ? 20.252  21.080 73.509 1.00 25.54 ? 522  MET A CG    1 
ATOM   4007  S  SD    . MET A  1  495 ? 21.008  22.670 73.098 1.00 26.64 ? 522  MET A SD    1 
ATOM   4008  C  CE    . MET A  1  495 ? 21.599  23.156 74.726 1.00 24.12 ? 522  MET A CE    1 
ATOM   4009  N  N     . VAL A  1  496 ? 17.035  19.549 72.219 1.00 27.03 ? 523  VAL A N     1 
ATOM   4010  C  CA    . VAL A  1  496 ? 16.910  18.436 71.288 1.00 27.55 ? 523  VAL A CA    1 
ATOM   4011  C  C     . VAL A  1  496 ? 16.042  18.823 70.093 1.00 27.53 ? 523  VAL A C     1 
ATOM   4012  O  O     . VAL A  1  496 ? 16.394  18.534 68.944 1.00 27.64 ? 523  VAL A O     1 
ATOM   4013  C  CB    . VAL A  1  496 ? 16.364  17.175 71.991 1.00 28.32 ? 523  VAL A CB    1 
ATOM   4014  C  CG1   . VAL A  1  496 ? 16.122  16.047 70.998 1.00 29.05 ? 523  VAL A CG1   1 
ATOM   4015  C  CG2   . VAL A  1  496 ? 17.336  16.718 73.066 1.00 28.89 ? 523  VAL A CG2   1 
ATOM   4016  N  N     . GLU A  1  497 ? 14.937  19.506 70.366 1.00 27.48 ? 524  GLU A N     1 
ATOM   4017  C  CA    . GLU A  1  497 ? 13.956  19.817 69.325 1.00 28.12 ? 524  GLU A CA    1 
ATOM   4018  C  C     . GLU A  1  497 ? 14.390  20.882 68.323 1.00 27.26 ? 524  GLU A C     1 
ATOM   4019  O  O     . GLU A  1  497 ? 13.906  20.901 67.193 1.00 27.47 ? 524  GLU A O     1 
ATOM   4020  C  CB    . GLU A  1  497 ? 12.592  20.132 69.945 1.00 28.68 ? 524  GLU A CB    1 
ATOM   4021  C  CG    . GLU A  1  497 ? 11.956  18.893 70.597 1.00 30.62 ? 524  GLU A CG    1 
ATOM   4022  C  CD    . GLU A  1  497 ? 11.831  17.723 69.622 1.00 33.22 ? 524  GLU A CD    1 
ATOM   4023  O  OE1   . GLU A  1  497 ? 11.239  17.903 68.533 1.00 34.65 ? 524  GLU A OE1   1 
ATOM   4024  O  OE2   . GLU A  1  497 ? 12.320  16.622 69.941 1.00 34.02 ? 524  GLU A OE2   1 
ATOM   4025  N  N     . LEU A  1  498 ? 15.291  21.768 68.733 1.00 26.66 ? 525  LEU A N     1 
ATOM   4026  C  CA    . LEU A  1  498 ? 15.888  22.720 67.798 1.00 26.51 ? 525  LEU A CA    1 
ATOM   4027  C  C     . LEU A  1  498 ? 17.135  22.120 67.175 1.00 26.52 ? 525  LEU A C     1 
ATOM   4028  O  O     . LEU A  1  498 ? 17.326  22.215 65.961 1.00 26.82 ? 525  LEU A O     1 
ATOM   4029  C  CB    . LEU A  1  498 ? 16.229  24.051 68.482 1.00 26.05 ? 525  LEU A CB    1 
ATOM   4030  C  CG    . LEU A  1  498 ? 15.105  25.074 68.676 1.00 26.40 ? 525  LEU A CG    1 
ATOM   4031  C  CD1   . LEU A  1  498 ? 13.879  24.463 69.354 1.00 27.14 ? 525  LEU A CD1   1 
ATOM   4032  C  CD2   . LEU A  1  498 ? 15.609  26.276 69.469 1.00 26.81 ? 525  LEU A CD2   1 
ATOM   4033  N  N     . GLY A  1  499 ? 17.964  21.503 68.014 1.00 26.04 ? 526  GLY A N     1 
ATOM   4034  C  CA    . GLY A  1  499 ? 19.236  20.935 67.599 1.00 26.27 ? 526  GLY A CA    1 
ATOM   4035  C  C     . GLY A  1  499 ? 19.135  19.864 66.524 1.00 27.19 ? 526  GLY A C     1 
ATOM   4036  O  O     . GLY A  1  499 ? 19.875  19.905 65.543 1.00 27.21 ? 526  GLY A O     1 
ATOM   4037  N  N     . ALA A  1  500 ? 18.211  18.917 66.702 1.00 27.36 ? 527  ALA A N     1 
ATOM   4038  C  CA    . ALA A  1  500 ? 18.094  17.771 65.802 1.00 27.75 ? 527  ALA A CA    1 
ATOM   4039  C  C     . ALA A  1  500 ? 17.780  18.117 64.331 1.00 27.60 ? 527  ALA A C     1 
ATOM   4040  O  O     . ALA A  1  500 ? 18.423  17.559 63.438 1.00 27.70 ? 527  ALA A O     1 
ATOM   4041  C  CB    . ALA A  1  500 ? 17.119  16.735 66.355 1.00 28.69 ? 527  ALA A CB    1 
ATOM   4042  N  N     . PRO A  1  501 ? 16.807  19.028 64.068 1.00 27.25 ? 528  PRO A N     1 
ATOM   4043  C  CA    . PRO A  1  501 ? 16.573  19.391 62.662 1.00 27.13 ? 528  PRO A CA    1 
ATOM   4044  C  C     . PRO A  1  501 ? 17.755  20.098 61.995 1.00 26.32 ? 528  PRO A C     1 
ATOM   4045  O  O     . PRO A  1  501 ? 18.039  19.831 60.838 1.00 26.12 ? 528  PRO A O     1 
ATOM   4046  C  CB    . PRO A  1  501 ? 15.341  20.312 62.715 1.00 27.32 ? 528  PRO A CB    1 
ATOM   4047  C  CG    . PRO A  1  501 ? 15.137  20.643 64.148 1.00 27.13 ? 528  PRO A CG    1 
ATOM   4048  C  CD    . PRO A  1  501 ? 15.722  19.520 64.938 1.00 27.29 ? 528  PRO A CD    1 
ATOM   4049  N  N     . PHE A  1  502 ? 18.433  20.991 62.717 1.00 25.60 ? 529  PHE A N     1 
ATOM   4050  C  CA    . PHE A  1  502 ? 19.641  21.635 62.196 1.00 25.36 ? 529  PHE A CA    1 
ATOM   4051  C  C     . PHE A  1  502 ? 20.730  20.607 61.884 1.00 26.09 ? 529  PHE A C     1 
ATOM   4052  O  O     . PHE A  1  502 ? 21.363  20.669 60.827 1.00 26.00 ? 529  PHE A O     1 
ATOM   4053  C  CB    . PHE A  1  502 ? 20.200  22.653 63.194 1.00 24.75 ? 529  PHE A CB    1 
ATOM   4054  C  CG    . PHE A  1  502 ? 19.371  23.912 63.346 1.00 24.42 ? 529  PHE A CG    1 
ATOM   4055  C  CD1   . PHE A  1  502 ? 19.001  24.668 62.238 1.00 24.09 ? 529  PHE A CD1   1 
ATOM   4056  C  CD2   . PHE A  1  502 ? 19.026  24.373 64.615 1.00 24.26 ? 529  PHE A CD2   1 
ATOM   4057  C  CE1   . PHE A  1  502 ? 18.260  25.842 62.397 1.00 24.46 ? 529  PHE A CE1   1 
ATOM   4058  C  CE2   . PHE A  1  502 ? 18.300  25.552 64.789 1.00 22.97 ? 529  PHE A CE2   1 
ATOM   4059  C  CZ    . PHE A  1  502 ? 17.918  26.288 63.683 1.00 23.54 ? 529  PHE A CZ    1 
ATOM   4060  N  N     . SER A  1  503 ? 20.940  19.679 62.822 1.00 26.51 ? 530  SER A N     1 
ATOM   4061  C  CA    A SER A  1  503 ? 21.941  18.620 62.685 0.50 27.35 ? 530  SER A CA    1 
ATOM   4062  C  CA    B SER A  1  503 ? 21.948  18.629 62.675 0.50 27.69 ? 530  SER A CA    1 
ATOM   4063  C  C     . SER A  1  503 ? 21.687  17.738 61.462 1.00 28.60 ? 530  SER A C     1 
ATOM   4064  O  O     . SER A  1  503 ? 22.601  17.481 60.672 1.00 29.17 ? 530  SER A O     1 
ATOM   4065  C  CB    A SER A  1  503 ? 21.983  17.763 63.957 0.50 27.42 ? 530  SER A CB    1 
ATOM   4066  C  CB    B SER A  1  503 ? 22.038  17.779 63.948 0.50 27.80 ? 530  SER A CB    1 
ATOM   4067  O  OG    A SER A  1  503 ? 22.952  16.735 63.859 0.50 26.66 ? 530  SER A OG    1 
ATOM   4068  O  OG    B SER A  1  503 ? 22.532  18.543 65.035 0.50 27.87 ? 530  SER A OG    1 
ATOM   4069  N  N     . LEU A  1  504 ? 20.443  17.273 61.324 1.00 29.64 ? 531  LEU A N     1 
ATOM   4070  C  CA    . LEU A  1  504 ? 20.005  16.426 60.201 0.88 31.28 ? 531  LEU A CA    1 
ATOM   4071  C  C     . LEU A  1  504 ? 20.329  17.064 58.857 1.00 31.18 ? 531  LEU A C     1 
ATOM   4072  O  O     . LEU A  1  504 ? 20.924  16.419 57.988 1.00 32.03 ? 531  LEU A O     1 
ATOM   4073  C  CB    . LEU A  1  504 ? 18.495  16.151 60.300 0.88 32.14 ? 531  LEU A CB    1 
ATOM   4074  C  CG    . LEU A  1  504 ? 17.630  15.458 59.214 0.88 34.60 ? 531  LEU A CG    1 
ATOM   4075  C  CD1   . LEU A  1  504 ? 16.993  16.427 58.215 0.88 35.24 ? 531  LEU A CD1   1 
ATOM   4076  C  CD2   . LEU A  1  504 ? 18.332  14.329 58.484 0.88 37.09 ? 531  LEU A CD2   1 
ATOM   4077  N  N     . LYS A  1  505 ? 19.914  18.321 58.696 1.00 30.39 ? 532  LYS A N     1 
ATOM   4078  C  CA    . LYS A  1  505 ? 20.146  19.078 57.474 1.00 30.18 ? 532  LYS A CA    1 
ATOM   4079  C  C     . LYS A  1  505 ? 21.628  19.186 57.143 1.00 29.80 ? 532  LYS A C     1 
ATOM   4080  O  O     . LYS A  1  505 ? 22.023  18.995 55.996 1.00 30.63 ? 532  LYS A O     1 
ATOM   4081  C  CB    . LYS A  1  505 ? 19.533  20.479 57.574 1.00 29.62 ? 532  LYS A CB    1 
ATOM   4082  C  CG    . LYS A  1  505 ? 18.074  20.570 57.141 1.00 30.18 ? 532  LYS A CG    1 
ATOM   4083  C  CD    . LYS A  1  505 ? 17.865  20.088 55.698 1.00 31.08 ? 532  LYS A CD    1 
ATOM   4084  C  CE    . LYS A  1  505 ? 18.387  21.089 54.679 1.00 30.13 ? 532  LYS A CE    1 
ATOM   4085  N  NZ    . LYS A  1  505 ? 17.913  20.772 53.312 1.00 27.82 ? 532  LYS A NZ    1 
ATOM   4086  N  N     . GLY A  1  506 ? 22.441  19.484 58.151 1.00 28.50 ? 533  GLY A N     1 
ATOM   4087  C  CA    . GLY A  1  506 ? 23.883  19.595 57.961 1.00 27.83 ? 533  GLY A CA    1 
ATOM   4088  C  C     . GLY A  1  506 ? 24.526  18.268 57.605 1.00 28.17 ? 533  GLY A C     1 
ATOM   4089  O  O     . GLY A  1  506 ? 25.519  18.226 56.879 1.00 29.30 ? 533  GLY A O     1 
ATOM   4090  N  N     . LEU A  1  507 ? 23.956  17.174 58.100 1.00 25.33 ? 534  LEU A N     1 
ATOM   4091  C  CA    . LEU A  1  507 ? 24.559  15.863 57.886 1.00 24.25 ? 534  LEU A CA    1 
ATOM   4092  C  C     . LEU A  1  507 ? 24.095  15.239 56.577 1.00 23.83 ? 534  LEU A C     1 
ATOM   4093  O  O     . LEU A  1  507 ? 24.922  14.891 55.735 1.00 23.22 ? 534  LEU A O     1 
ATOM   4094  C  CB    . LEU A  1  507 ? 24.327  14.931 59.089 1.00 24.18 ? 534  LEU A CB    1 
ATOM   4095  C  CG    . LEU A  1  507 ? 25.007  15.387 60.391 1.00 23.58 ? 534  LEU A CG    1 
ATOM   4096  C  CD1   . LEU A  1  507 ? 24.393  14.720 61.617 1.00 23.57 ? 534  LEU A CD1   1 
ATOM   4097  C  CD2   . LEU A  1  507 ? 26.517  15.168 60.350 1.00 22.72 ? 534  LEU A CD2   1 
ATOM   4098  N  N     . MET A  1  508 ? 22.781  15.124 56.405 1.00 24.09 ? 535  MET A N     1 
ATOM   4099  C  CA    . MET A  1  508 ? 22.209  14.460 55.235 1.00 24.24 ? 535  MET A CA    1 
ATOM   4100  C  C     . MET A  1  508 ? 22.194  15.375 54.004 1.00 24.03 ? 535  MET A C     1 
ATOM   4101  O  O     . MET A  1  508 ? 22.128  14.889 52.873 1.00 23.89 ? 535  MET A O     1 
ATOM   4102  C  CB    . MET A  1  508 ? 20.801  13.928 55.540 1.00 25.28 ? 535  MET A CB    1 
ATOM   4103  C  CG    . MET A  1  508 ? 20.724  12.868 56.666 1.00 26.94 ? 535  MET A CG    1 
ATOM   4104  S  SD    . MET A  1  508 ? 21.864  11.468 56.528 1.00 28.94 ? 535  MET A SD    1 
ATOM   4105  C  CE    . MET A  1  508 ? 21.180  10.595 55.124 1.00 29.49 ? 535  MET A CE    1 
ATOM   4106  N  N     . GLY A  1  509 ? 22.282  16.690 54.232 1.00 23.54 ? 536  GLY A N     1 
ATOM   4107  C  CA    . GLY A  1  509 ? 22.305  17.681 53.150 1.00 23.66 ? 536  GLY A CA    1 
ATOM   4108  C  C     . GLY A  1  509 ? 23.609  17.739 52.370 1.00 23.08 ? 536  GLY A C     1 
ATOM   4109  O  O     . GLY A  1  509 ? 23.688  18.381 51.330 1.00 23.90 ? 536  GLY A O     1 
ATOM   4110  N  N     . ASN A  1  510 ? 24.642  17.078 52.880 1.00 22.27 ? 537  ASN A N     1 
ATOM   4111  C  CA    . ASN A  1  510 ? 25.933  17.017 52.207 1.00 21.47 ? 537  ASN A CA    1 
ATOM   4112  C  C     . ASN A  1  510 ? 25.789  16.397 50.804 1.00 21.17 ? 537  ASN A C     1 
ATOM   4113  O  O     . ASN A  1  510 ? 25.035  15.430 50.628 1.00 21.47 ? 537  ASN A O     1 
ATOM   4114  C  CB    . ASN A  1  510 ? 26.914  16.212 53.070 1.00 20.70 ? 537  ASN A CB    1 
ATOM   4115  C  CG    . ASN A  1  510 ? 28.360  16.464 52.701 1.00 20.60 ? 537  ASN A CG    1 
ATOM   4116  O  OD1   . ASN A  1  510 ? 28.858  15.924 51.721 1.00 21.20 ? 537  ASN A OD1   1 
ATOM   4117  N  ND2   . ASN A  1  510 ? 29.045  17.281 53.495 1.00 20.52 ? 537  ASN A ND2   1 
ATOM   4118  N  N     . PRO A  1  511 ? 26.502  16.947 49.802 1.00 20.88 ? 538  PRO A N     1 
ATOM   4119  C  CA    . PRO A  1  511 ? 26.433  16.389 48.449 1.00 20.79 ? 538  PRO A CA    1 
ATOM   4120  C  C     . PRO A  1  511 ? 26.779  14.902 48.371 1.00 20.55 ? 538  PRO A C     1 
ATOM   4121  O  O     . PRO A  1  511 ? 26.220  14.202 47.531 1.00 20.50 ? 538  PRO A O     1 
ATOM   4122  C  CB    . PRO A  1  511 ? 27.472  17.201 47.667 1.00 21.00 ? 538  PRO A CB    1 
ATOM   4123  C  CG    . PRO A  1  511 ? 28.291  17.921 48.721 1.00 20.71 ? 538  PRO A CG    1 
ATOM   4124  C  CD    . PRO A  1  511 ? 27.345  18.158 49.843 1.00 20.87 ? 538  PRO A CD    1 
ATOM   4125  N  N     . ILE A  1  512 ? 27.665  14.416 49.238 1.00 19.97 ? 539  ILE A N     1 
ATOM   4126  C  CA    . ILE A  1  512 ? 28.050  13.005 49.167 1.00 20.24 ? 539  ILE A CA    1 
ATOM   4127  C  C     . ILE A  1  512 ? 26.877  12.063 49.465 1.00 20.41 ? 539  ILE A C     1 
ATOM   4128  O  O     . ILE A  1  512 ? 26.913  10.892 49.078 1.00 20.85 ? 539  ILE A O     1 
ATOM   4129  C  CB    . ILE A  1  512 ? 29.314  12.646 50.000 1.00 20.19 ? 539  ILE A CB    1 
ATOM   4130  C  CG1   . ILE A  1  512 ? 29.003  12.582 51.495 1.00 20.83 ? 539  ILE A CG1   1 
ATOM   4131  C  CG2   . ILE A  1  512 ? 30.461  13.597 49.698 1.00 20.57 ? 539  ILE A CG2   1 
ATOM   4132  C  CD1   . ILE A  1  512 ? 29.764  11.475 52.185 1.00 21.72 ? 539  ILE A CD1   1 
ATOM   4133  N  N     . CYS A  1  513 ? 25.825  12.597 50.097 1.00 20.05 ? 540  CYS A N     1 
ATOM   4134  C  CA    . CYS A  1  513 ? 24.618  11.824 50.404 1.00 20.42 ? 540  CYS A CA    1 
ATOM   4135  C  C     . CYS A  1  513 ? 23.613  11.793 49.250 1.00 21.36 ? 540  CYS A C     1 
ATOM   4136  O  O     . CYS A  1  513 ? 22.624  11.047 49.310 1.00 22.20 ? 540  CYS A O     1 
ATOM   4137  C  CB    . CYS A  1  513 ? 23.927  12.360 51.657 1.00 19.76 ? 540  CYS A CB    1 
ATOM   4138  S  SG    . CYS A  1  513 ? 24.937  12.272 53.140 1.00 20.70 ? 540  CYS A SG    1 
ATOM   4139  N  N     . SER A  1  514 ? 23.858  12.590 48.212 1.00 20.93 ? 541  SER A N     1 
ATOM   4140  C  CA    . SER A  1  514 ? 22.949  12.635 47.068 1.00 22.49 ? 541  SER A CA    1 
ATOM   4141  C  C     . SER A  1  514 ? 23.147  11.397 46.174 1.00 23.19 ? 541  SER A C     1 
ATOM   4142  O  O     . SER A  1  514 ? 24.229  10.812 46.171 1.00 22.52 ? 541  SER A O     1 
ATOM   4143  C  CB    . SER A  1  514 ? 23.096  13.955 46.289 1.00 22.44 ? 541  SER A CB    1 
ATOM   4144  O  OG    . SER A  1  514 ? 24.349  14.062 45.628 1.00 23.02 ? 541  SER A OG    1 
ATOM   4145  N  N     . PRO A  1  515 ? 22.096  10.981 45.433 1.00 24.81 ? 542  PRO A N     1 
ATOM   4146  C  CA    . PRO A  1  515 ? 22.207  9.768  44.610 1.00 26.05 ? 542  PRO A CA    1 
ATOM   4147  C  C     . PRO A  1  515 ? 23.395  9.756  43.642 1.00 26.01 ? 542  PRO A C     1 
ATOM   4148  O  O     . PRO A  1  515 ? 24.041  8.718  43.487 1.00 25.83 ? 542  PRO A O     1 
ATOM   4149  C  CB    . PRO A  1  515 ? 20.892  9.744  43.829 1.00 27.80 ? 542  PRO A CB    1 
ATOM   4150  C  CG    . PRO A  1  515 ? 19.946  10.504 44.652 1.00 27.81 ? 542  PRO A CG    1 
ATOM   4151  C  CD    . PRO A  1  515 ? 20.720  11.515 45.436 1.00 25.72 ? 542  PRO A CD    1 
ATOM   4152  N  N     . GLN A  1  516 ? 23.697  10.890 43.007 1.00 26.15 ? 543  GLN A N     1 
ATOM   4153  C  CA    . GLN A  1  516 ? 24.790  10.898 42.027 1.00 26.44 ? 543  GLN A CA    1 
ATOM   4154  C  C     . GLN A  1  516 ? 26.169  10.766 42.667 1.00 24.89 ? 543  GLN A C     1 
ATOM   4155  O  O     . GLN A  1  516 ? 27.136  10.385 41.998 1.00 25.26 ? 543  GLN A O     1 
ATOM   4156  C  CB    . GLN A  1  516 ? 24.706  12.086 41.063 1.00 27.36 ? 543  GLN A CB    1 
ATOM   4157  C  CG    . GLN A  1  516 ? 23.629  11.918 39.974 1.00 30.13 ? 543  GLN A CG    1 
ATOM   4158  C  CD    . GLN A  1  516 ? 23.798  10.648 39.154 1.00 33.03 ? 543  GLN A CD    1 
ATOM   4159  O  OE1   . GLN A  1  516 ? 23.467  9.544  39.607 1.00 34.90 ? 543  GLN A OE1   1 
ATOM   4160  N  NE2   . GLN A  1  516 ? 24.312  10.795 37.939 1.00 34.16 ? 543  GLN A NE2   1 
ATOM   4161  N  N     . TYR A  1  517 ? 26.239  11.055 43.963 1.00 23.07 ? 544  TYR A N     1 
ATOM   4162  C  CA    . TYR A  1  517 ? 27.461  10.875 44.738 1.00 21.88 ? 544  TYR A CA    1 
ATOM   4163  C  C     . TYR A  1  517 ? 27.521  9.554  45.503 1.00 22.10 ? 544  TYR A C     1 
ATOM   4164  O  O     . TYR A  1  517 ? 28.600  8.999  45.674 1.00 22.37 ? 544  TYR A O     1 
ATOM   4165  C  CB    . TYR A  1  517 ? 27.653  12.035 45.728 1.00 20.39 ? 544  TYR A CB    1 
ATOM   4166  C  CG    . TYR A  1  517 ? 28.280  13.279 45.129 1.00 20.24 ? 544  TYR A CG    1 
ATOM   4167  C  CD1   . TYR A  1  517 ? 27.540  14.138 44.308 1.00 19.47 ? 544  TYR A CD1   1 
ATOM   4168  C  CD2   . TYR A  1  517 ? 29.611  13.601 45.384 1.00 19.42 ? 544  TYR A CD2   1 
ATOM   4169  C  CE1   . TYR A  1  517 ? 28.121  15.292 43.753 1.00 19.78 ? 544  TYR A CE1   1 
ATOM   4170  C  CE2   . TYR A  1  517 ? 30.196  14.752 44.840 1.00 19.69 ? 544  TYR A CE2   1 
ATOM   4171  C  CZ    . TYR A  1  517 ? 29.445  15.586 44.027 1.00 19.75 ? 544  TYR A CZ    1 
ATOM   4172  O  OH    . TYR A  1  517 ? 30.025  16.716 43.492 1.00 21.06 ? 544  TYR A OH    1 
ATOM   4173  N  N     . TRP A  1  518 ? 26.386  9.055  45.989 1.00 22.43 ? 545  TRP A N     1 
ATOM   4174  C  CA    . TRP A  1  518 ? 26.417  7.894  46.884 1.00 22.73 ? 545  TRP A CA    1 
ATOM   4175  C  C     . TRP A  1  518 ? 26.593  6.572  46.118 1.00 23.97 ? 545  TRP A C     1 
ATOM   4176  O  O     . TRP A  1  518 ? 25.651  5.783  45.962 1.00 25.42 ? 545  TRP A O     1 
ATOM   4177  C  CB    . TRP A  1  518 ? 25.192  7.882  47.803 1.00 22.98 ? 545  TRP A CB    1 
ATOM   4178  C  CG    . TRP A  1  518 ? 25.282  6.885  48.938 1.00 22.86 ? 545  TRP A CG    1 
ATOM   4179  C  CD1   . TRP A  1  518 ? 24.523  5.754  49.100 1.00 23.65 ? 545  TRP A CD1   1 
ATOM   4180  C  CD2   . TRP A  1  518 ? 26.172  6.935  50.058 1.00 20.99 ? 545  TRP A CD2   1 
ATOM   4181  N  NE1   . TRP A  1  518 ? 24.888  5.104  50.250 1.00 23.47 ? 545  TRP A NE1   1 
ATOM   4182  C  CE2   . TRP A  1  518 ? 25.899  5.804  50.857 1.00 22.10 ? 545  TRP A CE2   1 
ATOM   4183  C  CE3   . TRP A  1  518 ? 27.176  7.831  50.467 1.00 20.69 ? 545  TRP A CE3   1 
ATOM   4184  C  CZ2   . TRP A  1  518 ? 26.595  5.536  52.040 1.00 22.13 ? 545  TRP A CZ2   1 
ATOM   4185  C  CZ3   . TRP A  1  518 ? 27.871  7.563  51.645 1.00 20.50 ? 545  TRP A CZ3   1 
ATOM   4186  C  CH2   . TRP A  1  518 ? 27.570  6.428  52.421 1.00 21.52 ? 545  TRP A CH2   1 
ATOM   4187  N  N     . LYS A  1  519 ? 27.824  6.354  45.659 1.00 23.62 ? 546  LYS A N     1 
ATOM   4188  C  CA    . LYS A  1  519 ? 28.194  5.261  44.762 1.00 24.97 ? 546  LYS A CA    1 
ATOM   4189  C  C     . LYS A  1  519 ? 29.632  4.888  45.089 1.00 24.45 ? 546  LYS A C     1 
ATOM   4190  O  O     . LYS A  1  519 ? 30.419  5.763  45.432 1.00 23.60 ? 546  LYS A O     1 
ATOM   4191  C  CB    . LYS A  1  519 ? 28.185  5.732  43.301 1.00 25.31 ? 546  LYS A CB    1 
ATOM   4192  C  CG    . LYS A  1  519 ? 26.846  6.077  42.706 1.00 26.98 ? 546  LYS A CG    1 
ATOM   4193  C  CD    . LYS A  1  519 ? 27.020  6.553  41.267 1.00 26.24 ? 546  LYS A CD    1 
ATOM   4194  C  CE    . LYS A  1  519 ? 25.687  6.950  40.673 1.00 27.08 ? 546  LYS A CE    1 
ATOM   4195  N  NZ    . LYS A  1  519 ? 25.803  7.229  39.221 1.00 27.52 ? 546  LYS A NZ    1 
ATOM   4196  N  N     . PRO A  1  520 ? 29.997  3.598  44.939 1.00 25.56 ? 547  PRO A N     1 
ATOM   4197  C  CA    . PRO A  1  520 ? 31.373  3.157  45.202 1.00 25.18 ? 547  PRO A CA    1 
ATOM   4198  C  C     . PRO A  1  520 ? 32.433  3.933  44.406 1.00 24.57 ? 547  PRO A C     1 
ATOM   4199  O  O     . PRO A  1  520 ? 33.470  4.286  44.968 1.00 24.10 ? 547  PRO A O     1 
ATOM   4200  C  CB    . PRO A  1  520 ? 31.361  1.684  44.783 1.00 26.93 ? 547  PRO A CB    1 
ATOM   4201  C  CG    . PRO A  1  520 ? 29.948  1.282  44.888 1.00 28.15 ? 547  PRO A CG    1 
ATOM   4202  C  CD    . PRO A  1  520 ? 29.120  2.474  44.566 1.00 26.69 ? 547  PRO A CD    1 
ATOM   4203  N  N     . SER A  1  521 ? 32.169  4.218  43.130 1.00 24.89 ? 548  SER A N     1 
ATOM   4204  C  CA    . SER A  1  521 ? 33.147  4.925  42.279 1.00 24.47 ? 548  SER A CA    1 
ATOM   4205  C  C     . SER A  1  521 ? 33.539  6.320  42.779 1.00 23.07 ? 548  SER A C     1 
ATOM   4206  O  O     . SER A  1  521 ? 34.675  6.756  42.554 1.00 23.19 ? 548  SER A O     1 
ATOM   4207  C  CB    . SER A  1  521 ? 32.681  4.997  40.823 1.00 25.36 ? 548  SER A CB    1 
ATOM   4208  O  OG    . SER A  1  521 ? 31.398  5.585  40.730 1.00 26.52 ? 548  SER A OG    1 
ATOM   4209  N  N     . THR A  1  522 ? 32.612  7.006  43.453 1.00 21.93 ? 549  THR A N     1 
ATOM   4210  C  CA    . THR A  1  522 ? 32.885  8.304  44.080 1.00 20.71 ? 549  THR A CA    1 
ATOM   4211  C  C     . THR A  1  522 ? 34.070  8.234  45.054 1.00 20.30 ? 549  THR A C     1 
ATOM   4212  O  O     . THR A  1  522 ? 34.824  9.206  45.194 1.00 19.75 ? 549  THR A O     1 
ATOM   4213  C  CB    . THR A  1  522 ? 31.638  8.831  44.845 1.00 20.70 ? 549  THR A CB    1 
ATOM   4214  O  OG1   . THR A  1  522 ? 30.522  8.921  43.951 1.00 20.40 ? 549  THR A OG1   1 
ATOM   4215  C  CG2   . THR A  1  522 ? 31.889  10.207 45.457 1.00 18.49 ? 549  THR A CG2   1 
ATOM   4216  N  N     . PHE A  1  523 ? 34.226  7.077  45.700 1.00 19.93 ? 550  PHE A N     1 
ATOM   4217  C  CA    . PHE A  1  523 ? 35.186  6.880  46.778 1.00 19.83 ? 550  PHE A CA    1 
ATOM   4218  C  C     . PHE A  1  523 ? 36.319  5.910  46.415 1.00 20.84 ? 550  PHE A C     1 
ATOM   4219  O  O     . PHE A  1  523 ? 36.914  5.280  47.293 1.00 21.17 ? 550  PHE A O     1 
ATOM   4220  C  CB    . PHE A  1  523 ? 34.453  6.415  48.048 1.00 19.73 ? 550  PHE A CB    1 
ATOM   4221  C  CG    . PHE A  1  523 ? 33.249  7.262  48.386 1.00 19.29 ? 550  PHE A CG    1 
ATOM   4222  C  CD1   . PHE A  1  523 ? 33.411  8.535  48.929 1.00 17.24 ? 550  PHE A CD1   1 
ATOM   4223  C  CD2   . PHE A  1  523 ? 31.958  6.792  48.130 1.00 19.24 ? 550  PHE A CD2   1 
ATOM   4224  C  CE1   . PHE A  1  523 ? 32.306  9.330  49.219 1.00 18.03 ? 550  PHE A CE1   1 
ATOM   4225  C  CE2   . PHE A  1  523 ? 30.843  7.575  48.419 1.00 18.33 ? 550  PHE A CE2   1 
ATOM   4226  C  CZ    . PHE A  1  523 ? 31.014  8.844  48.963 1.00 17.30 ? 550  PHE A CZ    1 
ATOM   4227  N  N     . GLY A  1  524 ? 36.617  5.797  45.122 1.00 21.37 ? 551  GLY A N     1 
ATOM   4228  C  CA    . GLY A  1  524 ? 37.706  4.950  44.660 1.00 22.74 ? 551  GLY A CA    1 
ATOM   4229  C  C     . GLY A  1  524 ? 37.353  3.478  44.572 1.00 23.89 ? 551  GLY A C     1 
ATOM   4230  O  O     . GLY A  1  524 ? 38.230  2.642  44.399 1.00 24.85 ? 551  GLY A O     1 
ATOM   4231  N  N     . GLY A  1  525 ? 36.067  3.158  44.670 1.00 24.15 ? 552  GLY A N     1 
ATOM   4232  C  CA    . GLY A  1  525 ? 35.619  1.779  44.522 1.00 25.44 ? 552  GLY A CA    1 
ATOM   4233  C  C     . GLY A  1  525 ? 35.143  1.214  45.843 1.00 25.72 ? 552  GLY A C     1 
ATOM   4234  O  O     . GLY A  1  525 ? 35.011  1.947  46.829 1.00 24.92 ? 552  GLY A O     1 
ATOM   4235  N  N     . GLU A  1  526 ? 34.889  -0.089 45.861 1.00 38.25 ? 553  GLU A N     1 
ATOM   4236  C  CA    . GLU A  1  526 ? 34.274  -0.738 47.015 1.00 38.17 ? 553  GLU A CA    1 
ATOM   4237  C  C     . GLU A  1  526 ? 35.099  -0.627 48.287 1.00 35.97 ? 553  GLU A C     1 
ATOM   4238  O  O     . GLU A  1  526 ? 34.533  -0.509 49.367 1.00 35.25 ? 553  GLU A O     1 
ATOM   4239  C  CB    . GLU A  1  526 ? 33.948  -2.210 46.726 1.00 40.21 ? 553  GLU A CB    1 
ATOM   4240  C  CG    . GLU A  1  526 ? 32.775  -2.429 45.749 1.00 44.32 ? 553  GLU A CG    1 
ATOM   4241  C  CD    . GLU A  1  526 ? 31.430  -1.853 46.228 1.00 45.85 ? 553  GLU A CD    1 
ATOM   4242  O  OE1   . GLU A  1  526 ? 31.306  -1.421 47.397 1.00 44.32 ? 553  GLU A OE1   1 
ATOM   4243  O  OE2   . GLU A  1  526 ? 30.481  -1.845 45.418 1.00 49.18 ? 553  GLU A OE2   1 
ATOM   4244  N  N     . VAL A  1  527 ? 36.425  -0.662 48.157 1.00 35.42 ? 554  VAL A N     1 
ATOM   4245  C  CA    . VAL A  1  527 ? 37.317  -0.524 49.311 1.00 34.23 ? 554  VAL A CA    1 
ATOM   4246  C  C     . VAL A  1  527 ? 37.132  0.839  49.997 1.00 32.35 ? 554  VAL A C     1 
ATOM   4247  O  O     . VAL A  1  527 ? 36.999  0.917  51.220 1.00 31.25 ? 554  VAL A O     1 
ATOM   4248  C  CB    . VAL A  1  527 ? 38.809  -0.754 48.935 1.00 34.54 ? 554  VAL A CB    1 
ATOM   4249  C  CG1   . VAL A  1  527 ? 39.706  -0.538 50.150 1.00 33.17 ? 554  VAL A CG1   1 
ATOM   4250  C  CG2   . VAL A  1  527 ? 39.012  -2.159 48.387 1.00 36.65 ? 554  VAL A CG2   1 
ATOM   4251  N  N     . GLY A  1  528 ? 37.095  1.902  49.198 1.00 32.36 ? 555  GLY A N     1 
ATOM   4252  C  CA    . GLY A  1  528 ? 36.882  3.251  49.726 1.00 31.28 ? 555  GLY A CA    1 
ATOM   4253  C  C     . GLY A  1  528 ? 35.500  3.433  50.330 1.00 31.02 ? 555  GLY A C     1 
ATOM   4254  O  O     . GLY A  1  528 ? 35.353  4.047  51.391 1.00 29.72 ? 555  GLY A O     1 
ATOM   4255  N  N     . PHE A  1  529 ? 34.491  2.894  49.648 1.00 32.55 ? 556  PHE A N     1 
ATOM   4256  C  CA    . PHE A  1  529 ? 33.111  2.918  50.125 1.00 33.15 ? 556  PHE A CA    1 
ATOM   4257  C  C     . PHE A  1  529 ? 32.972  2.209  51.477 1.00 32.80 ? 556  PHE A C     1 
ATOM   4258  O  O     . PHE A  1  529 ? 32.277  2.707  52.359 1.00 32.47 ? 556  PHE A O     1 
ATOM   4259  C  CB    . PHE A  1  529 ? 32.186  2.279  49.088 1.00 35.27 ? 556  PHE A CB    1 
ATOM   4260  C  CG    . PHE A  1  529 ? 30.768  2.786  49.121 1.00 36.41 ? 556  PHE A CG    1 
ATOM   4261  C  CD1   . PHE A  1  529 ? 30.457  4.035  49.649 1.00 35.14 ? 556  PHE A CD1   1 
ATOM   4262  C  CD2   . PHE A  1  529 ? 29.739  2.021  48.577 1.00 39.70 ? 556  PHE A CD2   1 
ATOM   4263  C  CE1   . PHE A  1  529 ? 29.144  4.500  49.658 1.00 36.30 ? 556  PHE A CE1   1 
ATOM   4264  C  CE2   . PHE A  1  529 ? 28.420  2.486  48.575 1.00 40.99 ? 556  PHE A CE2   1 
ATOM   4265  C  CZ    . PHE A  1  529 ? 28.129  3.732  49.115 1.00 38.76 ? 556  PHE A CZ    1 
ATOM   4266  N  N     . LYS A  1  530 ? 33.641  1.064  51.635 1.00 33.26 ? 557  LYS A N     1 
ATOM   4267  C  CA    . LYS A  1  530 ? 33.613  0.298  52.893 1.00 33.46 ? 557  LYS A CA    1 
ATOM   4268  C  C     . LYS A  1  530 ? 34.206  1.072  54.072 1.00 31.19 ? 557  LYS A C     1 
ATOM   4269  O  O     . LYS A  1  530 ? 33.702  0.988  55.193 1.00 30.70 ? 557  LYS A O     1 
ATOM   4270  C  CB    . LYS A  1  530 ? 34.341  -1.042 52.751 1.00 34.05 ? 557  LYS A CB    1 
ATOM   4271  C  CG    . LYS A  1  530 ? 33.532  -2.121 52.057 1.00 39.00 ? 557  LYS A CG    1 
ATOM   4272  N  N     . ILE A  1  531 ? 35.276  1.820  53.820 1.00 30.15 ? 558  ILE A N     1 
ATOM   4273  C  CA    . ILE A  1  531 ? 35.881  2.637  54.873 1.00 28.71 ? 558  ILE A CA    1 
ATOM   4274  C  C     . ILE A  1  531 ? 34.820  3.540  55.516 1.00 28.72 ? 558  ILE A C     1 
ATOM   4275  O  O     . ILE A  1  531 ? 34.742  3.630  56.741 1.00 28.70 ? 558  ILE A O     1 
ATOM   4276  C  CB    . ILE A  1  531 ? 37.079  3.471  54.353 1.00 27.75 ? 558  ILE A CB    1 
ATOM   4277  C  CG1   . ILE A  1  531 ? 38.232  2.548  53.933 1.00 28.07 ? 558  ILE A CG1   1 
ATOM   4278  C  CG2   . ILE A  1  531 ? 37.545  4.470  55.416 1.00 25.07 ? 558  ILE A CG2   1 
ATOM   4279  C  CD1   . ILE A  1  531 ? 39.348  3.271  53.168 1.00 27.55 ? 558  ILE A CD1   1 
ATOM   4280  N  N     . ILE A  1  532 ? 33.998  4.183  54.685 1.00 29.66 ? 559  ILE A N     1 
ATOM   4281  C  CA    . ILE A  1  532 ? 32.912  5.052  55.163 1.00 29.76 ? 559  ILE A CA    1 
ATOM   4282  C  C     . ILE A  1  532 ? 31.874  4.276  55.970 1.00 30.91 ? 559  ILE A C     1 
ATOM   4283  O  O     . ILE A  1  532 ? 31.557  4.634  57.113 1.00 30.51 ? 559  ILE A O     1 
ATOM   4284  C  CB    . ILE A  1  532 ? 32.189  5.779  53.991 1.00 30.70 ? 559  ILE A CB    1 
ATOM   4285  C  CG1   . ILE A  1  532 ? 33.132  6.777  53.314 1.00 30.03 ? 559  ILE A CG1   1 
ATOM   4286  C  CG2   . ILE A  1  532 ? 30.894  6.473  54.477 1.00 30.49 ? 559  ILE A CG2   1 
ATOM   4287  C  CD1   . ILE A  1  532 ? 32.530  7.472  52.124 1.00 30.36 ? 559  ILE A CD1   1 
ATOM   4288  N  N     . ASN A  1  533 ? 31.362  3.202  55.378 1.00 32.61 ? 560  ASN A N     1 
ATOM   4289  C  CA    . ASN A  1  533 ? 30.199  2.522  55.934 1.00 33.84 ? 560  ASN A CA    1 
ATOM   4290  C  C     . ASN A  1  533 ? 30.492  1.605  57.122 1.00 33.43 ? 560  ASN A C     1 
ATOM   4291  O  O     . ASN A  1  533 ? 29.580  0.996  57.680 1.00 34.67 ? 560  ASN A O     1 
ATOM   4292  C  CB    . ASN A  1  533 ? 29.404  1.822  54.823 1.00 36.11 ? 560  ASN A CB    1 
ATOM   4293  C  CG    . ASN A  1  533 ? 28.741  2.817  53.870 1.00 37.47 ? 560  ASN A CG    1 
ATOM   4294  O  OD1   . ASN A  1  533 ? 28.974  2.795  52.654 1.00 38.85 ? 560  ASN A OD1   1 
ATOM   4295  N  ND2   . ASN A  1  533 ? 27.925  3.705  54.424 1.00 36.68 ? 560  ASN A ND2   1 
ATOM   4296  N  N     . THR A  1  534 ? 31.760  1.547  57.525 1.00 31.71 ? 561  THR A N     1 
ATOM   4297  C  CA    . THR A  1  534 ? 32.182  0.774  58.700 1.00 30.98 ? 561  THR A CA    1 
ATOM   4298  C  C     . THR A  1  534 ? 32.939  1.654  59.719 1.00 28.69 ? 561  THR A C     1 
ATOM   4299  O  O     . THR A  1  534 ? 33.474  1.148  60.701 1.00 28.40 ? 561  THR A O     1 
ATOM   4300  C  CB    . THR A  1  534 ? 33.100  -0.408 58.302 1.00 31.73 ? 561  THR A CB    1 
ATOM   4301  O  OG1   . THR A  1  534 ? 34.258  0.101  57.621 1.00 30.62 ? 561  THR A OG1   1 
ATOM   4302  C  CG2   . THR A  1  534 ? 32.366  -1.396 57.398 1.00 34.03 ? 561  THR A CG2   1 
ATOM   4303  N  N     . ALA A  1  535 ? 32.985  2.963  59.488 1.00 26.93 ? 562  ALA A N     1 
ATOM   4304  C  CA    . ALA A  1  535 ? 33.715  3.857  60.388 1.00 25.16 ? 562  ALA A CA    1 
ATOM   4305  C  C     . ALA A  1  535 ? 32.997  3.978  61.730 1.00 25.16 ? 562  ALA A C     1 
ATOM   4306  O  O     . ALA A  1  535 ? 31.773  4.001  61.785 1.00 25.34 ? 562  ALA A O     1 
ATOM   4307  C  CB    . ALA A  1  535 ? 33.899  5.226  59.763 1.00 24.01 ? 562  ALA A CB    1 
ATOM   4308  N  N     . SER A  1  536 ? 33.779  4.032  62.803 1.00 24.45 ? 563  SER A N     1 
ATOM   4309  C  CA    . SER A  1  536 ? 33.257  4.267  64.141 1.00 24.38 ? 563  SER A CA    1 
ATOM   4310  C  C     . SER A  1  536 ? 34.256  5.105  64.911 1.00 23.44 ? 563  SER A C     1 
ATOM   4311  O  O     . SER A  1  536 ? 35.413  5.265  64.483 1.00 22.60 ? 563  SER A O     1 
ATOM   4312  C  CB    . SER A  1  536 ? 32.946  2.946  64.867 1.00 25.92 ? 563  SER A CB    1 
ATOM   4313  O  OG    . SER A  1  536 ? 34.122  2.242  65.223 1.00 25.02 ? 563  SER A OG    1 
ATOM   4314  N  N     . ILE A  1  537 ? 33.819  5.673  66.028 1.00 23.56 ? 564  ILE A N     1 
ATOM   4315  C  CA    . ILE A  1  537 ? 34.749  6.414  66.877 1.00 22.88 ? 564  ILE A CA    1 
ATOM   4316  C  C     . ILE A  1  537 ? 35.842  5.455  67.389 1.00 23.44 ? 564  ILE A C     1 
ATOM   4317  O  O     . ILE A  1  537 ? 37.006  5.837  67.515 1.00 22.79 ? 564  ILE A O     1 
ATOM   4318  C  CB    . ILE A  1  537 ? 34.027  7.197  68.019 1.00 23.08 ? 564  ILE A CB    1 
ATOM   4319  C  CG1   . ILE A  1  537 ? 35.014  8.060  68.811 1.00 21.47 ? 564  ILE A CG1   1 
ATOM   4320  C  CG2   . ILE A  1  537 ? 33.241  6.251  68.950 1.00 24.25 ? 564  ILE A CG2   1 
ATOM   4321  C  CD1   . ILE A  1  537 ? 35.672  9.177  67.982 1.00 22.48 ? 564  ILE A CD1   1 
ATOM   4322  N  N     . GLN A  1  538 ? 35.465  4.204  67.647 1.00 24.88 ? 565  GLN A N     1 
ATOM   4323  C  CA    . GLN A  1  538 ? 36.442  3.187  68.065 1.00 25.67 ? 565  GLN A CA    1 
ATOM   4324  C  C     . GLN A  1  538 ? 37.455  2.843  66.960 1.00 25.29 ? 565  GLN A C     1 
ATOM   4325  O  O     . GLN A  1  538 ? 38.662  2.824  67.217 1.00 25.56 ? 565  GLN A O     1 
ATOM   4326  C  CB    . GLN A  1  538 ? 35.748  1.927  68.605 1.00 27.45 ? 565  GLN A CB    1 
ATOM   4327  C  CG    . GLN A  1  538 ? 36.704  0.806  69.022 1.00 29.45 ? 565  GLN A CG    1 
ATOM   4328  C  CD    . GLN A  1  538 ? 37.596  1.175  70.214 1.00 30.46 ? 565  GLN A CD    1 
ATOM   4329  O  OE1   . GLN A  1  538 ? 37.255  0.882  71.357 1.00 31.34 ? 565  GLN A OE1   1 
ATOM   4330  N  NE2   . GLN A  1  538 ? 38.734  1.829  69.946 1.00 27.93 ? 565  GLN A NE2   1 
ATOM   4331  N  N     . SER A  1  539 ? 36.980  2.593  65.738 1.00 25.33 ? 566  SER A N     1 
ATOM   4332  C  CA    . SER A  1  539 ? 37.882  2.260  64.624 1.00 24.98 ? 566  SER A CA    1 
ATOM   4333  C  C     . SER A  1  539 ? 38.800  3.442  64.282 1.00 23.90 ? 566  SER A C     1 
ATOM   4334  O  O     . SER A  1  539 ? 39.972  3.247  63.938 1.00 24.01 ? 566  SER A O     1 
ATOM   4335  C  CB    . SER A  1  539 ? 37.114  1.744  63.391 1.00 25.37 ? 566  SER A CB    1 
ATOM   4336  O  OG    . SER A  1  539 ? 36.360  2.766  62.756 1.00 25.47 ? 566  SER A OG    1 
ATOM   4337  N  N     . LEU A  1  540 ? 38.280  4.659  64.418 1.00 22.81 ? 567  LEU A N     1 
ATOM   4338  C  CA    . LEU A  1  540 ? 39.088  5.864  64.212 1.00 22.73 ? 567  LEU A CA    1 
ATOM   4339  C  C     . LEU A  1  540 ? 40.323  5.893  65.120 1.00 22.85 ? 567  LEU A C     1 
ATOM   4340  O  O     . LEU A  1  540 ? 41.445  6.156  64.665 1.00 23.09 ? 567  LEU A O     1 
ATOM   4341  C  CB    . LEU A  1  540 ? 38.253  7.147  64.385 1.00 21.61 ? 567  LEU A CB    1 
ATOM   4342  C  CG    . LEU A  1  540 ? 38.975  8.472  64.075 1.00 22.24 ? 567  LEU A CG    1 
ATOM   4343  C  CD1   . LEU A  1  540 ? 39.225  8.652  62.560 1.00 22.10 ? 567  LEU A CD1   1 
ATOM   4344  C  CD2   . LEU A  1  540 ? 38.215  9.681  64.629 1.00 21.98 ? 567  LEU A CD2   1 
ATOM   4345  N  N     . ILE A  1  541 ? 40.103  5.629  66.402 1.00 23.05 ? 568  ILE A N     1 
ATOM   4346  C  CA    . ILE A  1  541 ? 41.179  5.625  67.380 1.00 23.14 ? 568  ILE A CA    1 
ATOM   4347  C  C     . ILE A  1  541 ? 42.059  4.393  67.158 1.00 24.22 ? 568  ILE A C     1 
ATOM   4348  O  O     . ILE A  1  541 ? 43.284  4.495  67.146 1.00 24.52 ? 568  ILE A O     1 
ATOM   4349  C  CB    . ILE A  1  541 ? 40.615  5.691  68.837 1.00 23.49 ? 568  ILE A CB    1 
ATOM   4350  C  CG1   . ILE A  1  541 ? 40.416  7.150  69.275 1.00 22.56 ? 568  ILE A CG1   1 
ATOM   4351  C  CG2   . ILE A  1  541 ? 41.522  4.948  69.829 1.00 23.95 ? 568  ILE A CG2   1 
ATOM   4352  C  CD1   . ILE A  1  541 ? 39.532  7.994  68.332 1.00 19.29 ? 568  ILE A CD1   1 
ATOM   4353  N  N     . CYS A  1  542 ? 41.425  3.241  66.948 1.00 25.04 ? 569  CYS A N     1 
ATOM   4354  C  CA    . CYS A  1  542 ? 42.149  1.991  66.757 1.00 26.96 ? 569  CYS A CA    1 
ATOM   4355  C  C     . CYS A  1  542 ? 43.143  2.035  65.587 1.00 26.35 ? 569  CYS A C     1 
ATOM   4356  O  O     . CYS A  1  542 ? 44.264  1.524  65.696 1.00 27.21 ? 569  CYS A O     1 
ATOM   4357  C  CB    . CYS A  1  542 ? 41.176  0.816  66.595 1.00 27.99 ? 569  CYS A CB    1 
ATOM   4358  S  SG    . CYS A  1  542 ? 41.995  -0.777 66.756 1.00 33.89 ? 569  CYS A SG    1 
ATOM   4359  N  N     . ASN A  1  543 ? 42.726  2.645  64.480 1.00 25.11 ? 570  ASN A N     1 
ATOM   4360  C  CA    . ASN A  1  543 ? 43.559  2.750  63.285 1.00 25.04 ? 570  ASN A CA    1 
ATOM   4361  C  C     . ASN A  1  543 ? 44.699  3.763  63.390 1.00 24.29 ? 570  ASN A C     1 
ATOM   4362  O  O     . ASN A  1  543 ? 45.704  3.628  62.700 1.00 25.10 ? 570  ASN A O     1 
ATOM   4363  C  CB    . ASN A  1  543 ? 42.695  3.055  62.049 1.00 24.69 ? 570  ASN A CB    1 
ATOM   4364  C  CG    . ASN A  1  543 ? 41.899  1.836  61.574 1.00 26.16 ? 570  ASN A CG    1 
ATOM   4365  O  OD1   . ASN A  1  543 ? 42.390  0.714  61.614 1.00 27.85 ? 570  ASN A OD1   1 
ATOM   4366  N  ND2   . ASN A  1  543 ? 40.666  2.060  61.132 1.00 25.22 ? 570  ASN A ND2   1 
ATOM   4367  N  N     . ASN A  1  544 ? 44.551  4.758  64.261 1.00 23.08 ? 571  ASN A N     1 
ATOM   4368  C  CA    . ASN A  1  544 ? 45.432  5.924  64.248 1.00 22.68 ? 571  ASN A CA    1 
ATOM   4369  C  C     . ASN A  1  544 ? 46.135  6.236  65.563 1.00 23.21 ? 571  ASN A C     1 
ATOM   4370  O  O     . ASN A  1  544 ? 46.921  7.184  65.638 1.00 23.74 ? 571  ASN A O     1 
ATOM   4371  C  CB    . ASN A  1  544 ? 44.653  7.151  63.759 1.00 21.78 ? 571  ASN A CB    1 
ATOM   4372  C  CG    . ASN A  1  544 ? 44.080  6.946  62.375 1.00 21.63 ? 571  ASN A CG    1 
ATOM   4373  O  OD1   . ASN A  1  544 ? 44.824  6.826  61.403 1.00 22.16 ? 571  ASN A OD1   1 
ATOM   4374  N  ND2   . ASN A  1  544 ? 42.756  6.856  62.284 1.00 20.91 ? 571  ASN A ND2   1 
ATOM   4375  N  N     . VAL A  1  545 ? 45.863  5.444  66.595 1.00 23.24 ? 572  VAL A N     1 
ATOM   4376  C  CA    . VAL A  1  545 ? 46.488  5.657  67.892 1.00 23.89 ? 572  VAL A CA    1 
ATOM   4377  C  C     . VAL A  1  545 ? 47.245  4.407  68.319 1.00 25.47 ? 572  VAL A C     1 
ATOM   4378  O  O     . VAL A  1  545 ? 46.683  3.307  68.332 1.00 25.58 ? 572  VAL A O     1 
ATOM   4379  C  CB    . VAL A  1  545 ? 45.455  6.072  68.976 1.00 23.41 ? 572  VAL A CB    1 
ATOM   4380  C  CG1   . VAL A  1  545 ? 46.145  6.286  70.327 1.00 23.36 ? 572  VAL A CG1   1 
ATOM   4381  C  CG2   . VAL A  1  545 ? 44.710  7.340  68.553 1.00 22.39 ? 572  VAL A CG2   1 
ATOM   4382  N  N     . LYS A  1  546 ? 48.519  4.584  68.666 1.00 26.82 ? 573  LYS A N     1 
ATOM   4383  C  CA    . LYS A  1  546 ? 49.376  3.465  69.057 1.00 29.16 ? 573  LYS A CA    1 
ATOM   4384  C  C     . LYS A  1  546 ? 48.736  2.642  70.176 1.00 29.85 ? 573  LYS A C     1 
ATOM   4385  O  O     . LYS A  1  546 ? 48.234  3.195  71.154 1.00 29.69 ? 573  LYS A O     1 
ATOM   4386  C  CB    . LYS A  1  546 ? 50.762  3.955  69.487 1.00 30.45 ? 573  LYS A CB    1 
ATOM   4387  C  CG    . LYS A  1  546 ? 51.813  2.857  69.481 1.00 33.98 ? 573  LYS A CG    1 
ATOM   4388  C  CD    . LYS A  1  546 ? 53.145  3.325  70.041 1.00 37.60 ? 573  LYS A CD    1 
ATOM   4389  C  CE    . LYS A  1  546 ? 54.131  2.172  70.043 1.00 42.00 ? 573  LYS A CE    1 
ATOM   4390  N  NZ    . LYS A  1  546 ? 55.538  2.619  70.209 1.00 45.86 ? 573  LYS A NZ    1 
ATOM   4391  N  N     . GLY A  1  547 ? 48.736  1.323  70.006 1.00 31.33 ? 574  GLY A N     1 
ATOM   4392  C  CA    . GLY A  1  547 ? 48.184  0.408  71.001 1.00 32.79 ? 574  GLY A CA    1 
ATOM   4393  C  C     . GLY A  1  547 ? 46.693  0.150  70.886 1.00 32.36 ? 574  GLY A C     1 
ATOM   4394  O  O     . GLY A  1  547 ? 46.154  -0.657 71.635 1.00 33.38 ? 574  GLY A O     1 
ATOM   4395  N  N     . CYS A  1  548 ? 46.026  0.828  69.950 1.00 31.31 ? 575  CYS A N     1 
ATOM   4396  C  CA    . CYS A  1  548 ? 44.570  0.709  69.761 1.00 31.44 ? 575  CYS A CA    1 
ATOM   4397  C  C     . CYS A  1  548 ? 43.802  0.673  71.093 1.00 31.76 ? 575  CYS A C     1 
ATOM   4398  O  O     . CYS A  1  548 ? 43.160  -0.330 71.410 1.00 33.04 ? 575  CYS A O     1 
ATOM   4399  C  CB    . CYS A  1  548 ? 44.218  -0.518 68.889 1.00 32.49 ? 575  CYS A CB    1 
ATOM   4400  S  SG    . CYS A  1  548 ? 42.410  -0.893 68.749 1.00 35.47 ? 575  CYS A SG    1 
ATOM   4401  N  N     . PRO A  1  549 ? 43.873  1.767  71.881 1.00 30.91 ? 576  PRO A N     1 
ATOM   4402  C  CA    . PRO A  1  549 ? 43.158  1.800  73.158 1.00 31.53 ? 576  PRO A CA    1 
ATOM   4403  C  C     . PRO A  1  549 ? 41.638  1.798  72.957 1.00 31.01 ? 576  PRO A C     1 
ATOM   4404  O  O     . PRO A  1  549 ? 41.148  2.318  71.951 1.00 29.16 ? 576  PRO A O     1 
ATOM   4405  C  CB    . PRO A  1  549 ? 43.599  3.134  73.772 1.00 30.74 ? 576  PRO A CB    1 
ATOM   4406  C  CG    . PRO A  1  549 ? 43.937  3.995  72.595 1.00 29.51 ? 576  PRO A CG    1 
ATOM   4407  C  CD    . PRO A  1  549 ? 44.543  3.049  71.594 1.00 29.78 ? 576  PRO A CD    1 
ATOM   4408  N  N     . PHE A  1  550 ? 40.909  1.203  73.899 1.00 32.31 ? 577  PHE A N     1 
ATOM   4409  C  CA    . PHE A  1  550 ? 39.451  1.274  73.895 1.00 32.51 ? 577  PHE A CA    1 
ATOM   4410  C  C     . PHE A  1  550 ? 39.014  2.729  74.019 1.00 30.95 ? 577  PHE A C     1 
ATOM   4411  O  O     . PHE A  1  550 ? 39.641  3.520  74.734 1.00 30.85 ? 577  PHE A O     1 
ATOM   4412  C  CB    . PHE A  1  550 ? 38.841  0.448  75.038 1.00 34.69 ? 577  PHE A CB    1 
ATOM   4413  C  CG    . PHE A  1  550 ? 37.360  0.693  75.246 1.00 36.18 ? 577  PHE A CG    1 
ATOM   4414  C  CD1   . PHE A  1  550 ? 36.411  -0.036 74.529 1.00 38.25 ? 577  PHE A CD1   1 
ATOM   4415  C  CD2   . PHE A  1  550 ? 36.919  1.656  76.156 1.00 36.35 ? 577  PHE A CD2   1 
ATOM   4416  C  CE1   . PHE A  1  550 ? 35.038  0.191  74.717 1.00 39.41 ? 577  PHE A CE1   1 
ATOM   4417  C  CE2   . PHE A  1  550 ? 35.559  1.894  76.351 1.00 37.91 ? 577  PHE A CE2   1 
ATOM   4418  C  CZ    . PHE A  1  550 ? 34.612  1.160  75.629 1.00 39.36 ? 577  PHE A CZ    1 
ATOM   4419  N  N     . THR A  1  551 ? 37.949  3.087  73.310 1.00 29.73 ? 578  THR A N     1 
ATOM   4420  C  CA    . THR A  1  551 ? 37.361  4.407  73.480 1.00 28.82 ? 578  THR A CA    1 
ATOM   4421  C  C     . THR A  1  551 ? 35.853  4.406  73.262 1.00 29.04 ? 578  THR A C     1 
ATOM   4422  O  O     . THR A  1  551 ? 35.282  3.437  72.743 1.00 29.81 ? 578  THR A O     1 
ATOM   4423  C  CB    . THR A  1  551 ? 38.052  5.494  72.606 1.00 27.26 ? 578  THR A CB    1 
ATOM   4424  O  OG1   . THR A  1  551 ? 37.785  6.789  73.166 1.00 28.19 ? 578  THR A OG1   1 
ATOM   4425  C  CG2   . THR A  1  551 ? 37.574  5.445  71.158 1.00 25.61 ? 578  THR A CG2   1 
ATOM   4426  N  N     . SER A  1  552 ? 35.230  5.516  73.654 1.00 28.41 ? 579  SER A N     1 
ATOM   4427  C  CA    . SER A  1  552 ? 33.787  5.632  73.743 1.00 29.03 ? 579  SER A CA    1 
ATOM   4428  C  C     . SER A  1  552 ? 33.462  7.085  74.043 1.00 28.24 ? 579  SER A C     1 
ATOM   4429  O  O     . SER A  1  552 ? 34.320  7.828  74.527 1.00 27.94 ? 579  SER A O     1 
ATOM   4430  C  CB    . SER A  1  552 ? 33.276  4.744  74.882 1.00 30.92 ? 579  SER A CB    1 
ATOM   4431  O  OG    . SER A  1  552 ? 31.879  4.832  75.001 1.00 32.77 ? 579  SER A OG    1 
ATOM   4432  N  N     . PHE A  1  553 ? 32.230  7.489  73.752 1.00 28.04 ? 580  PHE A N     1 
ATOM   4433  C  CA    . PHE A  1  553 ? 31.737  8.801  74.150 1.00 27.99 ? 580  PHE A CA    1 
ATOM   4434  C  C     . PHE A  1  553 ? 31.146  8.797  75.571 1.00 29.94 ? 580  PHE A C     1 
ATOM   4435  O  O     . PHE A  1  553 ? 30.752  9.842  76.090 1.00 30.10 ? 580  PHE A O     1 
ATOM   4436  C  CB    . PHE A  1  553 ? 30.725  9.333  73.120 1.00 27.07 ? 580  PHE A CB    1 
ATOM   4437  C  CG    . PHE A  1  553 ? 31.352  9.756  71.816 1.00 25.15 ? 580  PHE A CG    1 
ATOM   4438  C  CD1   . PHE A  1  553 ? 32.582  10.425 71.798 1.00 21.60 ? 580  PHE A CD1   1 
ATOM   4439  C  CD2   . PHE A  1  553 ? 30.710  9.510  70.609 1.00 24.38 ? 580  PHE A CD2   1 
ATOM   4440  C  CE1   . PHE A  1  553 ? 33.156  10.832 70.598 1.00 21.71 ? 580  PHE A CE1   1 
ATOM   4441  C  CE2   . PHE A  1  553 ? 31.285  9.916  69.393 1.00 22.59 ? 580  PHE A CE2   1 
ATOM   4442  C  CZ    . PHE A  1  553 ? 32.508  10.574 69.391 1.00 21.51 ? 580  PHE A CZ    1 
ATOM   4443  N  N     . ASN A  1  554 ? 31.111  7.620  76.194 1.00 31.83 ? 581  ASN A N     1 
ATOM   4444  C  CA    A ASN A  1  554 ? 30.593  7.516  77.548 0.50 33.87 ? 581  ASN A CA    1 
ATOM   4445  C  CA    B ASN A  1  554 ? 30.530  7.405  77.524 0.50 34.18 ? 581  ASN A CA    1 
ATOM   4446  C  C     . ASN A  1  554 ? 31.590  6.870  78.493 1.00 35.21 ? 581  ASN A C     1 
ATOM   4447  O  O     . ASN A  1  554 ? 32.369  6.000  78.111 1.00 34.84 ? 581  ASN A O     1 
ATOM   4448  C  CB    A ASN A  1  554 ? 29.235  6.806  77.590 0.50 35.49 ? 581  ASN A CB    1 
ATOM   4449  C  CB    B ASN A  1  554 ? 29.391  6.381  77.395 0.50 35.90 ? 581  ASN A CB    1 
ATOM   4450  C  CG    A ASN A  1  554 ? 29.319  5.357  77.176 0.50 35.84 ? 581  ASN A CG    1 
ATOM   4451  C  CG    B ASN A  1  554 ? 28.436  6.386  78.580 0.50 38.31 ? 581  ASN A CG    1 
ATOM   4452  O  OD1   A ASN A  1  554 ? 29.411  4.468  78.019 0.50 37.37 ? 581  ASN A OD1   1 
ATOM   4453  O  OD1   B ASN A  1  554 ? 28.846  6.338  79.739 0.50 39.71 ? 581  ASN A OD1   1 
ATOM   4454  N  ND2   A ASN A  1  554 ? 29.297  5.109  75.872 0.50 34.27 ? 581  ASN A ND2   1 
ATOM   4455  N  ND2   B ASN A  1  554 ? 27.144  6.414  78.284 0.50 39.92 ? 581  ASN A ND2   1 
ATOM   4456  N  N     . VAL A  1  555 ? 31.596  7.354  79.734 1.00 37.01 ? 582  VAL A N     1 
ATOM   4457  C  CA    . VAL A  1  555 ? 32.479  6.800  80.762 1.00 39.49 ? 582  VAL A CA    1 
ATOM   4458  C  C     . VAL A  1  555 ? 32.057  5.373  81.135 1.00 42.56 ? 582  VAL A C     1 
ATOM   4459  O  O     . VAL A  1  555 ? 32.909  4.539  81.408 1.00 43.99 ? 582  VAL A O     1 
ATOM   4460  C  CB    . VAL A  1  555 ? 32.552  7.684  82.046 1.00 40.17 ? 582  VAL A CB    1 
ATOM   4461  C  CG1   . VAL A  1  555 ? 33.092  9.066  81.720 1.00 38.58 ? 582  VAL A CG1   1 
ATOM   4462  C  CG2   . VAL A  1  555 ? 31.191  7.788  82.742 1.00 41.77 ? 582  VAL A CG2   1 
ATOM   4463  N  N     . GLN A  1  556 ? 30.744  5.112  81.119 1.00 44.82 ? 583  GLN A N     1 
ATOM   4464  C  CA    . GLN A  1  556 ? 30.123  3.850  81.581 1.00 48.46 ? 583  GLN A CA    1 
ATOM   4465  C  C     . GLN A  1  556 ? 30.353  3.571  83.075 1.00 51.18 ? 583  GLN A C     1 
ATOM   4466  O  O     . GLN A  1  556 ? 31.093  2.656  83.460 1.00 53.26 ? 583  GLN A O     1 
ATOM   4467  C  CB    . GLN A  1  556 ? 30.531  2.644  80.705 1.00 48.68 ? 583  GLN A CB    1 
ATOM   4468  C  CG    . GLN A  1  556 ? 29.735  1.359  80.980 1.00 51.54 ? 583  GLN A CG    1 
ATOM   4469  N  N     . HIS B  1  5   ? 48.041  4.723  28.412 1.00 45.72 ? 33   HIS B N     1 
ATOM   4470  C  CA    . HIS B  1  5   ? 47.035  5.814  28.565 1.00 44.78 ? 33   HIS B CA    1 
ATOM   4471  C  C     . HIS B  1  5   ? 45.928  5.440  29.557 1.00 43.38 ? 33   HIS B C     1 
ATOM   4472  O  O     . HIS B  1  5   ? 45.845  4.292  29.994 1.00 43.24 ? 33   HIS B O     1 
ATOM   4473  C  CB    . HIS B  1  5   ? 46.451  6.209  27.199 1.00 45.20 ? 33   HIS B CB    1 
ATOM   4474  C  CG    . HIS B  1  5   ? 45.669  5.123  26.527 1.00 46.03 ? 33   HIS B CG    1 
ATOM   4475  N  ND1   . HIS B  1  5   ? 44.361  4.831  26.857 1.00 46.15 ? 33   HIS B ND1   1 
ATOM   4476  C  CD2   . HIS B  1  5   ? 45.999  4.278  25.521 1.00 47.32 ? 33   HIS B CD2   1 
ATOM   4477  C  CE1   . HIS B  1  5   ? 43.926  3.842  26.096 1.00 46.89 ? 33   HIS B CE1   1 
ATOM   4478  N  NE2   . HIS B  1  5   ? 44.901  3.487  25.279 1.00 47.70 ? 33   HIS B NE2   1 
ATOM   4479  N  N     . HIS B  1  6   ? 45.092  6.416  29.915 1.00 42.22 ? 34   HIS B N     1 
ATOM   4480  C  CA    . HIS B  1  6   ? 43.980  6.196  30.844 1.00 41.16 ? 34   HIS B CA    1 
ATOM   4481  C  C     . HIS B  1  6   ? 43.078  5.065  30.324 1.00 41.01 ? 34   HIS B C     1 
ATOM   4482  O  O     . HIS B  1  6   ? 42.693  5.077  29.151 1.00 41.51 ? 34   HIS B O     1 
ATOM   4483  C  CB    . HIS B  1  6   ? 43.174  7.488  31.013 1.00 40.32 ? 34   HIS B CB    1 
ATOM   4484  C  CG    . HIS B  1  6   ? 42.349  7.540  32.265 1.00 39.45 ? 34   HIS B CG    1 
ATOM   4485  N  ND1   . HIS B  1  6   ? 41.350  6.631  32.542 1.00 38.58 ? 34   HIS B ND1   1 
ATOM   4486  C  CD2   . HIS B  1  6   ? 42.349  8.420  33.294 1.00 40.17 ? 34   HIS B CD2   1 
ATOM   4487  C  CE1   . HIS B  1  6   ? 40.787  6.934  33.698 1.00 38.84 ? 34   HIS B CE1   1 
ATOM   4488  N  NE2   . HIS B  1  6   ? 41.373  8.018  34.174 1.00 39.22 ? 34   HIS B NE2   1 
ATOM   4489  N  N     . PRO B  1  7   ? 42.746  4.080  31.184 1.00 40.69 ? 35   PRO B N     1 
ATOM   4490  C  CA    . PRO B  1  7   ? 41.939  2.939  30.720 1.00 41.02 ? 35   PRO B CA    1 
ATOM   4491  C  C     . PRO B  1  7   ? 40.496  3.314  30.356 1.00 40.33 ? 35   PRO B C     1 
ATOM   4492  O  O     . PRO B  1  7   ? 39.807  2.535  29.697 1.00 40.81 ? 35   PRO B O     1 
ATOM   4493  C  CB    . PRO B  1  7   ? 41.951  1.976  31.918 1.00 41.30 ? 35   PRO B CB    1 
ATOM   4494  C  CG    . PRO B  1  7   ? 43.041  2.467  32.824 1.00 40.99 ? 35   PRO B CG    1 
ATOM   4495  C  CD    . PRO B  1  7   ? 43.121  3.942  32.602 1.00 40.52 ? 35   PRO B CD    1 
ATOM   4496  N  N     . CYS B  1  8   ? 40.054  4.498  30.773 1.00 39.37 ? 36   CYS B N     1 
ATOM   4497  C  CA    . CYS B  1  8   ? 38.694  4.960  30.483 1.00 39.04 ? 36   CYS B CA    1 
ATOM   4498  C  C     . CYS B  1  8   ? 38.583  5.776  29.189 1.00 39.16 ? 36   CYS B C     1 
ATOM   4499  O  O     . CYS B  1  8   ? 37.483  6.200  28.822 1.00 38.69 ? 36   CYS B O     1 
ATOM   4500  C  CB    . CYS B  1  8   ? 38.125  5.747  31.674 1.00 38.21 ? 36   CYS B CB    1 
ATOM   4501  S  SG    . CYS B  1  8   ? 37.829  4.720  33.144 1.00 39.36 ? 36   CYS B SG    1 
ATOM   4502  N  N     . CYS B  1  9   ? 39.710  5.969  28.499 1.00 39.85 ? 37   CYS B N     1 
ATOM   4503  C  CA    . CYS B  1  9   ? 39.773  6.822  27.299 1.00 40.80 ? 37   CYS B CA    1 
ATOM   4504  C  C     . CYS B  1  9   ? 38.706  6.532  26.244 1.00 40.99 ? 37   CYS B C     1 
ATOM   4505  O  O     . CYS B  1  9   ? 38.224  7.451  25.585 1.00 41.47 ? 37   CYS B O     1 
ATOM   4506  C  CB    . CYS B  1  9   ? 41.159  6.774  26.650 1.00 41.79 ? 37   CYS B CB    1 
ATOM   4507  S  SG    . CYS B  1  9   ? 42.414  7.796  27.454 1.00 43.92 ? 37   CYS B SG    1 
ATOM   4508  N  N     . SER B  1  10  ? 38.329  5.264  26.099 1.00 40.98 ? 38   SER B N     1 
ATOM   4509  C  CA    . SER B  1  10  ? 37.367  4.856  25.071 1.00 41.68 ? 38   SER B CA    1 
ATOM   4510  C  C     . SER B  1  10  ? 35.901  5.037  25.482 1.00 40.67 ? 38   SER B C     1 
ATOM   4511  O  O     . SER B  1  10  ? 34.996  4.671  24.726 1.00 41.34 ? 38   SER B O     1 
ATOM   4512  C  CB    . SER B  1  10  ? 37.620  3.405  24.647 1.00 42.61 ? 38   SER B CB    1 
ATOM   4513  O  OG    . SER B  1  10  ? 37.284  2.506  25.685 1.00 42.96 ? 38   SER B OG    1 
ATOM   4514  N  N     . ASN B  1  11  ? 35.680  5.607  26.667 1.00 39.19 ? 39   ASN B N     1 
ATOM   4515  C  CA    . ASN B  1  11  ? 34.341  5.762  27.253 1.00 38.43 ? 39   ASN B CA    1 
ATOM   4516  C  C     . ASN B  1  11  ? 33.538  4.466  27.200 1.00 38.88 ? 39   ASN B C     1 
ATOM   4517  O  O     . ASN B  1  11  ? 32.477  4.417  26.571 1.00 39.45 ? 39   ASN B O     1 
ATOM   4518  C  CB    . ASN B  1  11  ? 33.566  6.904  26.580 1.00 38.55 ? 39   ASN B CB    1 
ATOM   4519  C  CG    . ASN B  1  11  ? 34.397  8.153  26.416 1.00 38.71 ? 39   ASN B CG    1 
ATOM   4520  O  OD1   . ASN B  1  11  ? 34.799  8.784  27.393 1.00 38.24 ? 39   ASN B OD1   1 
ATOM   4521  N  ND2   . ASN B  1  11  ? 34.662  8.518  25.172 1.00 40.46 ? 39   ASN B ND2   1 
ATOM   4522  N  N     . PRO B  1  12  ? 34.048  3.406  27.858 1.00 38.84 ? 40   PRO B N     1 
ATOM   4523  C  CA    . PRO B  1  12  ? 33.438  2.087  27.729 1.00 39.60 ? 40   PRO B CA    1 
ATOM   4524  C  C     . PRO B  1  12  ? 32.097  1.949  28.450 1.00 39.09 ? 40   PRO B C     1 
ATOM   4525  O  O     . PRO B  1  12  ? 31.268  1.138  28.032 1.00 39.85 ? 40   PRO B O     1 
ATOM   4526  C  CB    . PRO B  1  12  ? 34.481  1.163  28.365 1.00 39.96 ? 40   PRO B CB    1 
ATOM   4527  C  CG    . PRO B  1  12  ? 35.167  2.029  29.378 1.00 38.77 ? 40   PRO B CG    1 
ATOM   4528  C  CD    . PRO B  1  12  ? 35.218  3.387  28.762 1.00 38.32 ? 40   PRO B CD    1 
ATOM   4529  N  N     . CYS B  1  13  ? 31.886  2.727  29.514 1.00 37.49 ? 41   CYS B N     1 
ATOM   4530  C  CA    . CYS B  1  13  ? 30.684  2.574  30.334 1.00 37.26 ? 41   CYS B CA    1 
ATOM   4531  C  C     . CYS B  1  13  ? 29.496  3.296  29.712 1.00 36.90 ? 41   CYS B C     1 
ATOM   4532  O  O     . CYS B  1  13  ? 29.556  4.498  29.428 1.00 36.36 ? 41   CYS B O     1 
ATOM   4533  C  CB    . CYS B  1  13  ? 30.917  3.035  31.780 1.00 36.27 ? 41   CYS B CB    1 
ATOM   4534  S  SG    . CYS B  1  13  ? 32.445  2.392  32.549 1.00 37.82 ? 41   CYS B SG    1 
ATOM   4535  N  N     . GLN B  1  14  ? 28.419  2.543  29.501 1.00 37.20 ? 42   GLN B N     1 
ATOM   4536  C  CA    . GLN B  1  14  ? 27.217  3.060  28.848 1.00 36.73 ? 42   GLN B CA    1 
ATOM   4537  C  C     . GLN B  1  14  ? 26.121  3.371  29.861 1.00 35.61 ? 42   GLN B C     1 
ATOM   4538  O  O     . GLN B  1  14  ? 26.206  2.971  31.031 1.00 35.13 ? 42   GLN B O     1 
ATOM   4539  C  CB    . GLN B  1  14  ? 26.696  2.051  27.813 1.00 38.34 ? 42   GLN B CB    1 
ATOM   4540  C  CG    . GLN B  1  14  ? 27.737  1.539  26.820 1.00 39.19 ? 42   GLN B CG    1 
ATOM   4541  C  CD    . GLN B  1  14  ? 28.450  2.651  26.066 1.00 38.33 ? 42   GLN B CD    1 
ATOM   4542  O  OE1   . GLN B  1  14  ? 27.819  3.511  25.450 1.00 37.23 ? 42   GLN B OE1   1 
ATOM   4543  N  NE2   . GLN B  1  14  ? 29.777  2.627  26.106 1.00 37.93 ? 42   GLN B NE2   1 
ATOM   4544  N  N     . ASN B  1  15  ? 25.103  4.097  29.400 1.00 35.03 ? 43   ASN B N     1 
ATOM   4545  C  CA    . ASN B  1  15  ? 23.875  4.348  30.159 1.00 34.64 ? 43   ASN B CA    1 
ATOM   4546  C  C     . ASN B  1  15  ? 24.077  5.013  31.533 1.00 33.63 ? 43   ASN B C     1 
ATOM   4547  O  O     . ASN B  1  15  ? 23.485  4.596  32.527 1.00 33.11 ? 43   ASN B O     1 
ATOM   4548  C  CB    . ASN B  1  15  ? 23.042  3.058  30.267 1.00 35.47 ? 43   ASN B CB    1 
ATOM   4549  C  CG    . ASN B  1  15  ? 22.768  2.420  28.904 1.00 36.95 ? 43   ASN B CG    1 
ATOM   4550  O  OD1   . ASN B  1  15  ? 22.290  3.083  27.987 1.00 36.34 ? 43   ASN B OD1   1 
ATOM   4551  N  ND2   . ASN B  1  15  ? 23.084  1.133  28.769 1.00 36.46 ? 43   ASN B ND2   1 
ATOM   4552  N  N     . ARG B  1  16  ? 24.907  6.058  31.559 1.00 33.36 ? 44   ARG B N     1 
ATOM   4553  C  CA    . ARG B  1  16  ? 25.220  6.839  32.780 1.00 33.11 ? 44   ARG B CA    1 
ATOM   4554  C  C     . ARG B  1  16  ? 26.064  6.083  33.822 1.00 33.11 ? 44   ARG B C     1 
ATOM   4555  O  O     . ARG B  1  16  ? 26.198  6.533  34.960 1.00 32.63 ? 44   ARG B O     1 
ATOM   4556  C  CB    . ARG B  1  16  ? 23.960  7.431  33.449 1.00 32.74 ? 44   ARG B CB    1 
ATOM   4557  C  CG    . ARG B  1  16  ? 22.977  8.185  32.542 1.00 34.05 ? 44   ARG B CG    1 
ATOM   4558  C  CD    . ARG B  1  16  ? 23.475  9.540  32.066 1.00 34.53 ? 44   ARG B CD    1 
ATOM   4559  N  NE    . ARG B  1  16  ? 24.186  10.289 33.101 1.00 35.76 ? 44   ARG B NE    1 
ATOM   4560  C  CZ    . ARG B  1  16  ? 23.612  11.054 34.029 1.00 36.14 ? 44   ARG B CZ    1 
ATOM   4561  N  NH1   . ARG B  1  16  ? 22.291  11.189 34.084 1.00 37.25 ? 44   ARG B NH1   1 
ATOM   4562  N  NH2   . ARG B  1  16  ? 24.374  11.685 34.912 1.00 36.74 ? 44   ARG B NH2   1 
ATOM   4563  N  N     . GLY B  1  17  ? 26.627  4.940  33.432 1.00 34.30 ? 45   GLY B N     1 
ATOM   4564  C  CA    . GLY B  1  17  ? 27.597  4.221  34.272 1.00 34.79 ? 45   GLY B CA    1 
ATOM   4565  C  C     . GLY B  1  17  ? 28.893  5.014  34.381 1.00 34.77 ? 45   GLY B C     1 
ATOM   4566  O  O     . GLY B  1  17  ? 29.279  5.704  33.437 1.00 34.39 ? 45   GLY B O     1 
ATOM   4567  N  N     . GLU B  1  18  ? 29.563  4.919  35.526 1.00 35.05 ? 46   GLU B N     1 
ATOM   4568  C  CA    . GLU B  1  18  ? 30.776  5.702  35.779 1.00 35.45 ? 46   GLU B CA    1 
ATOM   4569  C  C     . GLU B  1  18  ? 32.022  4.851  35.564 1.00 35.62 ? 46   GLU B C     1 
ATOM   4570  O  O     . GLU B  1  18  ? 32.104  3.736  36.070 1.00 35.85 ? 46   GLU B O     1 
ATOM   4571  C  CB    . GLU B  1  18  ? 30.796  6.238  37.218 1.00 35.64 ? 46   GLU B CB    1 
ATOM   4572  C  CG    . GLU B  1  18  ? 29.444  6.662  37.786 1.00 38.42 ? 46   GLU B CG    1 
ATOM   4573  C  CD    . GLU B  1  18  ? 29.161  8.137  37.637 1.00 42.00 ? 46   GLU B CD    1 
ATOM   4574  O  OE1   . GLU B  1  18  ? 29.559  8.728  36.602 1.00 44.07 ? 46   GLU B OE1   1 
ATOM   4575  O  OE2   . GLU B  1  18  ? 28.521  8.707  38.557 1.00 43.44 ? 46   GLU B OE2   1 
ATOM   4576  N  N     . CYS B  1  19  ? 32.995  5.388  34.831 1.00 35.49 ? 47   CYS B N     1 
ATOM   4577  C  CA    . CYS B  1  19  ? 34.249  4.682  34.600 1.00 36.15 ? 47   CYS B CA    1 
ATOM   4578  C  C     . CYS B  1  19  ? 35.295  5.070  35.632 1.00 35.60 ? 47   CYS B C     1 
ATOM   4579  O  O     . CYS B  1  19  ? 35.462  6.243  35.959 1.00 35.07 ? 47   CYS B O     1 
ATOM   4580  C  CB    . CYS B  1  19  ? 34.787  4.936  33.187 1.00 36.60 ? 47   CYS B CB    1 
ATOM   4581  S  SG    . CYS B  1  19  ? 36.082  3.756  32.688 1.00 40.22 ? 47   CYS B SG    1 
ATOM   4582  N  N     . MET B  1  20  ? 35.996  4.068  36.139 1.00 35.85 ? 48   MET B N     1 
ATOM   4583  C  CA    . MET B  1  20  ? 37.068  4.270  37.099 1.00 35.67 ? 48   MET B CA    1 
ATOM   4584  C  C     . MET B  1  20  ? 38.207  3.366  36.655 1.00 36.27 ? 48   MET B C     1 
ATOM   4585  O  O     . MET B  1  20  ? 37.963  2.233  36.251 1.00 36.97 ? 48   MET B O     1 
ATOM   4586  C  CB    . MET B  1  20  ? 36.577  3.884  38.500 1.00 35.75 ? 48   MET B CB    1 
ATOM   4587  C  CG    . MET B  1  20  ? 37.628  3.916  39.604 1.00 36.92 ? 48   MET B CG    1 
ATOM   4588  S  SD    . MET B  1  20  ? 37.006  3.341  41.211 1.00 37.55 ? 48   MET B SD    1 
ATOM   4589  C  CE    . MET B  1  20  ? 37.067  1.559  41.006 1.00 37.34 ? 48   MET B CE    1 
ATOM   4590  N  N     . SER B  1  21  ? 39.442  3.858  36.699 1.00 36.21 ? 49   SER B N     1 
ATOM   4591  C  CA    . SER B  1  21  ? 40.590  2.982  36.449 1.00 37.08 ? 49   SER B CA    1 
ATOM   4592  C  C     . SER B  1  21  ? 40.796  2.052  37.643 1.00 37.84 ? 49   SER B C     1 
ATOM   4593  O  O     . SER B  1  21  ? 40.539  2.436  38.786 1.00 36.85 ? 49   SER B O     1 
ATOM   4594  C  CB    . SER B  1  21  ? 41.865  3.784  36.152 1.00 37.32 ? 49   SER B CB    1 
ATOM   4595  O  OG    . SER B  1  21  ? 42.231  4.620  37.238 1.00 36.52 ? 49   SER B OG    1 
ATOM   4596  N  N     . THR B  1  22  ? 41.227  0.823  37.361 1.00 39.36 ? 50   THR B N     1 
ATOM   4597  C  CA    . THR B  1  22  ? 41.567  -0.156 38.394 1.00 41.08 ? 50   THR B CA    1 
ATOM   4598  C  C     . THR B  1  22  ? 42.888  -0.802 38.013 1.00 42.62 ? 50   THR B C     1 
ATOM   4599  O  O     . THR B  1  22  ? 42.923  -1.953 37.595 1.00 44.15 ? 50   THR B O     1 
ATOM   4600  C  CB    . THR B  1  22  ? 40.500  -1.268 38.525 1.00 41.58 ? 50   THR B CB    1 
ATOM   4601  O  OG1   . THR B  1  22  ? 40.275  -1.868 37.242 1.00 42.44 ? 50   THR B OG1   1 
ATOM   4602  C  CG2   . THR B  1  22  ? 39.201  -0.715 39.055 1.00 40.55 ? 50   THR B CG2   1 
ATOM   4603  N  N     . GLY B  1  23  ? 43.973  -0.052 38.148 1.00 42.91 ? 51   GLY B N     1 
ATOM   4604  C  CA    . GLY B  1  23  ? 45.269  -0.478 37.627 1.00 44.14 ? 51   GLY B CA    1 
ATOM   4605  C  C     . GLY B  1  23  ? 45.568  0.341  36.389 1.00 43.64 ? 51   GLY B C     1 
ATOM   4606  O  O     . GLY B  1  23  ? 44.711  1.100  35.929 1.00 42.32 ? 51   GLY B O     1 
ATOM   4607  N  N     . PHE B  1  24  ? 46.776  0.187  35.845 1.00 44.69 ? 52   PHE B N     1 
ATOM   4608  C  CA    . PHE B  1  24  ? 47.205  0.958  34.670 1.00 44.55 ? 52   PHE B CA    1 
ATOM   4609  C  C     . PHE B  1  24  ? 46.433  0.620  33.395 1.00 44.40 ? 52   PHE B C     1 
ATOM   4610  O  O     . PHE B  1  24  ? 46.135  1.512  32.591 1.00 44.04 ? 52   PHE B O     1 
ATOM   4611  C  CB    . PHE B  1  24  ? 48.710  0.797  34.420 1.00 45.98 ? 52   PHE B CB    1 
ATOM   4612  C  CG    . PHE B  1  24  ? 49.573  1.429  35.480 1.00 46.57 ? 52   PHE B CG    1 
ATOM   4613  C  CD1   . PHE B  1  24  ? 49.906  2.780  35.412 1.00 46.52 ? 52   PHE B CD1   1 
ATOM   4614  C  CD2   . PHE B  1  24  ? 50.051  0.674  36.546 1.00 47.21 ? 52   PHE B CD2   1 
ATOM   4615  C  CE1   . PHE B  1  24  ? 50.704  3.370  36.395 1.00 47.64 ? 52   PHE B CE1   1 
ATOM   4616  C  CE2   . PHE B  1  24  ? 50.851  1.255  37.535 1.00 48.50 ? 52   PHE B CE2   1 
ATOM   4617  C  CZ    . PHE B  1  24  ? 51.177  2.605  37.458 1.00 47.93 ? 52   PHE B CZ    1 
ATOM   4618  N  N     . ASP B  1  25  ? 46.096  -0.657 33.227 1.00 44.83 ? 53   ASP B N     1 
ATOM   4619  C  CA    . ASP B  1  25  ? 45.541  -1.151 31.965 1.00 45.07 ? 53   ASP B CA    1 
ATOM   4620  C  C     . ASP B  1  25  ? 44.068  -1.572 32.038 1.00 44.22 ? 53   ASP B C     1 
ATOM   4621  O  O     . ASP B  1  25  ? 43.545  -2.143 31.077 1.00 45.08 ? 53   ASP B O     1 
ATOM   4622  C  CB    . ASP B  1  25  ? 46.381  -2.336 31.449 1.00 47.16 ? 53   ASP B CB    1 
ATOM   4623  C  CG    . ASP B  1  25  ? 47.852  -1.989 31.279 1.00 48.04 ? 53   ASP B CG    1 
ATOM   4624  N  N     . GLN B  1  26  ? 43.407  -1.312 33.165 1.00 42.56 ? 54   GLN B N     1 
ATOM   4625  C  CA    . GLN B  1  26  ? 42.055  -1.842 33.398 1.00 41.82 ? 54   GLN B CA    1 
ATOM   4626  C  C     . GLN B  1  26  ? 41.089  -0.820 33.989 1.00 39.73 ? 54   GLN B C     1 
ATOM   4627  O  O     . GLN B  1  26  ? 41.495  0.096  34.701 1.00 38.35 ? 54   GLN B O     1 
ATOM   4628  C  CB    . GLN B  1  26  ? 42.101  -3.084 34.299 1.00 42.99 ? 54   GLN B CB    1 
ATOM   4629  C  CG    . GLN B  1  26  ? 42.658  -4.337 33.636 1.00 45.85 ? 54   GLN B CG    1 
ATOM   4630  N  N     . TYR B  1  27  ? 39.809  -0.997 33.678 1.00 39.06 ? 55   TYR B N     1 
ATOM   4631  C  CA    . TYR B  1  27  ? 38.752  -0.147 34.205 1.00 37.66 ? 55   TYR B CA    1 
ATOM   4632  C  C     . TYR B  1  27  ? 37.674  -1.002 34.854 1.00 38.07 ? 55   TYR B C     1 
ATOM   4633  O  O     . TYR B  1  27  ? 37.625  -2.215 34.655 1.00 39.14 ? 55   TYR B O     1 
ATOM   4634  C  CB    . TYR B  1  27  ? 38.136  0.722  33.096 1.00 36.68 ? 55   TYR B CB    1 
ATOM   4635  C  CG    . TYR B  1  27  ? 37.353  -0.056 32.055 1.00 37.31 ? 55   TYR B CG    1 
ATOM   4636  C  CD1   . TYR B  1  27  ? 35.987  -0.312 32.219 1.00 36.98 ? 55   TYR B CD1   1 
ATOM   4637  C  CD2   . TYR B  1  27  ? 37.982  -0.547 30.908 1.00 38.06 ? 55   TYR B CD2   1 
ATOM   4638  C  CE1   . TYR B  1  27  ? 35.264  -1.038 31.260 1.00 37.48 ? 55   TYR B CE1   1 
ATOM   4639  C  CE2   . TYR B  1  27  ? 37.270  -1.265 29.941 1.00 39.19 ? 55   TYR B CE2   1 
ATOM   4640  C  CZ    . TYR B  1  27  ? 35.917  -1.507 30.124 1.00 39.12 ? 55   TYR B CZ    1 
ATOM   4641  O  OH    . TYR B  1  27  ? 35.227  -2.216 29.168 1.00 39.64 ? 55   TYR B OH    1 
ATOM   4642  N  N     . LYS B  1  28  ? 36.819  -0.347 35.627 1.00 37.08 ? 56   LYS B N     1 
ATOM   4643  C  CA    . LYS B  1  28  ? 35.621  -0.956 36.179 1.00 37.80 ? 56   LYS B CA    1 
ATOM   4644  C  C     . LYS B  1  28  ? 34.484  0.064  36.014 1.00 36.44 ? 56   LYS B C     1 
ATOM   4645  O  O     . LYS B  1  28  ? 34.694  1.263  36.198 1.00 35.23 ? 56   LYS B O     1 
ATOM   4646  C  CB    . LYS B  1  28  ? 35.865  -1.346 37.646 1.00 38.38 ? 56   LYS B CB    1 
ATOM   4647  C  CG    . LYS B  1  28  ? 34.634  -1.448 38.545 1.00 40.05 ? 56   LYS B CG    1 
ATOM   4648  C  CD    . LYS B  1  28  ? 33.955  -2.805 38.470 1.00 43.78 ? 56   LYS B CD    1 
ATOM   4649  C  CE    . LYS B  1  28  ? 32.719  -2.845 39.370 1.00 44.87 ? 56   LYS B CE    1 
ATOM   4650  N  NZ    . LYS B  1  28  ? 31.992  -4.149 39.265 1.00 47.38 ? 56   LYS B NZ    1 
ATOM   4651  N  N     . CYS B  1  29  ? 33.302  -0.409 35.626 1.00 36.80 ? 57   CYS B N     1 
ATOM   4652  C  CA    . CYS B  1  29  ? 32.134  0.461  35.506 1.00 35.90 ? 57   CYS B CA    1 
ATOM   4653  C  C     . CYS B  1  29  ? 31.239  0.338  36.730 1.00 35.73 ? 57   CYS B C     1 
ATOM   4654  O  O     . CYS B  1  29  ? 30.934  -0.770 37.183 1.00 36.99 ? 57   CYS B O     1 
ATOM   4655  C  CB    . CYS B  1  29  ? 31.323  0.147  34.245 1.00 36.64 ? 57   CYS B CB    1 
ATOM   4656  S  SG    . CYS B  1  29  ? 32.182  0.390  32.677 1.00 37.61 ? 57   CYS B SG    1 
ATOM   4657  N  N     . ASP B  1  30  ? 30.824  1.488  37.251 1.00 34.16 ? 58   ASP B N     1 
ATOM   4658  C  CA    . ASP B  1  30  ? 29.879  1.565  38.347 1.00 33.94 ? 58   ASP B CA    1 
ATOM   4659  C  C     . ASP B  1  30  ? 28.488  1.741  37.748 1.00 33.71 ? 58   ASP B C     1 
ATOM   4660  O  O     . ASP B  1  30  ? 28.174  2.803  37.207 1.00 32.74 ? 58   ASP B O     1 
ATOM   4661  C  CB    . ASP B  1  30  ? 30.241  2.751  39.252 1.00 32.82 ? 58   ASP B CB    1 
ATOM   4662  C  CG    . ASP B  1  30  ? 29.450  2.782  40.552 1.00 33.26 ? 58   ASP B CG    1 
ATOM   4663  O  OD1   . ASP B  1  30  ? 28.385  2.141  40.644 1.00 33.58 ? 58   ASP B OD1   1 
ATOM   4664  O  OD2   . ASP B  1  30  ? 29.899  3.472  41.492 1.00 34.10 ? 58   ASP B OD2   1 
ATOM   4665  N  N     . CYS B  1  31  ? 27.661  0.700  37.847 1.00 34.77 ? 59   CYS B N     1 
ATOM   4666  C  CA    . CYS B  1  31  ? 26.325  0.716  37.238 1.00 35.23 ? 59   CYS B CA    1 
ATOM   4667  C  C     . CYS B  1  31  ? 25.205  1.084  38.217 1.00 34.36 ? 59   CYS B C     1 
ATOM   4668  O  O     . CYS B  1  31  ? 24.030  0.918  37.895 1.00 34.99 ? 59   CYS B O     1 
ATOM   4669  C  CB    . CYS B  1  31  ? 26.004  -0.625 36.566 1.00 36.93 ? 59   CYS B CB    1 
ATOM   4670  S  SG    . CYS B  1  31  ? 27.221  -1.273 35.364 1.00 40.31 ? 59   CYS B SG    1 
ATOM   4671  N  N     . THR B  1  32  ? 25.564  1.601  39.391 1.00 33.53 ? 60   THR B N     1 
ATOM   4672  C  CA    . THR B  1  32  ? 24.583  1.943  40.431 1.00 32.90 ? 60   THR B CA    1 
ATOM   4673  C  C     . THR B  1  32  ? 23.447  2.818  39.898 1.00 32.32 ? 60   THR B C     1 
ATOM   4674  O  O     . THR B  1  32  ? 23.692  3.885  39.340 1.00 30.99 ? 60   THR B O     1 
ATOM   4675  C  CB    . THR B  1  32  ? 25.236  2.657  41.641 1.00 32.42 ? 60   THR B CB    1 
ATOM   4676  O  OG1   . THR B  1  32  ? 26.392  1.931  42.069 1.00 32.40 ? 60   THR B OG1   1 
ATOM   4677  C  CG2   . THR B  1  32  ? 24.253  2.760  42.804 1.00 32.20 ? 60   THR B CG2   1 
ATOM   4678  N  N     . ARG B  1  33  ? 22.215  2.333  40.067 1.00 33.08 ? 61   ARG B N     1 
ATOM   4679  C  CA    . ARG B  1  33  ? 20.985  3.065  39.719 1.00 32.93 ? 61   ARG B CA    1 
ATOM   4680  C  C     . ARG B  1  33  ? 20.817  3.436  38.233 1.00 32.73 ? 61   ARG B C     1 
ATOM   4681  O  O     . ARG B  1  33  ? 19.982  4.273  37.894 1.00 32.52 ? 61   ARG B O     1 
ATOM   4682  C  CB    . ARG B  1  33  ? 20.808  4.303  40.622 1.00 32.07 ? 61   ARG B CB    1 
ATOM   4683  C  CG    . ARG B  1  33  ? 20.408  3.959  42.049 1.00 32.18 ? 61   ARG B CG    1 
ATOM   4684  C  CD    . ARG B  1  33  ? 20.224  5.195  42.923 1.00 31.05 ? 61   ARG B CD    1 
ATOM   4685  N  NE    . ARG B  1  33  ? 21.488  5.870  43.215 1.00 29.39 ? 61   ARG B NE    1 
ATOM   4686  C  CZ    . ARG B  1  33  ? 22.362  5.484  44.142 1.00 29.19 ? 61   ARG B CZ    1 
ATOM   4687  N  NH1   . ARG B  1  33  ? 22.125  4.418  44.896 1.00 29.37 ? 61   ARG B NH1   1 
ATOM   4688  N  NH2   . ARG B  1  33  ? 23.481  6.176  44.319 1.00 27.61 ? 61   ARG B NH2   1 
ATOM   4689  N  N     . THR B  1  34  ? 21.603  2.821  37.353 1.00 33.13 ? 62   THR B N     1 
ATOM   4690  C  CA    . THR B  1  34  ? 21.481  3.076  35.914 1.00 33.29 ? 62   THR B CA    1 
ATOM   4691  C  C     . THR B  1  34  ? 20.356  2.244  35.280 1.00 35.02 ? 62   THR B C     1 
ATOM   4692  O  O     . THR B  1  34  ? 19.869  2.574  34.203 1.00 35.36 ? 62   THR B O     1 
ATOM   4693  C  CB    . THR B  1  34  ? 22.791  2.769  35.152 1.00 33.24 ? 62   THR B CB    1 
ATOM   4694  O  OG1   . THR B  1  34  ? 23.087  1.371  35.249 1.00 34.19 ? 62   THR B OG1   1 
ATOM   4695  C  CG2   . THR B  1  34  ? 23.965  3.583  35.693 1.00 31.63 ? 62   THR B CG2   1 
ATOM   4696  N  N     . GLY B  1  35  ? 19.957  1.166  35.949 1.00 36.42 ? 63   GLY B N     1 
ATOM   4697  C  CA    . GLY B  1  35  ? 18.955  0.248  35.407 1.00 38.88 ? 63   GLY B CA    1 
ATOM   4698  C  C     . GLY B  1  35  ? 19.579  -0.824 34.529 1.00 40.52 ? 63   GLY B C     1 
ATOM   4699  O  O     . GLY B  1  35  ? 18.870  -1.600 33.886 1.00 42.22 ? 63   GLY B O     1 
ATOM   4700  N  N     . PHE B  1  36  ? 20.913  -0.851 34.506 1.00 40.35 ? 64   PHE B N     1 
ATOM   4701  C  CA    . PHE B  1  36  ? 21.689  -1.804 33.712 1.00 41.75 ? 64   PHE B CA    1 
ATOM   4702  C  C     . PHE B  1  36  ? 22.767  -2.459 34.570 1.00 42.38 ? 64   PHE B C     1 
ATOM   4703  O  O     . PHE B  1  36  ? 23.129  -1.947 35.636 1.00 41.36 ? 64   PHE B O     1 
ATOM   4704  C  CB    . PHE B  1  36  ? 22.380  -1.095 32.545 1.00 40.77 ? 64   PHE B CB    1 
ATOM   4705  C  CG    . PHE B  1  36  ? 21.448  -0.592 31.479 1.00 40.73 ? 64   PHE B CG    1 
ATOM   4706  C  CD1   . PHE B  1  36  ? 21.242  -1.332 30.316 1.00 41.67 ? 64   PHE B CD1   1 
ATOM   4707  C  CD2   . PHE B  1  36  ? 20.806  0.637  31.613 1.00 38.50 ? 64   PHE B CD2   1 
ATOM   4708  C  CE1   . PHE B  1  36  ? 20.395  -0.867 29.318 1.00 41.47 ? 64   PHE B CE1   1 
ATOM   4709  C  CE2   . PHE B  1  36  ? 19.955  1.109  30.615 1.00 38.22 ? 64   PHE B CE2   1 
ATOM   4710  C  CZ    . PHE B  1  36  ? 19.750  0.354  29.469 1.00 40.05 ? 64   PHE B CZ    1 
ATOM   4711  N  N     . TYR B  1  37  ? 23.294  -3.580 34.088 1.00 44.43 ? 65   TYR B N     1 
ATOM   4712  C  CA    . TYR B  1  37  ? 24.426  -4.243 34.730 1.00 45.39 ? 65   TYR B CA    1 
ATOM   4713  C  C     . TYR B  1  37  ? 25.352  -4.866 33.681 1.00 46.60 ? 65   TYR B C     1 
ATOM   4714  O  O     . TYR B  1  37  ? 25.150  -4.682 32.475 1.00 46.82 ? 65   TYR B O     1 
ATOM   4715  C  CB    . TYR B  1  37  ? 23.950  -5.282 35.760 1.00 47.09 ? 65   TYR B CB    1 
ATOM   4716  C  CG    . TYR B  1  37  ? 23.103  -6.392 35.187 1.00 50.24 ? 65   TYR B CG    1 
ATOM   4717  C  CD1   . TYR B  1  37  ? 23.671  -7.618 34.840 1.00 52.93 ? 65   TYR B CD1   1 
ATOM   4718  C  CD2   . TYR B  1  37  ? 21.730  -6.222 34.999 1.00 51.38 ? 65   TYR B CD2   1 
ATOM   4719  C  CE1   . TYR B  1  37  ? 22.895  -8.646 34.310 1.00 56.40 ? 65   TYR B CE1   1 
ATOM   4720  C  CE2   . TYR B  1  37  ? 20.946  -7.241 34.471 1.00 54.28 ? 65   TYR B CE2   1 
ATOM   4721  C  CZ    . TYR B  1  37  ? 21.534  -8.452 34.131 1.00 56.93 ? 65   TYR B CZ    1 
ATOM   4722  O  OH    . TYR B  1  37  ? 20.762  -9.465 33.610 1.00 60.24 ? 65   TYR B OH    1 
ATOM   4723  N  N     . GLY B  1  38  ? 26.359  -5.603 34.142 1.00 47.64 ? 66   GLY B N     1 
ATOM   4724  C  CA    . GLY B  1  38  ? 27.388  -6.139 33.258 1.00 48.89 ? 66   GLY B CA    1 
ATOM   4725  C  C     . GLY B  1  38  ? 28.588  -5.214 33.199 1.00 47.35 ? 66   GLY B C     1 
ATOM   4726  O  O     . GLY B  1  38  ? 28.535  -4.080 33.680 1.00 45.39 ? 66   GLY B O     1 
ATOM   4727  N  N     . GLU B  1  39  ? 29.664  -5.702 32.591 1.00 50.90 ? 67   GLU B N     1 
ATOM   4728  C  CA    . GLU B  1  39  ? 30.949  -5.002 32.537 1.00 50.06 ? 67   GLU B CA    1 
ATOM   4729  C  C     . GLU B  1  39  ? 30.855  -3.534 32.090 1.00 46.49 ? 67   GLU B C     1 
ATOM   4730  O  O     . GLU B  1  39  ? 31.563  -2.684 32.618 1.00 46.29 ? 67   GLU B O     1 
ATOM   4731  C  CB    . GLU B  1  39  ? 31.919  -5.774 31.630 1.00 52.84 ? 67   GLU B CB    1 
ATOM   4732  C  CG    . GLU B  1  39  ? 33.359  -5.268 31.649 1.00 53.67 ? 67   GLU B CG    1 
ATOM   4733  C  CD    . GLU B  1  39  ? 34.241  -5.926 30.595 1.00 58.91 ? 67   GLU B CD    1 
ATOM   4734  O  OE1   . GLU B  1  39  ? 33.755  -6.802 29.848 1.00 62.60 ? 67   GLU B OE1   1 
ATOM   4735  O  OE2   . GLU B  1  39  ? 35.431  -5.560 30.510 1.00 61.07 ? 67   GLU B OE2   1 
ATOM   4736  N  N     . ASN B  1  40  ? 29.987  -3.252 31.120 1.00 45.85 ? 68   ASN B N     1 
ATOM   4737  C  CA    . ASN B  1  40  ? 29.856  -1.912 30.548 1.00 45.65 ? 68   ASN B CA    1 
ATOM   4738  C  C     . ASN B  1  40  ? 28.492  -1.279 30.776 1.00 43.62 ? 68   ASN B C     1 
ATOM   4739  O  O     . ASN B  1  40  ? 28.138  -0.314 30.095 1.00 44.35 ? 68   ASN B O     1 
ATOM   4740  C  CB    . ASN B  1  40  ? 30.120  -1.949 29.045 1.00 49.14 ? 68   ASN B CB    1 
ATOM   4741  C  CG    . ASN B  1  40  ? 31.483  -2.473 28.704 1.00 56.26 ? 68   ASN B CG    1 
ATOM   4742  O  OD1   . ASN B  1  40  ? 32.490  -2.082 29.302 1.00 55.03 ? 68   ASN B OD1   1 
ATOM   4743  N  ND2   . ASN B  1  40  ? 31.526  -3.371 27.723 1.00 69.09 ? 68   ASN B ND2   1 
ATOM   4744  N  N     . CYS B  1  41  ? 27.736  -1.825 31.729 1.00 42.65 ? 69   CYS B N     1 
ATOM   4745  C  CA    . CYS B  1  41  ? 26.366  -1.384 32.029 1.00 41.93 ? 69   CYS B CA    1 
ATOM   4746  C  C     . CYS B  1  41  ? 25.485  -1.378 30.769 1.00 41.96 ? 69   CYS B C     1 
ATOM   4747  O  O     . CYS B  1  41  ? 24.783  -0.397 30.494 1.00 42.34 ? 69   CYS B O     1 
ATOM   4748  C  CB    . CYS B  1  41  ? 26.348  -0.005 32.718 1.00 42.86 ? 69   CYS B CB    1 
ATOM   4749  S  SG    . CYS B  1  41  ? 27.553  0.257  34.046 1.00 45.50 ? 69   CYS B SG    1 
ATOM   4750  N  N     . THR B  1  42  ? 25.536  -2.476 30.008 1.00 42.98 ? 70   THR B N     1 
ATOM   4751  C  CA    . THR B  1  42  ? 24.755  -2.604 28.773 1.00 45.31 ? 70   THR B CA    1 
ATOM   4752  C  C     . THR B  1  42  ? 23.657  -3.676 28.829 1.00 47.15 ? 70   THR B C     1 
ATOM   4753  O  O     . THR B  1  42  ? 22.815  -3.741 27.932 1.00 50.13 ? 70   THR B O     1 
ATOM   4754  C  CB    . THR B  1  42  ? 25.649  -2.857 27.531 1.00 49.19 ? 70   THR B CB    1 
ATOM   4755  O  OG1   . THR B  1  42  ? 26.480  -3.999 27.756 1.00 50.41 ? 70   THR B OG1   1 
ATOM   4756  C  CG2   . THR B  1  42  ? 26.525  -1.659 27.242 1.00 48.88 ? 70   THR B CG2   1 
ATOM   4757  N  N     . THR B  1  43  ? 23.673  -4.511 29.868 1.00 46.94 ? 71   THR B N     1 
ATOM   4758  C  CA    . THR B  1  43  ? 22.627  -5.524 30.062 1.00 50.40 ? 71   THR B CA    1 
ATOM   4759  C  C     . THR B  1  43  ? 21.475  -4.928 30.879 1.00 48.82 ? 71   THR B C     1 
ATOM   4760  O  O     . THR B  1  43  ? 21.644  -4.629 32.068 1.00 47.79 ? 71   THR B O     1 
ATOM   4761  C  CB    . THR B  1  43  ? 23.160  -6.791 30.762 1.00 54.46 ? 71   THR B CB    1 
ATOM   4762  O  OG1   . THR B  1  43  ? 24.413  -7.172 30.183 1.00 55.85 ? 71   THR B OG1   1 
ATOM   4763  C  CG2   . THR B  1  43  ? 22.167  -7.944 30.625 1.00 60.77 ? 71   THR B CG2   1 
ATOM   4764  N  N     . PRO B  1  44  ? 20.304  -4.745 30.239 1.00 49.87 ? 72   PRO B N     1 
ATOM   4765  C  CA    . PRO B  1  44  ? 19.176  -4.107 30.912 1.00 48.96 ? 72   PRO B CA    1 
ATOM   4766  C  C     . PRO B  1  44  ? 18.520  -5.017 31.935 1.00 52.71 ? 72   PRO B C     1 
ATOM   4767  O  O     . PRO B  1  44  ? 18.448  -6.237 31.734 1.00 57.19 ? 72   PRO B O     1 
ATOM   4768  C  CB    . PRO B  1  44  ? 18.203  -3.806 29.766 1.00 50.64 ? 72   PRO B CB    1 
ATOM   4769  C  CG    . PRO B  1  44  ? 18.526  -4.792 28.724 1.00 54.97 ? 72   PRO B CG    1 
ATOM   4770  C  CD    . PRO B  1  44  ? 19.991  -5.089 28.840 1.00 53.61 ? 72   PRO B CD    1 
ATOM   4771  N  N     . GLU B  1  45  ? 18.070  -4.421 33.034 1.00 52.74 ? 73   GLU B N     1 
ATOM   4772  C  CA    . GLU B  1  45  ? 17.241  -5.127 34.002 1.00 58.49 ? 73   GLU B CA    1 
ATOM   4773  C  C     . GLU B  1  45  ? 15.834  -5.233 33.430 1.00 60.11 ? 73   GLU B C     1 
ATOM   4774  O  O     . GLU B  1  45  ? 15.496  -4.519 32.481 1.00 56.89 ? 73   GLU B O     1 
ATOM   4775  C  CB    . GLU B  1  45  ? 17.252  -4.410 35.354 1.00 60.66 ? 73   GLU B CB    1 
ATOM   4776  C  CG    . GLU B  1  45  ? 18.529  -4.665 36.160 1.00 63.62 ? 73   GLU B CG    1 
ATOM   4777  C  CD    . GLU B  1  45  ? 18.776  -3.636 37.256 1.00 67.54 ? 73   GLU B CD    1 
ATOM   4778  O  OE1   . GLU B  1  45  ? 18.211  -2.522 37.187 1.00 67.03 ? 73   GLU B OE1   1 
ATOM   4779  O  OE2   . GLU B  1  45  ? 19.553  -3.942 38.188 1.00 73.04 ? 73   GLU B OE2   1 
ATOM   4780  N  N     . PHE B  1  46  ? 15.023  -6.129 33.989 1.00 66.51 ? 74   PHE B N     1 
ATOM   4781  C  CA    . PHE B  1  46  ? 13.704  -6.418 33.424 1.00 69.52 ? 74   PHE B CA    1 
ATOM   4782  C  C     . PHE B  1  46  ? 12.816  -5.179 33.272 1.00 66.34 ? 74   PHE B C     1 
ATOM   4783  O  O     . PHE B  1  46  ? 12.291  -4.927 32.188 1.00 65.22 ? 74   PHE B O     1 
ATOM   4784  C  CB    . PHE B  1  46  ? 12.982  -7.512 34.217 1.00 78.85 ? 74   PHE B CB    1 
ATOM   4785  C  CG    . PHE B  1  46  ? 11.646  -7.890 33.644 1.00 83.42 ? 74   PHE B CG    1 
ATOM   4786  C  CD1   . PHE B  1  46  ? 11.557  -8.513 32.401 1.00 85.53 ? 74   PHE B CD1   1 
ATOM   4787  C  CD2   . PHE B  1  46  ? 10.474  -7.623 34.347 1.00 87.68 ? 74   PHE B CD2   1 
ATOM   4788  C  CE1   . PHE B  1  46  ? 10.316  -8.868 31.866 1.00 91.26 ? 74   PHE B CE1   1 
ATOM   4789  C  CE2   . PHE B  1  46  ? 9.229   -7.977 33.823 1.00 92.38 ? 74   PHE B CE2   1 
ATOM   4790  C  CZ    . PHE B  1  46  ? 9.150   -8.597 32.579 1.00 94.07 ? 74   PHE B CZ    1 
ATOM   4791  N  N     . LEU B  1  47  ? 12.668  -4.412 34.352 1.00 66.72 ? 75   LEU B N     1 
ATOM   4792  C  CA    . LEU B  1  47  ? 11.846  -3.202 34.343 1.00 65.90 ? 75   LEU B CA    1 
ATOM   4793  C  C     . LEU B  1  47  ? 12.338  -2.179 33.316 1.00 60.35 ? 75   LEU B C     1 
ATOM   4794  O  O     . LEU B  1  47  ? 11.529  -1.488 32.692 1.00 60.96 ? 75   LEU B O     1 
ATOM   4795  C  CB    . LEU B  1  47  ? 11.784  -2.579 35.741 1.00 69.83 ? 75   LEU B CB    1 
ATOM   4796  N  N     . THR B  1  48  ? 13.659  -2.098 33.142 1.00 56.59 ? 76   THR B N     1 
ATOM   4797  C  CA    . THR B  1  48  ? 14.284  -1.216 32.147 1.00 53.13 ? 76   THR B CA    1 
ATOM   4798  C  C     . THR B  1  48  ? 13.841  -1.590 30.729 1.00 54.14 ? 76   THR B C     1 
ATOM   4799  O  O     . THR B  1  48  ? 13.564  -0.711 29.911 1.00 54.92 ? 76   THR B O     1 
ATOM   4800  C  CB    . THR B  1  48  ? 15.828  -1.261 32.228 1.00 49.76 ? 76   THR B CB    1 
ATOM   4801  O  OG1   . THR B  1  48  ? 16.247  -1.077 33.584 1.00 51.02 ? 76   THR B OG1   1 
ATOM   4802  C  CG2   . THR B  1  48  ? 16.458  -0.179 31.354 1.00 48.35 ? 76   THR B CG2   1 
ATOM   4803  N  N     . ARG B  1  49  ? 13.777  -2.894 30.456 1.00 56.28 ? 77   ARG B N     1 
ATOM   4804  C  CA    . ARG B  1  49  ? 13.294  -3.404 29.174 1.00 60.44 ? 77   ARG B CA    1 
ATOM   4805  C  C     . ARG B  1  49  ? 11.885  -2.906 28.873 1.00 63.67 ? 77   ARG B C     1 
ATOM   4806  O  O     . ARG B  1  49  ? 11.623  -2.424 27.771 1.00 66.53 ? 77   ARG B O     1 
ATOM   4807  C  CB    . ARG B  1  49  ? 13.326  -4.937 29.134 1.00 64.87 ? 77   ARG B CB    1 
ATOM   4808  C  CG    . ARG B  1  49  ? 14.719  -5.530 29.068 1.00 64.69 ? 77   ARG B CG    1 
ATOM   4809  C  CD    . ARG B  1  49  ? 14.687  -7.020 28.720 1.00 73.89 ? 77   ARG B CD    1 
ATOM   4810  N  NE    . ARG B  1  49  ? 16.045  -7.534 28.544 1.00 75.50 ? 77   ARG B NE    1 
ATOM   4811  C  CZ    . ARG B  1  49  ? 16.740  -7.466 27.409 1.00 77.96 ? 77   ARG B CZ    1 
ATOM   4812  N  NH1   . ARG B  1  49  ? 16.212  -6.911 26.323 1.00 81.18 ? 77   ARG B NH1   1 
ATOM   4813  N  NH2   . ARG B  1  49  ? 17.973  -7.954 27.361 1.00 78.55 ? 77   ARG B NH2   1 
ATOM   4814  N  N     . ILE B  1  50  ? 10.994  -3.016 29.859 1.00 64.76 ? 78   ILE B N     1 
ATOM   4815  C  CA    . ILE B  1  50  ? 9.610   -2.548 29.726 1.00 68.36 ? 78   ILE B CA    1 
ATOM   4816  C  C     . ILE B  1  50  ? 9.556   -1.024 29.543 1.00 67.25 ? 78   ILE B C     1 
ATOM   4817  O  O     . ILE B  1  50  ? 8.750   -0.517 28.756 1.00 71.13 ? 78   ILE B O     1 
ATOM   4818  C  CB    . ILE B  1  50  ? 8.727   -2.995 30.924 1.00 71.20 ? 78   ILE B CB    1 
ATOM   4819  C  CG1   . ILE B  1  50  ? 8.756   -4.523 31.068 1.00 75.23 ? 78   ILE B CG1   1 
ATOM   4820  C  CG2   . ILE B  1  50  ? 7.285   -2.496 30.762 1.00 75.38 ? 78   ILE B CG2   1 
ATOM   4821  C  CD1   . ILE B  1  50  ? 8.058   -5.053 32.311 1.00 80.29 ? 78   ILE B CD1   1 
ATOM   4822  N  N     . LYS B  1  51  ? 10.422  -0.306 30.261 1.00 63.58 ? 79   LYS B N     1 
ATOM   4823  C  CA    . LYS B  1  51  ? 10.540  1.148  30.112 1.00 64.40 ? 79   LYS B CA    1 
ATOM   4824  C  C     . LYS B  1  51  ? 11.000  1.529  28.705 1.00 65.94 ? 79   LYS B C     1 
ATOM   4825  O  O     . LYS B  1  51  ? 10.392  2.384  28.062 1.00 71.08 ? 79   LYS B O     1 
ATOM   4826  C  CB    . LYS B  1  51  ? 11.493  1.729  31.156 1.00 62.14 ? 79   LYS B CB    1 
ATOM   4827  C  CG    . LYS B  1  51  ? 10.907  1.845  32.555 1.00 64.93 ? 79   LYS B CG    1 
ATOM   4828  C  CD    . LYS B  1  51  ? 11.901  2.503  33.508 1.00 64.84 ? 79   LYS B CD    1 
ATOM   4829  N  N     . LEU B  1  52  ? 12.057  0.876  28.227 1.00 82.75 ? 80   LEU B N     1 
ATOM   4830  C  CA    . LEU B  1  52  ? 12.586  1.112  26.880 1.00 80.12 ? 80   LEU B CA    1 
ATOM   4831  C  C     . LEU B  1  52  ? 11.633  0.670  25.763 1.00 80.37 ? 80   LEU B C     1 
ATOM   4832  O  O     . LEU B  1  52  ? 11.758  1.118  24.624 1.00 77.47 ? 80   LEU B O     1 
ATOM   4833  C  CB    . LEU B  1  52  ? 13.947  0.430  26.707 1.00 82.53 ? 80   LEU B CB    1 
ATOM   4834  C  CG    . LEU B  1  52  ? 15.148  1.024  27.450 1.00 82.04 ? 80   LEU B CG    1 
ATOM   4835  C  CD1   . LEU B  1  52  ? 16.296  0.028  27.475 1.00 86.22 ? 80   LEU B CD1   1 
ATOM   4836  C  CD2   . LEU B  1  52  ? 15.595  2.353  26.842 1.00 76.39 ? 80   LEU B CD2   1 
ATOM   4837  N  N     . LEU B  1  53  ? 10.695  -0.216 26.095 1.00 84.34 ? 81   LEU B N     1 
ATOM   4838  C  CA    . LEU B  1  53  ? 9.679   -0.672 25.147 1.00 85.38 ? 81   LEU B CA    1 
ATOM   4839  C  C     . LEU B  1  53  ? 8.637   0.421  24.888 1.00 81.73 ? 81   LEU B C     1 
ATOM   4840  O  O     . LEU B  1  53  ? 8.255   0.654  23.742 1.00 79.99 ? 81   LEU B O     1 
ATOM   4841  C  CB    . LEU B  1  53  ? 9.004   -1.952 25.658 1.00 91.42 ? 81   LEU B CB    1 
ATOM   4842  C  CG    . LEU B  1  53  ? 8.194   -2.791 24.665 1.00 94.01 ? 81   LEU B CG    1 
ATOM   4843  N  N     . LEU B  1  54  ? 8.205   1.098  25.951 1.00 80.93 ? 82   LEU B N     1 
ATOM   4844  C  CA    . LEU B  1  54  ? 7.118   2.077  25.872 1.00 78.27 ? 82   LEU B CA    1 
ATOM   4845  C  C     . LEU B  1  54  ? 7.577   3.485  25.502 1.00 73.09 ? 82   LEU B C     1 
ATOM   4846  O  O     . LEU B  1  54  ? 6.865   4.206  24.791 1.00 71.00 ? 82   LEU B O     1 
ATOM   4847  C  CB    . LEU B  1  54  ? 6.338   2.134  27.193 1.00 80.22 ? 82   LEU B CB    1 
ATOM   4848  C  CG    . LEU B  1  54  ? 5.828   0.853  27.864 1.00 86.29 ? 82   LEU B CG    1 
ATOM   4849  C  CD1   . LEU B  1  54  ? 5.046   1.221  29.117 1.00 87.45 ? 82   LEU B CD1   1 
ATOM   4850  C  CD2   . LEU B  1  54  ? 4.982   -0.013 26.929 1.00 89.26 ? 82   LEU B CD2   1 
ATOM   4851  N  N     . LYS B  1  55  ? 8.755   3.872  25.994 1.00 71.53 ? 83   LYS B N     1 
ATOM   4852  C  CA    . LYS B  1  55  ? 9.283   5.224  25.818 1.00 66.81 ? 83   LYS B CA    1 
ATOM   4853  C  C     . LYS B  1  55  ? 9.310   5.675  24.353 1.00 64.17 ? 83   LYS B C     1 
ATOM   4854  O  O     . LYS B  1  55  ? 9.999   5.073  23.527 1.00 64.87 ? 83   LYS B O     1 
ATOM   4855  C  CB    . LYS B  1  55  ? 10.682  5.341  26.441 1.00 66.92 ? 83   LYS B CB    1 
ATOM   4856  C  CG    . LYS B  1  55  ? 11.213  6.769  26.545 1.00 62.80 ? 83   LYS B CG    1 
ATOM   4857  N  N     . PRO B  1  56  ? 8.551   6.738  24.030 1.00 61.34 ? 84   PRO B N     1 
ATOM   4858  C  CA    . PRO B  1  56  ? 8.621   7.326  22.696 1.00 59.13 ? 84   PRO B CA    1 
ATOM   4859  C  C     . PRO B  1  56  ? 9.893   8.161  22.543 1.00 56.63 ? 84   PRO B C     1 
ATOM   4860  O  O     . PRO B  1  56  ? 10.460  8.607  23.541 1.00 55.85 ? 84   PRO B O     1 
ATOM   4861  C  CB    . PRO B  1  56  ? 7.386   8.228  22.649 1.00 57.63 ? 84   PRO B CB    1 
ATOM   4862  C  CG    . PRO B  1  56  ? 7.171   8.637  24.066 1.00 57.41 ? 84   PRO B CG    1 
ATOM   4863  C  CD    . PRO B  1  56  ? 7.623   7.474  24.913 1.00 60.51 ? 84   PRO B CD    1 
ATOM   4864  N  N     . THR B  1  57  ? 10.332  8.357  21.303 1.00 55.66 ? 85   THR B N     1 
ATOM   4865  C  CA    . THR B  1  57  ? 11.533  9.133  21.016 1.00 53.99 ? 85   THR B CA    1 
ATOM   4866  C  C     . THR B  1  57  ? 11.231  10.626 21.166 1.00 51.35 ? 85   THR B C     1 
ATOM   4867  O  O     . THR B  1  57  ? 10.064  11.023 21.128 1.00 50.60 ? 85   THR B O     1 
ATOM   4868  C  CB    . THR B  1  57  ? 12.060  8.861  19.588 1.00 54.30 ? 85   THR B CB    1 
ATOM   4869  O  OG1   . THR B  1  57  ? 11.231  9.532  18.633 1.00 53.05 ? 85   THR B OG1   1 
ATOM   4870  C  CG2   . THR B  1  57  ? 12.089  7.363  19.283 1.00 57.08 ? 85   THR B CG2   1 
ATOM   4871  N  N     . PRO B  1  58  ? 12.277  11.458 21.347 1.00 50.30 ? 86   PRO B N     1 
ATOM   4872  C  CA    . PRO B  1  58  ? 12.058  12.909 21.337 1.00 48.23 ? 86   PRO B CA    1 
ATOM   4873  C  C     . PRO B  1  58  ? 11.421  13.407 20.032 1.00 47.60 ? 86   PRO B C     1 
ATOM   4874  O  O     . PRO B  1  58  ? 10.641  14.357 20.061 1.00 46.29 ? 86   PRO B O     1 
ATOM   4875  C  CB    . PRO B  1  58  ? 13.471  13.476 21.498 1.00 48.11 ? 86   PRO B CB    1 
ATOM   4876  C  CG    . PRO B  1  58  ? 14.192  12.429 22.270 1.00 50.18 ? 86   PRO B CG    1 
ATOM   4877  C  CD    . PRO B  1  58  ? 13.653  11.118 21.762 1.00 51.62 ? 86   PRO B CD    1 
ATOM   4878  N  N     . ASN B  1  59  ? 11.737  12.756 18.912 1.00 48.78 ? 87   ASN B N     1 
ATOM   4879  C  CA    . ASN B  1  59  ? 11.168  13.136 17.618 1.00 49.05 ? 87   ASN B CA    1 
ATOM   4880  C  C     . ASN B  1  59  ? 9.654   12.944 17.498 1.00 49.45 ? 87   ASN B C     1 
ATOM   4881  O  O     . ASN B  1  59  ? 8.969   13.799 16.938 1.00 49.19 ? 87   ASN B O     1 
ATOM   4882  C  CB    . ASN B  1  59  ? 11.905  12.452 16.459 1.00 50.31 ? 87   ASN B CB    1 
ATOM   4883  C  CG    . ASN B  1  59  ? 13.232  13.128 16.128 1.00 50.36 ? 87   ASN B CG    1 
ATOM   4884  O  OD1   . ASN B  1  59  ? 13.605  14.135 16.734 1.00 48.79 ? 87   ASN B OD1   1 
ATOM   4885  N  ND2   . ASN B  1  59  ? 13.952  12.570 15.163 1.00 51.61 ? 87   ASN B ND2   1 
ATOM   4886  N  N     . THR B  1  60  ? 9.128   11.837 18.023 1.00 50.95 ? 88   THR B N     1 
ATOM   4887  C  CA    . THR B  1  60  ? 7.680   11.607 17.952 1.00 52.05 ? 88   THR B CA    1 
ATOM   4888  C  C     . THR B  1  60  ? 6.933   12.491 18.947 1.00 50.72 ? 88   THR B C     1 
ATOM   4889  O  O     . THR B  1  60  ? 5.857   12.997 18.630 1.00 50.98 ? 88   THR B O     1 
ATOM   4890  C  CB    . THR B  1  60  ? 7.252   10.109 18.109 1.00 54.76 ? 88   THR B CB    1 
ATOM   4891  O  OG1   . THR B  1  60  ? 7.136   9.769  19.494 1.00 55.79 ? 88   THR B OG1   1 
ATOM   4892  C  CG2   . THR B  1  60  ? 8.232   9.163  17.410 1.00 55.95 ? 88   THR B CG2   1 
ATOM   4893  N  N     . VAL B  1  61  ? 7.508   12.685 20.135 1.00 49.76 ? 89   VAL B N     1 
ATOM   4894  C  CA    . VAL B  1  61  ? 6.935   13.606 21.126 1.00 48.53 ? 89   VAL B CA    1 
ATOM   4895  C  C     . VAL B  1  61  ? 6.871   15.040 20.580 1.00 46.84 ? 89   VAL B C     1 
ATOM   4896  O  O     . VAL B  1  61  ? 5.892   15.750 20.817 1.00 46.40 ? 89   VAL B O     1 
ATOM   4897  C  CB    . VAL B  1  61  ? 7.693   13.566 22.481 1.00 48.41 ? 89   VAL B CB    1 
ATOM   4898  C  CG1   . VAL B  1  61  ? 7.199   14.663 23.426 1.00 46.81 ? 89   VAL B CG1   1 
ATOM   4899  C  CG2   . VAL B  1  61  ? 7.530   12.208 23.136 1.00 50.50 ? 89   VAL B CG2   1 
ATOM   4900  N  N     . HIS B  1  62  ? 7.911   15.449 19.850 1.00 46.09 ? 90   HIS B N     1 
ATOM   4901  C  CA    . HIS B  1  62  ? 7.930   16.752 19.183 1.00 45.40 ? 90   HIS B CA    1 
ATOM   4902  C  C     . HIS B  1  62  ? 6.816   16.849 18.144 1.00 46.25 ? 90   HIS B C     1 
ATOM   4903  O  O     . HIS B  1  62  ? 6.138   17.871 18.055 1.00 45.91 ? 90   HIS B O     1 
ATOM   4904  C  CB    . HIS B  1  62  ? 9.282   17.022 18.518 1.00 45.34 ? 90   HIS B CB    1 
ATOM   4905  C  CG    . HIS B  1  62  ? 9.330   18.311 17.753 1.00 45.63 ? 90   HIS B CG    1 
ATOM   4906  N  ND1   . HIS B  1  62  ? 9.574   19.528 18.356 1.00 44.78 ? 90   HIS B ND1   1 
ATOM   4907  C  CD2   . HIS B  1  62  ? 9.160   18.574 16.435 1.00 46.60 ? 90   HIS B CD2   1 
ATOM   4908  C  CE1   . HIS B  1  62  ? 9.551   20.482 17.444 1.00 45.61 ? 90   HIS B CE1   1 
ATOM   4909  N  NE2   . HIS B  1  62  ? 9.303   19.930 16.269 1.00 46.89 ? 90   HIS B NE2   1 
ATOM   4910  N  N     . TYR B  1  63  ? 6.638   15.781 17.367 1.00 47.70 ? 91   TYR B N     1 
ATOM   4911  C  CA    . TYR B  1  63  ? 5.583   15.718 16.359 1.00 49.16 ? 91   TYR B CA    1 
ATOM   4912  C  C     . TYR B  1  63  ? 4.212   15.949 16.995 1.00 49.70 ? 91   TYR B C     1 
ATOM   4913  O  O     . TYR B  1  63  ? 3.438   16.789 16.528 1.00 50.34 ? 91   TYR B O     1 
ATOM   4914  C  CB    . TYR B  1  63  ? 5.611   14.370 15.626 1.00 50.93 ? 91   TYR B CB    1 
ATOM   4915  C  CG    . TYR B  1  63  ? 4.600   14.257 14.504 1.00 52.81 ? 91   TYR B CG    1 
ATOM   4916  C  CD1   . TYR B  1  63  ? 4.992   14.391 13.173 1.00 53.52 ? 91   TYR B CD1   1 
ATOM   4917  C  CD2   . TYR B  1  63  ? 3.249   14.017 14.773 1.00 54.34 ? 91   TYR B CD2   1 
ATOM   4918  C  CE1   . TYR B  1  63  ? 4.063   14.291 12.138 1.00 56.06 ? 91   TYR B CE1   1 
ATOM   4919  C  CE2   . TYR B  1  63  ? 2.313   13.922 13.745 1.00 56.49 ? 91   TYR B CE2   1 
ATOM   4920  C  CZ    . TYR B  1  63  ? 2.729   14.059 12.436 1.00 57.11 ? 91   TYR B CZ    1 
ATOM   4921  O  OH    . TYR B  1  63  ? 1.813   13.960 11.420 1.00 61.17 ? 91   TYR B OH    1 
ATOM   4922  N  N     . ILE B  1  64  ? 3.932   15.206 18.066 1.00 49.69 ? 92   ILE B N     1 
ATOM   4923  C  CA    . ILE B  1  64  ? 2.663   15.299 18.785 1.00 50.55 ? 92   ILE B CA    1 
ATOM   4924  C  C     . ILE B  1  64  ? 2.403   16.726 19.278 1.00 49.07 ? 92   ILE B C     1 
ATOM   4925  O  O     . ILE B  1  64  ? 1.300   17.254 19.116 1.00 49.87 ? 92   ILE B O     1 
ATOM   4926  C  CB    . ILE B  1  64  ? 2.600   14.269 19.952 1.00 51.35 ? 92   ILE B CB    1 
ATOM   4927  C  CG1   . ILE B  1  64  ? 2.647   12.841 19.396 1.00 53.45 ? 92   ILE B CG1   1 
ATOM   4928  C  CG2   . ILE B  1  64  ? 1.333   14.456 20.792 1.00 52.28 ? 92   ILE B CG2   1 
ATOM   4929  C  CD1   . ILE B  1  64  ? 3.169   11.810 20.367 1.00 54.65 ? 92   ILE B CD1   1 
ATOM   4930  N  N     . LEU B  1  65  ? 3.431   17.349 19.852 1.00 47.22 ? 93   LEU B N     1 
ATOM   4931  C  CA    . LEU B  1  65  ? 3.327   18.712 20.375 1.00 46.24 ? 93   LEU B CA    1 
ATOM   4932  C  C     . LEU B  1  65  ? 3.211   19.784 19.283 1.00 46.60 ? 93   LEU B C     1 
ATOM   4933  O  O     . LEU B  1  65  ? 2.703   20.876 19.538 1.00 46.80 ? 93   LEU B O     1 
ATOM   4934  C  CB    . LEU B  1  65  ? 4.502   19.022 21.313 1.00 44.64 ? 93   LEU B CB    1 
ATOM   4935  C  CG    . LEU B  1  65  ? 4.445   18.421 22.720 1.00 44.87 ? 93   LEU B CG    1 
ATOM   4936  C  CD1   . LEU B  1  65  ? 5.833   18.318 23.331 1.00 43.37 ? 93   LEU B CD1   1 
ATOM   4937  C  CD2   . LEU B  1  65  ? 3.514   19.230 23.621 1.00 45.41 ? 93   LEU B CD2   1 
ATOM   4938  N  N     . THR B  1  66  ? 3.668   19.468 18.071 1.00 47.33 ? 94   THR B N     1 
ATOM   4939  C  CA    . THR B  1  66  ? 3.631   20.427 16.959 1.00 48.09 ? 94   THR B CA    1 
ATOM   4940  C  C     . THR B  1  66  ? 2.532   20.124 15.933 1.00 50.55 ? 94   THR B C     1 
ATOM   4941  O  O     . THR B  1  66  ? 2.449   20.771 14.885 1.00 51.98 ? 94   THR B O     1 
ATOM   4942  C  CB    . THR B  1  66  ? 5.004   20.560 16.261 1.00 47.57 ? 94   THR B CB    1 
ATOM   4943  O  OG1   . THR B  1  66  ? 5.445   19.273 15.814 1.00 47.64 ? 94   THR B OG1   1 
ATOM   4944  C  CG2   . THR B  1  66  ? 6.041   21.147 17.223 1.00 46.04 ? 94   THR B CG2   1 
ATOM   4945  N  N     . HIS B  1  67  ? 1.690   19.143 16.243 1.00 51.51 ? 95   HIS B N     1 
ATOM   4946  C  CA    . HIS B  1  67  ? 0.511   18.847 15.432 1.00 54.28 ? 95   HIS B CA    1 
ATOM   4947  C  C     . HIS B  1  67  ? -0.717  18.790 16.326 1.00 55.25 ? 95   HIS B C     1 
ATOM   4948  O  O     . HIS B  1  67  ? -0.608  18.983 17.537 1.00 53.71 ? 95   HIS B O     1 
ATOM   4949  C  CB    . HIS B  1  67  ? 0.691   17.531 14.674 1.00 55.66 ? 95   HIS B CB    1 
ATOM   4950  C  CG    . HIS B  1  67  ? 1.759   17.586 13.628 1.00 55.63 ? 95   HIS B CG    1 
ATOM   4951  N  ND1   . HIS B  1  67  ? 3.101   17.512 13.932 1.00 53.78 ? 95   HIS B ND1   1 
ATOM   4952  C  CD2   . HIS B  1  67  ? 1.684   17.722 12.283 1.00 57.46 ? 95   HIS B CD2   1 
ATOM   4953  C  CE1   . HIS B  1  67  ? 3.808   17.597 12.820 1.00 54.67 ? 95   HIS B CE1   1 
ATOM   4954  N  NE2   . HIS B  1  67  ? 2.972   17.721 11.804 1.00 57.13 ? 95   HIS B NE2   1 
ATOM   4955  N  N     . PHE B  1  68  ? -1.876  18.535 15.722 1.00 58.17 ? 96   PHE B N     1 
ATOM   4956  C  CA    . PHE B  1  68  ? -3.156  18.424 16.433 1.00 59.97 ? 96   PHE B CA    1 
ATOM   4957  C  C     . PHE B  1  68  ? -3.540  19.718 17.154 1.00 59.11 ? 96   PHE B C     1 
ATOM   4958  O  O     . PHE B  1  68  ? -3.973  19.693 18.309 1.00 58.91 ? 96   PHE B O     1 
ATOM   4959  C  CB    . PHE B  1  68  ? -3.151  17.228 17.400 1.00 59.96 ? 96   PHE B CB    1 
ATOM   4960  C  CG    . PHE B  1  68  ? -2.596  15.963 16.803 1.00 60.76 ? 96   PHE B CG    1 
ATOM   4961  C  CD1   . PHE B  1  68  ? -1.317  15.527 17.136 1.00 58.42 ? 96   PHE B CD1   1 
ATOM   4962  C  CD2   . PHE B  1  68  ? -3.350  15.212 15.904 1.00 64.96 ? 96   PHE B CD2   1 
ATOM   4963  C  CE1   . PHE B  1  68  ? -0.796  14.358 16.587 1.00 59.47 ? 96   PHE B CE1   1 
ATOM   4964  C  CE2   . PHE B  1  68  ? -2.838  14.039 15.345 1.00 66.01 ? 96   PHE B CE2   1 
ATOM   4965  C  CZ    . PHE B  1  68  ? -1.556  13.613 15.687 1.00 63.29 ? 96   PHE B CZ    1 
ATOM   4966  N  N     . LYS B  1  69  ? -3.385  20.841 16.449 1.00 59.08 ? 97   LYS B N     1 
ATOM   4967  C  CA    . LYS B  1  69  ? -3.684  22.183 16.975 1.00 58.70 ? 97   LYS B CA    1 
ATOM   4968  C  C     . LYS B  1  69  ? -5.080  22.305 17.591 1.00 60.77 ? 97   LYS B C     1 
ATOM   4969  O  O     . LYS B  1  69  ? -5.269  23.039 18.557 1.00 60.05 ? 97   LYS B O     1 
ATOM   4970  C  CB    . LYS B  1  69  ? -3.511  23.236 15.873 1.00 59.99 ? 97   LYS B CB    1 
ATOM   4971  C  CG    . LYS B  1  69  ? -3.329  24.664 16.381 1.00 59.67 ? 97   LYS B CG    1 
ATOM   4972  C  CD    . LYS B  1  69  ? -3.205  25.652 15.228 1.00 62.13 ? 97   LYS B CD    1 
ATOM   4973  N  N     . GLY B  1  70  ? -6.051  21.591 17.024 1.00 63.99 ? 98   GLY B N     1 
ATOM   4974  C  CA    . GLY B  1  70  ? -7.414  21.572 17.553 1.00 66.54 ? 98   GLY B CA    1 
ATOM   4975  C  C     . GLY B  1  70  ? -7.495  20.939 18.930 1.00 65.30 ? 98   GLY B C     1 
ATOM   4976  O  O     . GLY B  1  70  ? -8.159  21.466 19.829 1.00 65.80 ? 98   GLY B O     1 
ATOM   4977  N  N     . VAL B  1  71  ? -6.805  19.811 19.093 1.00 63.75 ? 99   VAL B N     1 
ATOM   4978  C  CA    . VAL B  1  71  ? -6.765  19.086 20.361 1.00 62.86 ? 99   VAL B CA    1 
ATOM   4979  C  C     . VAL B  1  71  ? -6.064  19.926 21.432 1.00 59.35 ? 99   VAL B C     1 
ATOM   4980  O  O     . VAL B  1  71  ? -6.546  20.031 22.563 1.00 59.71 ? 99   VAL B O     1 
ATOM   4981  C  CB    . VAL B  1  71  ? -6.078  17.700 20.210 1.00 62.50 ? 99   VAL B CB    1 
ATOM   4982  C  CG1   . VAL B  1  71  ? -5.997  16.978 21.548 1.00 62.34 ? 99   VAL B CG1   1 
ATOM   4983  C  CG2   . VAL B  1  71  ? -6.818  16.842 19.196 1.00 66.17 ? 99   VAL B CG2   1 
ATOM   4984  N  N     . TRP B  1  72  ? -4.943  20.540 21.059 1.00 56.30 ? 100  TRP B N     1 
ATOM   4985  C  CA    . TRP B  1  72  ? -4.174  21.366 21.986 1.00 53.24 ? 100  TRP B CA    1 
ATOM   4986  C  C     . TRP B  1  72  ? -4.919  22.624 22.414 1.00 54.09 ? 100  TRP B C     1 
ATOM   4987  O  O     . TRP B  1  72  ? -4.752  23.086 23.539 1.00 52.53 ? 100  TRP B O     1 
ATOM   4988  C  CB    . TRP B  1  72  ? -2.813  21.734 21.398 1.00 50.57 ? 100  TRP B CB    1 
ATOM   4989  C  CG    . TRP B  1  72  ? -1.862  20.584 21.332 1.00 48.94 ? 100  TRP B CG    1 
ATOM   4990  C  CD1   . TRP B  1  72  ? -1.317  20.040 20.208 1.00 48.78 ? 100  TRP B CD1   1 
ATOM   4991  C  CD2   . TRP B  1  72  ? -1.350  19.824 22.433 1.00 47.71 ? 100  TRP B CD2   1 
ATOM   4992  N  NE1   . TRP B  1  72  ? -0.491  18.993 20.535 1.00 47.91 ? 100  TRP B NE1   1 
ATOM   4993  C  CE2   . TRP B  1  72  ? -0.490  18.840 21.896 1.00 47.38 ? 100  TRP B CE2   1 
ATOM   4994  C  CE3   . TRP B  1  72  ? -1.528  19.885 23.824 1.00 47.66 ? 100  TRP B CE3   1 
ATOM   4995  C  CZ2   . TRP B  1  72  ? 0.192   17.918 22.700 1.00 46.91 ? 100  TRP B CZ2   1 
ATOM   4996  C  CZ3   . TRP B  1  72  ? -0.851  18.967 24.623 1.00 47.15 ? 100  TRP B CZ3   1 
ATOM   4997  C  CH2   . TRP B  1  72  ? -0.001  17.996 24.057 1.00 46.86 ? 100  TRP B CH2   1 
ATOM   4998  N  N     . ASN B  1  73  ? -5.737  23.170 21.514 1.00 56.75 ? 101  ASN B N     1 
ATOM   4999  C  CA    . ASN B  1  73  ? -6.569  24.327 21.833 1.00 58.47 ? 101  ASN B CA    1 
ATOM   5000  C  C     . ASN B  1  73  ? -7.577  23.994 22.937 1.00 60.11 ? 101  ASN B C     1 
ATOM   5001  O  O     . ASN B  1  73  ? -7.834  24.815 23.822 1.00 59.75 ? 101  ASN B O     1 
ATOM   5002  C  CB    . ASN B  1  73  ? -7.285  24.854 20.582 1.00 61.78 ? 101  ASN B CB    1 
ATOM   5003  C  CG    . ASN B  1  73  ? -7.898  26.233 20.796 1.00 63.86 ? 101  ASN B CG    1 
ATOM   5004  O  OD1   . ASN B  1  73  ? -7.259  27.137 21.343 1.00 62.51 ? 101  ASN B OD1   1 
ATOM   5005  N  ND2   . ASN B  1  73  ? -9.143  26.399 20.363 1.00 68.65 ? 101  ASN B ND2   1 
ATOM   5006  N  N     . ILE B  1  74  ? -8.131  22.783 22.879 1.00 62.07 ? 102  ILE B N     1 
ATOM   5007  C  CA    . ILE B  1  74  ? -8.992  22.272 23.941 1.00 64.17 ? 102  ILE B CA    1 
ATOM   5008  C  C     . ILE B  1  74  ? -8.174  22.072 25.219 1.00 61.31 ? 102  ILE B C     1 
ATOM   5009  O  O     . ILE B  1  74  ? -8.551  22.571 26.280 1.00 61.67 ? 102  ILE B O     1 
ATOM   5010  C  CB    . ILE B  1  74  ? -9.702  20.955 23.525 1.00 67.66 ? 102  ILE B CB    1 
ATOM   5011  C  CG1   . ILE B  1  74  ? -10.651 21.206 22.345 1.00 71.41 ? 102  ILE B CG1   1 
ATOM   5012  C  CG2   . ILE B  1  74  ? -10.466 20.355 24.705 1.00 70.10 ? 102  ILE B CG2   1 
ATOM   5013  C  CD1   . ILE B  1  74  ? -10.967 19.971 21.509 1.00 73.72 ? 102  ILE B CD1   1 
ATOM   5014  N  N     . VAL B  1  75  ? -7.048  21.365 25.100 1.00 58.94 ? 103  VAL B N     1 
ATOM   5015  C  CA    . VAL B  1  75  ? -6.154  21.092 26.233 1.00 56.57 ? 103  VAL B CA    1 
ATOM   5016  C  C     . VAL B  1  75  ? -5.706  22.372 26.948 1.00 54.18 ? 103  VAL B C     1 
ATOM   5017  O  O     . VAL B  1  75  ? -5.789  22.462 28.179 1.00 54.02 ? 103  VAL B O     1 
ATOM   5018  C  CB    . VAL B  1  75  ? -4.919  20.246 25.800 1.00 54.68 ? 103  VAL B CB    1 
ATOM   5019  C  CG1   . VAL B  1  75  ? -3.882  20.179 26.909 1.00 52.26 ? 103  VAL B CG1   1 
ATOM   5020  C  CG2   . VAL B  1  75  ? -5.348  18.840 25.398 1.00 57.67 ? 103  VAL B CG2   1 
ATOM   5021  N  N     . ASN B  1  76  ? -5.246  23.358 26.175 1.00 52.61 ? 104  ASN B N     1 
ATOM   5022  C  CA    . ASN B  1  76  ? -4.824  24.652 26.720 1.00 50.91 ? 104  ASN B CA    1 
ATOM   5023  C  C     . ASN B  1  76  ? -5.923  25.393 27.482 1.00 52.94 ? 104  ASN B C     1 
ATOM   5024  O  O     . ASN B  1  76  ? -5.635  26.304 28.256 1.00 51.90 ? 104  ASN B O     1 
ATOM   5025  C  CB    . ASN B  1  76  ? -4.272  25.561 25.615 1.00 49.99 ? 104  ASN B CB    1 
ATOM   5026  C  CG    . ASN B  1  76  ? -3.005  25.017 24.976 1.00 47.69 ? 104  ASN B CG    1 
ATOM   5027  O  OD1   . ASN B  1  76  ? -2.291  24.192 25.557 1.00 45.68 ? 104  ASN B OD1   1 
ATOM   5028  N  ND2   . ASN B  1  76  ? -2.719  25.483 23.766 1.00 46.87 ? 104  ASN B ND2   1 
ATOM   5029  N  N     . ASN B  1  77  ? -7.174  24.997 27.259 1.00 56.32 ? 105  ASN B N     1 
ATOM   5030  C  CA    . ASN B  1  77  ? -8.321  25.644 27.894 1.00 59.05 ? 105  ASN B CA    1 
ATOM   5031  C  C     . ASN B  1  77  ? -8.916  24.882 29.083 1.00 60.69 ? 105  ASN B C     1 
ATOM   5032  O  O     . ASN B  1  77  ? -9.884  25.332 29.694 1.00 63.15 ? 105  ASN B O     1 
ATOM   5033  C  CB    . ASN B  1  77  ? -9.393  25.969 26.850 1.00 62.34 ? 105  ASN B CB    1 
ATOM   5034  C  CG    . ASN B  1  77  ? -9.050  27.205 26.037 1.00 62.15 ? 105  ASN B CG    1 
ATOM   5035  O  OD1   . ASN B  1  77  ? -8.884  28.295 26.587 1.00 62.04 ? 105  ASN B OD1   1 
ATOM   5036  N  ND2   . ASN B  1  77  ? -8.935  27.040 24.725 1.00 62.85 ? 105  ASN B ND2   1 
ATOM   5037  N  N     . ILE B  1  78  A -8.329  23.733 29.406 1.00 59.95 ? 105  ILE B N     1 
ATOM   5038  C  CA    . ILE B  1  78  A -8.683  22.996 30.617 1.00 61.57 ? 105  ILE B CA    1 
ATOM   5039  C  C     . ILE B  1  78  A -7.479  23.047 31.562 1.00 58.57 ? 105  ILE B C     1 
ATOM   5040  O  O     . ILE B  1  78  A -6.497  22.323 31.353 1.00 56.92 ? 105  ILE B O     1 
ATOM   5041  C  CB    . ILE B  1  78  A -9.091  21.533 30.310 1.00 64.33 ? 105  ILE B CB    1 
ATOM   5042  C  CG1   . ILE B  1  78  A -10.175 21.496 29.228 1.00 67.31 ? 105  ILE B CG1   1 
ATOM   5043  C  CG2   . ILE B  1  78  A -9.579  20.827 31.578 1.00 67.02 ? 105  ILE B CG2   1 
ATOM   5044  C  CD1   . ILE B  1  78  A -10.170 20.236 28.400 1.00 68.94 ? 105  ILE B CD1   1 
ATOM   5045  N  N     . PRO B  1  79  ? -7.543  23.919 32.593 1.00 58.07 ? 106  PRO B N     1 
ATOM   5046  C  CA    . PRO B  1  79  ? -6.420  24.177 33.508 1.00 55.44 ? 106  PRO B CA    1 
ATOM   5047  C  C     . PRO B  1  79  ? -5.817  22.919 34.135 1.00 55.61 ? 106  PRO B C     1 
ATOM   5048  O  O     . PRO B  1  79  ? -4.597  22.822 34.251 1.00 53.39 ? 106  PRO B O     1 
ATOM   5049  C  CB    . PRO B  1  79  ? -7.044  25.067 34.583 1.00 56.42 ? 106  PRO B CB    1 
ATOM   5050  C  CG    . PRO B  1  79  ? -8.137  25.770 33.879 1.00 58.37 ? 106  PRO B CG    1 
ATOM   5051  C  CD    . PRO B  1  79  ? -8.710  24.753 32.931 1.00 60.36 ? 106  PRO B CD    1 
ATOM   5052  N  N     . PHE B  1  80  ? -6.662  21.965 34.518 1.00 58.84 ? 107  PHE B N     1 
ATOM   5053  C  CA    . PHE B  1  80  ? -6.189  20.703 35.081 1.00 59.91 ? 107  PHE B CA    1 
ATOM   5054  C  C     . PHE B  1  80  ? -5.325  19.901 34.098 1.00 58.26 ? 107  PHE B C     1 
ATOM   5055  O  O     . PHE B  1  80  ? -4.256  19.415 34.470 1.00 57.04 ? 107  PHE B O     1 
ATOM   5056  C  CB    . PHE B  1  80  ? -7.358  19.854 35.584 1.00 64.46 ? 107  PHE B CB    1 
ATOM   5057  C  CG    . PHE B  1  80  ? -6.931  18.596 36.285 1.00 67.26 ? 107  PHE B CG    1 
ATOM   5058  C  CD1   . PHE B  1  80  ? -6.455  18.640 37.598 1.00 68.25 ? 107  PHE B CD1   1 
ATOM   5059  C  CD2   . PHE B  1  80  ? -6.995  17.365 35.634 1.00 69.91 ? 107  PHE B CD2   1 
ATOM   5060  C  CE1   . PHE B  1  80  ? -6.052  17.474 38.254 1.00 71.09 ? 107  PHE B CE1   1 
ATOM   5061  C  CE2   . PHE B  1  80  ? -6.596  16.191 36.281 1.00 72.94 ? 107  PHE B CE2   1 
ATOM   5062  C  CZ    . PHE B  1  80  ? -6.125  16.246 37.593 1.00 73.57 ? 107  PHE B CZ    1 
ATOM   5063  N  N     . LEU B  1  81  ? -5.791  19.767 32.855 1.00 58.47 ? 108  LEU B N     1 
ATOM   5064  C  CA    . LEU B  1  81  ? -5.039  19.053 31.819 1.00 57.23 ? 108  LEU B CA    1 
ATOM   5065  C  C     . LEU B  1  81  ? -3.750  19.790 31.444 1.00 53.21 ? 108  LEU B C     1 
ATOM   5066  O  O     . LEU B  1  81  ? -2.702  19.162 31.257 1.00 52.10 ? 108  LEU B O     1 
ATOM   5067  C  CB    . LEU B  1  81  ? -5.892  18.817 30.567 1.00 59.00 ? 108  LEU B CB    1 
ATOM   5068  C  CG    . LEU B  1  81  ? -7.158  17.958 30.623 1.00 64.04 ? 108  LEU B CG    1 
ATOM   5069  C  CD1   . LEU B  1  81  ? -7.644  17.685 29.204 1.00 65.82 ? 108  LEU B CD1   1 
ATOM   5070  C  CD2   . LEU B  1  81  ? -6.942  16.644 31.371 1.00 66.48 ? 108  LEU B CD2   1 
ATOM   5071  N  N     . ARG B  1  82  ? -3.837  21.116 31.338 1.00 51.49 ? 109  ARG B N     1 
ATOM   5072  C  CA    . ARG B  1  82  ? -2.672  21.953 31.063 1.00 48.37 ? 109  ARG B CA    1 
ATOM   5073  C  C     . ARG B  1  82  ? -1.616  21.788 32.157 1.00 47.24 ? 109  ARG B C     1 
ATOM   5074  O  O     . ARG B  1  82  ? -0.426  21.647 31.859 1.00 45.59 ? 109  ARG B O     1 
ATOM   5075  C  CB    . ARG B  1  82  ? -3.083  23.422 30.914 1.00 47.85 ? 109  ARG B CB    1 
ATOM   5076  C  CG    . ARG B  1  82  ? -1.924  24.386 30.623 1.00 45.34 ? 109  ARG B CG    1 
ATOM   5077  C  CD    . ARG B  1  82  ? -2.455  25.739 30.178 1.00 45.95 ? 109  ARG B CD    1 
ATOM   5078  N  NE    . ARG B  1  82  ? -1.401  26.715 29.900 1.00 43.91 ? 109  ARG B NE    1 
ATOM   5079  C  CZ    . ARG B  1  82  ? -1.201  27.824 30.606 1.00 43.82 ? 109  ARG B CZ    1 
ATOM   5080  N  NH1   . ARG B  1  82  ? -1.976  28.105 31.642 1.00 45.11 ? 109  ARG B NH1   1 
ATOM   5081  N  NH2   . ARG B  1  82  ? -0.225  28.659 30.276 1.00 42.86 ? 109  ARG B NH2   1 
ATOM   5082  N  N     . SER B  1  83  ? -2.059  21.800 33.416 1.00 48.46 ? 110  SER B N     1 
ATOM   5083  C  CA    . SER B  1  83  ? -1.171  21.577 34.561 1.00 48.16 ? 110  SER B CA    1 
ATOM   5084  C  C     . SER B  1  83  ? -0.505  20.204 34.490 1.00 49.00 ? 110  SER B C     1 
ATOM   5085  O  O     . SER B  1  83  ? 0.715   20.101 34.603 1.00 47.73 ? 110  SER B O     1 
ATOM   5086  C  CB    . SER B  1  83  ? -1.930  21.722 35.885 1.00 50.04 ? 110  SER B CB    1 
ATOM   5087  O  OG    . SER B  1  83  ? -2.332  23.060 36.098 1.00 49.59 ? 110  SER B OG    1 
ATOM   5088  N  N     . LEU B  1  84  ? -1.312  19.160 34.292 1.00 51.55 ? 111  LEU B N     1 
ATOM   5089  C  CA    . LEU B  1  84  ? -0.816  17.788 34.217 1.00 53.23 ? 111  LEU B CA    1 
ATOM   5090  C  C     . LEU B  1  84  ? 0.263   17.632 33.148 1.00 51.23 ? 111  LEU B C     1 
ATOM   5091  O  O     . LEU B  1  84  ? 1.313   17.036 33.400 1.00 51.29 ? 111  LEU B O     1 
ATOM   5092  C  CB    . LEU B  1  84  ? -1.970  16.820 33.946 1.00 56.60 ? 111  LEU B CB    1 
ATOM   5093  C  CG    . LEU B  1  84  ? -1.802  15.345 34.317 1.00 59.77 ? 111  LEU B CG    1 
ATOM   5094  C  CD1   . LEU B  1  84  ? -3.172  14.713 34.510 1.00 64.18 ? 111  LEU B CD1   1 
ATOM   5095  C  CD2   . LEU B  1  84  ? -0.998  14.575 33.272 1.00 59.51 ? 111  LEU B CD2   1 
ATOM   5096  N  N     . ILE B  1  85  ? -0.003  18.173 31.962 1.00 50.07 ? 112  ILE B N     1 
ATOM   5097  C  CA    . ILE B  1  85  ? 0.940   18.107 30.847 1.00 48.31 ? 112  ILE B CA    1 
ATOM   5098  C  C     . ILE B  1  85  ? 2.213   18.915 31.136 1.00 46.11 ? 112  ILE B C     1 
ATOM   5099  O  O     . ILE B  1  85  ? 3.320   18.416 30.928 1.00 45.89 ? 112  ILE B O     1 
ATOM   5100  C  CB    . ILE B  1  85  ? 0.262   18.477 29.498 1.00 47.92 ? 112  ILE B CB    1 
ATOM   5101  C  CG1   . ILE B  1  85  ? -0.738  17.381 29.120 1.00 50.81 ? 112  ILE B CG1   1 
ATOM   5102  C  CG2   . ILE B  1  85  ? 1.294   18.642 28.388 1.00 46.35 ? 112  ILE B CG2   1 
ATOM   5103  C  CD1   . ILE B  1  85  ? -1.587  17.690 27.931 1.00 51.70 ? 112  ILE B CD1   1 
ATOM   5104  N  N     . MET B  1  86  ? 2.061   20.137 31.645 1.00 45.11 ? 113  MET B N     1 
ATOM   5105  C  CA    . MET B  1  86  ? 3.230   20.940 32.013 1.00 43.76 ? 113  MET B CA    1 
ATOM   5106  C  C     . MET B  1  86  ? 4.100   20.257 33.077 1.00 44.99 ? 113  MET B C     1 
ATOM   5107  O  O     . MET B  1  86  ? 5.326   20.353 33.028 1.00 44.41 ? 113  MET B O     1 
ATOM   5108  C  CB    . MET B  1  86  ? 2.848   22.355 32.453 1.00 42.69 ? 113  MET B CB    1 
ATOM   5109  C  CG    . MET B  1  86  ? 4.056   23.301 32.561 1.00 40.88 ? 113  MET B CG    1 
ATOM   5110  S  SD    . MET B  1  86  ? 4.962   23.437 31.005 1.00 39.01 ? 113  MET B SD    1 
ATOM   5111  C  CE    . MET B  1  86  ? 6.515   24.175 31.525 1.00 37.84 ? 113  MET B CE    1 
ATOM   5112  N  N     . LYS B  1  87  ? 3.463   19.569 34.019 1.00 47.47 ? 114  LYS B N     1 
ATOM   5113  C  CA    . LYS B  1  87  ? 4.173   18.783 35.028 1.00 50.02 ? 114  LYS B CA    1 
ATOM   5114  C  C     . LYS B  1  87  ? 5.025   17.677 34.387 1.00 51.16 ? 114  LYS B C     1 
ATOM   5115  O  O     . LYS B  1  87  ? 6.177   17.483 34.777 1.00 51.50 ? 114  LYS B O     1 
ATOM   5116  C  CB    . LYS B  1  87  ? 3.185   18.216 36.057 1.00 52.48 ? 114  LYS B CB    1 
ATOM   5117  C  CG    . LYS B  1  87  ? 3.803   17.296 37.117 1.00 55.42 ? 114  LYS B CG    1 
ATOM   5118  C  CD    . LYS B  1  87  ? 3.123   17.434 38.478 1.00 58.55 ? 114  LYS B CD    1 
ATOM   5119  C  CE    . LYS B  1  87  ? 1.612   17.268 38.404 1.00 60.44 ? 114  LYS B CE    1 
ATOM   5120  N  NZ    . LYS B  1  87  ? 0.940   17.933 39.559 1.00 62.97 ? 114  LYS B NZ    1 
ATOM   5121  N  N     . TYR B  1  88  ? 4.457   16.974 33.404 1.00 52.65 ? 115  TYR B N     1 
ATOM   5122  C  CA    . TYR B  1  88  ? 5.181   15.953 32.631 1.00 54.34 ? 115  TYR B CA    1 
ATOM   5123  C  C     . TYR B  1  88  ? 6.410   16.553 31.940 1.00 52.51 ? 115  TYR B C     1 
ATOM   5124  O  O     . TYR B  1  88  ? 7.524   16.021 32.052 1.00 53.33 ? 115  TYR B O     1 
ATOM   5125  C  CB    . TYR B  1  88  ? 4.258   15.282 31.598 1.00 55.59 ? 115  TYR B CB    1 
ATOM   5126  C  CG    . TYR B  1  88  ? 4.998   14.607 30.452 1.00 57.53 ? 115  TYR B CG    1 
ATOM   5127  C  CD1   . TYR B  1  88  ? 5.582   13.346 30.617 1.00 61.48 ? 115  TYR B CD1   1 
ATOM   5128  C  CD2   . TYR B  1  88  ? 5.120   15.234 29.201 1.00 57.07 ? 115  TYR B CD2   1 
ATOM   5129  C  CE1   . TYR B  1  88  ? 6.272   12.724 29.571 1.00 62.51 ? 115  TYR B CE1   1 
ATOM   5130  C  CE2   . TYR B  1  88  ? 5.813   14.622 28.147 1.00 58.36 ? 115  TYR B CE2   1 
ATOM   5131  C  CZ    . TYR B  1  88  ? 6.383   13.365 28.342 1.00 61.15 ? 115  TYR B CZ    1 
ATOM   5132  O  OH    . TYR B  1  88  ? 7.064   12.747 27.315 1.00 62.14 ? 115  TYR B OH    1 
ATOM   5133  N  N     . VAL B  1  89  ? 6.192   17.660 31.231 1.00 50.44 ? 116  VAL B N     1 
ATOM   5134  C  CA    . VAL B  1  89  ? 7.270   18.400 30.577 1.00 49.17 ? 116  VAL B CA    1 
ATOM   5135  C  C     . VAL B  1  89  ? 8.410   18.695 31.556 1.00 49.82 ? 116  VAL B C     1 
ATOM   5136  O  O     . VAL B  1  89  ? 9.576   18.426 31.254 1.00 50.49 ? 116  VAL B O     1 
ATOM   5137  C  CB    . VAL B  1  89  ? 6.740   19.707 29.920 1.00 47.52 ? 116  VAL B CB    1 
ATOM   5138  C  CG1   . VAL B  1  89  ? 7.890   20.590 29.418 1.00 46.49 ? 116  VAL B CG1   1 
ATOM   5139  C  CG2   . VAL B  1  89  ? 5.781   19.377 28.791 1.00 46.81 ? 116  VAL B CG2   1 
ATOM   5140  N  N     . LEU B  1  90  ? 8.068   19.216 32.733 1.00 50.20 ? 117  LEU B N     1 
ATOM   5141  C  CA    . LEU B  1  90  ? 9.069   19.583 33.734 1.00 51.29 ? 117  LEU B CA    1 
ATOM   5142  C  C     . LEU B  1  90  ? 9.813   18.381 34.329 1.00 54.04 ? 117  LEU B C     1 
ATOM   5143  O  O     . LEU B  1  90  ? 11.037  18.423 34.481 1.00 54.80 ? 117  LEU B O     1 
ATOM   5144  C  CB    . LEU B  1  90  ? 8.441   20.425 34.855 1.00 51.11 ? 117  LEU B CB    1 
ATOM   5145  C  CG    . LEU B  1  90  ? 7.970   21.854 34.560 1.00 48.95 ? 117  LEU B CG    1 
ATOM   5146  C  CD1   . LEU B  1  90  ? 7.160   22.393 35.732 1.00 48.95 ? 117  LEU B CD1   1 
ATOM   5147  C  CD2   . LEU B  1  90  ? 9.129   22.799 34.228 1.00 47.79 ? 117  LEU B CD2   1 
ATOM   5148  N  N     . THR B  1  91  ? 9.076   17.316 34.654 1.00 56.06 ? 118  THR B N     1 
ATOM   5149  C  CA    . THR B  1  91  ? 9.654   16.154 35.342 1.00 59.56 ? 118  THR B CA    1 
ATOM   5150  C  C     . THR B  1  91  ? 10.471  15.230 34.439 1.00 60.72 ? 118  THR B C     1 
ATOM   5151  O  O     . THR B  1  91  ? 11.461  14.658 34.886 1.00 63.21 ? 118  THR B O     1 
ATOM   5152  C  CB    . THR B  1  91  ? 8.597   15.328 36.114 1.00 61.77 ? 118  THR B CB    1 
ATOM   5153  O  OG1   . THR B  1  91  ? 7.446   15.118 35.287 1.00 60.57 ? 118  THR B OG1   1 
ATOM   5154  C  CG2   . THR B  1  91  ? 8.186   16.044 37.401 1.00 62.28 ? 118  THR B CG2   1 
ATOM   5155  N  N     . SER B  1  92  ? 10.063  15.085 33.181 1.00 59.91 ? 119  SER B N     1 
ATOM   5156  C  CA    . SER B  1  92  ? 10.836  14.298 32.213 1.00 61.14 ? 119  SER B CA    1 
ATOM   5157  C  C     . SER B  1  92  ? 12.210  14.917 31.918 1.00 61.10 ? 119  SER B C     1 
ATOM   5158  O  O     . SER B  1  92  ? 13.183  14.196 31.686 1.00 63.08 ? 119  SER B O     1 
ATOM   5159  C  CB    . SER B  1  92  ? 10.048  14.090 30.917 1.00 59.75 ? 119  SER B CB    1 
ATOM   5160  O  OG    . SER B  1  92  ? 9.659   15.323 30.343 1.00 57.18 ? 119  SER B OG    1 
ATOM   5161  N  N     . ARG B  1  93  ? 12.281  16.247 31.949 1.00 59.64 ? 120  ARG B N     1 
ATOM   5162  C  CA    . ARG B  1  93  ? 13.523  16.982 31.703 1.00 59.99 ? 120  ARG B CA    1 
ATOM   5163  C  C     . ARG B  1  93  ? 14.412  17.087 32.947 1.00 62.58 ? 120  ARG B C     1 
ATOM   5164  O  O     . ARG B  1  93  ? 15.504  17.664 32.883 1.00 63.43 ? 120  ARG B O     1 
ATOM   5165  C  CB    . ARG B  1  93  ? 13.211  18.400 31.208 1.00 57.67 ? 120  ARG B CB    1 
ATOM   5166  C  CG    . ARG B  1  93  ? 12.400  18.486 29.924 1.00 55.96 ? 120  ARG B CG    1 
ATOM   5167  C  CD    . ARG B  1  93  ? 13.276  18.322 28.711 1.00 55.49 ? 120  ARG B CD    1 
ATOM   5168  N  NE    . ARG B  1  93  ? 12.511  18.389 27.472 1.00 53.68 ? 120  ARG B NE    1 
ATOM   5169  C  CZ    . ARG B  1  93  ? 12.943  17.915 26.308 1.00 54.02 ? 120  ARG B CZ    1 
ATOM   5170  N  NH1   . ARG B  1  93  ? 14.136  17.339 26.231 1.00 55.56 ? 120  ARG B NH1   1 
ATOM   5171  N  NH2   . ARG B  1  93  ? 12.188  18.017 25.222 1.00 52.38 ? 120  ARG B NH2   1 
ATOM   5172  N  N     . SER B  1  94  ? 13.952  16.538 34.070 1.00 64.43 ? 121  SER B N     1 
ATOM   5173  C  CA    . SER B  1  94  ? 14.612  16.772 35.357 1.00 66.86 ? 121  SER B CA    1 
ATOM   5174  C  C     . SER B  1  94  ? 15.790  15.835 35.615 1.00 70.11 ? 121  SER B C     1 
ATOM   5175  O  O     . SER B  1  94  ? 16.907  16.295 35.870 1.00 71.64 ? 121  SER B O     1 
ATOM   5176  C  CB    . SER B  1  94  ? 13.601  16.702 36.509 1.00 67.60 ? 121  SER B CB    1 
ATOM   5177  O  OG    . SER B  1  94  ? 13.138  15.373 36.707 1.00 70.12 ? 121  SER B OG    1 
ATOM   5178  N  N     . TYR B  1  95  ? 15.533  14.529 35.526 1.00 47.44 ? 122  TYR B N     1 
ATOM   5179  C  CA    . TYR B  1  95  ? 16.498  13.486 35.892 1.00 47.08 ? 122  TYR B CA    1 
ATOM   5180  C  C     . TYR B  1  95  ? 17.810  13.503 35.088 1.00 45.10 ? 122  TYR B C     1 
ATOM   5181  O  O     . TYR B  1  95  ? 18.740  12.756 35.404 1.00 45.13 ? 122  TYR B O     1 
ATOM   5182  C  CB    . TYR B  1  95  ? 15.839  12.103 35.766 1.00 49.64 ? 122  TYR B CB    1 
ATOM   5183  C  CG    . TYR B  1  95  ? 15.878  11.541 34.358 1.00 52.00 ? 122  TYR B CG    1 
ATOM   5184  C  CD1   . TYR B  1  95  ? 15.053  12.059 33.355 1.00 54.28 ? 122  TYR B CD1   1 
ATOM   5185  C  CD2   . TYR B  1  95  ? 16.754  10.503 34.024 1.00 53.65 ? 122  TYR B CD2   1 
ATOM   5186  C  CE1   . TYR B  1  95  ? 15.093  11.552 32.053 1.00 55.79 ? 122  TYR B CE1   1 
ATOM   5187  C  CE2   . TYR B  1  95  ? 16.804  9.989  32.719 1.00 55.33 ? 122  TYR B CE2   1 
ATOM   5188  C  CZ    . TYR B  1  95  ? 15.969  10.516 31.744 1.00 56.38 ? 122  TYR B CZ    1 
ATOM   5189  O  OH    . TYR B  1  95  ? 16.008  10.017 30.457 1.00 57.98 ? 122  TYR B OH    1 
ATOM   5190  N  N     . LEU B  1  96  ? 17.877  14.337 34.050 1.00 43.01 ? 123  LEU B N     1 
ATOM   5191  C  CA    . LEU B  1  96  ? 19.029  14.362 33.152 1.00 40.74 ? 123  LEU B CA    1 
ATOM   5192  C  C     . LEU B  1  96  ? 20.219  15.183 33.645 1.00 38.30 ? 123  LEU B C     1 
ATOM   5193  O  O     . LEU B  1  96  ? 21.328  15.007 33.151 1.00 37.43 ? 123  LEU B O     1 
ATOM   5194  C  CB    . LEU B  1  96  ? 18.614  14.813 31.746 1.00 40.89 ? 123  LEU B CB    1 
ATOM   5195  C  CG    . LEU B  1  96  ? 17.933  13.727 30.906 1.00 42.45 ? 123  LEU B CG    1 
ATOM   5196  C  CD1   . LEU B  1  96  ? 17.104  14.329 29.785 1.00 42.58 ? 123  LEU B CD1   1 
ATOM   5197  C  CD2   . LEU B  1  96  ? 18.952  12.718 30.363 1.00 42.35 ? 123  LEU B CD2   1 
ATOM   5198  N  N     . ILE B  1  97  ? 19.992  16.064 34.616 1.00 36.63 ? 124  ILE B N     1 
ATOM   5199  C  CA    . ILE B  1  97  ? 21.047  16.951 35.119 1.00 34.34 ? 124  ILE B CA    1 
ATOM   5200  C  C     . ILE B  1  97  ? 21.532  16.517 36.494 1.00 33.63 ? 124  ILE B C     1 
ATOM   5201  O  O     . ILE B  1  97  ? 20.722  16.300 37.391 1.00 34.41 ? 124  ILE B O     1 
ATOM   5202  C  CB    . ILE B  1  97  ? 20.568  18.440 35.162 1.00 33.75 ? 124  ILE B CB    1 
ATOM   5203  C  CG1   . ILE B  1  97  ? 20.055  18.891 33.783 1.00 34.27 ? 124  ILE B CG1   1 
ATOM   5204  C  CG2   . ILE B  1  97  ? 21.672  19.388 35.685 1.00 32.02 ? 124  ILE B CG2   1 
ATOM   5205  C  CD1   . ILE B  1  97  ? 21.038  18.664 32.626 1.00 34.67 ? 124  ILE B CD1   1 
ATOM   5206  N  N     . ASP B  1  98  ? 22.852  16.399 36.660 1.00 32.34 ? 125  ASP B N     1 
ATOM   5207  C  CA    . ASP B  1  98  ? 23.439  16.131 37.976 1.00 31.69 ? 125  ASP B CA    1 
ATOM   5208  C  C     . ASP B  1  98  ? 23.245  17.345 38.893 1.00 30.69 ? 125  ASP B C     1 
ATOM   5209  O  O     . ASP B  1  98  ? 23.811  18.414 38.648 1.00 29.46 ? 125  ASP B O     1 
ATOM   5210  C  CB    . ASP B  1  98  ? 24.941  15.809 37.869 1.00 31.25 ? 125  ASP B CB    1 
ATOM   5211  C  CG    . ASP B  1  98  ? 25.231  14.419 37.282 1.00 33.03 ? 125  ASP B CG    1 
ATOM   5212  O  OD1   . ASP B  1  98  ? 24.290  13.610 37.058 1.00 32.85 ? 125  ASP B OD1   1 
ATOM   5213  O  OD2   . ASP B  1  98  ? 26.434  14.146 37.038 1.00 33.20 ? 125  ASP B OD2   1 
ATOM   5214  N  N     . SER B  1  99  ? 22.451  17.172 39.948 1.00 30.54 ? 126  SER B N     1 
ATOM   5215  C  CA    . SER B  1  99  ? 22.230  18.221 40.939 1.00 29.42 ? 126  SER B CA    1 
ATOM   5216  C  C     . SER B  1  99  ? 22.055  17.613 42.337 1.00 29.64 ? 126  SER B C     1 
ATOM   5217  O  O     . SER B  1  99  ? 21.053  16.937 42.576 1.00 30.54 ? 126  SER B O     1 
ATOM   5218  C  CB    . SER B  1  99  ? 20.990  19.032 40.567 1.00 29.90 ? 126  SER B CB    1 
ATOM   5219  O  OG    . SER B  1  99  ? 20.877  20.192 41.373 1.00 29.62 ? 126  SER B OG    1 
ATOM   5220  N  N     . PRO B  1  100 ? 23.007  17.856 43.271 1.00 28.37 ? 127  PRO B N     1 
ATOM   5221  C  CA    . PRO B  1  100 ? 24.239  18.662 43.220 1.00 27.04 ? 127  PRO B CA    1 
ATOM   5222  C  C     . PRO B  1  100 ? 25.189  18.272 42.083 1.00 26.18 ? 127  PRO B C     1 
ATOM   5223  O  O     . PRO B  1  100 ? 25.275  17.097 41.738 1.00 27.34 ? 127  PRO B O     1 
ATOM   5224  C  CB    . PRO B  1  100 ? 24.914  18.373 44.569 1.00 26.95 ? 127  PRO B CB    1 
ATOM   5225  C  CG    . PRO B  1  100 ? 23.842  17.926 45.461 1.00 27.78 ? 127  PRO B CG    1 
ATOM   5226  C  CD    . PRO B  1  100 ? 22.811  17.252 44.604 1.00 29.24 ? 127  PRO B CD    1 
ATOM   5227  N  N     . PRO B  1  101 ? 25.906  19.254 41.515 1.00 25.01 ? 128  PRO B N     1 
ATOM   5228  C  CA    . PRO B  1  101 ? 26.746  19.038 40.334 1.00 24.29 ? 128  PRO B CA    1 
ATOM   5229  C  C     . PRO B  1  101 ? 27.983  18.189 40.620 1.00 24.28 ? 128  PRO B C     1 
ATOM   5230  O  O     . PRO B  1  101 ? 28.375  18.027 41.785 1.00 23.70 ? 128  PRO B O     1 
ATOM   5231  C  CB    . PRO B  1  101 ? 27.173  20.457 39.957 1.00 23.52 ? 128  PRO B CB    1 
ATOM   5232  C  CG    . PRO B  1  101 ? 27.215  21.166 41.265 1.00 23.43 ? 128  PRO B CG    1 
ATOM   5233  C  CD    . PRO B  1  101 ? 26.025  20.638 42.016 1.00 23.80 ? 128  PRO B CD    1 
ATOM   5234  N  N     . THR B  1  102 ? 28.597  17.687 39.527 1.00 24.06 ? 129  THR B N     1 
ATOM   5235  C  CA    . THR B  1  102 ? 29.685  16.724 39.637 1.00 24.22 ? 129  THR B CA    1 
ATOM   5236  C  C     . THR B  1  102 ? 30.978  17.264 38.987 1.00 24.08 ? 129  THR B C     1 
ATOM   5237  O  O     . THR B  1  102 ? 31.738  17.992 39.632 1.00 23.96 ? 129  THR B O     1 
ATOM   5238  C  CB    . THR B  1  102 ? 29.274  15.344 39.032 1.00 25.02 ? 129  THR B CB    1 
ATOM   5239  O  OG1   . THR B  1  102 ? 28.741  15.531 37.712 1.00 24.68 ? 129  THR B OG1   1 
ATOM   5240  C  CG2   . THR B  1  102 ? 28.217  14.659 39.893 1.00 25.74 ? 129  THR B CG2   1 
ATOM   5241  N  N     . TYR B  1  103 ? 31.195  16.958 37.716 1.00 24.03 ? 130  TYR B N     1 
ATOM   5242  C  CA    . TYR B  1  103 ? 32.480  17.177 37.042 1.00 24.39 ? 130  TYR B CA    1 
ATOM   5243  C  C     . TYR B  1  103 ? 32.730  18.620 36.631 1.00 23.54 ? 130  TYR B C     1 
ATOM   5244  O  O     . TYR B  1  103 ? 31.800  19.412 36.551 1.00 23.54 ? 130  TYR B O     1 
ATOM   5245  C  CB    . TYR B  1  103 ? 32.597  16.252 35.820 1.00 24.67 ? 130  TYR B CB    1 
ATOM   5246  C  CG    . TYR B  1  103 ? 32.192  14.832 36.130 1.00 27.47 ? 130  TYR B CG    1 
ATOM   5247  C  CD1   . TYR B  1  103 ? 32.987  14.030 36.946 1.00 28.20 ? 130  TYR B CD1   1 
ATOM   5248  C  CD2   . TYR B  1  103 ? 30.996  14.301 35.642 1.00 29.34 ? 130  TYR B CD2   1 
ATOM   5249  C  CE1   . TYR B  1  103 ? 32.617  12.727 37.264 1.00 31.67 ? 130  TYR B CE1   1 
ATOM   5250  C  CE2   . TYR B  1  103 ? 30.615  12.985 35.953 1.00 32.73 ? 130  TYR B CE2   1 
ATOM   5251  C  CZ    . TYR B  1  103 ? 31.434  12.210 36.763 1.00 33.32 ? 130  TYR B CZ    1 
ATOM   5252  O  OH    . TYR B  1  103 ? 31.081  10.918 37.085 1.00 36.51 ? 130  TYR B OH    1 
ATOM   5253  N  N     . ASN B  1  104 ? 33.997  18.960 36.401 1.00 23.56 ? 131  ASN B N     1 
ATOM   5254  C  CA    . ASN B  1  104 ? 34.337  20.205 35.686 1.00 23.72 ? 131  ASN B CA    1 
ATOM   5255  C  C     . ASN B  1  104 ? 35.571  20.028 34.792 1.00 23.99 ? 131  ASN B C     1 
ATOM   5256  O  O     . ASN B  1  104 ? 36.066  18.903 34.645 1.00 24.71 ? 131  ASN B O     1 
ATOM   5257  C  CB    . ASN B  1  104 ? 34.422  21.423 36.634 1.00 22.97 ? 131  ASN B CB    1 
ATOM   5258  C  CG    . ASN B  1  104 ? 35.590  21.345 37.604 1.00 23.42 ? 131  ASN B CG    1 
ATOM   5259  O  OD1   . ASN B  1  104 ? 36.650  20.811 37.283 1.00 24.03 ? 131  ASN B OD1   1 
ATOM   5260  N  ND2   . ASN B  1  104 ? 35.406  21.906 38.792 1.00 21.34 ? 131  ASN B ND2   1 
ATOM   5261  N  N     . VAL B  1  105 ? 36.069  21.117 34.203 1.00 23.73 ? 132  VAL B N     1 
ATOM   5262  C  CA    . VAL B  1  105 ? 37.199  21.023 33.266 1.00 24.05 ? 132  VAL B CA    1 
ATOM   5263  C  C     . VAL B  1  105 ? 38.451  20.375 33.878 1.00 24.74 ? 132  VAL B C     1 
ATOM   5264  O  O     . VAL B  1  105 ? 39.220  19.703 33.176 1.00 25.70 ? 132  VAL B O     1 
ATOM   5265  C  CB    . VAL B  1  105 ? 37.534  22.392 32.596 1.00 24.09 ? 132  VAL B CB    1 
ATOM   5266  C  CG1   . VAL B  1  105 ? 38.166  23.378 33.597 1.00 23.96 ? 132  VAL B CG1   1 
ATOM   5267  C  CG2   . VAL B  1  105 ? 38.442  22.193 31.377 1.00 23.99 ? 132  VAL B CG2   1 
ATOM   5268  N  N     . HIS B  1  106 ? 38.651  20.558 35.179 1.00 24.07 ? 133  HIS B N     1 
ATOM   5269  C  CA    . HIS B  1  106 ? 39.823  19.989 35.843 1.00 24.61 ? 133  HIS B CA    1 
ATOM   5270  C  C     . HIS B  1  106 ? 39.550  18.665 36.539 1.00 24.55 ? 133  HIS B C     1 
ATOM   5271  O  O     . HIS B  1  106 ? 40.481  18.010 36.989 1.00 25.59 ? 133  HIS B O     1 
ATOM   5272  C  CB    . HIS B  1  106 ? 40.432  20.990 36.837 1.00 24.37 ? 133  HIS B CB    1 
ATOM   5273  C  CG    . HIS B  1  106 ? 41.177  22.110 36.183 1.00 25.53 ? 133  HIS B CG    1 
ATOM   5274  N  ND1   . HIS B  1  106 ? 41.370  23.332 36.791 1.00 25.72 ? 133  HIS B ND1   1 
ATOM   5275  C  CD2   . HIS B  1  106 ? 41.760  22.199 34.963 1.00 26.98 ? 133  HIS B CD2   1 
ATOM   5276  C  CE1   . HIS B  1  106 ? 42.049  24.122 35.977 1.00 27.68 ? 133  HIS B CE1   1 
ATOM   5277  N  NE2   . HIS B  1  106 ? 42.299  23.458 34.862 1.00 27.89 ? 133  HIS B NE2   1 
ATOM   5278  N  N     . TYR B  1  107 ? 38.281  18.274 36.645 1.00 24.03 ? 134  TYR B N     1 
ATOM   5279  C  CA    . TYR B  1  107 ? 37.930  17.082 37.406 1.00 24.00 ? 134  TYR B CA    1 
ATOM   5280  C  C     . TYR B  1  107 ? 37.033  16.125 36.632 1.00 24.56 ? 134  TYR B C     1 
ATOM   5281  O  O     . TYR B  1  107 ? 35.840  16.370 36.460 1.00 24.48 ? 134  TYR B O     1 
ATOM   5282  C  CB    . TYR B  1  107 ? 37.361  17.464 38.790 1.00 23.60 ? 134  TYR B CB    1 
ATOM   5283  C  CG    . TYR B  1  107 ? 38.420  18.109 39.662 1.00 22.93 ? 134  TYR B CG    1 
ATOM   5284  C  CD1   . TYR B  1  107 ? 39.318  17.323 40.397 1.00 23.31 ? 134  TYR B CD1   1 
ATOM   5285  C  CD2   . TYR B  1  107 ? 38.576  19.497 39.698 1.00 21.76 ? 134  TYR B CD2   1 
ATOM   5286  C  CE1   . TYR B  1  107 ? 40.317  17.904 41.171 1.00 23.17 ? 134  TYR B CE1   1 
ATOM   5287  C  CE2   . TYR B  1  107 ? 39.583  20.094 40.467 1.00 22.04 ? 134  TYR B CE2   1 
ATOM   5288  C  CZ    . TYR B  1  107 ? 40.443  19.291 41.202 1.00 22.90 ? 134  TYR B CZ    1 
ATOM   5289  O  OH    . TYR B  1  107 ? 41.440  19.861 41.963 1.00 23.76 ? 134  TYR B OH    1 
ATOM   5290  N  N     . GLY B  1  108 ? 37.647  15.049 36.141 1.00 25.43 ? 135  GLY B N     1 
ATOM   5291  C  CA    . GLY B  1  108 ? 36.944  13.942 35.487 1.00 26.04 ? 135  GLY B CA    1 
ATOM   5292  C  C     . GLY B  1  108 ? 36.429  12.910 36.476 1.00 26.83 ? 135  GLY B C     1 
ATOM   5293  O  O     . GLY B  1  108 ? 35.865  11.889 36.082 1.00 27.21 ? 135  GLY B O     1 
ATOM   5294  N  N     . TYR B  1  109 ? 36.633  13.191 37.765 1.00 26.47 ? 136  TYR B N     1 
ATOM   5295  C  CA    . TYR B  1  109 ? 36.115  12.390 38.874 1.00 27.09 ? 136  TYR B CA    1 
ATOM   5296  C  C     . TYR B  1  109 ? 35.490  13.362 39.886 1.00 26.39 ? 136  TYR B C     1 
ATOM   5297  O  O     . TYR B  1  109 ? 35.885  14.525 39.946 1.00 25.77 ? 136  TYR B O     1 
ATOM   5298  C  CB    . TYR B  1  109 ? 37.243  11.578 39.528 1.00 27.51 ? 136  TYR B CB    1 
ATOM   5299  C  CG    . TYR B  1  109 ? 38.447  12.411 39.965 1.00 27.08 ? 136  TYR B CG    1 
ATOM   5300  C  CD1   . TYR B  1  109 ? 38.524  12.943 41.255 1.00 26.12 ? 136  TYR B CD1   1 
ATOM   5301  C  CD2   . TYR B  1  109 ? 39.507  12.665 39.082 1.00 26.10 ? 136  TYR B CD2   1 
ATOM   5302  C  CE1   . TYR B  1  109 ? 39.615  13.716 41.654 1.00 25.70 ? 136  TYR B CE1   1 
ATOM   5303  C  CE2   . TYR B  1  109 ? 40.598  13.430 39.470 1.00 25.70 ? 136  TYR B CE2   1 
ATOM   5304  C  CZ    . TYR B  1  109 ? 40.643  13.959 40.755 1.00 26.41 ? 136  TYR B CZ    1 
ATOM   5305  O  OH    . TYR B  1  109 ? 41.730  14.710 41.153 1.00 26.84 ? 136  TYR B OH    1 
ATOM   5306  N  N     . LYS B  1  110 ? 34.522  12.887 40.666 1.00 26.49 ? 137  LYS B N     1 
ATOM   5307  C  CA    . LYS B  1  110 ? 33.900  13.701 41.718 1.00 26.24 ? 137  LYS B CA    1 
ATOM   5308  C  C     . LYS B  1  110 ? 34.917  14.088 42.787 1.00 25.66 ? 137  LYS B C     1 
ATOM   5309  O  O     . LYS B  1  110 ? 35.727  13.262 43.202 1.00 25.79 ? 137  LYS B O     1 
ATOM   5310  C  CB    . LYS B  1  110 ? 32.688  12.981 42.334 1.00 26.89 ? 137  LYS B CB    1 
ATOM   5311  C  CG    . LYS B  1  110 ? 31.476  12.972 41.380 1.00 29.28 ? 137  LYS B CG    1 
ATOM   5312  C  CD    . LYS B  1  110 ? 30.352  12.072 41.845 1.00 31.18 ? 137  LYS B CD    1 
ATOM   5313  C  CE    . LYS B  1  110 ? 30.491  10.662 41.291 1.00 34.57 ? 137  LYS B CE    1 
ATOM   5314  N  NZ    . LYS B  1  110 ? 30.018  10.570 39.893 1.00 35.14 ? 137  LYS B NZ    1 
ATOM   5315  N  N     . SER B  1  111 ? 34.901  15.363 43.177 1.00 25.15 ? 138  SER B N     1 
ATOM   5316  C  CA    . SER B  1  111 ? 35.807  15.886 44.204 1.00 24.86 ? 138  SER B CA    1 
ATOM   5317  C  C     . SER B  1  111 ? 35.156  17.048 44.930 1.00 23.89 ? 138  SER B C     1 
ATOM   5318  O  O     . SER B  1  111 ? 34.248  17.682 44.396 1.00 23.62 ? 138  SER B O     1 
ATOM   5319  C  CB    . SER B  1  111 ? 37.133  16.341 43.589 1.00 24.90 ? 138  SER B CB    1 
ATOM   5320  O  OG    . SER B  1  111 ? 36.933  17.456 42.736 1.00 25.10 ? 138  SER B OG    1 
ATOM   5321  N  N     . TRP B  1  112 ? 35.618  17.326 46.148 1.00 23.75 ? 139  TRP B N     1 
ATOM   5322  C  CA    . TRP B  1  112 ? 35.112  18.466 46.891 1.00 23.18 ? 139  TRP B CA    1 
ATOM   5323  C  C     . TRP B  1  112 ? 35.484  19.778 46.204 1.00 22.92 ? 139  TRP B C     1 
ATOM   5324  O  O     . TRP B  1  112 ? 34.743  20.762 46.285 1.00 22.93 ? 139  TRP B O     1 
ATOM   5325  C  CB    . TRP B  1  112 ? 35.585  18.478 48.356 1.00 23.12 ? 139  TRP B CB    1 
ATOM   5326  C  CG    . TRP B  1  112 ? 34.741  19.434 49.130 1.00 22.41 ? 139  TRP B CG    1 
ATOM   5327  C  CD1   . TRP B  1  112 ? 35.025  20.742 49.434 1.00 21.21 ? 139  TRP B CD1   1 
ATOM   5328  C  CD2   . TRP B  1  112 ? 33.420  19.188 49.606 1.00 21.32 ? 139  TRP B CD2   1 
ATOM   5329  N  NE1   . TRP B  1  112 ? 33.963  21.311 50.105 1.00 20.62 ? 139  TRP B NE1   1 
ATOM   5330  C  CE2   . TRP B  1  112 ? 32.964  20.377 50.218 1.00 21.16 ? 139  TRP B CE2   1 
ATOM   5331  C  CE3   . TRP B  1  112 ? 32.574  18.071 49.580 1.00 22.49 ? 139  TRP B CE3   1 
ATOM   5332  C  CZ2   . TRP B  1  112 ? 31.699  20.475 50.816 1.00 21.78 ? 139  TRP B CZ2   1 
ATOM   5333  C  CZ3   . TRP B  1  112 ? 31.327  18.168 50.170 1.00 22.94 ? 139  TRP B CZ3   1 
ATOM   5334  C  CH2   . TRP B  1  112 ? 30.899  19.363 50.779 1.00 23.12 ? 139  TRP B CH2   1 
ATOM   5335  N  N     . GLU B  1  113 ? 36.634  19.796 45.536 1.00 23.19 ? 140  GLU B N     1 
ATOM   5336  C  CA    . GLU B  1  113 ? 37.050  20.980 44.798 1.00 22.85 ? 140  GLU B CA    1 
ATOM   5337  C  C     . GLU B  1  113 ? 36.041  21.281 43.700 1.00 22.56 ? 140  GLU B C     1 
ATOM   5338  O  O     . GLU B  1  113 ? 35.594  22.418 43.564 1.00 21.90 ? 140  GLU B O     1 
ATOM   5339  C  CB    . GLU B  1  113 ? 38.461  20.810 44.220 1.00 23.64 ? 140  GLU B CB    1 
ATOM   5340  C  CG    . GLU B  1  113 ? 38.938  22.005 43.378 1.00 24.25 ? 140  GLU B CG    1 
ATOM   5341  C  CD    . GLU B  1  113 ? 39.093  23.290 44.186 1.00 25.25 ? 140  GLU B CD    1 
ATOM   5342  O  OE1   . GLU B  1  113 ? 39.264  23.219 45.428 1.00 26.07 ? 140  GLU B OE1   1 
ATOM   5343  O  OE2   . GLU B  1  113 ? 39.059  24.373 43.570 1.00 25.12 ? 140  GLU B OE2   1 
ATOM   5344  N  N     . ALA B  1  114 ? 35.667  20.256 42.936 1.00 22.70 ? 141  ALA B N     1 
ATOM   5345  C  CA    . ALA B  1  114 ? 34.677  20.422 41.871 1.00 22.25 ? 141  ALA B CA    1 
ATOM   5346  C  C     . ALA B  1  114 ? 33.305  20.821 42.420 1.00 22.29 ? 141  ALA B C     1 
ATOM   5347  O  O     . ALA B  1  114 ? 32.648  21.701 41.864 1.00 22.16 ? 141  ALA B O     1 
ATOM   5348  C  CB    . ALA B  1  114 ? 34.580  19.165 41.031 1.00 22.85 ? 141  ALA B CB    1 
ATOM   5349  N  N     . PHE B  1  115 ? 32.873  20.192 43.514 1.00 22.21 ? 142  PHE B N     1 
ATOM   5350  C  CA    . PHE B  1  115 ? 31.592  20.561 44.104 1.00 21.60 ? 142  PHE B CA    1 
ATOM   5351  C  C     . PHE B  1  115 ? 31.572  22.001 44.639 1.00 21.23 ? 142  PHE B C     1 
ATOM   5352  O  O     . PHE B  1  115 ? 30.630  22.746 44.372 1.00 21.05 ? 142  PHE B O     1 
ATOM   5353  C  CB    . PHE B  1  115 ? 31.139  19.605 45.224 1.00 21.85 ? 142  PHE B CB    1 
ATOM   5354  C  CG    . PHE B  1  115 ? 30.038  20.187 46.066 1.00 21.26 ? 142  PHE B CG    1 
ATOM   5355  C  CD1   . PHE B  1  115 ? 28.734  20.250 45.575 1.00 21.80 ? 142  PHE B CD1   1 
ATOM   5356  C  CD2   . PHE B  1  115 ? 30.312  20.753 47.309 1.00 21.11 ? 142  PHE B CD2   1 
ATOM   5357  C  CE1   . PHE B  1  115 ? 27.710  20.840 46.331 1.00 21.21 ? 142  PHE B CE1   1 
ATOM   5358  C  CE2   . PHE B  1  115 ? 29.299  21.343 48.068 1.00 21.74 ? 142  PHE B CE2   1 
ATOM   5359  C  CZ    . PHE B  1  115 ? 27.994  21.379 47.576 1.00 21.82 ? 142  PHE B CZ    1 
ATOM   5360  N  N     . SER B  1  116 ? 32.594  22.377 45.404 1.00 21.01 ? 143  SER B N     1 
ATOM   5361  C  CA    . SER B  1  116 ? 32.552  23.629 46.177 1.00 21.25 ? 143  SER B CA    1 
ATOM   5362  C  C     . SER B  1  116 ? 33.037  24.885 45.452 1.00 21.54 ? 143  SER B C     1 
ATOM   5363  O  O     . SER B  1  116 ? 32.737  25.997 45.881 1.00 21.76 ? 143  SER B O     1 
ATOM   5364  C  CB    . SER B  1  116 ? 33.318  23.485 47.503 1.00 21.12 ? 143  SER B CB    1 
ATOM   5365  O  OG    . SER B  1  116 ? 34.711  23.374 47.279 1.00 20.69 ? 143  SER B OG    1 
ATOM   5366  N  N     . ASN B  1  117 ? 33.784  24.728 44.365 1.00 22.09 ? 144  ASN B N     1 
ATOM   5367  C  CA    . ASN B  1  117 ? 34.372  25.894 43.711 1.00 22.55 ? 144  ASN B CA    1 
ATOM   5368  C  C     . ASN B  1  117 ? 33.445  26.457 42.634 1.00 22.20 ? 144  ASN B C     1 
ATOM   5369  O  O     . ASN B  1  117 ? 33.381  25.946 41.516 1.00 22.09 ? 144  ASN B O     1 
ATOM   5370  C  CB    . ASN B  1  117 ? 35.769  25.562 43.155 1.00 22.74 ? 144  ASN B CB    1 
ATOM   5371  C  CG    . ASN B  1  117 ? 36.526  26.793 42.683 1.00 24.49 ? 144  ASN B CG    1 
ATOM   5372  O  OD1   . ASN B  1  117 ? 35.930  27.779 42.251 1.00 23.90 ? 144  ASN B OD1   1 
ATOM   5373  N  ND2   . ASN B  1  117 ? 37.855  26.732 42.762 1.00 27.56 ? 144  ASN B ND2   1 
ATOM   5374  N  N     . LEU B  1  118 ? 32.756  27.535 42.985 1.00 22.13 ? 145  LEU B N     1 
ATOM   5375  C  CA    . LEU B  1  118 ? 31.771  28.180 42.123 1.00 21.86 ? 145  LEU B CA    1 
ATOM   5376  C  C     . LEU B  1  118 ? 32.365  28.926 40.918 1.00 21.82 ? 145  LEU B C     1 
ATOM   5377  O  O     . LEU B  1  118 ? 31.628  29.324 40.008 1.00 21.90 ? 145  LEU B O     1 
ATOM   5378  C  CB    . LEU B  1  118 ? 30.913  29.143 42.953 1.00 22.14 ? 145  LEU B CB    1 
ATOM   5379  C  CG    . LEU B  1  118 ? 30.087  28.540 44.094 1.00 22.95 ? 145  LEU B CG    1 
ATOM   5380  C  CD1   . LEU B  1  118 ? 29.351  29.642 44.866 1.00 23.06 ? 145  LEU B CD1   1 
ATOM   5381  C  CD2   . LEU B  1  118 ? 29.101  27.503 43.550 1.00 20.96 ? 145  LEU B CD2   1 
ATOM   5382  N  N     . SER B  1  119 ? 33.679  29.122 40.900 1.00 21.52 ? 146  SER B N     1 
ATOM   5383  C  CA    . SER B  1  119 ? 34.323  29.780 39.752 1.00 21.55 ? 146  SER B CA    1 
ATOM   5384  C  C     . SER B  1  119 ? 34.333  28.910 38.499 1.00 21.18 ? 146  SER B C     1 
ATOM   5385  O  O     . SER B  1  119 ? 34.582  29.407 37.411 1.00 21.14 ? 146  SER B O     1 
ATOM   5386  C  CB    . SER B  1  119 ? 35.751  30.214 40.081 1.00 21.82 ? 146  SER B CB    1 
ATOM   5387  O  OG    . SER B  1  119 ? 35.749  31.224 41.068 1.00 22.44 ? 146  SER B OG    1 
ATOM   5388  N  N     . TYR B  1  120 ? 34.064  27.616 38.655 1.00 21.05 ? 147  TYR B N     1 
ATOM   5389  C  CA    . TYR B  1  120 ? 34.012  26.708 37.513 1.00 20.98 ? 147  TYR B CA    1 
ATOM   5390  C  C     . TYR B  1  120 ? 32.601  26.638 36.930 1.00 21.02 ? 147  TYR B C     1 
ATOM   5391  O  O     . TYR B  1  120 ? 31.610  26.638 37.666 1.00 20.56 ? 147  TYR B O     1 
ATOM   5392  C  CB    . TYR B  1  120 ? 34.386  25.290 37.939 1.00 21.10 ? 147  TYR B CB    1 
ATOM   5393  C  CG    . TYR B  1  120 ? 35.860  25.004 38.199 1.00 21.95 ? 147  TYR B CG    1 
ATOM   5394  C  CD1   . TYR B  1  120 ? 36.701  24.588 37.164 1.00 20.45 ? 147  TYR B CD1   1 
ATOM   5395  C  CD2   . TYR B  1  120 ? 36.388  25.079 39.490 1.00 22.01 ? 147  TYR B CD2   1 
ATOM   5396  C  CE1   . TYR B  1  120 ? 38.047  24.287 37.401 1.00 23.47 ? 147  TYR B CE1   1 
ATOM   5397  C  CE2   . TYR B  1  120 ? 37.730  24.779 39.743 1.00 22.78 ? 147  TYR B CE2   1 
ATOM   5398  C  CZ    . TYR B  1  120 ? 38.554  24.384 38.690 1.00 23.23 ? 147  TYR B CZ    1 
ATOM   5399  O  OH    . TYR B  1  120 ? 39.881  24.084 38.925 1.00 25.63 ? 147  TYR B OH    1 
ATOM   5400  N  N     . TYR B  1  121 ? 32.518  26.552 35.608 1.00 21.22 ? 148  TYR B N     1 
ATOM   5401  C  CA    . TYR B  1  121 ? 31.349  25.967 34.983 1.00 21.55 ? 148  TYR B CA    1 
ATOM   5402  C  C     . TYR B  1  121 ? 31.420  24.487 35.324 1.00 21.66 ? 148  TYR B C     1 
ATOM   5403  O  O     . TYR B  1  121 ? 32.502  23.908 35.352 1.00 21.38 ? 148  TYR B O     1 
ATOM   5404  C  CB    . TYR B  1  121 ? 31.411  26.107 33.458 1.00 21.73 ? 148  TYR B CB    1 
ATOM   5405  C  CG    . TYR B  1  121 ? 31.144  27.504 32.929 1.00 22.38 ? 148  TYR B CG    1 
ATOM   5406  C  CD1   . TYR B  1  121 ? 29.902  28.118 33.112 1.00 22.95 ? 148  TYR B CD1   1 
ATOM   5407  C  CD2   . TYR B  1  121 ? 32.123  28.193 32.221 1.00 22.35 ? 148  TYR B CD2   1 
ATOM   5408  C  CE1   . TYR B  1  121 ? 29.649  29.402 32.619 1.00 24.15 ? 148  TYR B CE1   1 
ATOM   5409  C  CE2   . TYR B  1  121 ? 31.885  29.475 31.717 1.00 24.07 ? 148  TYR B CE2   1 
ATOM   5410  C  CZ    . TYR B  1  121 ? 30.648  30.071 31.910 1.00 25.44 ? 148  TYR B CZ    1 
ATOM   5411  O  OH    . TYR B  1  121 ? 30.421  31.340 31.413 1.00 26.70 ? 148  TYR B OH    1 
ATOM   5412  N  N     . THR B  1  122 ? 30.275  23.867 35.562 1.00 21.24 ? 149  THR B N     1 
ATOM   5413  C  CA    . THR B  1  122 ? 30.258  22.436 35.765 1.00 21.23 ? 149  THR B CA    1 
ATOM   5414  C  C     . THR B  1  122 ? 30.234  21.726 34.395 1.00 21.25 ? 149  THR B C     1 
ATOM   5415  O  O     . THR B  1  122 ? 30.151  22.382 33.351 1.00 21.27 ? 149  THR B O     1 
ATOM   5416  C  CB    . THR B  1  122 ? 29.090  22.018 36.682 1.00 21.67 ? 149  THR B CB    1 
ATOM   5417  O  OG1   . THR B  1  122 ? 29.279  20.656 37.091 1.00 22.56 ? 149  THR B OG1   1 
ATOM   5418  C  CG2   . THR B  1  122 ? 27.731  22.172 35.970 1.00 20.90 ? 149  THR B CG2   1 
ATOM   5419  N  N     . ARG B  1  123 ? 30.332  20.403 34.399 1.00 21.30 ? 150  ARG B N     1 
ATOM   5420  C  CA    . ARG B  1  123 ? 30.377  19.621 33.156 1.00 21.57 ? 150  ARG B CA    1 
ATOM   5421  C  C     . ARG B  1  123 ? 29.404  18.453 33.198 1.00 22.66 ? 150  ARG B C     1 
ATOM   5422  O  O     . ARG B  1  123 ? 29.424  17.655 34.151 1.00 23.10 ? 150  ARG B O     1 
ATOM   5423  C  CB    . ARG B  1  123 ? 31.798  19.099 32.891 1.00 21.64 ? 150  ARG B CB    1 
ATOM   5424  C  CG    . ARG B  1  123 ? 32.732  20.143 32.308 1.00 21.15 ? 150  ARG B CG    1 
ATOM   5425  C  CD    . ARG B  1  123 ? 32.493  20.336 30.818 1.00 21.65 ? 150  ARG B CD    1 
ATOM   5426  N  NE    . ARG B  1  123 ? 33.188  19.301 30.045 1.00 23.17 ? 150  ARG B NE    1 
ATOM   5427  C  CZ    . ARG B  1  123 ? 34.458  19.380 29.644 1.00 23.16 ? 150  ARG B CZ    1 
ATOM   5428  N  NH1   . ARG B  1  123 ? 35.191  20.456 29.925 1.00 22.09 ? 150  ARG B NH1   1 
ATOM   5429  N  NH2   . ARG B  1  123 ? 34.994  18.384 28.943 1.00 22.11 ? 150  ARG B NH2   1 
ATOM   5430  N  N     . ALA B  1  124 ? 28.559  18.367 32.169 1.00 22.84 ? 151  ALA B N     1 
ATOM   5431  C  CA    . ALA B  1  124 ? 27.593  17.279 32.020 1.00 24.02 ? 151  ALA B CA    1 
ATOM   5432  C  C     . ALA B  1  124 ? 28.291  15.969 31.659 1.00 24.97 ? 151  ALA B C     1 
ATOM   5433  O  O     . ALA B  1  124 ? 27.789  14.891 31.963 1.00 25.34 ? 151  ALA B O     1 
ATOM   5434  C  CB    . ALA B  1  124 ? 26.540  17.633 30.960 1.00 24.21 ? 151  ALA B CB    1 
ATOM   5435  N  N     . LEU B  1  125 ? 29.433  16.076 30.980 1.00 25.14 ? 152  LEU B N     1 
ATOM   5436  C  CA    . LEU B  1  125 ? 30.321  14.933 30.764 1.00 25.92 ? 152  LEU B CA    1 
ATOM   5437  C  C     . LEU B  1  125 ? 31.737  15.315 31.166 1.00 25.90 ? 152  LEU B C     1 
ATOM   5438  O  O     . LEU B  1  125 ? 32.184  16.438 30.877 1.00 24.68 ? 152  LEU B O     1 
ATOM   5439  C  CB    . LEU B  1  125 ? 30.296  14.453 29.302 1.00 26.34 ? 152  LEU B CB    1 
ATOM   5440  C  CG    . LEU B  1  125 ? 29.102  13.620 28.800 1.00 27.50 ? 152  LEU B CG    1 
ATOM   5441  C  CD1   . LEU B  1  125 ? 29.261  13.275 27.317 1.00 27.94 ? 152  LEU B CD1   1 
ATOM   5442  C  CD2   . LEU B  1  125 ? 28.893  12.341 29.617 1.00 28.65 ? 152  LEU B CD2   1 
ATOM   5443  N  N     . PRO B  1  126 ? 32.458  14.382 31.822 1.00 26.56 ? 153  PRO B N     1 
ATOM   5444  C  CA    . PRO B  1  126 ? 33.818  14.705 32.242 1.00 26.82 ? 153  PRO B CA    1 
ATOM   5445  C  C     . PRO B  1  126 ? 34.714  14.953 31.026 1.00 27.31 ? 153  PRO B C     1 
ATOM   5446  O  O     . PRO B  1  126 ? 34.418  14.457 29.939 1.00 27.92 ? 153  PRO B O     1 
ATOM   5447  C  CB    . PRO B  1  126 ? 34.258  13.460 33.033 1.00 27.10 ? 153  PRO B CB    1 
ATOM   5448  C  CG    . PRO B  1  126 ? 33.406  12.365 32.554 1.00 28.56 ? 153  PRO B CG    1 
ATOM   5449  C  CD    . PRO B  1  126 ? 32.092  12.986 32.128 1.00 27.83 ? 153  PRO B CD    1 
ATOM   5450  N  N     . PRO B  1  127 ? 35.784  15.742 31.193 1.00 27.53 ? 154  PRO B N     1 
ATOM   5451  C  CA    . PRO B  1  127 ? 36.700  15.935 30.067 1.00 28.03 ? 154  PRO B CA    1 
ATOM   5452  C  C     . PRO B  1  127 ? 37.391  14.632 29.641 1.00 29.57 ? 154  PRO B C     1 
ATOM   5453  O  O     . PRO B  1  127 ? 37.516  13.695 30.442 1.00 30.10 ? 154  PRO B O     1 
ATOM   5454  C  CB    . PRO B  1  127 ? 37.725  16.933 30.610 1.00 27.44 ? 154  PRO B CB    1 
ATOM   5455  C  CG    . PRO B  1  127 ? 37.678  16.756 32.107 1.00 28.15 ? 154  PRO B CG    1 
ATOM   5456  C  CD    . PRO B  1  127 ? 36.255  16.411 32.425 1.00 27.02 ? 154  PRO B CD    1 
ATOM   5457  N  N     . VAL B  1  128 ? 37.810  14.575 28.380 1.00 30.26 ? 155  VAL B N     1 
ATOM   5458  C  CA    . VAL B  1  128 ? 38.650  13.487 27.889 1.00 31.93 ? 155  VAL B CA    1 
ATOM   5459  C  C     . VAL B  1  128 ? 39.991  13.608 28.626 1.00 32.90 ? 155  VAL B C     1 
ATOM   5460  O  O     . VAL B  1  128 ? 40.499  14.723 28.802 1.00 32.23 ? 155  VAL B O     1 
ATOM   5461  C  CB    . VAL B  1  128 ? 38.858  13.588 26.347 1.00 32.55 ? 155  VAL B CB    1 
ATOM   5462  C  CG1   . VAL B  1  128 ? 39.762  12.461 25.825 1.00 33.27 ? 155  VAL B CG1   1 
ATOM   5463  C  CG2   . VAL B  1  128 ? 37.526  13.574 25.616 1.00 31.32 ? 155  VAL B CG2   1 
ATOM   5464  N  N     . ALA B  1  129 ? 40.549  12.482 29.075 1.00 34.41 ? 156  ALA B N     1 
ATOM   5465  C  CA    . ALA B  1  129 ? 41.786  12.500 29.862 1.00 35.31 ? 156  ALA B CA    1 
ATOM   5466  C  C     . ALA B  1  129 ? 42.968  13.013 29.036 1.00 36.52 ? 156  ALA B C     1 
ATOM   5467  O  O     . ALA B  1  129 ? 43.003  12.828 27.816 1.00 36.90 ? 156  ALA B O     1 
ATOM   5468  C  CB    . ALA B  1  129 ? 42.080  11.123 30.433 1.00 36.46 ? 156  ALA B CB    1 
ATOM   5469  N  N     . ASP B  1  130 ? 43.926  13.649 29.710 1.00 37.16 ? 157  ASP B N     1 
ATOM   5470  C  CA    . ASP B  1  130 ? 45.054  14.327 29.051 1.00 38.84 ? 157  ASP B CA    1 
ATOM   5471  C  C     . ASP B  1  130 ? 45.974  13.389 28.255 1.00 40.47 ? 157  ASP B C     1 
ATOM   5472  O  O     . ASP B  1  130 ? 46.620  13.820 27.308 1.00 41.09 ? 157  ASP B O     1 
ATOM   5473  C  CB    . ASP B  1  130 ? 45.900  15.120 30.068 1.00 39.11 ? 157  ASP B CB    1 
ATOM   5474  C  CG    . ASP B  1  130 ? 45.119  16.253 30.762 1.00 39.82 ? 157  ASP B CG    1 
ATOM   5475  O  OD1   . ASP B  1  130 ? 44.097  16.748 30.227 1.00 40.28 ? 157  ASP B OD1   1 
ATOM   5476  O  OD2   . ASP B  1  130 ? 45.551  16.662 31.863 1.00 42.63 ? 157  ASP B OD2   1 
ATOM   5477  N  N     . ASP B  1  131 ? 46.040  12.117 28.637 1.00 41.43 ? 158  ASP B N     1 
ATOM   5478  C  CA    . ASP B  1  131 ? 46.943  11.186 27.953 1.00 43.22 ? 158  ASP B CA    1 
ATOM   5479  C  C     . ASP B  1  131 ? 46.265  10.275 26.929 1.00 43.81 ? 158  ASP B C     1 
ATOM   5480  O  O     . ASP B  1  131 ? 46.866  9.295  26.486 1.00 45.44 ? 158  ASP B O     1 
ATOM   5481  C  CB    . ASP B  1  131 ? 47.742  10.356 28.967 1.00 44.25 ? 158  ASP B CB    1 
ATOM   5482  C  CG    . ASP B  1  131 ? 46.872  9.402  29.776 1.00 44.69 ? 158  ASP B CG    1 
ATOM   5483  O  OD1   . ASP B  1  131 ? 45.635  9.375  29.590 1.00 43.57 ? 158  ASP B OD1   1 
ATOM   5484  O  OD2   . ASP B  1  131 ? 47.439  8.662  30.604 1.00 46.72 ? 158  ASP B OD2   1 
ATOM   5485  N  N     . CYS B  1  132 ? 45.027  10.587 26.548 1.00 42.37 ? 159  CYS B N     1 
ATOM   5486  C  CA    . CYS B  1  132 ? 44.324  9.754  25.569 1.00 43.13 ? 159  CYS B CA    1 
ATOM   5487  C  C     . CYS B  1  132 ? 44.999  9.831  24.192 1.00 44.26 ? 159  CYS B C     1 
ATOM   5488  O  O     . CYS B  1  132 ? 45.475  10.897 23.806 1.00 43.95 ? 159  CYS B O     1 
ATOM   5489  C  CB    . CYS B  1  132 ? 42.837  10.112 25.493 1.00 41.53 ? 159  CYS B CB    1 
ATOM   5490  S  SG    . CYS B  1  132 ? 41.895  9.709  26.994 1.00 40.80 ? 159  CYS B SG    1 
ATOM   5491  N  N     . PRO B  1  133 ? 45.068  8.696  23.463 1.00 45.95 ? 160  PRO B N     1 
ATOM   5492  C  CA    . PRO B  1  133 ? 45.773  8.651  22.173 1.00 47.36 ? 160  PRO B CA    1 
ATOM   5493  C  C     . PRO B  1  133 ? 45.197  9.569  21.084 1.00 46.81 ? 160  PRO B C     1 
ATOM   5494  O  O     . PRO B  1  133 ? 45.947  10.035 20.219 1.00 47.75 ? 160  PRO B O     1 
ATOM   5495  C  CB    . PRO B  1  133 ? 45.663  7.179  21.749 1.00 49.13 ? 160  PRO B CB    1 
ATOM   5496  C  CG    . PRO B  1  133 ? 44.589  6.595  22.595 1.00 48.56 ? 160  PRO B CG    1 
ATOM   5497  C  CD    . PRO B  1  133 ? 44.589  7.364  23.873 1.00 46.79 ? 160  PRO B CD    1 
ATOM   5498  N  N     . THR B  1  134 ? 43.885  9.802  21.110 1.00 45.37 ? 161  THR B N     1 
ATOM   5499  C  CA    . THR B  1  134 ? 43.246  10.741 20.186 1.00 44.53 ? 161  THR B CA    1 
ATOM   5500  C  C     . THR B  1  134 ? 42.466  11.798 20.978 1.00 42.78 ? 161  THR B C     1 
ATOM   5501  O  O     . THR B  1  134 ? 42.147  11.572 22.151 1.00 42.36 ? 161  THR B O     1 
ATOM   5502  C  CB    . THR B  1  134 ? 42.307  10.037 19.172 1.00 45.08 ? 161  THR B CB    1 
ATOM   5503  O  OG1   . THR B  1  134 ? 41.184  9.471  19.855 1.00 43.89 ? 161  THR B OG1   1 
ATOM   5504  C  CG2   . THR B  1  134 ? 43.047  8.950  18.383 1.00 47.05 ? 161  THR B CG2   1 
ATOM   5505  N  N     . PRO B  1  135 ? 42.171  12.955 20.349 1.00 41.84 ? 162  PRO B N     1 
ATOM   5506  C  CA    . PRO B  1  135 ? 41.434  14.027 21.021 1.00 40.06 ? 162  PRO B CA    1 
ATOM   5507  C  C     . PRO B  1  135 ? 40.093  13.587 21.621 1.00 39.28 ? 162  PRO B C     1 
ATOM   5508  O  O     . PRO B  1  135 ? 39.737  14.041 22.708 1.00 38.05 ? 162  PRO B O     1 
ATOM   5509  C  CB    . PRO B  1  135 ? 41.216  15.055 19.903 1.00 39.72 ? 162  PRO B CB    1 
ATOM   5510  C  CG    . PRO B  1  135 ? 42.363  14.855 18.995 1.00 41.39 ? 162  PRO B CG    1 
ATOM   5511  C  CD    . PRO B  1  135 ? 42.621  13.370 19.003 1.00 42.58 ? 162  PRO B CD    1 
ATOM   5512  N  N     . MET B  1  136 ? 39.368  12.723 20.951 1.00 40.13 ? 163  MET B N     1 
ATOM   5513  C  CA    . MET B  1  136 ? 38.111  12.216 21.458 1.00 39.71 ? 163  MET B CA    1 
ATOM   5514  C  C     . MET B  1  136 ? 38.196  10.963 22.304 1.00 40.22 ? 163  MET B C     1 
ATOM   5515  O  O     . MET B  1  136 ? 37.218  10.469 22.751 1.00 40.01 ? 163  MET B O     1 
ATOM   5516  C  CB    . MET B  1  136 ? 37.127  11.983 20.334 1.00 40.25 ? 163  MET B CB    1 
ATOM   5517  C  CG    . MET B  1  136 ? 36.660  13.235 19.656 1.00 40.25 ? 163  MET B CG    1 
ATOM   5518  S  SD    . MET B  1  136 ? 35.971  14.422 20.767 1.00 41.37 ? 163  MET B SD    1 
ATOM   5519  C  CE    . MET B  1  136 ? 35.183  15.509 19.665 1.00 40.15 ? 163  MET B CE    1 
ATOM   5520  N  N     . GLY B  1  137 ? 39.380  10.436 22.481 1.00 40.97 ? 164  GLY B N     1 
ATOM   5521  C  CA    . GLY B  1  137 ? 39.582  9.249  23.271 1.00 41.79 ? 164  GLY B CA    1 
ATOM   5522  C  C     . GLY B  1  137 ? 40.495  8.251  22.606 1.00 43.72 ? 164  GLY B C     1 
ATOM   5523  O  O     . GLY B  1  137 ? 41.667  8.324  22.735 1.00 44.21 ? 164  GLY B O     1 
ATOM   5524  N  N     . VAL B  1  138 ? 39.910  7.331  21.876 1.00 44.89 ? 165  VAL B N     1 
ATOM   5525  C  CA    . VAL B  1  138 ? 40.682  6.354  21.138 1.00 47.02 ? 165  VAL B CA    1 
ATOM   5526  C  C     . VAL B  1  138 ? 40.338  6.364  19.660 1.00 48.03 ? 165  VAL B C     1 
ATOM   5527  O  O     . VAL B  1  138 ? 41.148  5.993  18.855 1.00 49.17 ? 165  VAL B O     1 
ATOM   5528  C  CB    . VAL B  1  138 ? 40.540  4.928  21.706 1.00 48.43 ? 165  VAL B CB    1 
ATOM   5529  C  CG1   . VAL B  1  138 ? 41.040  4.850  23.128 1.00 47.83 ? 165  VAL B CG1   1 
ATOM   5530  C  CG2   . VAL B  1  138 ? 39.168  4.433  21.575 1.00 47.89 ? 165  VAL B CG2   1 
ATOM   5531  N  N     . LYS B  1  139 ? 39.147  6.839  19.329 1.00 47.52 ? 166  LYS B N     1 
ATOM   5532  C  CA    . LYS B  1  139 ? 38.667  6.868  17.949 1.00 48.84 ? 166  LYS B CA    1 
ATOM   5533  C  C     . LYS B  1  139 ? 39.194  8.063  17.161 1.00 48.29 ? 166  LYS B C     1 
ATOM   5534  O  O     . LYS B  1  139 ? 39.622  9.062  17.741 1.00 46.94 ? 166  LYS B O     1 
ATOM   5535  C  CB    . LYS B  1  139 ? 37.139  6.833  17.916 1.00 48.55 ? 166  LYS B CB    1 
ATOM   5536  C  CG    . LYS B  1  139 ? 36.556  5.446  18.105 1.00 50.86 ? 166  LYS B CG    1 
ATOM   5537  C  CD    . LYS B  1  139 ? 35.052  5.511  18.283 1.00 52.10 ? 166  LYS B CD    1 
ATOM   5538  C  CE    . LYS B  1  139 ? 34.428  4.129  18.143 1.00 55.23 ? 166  LYS B CE    1 
ATOM   5539  N  NZ    . LYS B  1  139 ? 32.986  4.163  18.518 1.00 56.09 ? 166  LYS B NZ    1 
ATOM   5540  N  N     . GLY B  1  140 ? 39.162  7.949  15.835 1.00 49.65 ? 167  GLY B N     1 
ATOM   5541  C  CA    . GLY B  1  140 ? 39.550  9.044  14.952 1.00 49.47 ? 167  GLY B CA    1 
ATOM   5542  C  C     . GLY B  1  140 ? 41.046  9.203  14.771 1.00 50.64 ? 167  GLY B C     1 
ATOM   5543  O  O     . GLY B  1  140 ? 41.834  8.358  15.205 1.00 51.92 ? 167  GLY B O     1 
ATOM   5544  N  N     . ASN B  1  141 ? 41.434  10.294 14.117 1.00 50.57 ? 168  ASN B N     1 
ATOM   5545  C  CA    . ASN B  1  141 ? 42.838  10.564 13.818 1.00 51.71 ? 168  ASN B CA    1 
ATOM   5546  C  C     . ASN B  1  141 ? 43.570  11.190 15.003 1.00 50.63 ? 168  ASN B C     1 
ATOM   5547  O  O     . ASN B  1  141 ? 42.939  11.612 15.976 1.00 49.17 ? 168  ASN B O     1 
ATOM   5548  C  CB    . ASN B  1  141 ? 42.955  11.455 12.574 1.00 51.90 ? 168  ASN B CB    1 
ATOM   5549  C  CG    . ASN B  1  141 ? 42.451  10.772 11.311 1.00 53.78 ? 168  ASN B CG    1 
ATOM   5550  O  OD1   . ASN B  1  141 ? 41.603  11.311 10.599 1.00 54.13 ? 168  ASN B OD1   1 
ATOM   5551  N  ND2   . ASN B  1  141 ? 42.973  9.583  11.024 1.00 56.38 ? 168  ASN B ND2   1 
ATOM   5552  N  N     . LYS B  1  142 ? 44.899  11.243 14.908 1.00 51.66 ? 169  LYS B N     1 
ATOM   5553  C  CA    . LYS B  1  142 ? 45.760  11.849 15.934 1.00 50.98 ? 169  LYS B CA    1 
ATOM   5554  C  C     . LYS B  1  142 ? 45.377  13.306 16.205 1.00 48.75 ? 169  LYS B C     1 
ATOM   5555  O  O     . LYS B  1  142 ? 45.467  13.776 17.337 1.00 47.84 ? 169  LYS B O     1 
ATOM   5556  C  CB    . LYS B  1  142 ? 47.239  11.741 15.518 1.00 53.03 ? 169  LYS B CB    1 
ATOM   5557  C  CG    . LYS B  1  142 ? 48.262  11.845 16.665 1.00 54.07 ? 169  LYS B CG    1 
ATOM   5558  C  CD    . LYS B  1  142 ? 48.632  13.299 16.997 1.00 53.56 ? 169  LYS B CD    1 
ATOM   5559  N  N     . GLU B  1  143 ? 44.950  14.014 15.163 1.00 47.98 ? 170  GLU B N     1 
ATOM   5560  C  CA    . GLU B  1  143 ? 44.476  15.380 15.311 1.00 45.77 ? 170  GLU B CA    1 
ATOM   5561  C  C     . GLU B  1  143 ? 43.090  15.554 14.707 1.00 44.42 ? 170  GLU B C     1 
ATOM   5562  O  O     . GLU B  1  143 ? 42.760  14.932 13.694 1.00 45.24 ? 170  GLU B O     1 
ATOM   5563  C  CB    . GLU B  1  143 ? 45.458  16.366 14.672 1.00 46.47 ? 170  GLU B CB    1 
ATOM   5564  C  CG    . GLU B  1  143 ? 46.722  16.600 15.493 1.00 47.49 ? 170  GLU B CG    1 
ATOM   5565  N  N     . LEU B  1  144 ? 42.283  16.399 15.346 1.00 41.86 ? 171  LEU B N     1 
ATOM   5566  C  CA    . LEU B  1  144 ? 41.009  16.823 14.783 1.00 40.36 ? 171  LEU B CA    1 
ATOM   5567  C  C     . LEU B  1  144 ? 41.276  17.739 13.590 1.00 40.24 ? 171  LEU B C     1 
ATOM   5568  O  O     . LEU B  1  144 ? 42.349  18.341 13.514 1.00 40.41 ? 171  LEU B O     1 
ATOM   5569  C  CB    . LEU B  1  144 ? 40.165  17.547 15.837 1.00 38.54 ? 171  LEU B CB    1 
ATOM   5570  C  CG    . LEU B  1  144 ? 39.441  16.666 16.861 1.00 38.07 ? 171  LEU B CG    1 
ATOM   5571  C  CD1   . LEU B  1  144 ? 38.876  17.516 17.975 1.00 35.68 ? 171  LEU B CD1   1 
ATOM   5572  C  CD2   . LEU B  1  144 ? 38.335  15.812 16.220 1.00 38.49 ? 171  LEU B CD2   1 
ATOM   5573  N  N     . PRO B  1  145 ? 40.312  17.839 12.649 1.00 39.80 ? 172  PRO B N     1 
ATOM   5574  C  CA    . PRO B  1  145 ? 40.511  18.716 11.486 1.00 39.96 ? 172  PRO B CA    1 
ATOM   5575  C  C     . PRO B  1  145 ? 40.743  20.162 11.908 1.00 38.61 ? 172  PRO B C     1 
ATOM   5576  O  O     . PRO B  1  145 ? 40.196  20.601 12.929 1.00 36.94 ? 172  PRO B O     1 
ATOM   5577  C  CB    . PRO B  1  145 ? 39.181  18.607 10.722 1.00 39.74 ? 172  PRO B CB    1 
ATOM   5578  C  CG    . PRO B  1  145 ? 38.200  18.076 11.719 1.00 38.93 ? 172  PRO B CG    1 
ATOM   5579  C  CD    . PRO B  1  145 ? 39.006  17.163 12.596 1.00 39.35 ? 172  PRO B CD    1 
ATOM   5580  N  N     . ASP B  1  146 ? 41.574  20.874 11.147 1.00 38.98 ? 173  ASP B N     1 
ATOM   5581  C  CA    . ASP B  1  146 ? 41.767  22.310 11.326 1.00 38.45 ? 173  ASP B CA    1 
ATOM   5582  C  C     . ASP B  1  146 ? 40.400  22.974 11.514 1.00 36.79 ? 173  ASP B C     1 
ATOM   5583  O  O     . ASP B  1  146 ? 39.503  22.810 10.688 1.00 36.54 ? 173  ASP B O     1 
ATOM   5584  C  CB    . ASP B  1  146 ? 42.492  22.900 10.105 1.00 40.04 ? 173  ASP B CB    1 
ATOM   5585  C  CG    . ASP B  1  146 ? 42.847  24.382 10.268 1.00 40.73 ? 173  ASP B CG    1 
ATOM   5586  O  OD1   . ASP B  1  146 ? 42.369  25.052 11.213 1.00 40.48 ? 173  ASP B OD1   1 
ATOM   5587  O  OD2   . ASP B  1  146 ? 43.620  24.882 9.427  1.00 44.63 ? 173  ASP B OD2   1 
ATOM   5588  N  N     . SER B  1  147 ? 40.242  23.700 12.615 1.00 35.66 ? 174  SER B N     1 
ATOM   5589  C  CA    . SER B  1  147 ? 38.969  24.354 12.927 1.00 34.54 ? 174  SER B CA    1 
ATOM   5590  C  C     . SER B  1  147 ? 38.584  25.419 11.899 1.00 34.71 ? 174  SER B C     1 
ATOM   5591  O  O     . SER B  1  147 ? 37.400  25.658 11.678 1.00 34.00 ? 174  SER B O     1 
ATOM   5592  C  CB    . SER B  1  147 ? 38.970  24.935 14.349 1.00 33.54 ? 174  SER B CB    1 
ATOM   5593  O  OG    . SER B  1  147 ? 39.944  25.950 14.507 1.00 33.04 ? 174  SER B OG    1 
ATOM   5594  N  N     . LYS B  1  148 ? 39.583  26.047 11.275 1.00 35.68 ? 175  LYS B N     1 
ATOM   5595  C  CA    . LYS B  1  148 ? 39.344  27.001 10.183 1.00 36.37 ? 175  LYS B CA    1 
ATOM   5596  C  C     . LYS B  1  148 ? 38.669  26.319 8.984  1.00 37.04 ? 175  LYS B C     1 
ATOM   5597  O  O     . LYS B  1  148 ? 37.771  26.893 8.364  1.00 36.80 ? 175  LYS B O     1 
ATOM   5598  C  CB    . LYS B  1  148 ? 40.645  27.707 9.761  1.00 37.36 ? 175  LYS B CB    1 
ATOM   5599  C  CG    . LYS B  1  148 ? 40.570  28.448 8.408  1.00 38.62 ? 175  LYS B CG    1 
ATOM   5600  C  CD    . LYS B  1  148 ? 41.778  29.343 8.187  1.00 40.34 ? 175  LYS B CD    1 
ATOM   5601  C  CE    . LYS B  1  148 ? 42.215  29.355 6.728  1.00 43.60 ? 175  LYS B CE    1 
ATOM   5602  N  NZ    . LYS B  1  148 ? 41.407  30.268 5.866  1.00 43.71 ? 175  LYS B NZ    1 
ATOM   5603  N  N     . GLU B  1  149 ? 39.102  25.096 8.675  1.00 37.84 ? 176  GLU B N     1 
ATOM   5604  C  CA    . GLU B  1  149 ? 38.503  24.303 7.601  1.00 38.89 ? 176  GLU B CA    1 
ATOM   5605  C  C     . GLU B  1  149 ? 37.053  23.913 7.901  1.00 37.73 ? 176  GLU B C     1 
ATOM   5606  O  O     . GLU B  1  149 ? 36.194  24.010 7.024  1.00 37.88 ? 176  GLU B O     1 
ATOM   5607  C  CB    . GLU B  1  149 ? 39.344  23.052 7.292  1.00 40.34 ? 176  GLU B CB    1 
ATOM   5608  C  CG    . GLU B  1  149 ? 40.665  23.327 6.554  1.00 43.63 ? 176  GLU B CG    1 
ATOM   5609  C  CD    . GLU B  1  149 ? 40.475  23.985 5.187  1.00 47.85 ? 176  GLU B CD    1 
ATOM   5610  O  OE1   . GLU B  1  149 ? 39.381  23.859 4.591  1.00 49.16 ? 176  GLU B OE1   1 
ATOM   5611  O  OE2   . GLU B  1  149 ? 41.431  24.629 4.699  1.00 50.90 ? 176  GLU B OE2   1 
ATOM   5612  N  N     . VAL B  1  150 ? 36.793  23.468 9.130  1.00 36.69 ? 177  VAL B N     1 
ATOM   5613  C  CA    . VAL B  1  150 ? 35.434  23.125 9.564  1.00 35.86 ? 177  VAL B CA    1 
ATOM   5614  C  C     . VAL B  1  150 ? 34.528  24.350 9.430  1.00 35.14 ? 177  VAL B C     1 
ATOM   5615  O  O     . VAL B  1  150 ? 33.452  24.274 8.837  1.00 35.14 ? 177  VAL B O     1 
ATOM   5616  C  CB    . VAL B  1  150 ? 35.397  22.600 11.025 1.00 35.13 ? 177  VAL B CB    1 
ATOM   5617  C  CG1   . VAL B  1  150 ? 33.954  22.356 11.482 1.00 33.99 ? 177  VAL B CG1   1 
ATOM   5618  C  CG2   . VAL B  1  150 ? 36.235  21.320 11.163 1.00 35.79 ? 177  VAL B CG2   1 
ATOM   5619  N  N     . LEU B  1  151 ? 34.997  25.473 9.969  1.00 34.21 ? 178  LEU B N     1 
ATOM   5620  C  CA    . LEU B  1  151 ? 34.292  26.750 9.911  1.00 33.56 ? 178  LEU B CA    1 
ATOM   5621  C  C     . LEU B  1  151 ? 33.947  27.180 8.479  1.00 34.11 ? 178  LEU B C     1 
ATOM   5622  O  O     . LEU B  1  151 ? 32.802  27.525 8.184  1.00 33.88 ? 178  LEU B O     1 
ATOM   5623  C  CB    . LEU B  1  151 ? 35.153  27.825 10.579 1.00 33.14 ? 178  LEU B CB    1 
ATOM   5624  C  CG    . LEU B  1  151 ? 34.800  29.299 10.394 1.00 33.56 ? 178  LEU B CG    1 
ATOM   5625  C  CD1   . LEU B  1  151 ? 33.799  29.705 11.448 1.00 33.23 ? 178  LEU B CD1   1 
ATOM   5626  C  CD2   . LEU B  1  151 ? 36.056  30.155 10.481 1.00 33.95 ? 178  LEU B CD2   1 
ATOM   5627  N  N     . GLU B  1  152 ? 34.945  27.167 7.603  1.00 34.68 ? 179  GLU B N     1 
ATOM   5628  C  CA    . GLU B  1  152 ? 34.777  27.674 6.244  1.00 35.45 ? 179  GLU B CA    1 
ATOM   5629  C  C     . GLU B  1  152 ? 33.896  26.772 5.390  1.00 35.92 ? 179  GLU B C     1 
ATOM   5630  O  O     . GLU B  1  152 ? 33.057  27.255 4.625  1.00 36.36 ? 179  GLU B O     1 
ATOM   5631  C  CB    . GLU B  1  152 ? 36.138  27.904 5.583  1.00 36.45 ? 179  GLU B CB    1 
ATOM   5632  C  CG    . GLU B  1  152 ? 36.941  29.041 6.225  1.00 36.75 ? 179  GLU B CG    1 
ATOM   5633  C  CD    . GLU B  1  152 ? 38.244  29.351 5.503  1.00 39.30 ? 179  GLU B CD    1 
ATOM   5634  O  OE1   . GLU B  1  152 ? 38.722  28.507 4.714  1.00 40.96 ? 179  GLU B OE1   1 
ATOM   5635  O  OE2   . GLU B  1  152 ? 38.793  30.452 5.728  1.00 39.49 ? 179  GLU B OE2   1 
ATOM   5636  N  N     . LYS B  1  153 ? 34.068  25.463 5.543  1.00 36.21 ? 180  LYS B N     1 
ATOM   5637  C  CA    . LYS B  1  153 ? 33.335  24.503 4.724  1.00 37.01 ? 180  LYS B CA    1 
ATOM   5638  C  C     . LYS B  1  153 ? 31.850  24.398 5.071  1.00 36.43 ? 180  LYS B C     1 
ATOM   5639  O  O     . LYS B  1  153 ? 31.015  24.385 4.169  1.00 37.09 ? 180  LYS B O     1 
ATOM   5640  C  CB    . LYS B  1  153 ? 34.009  23.128 4.754  1.00 37.99 ? 180  LYS B CB    1 
ATOM   5641  C  CG    . LYS B  1  153 ? 35.291  23.077 3.937  1.00 39.38 ? 180  LYS B CG    1 
ATOM   5642  C  CD    . LYS B  1  153 ? 35.987  21.736 4.081  1.00 42.46 ? 180  LYS B CD    1 
ATOM   5643  C  CE    . LYS B  1  153 ? 37.257  21.673 3.228  1.00 44.09 ? 180  LYS B CE    1 
ATOM   5644  N  NZ    . LYS B  1  153 ? 37.057  22.253 1.865  1.00 46.06 ? 180  LYS B NZ    1 
ATOM   5645  N  N     . VAL B  1  154 ? 31.517  24.341 6.361  1.00 34.87 ? 181  VAL B N     1 
ATOM   5646  C  CA    . VAL B  1  154 ? 30.141  24.020 6.759  1.00 34.29 ? 181  VAL B CA    1 
ATOM   5647  C  C     . VAL B  1  154 ? 29.426  25.030 7.666  1.00 33.04 ? 181  VAL B C     1 
ATOM   5648  O  O     . VAL B  1  154 ? 28.220  24.907 7.874  1.00 33.38 ? 181  VAL B O     1 
ATOM   5649  C  CB    . VAL B  1  154 ? 30.027  22.597 7.390  1.00 34.41 ? 181  VAL B CB    1 
ATOM   5650  C  CG1   . VAL B  1  154 ? 30.320  21.516 6.361  1.00 35.72 ? 181  VAL B CG1   1 
ATOM   5651  C  CG2   . VAL B  1  154 ? 30.932  22.448 8.616  1.00 33.66 ? 181  VAL B CG2   1 
ATOM   5652  N  N     . LEU B  1  155 ? 30.147  26.016 8.201  1.00 31.99 ? 182  LEU B N     1 
ATOM   5653  C  CA    . LEU B  1  155 ? 29.536  26.976 9.136  1.00 30.77 ? 182  LEU B CA    1 
ATOM   5654  C  C     . LEU B  1  155 ? 29.255  28.365 8.578  1.00 30.47 ? 182  LEU B C     1 
ATOM   5655  O  O     . LEU B  1  155 ? 28.205  28.945 8.860  1.00 29.80 ? 182  LEU B O     1 
ATOM   5656  C  CB    . LEU B  1  155 ? 30.356  27.099 10.421 1.00 29.99 ? 182  LEU B CB    1 
ATOM   5657  C  CG    . LEU B  1  155 ? 30.526  25.840 11.267 1.00 29.92 ? 182  LEU B CG    1 
ATOM   5658  C  CD1   . LEU B  1  155 ? 31.223  26.212 12.559 1.00 29.04 ? 182  LEU B CD1   1 
ATOM   5659  C  CD2   . LEU B  1  155 ? 29.184  25.170 11.551 1.00 28.94 ? 182  LEU B CD2   1 
ATOM   5660  N  N     . LEU B  1  156 ? 30.182  28.897 7.786  1.00 30.59 ? 183  LEU B N     1 
ATOM   5661  C  CA    . LEU B  1  156 ? 30.087  30.282 7.341  1.00 30.40 ? 183  LEU B CA    1 
ATOM   5662  C  C     . LEU B  1  156 ? 28.933  30.538 6.365  1.00 30.96 ? 183  LEU B C     1 
ATOM   5663  O  O     . LEU B  1  156 ? 28.705  29.763 5.436  1.00 31.71 ? 183  LEU B O     1 
ATOM   5664  C  CB    . LEU B  1  156 ? 31.419  30.765 6.761  1.00 30.94 ? 183  LEU B CB    1 
ATOM   5665  C  CG    . LEU B  1  156 ? 32.574  31.003 7.741  1.00 30.86 ? 183  LEU B CG    1 
ATOM   5666  C  CD1   . LEU B  1  156 ? 33.782  31.617 7.011  1.00 31.81 ? 183  LEU B CD1   1 
ATOM   5667  C  CD2   . LEU B  1  156 ? 32.152  31.871 8.925  1.00 28.58 ? 183  LEU B CD2   1 
ATOM   5668  N  N     . ARG B  1  157 ? 28.181  31.591 6.598  1.00 30.58 ? 184  ARG B N     1 
ATOM   5669  C  CA    . ARG B  1  157 ? 27.039  31.987 5.783  1.00 31.40 ? 184  ARG B CA    1 
ATOM   5670  C  C     . ARG B  1  157 ? 27.368  32.316 4.322  1.00 32.58 ? 184  ARG B C     1 
ATOM   5671  O  O     . ARG B  1  157 ? 28.302  33.018 4.081  1.00 33.05 ? 184  ARG B O     1 
ATOM   5672  C  CB    . ARG B  1  157 ? 26.398  33.199 6.430  1.00 30.51 ? 184  ARG B CB    1 
ATOM   5673  C  CG    . ARG B  1  157 ? 25.262  33.822 5.699  1.00 31.42 ? 184  ARG B CG    1 
ATOM   5674  C  CD    . ARG B  1  157 ? 24.678  34.958 6.515  1.00 29.68 ? 184  ARG B CD    1 
ATOM   5675  N  NE    . ARG B  1  157 ? 23.953  34.458 7.659  1.00 28.31 ? 184  ARG B NE    1 
ATOM   5676  C  CZ    . ARG B  1  157 ? 23.629  35.142 8.739  1.00 28.36 ? 184  ARG B CZ    1 
ATOM   5677  N  NH1   . ARG B  1  157 ? 23.956  36.389 8.877  1.00 27.92 ? 184  ARG B NH1   1 
ATOM   5678  N  NH2   . ARG B  1  157 ? 22.953  34.547 9.673  1.00 26.91 ? 184  ARG B NH2   1 
ATOM   5679  N  N     . ARG B  1  158 ? 26.587  31.829 3.360  1.00 34.43 ? 185  ARG B N     1 
ATOM   5680  C  CA    . ARG B  1  158 ? 26.799  32.351 2.012  1.00 35.65 ? 185  ARG B CA    1 
ATOM   5681  C  C     . ARG B  1  158 ? 25.687  33.377 1.772  1.00 35.85 ? 185  ARG B C     1 
ATOM   5682  O  O     . ARG B  1  158 ? 25.846  34.545 2.122  1.00 36.03 ? 185  ARG B O     1 
ATOM   5683  C  CB    . ARG B  1  158 ? 26.794  31.222 0.968  1.00 36.49 ? 185  ARG B CB    1 
ATOM   5684  C  CG    . ARG B  1  158 ? 28.103  30.415 0.852  1.00 37.01 ? 185  ARG B CG    1 
ATOM   5685  C  CD    . ARG B  1  158 ? 28.344  29.460 2.034  1.00 35.42 ? 185  ARG B CD    1 
ATOM   5686  N  NE    . ARG B  1  158 ? 29.457  28.545 1.765  1.00 36.30 ? 185  ARG B NE    1 
ATOM   5687  C  CZ    . ARG B  1  158 ? 30.097  27.809 2.677  1.00 34.67 ? 185  ARG B CZ    1 
ATOM   5688  N  NH1   . ARG B  1  158 ? 29.773  27.869 3.963  1.00 32.08 ? 185  ARG B NH1   1 
ATOM   5689  N  NH2   . ARG B  1  158 ? 31.095  27.022 2.296  1.00 35.70 ? 185  ARG B NH2   1 
ATOM   5690  N  N     . GLU B  1  159 ? 24.532  32.887 1.365  1.00 36.14 ? 186  GLU B N     1 
ATOM   5691  C  CA    . GLU B  1  159 ? 23.251  33.562 1.472  1.00 35.98 ? 186  GLU B CA    1 
ATOM   5692  C  C     . GLU B  1  159 ? 22.664  33.475 2.870  1.00 34.47 ? 186  GLU B C     1 
ATOM   5693  O  O     . GLU B  1  159 ? 22.673  32.446 3.457  1.00 34.08 ? 186  GLU B O     1 
ATOM   5694  C  CB    . GLU B  1  159 ? 22.213  32.900 0.594  1.00 36.76 ? 186  GLU B CB    1 
ATOM   5695  C  CG    . GLU B  1  159 ? 22.261  33.241 -0.835 1.00 39.48 ? 186  GLU B CG    1 
ATOM   5696  N  N     . PHE B  1  160 ? 22.069  34.550 3.334  1.00 33.66 ? 187  PHE B N     1 
ATOM   5697  C  CA    . PHE B  1  160 ? 21.359  34.594 4.608  1.00 32.92 ? 187  PHE B CA    1 
ATOM   5698  C  C     . PHE B  1  160 ? 20.209  33.587 4.592  1.00 33.26 ? 187  PHE B C     1 
ATOM   5699  O  O     . PHE B  1  160 ? 19.424  33.554 3.647  1.00 34.44 ? 187  PHE B O     1 
ATOM   5700  C  CB    . PHE B  1  160 ? 20.839  36.018 4.889  1.00 32.59 ? 187  PHE B CB    1 
ATOM   5701  C  CG    . PHE B  1  160 ? 19.944  36.125 6.104  1.00 31.92 ? 187  PHE B CG    1 
ATOM   5702  C  CD1   . PHE B  1  160 ? 20.458  35.965 7.389  1.00 31.58 ? 187  PHE B CD1   1 
ATOM   5703  C  CD2   . PHE B  1  160 ? 18.592  36.420 5.959  1.00 32.48 ? 187  PHE B CD2   1 
ATOM   5704  C  CE1   . PHE B  1  160 ? 19.632  36.075 8.515  1.00 31.31 ? 187  PHE B CE1   1 
ATOM   5705  C  CE2   . PHE B  1  160 ? 17.752  36.533 7.070  1.00 31.95 ? 187  PHE B CE2   1 
ATOM   5706  C  CZ    . PHE B  1  160 ? 18.271  36.357 8.354  1.00 32.00 ? 187  PHE B CZ    1 
ATOM   5707  N  N     . ILE B  1  161 ? 20.136  32.755 5.627  1.00 32.50 ? 188  ILE B N     1 
ATOM   5708  C  CA    . ILE B  1  161 ? 19.043  31.798 5.769  1.00 32.78 ? 188  ILE B CA    1 
ATOM   5709  C  C     . ILE B  1  161 ? 18.143  32.267 6.913  1.00 32.13 ? 188  ILE B C     1 
ATOM   5710  O  O     . ILE B  1  161 ? 18.532  32.174 8.092  1.00 31.33 ? 188  ILE B O     1 
ATOM   5711  C  CB    . ILE B  1  161 ? 19.562  30.350 6.006  1.00 32.69 ? 188  ILE B CB    1 
ATOM   5712  C  CG1   . ILE B  1  161 ? 20.435  29.898 4.826  1.00 34.17 ? 188  ILE B CG1   1 
ATOM   5713  C  CG2   . ILE B  1  161 ? 18.397  29.380 6.203  1.00 32.72 ? 188  ILE B CG2   1 
ATOM   5714  C  CD1   . ILE B  1  161 ? 21.417  28.808 5.167  1.00 34.26 ? 188  ILE B CD1   1 
ATOM   5715  N  N     . PRO B  1  162 ? 16.947  32.793 6.574  1.00 32.53 ? 189  PRO B N     1 
ATOM   5716  C  CA    . PRO B  1  162 ? 16.052  33.278 7.623  1.00 31.96 ? 189  PRO B CA    1 
ATOM   5717  C  C     . PRO B  1  162 ? 15.487  32.127 8.440  1.00 31.87 ? 189  PRO B C     1 
ATOM   5718  O  O     . PRO B  1  162 ? 15.344  31.018 7.921  1.00 32.46 ? 189  PRO B O     1 
ATOM   5719  C  CB    . PRO B  1  162 ? 14.940  33.991 6.845  1.00 32.95 ? 189  PRO B CB    1 
ATOM   5720  C  CG    . PRO B  1  162 ? 14.943  33.355 5.486  1.00 33.89 ? 189  PRO B CG    1 
ATOM   5721  C  CD    . PRO B  1  162 ? 16.350  32.906 5.224  1.00 33.76 ? 189  PRO B CD    1 
ATOM   5722  N  N     . ASP B  1  163 ? 15.195  32.381 9.714  1.00 31.21 ? 190  ASP B N     1 
ATOM   5723  C  CA    . ASP B  1  163 ? 14.571  31.371 10.555 1.00 31.26 ? 190  ASP B CA    1 
ATOM   5724  C  C     . ASP B  1  163 ? 13.135  31.154 10.103 1.00 32.16 ? 190  ASP B C     1 
ATOM   5725  O  O     . ASP B  1  163 ? 12.351  32.098 10.098 1.00 31.98 ? 190  ASP B O     1 
ATOM   5726  C  CB    . ASP B  1  163 ? 14.593  31.781 12.028 1.00 30.68 ? 190  ASP B CB    1 
ATOM   5727  C  CG    . ASP B  1  163 ? 13.700  30.896 12.893 1.00 31.80 ? 190  ASP B CG    1 
ATOM   5728  O  OD1   . ASP B  1  163 ? 13.607  29.683 12.615 1.00 33.97 ? 190  ASP B OD1   1 
ATOM   5729  O  OD2   . ASP B  1  163 ? 13.081  31.408 13.852 1.00 33.34 ? 190  ASP B OD2   1 
ATOM   5730  N  N     . PRO B  1  164 ? 12.788  29.904 9.725  1.00 33.13 ? 191  PRO B N     1 
ATOM   5731  C  CA    . PRO B  1  164 ? 11.422  29.573 9.309  1.00 34.39 ? 191  PRO B CA    1 
ATOM   5732  C  C     . PRO B  1  164 ? 10.396  29.678 10.441 1.00 34.50 ? 191  PRO B C     1 
ATOM   5733  O  O     . PRO B  1  164 ? 9.204   29.773 10.165 1.00 35.49 ? 191  PRO B O     1 
ATOM   5734  C  CB    . PRO B  1  164 ? 11.536  28.126 8.812  1.00 35.01 ? 191  PRO B CB    1 
ATOM   5735  C  CG    . PRO B  1  164 ? 12.780  27.589 9.468  1.00 34.40 ? 191  PRO B CG    1 
ATOM   5736  C  CD    . PRO B  1  164 ? 13.705  28.759 9.558  1.00 33.06 ? 191  PRO B CD    1 
ATOM   5737  N  N     . GLN B  1  165 ? 10.853  29.665 11.694 1.00 33.75 ? 192  GLN B N     1 
ATOM   5738  C  CA    . GLN B  1  165 ? 9.966   29.892 12.843 1.00 33.79 ? 192  GLN B CA    1 
ATOM   5739  C  C     . GLN B  1  165 ? 9.667   31.378 13.044 1.00 33.48 ? 192  GLN B C     1 
ATOM   5740  O  O     . GLN B  1  165 ? 8.843   31.749 13.887 1.00 33.88 ? 192  GLN B O     1 
ATOM   5741  C  CB    . GLN B  1  165 ? 10.545  29.276 14.128 1.00 32.76 ? 192  GLN B CB    1 
ATOM   5742  C  CG    . GLN B  1  165 ? 10.344  27.765 14.239 1.00 33.51 ? 192  GLN B CG    1 
ATOM   5743  C  CD    . GLN B  1  165 ? 10.913  27.176 15.519 1.00 33.21 ? 192  GLN B CD    1 
ATOM   5744  O  OE1   . GLN B  1  165 ? 11.842  26.372 15.481 1.00 33.10 ? 192  GLN B OE1   1 
ATOM   5745  N  NE2   . GLN B  1  165 ? 10.356  27.571 16.662 1.00 32.28 ? 192  GLN B NE2   1 
ATOM   5746  N  N     . GLY B  1  166 ? 10.341  32.223 12.269 1.00 33.18 ? 193  GLY B N     1 
ATOM   5747  C  CA    . GLY B  1  166 ? 10.077  33.658 12.257 1.00 32.86 ? 193  GLY B CA    1 
ATOM   5748  C  C     . GLY B  1  166 ? 10.638  34.435 13.434 1.00 31.87 ? 193  GLY B C     1 
ATOM   5749  O  O     . GLY B  1  166 ? 10.122  35.502 13.766 1.00 31.75 ? 193  GLY B O     1 
ATOM   5750  N  N     . SER B  1  167 ? 11.693  33.910 14.060 1.00 30.70 ? 194  SER B N     1 
ATOM   5751  C  CA    . SER B  1  167 ? 12.353  34.601 15.164 1.00 29.52 ? 194  SER B CA    1 
ATOM   5752  C  C     . SER B  1  167 ? 12.851  35.961 14.694 1.00 29.35 ? 194  SER B C     1 
ATOM   5753  O  O     . SER B  1  167 ? 13.385  36.084 13.590 1.00 29.85 ? 194  SER B O     1 
ATOM   5754  C  CB    . SER B  1  167 ? 13.522  33.778 15.706 1.00 28.65 ? 194  SER B CB    1 
ATOM   5755  O  OG    . SER B  1  167 ? 13.069  32.537 16.211 1.00 29.39 ? 194  SER B OG    1 
ATOM   5756  N  N     . ASN B  1  168 ? 12.670  36.977 15.532 1.00 28.50 ? 195  ASN B N     1 
ATOM   5757  C  CA    . ASN B  1  168 ? 13.040  38.339 15.166 1.00 28.02 ? 195  ASN B CA    1 
ATOM   5758  C  C     . ASN B  1  168 ? 14.239  38.868 15.963 1.00 27.19 ? 195  ASN B C     1 
ATOM   5759  O  O     . ASN B  1  168 ? 14.890  38.114 16.702 1.00 26.12 ? 195  ASN B O     1 
ATOM   5760  C  CB    . ASN B  1  168 ? 11.822  39.276 15.260 1.00 28.37 ? 195  ASN B CB    1 
ATOM   5761  C  CG    . ASN B  1  168 ? 11.247  39.369 16.666 1.00 27.78 ? 195  ASN B CG    1 
ATOM   5762  O  OD1   . ASN B  1  168 ? 11.898  39.021 17.648 1.00 24.60 ? 195  ASN B OD1   1 
ATOM   5763  N  ND2   . ASN B  1  168 ? 10.011  39.845 16.761 1.00 28.12 ? 195  ASN B ND2   1 
ATOM   5764  N  N     . MET B  1  169 ? 14.543  40.155 15.805 1.00 27.27 ? 196  MET B N     1 
ATOM   5765  C  CA    . MET B  1  169 ? 15.677  40.733 16.517 1.00 27.17 ? 196  MET B CA    1 
ATOM   5766  C  C     . MET B  1  169 ? 15.384  40.974 17.995 1.00 26.34 ? 196  MET B C     1 
ATOM   5767  O  O     . MET B  1  169 ? 16.310  40.977 18.811 1.00 25.82 ? 196  MET B O     1 
ATOM   5768  C  CB    . MET B  1  169 ? 16.220  41.990 15.823 1.00 27.68 ? 196  MET B CB    1 
ATOM   5769  C  CG    . MET B  1  169 ? 16.999  41.712 14.531 1.00 29.68 ? 196  MET B CG    1 
ATOM   5770  S  SD    . MET B  1  169 ? 18.370  40.544 14.730 1.00 32.97 ? 196  MET B SD    1 
ATOM   5771  C  CE    . MET B  1  169 ? 17.584  39.036 14.270 1.00 32.91 ? 196  MET B CE    1 
ATOM   5772  N  N     . MET B  1  170 ? 14.107  41.144 18.342 1.00 26.44 ? 197  MET B N     1 
ATOM   5773  C  CA    . MET B  1  170 ? 13.711  41.211 19.748 1.00 25.95 ? 197  MET B CA    1 
ATOM   5774  C  C     . MET B  1  170 ? 14.090  39.908 20.455 1.00 25.22 ? 197  MET B C     1 
ATOM   5775  O  O     . MET B  1  170 ? 14.547  39.938 21.600 1.00 24.41 ? 197  MET B O     1 
ATOM   5776  C  CB    . MET B  1  170 ? 12.211  41.473 19.916 1.00 26.53 ? 197  MET B CB    1 
ATOM   5777  C  CG    . MET B  1  170 ? 11.749  42.862 19.488 1.00 28.43 ? 197  MET B CG    1 
ATOM   5778  S  SD    . MET B  1  170 ? 12.428  44.211 20.483 1.00 30.28 ? 197  MET B SD    1 
ATOM   5779  C  CE    . MET B  1  170 ? 11.531  43.982 22.021 1.00 29.53 ? 197  MET B CE    1 
ATOM   5780  N  N     . PHE B  1  171 ? 13.895  38.782 19.768 1.00 24.97 ? 198  PHE B N     1 
ATOM   5781  C  CA    . PHE B  1  171 ? 14.253  37.472 20.304 1.00 24.79 ? 198  PHE B CA    1 
ATOM   5782  C  C     . PHE B  1  171 ? 15.762  37.285 20.403 1.00 24.09 ? 198  PHE B C     1 
ATOM   5783  O  O     . PHE B  1  171 ? 16.266  36.820 21.429 1.00 23.73 ? 198  PHE B O     1 
ATOM   5784  C  CB    . PHE B  1  171 ? 13.643  36.329 19.478 1.00 25.03 ? 198  PHE B CB    1 
ATOM   5785  C  CG    . PHE B  1  171 ? 14.153  34.959 19.874 1.00 26.35 ? 198  PHE B CG    1 
ATOM   5786  C  CD1   . PHE B  1  171 ? 13.528  34.232 20.886 1.00 27.35 ? 198  PHE B CD1   1 
ATOM   5787  C  CD2   . PHE B  1  171 ? 15.278  34.414 19.253 1.00 25.89 ? 198  PHE B CD2   1 
ATOM   5788  C  CE1   . PHE B  1  171 ? 14.006  32.969 21.263 1.00 27.60 ? 198  PHE B CE1   1 
ATOM   5789  C  CE2   . PHE B  1  171 ? 15.762  33.157 19.621 1.00 28.14 ? 198  PHE B CE2   1 
ATOM   5790  C  CZ    . PHE B  1  171 ? 15.125  32.435 20.626 1.00 28.60 ? 198  PHE B CZ    1 
ATOM   5791  N  N     . ALA B  1  172 ? 16.474  37.626 19.329 1.00 24.49 ? 199  ALA B N     1 
ATOM   5792  C  CA    . ALA B  1  172 ? 17.933  37.478 19.286 1.00 24.25 ? 199  ALA B CA    1 
ATOM   5793  C  C     . ALA B  1  172 ? 18.616  38.281 20.391 1.00 23.83 ? 199  ALA B C     1 
ATOM   5794  O  O     . ALA B  1  172 ? 19.508  37.780 21.069 1.00 23.05 ? 199  ALA B O     1 
ATOM   5795  C  CB    . ALA B  1  172 ? 18.476  37.878 17.915 1.00 24.91 ? 199  ALA B CB    1 
ATOM   5796  N  N     . PHE B  1  173 ? 18.186  39.525 20.581 1.00 24.34 ? 200  PHE B N     1 
ATOM   5797  C  CA    . PHE B  1  173 ? 18.780  40.369 21.610 1.00 24.53 ? 200  PHE B CA    1 
ATOM   5798  C  C     . PHE B  1  173 ? 18.310  40.014 23.021 1.00 23.97 ? 200  PHE B C     1 
ATOM   5799  O  O     . PHE B  1  173 ? 19.036  40.248 23.987 1.00 23.18 ? 200  PHE B O     1 
ATOM   5800  C  CB    . PHE B  1  173 ? 18.557  41.860 21.306 1.00 25.39 ? 200  PHE B CB    1 
ATOM   5801  C  CG    . PHE B  1  173 ? 19.434  42.383 20.207 1.00 27.39 ? 200  PHE B CG    1 
ATOM   5802  C  CD1   . PHE B  1  173 ? 20.820  42.295 20.304 1.00 27.95 ? 200  PHE B CD1   1 
ATOM   5803  C  CD2   . PHE B  1  173 ? 18.878  42.950 19.065 1.00 28.96 ? 200  PHE B CD2   1 
ATOM   5804  C  CE1   . PHE B  1  173 ? 21.632  42.779 19.282 1.00 30.09 ? 200  PHE B CE1   1 
ATOM   5805  C  CE2   . PHE B  1  173 ? 19.684  43.433 18.041 1.00 29.79 ? 200  PHE B CE2   1 
ATOM   5806  C  CZ    . PHE B  1  173 ? 21.059  43.350 18.148 1.00 29.51 ? 200  PHE B CZ    1 
ATOM   5807  N  N     . PHE B  1  174 ? 17.105  39.450 23.144 1.00 24.04 ? 201  PHE B N     1 
ATOM   5808  C  CA    . PHE B  1  174 ? 16.648  38.973 24.445 1.00 23.61 ? 201  PHE B CA    1 
ATOM   5809  C  C     . PHE B  1  174 ? 17.516  37.779 24.849 1.00 23.38 ? 201  PHE B C     1 
ATOM   5810  O  O     . PHE B  1  174 ? 17.970  37.683 25.989 1.00 22.83 ? 201  PHE B O     1 
ATOM   5811  C  CB    . PHE B  1  174 ? 15.161  38.596 24.426 1.00 23.93 ? 201  PHE B CB    1 
ATOM   5812  C  CG    . PHE B  1  174 ? 14.593  38.289 25.798 1.00 23.93 ? 201  PHE B CG    1 
ATOM   5813  C  CD1   . PHE B  1  174 ? 13.902  39.263 26.511 1.00 23.79 ? 201  PHE B CD1   1 
ATOM   5814  C  CD2   . PHE B  1  174 ? 14.762  37.031 26.376 1.00 24.23 ? 201  PHE B CD2   1 
ATOM   5815  C  CE1   . PHE B  1  174 ? 13.380  38.985 27.772 1.00 25.27 ? 201  PHE B CE1   1 
ATOM   5816  C  CE2   . PHE B  1  174 ? 14.245  36.741 27.644 1.00 24.60 ? 201  PHE B CE2   1 
ATOM   5817  C  CZ    . PHE B  1  174 ? 13.555  37.714 28.341 1.00 24.92 ? 201  PHE B CZ    1 
ATOM   5818  N  N     . ALA B  1  175 ? 17.758  36.882 23.897 1.00 23.58 ? 202  ALA B N     1 
ATOM   5819  C  CA    . ALA B  1  175 ? 18.579  35.711 24.147 1.00 23.40 ? 202  ALA B CA    1 
ATOM   5820  C  C     . ALA B  1  175 ? 19.951  36.147 24.632 1.00 23.39 ? 202  ALA B C     1 
ATOM   5821  O  O     . ALA B  1  175 ? 20.479  35.607 25.610 1.00 22.69 ? 202  ALA B O     1 
ATOM   5822  C  CB    . ALA B  1  175 ? 18.699  34.876 22.891 1.00 23.55 ? 202  ALA B CB    1 
ATOM   5823  N  N     . GLN B  1  176 ? 20.516  37.140 23.949 1.00 23.71 ? 203  GLN B N     1 
ATOM   5824  C  CA    . GLN B  1  176 ? 21.846  37.619 24.273 1.00 23.63 ? 203  GLN B CA    1 
ATOM   5825  C  C     . GLN B  1  176 ? 21.864  38.282 25.656 1.00 22.81 ? 203  GLN B C     1 
ATOM   5826  O  O     . GLN B  1  176 ? 22.696  37.947 26.498 1.00 21.84 ? 203  GLN B O     1 
ATOM   5827  C  CB    . GLN B  1  176 ? 22.347  38.560 23.180 1.00 24.69 ? 203  GLN B CB    1 
ATOM   5828  C  CG    . GLN B  1  176 ? 23.859  38.664 23.130 1.00 27.54 ? 203  GLN B CG    1 
ATOM   5829  C  CD    . GLN B  1  176 ? 24.359  39.785 22.229 1.00 30.68 ? 203  GLN B CD    1 
ATOM   5830  O  OE1   . GLN B  1  176 ? 23.579  40.506 21.602 1.00 30.91 ? 203  GLN B OE1   1 
ATOM   5831  N  NE2   . GLN B  1  176 ? 25.676  39.939 22.173 1.00 32.08 ? 203  GLN B NE2   1 
ATOM   5832  N  N     . HIS B  1  177 ? 20.911  39.184 25.900 1.00 22.15 ? 204  HIS B N     1 
ATOM   5833  C  CA    . HIS B  1  177 ? 20.810  39.881 27.179 1.00 21.68 ? 204  HIS B CA    1 
ATOM   5834  C  C     . HIS B  1  177 ? 20.556  38.915 28.360 1.00 21.51 ? 204  HIS B C     1 
ATOM   5835  O  O     . HIS B  1  177 ? 21.284  38.947 29.348 1.00 21.34 ? 204  HIS B O     1 
ATOM   5836  C  CB    . HIS B  1  177 ? 19.730  40.976 27.098 1.00 21.95 ? 204  HIS B CB    1 
ATOM   5837  C  CG    . HIS B  1  177 ? 19.635  41.836 28.319 1.00 21.14 ? 204  HIS B CG    1 
ATOM   5838  N  ND1   . HIS B  1  177 ? 18.758  41.571 29.349 1.00 21.08 ? 204  HIS B ND1   1 
ATOM   5839  C  CD2   . HIS B  1  177 ? 20.289  42.971 28.663 1.00 22.03 ? 204  HIS B CD2   1 
ATOM   5840  C  CE1   . HIS B  1  177 ? 18.882  42.501 30.280 1.00 21.14 ? 204  HIS B CE1   1 
ATOM   5841  N  NE2   . HIS B  1  177 ? 19.801  43.365 29.886 1.00 22.27 ? 204  HIS B NE2   1 
ATOM   5842  N  N     . PHE B  1  178 ? 19.549  38.047 28.238 1.00 21.53 ? 205  PHE B N     1 
ATOM   5843  C  CA    . PHE B  1  178 ? 19.183  37.096 29.303 1.00 21.08 ? 205  PHE B CA    1 
ATOM   5844  C  C     . PHE B  1  178 ? 20.323  36.135 29.689 1.00 21.40 ? 205  PHE B C     1 
ATOM   5845  O  O     . PHE B  1  178 ? 20.676  36.044 30.870 1.00 20.78 ? 205  PHE B O     1 
ATOM   5846  C  CB    . PHE B  1  178 ? 17.909  36.324 28.924 1.00 21.46 ? 205  PHE B CB    1 
ATOM   5847  C  CG    . PHE B  1  178 ? 17.592  35.160 29.838 1.00 21.60 ? 205  PHE B CG    1 
ATOM   5848  C  CD1   . PHE B  1  178 ? 17.184  35.375 31.155 1.00 20.60 ? 205  PHE B CD1   1 
ATOM   5849  C  CD2   . PHE B  1  178 ? 17.685  33.845 29.367 1.00 20.80 ? 205  PHE B CD2   1 
ATOM   5850  C  CE1   . PHE B  1  178 ? 16.890  34.298 32.003 1.00 19.74 ? 205  PHE B CE1   1 
ATOM   5851  C  CE2   . PHE B  1  178 ? 17.393  32.770 30.196 1.00 19.95 ? 205  PHE B CE2   1 
ATOM   5852  C  CZ    . PHE B  1  178 ? 16.997  32.996 31.521 1.00 20.51 ? 205  PHE B CZ    1 
ATOM   5853  N  N     . THR B  1  179 ? 20.911  35.453 28.696 1.00 21.18 ? 206  THR B N     1 
ATOM   5854  C  CA    . THR B  1  179 ? 21.913  34.420 28.960 1.00 21.09 ? 206  THR B CA    1 
ATOM   5855  C  C     . THR B  1  179 ? 23.249  34.974 29.460 1.00 22.04 ? 206  THR B C     1 
ATOM   5856  O  O     . THR B  1  179 ? 24.013  34.257 30.106 1.00 22.55 ? 206  THR B O     1 
ATOM   5857  C  CB    . THR B  1  179 ? 22.190  33.528 27.724 1.00 21.17 ? 206  THR B CB    1 
ATOM   5858  O  OG1   . THR B  1  179 ? 22.701  34.329 26.653 1.00 19.62 ? 206  THR B OG1   1 
ATOM   5859  C  CG2   . THR B  1  179 ? 20.927  32.788 27.283 1.00 21.07 ? 206  THR B CG2   1 
ATOM   5860  N  N     . HIS B  1  180 ? 23.521  36.241 29.176 1.00 22.32 ? 207  HIS B N     1 
ATOM   5861  C  CA    . HIS B  1  180 ? 24.780  36.857 29.579 1.00 23.34 ? 207  HIS B CA    1 
ATOM   5862  C  C     . HIS B  1  180 ? 24.810  37.275 31.050 1.00 22.74 ? 207  HIS B C     1 
ATOM   5863  O  O     . HIS B  1  180 ? 25.795  37.851 31.509 1.00 22.60 ? 207  HIS B O     1 
ATOM   5864  C  CB    . HIS B  1  180 ? 25.150  38.010 28.640 1.00 24.24 ? 207  HIS B CB    1 
ATOM   5865  C  CG    . HIS B  1  180 ? 25.682  37.550 27.317 1.00 28.33 ? 207  HIS B CG    1 
ATOM   5866  N  ND1   . HIS B  1  180 ? 26.760  38.147 26.697 1.00 32.84 ? 207  HIS B ND1   1 
ATOM   5867  C  CD2   . HIS B  1  180 ? 25.299  36.532 26.508 1.00 30.48 ? 207  HIS B CD2   1 
ATOM   5868  C  CE1   . HIS B  1  180 ? 27.010  37.525 25.557 1.00 34.07 ? 207  HIS B CE1   1 
ATOM   5869  N  NE2   . HIS B  1  180 ? 26.139  36.540 25.420 1.00 34.88 ? 207  HIS B NE2   1 
ATOM   5870  N  N     . GLN B  1  181 ? 23.735  36.976 31.782 1.00 22.03 ? 208  GLN B N     1 
ATOM   5871  C  CA    . GLN B  1  181 ? 23.801  37.036 33.244 1.00 21.68 ? 208  GLN B CA    1 
ATOM   5872  C  C     . GLN B  1  181 ? 24.444  35.783 33.836 1.00 21.91 ? 208  GLN B C     1 
ATOM   5873  O  O     . GLN B  1  181 ? 25.004  35.848 34.930 1.00 22.64 ? 208  GLN B O     1 
ATOM   5874  C  CB    . GLN B  1  181 ? 22.427  37.300 33.881 1.00 21.27 ? 208  GLN B CB    1 
ATOM   5875  C  CG    . GLN B  1  181 ? 21.513  36.092 34.020 1.00 19.21 ? 208  GLN B CG    1 
ATOM   5876  C  CD    . GLN B  1  181 ? 20.101  36.500 34.357 1.00 18.65 ? 208  GLN B CD    1 
ATOM   5877  O  OE1   . GLN B  1  181 ? 19.799  36.842 35.505 1.00 18.06 ? 208  GLN B OE1   1 
ATOM   5878  N  NE2   . GLN B  1  181 ? 19.220  36.479 33.353 1.00 15.80 ? 208  GLN B NE2   1 
ATOM   5879  N  N     . PHE B  1  182 ? 24.347  34.645 33.134 1.00 21.84 ? 209  PHE B N     1 
ATOM   5880  C  CA    . PHE B  1  182 ? 24.940  33.388 33.624 1.00 21.75 ? 209  PHE B CA    1 
ATOM   5881  C  C     . PHE B  1  182 ? 26.051  32.771 32.765 1.00 22.12 ? 209  PHE B C     1 
ATOM   5882  O  O     . PHE B  1  182 ? 26.767  31.875 33.225 1.00 22.28 ? 209  PHE B O     1 
ATOM   5883  C  CB    . PHE B  1  182 ? 23.876  32.344 34.017 1.00 21.49 ? 209  PHE B CB    1 
ATOM   5884  C  CG    . PHE B  1  182 ? 22.798  32.126 32.990 1.00 20.97 ? 209  PHE B CG    1 
ATOM   5885  C  CD1   . PHE B  1  182 ? 23.040  31.366 31.844 1.00 20.56 ? 209  PHE B CD1   1 
ATOM   5886  C  CD2   . PHE B  1  182 ? 21.528  32.647 33.190 1.00 20.03 ? 209  PHE B CD2   1 
ATOM   5887  C  CE1   . PHE B  1  182 ? 22.024  31.150 30.903 1.00 19.93 ? 209  PHE B CE1   1 
ATOM   5888  C  CE2   . PHE B  1  182 ? 20.509  32.447 32.251 1.00 20.01 ? 209  PHE B CE2   1 
ATOM   5889  C  CZ    . PHE B  1  182 ? 20.758  31.698 31.110 1.00 19.52 ? 209  PHE B CZ    1 
ATOM   5890  N  N     . PHE B  1  183 ? 26.189  33.236 31.526 1.00 22.65 ? 210  PHE B N     1 
ATOM   5891  C  CA    . PHE B  1  183 ? 27.388  32.940 30.738 1.00 23.54 ? 210  PHE B CA    1 
ATOM   5892  C  C     . PHE B  1  183 ? 28.303  34.162 30.780 1.00 24.31 ? 210  PHE B C     1 
ATOM   5893  O  O     . PHE B  1  183 ? 28.070  35.152 30.078 1.00 25.02 ? 210  PHE B O     1 
ATOM   5894  C  CB    . PHE B  1  183 ? 27.038  32.572 29.291 1.00 23.03 ? 210  PHE B CB    1 
ATOM   5895  C  CG    . PHE B  1  183 ? 26.075  31.419 29.160 1.00 22.63 ? 210  PHE B CG    1 
ATOM   5896  C  CD1   . PHE B  1  183 ? 26.171  30.298 29.986 1.00 20.17 ? 210  PHE B CD1   1 
ATOM   5897  C  CD2   . PHE B  1  183 ? 25.091  31.445 28.182 1.00 21.76 ? 210  PHE B CD2   1 
ATOM   5898  C  CE1   . PHE B  1  183 ? 25.292  29.237 29.845 1.00 21.88 ? 210  PHE B CE1   1 
ATOM   5899  C  CE2   . PHE B  1  183 ? 24.211  30.384 28.027 1.00 22.00 ? 210  PHE B CE2   1 
ATOM   5900  C  CZ    . PHE B  1  183 ? 24.307  29.274 28.860 1.00 21.09 ? 210  PHE B CZ    1 
ATOM   5901  N  N     . LYS B  1  184 ? 29.326  34.091 31.625 1.00 25.10 ? 211  LYS B N     1 
ATOM   5902  C  CA    . LYS B  1  184 ? 30.250  35.200 31.870 1.00 25.67 ? 211  LYS B CA    1 
ATOM   5903  C  C     . LYS B  1  184 ? 31.636  34.620 32.051 1.00 26.43 ? 211  LYS B C     1 
ATOM   5904  O  O     . LYS B  1  184 ? 32.159  34.558 33.168 1.00 26.54 ? 211  LYS B O     1 
ATOM   5905  C  CB    . LYS B  1  184 ? 29.870  35.970 33.139 1.00 25.83 ? 211  LYS B CB    1 
ATOM   5906  C  CG    . LYS B  1  184 ? 28.502  36.622 33.128 1.00 25.89 ? 211  LYS B CG    1 
ATOM   5907  C  CD    . LYS B  1  184 ? 28.443  37.812 34.073 1.00 27.79 ? 211  LYS B CD    1 
ATOM   5908  C  CE    . LYS B  1  184 ? 28.400  37.394 35.529 1.00 27.55 ? 211  LYS B CE    1 
ATOM   5909  N  NZ    . LYS B  1  184 ? 28.410  38.571 36.438 1.00 28.36 ? 211  LYS B NZ    1 
ATOM   5910  N  N     . THR B  1  185 ? 32.226  34.174 30.952 1.00 27.30 ? 212  THR B N     1 
ATOM   5911  C  CA    . THR B  1  185 ? 33.483  33.449 31.024 1.00 28.30 ? 212  THR B CA    1 
ATOM   5912  C  C     . THR B  1  185 ? 34.560  34.351 31.620 1.00 29.57 ? 212  THR B C     1 
ATOM   5913  O  O     . THR B  1  185 ? 34.635  35.537 31.302 1.00 30.02 ? 212  THR B O     1 
ATOM   5914  C  CB    . THR B  1  185 ? 33.881  32.859 29.659 1.00 28.42 ? 212  THR B CB    1 
ATOM   5915  O  OG1   . THR B  1  185 ? 32.812  32.029 29.197 1.00 27.96 ? 212  THR B OG1   1 
ATOM   5916  C  CG2   . THR B  1  185 ? 35.132  32.003 29.782 1.00 28.67 ? 212  THR B CG2   1 
ATOM   5917  N  N     . ASP B  1  186 ? 35.320  33.787 32.553 1.00 32.11 ? 213  ASP B N     1 
ATOM   5918  C  CA    . ASP B  1  186 ? 36.422  34.470 33.195 1.00 34.46 ? 213  ASP B CA    1 
ATOM   5919  C  C     . ASP B  1  186 ? 37.654  34.162 32.361 1.00 36.19 ? 213  ASP B C     1 
ATOM   5920  O  O     . ASP B  1  186 ? 38.373  33.203 32.647 1.00 34.82 ? 213  ASP B O     1 
ATOM   5921  C  CB    . ASP B  1  186 ? 36.593  33.943 34.628 1.00 32.82 ? 213  ASP B CB    1 
ATOM   5922  C  CG    . ASP B  1  186 ? 37.656  34.698 35.416 1.00 37.36 ? 213  ASP B CG    1 
ATOM   5923  O  OD1   . ASP B  1  186 ? 38.315  35.603 34.857 1.00 41.08 ? 213  ASP B OD1   1 
ATOM   5924  O  OD2   . ASP B  1  186 ? 37.832  34.385 36.612 1.00 39.30 ? 213  ASP B OD2   1 
ATOM   5925  N  N     . HIS B  1  187 ? 37.890  34.968 31.328 1.00 39.90 ? 214  HIS B N     1 
ATOM   5926  C  CA    A HIS B  1  187 ? 38.999  34.792 30.375 0.50 42.47 ? 214  HIS B CA    1 
ATOM   5927  C  CA    B HIS B  1  187 ? 38.991  34.648 30.425 0.50 42.01 ? 214  HIS B CA    1 
ATOM   5928  C  C     . HIS B  1  187 ? 40.382  34.856 31.033 1.00 44.23 ? 214  HIS B C     1 
ATOM   5929  O  O     . HIS B  1  187 ? 41.385  34.406 30.465 1.00 45.48 ? 214  HIS B O     1 
ATOM   5930  C  CB    A HIS B  1  187 ? 38.918  35.854 29.269 0.50 47.34 ? 214  HIS B CB    1 
ATOM   5931  C  CB    B HIS B  1  187 ? 38.816  35.294 29.049 0.50 45.99 ? 214  HIS B CB    1 
ATOM   5932  C  CG    A HIS B  1  187 ? 37.548  36.025 28.686 0.50 48.18 ? 214  HIS B CG    1 
ATOM   5933  C  CG    B HIS B  1  187 ? 37.973  34.475 28.120 0.50 45.49 ? 214  HIS B CG    1 
ATOM   5934  N  ND1   A HIS B  1  187 ? 36.739  37.100 28.987 0.50 50.76 ? 214  HIS B ND1   1 
ATOM   5935  N  ND1   B HIS B  1  187 ? 36.691  34.835 27.761 0.50 46.93 ? 214  HIS B ND1   1 
ATOM   5936  C  CD2   A HIS B  1  187 ? 36.843  35.256 27.822 0.50 47.78 ? 214  HIS B CD2   1 
ATOM   5937  C  CD2   B HIS B  1  187 ? 38.217  33.293 27.507 0.50 44.80 ? 214  HIS B CD2   1 
ATOM   5938  C  CE1   A HIS B  1  187 ? 35.597  36.987 28.332 0.50 51.34 ? 214  HIS B CE1   1 
ATOM   5939  C  CE1   B HIS B  1  187 ? 36.191  33.920 26.948 0.50 47.00 ? 214  HIS B CE1   1 
ATOM   5940  N  NE2   A HIS B  1  187 ? 35.635  35.876 27.619 0.50 49.30 ? 214  HIS B NE2   1 
ATOM   5941  N  NE2   B HIS B  1  187 ? 37.097  32.974 26.778 0.50 45.86 ? 214  HIS B NE2   1 
ATOM   5942  N  N     . LYS B  1  188 ? 40.435  35.472 32.213 1.00 45.08 ? 215  LYS B N     1 
ATOM   5943  C  CA    . LYS B  1  188 ? 41.669  35.545 32.988 1.00 47.55 ? 215  LYS B CA    1 
ATOM   5944  C  C     . LYS B  1  188 ? 42.065  34.139 33.448 1.00 44.35 ? 215  LYS B C     1 
ATOM   5945  O  O     . LYS B  1  188 ? 43.246  33.800 33.488 1.00 46.51 ? 215  LYS B O     1 
ATOM   5946  C  CB    . LYS B  1  188 ? 41.498  36.470 34.195 1.00 50.34 ? 215  LYS B CB    1 
ATOM   5947  C  CG    . LYS B  1  188 ? 41.469  37.954 33.848 1.00 56.26 ? 215  LYS B CG    1 
ATOM   5948  N  N     . ARG B  1  189 ? 41.072  33.318 33.778 1.00 39.54 ? 216  ARG B N     1 
ATOM   5949  C  CA    . ARG B  1  189 ? 41.340  31.963 34.243 1.00 37.75 ? 216  ARG B CA    1 
ATOM   5950  C  C     . ARG B  1  189 ? 41.287  30.941 33.102 1.00 35.71 ? 216  ARG B C     1 
ATOM   5951  O  O     . ARG B  1  189 ? 42.115  30.026 33.049 1.00 36.66 ? 216  ARG B O     1 
ATOM   5952  C  CB    . ARG B  1  189 ? 40.388  31.563 35.373 1.00 35.75 ? 216  ARG B CB    1 
ATOM   5953  C  CG    . ARG B  1  189 ? 40.463  32.428 36.625 1.00 39.52 ? 216  ARG B CG    1 
ATOM   5954  C  CD    . ARG B  1  189 ? 39.719  31.772 37.782 1.00 40.57 ? 216  ARG B CD    1 
ATOM   5955  N  NE    . ARG B  1  189 ? 39.105  32.749 38.682 1.00 44.01 ? 216  ARG B NE    1 
ATOM   5956  C  CZ    . ARG B  1  189 ? 39.548  33.047 39.899 1.00 49.14 ? 216  ARG B CZ    1 
ATOM   5957  N  NH1   . ARG B  1  189 ? 40.620  32.451 40.398 1.00 52.79 ? 216  ARG B NH1   1 
ATOM   5958  N  NH2   . ARG B  1  189 ? 38.913  33.954 40.624 1.00 52.36 ? 216  ARG B NH2   1 
ATOM   5959  N  N     . GLY B  1  190 ? 40.321  31.100 32.197 1.00 33.48 ? 217  GLY B N     1 
ATOM   5960  C  CA    . GLY B  1  190 ? 40.182  30.206 31.041 1.00 32.34 ? 217  GLY B CA    1 
ATOM   5961  C  C     . GLY B  1  190 ? 38.734  29.929 30.677 1.00 29.68 ? 217  GLY B C     1 
ATOM   5962  O  O     . GLY B  1  190 ? 37.829  30.299 31.426 1.00 27.84 ? 217  GLY B O     1 
ATOM   5963  N  N     . PRO B  1  191 ? 38.501  29.256 29.533 1.00 30.44 ? 218  PRO B N     1 
ATOM   5964  C  CA    . PRO B  1  191 ? 37.132  29.007 29.035 1.00 30.10 ? 218  PRO B CA    1 
ATOM   5965  C  C     . PRO B  1  191 ? 36.227  28.183 29.974 1.00 27.70 ? 218  PRO B C     1 
ATOM   5966  O  O     . PRO B  1  191 ? 34.998  28.279 29.885 1.00 27.21 ? 218  PRO B O     1 
ATOM   5967  C  CB    . PRO B  1  191 ? 37.360  28.267 27.708 1.00 33.26 ? 218  PRO B CB    1 
ATOM   5968  C  CG    . PRO B  1  191 ? 38.756  27.722 27.797 1.00 34.07 ? 218  PRO B CG    1 
ATOM   5969  C  CD    . PRO B  1  191 ? 39.525  28.704 28.629 1.00 32.52 ? 218  PRO B CD    1 
ATOM   5970  N  N     . GLY B  1  192 ? 36.823  27.387 30.860 1.00 26.97 ? 219  GLY B N     1 
ATOM   5971  C  CA    . GLY B  1  192 ? 36.053  26.557 31.794 1.00 25.52 ? 219  GLY B CA    1 
ATOM   5972  C  C     . GLY B  1  192 ? 35.657  27.235 33.100 1.00 23.58 ? 219  GLY B C     1 
ATOM   5973  O  O     . GLY B  1  192 ? 35.119  26.584 34.012 1.00 23.22 ? 219  GLY B O     1 
ATOM   5974  N  N     . PHE B  1  193 ? 35.912  28.538 33.184 1.00 22.39 ? 220  PHE B N     1 
ATOM   5975  C  CA    . PHE B  1  193 ? 35.664  29.319 34.393 1.00 21.24 ? 220  PHE B CA    1 
ATOM   5976  C  C     . PHE B  1  193 ? 34.652  30.426 34.126 1.00 20.99 ? 220  PHE B C     1 
ATOM   5977  O  O     . PHE B  1  193 ? 34.628  31.007 33.031 1.00 21.60 ? 220  PHE B O     1 
ATOM   5978  C  CB    . PHE B  1  193 ? 36.970  29.936 34.913 1.00 22.78 ? 220  PHE B CB    1 
ATOM   5979  C  CG    . PHE B  1  193 ? 37.961  28.924 35.438 1.00 23.23 ? 220  PHE B CG    1 
ATOM   5980  C  CD1   . PHE B  1  193 ? 38.001  28.613 36.796 1.00 23.39 ? 220  PHE B CD1   1 
ATOM   5981  C  CD2   . PHE B  1  193 ? 38.838  28.275 34.576 1.00 23.49 ? 220  PHE B CD2   1 
ATOM   5982  C  CE1   . PHE B  1  193 ? 38.915  27.679 37.289 1.00 26.96 ? 220  PHE B CE1   1 
ATOM   5983  C  CE2   . PHE B  1  193 ? 39.757  27.332 35.056 1.00 26.40 ? 220  PHE B CE2   1 
ATOM   5984  C  CZ    . PHE B  1  193 ? 39.799  27.039 36.417 1.00 26.63 ? 220  PHE B CZ    1 
ATOM   5985  N  N     . THR B  1  194 ? 33.844  30.728 35.144 1.00 20.02 ? 221  THR B N     1 
ATOM   5986  C  CA    . THR B  1  194 ? 32.828  31.777 35.060 1.00 20.03 ? 221  THR B CA    1 
ATOM   5987  C  C     . THR B  1  194 ? 32.956  32.856 36.143 1.00 21.51 ? 221  THR B C     1 
ATOM   5988  O  O     . THR B  1  194 ? 33.492  32.613 37.228 1.00 21.75 ? 221  THR B O     1 
ATOM   5989  C  CB    . THR B  1  194 ? 31.403  31.166 35.117 1.00 18.77 ? 221  THR B CB    1 
ATOM   5990  O  OG1   . THR B  1  194 ? 30.430  32.208 35.034 1.00 19.37 ? 221  THR B OG1   1 
ATOM   5991  C  CG2   . THR B  1  194 ? 31.189  30.378 36.408 1.00 18.13 ? 221  THR B CG2   1 
ATOM   5992  N  N     . ARG B  1  195 ? 32.439  34.048 35.842 1.00 23.67 ? 222  ARG B N     1 
ATOM   5993  C  CA    . ARG B  1  195 ? 32.351  35.138 36.812 1.00 26.02 ? 222  ARG B CA    1 
ATOM   5994  C  C     . ARG B  1  195 ? 30.945  35.227 37.391 1.00 24.95 ? 222  ARG B C     1 
ATOM   5995  O  O     . ARG B  1  195 ? 30.696  36.045 38.274 1.00 27.01 ? 222  ARG B O     1 
ATOM   5996  C  CB    . ARG B  1  195 ? 32.695  36.484 36.166 1.00 30.41 ? 222  ARG B CB    1 
ATOM   5997  C  CG    . ARG B  1  195 ? 33.979  36.504 35.371 1.00 33.86 ? 222  ARG B CG    1 
ATOM   5998  C  CD    . ARG B  1  195 ? 35.125  37.080 36.175 1.00 40.53 ? 222  ARG B CD    1 
ATOM   5999  N  NE    . ARG B  1  195 ? 35.048  38.537 36.266 1.00 47.66 ? 222  ARG B NE    1 
ATOM   6000  C  CZ    . ARG B  1  195 ? 36.089  39.332 36.502 1.00 54.26 ? 222  ARG B CZ    1 
ATOM   6001  N  NH1   . ARG B  1  195 ? 37.307  38.818 36.661 1.00 54.81 ? 222  ARG B NH1   1 
ATOM   6002  N  NH2   . ARG B  1  195 ? 35.914  40.647 36.564 1.00 60.33 ? 222  ARG B NH2   1 
ATOM   6003  N  N     . GLY B  1  196 ? 30.026  34.415 36.867 1.00 22.60 ? 223  GLY B N     1 
ATOM   6004  C  CA    . GLY B  1  196 ? 28.638  34.412 37.310 1.00 22.24 ? 223  GLY B CA    1 
ATOM   6005  C  C     . GLY B  1  196 ? 28.438  33.446 38.464 1.00 20.82 ? 223  GLY B C     1 
ATOM   6006  O  O     . GLY B  1  196 ? 27.921  32.342 38.273 1.00 19.66 ? 223  GLY B O     1 
ATOM   6007  N  N     . LEU B  1  197 ? 28.847  33.859 39.661 1.00 21.97 ? 224  LEU B N     1 
ATOM   6008  C  CA    . LEU B  1  197 ? 28.908  32.946 40.806 1.00 21.80 ? 224  LEU B CA    1 
ATOM   6009  C  C     . LEU B  1  197 ? 27.533  32.597 41.388 1.00 21.10 ? 224  LEU B C     1 
ATOM   6010  O  O     . LEU B  1  197 ? 27.422  31.687 42.209 1.00 21.64 ? 224  LEU B O     1 
ATOM   6011  C  CB    . LEU B  1  197 ? 29.845  33.482 41.900 1.00 24.48 ? 224  LEU B CB    1 
ATOM   6012  C  CG    . LEU B  1  197 ? 31.301  33.820 41.542 1.00 26.81 ? 224  LEU B CG    1 
ATOM   6013  C  CD1   . LEU B  1  197 ? 32.068  34.267 42.783 1.00 29.78 ? 224  LEU B CD1   1 
ATOM   6014  C  CD2   . LEU B  1  197 ? 32.016  32.665 40.874 1.00 25.23 ? 224  LEU B CD2   1 
ATOM   6015  N  N     . GLY B  1  198 ? 26.502  33.328 40.970 1.00 21.10 ? 225  GLY B N     1 
ATOM   6016  C  CA    . GLY B  1  198 ? 25.125  32.993 41.311 1.00 20.62 ? 225  GLY B CA    1 
ATOM   6017  C  C     . GLY B  1  198 ? 24.583  31.827 40.491 1.00 19.48 ? 225  GLY B C     1 
ATOM   6018  O  O     . GLY B  1  198 ? 23.591  31.209 40.872 1.00 19.96 ? 225  GLY B O     1 
ATOM   6019  N  N     . HIS B  1  199 ? 25.227  31.528 39.363 1.00 18.36 ? 226  HIS B N     1 
ATOM   6020  C  CA    . HIS B  1  199 ? 24.888  30.360 38.536 1.00 18.46 ? 226  HIS B CA    1 
ATOM   6021  C  C     . HIS B  1  199 ? 23.395  30.241 38.145 1.00 20.10 ? 226  HIS B C     1 
ATOM   6022  O  O     . HIS B  1  199 ? 22.797  29.163 38.251 1.00 20.63 ? 226  HIS B O     1 
ATOM   6023  C  CB    . HIS B  1  199 ? 25.368  29.066 39.213 1.00 18.61 ? 226  HIS B CB    1 
ATOM   6024  C  CG    . HIS B  1  199 ? 26.849  28.854 39.129 1.00 17.81 ? 226  HIS B CG    1 
ATOM   6025  N  ND1   . HIS B  1  199 ? 27.446  28.192 38.080 1.00 17.69 ? 226  HIS B ND1   1 
ATOM   6026  C  CD2   . HIS B  1  199 ? 27.850  29.205 39.972 1.00 17.36 ? 226  HIS B CD2   1 
ATOM   6027  C  CE1   . HIS B  1  199 ? 28.754  28.158 38.268 1.00 17.94 ? 226  HIS B CE1   1 
ATOM   6028  N  NE2   . HIS B  1  199 ? 29.026  28.765 39.411 1.00 17.23 ? 226  HIS B NE2   1 
ATOM   6029  N  N     . GLY B  1  200 ? 22.810  31.343 37.679 1.00 22.39 ? 227  GLY B N     1 
ATOM   6030  C  CA    . GLY B  1  200 ? 21.411  31.334 37.273 1.00 22.04 ? 227  GLY B CA    1 
ATOM   6031  C  C     . GLY B  1  200 ? 20.804  32.712 37.131 1.00 21.60 ? 227  GLY B C     1 
ATOM   6032  O  O     . GLY B  1  200 ? 21.504  33.696 36.872 1.00 21.66 ? 227  GLY B O     1 
ATOM   6033  N  N     . VAL B  1  201 ? 19.495  32.777 37.329 1.00 21.08 ? 228  VAL B N     1 
ATOM   6034  C  CA    . VAL B  1  201 ? 18.732  33.987 37.071 1.00 20.99 ? 228  VAL B CA    1 
ATOM   6035  C  C     . VAL B  1  201 ? 18.687  34.840 38.340 1.00 20.74 ? 228  VAL B C     1 
ATOM   6036  O  O     . VAL B  1  201 ? 17.720  34.806 39.088 1.00 20.77 ? 228  VAL B O     1 
ATOM   6037  C  CB    . VAL B  1  201 ? 17.301  33.632 36.554 1.00 20.90 ? 228  VAL B CB    1 
ATOM   6038  C  CG1   . VAL B  1  201 ? 16.558  34.865 36.102 1.00 19.54 ? 228  VAL B CG1   1 
ATOM   6039  C  CG2   . VAL B  1  201 ? 17.386  32.612 35.411 1.00 20.58 ? 228  VAL B CG2   1 
ATOM   6040  N  N     . ASP B  1  202 ? 19.759  35.589 38.575 1.00 20.98 ? 229  ASP B N     1 
ATOM   6041  C  CA    . ASP B  1  202 ? 19.851  36.462 39.742 1.00 20.74 ? 229  ASP B CA    1 
ATOM   6042  C  C     . ASP B  1  202 ? 19.753  37.928 39.339 1.00 20.01 ? 229  ASP B C     1 
ATOM   6043  O  O     . ASP B  1  202 ? 19.714  38.815 40.187 1.00 19.64 ? 229  ASP B O     1 
ATOM   6044  C  CB    . ASP B  1  202 ? 21.139  36.163 40.547 1.00 21.43 ? 229  ASP B CB    1 
ATOM   6045  C  CG    . ASP B  1  202 ? 22.422  36.393 39.751 1.00 23.11 ? 229  ASP B CG    1 
ATOM   6046  O  OD1   . ASP B  1  202 ? 22.371  36.881 38.598 1.00 23.17 ? 229  ASP B OD1   1 
ATOM   6047  O  OD2   . ASP B  1  202 ? 23.508  36.080 40.299 1.00 24.90 ? 229  ASP B OD2   1 
ATOM   6048  N  N     . LEU B  1  203 ? 19.702  38.160 38.028 1.00 19.88 ? 230  LEU B N     1 
ATOM   6049  C  CA    . LEU B  1  203 ? 19.672  39.499 37.426 1.00 19.55 ? 230  LEU B CA    1 
ATOM   6050  C  C     . LEU B  1  203 ? 20.884  40.371 37.758 1.00 19.56 ? 230  LEU B C     1 
ATOM   6051  O  O     . LEU B  1  203 ? 20.772  41.599 37.831 1.00 19.20 ? 230  LEU B O     1 
ATOM   6052  C  CB    . LEU B  1  203 ? 18.356  40.224 37.747 1.00 19.07 ? 230  LEU B CB    1 
ATOM   6053  C  CG    . LEU B  1  203 ? 17.184  40.002 36.784 1.00 19.88 ? 230  LEU B CG    1 
ATOM   6054  C  CD1   . LEU B  1  203 ? 16.801  38.512 36.600 1.00 19.35 ? 230  LEU B CD1   1 
ATOM   6055  C  CD2   . LEU B  1  203 ? 15.987  40.813 37.262 1.00 19.53 ? 230  LEU B CD2   1 
ATOM   6056  N  N     . ASN B  1  204 ? 22.038  39.731 37.947 1.00 20.03 ? 231  ASN B N     1 
ATOM   6057  C  CA    . ASN B  1  204 ? 23.309  40.443 38.122 1.00 20.49 ? 231  ASN B CA    1 
ATOM   6058  C  C     . ASN B  1  204 ? 23.668  41.343 36.926 1.00 20.77 ? 231  ASN B C     1 
ATOM   6059  O  O     . ASN B  1  204 ? 24.435  42.295 37.072 1.00 20.97 ? 231  ASN B O     1 
ATOM   6060  C  CB    . ASN B  1  204 ? 24.453  39.463 38.415 1.00 21.17 ? 231  ASN B CB    1 
ATOM   6061  C  CG    . ASN B  1  204 ? 24.961  38.761 37.168 1.00 22.07 ? 231  ASN B CG    1 
ATOM   6062  O  OD1   . ASN B  1  204 ? 25.725  39.328 36.390 1.00 24.47 ? 231  ASN B OD1   1 
ATOM   6063  N  ND2   . ASN B  1  204 ? 24.559  37.515 36.988 1.00 21.94 ? 231  ASN B ND2   1 
ATOM   6064  N  N     . HIS B  1  205 ? 23.116  41.029 35.752 1.00 20.86 ? 232  HIS B N     1 
ATOM   6065  C  CA    . HIS B  1  205 ? 23.327  41.844 34.547 1.00 21.39 ? 232  HIS B CA    1 
ATOM   6066  C  C     . HIS B  1  205 ? 22.575  43.186 34.616 1.00 21.03 ? 232  HIS B C     1 
ATOM   6067  O  O     . HIS B  1  205 ? 22.845  44.101 33.839 1.00 21.60 ? 232  HIS B O     1 
ATOM   6068  C  CB    . HIS B  1  205 ? 22.997  41.047 33.268 1.00 21.46 ? 232  HIS B CB    1 
ATOM   6069  C  CG    . HIS B  1  205 ? 21.559  40.645 33.133 1.00 21.01 ? 232  HIS B CG    1 
ATOM   6070  N  ND1   . HIS B  1  205 ? 20.742  40.386 34.214 1.00 21.64 ? 232  HIS B ND1   1 
ATOM   6071  C  CD2   . HIS B  1  205 ? 20.803  40.421 32.031 1.00 19.93 ? 232  HIS B CD2   1 
ATOM   6072  C  CE1   . HIS B  1  205 ? 19.542  40.039 33.785 1.00 19.86 ? 232  HIS B CE1   1 
ATOM   6073  N  NE2   . HIS B  1  205 ? 19.550  40.060 32.464 1.00 20.99 ? 232  HIS B NE2   1 
ATOM   6074  N  N     . ILE B  1  206 ? 21.650  43.292 35.565 1.00 20.45 ? 233  ILE B N     1 
ATOM   6075  C  CA    . ILE B  1  206 ? 20.969  44.557 35.867 1.00 20.47 ? 233  ILE B CA    1 
ATOM   6076  C  C     . ILE B  1  206 ? 21.517  45.193 37.149 1.00 20.87 ? 233  ILE B C     1 
ATOM   6077  O  O     . ILE B  1  206 ? 21.752  46.407 37.193 1.00 21.06 ? 233  ILE B O     1 
ATOM   6078  C  CB    . ILE B  1  206 ? 19.431  44.364 36.020 1.00 19.89 ? 233  ILE B CB    1 
ATOM   6079  C  CG1   . ILE B  1  206 ? 18.798  43.974 34.680 1.00 19.58 ? 233  ILE B CG1   1 
ATOM   6080  C  CG2   . ILE B  1  206 ? 18.760  45.638 36.584 1.00 20.08 ? 233  ILE B CG2   1 
ATOM   6081  C  CD1   . ILE B  1  206 ? 17.456  43.228 34.829 1.00 17.33 ? 233  ILE B CD1   1 
ATOM   6082  N  N     . TYR B  1  207 ? 21.714  44.371 38.183 1.00 20.69 ? 234  TYR B N     1 
ATOM   6083  C  CA    . TYR B  1  207 ? 22.082  44.870 39.514 1.00 21.57 ? 234  TYR B CA    1 
ATOM   6084  C  C     . TYR B  1  207 ? 23.567  44.821 39.853 1.00 22.55 ? 234  TYR B C     1 
ATOM   6085  O  O     . TYR B  1  207 ? 23.988  45.403 40.853 1.00 23.65 ? 234  TYR B O     1 
ATOM   6086  C  CB    . TYR B  1  207 ? 21.291  44.125 40.600 1.00 20.70 ? 234  TYR B CB    1 
ATOM   6087  C  CG    . TYR B  1  207 ? 19.792  44.254 40.430 1.00 19.90 ? 234  TYR B CG    1 
ATOM   6088  C  CD1   . TYR B  1  207 ? 19.152  45.475 40.628 1.00 19.31 ? 234  TYR B CD1   1 
ATOM   6089  C  CD2   . TYR B  1  207 ? 19.016  43.154 40.056 1.00 18.58 ? 234  TYR B CD2   1 
ATOM   6090  C  CE1   . TYR B  1  207 ? 17.765  45.609 40.452 1.00 18.97 ? 234  TYR B CE1   1 
ATOM   6091  C  CE2   . TYR B  1  207 ? 17.628  43.271 39.884 1.00 18.20 ? 234  TYR B CE2   1 
ATOM   6092  C  CZ    . TYR B  1  207 ? 17.013  44.491 40.091 1.00 18.95 ? 234  TYR B CZ    1 
ATOM   6093  O  OH    . TYR B  1  207 ? 15.650  44.596 39.923 1.00 18.10 ? 234  TYR B OH    1 
ATOM   6094  N  N     . GLY B  1  208 ? 24.354  44.118 39.047 1.00 22.89 ? 235  GLY B N     1 
ATOM   6095  C  CA    . GLY B  1  208 ? 25.766  43.929 39.363 1.00 24.05 ? 235  GLY B CA    1 
ATOM   6096  C  C     . GLY B  1  208 ? 26.026  42.630 40.111 1.00 24.46 ? 235  GLY B C     1 
ATOM   6097  O  O     . GLY B  1  208 ? 25.189  42.160 40.912 1.00 23.84 ? 235  GLY B O     1 
ATOM   6098  N  N     . GLU B  1  209 ? 27.201  42.064 39.856 1.00 25.12 ? 236  GLU B N     1 
ATOM   6099  C  CA    . GLU B  1  209 ? 27.605  40.791 40.427 1.00 26.06 ? 236  GLU B CA    1 
ATOM   6100  C  C     . GLU B  1  209 ? 27.978  40.908 41.915 1.00 26.93 ? 236  GLU B C     1 
ATOM   6101  O  O     . GLU B  1  209 ? 27.709  39.996 42.699 1.00 27.13 ? 236  GLU B O     1 
ATOM   6102  C  CB    . GLU B  1  209 ? 28.760  40.201 39.604 1.00 26.86 ? 236  GLU B CB    1 
ATOM   6103  C  CG    . GLU B  1  209 ? 29.374  38.909 40.157 1.00 28.35 ? 236  GLU B CG    1 
ATOM   6104  C  CD    . GLU B  1  209 ? 28.485  37.686 39.994 1.00 27.63 ? 236  GLU B CD    1 
ATOM   6105  O  OE1   . GLU B  1  209 ? 27.627  37.674 39.083 1.00 26.66 ? 236  GLU B OE1   1 
ATOM   6106  O  OE2   . GLU B  1  209 ? 28.677  36.716 40.763 1.00 28.16 ? 236  GLU B OE2   1 
ATOM   6107  N  N     . THR B  1  210 ? 28.587  42.029 42.289 1.00 27.48 ? 237  THR B N     1 
ATOM   6108  C  CA    . THR B  1  210 ? 29.034  42.257 43.660 1.00 28.61 ? 237  THR B CA    1 
ATOM   6109  C  C     . THR B  1  210 ? 28.236  43.379 44.317 1.00 28.25 ? 237  THR B C     1 
ATOM   6110  O  O     . THR B  1  210 ? 27.624  44.219 43.635 1.00 27.56 ? 237  THR B O     1 
ATOM   6111  C  CB    . THR B  1  210 ? 30.537  42.647 43.725 1.00 29.95 ? 237  THR B CB    1 
ATOM   6112  O  OG1   . THR B  1  210 ? 30.726  43.917 43.094 1.00 30.56 ? 237  THR B OG1   1 
ATOM   6113  C  CG2   . THR B  1  210 ? 31.417  41.609 43.039 1.00 30.81 ? 237  THR B CG2   1 
ATOM   6114  N  N     . LEU B  1  211 ? 28.277  43.403 45.646 1.00 28.77 ? 238  LEU B N     1 
ATOM   6115  C  CA    . LEU B  1  211 ? 27.530  44.382 46.431 1.00 28.77 ? 238  LEU B CA    1 
ATOM   6116  C  C     . LEU B  1  211 ? 28.037  45.815 46.219 1.00 29.36 ? 238  LEU B C     1 
ATOM   6117  O  O     . LEU B  1  211 ? 27.243  46.753 46.210 1.00 28.82 ? 238  LEU B O     1 
ATOM   6118  C  CB    . LEU B  1  211 ? 27.559  44.005 47.917 1.00 29.22 ? 238  LEU B CB    1 
ATOM   6119  C  CG    . LEU B  1  211 ? 26.651  44.788 48.870 1.00 29.73 ? 238  LEU B CG    1 
ATOM   6120  C  CD1   . LEU B  1  211 ? 25.183  44.641 48.489 1.00 28.79 ? 238  LEU B CD1   1 
ATOM   6121  C  CD2   . LEU B  1  211 ? 26.886  44.367 50.321 1.00 31.32 ? 238  LEU B CD2   1 
ATOM   6122  N  N     . ASP B  1  212 ? 29.352  45.965 46.058 1.00 30.50 ? 239  ASP B N     1 
ATOM   6123  C  CA    . ASP B  1  212 ? 29.979  47.253 45.740 1.00 31.91 ? 239  ASP B CA    1 
ATOM   6124  C  C     . ASP B  1  212 ? 29.364  47.852 44.472 1.00 30.33 ? 239  ASP B C     1 
ATOM   6125  O  O     . ASP B  1  212 ? 28.960  49.016 44.456 1.00 30.15 ? 239  ASP B O     1 
ATOM   6126  C  CB    . ASP B  1  212 ? 31.500  47.088 45.540 1.00 33.89 ? 239  ASP B CB    1 
ATOM   6127  C  CG    . ASP B  1  212 ? 32.287  47.147 46.845 1.00 38.85 ? 239  ASP B CG    1 
ATOM   6128  O  OD1   . ASP B  1  212 ? 31.854  47.842 47.793 1.00 43.11 ? 239  ASP B OD1   1 
ATOM   6129  O  OD2   . ASP B  1  212 ? 33.373  46.516 46.924 1.00 45.08 ? 239  ASP B OD2   1 
ATOM   6130  N  N     . ARG B  1  213 ? 29.302  47.043 43.416 1.00 28.89 ? 240  ARG B N     1 
ATOM   6131  C  CA    . ARG B  1  213 ? 28.775  47.479 42.128 1.00 27.50 ? 240  ARG B CA    1 
ATOM   6132  C  C     . ARG B  1  213 ? 27.284  47.830 42.247 1.00 26.29 ? 240  ARG B C     1 
ATOM   6133  O  O     . ARG B  1  213 ? 26.851  48.876 41.758 1.00 25.48 ? 240  ARG B O     1 
ATOM   6134  C  CB    . ARG B  1  213 ? 29.028  46.403 41.065 1.00 27.24 ? 240  ARG B CB    1 
ATOM   6135  C  CG    . ARG B  1  213 ? 28.706  46.810 39.640 1.00 26.40 ? 240  ARG B CG    1 
ATOM   6136  C  CD    . ARG B  1  213 ? 29.096  45.704 38.666 1.00 26.06 ? 240  ARG B CD    1 
ATOM   6137  N  NE    . ARG B  1  213 ? 28.813  46.079 37.284 1.00 26.08 ? 240  ARG B NE    1 
ATOM   6138  C  CZ    . ARG B  1  213 ? 29.666  46.722 36.491 1.00 26.97 ? 240  ARG B CZ    1 
ATOM   6139  N  NH1   . ARG B  1  213 ? 30.864  47.071 36.943 1.00 26.28 ? 240  ARG B NH1   1 
ATOM   6140  N  NH2   . ARG B  1  213 ? 29.312  47.034 35.244 1.00 26.24 ? 240  ARG B NH2   1 
ATOM   6141  N  N     . GLN B  1  214 ? 26.525  46.978 42.939 1.00 25.03 ? 241  GLN B N     1 
ATOM   6142  C  CA    . GLN B  1  214 ? 25.097  47.217 43.172 1.00 24.25 ? 241  GLN B CA    1 
ATOM   6143  C  C     . GLN B  1  214 ? 24.875  48.564 43.841 1.00 24.35 ? 241  GLN B C     1 
ATOM   6144  O  O     . GLN B  1  214 ? 24.017  49.332 43.423 1.00 24.16 ? 241  GLN B O     1 
ATOM   6145  C  CB    . GLN B  1  214 ? 24.481  46.117 44.043 1.00 23.28 ? 241  GLN B CB    1 
ATOM   6146  C  CG    . GLN B  1  214 ? 23.002  46.338 44.343 1.00 23.67 ? 241  GLN B CG    1 
ATOM   6147  C  CD    . GLN B  1  214 ? 22.549  45.587 45.585 1.00 25.33 ? 241  GLN B CD    1 
ATOM   6148  O  OE1   . GLN B  1  214 ? 22.158  46.199 46.584 1.00 23.94 ? 241  GLN B OE1   1 
ATOM   6149  N  NE2   . GLN B  1  214 ? 22.627  44.256 45.538 1.00 22.96 ? 241  GLN B NE2   1 
ATOM   6150  N  N     . HIS B  1  215 ? 25.662  48.835 44.876 1.00 24.89 ? 242  HIS B N     1 
ATOM   6151  C  CA    . HIS B  1  215 ? 25.541  50.073 45.624 1.00 25.84 ? 242  HIS B CA    1 
ATOM   6152  C  C     . HIS B  1  215 ? 25.882  51.308 44.784 1.00 26.42 ? 242  HIS B C     1 
ATOM   6153  O  O     . HIS B  1  215 ? 25.260  52.350 44.948 1.00 26.75 ? 242  HIS B O     1 
ATOM   6154  C  CB    . HIS B  1  215 ? 26.339  49.991 46.926 1.00 26.91 ? 242  HIS B CB    1 
ATOM   6155  C  CG    . HIS B  1  215 ? 25.649  49.200 48.003 1.00 26.62 ? 242  HIS B CG    1 
ATOM   6156  N  ND1   . HIS B  1  215 ? 26.071  49.201 49.314 1.00 28.03 ? 242  HIS B ND1   1 
ATOM   6157  C  CD2   . HIS B  1  215 ? 24.555  48.400 47.963 1.00 25.50 ? 242  HIS B CD2   1 
ATOM   6158  C  CE1   . HIS B  1  215 ? 25.272  48.434 50.036 1.00 28.32 ? 242  HIS B CE1   1 
ATOM   6159  N  NE2   . HIS B  1  215 ? 24.342  47.936 49.239 1.00 27.54 ? 242  HIS B NE2   1 
ATOM   6160  N  N     . LYS B  1  216 ? 26.834  51.183 43.863 1.00 26.89 ? 243  LYS B N     1 
ATOM   6161  C  CA    . LYS B  1  216 ? 27.162  52.295 42.957 1.00 27.98 ? 243  LYS B CA    1 
ATOM   6162  C  C     . LYS B  1  216 ? 26.040  52.536 41.944 1.00 26.95 ? 243  LYS B C     1 
ATOM   6163  O  O     . LYS B  1  216 ? 25.857  53.651 41.472 1.00 27.69 ? 243  LYS B O     1 
ATOM   6164  C  CB    . LYS B  1  216 ? 28.465  52.038 42.208 1.00 28.65 ? 243  LYS B CB    1 
ATOM   6165  C  CG    . LYS B  1  216 ? 29.725  52.106 43.044 1.00 31.39 ? 243  LYS B CG    1 
ATOM   6166  C  CD    . LYS B  1  216 ? 30.878  51.613 42.205 1.00 34.62 ? 243  LYS B CD    1 
ATOM   6167  C  CE    . LYS B  1  216 ? 32.212  52.039 42.766 1.00 38.27 ? 243  LYS B CE    1 
ATOM   6168  N  NZ    . LYS B  1  216 ? 33.302  51.372 41.997 1.00 40.85 ? 243  LYS B NZ    1 
ATOM   6169  N  N     . LEU B  1  217 ? 25.305  51.478 41.615 1.00 25.55 ? 244  LEU B N     1 
ATOM   6170  C  CA    . LEU B  1  217 ? 24.199  51.572 40.671 1.00 25.09 ? 244  LEU B CA    1 
ATOM   6171  C  C     . LEU B  1  217 ? 22.898  52.101 41.298 1.00 24.92 ? 244  LEU B C     1 
ATOM   6172  O  O     . LEU B  1  217 ? 22.029  52.586 40.582 1.00 24.72 ? 244  LEU B O     1 
ATOM   6173  C  CB    . LEU B  1  217 ? 23.954  50.217 40.000 1.00 23.66 ? 244  LEU B CB    1 
ATOM   6174  C  CG    . LEU B  1  217 ? 25.041  49.765 39.026 1.00 24.15 ? 244  LEU B CG    1 
ATOM   6175  C  CD1   . LEU B  1  217 ? 24.910  48.287 38.703 1.00 24.06 ? 244  LEU B CD1   1 
ATOM   6176  C  CD2   . LEU B  1  217 ? 24.990  50.624 37.754 1.00 25.62 ? 244  LEU B CD2   1 
ATOM   6177  N  N     . ARG B  1  218 ? 22.768  51.999 42.621 1.00 25.03 ? 245  ARG B N     1 
ATOM   6178  C  CA    . ARG B  1  218 ? 21.508  52.329 43.298 1.00 25.19 ? 245  ARG B CA    1 
ATOM   6179  C  C     . ARG B  1  218 ? 21.373  53.802 43.656 1.00 26.43 ? 245  ARG B C     1 
ATOM   6180  O  O     . ARG B  1  218 ? 22.350  54.460 44.009 1.00 27.05 ? 245  ARG B O     1 
ATOM   6181  C  CB    . ARG B  1  218 ? 21.323  51.476 44.556 1.00 24.69 ? 245  ARG B CB    1 
ATOM   6182  C  CG    . ARG B  1  218 ? 20.850  50.052 44.281 1.00 23.58 ? 245  ARG B CG    1 
ATOM   6183  C  CD    . ARG B  1  218 ? 20.886  49.211 45.561 1.00 23.35 ? 245  ARG B CD    1 
ATOM   6184  N  NE    . ARG B  1  218 ? 20.048  49.782 46.617 1.00 23.64 ? 245  ARG B NE    1 
ATOM   6185  C  CZ    . ARG B  1  218 ? 19.937  49.282 47.847 1.00 25.09 ? 245  ARG B CZ    1 
ATOM   6186  N  NH1   . ARG B  1  218 ? 20.619  48.193 48.196 1.00 23.08 ? 245  ARG B NH1   1 
ATOM   6187  N  NH2   . ARG B  1  218 ? 19.141  49.873 48.733 1.00 22.64 ? 245  ARG B NH2   1 
ATOM   6188  N  N     . LEU B  1  219 ? 20.141  54.298 43.579 1.00 27.05 ? 246  LEU B N     1 
ATOM   6189  C  CA    . LEU B  1  219 ? 19.826  55.674 43.971 1.00 28.90 ? 246  LEU B CA    1 
ATOM   6190  C  C     . LEU B  1  219 ? 19.774  55.845 45.497 1.00 29.67 ? 246  LEU B C     1 
ATOM   6191  O  O     . LEU B  1  219 ? 20.032  56.930 46.004 1.00 30.99 ? 246  LEU B O     1 
ATOM   6192  C  CB    . LEU B  1  219 ? 18.496  56.108 43.330 1.00 28.88 ? 246  LEU B CB    1 
ATOM   6193  C  CG    . LEU B  1  219 ? 18.030  57.570 43.381 1.00 30.83 ? 246  LEU B CG    1 
ATOM   6194  C  CD1   . LEU B  1  219 ? 19.021  58.512 42.700 1.00 31.13 ? 246  LEU B CD1   1 
ATOM   6195  C  CD2   . LEU B  1  219 ? 16.646  57.699 42.743 1.00 30.84 ? 246  LEU B CD2   1 
ATOM   6196  N  N     . PHE B  1  220 ? 19.454  54.766 46.217 1.00 29.37 ? 247  PHE B N     1 
ATOM   6197  C  CA    . PHE B  1  220 ? 19.224  54.802 47.676 1.00 30.24 ? 247  PHE B CA    1 
ATOM   6198  C  C     . PHE B  1  220 ? 18.050  55.689 48.089 1.00 31.18 ? 247  PHE B C     1 
ATOM   6199  O  O     . PHE B  1  220 ? 17.963  56.170 49.222 1.00 32.45 ? 247  PHE B O     1 
ATOM   6200  C  CB    . PHE B  1  220 ? 20.511  55.096 48.467 1.00 31.07 ? 247  PHE B CB    1 
ATOM   6201  C  CG    . PHE B  1  220 ? 21.490  53.950 48.451 1.00 30.51 ? 247  PHE B CG    1 
ATOM   6202  C  CD1   . PHE B  1  220 ? 21.241  52.794 49.189 1.00 30.43 ? 247  PHE B CD1   1 
ATOM   6203  C  CD2   . PHE B  1  220 ? 22.634  54.009 47.667 1.00 30.50 ? 247  PHE B CD2   1 
ATOM   6204  C  CE1   . PHE B  1  220 ? 22.131  51.720 49.158 1.00 30.07 ? 247  PHE B CE1   1 
ATOM   6205  C  CE2   . PHE B  1  220 ? 23.534  52.941 47.636 1.00 29.90 ? 247  PHE B CE2   1 
ATOM   6206  C  CZ    . PHE B  1  220 ? 23.279  51.798 48.379 1.00 29.95 ? 247  PHE B CZ    1 
ATOM   6207  N  N     . LYS B  1  221 ? 17.144  55.887 47.144 1.00 31.03 ? 248  LYS B N     1 
ATOM   6208  C  CA    . LYS B  1  221 ? 15.877  56.538 47.393 1.00 31.70 ? 248  LYS B CA    1 
ATOM   6209  C  C     . LYS B  1  221 ? 14.811  55.719 46.681 1.00 30.39 ? 248  LYS B C     1 
ATOM   6210  O  O     . LYS B  1  221 ? 14.988  55.339 45.519 1.00 29.45 ? 248  LYS B O     1 
ATOM   6211  C  CB    . LYS B  1  221 ? 15.909  57.983 46.889 1.00 33.07 ? 248  LYS B CB    1 
ATOM   6212  C  CG    . LYS B  1  221 ? 14.608  58.745 47.082 1.00 36.53 ? 248  LYS B CG    1 
ATOM   6213  C  CD    . LYS B  1  221 ? 14.747  60.200 46.646 1.00 40.43 ? 248  LYS B CD    1 
ATOM   6214  C  CE    . LYS B  1  221 ? 13.387  60.859 46.451 1.00 41.64 ? 248  LYS B CE    1 
ATOM   6215  N  NZ    . LYS B  1  221 ? 13.542  62.210 45.820 1.00 44.06 ? 248  LYS B NZ    1 
ATOM   6216  N  N     . ASP B  1  222 ? 13.734  55.417 47.410 1.00 30.31 ? 249  ASP B N     1 
ATOM   6217  C  CA    . ASP B  1  222 ? 12.563  54.680 46.907 1.00 29.04 ? 249  ASP B CA    1 
ATOM   6218  C  C     . ASP B  1  222 ? 12.852  53.283 46.320 1.00 27.17 ? 249  ASP B C     1 
ATOM   6219  O  O     . ASP B  1  222 ? 12.047  52.745 45.558 1.00 25.97 ? 249  ASP B O     1 
ATOM   6220  C  CB    . ASP B  1  222 ? 11.767  55.552 45.927 1.00 30.01 ? 249  ASP B CB    1 
ATOM   6221  C  CG    . ASP B  1  222 ? 11.299  56.856 46.555 1.00 32.33 ? 249  ASP B CG    1 
ATOM   6222  O  OD1   . ASP B  1  222 ? 11.181  56.916 47.794 1.00 33.99 ? 249  ASP B OD1   1 
ATOM   6223  O  OD2   . ASP B  1  222 ? 11.063  57.828 45.810 1.00 35.61 ? 249  ASP B OD2   1 
ATOM   6224  N  N     . GLY B  1  223 ? 13.986  52.700 46.703 1.00 26.09 ? 250  GLY B N     1 
ATOM   6225  C  CA    . GLY B  1  223 ? 14.404  51.393 46.202 1.00 24.80 ? 250  GLY B CA    1 
ATOM   6226  C  C     . GLY B  1  223 ? 14.970  51.431 44.791 1.00 24.36 ? 250  GLY B C     1 
ATOM   6227  O  O     . GLY B  1  223 ? 15.310  50.384 44.227 1.00 23.72 ? 250  GLY B O     1 
ATOM   6228  N  N     . LYS B  1  224 ? 15.086  52.634 44.232 1.00 24.35 ? 251  LYS B N     1 
ATOM   6229  C  CA    . LYS B  1  224 ? 15.405  52.813 42.812 1.00 24.41 ? 251  LYS B CA    1 
ATOM   6230  C  C     . LYS B  1  224 ? 16.870  52.636 42.397 1.00 24.57 ? 251  LYS B C     1 
ATOM   6231  O  O     . LYS B  1  224 ? 17.793  52.685 43.221 1.00 24.88 ? 251  LYS B O     1 
ATOM   6232  C  CB    . LYS B  1  224 ? 14.850  54.152 42.302 1.00 25.26 ? 251  LYS B CB    1 
ATOM   6233  C  CG    . LYS B  1  224 ? 13.332  54.132 42.171 1.00 24.73 ? 251  LYS B CG    1 
ATOM   6234  C  CD    . LYS B  1  224 ? 12.752  55.457 41.693 1.00 25.87 ? 251  LYS B CD    1 
ATOM   6235  C  CE    . LYS B  1  224 ? 11.280  55.292 41.385 1.00 25.21 ? 251  LYS B CE    1 
ATOM   6236  N  NZ    . LYS B  1  224 ? 10.568  56.598 41.321 1.00 26.84 ? 251  LYS B NZ    1 
ATOM   6237  N  N     . LEU B  1  225 ? 17.053  52.425 41.095 1.00 24.51 ? 252  LEU B N     1 
ATOM   6238  C  CA    . LEU B  1  225 ? 18.354  52.452 40.448 1.00 24.56 ? 252  LEU B CA    1 
ATOM   6239  C  C     . LEU B  1  225 ? 18.607  53.853 39.914 1.00 25.66 ? 252  LEU B C     1 
ATOM   6240  O  O     . LEU B  1  225 ? 17.666  54.526 39.492 1.00 26.06 ? 252  LEU B O     1 
ATOM   6241  C  CB    . LEU B  1  225 ? 18.376  51.453 39.280 1.00 23.95 ? 252  LEU B CB    1 
ATOM   6242  C  CG    . LEU B  1  225 ? 18.408  49.954 39.618 1.00 23.45 ? 252  LEU B CG    1 
ATOM   6243  C  CD1   . LEU B  1  225 ? 18.181  49.112 38.364 1.00 21.83 ? 252  LEU B CD1   1 
ATOM   6244  C  CD2   . LEU B  1  225 ? 19.714  49.586 40.288 1.00 23.73 ? 252  LEU B CD2   1 
ATOM   6245  N  N     . LYS B  1  226 ? 19.869  54.286 39.930 1.00 26.28 ? 253  LYS B N     1 
ATOM   6246  C  CA    . LYS B  1  226 ? 20.277  55.544 39.296 1.00 27.72 ? 253  LYS B CA    1 
ATOM   6247  C  C     . LYS B  1  226 ? 19.960  55.539 37.800 1.00 27.51 ? 253  LYS B C     1 
ATOM   6248  O  O     . LYS B  1  226 ? 19.993  54.495 37.142 1.00 26.58 ? 253  LYS B O     1 
ATOM   6249  C  CB    . LYS B  1  226 ? 21.783  55.789 39.474 1.00 28.56 ? 253  LYS B CB    1 
ATOM   6250  C  CG    . LYS B  1  226 ? 22.226  56.280 40.852 1.00 30.47 ? 253  LYS B CG    1 
ATOM   6251  C  CD    . LYS B  1  226 ? 23.734  56.516 40.845 1.00 33.85 ? 253  LYS B CD    1 
ATOM   6252  C  CE    . LYS B  1  226 ? 24.305  56.653 42.255 1.00 36.73 ? 253  LYS B CE    1 
ATOM   6253  N  NZ    . LYS B  1  226 ? 25.711  56.098 42.363 1.00 37.31 ? 253  LYS B NZ    1 
ATOM   6254  N  N     . TYR B  1  227 ? 19.676  56.717 37.266 1.00 28.30 ? 254  TYR B N     1 
ATOM   6255  C  CA    . TYR B  1  227 ? 19.352  56.868 35.857 1.00 28.82 ? 254  TYR B CA    1 
ATOM   6256  C  C     . TYR B  1  227 ? 19.684  58.288 35.409 1.00 30.70 ? 254  TYR B C     1 
ATOM   6257  O  O     . TYR B  1  227 ? 19.973  59.148 36.236 1.00 31.56 ? 254  TYR B O     1 
ATOM   6258  C  CB    . TYR B  1  227 ? 17.863  56.597 35.638 1.00 27.80 ? 254  TYR B CB    1 
ATOM   6259  C  CG    . TYR B  1  227 ? 16.960  57.519 36.423 1.00 28.29 ? 254  TYR B CG    1 
ATOM   6260  C  CD1   . TYR B  1  227 ? 16.448  58.688 35.842 1.00 29.34 ? 254  TYR B CD1   1 
ATOM   6261  C  CD2   . TYR B  1  227 ? 16.622  57.234 37.744 1.00 26.84 ? 254  TYR B CD2   1 
ATOM   6262  C  CE1   . TYR B  1  227 ? 15.623  59.540 36.557 1.00 30.33 ? 254  TYR B CE1   1 
ATOM   6263  C  CE2   . TYR B  1  227 ? 15.799  58.081 38.471 1.00 28.29 ? 254  TYR B CE2   1 
ATOM   6264  C  CZ    . TYR B  1  227 ? 15.300  59.225 37.873 1.00 30.35 ? 254  TYR B CZ    1 
ATOM   6265  O  OH    . TYR B  1  227 ? 14.488  60.062 38.591 1.00 31.72 ? 254  TYR B OH    1 
ATOM   6266  N  N     . GLN B  1  228 ? 19.618  58.531 34.103 1.00 31.70 ? 255  GLN B N     1 
ATOM   6267  C  CA    . GLN B  1  228 ? 19.663  59.892 33.575 1.00 33.87 ? 255  GLN B CA    1 
ATOM   6268  C  C     . GLN B  1  228 ? 18.459  60.135 32.668 1.00 34.25 ? 255  GLN B C     1 
ATOM   6269  O  O     . GLN B  1  228 ? 17.797  59.190 32.233 1.00 33.45 ? 255  GLN B O     1 
ATOM   6270  C  CB    . GLN B  1  228 ? 20.978  60.165 32.827 1.00 34.96 ? 255  GLN B CB    1 
ATOM   6271  C  CG    . GLN B  1  228 ? 21.143  59.363 31.538 1.00 35.56 ? 255  GLN B CG    1 
ATOM   6272  C  CD    . GLN B  1  228 ? 22.511  59.527 30.910 1.00 36.52 ? 255  GLN B CD    1 
ATOM   6273  O  OE1   . GLN B  1  228 ? 22.897  60.623 30.516 1.00 38.91 ? 255  GLN B OE1   1 
ATOM   6274  N  NE2   . GLN B  1  228 ? 23.246  58.427 30.800 1.00 36.12 ? 255  GLN B NE2   1 
ATOM   6275  N  N     . VAL B  1  229 ? 18.170  61.405 32.408 1.00 35.72 ? 256  VAL B N     1 
ATOM   6276  C  CA    . VAL B  1  229 ? 17.101  61.774 31.495 1.00 36.36 ? 256  VAL B CA    1 
ATOM   6277  C  C     . VAL B  1  229 ? 17.691  62.480 30.279 1.00 37.93 ? 256  VAL B C     1 
ATOM   6278  O  O     . VAL B  1  229 ? 18.295  63.538 30.409 1.00 39.69 ? 256  VAL B O     1 
ATOM   6279  C  CB    . VAL B  1  229 ? 16.049  62.667 32.171 1.00 36.87 ? 256  VAL B CB    1 
ATOM   6280  C  CG1   . VAL B  1  229 ? 14.908  62.951 31.214 1.00 37.67 ? 256  VAL B CG1   1 
ATOM   6281  C  CG2   . VAL B  1  229 ? 15.527  62.005 33.447 1.00 35.88 ? 256  VAL B CG2   1 
ATOM   6282  N  N     . ILE B  1  230 ? 17.528  61.873 29.107 1.00 37.71 ? 257  ILE B N     1 
ATOM   6283  C  CA    . ILE B  1  230 ? 17.974  62.466 27.848 1.00 39.03 ? 257  ILE B CA    1 
ATOM   6284  C  C     . ILE B  1  230 ? 16.756  62.680 26.953 1.00 39.60 ? 257  ILE B C     1 
ATOM   6285  O  O     . ILE B  1  230 ? 16.090  61.722 26.561 1.00 38.94 ? 257  ILE B O     1 
ATOM   6286  C  CB    . ILE B  1  230 ? 19.027  61.570 27.131 1.00 38.58 ? 257  ILE B CB    1 
ATOM   6287  C  CG1   . ILE B  1  230 ? 20.178  61.221 28.088 1.00 37.85 ? 257  ILE B CG1   1 
ATOM   6288  C  CG2   . ILE B  1  230 ? 19.551  62.255 25.862 1.00 40.01 ? 257  ILE B CG2   1 
ATOM   6289  C  CD1   . ILE B  1  230 ? 21.033  60.048 27.643 1.00 36.47 ? 257  ILE B CD1   1 
ATOM   6290  N  N     . GLY B  1  231 ? 16.472  63.944 26.652 1.00 41.27 ? 258  GLY B N     1 
ATOM   6291  C  CA    . GLY B  1  231 ? 15.316  64.339 25.840 1.00 42.11 ? 258  GLY B CA    1 
ATOM   6292  C  C     . GLY B  1  231 ? 13.995  63.823 26.379 1.00 40.79 ? 258  GLY B C     1 
ATOM   6293  O  O     . GLY B  1  231 ? 13.146  63.370 25.615 1.00 40.87 ? 258  GLY B O     1 
ATOM   6294  N  N     . GLY B  1  232 ? 13.838  63.878 27.701 1.00 39.55 ? 259  GLY B N     1 
ATOM   6295  C  CA    . GLY B  1  232 ? 12.638  63.394 28.364 1.00 38.37 ? 259  GLY B CA    1 
ATOM   6296  C  C     . GLY B  1  232 ? 12.567  61.886 28.531 1.00 36.25 ? 259  GLY B C     1 
ATOM   6297  O  O     . GLY B  1  232 ? 11.584  61.370 29.057 1.00 35.42 ? 259  GLY B O     1 
ATOM   6298  N  N     . GLU B  1  233 ? 13.605  61.180 28.088 1.00 35.26 ? 260  GLU B N     1 
ATOM   6299  C  CA    . GLU B  1  233 ? 13.628  59.716 28.135 1.00 33.55 ? 260  GLU B CA    1 
ATOM   6300  C  C     . GLU B  1  233 ? 14.592  59.221 29.204 1.00 31.82 ? 260  GLU B C     1 
ATOM   6301  O  O     . GLU B  1  233 ? 15.678  59.778 29.368 1.00 32.23 ? 260  GLU B O     1 
ATOM   6302  C  CB    . GLU B  1  233 ? 14.024  59.145 26.773 1.00 33.88 ? 260  GLU B CB    1 
ATOM   6303  C  CG    . GLU B  1  233 ? 12.981  59.340 25.679 1.00 37.12 ? 260  GLU B CG    1 
ATOM   6304  C  CD    . GLU B  1  233 ? 11.860  58.329 25.775 1.00 40.65 ? 260  GLU B CD    1 
ATOM   6305  O  OE1   . GLU B  1  233 ? 12.150  57.106 25.846 1.00 40.81 ? 260  GLU B OE1   1 
ATOM   6306  O  OE2   . GLU B  1  233 ? 10.686  58.757 25.783 1.00 43.02 ? 260  GLU B OE2   1 
ATOM   6307  N  N     . VAL B  1  234 ? 14.198  58.173 29.922 1.00 29.90 ? 261  VAL B N     1 
ATOM   6308  C  CA    . VAL B  1  234 ? 15.032  57.607 30.985 1.00 28.68 ? 261  VAL B CA    1 
ATOM   6309  C  C     . VAL B  1  234 ? 16.044  56.598 30.429 1.00 28.49 ? 261  VAL B C     1 
ATOM   6310  O  O     . VAL B  1  234 ? 15.670  55.626 29.762 1.00 27.69 ? 261  VAL B O     1 
ATOM   6311  C  CB    . VAL B  1  234 ? 14.172  56.952 32.110 1.00 27.86 ? 261  VAL B CB    1 
ATOM   6312  C  CG1   . VAL B  1  234 ? 15.051  56.219 33.131 1.00 25.70 ? 261  VAL B CG1   1 
ATOM   6313  C  CG2   . VAL B  1  234 ? 13.300  58.010 32.805 1.00 27.96 ? 261  VAL B CG2   1 
ATOM   6314  N  N     . TYR B  1  235 ? 17.323  56.839 30.711 1.00 28.76 ? 262  TYR B N     1 
ATOM   6315  C  CA    . TYR B  1  235 ? 18.389  55.921 30.321 1.00 28.79 ? 262  TYR B CA    1 
ATOM   6316  C  C     . TYR B  1  235 ? 19.248  55.562 31.533 1.00 28.38 ? 262  TYR B C     1 
ATOM   6317  O  O     . TYR B  1  235 ? 19.145  56.219 32.562 1.00 28.72 ? 262  TYR B O     1 
ATOM   6318  C  CB    . TYR B  1  235 ? 19.247  56.557 29.223 1.00 30.23 ? 262  TYR B CB    1 
ATOM   6319  C  CG    . TYR B  1  235 ? 18.538  56.667 27.894 1.00 30.68 ? 262  TYR B CG    1 
ATOM   6320  C  CD1   . TYR B  1  235 ? 18.430  55.563 27.053 1.00 29.95 ? 262  TYR B CD1   1 
ATOM   6321  C  CD2   . TYR B  1  235 ? 17.980  57.876 27.474 1.00 32.77 ? 262  TYR B CD2   1 
ATOM   6322  C  CE1   . TYR B  1  235 ? 17.784  55.644 25.832 1.00 30.88 ? 262  TYR B CE1   1 
ATOM   6323  C  CE2   . TYR B  1  235 ? 17.322  57.973 26.241 1.00 33.95 ? 262  TYR B CE2   1 
ATOM   6324  C  CZ    . TYR B  1  235 ? 17.228  56.845 25.430 1.00 33.60 ? 262  TYR B CZ    1 
ATOM   6325  O  OH    . TYR B  1  235 ? 16.594  56.912 24.211 1.00 36.30 ? 262  TYR B OH    1 
ATOM   6326  N  N     . PRO B  1  236 ? 20.093  54.516 31.425 1.00 28.28 ? 263  PRO B N     1 
ATOM   6327  C  CA    . PRO B  1  236 ? 21.025  54.213 32.516 1.00 28.18 ? 263  PRO B CA    1 
ATOM   6328  C  C     . PRO B  1  236 ? 21.984  55.378 32.772 1.00 29.57 ? 263  PRO B C     1 
ATOM   6329  O  O     . PRO B  1  236 ? 22.217  56.181 31.868 1.00 30.51 ? 263  PRO B O     1 
ATOM   6330  C  CB    . PRO B  1  236 ? 21.806  53.005 31.977 1.00 27.79 ? 263  PRO B CB    1 
ATOM   6331  C  CG    . PRO B  1  236 ? 20.869  52.362 31.020 1.00 27.50 ? 263  PRO B CG    1 
ATOM   6332  C  CD    . PRO B  1  236 ? 20.200  53.520 30.342 1.00 28.04 ? 263  PRO B CD    1 
ATOM   6333  N  N     . PRO B  1  237 ? 22.555  55.461 33.990 1.00 29.88 ? 264  PRO B N     1 
ATOM   6334  C  CA    . PRO B  1  237 ? 23.492  56.549 34.284 1.00 31.36 ? 264  PRO B CA    1 
ATOM   6335  C  C     . PRO B  1  237 ? 24.849  56.326 33.597 1.00 32.27 ? 264  PRO B C     1 
ATOM   6336  O  O     . PRO B  1  237 ? 25.067  55.283 32.986 1.00 31.67 ? 264  PRO B O     1 
ATOM   6337  C  CB    . PRO B  1  237 ? 23.643  56.461 35.800 1.00 31.26 ? 264  PRO B CB    1 
ATOM   6338  C  CG    . PRO B  1  237 ? 23.472  54.981 36.102 1.00 29.96 ? 264  PRO B CG    1 
ATOM   6339  C  CD    . PRO B  1  237 ? 22.602  54.396 35.016 1.00 28.65 ? 264  PRO B CD    1 
ATOM   6340  N  N     . THR B  1  238 ? 25.758  57.285 33.707 1.00 34.14 ? 265  THR B N     1 
ATOM   6341  C  CA    . THR B  1  238 ? 27.075  57.132 33.100 1.00 35.66 ? 265  THR B CA    1 
ATOM   6342  C  C     . THR B  1  238 ? 28.084  56.473 34.040 1.00 36.10 ? 265  THR B C     1 
ATOM   6343  O  O     . THR B  1  238 ? 27.863  56.394 35.257 1.00 35.38 ? 265  THR B O     1 
ATOM   6344  C  CB    . THR B  1  238 ? 27.664  58.477 32.663 1.00 37.64 ? 265  THR B CB    1 
ATOM   6345  O  OG1   . THR B  1  238 ? 27.972  59.261 33.826 1.00 38.24 ? 265  THR B OG1   1 
ATOM   6346  C  CG2   . THR B  1  238 ? 26.690  59.231 31.753 1.00 38.31 ? 265  THR B CG2   1 
ATOM   6347  N  N     . VAL B  1  239 ? 29.187  56.013 33.447 1.00 37.21 ? 266  VAL B N     1 
ATOM   6348  C  CA    . VAL B  1  239 ? 30.365  55.529 34.163 1.00 38.48 ? 266  VAL B CA    1 
ATOM   6349  C  C     . VAL B  1  239 ? 30.930  56.635 35.061 1.00 40.62 ? 266  VAL B C     1 
ATOM   6350  O  O     . VAL B  1  239 ? 31.326  56.378 36.203 1.00 40.54 ? 266  VAL B O     1 
ATOM   6351  C  CB    . VAL B  1  239 ? 31.450  55.045 33.155 1.00 39.50 ? 266  VAL B CB    1 
ATOM   6352  C  CG1   . VAL B  1  239 ? 32.803  54.823 33.835 1.00 40.67 ? 266  VAL B CG1   1 
ATOM   6353  C  CG2   . VAL B  1  239 ? 30.988  53.783 32.436 1.00 37.75 ? 266  VAL B CG2   1 
ATOM   6354  N  N     . LYS B  1  240 ? 30.954  57.860 34.534 1.00 42.54 ? 267  LYS B N     1 
ATOM   6355  C  CA    . LYS B  1  240 ? 31.420  59.037 35.267 1.00 45.02 ? 267  LYS B CA    1 
ATOM   6356  C  C     . LYS B  1  240 ? 30.589  59.290 36.525 1.00 44.65 ? 267  LYS B C     1 
ATOM   6357  O  O     . LYS B  1  240 ? 31.141  59.567 37.589 1.00 45.66 ? 267  LYS B O     1 
ATOM   6358  C  CB    . LYS B  1  240 ? 31.405  60.268 34.347 1.00 46.63 ? 267  LYS B CB    1 
ATOM   6359  C  CG    . LYS B  1  240 ? 31.824  61.588 34.996 1.00 49.58 ? 267  LYS B CG    1 
ATOM   6360  C  CD    . LYS B  1  240 ? 33.334  61.722 35.092 1.00 51.68 ? 267  LYS B CD    1 
ATOM   6361  C  CE    . LYS B  1  240 ? 33.730  62.969 35.873 1.00 55.00 ? 267  LYS B CE    1 
ATOM   6362  N  NZ    . LYS B  1  240 ? 33.572  64.231 35.085 1.00 56.92 ? 267  LYS B NZ    1 
ATOM   6363  N  N     . ASP B  1  241 ? 29.268  59.185 36.392 1.00 43.66 ? 268  ASP B N     1 
ATOM   6364  C  CA    . ASP B  1  241 ? 28.331  59.422 37.492 1.00 43.52 ? 268  ASP B CA    1 
ATOM   6365  C  C     . ASP B  1  241 ? 28.419  58.336 38.568 1.00 42.08 ? 268  ASP B C     1 
ATOM   6366  O  O     . ASP B  1  241 ? 28.336  58.631 39.761 1.00 42.66 ? 268  ASP B O     1 
ATOM   6367  C  CB    . ASP B  1  241 ? 26.892  59.521 36.939 1.00 43.11 ? 268  ASP B CB    1 
ATOM   6368  C  CG    . ASP B  1  241 ? 25.824  59.750 38.028 1.00 44.55 ? 268  ASP B CG    1 
ATOM   6369  O  OD1   . ASP B  1  241 ? 26.147  60.232 39.141 1.00 48.46 ? 268  ASP B OD1   1 
ATOM   6370  O  OD2   . ASP B  1  241 ? 24.633  59.458 37.754 1.00 45.71 ? 268  ASP B OD2   1 
ATOM   6371  N  N     . THR B  1  242 ? 28.589  57.086 38.149 1.00 40.48 ? 269  THR B N     1 
ATOM   6372  C  CA    . THR B  1  242 ? 28.492  55.955 39.071 1.00 38.61 ? 269  THR B CA    1 
ATOM   6373  C  C     . THR B  1  242 ? 29.828  55.424 39.586 1.00 39.08 ? 269  THR B C     1 
ATOM   6374  O  O     . THR B  1  242 ? 29.878  54.819 40.653 1.00 38.35 ? 269  THR B O     1 
ATOM   6375  C  CB    . THR B  1  242 ? 27.743  54.780 38.431 1.00 37.05 ? 269  THR B CB    1 
ATOM   6376  O  OG1   . THR B  1  242 ? 28.363  54.443 37.187 1.00 36.42 ? 269  THR B OG1   1 
ATOM   6377  C  CG2   . THR B  1  242 ? 26.288  55.132 38.196 1.00 36.32 ? 269  THR B CG2   1 
ATOM   6378  N  N     . GLN B  1  243 ? 30.898  55.644 38.824 1.00 40.22 ? 270  GLN B N     1 
ATOM   6379  C  CA    . GLN B  1  243 ? 32.208  55.017 39.076 1.00 41.28 ? 270  GLN B CA    1 
ATOM   6380  C  C     . GLN B  1  243 ? 32.131  53.512 38.847 1.00 39.86 ? 270  GLN B C     1 
ATOM   6381  O  O     . GLN B  1  243 ? 32.956  52.752 39.344 1.00 40.18 ? 270  GLN B O     1 
ATOM   6382  C  CB    . GLN B  1  243 ? 32.730  55.335 40.487 1.00 42.24 ? 270  GLN B CB    1 
ATOM   6383  C  CG    . GLN B  1  243 ? 32.825  56.828 40.790 1.00 44.66 ? 270  GLN B CG    1 
ATOM   6384  C  CD    . GLN B  1  243 ? 33.730  57.547 39.819 1.00 48.41 ? 270  GLN B CD    1 
ATOM   6385  O  OE1   . GLN B  1  243 ? 33.264  58.266 38.934 1.00 49.51 ? 270  GLN B OE1   1 
ATOM   6386  N  NE2   . GLN B  1  243 ? 35.038  57.340 39.962 1.00 50.83 ? 270  GLN B NE2   1 
ATOM   6387  N  N     . VAL B  1  244 ? 31.116  53.098 38.094 1.00 38.48 ? 271  VAL B N     1 
ATOM   6388  C  CA    . VAL B  1  244 ? 30.918  51.703 37.736 1.00 37.52 ? 271  VAL B CA    1 
ATOM   6389  C  C     . VAL B  1  244 ? 31.757  51.425 36.494 1.00 38.43 ? 271  VAL B C     1 
ATOM   6390  O  O     . VAL B  1  244 ? 31.650  52.137 35.490 1.00 39.09 ? 271  VAL B O     1 
ATOM   6391  C  CB    . VAL B  1  244 ? 29.413  51.392 37.496 1.00 35.72 ? 271  VAL B CB    1 
ATOM   6392  C  CG1   . VAL B  1  244 ? 29.219  50.129 36.687 1.00 34.81 ? 271  VAL B CG1   1 
ATOM   6393  C  CG2   . VAL B  1  244 ? 28.682  51.285 38.814 1.00 35.26 ? 271  VAL B CG2   1 
ATOM   6394  N  N     . GLU B  1  245 ? 32.607  50.405 36.584 1.00 38.59 ? 272  GLU B N     1 
ATOM   6395  C  CA    . GLU B  1  245 ? 33.472  50.019 35.477 1.00 39.38 ? 272  GLU B CA    1 
ATOM   6396  C  C     . GLU B  1  245 ? 32.721  49.281 34.382 1.00 37.55 ? 272  GLU B C     1 
ATOM   6397  O  O     . GLU B  1  245 ? 31.923  48.374 34.652 1.00 36.28 ? 272  GLU B O     1 
ATOM   6398  C  CB    . GLU B  1  245 ? 34.639  49.176 35.972 1.00 40.46 ? 272  GLU B CB    1 
ATOM   6399  C  CG    . GLU B  1  245 ? 35.658  49.981 36.752 1.00 44.43 ? 272  GLU B CG    1 
ATOM   6400  C  CD    . GLU B  1  245 ? 36.972  49.252 36.911 1.00 48.48 ? 272  GLU B CD    1 
ATOM   6401  O  OE1   . GLU B  1  245 ? 36.943  48.040 37.228 1.00 49.41 ? 272  GLU B OE1   1 
ATOM   6402  O  OE2   . GLU B  1  245 ? 38.031  49.893 36.716 1.00 51.53 ? 272  GLU B OE2   1 
ATOM   6403  N  N     . MET B  1  246 ? 32.994  49.689 33.147 1.00 37.55 ? 273  MET B N     1 
ATOM   6404  C  CA    . MET B  1  246 ? 32.393  49.115 31.953 1.00 36.41 ? 273  MET B CA    1 
ATOM   6405  C  C     . MET B  1  246 ? 33.484  48.854 30.911 1.00 37.72 ? 273  MET B C     1 
ATOM   6406  O  O     . MET B  1  246 ? 34.555  49.478 30.957 1.00 39.05 ? 273  MET B O     1 
ATOM   6407  C  CB    . MET B  1  246 ? 31.355  50.084 31.372 1.00 36.00 ? 273  MET B CB    1 
ATOM   6408  C  CG    . MET B  1  246 ? 30.134  50.354 32.256 1.00 34.37 ? 273  MET B CG    1 
ATOM   6409  S  SD    . MET B  1  246 ? 29.031  48.937 32.418 1.00 31.77 ? 273  MET B SD    1 
ATOM   6410  C  CE    . MET B  1  246 ? 28.386  48.780 30.753 1.00 30.72 ? 273  MET B CE    1 
ATOM   6411  N  N     . ILE B  1  247 ? 33.213  47.938 29.978 1.00 36.90 ? 274  ILE B N     1 
ATOM   6412  C  CA    . ILE B  1  247 ? 34.107  47.719 28.841 1.00 38.26 ? 274  ILE B CA    1 
ATOM   6413  C  C     . ILE B  1  247 ? 33.651  48.584 27.669 1.00 38.81 ? 274  ILE B C     1 
ATOM   6414  O  O     . ILE B  1  247 ? 32.559  48.386 27.121 1.00 37.68 ? 274  ILE B O     1 
ATOM   6415  C  CB    . ILE B  1  247 ? 34.192  46.225 28.383 1.00 38.16 ? 274  ILE B CB    1 
ATOM   6416  C  CG1   . ILE B  1  247 ? 34.344  45.249 29.569 1.00 37.28 ? 274  ILE B CG1   1 
ATOM   6417  C  CG2   . ILE B  1  247 ? 35.288  46.038 27.311 1.00 39.65 ? 274  ILE B CG2   1 
ATOM   6418  C  CD1   . ILE B  1  247 ? 35.574  45.445 30.438 1.00 40.95 ? 274  ILE B CD1   1 
ATOM   6419  N  N     . TYR B  1  248 ? 34.489  49.554 27.312 1.00 40.33 ? 275  TYR B N     1 
ATOM   6420  C  CA    . TYR B  1  248 ? 34.273  50.408 26.142 1.00 41.50 ? 275  TYR B CA    1 
ATOM   6421  C  C     . TYR B  1  248 ? 35.596  50.658 25.430 1.00 43.88 ? 275  TYR B C     1 
ATOM   6422  O  O     . TYR B  1  248 ? 36.637  50.752 26.084 1.00 44.79 ? 275  TYR B O     1 
ATOM   6423  C  CB    . TYR B  1  248 ? 33.678  51.763 26.541 1.00 41.30 ? 275  TYR B CB    1 
ATOM   6424  C  CG    . TYR B  1  248 ? 32.212  51.736 26.888 1.00 39.55 ? 275  TYR B CG    1 
ATOM   6425  C  CD1   . TYR B  1  248 ? 31.234  51.654 25.891 1.00 39.44 ? 275  TYR B CD1   1 
ATOM   6426  C  CD2   . TYR B  1  248 ? 31.793  51.815 28.214 1.00 39.04 ? 275  TYR B CD2   1 
ATOM   6427  C  CE1   . TYR B  1  248 ? 29.875  51.633 26.215 1.00 37.27 ? 275  TYR B CE1   1 
ATOM   6428  C  CE2   . TYR B  1  248 ? 30.437  51.802 28.544 1.00 36.52 ? 275  TYR B CE2   1 
ATOM   6429  C  CZ    . TYR B  1  248 ? 29.484  51.708 27.544 1.00 36.68 ? 275  TYR B CZ    1 
ATOM   6430  O  OH    . TYR B  1  248 ? 28.132  51.688 27.884 1.00 35.88 ? 275  TYR B OH    1 
ATOM   6431  N  N     . PRO B  1  249 ? 35.564  50.759 24.088 1.00 45.04 ? 276  PRO B N     1 
ATOM   6432  C  CA    . PRO B  1  249 ? 36.738  51.251 23.371 1.00 47.79 ? 276  PRO B CA    1 
ATOM   6433  C  C     . PRO B  1  249 ? 37.064  52.674 23.833 1.00 49.35 ? 276  PRO B C     1 
ATOM   6434  O  O     . PRO B  1  249 ? 36.147  53.417 24.197 1.00 47.97 ? 276  PRO B O     1 
ATOM   6435  C  CB    . PRO B  1  249 ? 36.286  51.263 21.906 1.00 48.33 ? 276  PRO B CB    1 
ATOM   6436  C  CG    . PRO B  1  249 ? 35.147  50.332 21.837 1.00 46.06 ? 276  PRO B CG    1 
ATOM   6437  C  CD    . PRO B  1  249 ? 34.472  50.380 23.174 1.00 44.10 ? 276  PRO B CD    1 
ATOM   6438  N  N     . PRO B  1  250 ? 38.361  53.047 23.830 1.00 52.12 ? 277  PRO B N     1 
ATOM   6439  C  CA    . PRO B  1  250 ? 38.842  54.355 24.292 1.00 54.13 ? 277  PRO B CA    1 
ATOM   6440  C  C     . PRO B  1  250 ? 38.203  55.570 23.614 1.00 55.30 ? 277  PRO B C     1 
ATOM   6441  O  O     . PRO B  1  250 ? 38.163  56.642 24.218 1.00 56.29 ? 277  PRO B O     1 
ATOM   6442  C  CB    . PRO B  1  250 ? 40.337  54.311 23.954 1.00 56.60 ? 277  PRO B CB    1 
ATOM   6443  C  CG    . PRO B  1  250 ? 40.677  52.879 24.019 1.00 55.79 ? 277  PRO B CG    1 
ATOM   6444  C  CD    . PRO B  1  250 ? 39.485  52.172 23.446 1.00 53.54 ? 277  PRO B CD    1 
ATOM   6445  N  N     . HIS B  1  251 ? 37.721  55.415 22.381 1.00 55.78 ? 278  HIS B N     1 
ATOM   6446  C  CA    . HIS B  1  251 ? 37.133  56.539 21.642 1.00 56.87 ? 278  HIS B CA    1 
ATOM   6447  C  C     . HIS B  1  251 ? 35.689  56.877 22.056 1.00 54.67 ? 278  HIS B C     1 
ATOM   6448  O  O     . HIS B  1  251 ? 35.147  57.902 21.631 1.00 55.43 ? 278  HIS B O     1 
ATOM   6449  C  CB    . HIS B  1  251 ? 37.224  56.314 20.123 1.00 58.35 ? 278  HIS B CB    1 
ATOM   6450  C  CG    . HIS B  1  251 ? 36.463  55.118 19.638 1.00 58.06 ? 278  HIS B CG    1 
ATOM   6451  N  ND1   . HIS B  1  251 ? 35.098  55.132 19.441 1.00 57.59 ? 278  HIS B ND1   1 
ATOM   6452  C  CD2   . HIS B  1  251 ? 36.878  53.872 19.306 1.00 59.19 ? 278  HIS B CD2   1 
ATOM   6453  C  CE1   . HIS B  1  251 ? 34.703  53.945 19.015 1.00 56.68 ? 278  HIS B CE1   1 
ATOM   6454  N  NE2   . HIS B  1  251 ? 35.763  53.161 18.928 1.00 58.24 ? 278  HIS B NE2   1 
ATOM   6455  N  N     . ILE B  1  252 ? 35.066  56.021 22.867 1.00 52.03 ? 279  ILE B N     1 
ATOM   6456  C  CA    . ILE B  1  252 ? 33.678  56.255 23.290 1.00 49.90 ? 279  ILE B CA    1 
ATOM   6457  C  C     . ILE B  1  252 ? 33.598  57.434 24.267 1.00 50.35 ? 279  ILE B C     1 
ATOM   6458  O  O     . ILE B  1  252 ? 34.224  57.402 25.326 1.00 50.17 ? 279  ILE B O     1 
ATOM   6459  C  CB    . ILE B  1  252 ? 33.007  54.990 23.899 1.00 47.38 ? 279  ILE B CB    1 
ATOM   6460  C  CG1   . ILE B  1  252 ? 33.075  53.804 22.928 1.00 46.94 ? 279  ILE B CG1   1 
ATOM   6461  C  CG2   . ILE B  1  252 ? 31.555  55.282 24.311 1.00 45.27 ? 279  ILE B CG2   1 
ATOM   6462  C  CD1   . ILE B  1  252 ? 32.401  54.033 21.584 1.00 47.03 ? 279  ILE B CD1   1 
ATOM   6463  N  N     . PRO B  1  253 ? 32.839  58.486 23.899 1.00 50.96 ? 280  PRO B N     1 
ATOM   6464  C  CA    . PRO B  1  253 ? 32.731  59.681 24.734 1.00 51.59 ? 280  PRO B CA    1 
ATOM   6465  C  C     . PRO B  1  253 ? 32.000  59.420 26.049 1.00 49.48 ? 280  PRO B C     1 
ATOM   6466  O  O     . PRO B  1  253 ? 31.095  58.581 26.105 1.00 48.02 ? 280  PRO B O     1 
ATOM   6467  C  CB    . PRO B  1  253 ? 31.934  60.651 23.852 1.00 52.64 ? 280  PRO B CB    1 
ATOM   6468  C  CG    . PRO B  1  253 ? 32.124  60.137 22.449 1.00 53.47 ? 280  PRO B CG    1 
ATOM   6469  C  CD    . PRO B  1  253 ? 32.119  58.656 22.624 1.00 51.43 ? 280  PRO B CD    1 
ATOM   6470  N  N     . GLU B  1  254 ? 32.407  60.143 27.091 1.00 49.98 ? 281  GLU B N     1 
ATOM   6471  C  CA    . GLU B  1  254 ? 31.893  59.980 28.452 1.00 48.36 ? 281  GLU B CA    1 
ATOM   6472  C  C     . GLU B  1  254 ? 30.366  59.894 28.541 1.00 46.75 ? 281  GLU B C     1 
ATOM   6473  O  O     . GLU B  1  254 ? 29.834  59.049 29.264 1.00 44.82 ? 281  GLU B O     1 
ATOM   6474  C  CB    . GLU B  1  254 ? 32.414  61.103 29.359 1.00 49.73 ? 281  GLU B CB    1 
ATOM   6475  C  CG    . GLU B  1  254 ? 33.895  61.002 29.707 1.00 51.29 ? 281  GLU B CG    1 
ATOM   6476  N  N     . ASN B  1  255 ? 29.672  60.757 27.803 1.00 47.60 ? 282  ASN B N     1 
ATOM   6477  C  CA    . ASN B  1  255 ? 28.210  60.780 27.813 1.00 46.63 ? 282  ASN B CA    1 
ATOM   6478  C  C     . ASN B  1  255 ? 27.581  59.510 27.232 1.00 44.93 ? 282  ASN B C     1 
ATOM   6479  O  O     . ASN B  1  255 ? 26.417  59.208 27.498 1.00 43.26 ? 282  ASN B O     1 
ATOM   6480  C  CB    . ASN B  1  255 ? 27.683  62.016 27.079 1.00 48.33 ? 282  ASN B CB    1 
ATOM   6481  C  CG    . ASN B  1  255 ? 27.957  61.975 25.576 1.00 50.72 ? 282  ASN B CG    1 
ATOM   6482  O  OD1   . ASN B  1  255 ? 29.096  61.796 25.139 1.00 52.74 ? 282  ASN B OD1   1 
ATOM   6483  N  ND2   . ASN B  1  255 ? 26.906  62.153 24.781 1.00 51.45 ? 282  ASN B ND2   1 
ATOM   6484  N  N     . LEU B  1  256 ? 28.360  58.775 26.438 1.00 45.10 ? 283  LEU B N     1 
ATOM   6485  C  CA    . LEU B  1  256 ? 27.876  57.543 25.808 1.00 43.61 ? 283  LEU B CA    1 
ATOM   6486  C  C     . LEU B  1  256 ? 28.318  56.282 26.546 1.00 41.97 ? 283  LEU B C     1 
ATOM   6487  O  O     . LEU B  1  256 ? 28.009  55.165 26.122 1.00 41.21 ? 283  LEU B O     1 
ATOM   6488  C  CB    . LEU B  1  256 ? 28.305  57.492 24.334 1.00 44.89 ? 283  LEU B CB    1 
ATOM   6489  C  CG    . LEU B  1  256 ? 27.615  58.513 23.421 1.00 46.35 ? 283  LEU B CG    1 
ATOM   6490  C  CD1   . LEU B  1  256 ? 28.205  58.486 22.016 1.00 47.48 ? 283  LEU B CD1   1 
ATOM   6491  C  CD2   . LEU B  1  256 ? 26.111  58.283 23.381 1.00 44.02 ? 283  LEU B CD2   1 
ATOM   6492  N  N     . GLN B  1  257 ? 29.043  56.462 27.644 1.00 41.57 ? 284  GLN B N     1 
ATOM   6493  C  CA    . GLN B  1  257 ? 29.481  55.336 28.457 1.00 40.18 ? 284  GLN B CA    1 
ATOM   6494  C  C     . GLN B  1  257 ? 28.420  55.021 29.510 1.00 37.92 ? 284  GLN B C     1 
ATOM   6495  O  O     . GLN B  1  257 ? 28.551  55.402 30.672 1.00 37.89 ? 284  GLN B O     1 
ATOM   6496  C  CB    . GLN B  1  257 ? 30.848  55.620 29.098 1.00 41.52 ? 284  GLN B CB    1 
ATOM   6497  C  CG    . GLN B  1  257 ? 32.024  55.666 28.107 1.00 44.10 ? 284  GLN B CG    1 
ATOM   6498  C  CD    . GLN B  1  257 ? 33.325  56.168 28.728 1.00 47.45 ? 284  GLN B CD    1 
ATOM   6499  O  OE1   . GLN B  1  257 ? 33.546  56.052 29.933 1.00 48.29 ? 284  GLN B OE1   1 
ATOM   6500  N  NE2   . GLN B  1  257 ? 34.197  56.728 27.895 1.00 50.34 ? 284  GLN B NE2   1 
ATOM   6501  N  N     . PHE B  1  258 ? 27.361  54.338 29.088 1.00 36.30 ? 285  PHE B N     1 
ATOM   6502  C  CA    . PHE B  1  258 ? 26.274  53.951 29.997 1.00 34.88 ? 285  PHE B CA    1 
ATOM   6503  C  C     . PHE B  1  258 ? 26.732  52.884 30.989 1.00 33.24 ? 285  PHE B C     1 
ATOM   6504  O  O     . PHE B  1  258 ? 27.446  51.953 30.612 1.00 33.34 ? 285  PHE B O     1 
ATOM   6505  C  CB    . PHE B  1  258 ? 25.062  53.444 29.214 1.00 34.04 ? 285  PHE B CB    1 
ATOM   6506  C  CG    . PHE B  1  258 ? 24.405  54.496 28.369 1.00 36.96 ? 285  PHE B CG    1 
ATOM   6507  C  CD1   . PHE B  1  258 ? 23.428  55.326 28.904 1.00 37.12 ? 285  PHE B CD1   1 
ATOM   6508  C  CD2   . PHE B  1  258 ? 24.759  54.655 27.033 1.00 39.73 ? 285  PHE B CD2   1 
ATOM   6509  C  CE1   . PHE B  1  258 ? 22.820  56.301 28.128 1.00 39.41 ? 285  PHE B CE1   1 
ATOM   6510  C  CE2   . PHE B  1  258 ? 24.155  55.633 26.249 1.00 41.38 ? 285  PHE B CE2   1 
ATOM   6511  C  CZ    . PHE B  1  258 ? 23.182  56.454 26.799 1.00 41.10 ? 285  PHE B CZ    1 
ATOM   6512  N  N     . ALA B  1  259 ? 26.330  53.039 32.251 1.00 31.84 ? 286  ALA B N     1 
ATOM   6513  C  CA    . ALA B  1  259 ? 26.670  52.080 33.302 1.00 30.52 ? 286  ALA B CA    1 
ATOM   6514  C  C     . ALA B  1  259 ? 25.484  51.187 33.641 1.00 28.42 ? 286  ALA B C     1 
ATOM   6515  O  O     . ALA B  1  259 ? 24.421  51.664 34.048 1.00 27.54 ? 286  ALA B O     1 
ATOM   6516  C  CB    . ALA B  1  259 ? 27.166  52.787 34.546 1.00 30.91 ? 286  ALA B CB    1 
ATOM   6517  N  N     . VAL B  1  260 ? 25.687  49.885 33.470 1.00 27.45 ? 287  VAL B N     1 
ATOM   6518  C  CA    . VAL B  1  260 ? 24.685  48.887 33.827 1.00 25.66 ? 287  VAL B CA    1 
ATOM   6519  C  C     . VAL B  1  260 ? 25.331  47.729 34.584 1.00 25.26 ? 287  VAL B C     1 
ATOM   6520  O  O     . VAL B  1  260 ? 26.541  47.707 34.763 1.00 25.90 ? 287  VAL B O     1 
ATOM   6521  C  CB    . VAL B  1  260 ? 23.910  48.382 32.592 1.00 25.66 ? 287  VAL B CB    1 
ATOM   6522  C  CG1   . VAL B  1  260 ? 22.977  49.485 32.067 1.00 25.03 ? 287  VAL B CG1   1 
ATOM   6523  C  CG2   . VAL B  1  260 ? 24.870  47.904 31.503 1.00 25.46 ? 287  VAL B CG2   1 
ATOM   6524  N  N     . GLY B  1  261 ? 24.514  46.774 35.022 1.00 24.28 ? 288  GLY B N     1 
ATOM   6525  C  CA    . GLY B  1  261 ? 24.972  45.674 35.854 1.00 23.64 ? 288  GLY B CA    1 
ATOM   6526  C  C     . GLY B  1  261 ? 26.016  44.796 35.197 1.00 24.39 ? 288  GLY B C     1 
ATOM   6527  O  O     . GLY B  1  261 ? 26.974  44.388 35.855 1.00 24.30 ? 288  GLY B O     1 
ATOM   6528  N  N     . GLN B  1  262 ? 25.834  44.521 33.904 1.00 24.41 ? 289  GLN B N     1 
ATOM   6529  C  CA    . GLN B  1  262 ? 26.754  43.679 33.137 1.00 25.39 ? 289  GLN B CA    1 
ATOM   6530  C  C     . GLN B  1  262 ? 27.726  44.567 32.362 1.00 27.12 ? 289  GLN B C     1 
ATOM   6531  O  O     . GLN B  1  262 ? 27.323  45.372 31.514 1.00 27.35 ? 289  GLN B O     1 
ATOM   6532  C  CB    . GLN B  1  262 ? 25.989  42.755 32.174 1.00 24.90 ? 289  GLN B CB    1 
ATOM   6533  C  CG    . GLN B  1  262 ? 26.443  41.278 32.146 1.00 24.18 ? 289  GLN B CG    1 
ATOM   6534  C  CD    . GLN B  1  262 ? 27.769  41.032 31.426 1.00 25.33 ? 289  GLN B CD    1 
ATOM   6535  O  OE1   . GLN B  1  262 ? 28.583  41.933 31.272 1.00 26.35 ? 289  GLN B OE1   1 
ATOM   6536  N  NE2   . GLN B  1  262 ? 27.987  39.790 30.990 1.00 24.75 ? 289  GLN B NE2   1 
ATOM   6537  N  N     . GLU B  1  263 ? 29.006  44.373 32.647 1.00 28.53 ? 290  GLU B N     1 
ATOM   6538  C  CA    A GLU B  1  263 ? 30.117  45.176 32.135 0.50 30.36 ? 290  GLU B CA    1 
ATOM   6539  C  CA    B GLU B  1  263 ? 30.043  45.262 32.127 0.50 30.42 ? 290  GLU B CA    1 
ATOM   6540  C  C     . GLU B  1  263 ? 30.219  45.248 30.600 1.00 31.30 ? 290  GLU B C     1 
ATOM   6541  O  O     . GLU B  1  263 ? 30.821  46.176 30.045 1.00 32.37 ? 290  GLU B O     1 
ATOM   6542  C  CB    A GLU B  1  263 ? 31.442  44.627 32.701 0.50 31.39 ? 290  GLU B CB    1 
ATOM   6543  C  CB    B GLU B  1  263 ? 31.385  45.004 32.825 0.50 31.62 ? 290  GLU B CB    1 
ATOM   6544  C  CG    A GLU B  1  263 ? 31.619  44.746 34.222 0.50 31.49 ? 290  GLU B CG    1 
ATOM   6545  C  CG    B GLU B  1  263 ? 32.009  43.664 32.496 0.50 33.00 ? 290  GLU B CG    1 
ATOM   6546  C  CD    A GLU B  1  263 ? 31.042  43.575 35.026 0.50 30.91 ? 290  GLU B CD    1 
ATOM   6547  C  CD    B GLU B  1  263 ? 33.190  43.352 33.376 0.50 35.52 ? 290  GLU B CD    1 
ATOM   6548  O  OE1   A GLU B  1  263 ? 30.276  42.756 34.468 0.50 30.14 ? 290  GLU B OE1   1 
ATOM   6549  O  OE1   B GLU B  1  263 ? 33.180  43.787 34.547 0.50 36.57 ? 290  GLU B OE1   1 
ATOM   6550  O  OE2   A GLU B  1  263 ? 31.361  43.480 36.234 0.50 30.62 ? 290  GLU B OE2   1 
ATOM   6551  O  OE2   B GLU B  1  263 ? 34.123  42.672 32.900 0.50 37.02 ? 290  GLU B OE2   1 
ATOM   6552  N  N     . VAL B  1  264 ? 29.688  44.237 29.910 1.00 30.84 ? 291  VAL B N     1 
ATOM   6553  C  CA    . VAL B  1  264 ? 29.853  44.197 28.441 1.00 32.03 ? 291  VAL B CA    1 
ATOM   6554  C  C     . VAL B  1  264 ? 28.666  44.718 27.623 1.00 31.61 ? 291  VAL B C     1 
ATOM   6555  O  O     . VAL B  1  264 ? 28.730  44.736 26.397 1.00 32.57 ? 291  VAL B O     1 
ATOM   6556  C  CB    . VAL B  1  264 ? 30.312  42.803 27.908 1.00 32.84 ? 291  VAL B CB    1 
ATOM   6557  C  CG1   . VAL B  1  264 ? 31.590  42.337 28.629 1.00 34.06 ? 291  VAL B CG1   1 
ATOM   6558  C  CG2   . VAL B  1  264 ? 29.187  41.768 28.013 1.00 31.98 ? 291  VAL B CG2   1 
ATOM   6559  N  N     . PHE B  1  265 ? 27.603  45.163 28.293 1.00 30.55 ? 292  PHE B N     1 
ATOM   6560  C  CA    . PHE B  1  265 ? 26.347  45.497 27.599 1.00 30.21 ? 292  PHE B CA    1 
ATOM   6561  C  C     . PHE B  1  265 ? 26.380  46.787 26.767 1.00 31.41 ? 292  PHE B C     1 
ATOM   6562  O  O     . PHE B  1  265 ? 25.535  46.983 25.886 1.00 31.41 ? 292  PHE B O     1 
ATOM   6563  C  CB    . PHE B  1  265 ? 25.166  45.494 28.574 1.00 28.69 ? 292  PHE B CB    1 
ATOM   6564  C  CG    . PHE B  1  265 ? 24.652  44.110 28.911 1.00 27.19 ? 292  PHE B CG    1 
ATOM   6565  C  CD1   . PHE B  1  265 ? 25.306  42.964 28.450 1.00 27.37 ? 292  PHE B CD1   1 
ATOM   6566  C  CD2   . PHE B  1  265 ? 23.533  43.953 29.720 1.00 25.83 ? 292  PHE B CD2   1 
ATOM   6567  C  CE1   . PHE B  1  265 ? 24.832  41.689 28.763 1.00 25.84 ? 292  PHE B CE1   1 
ATOM   6568  C  CE2   . PHE B  1  265 ? 23.055  42.675 30.042 1.00 25.09 ? 292  PHE B CE2   1 
ATOM   6569  C  CZ    . PHE B  1  265 ? 23.705  41.545 29.561 1.00 24.84 ? 292  PHE B CZ    1 
ATOM   6570  N  N     . GLY B  1  266 ? 27.364  47.645 27.028 1.00 32.49 ? 293  GLY B N     1 
ATOM   6571  C  CA    . GLY B  1  266 ? 27.561  48.854 26.227 1.00 34.03 ? 293  GLY B CA    1 
ATOM   6572  C  C     . GLY B  1  266 ? 28.140  48.596 24.844 1.00 35.42 ? 293  GLY B C     1 
ATOM   6573  O  O     . GLY B  1  266 ? 28.249  49.512 24.026 1.00 36.64 ? 293  GLY B O     1 
ATOM   6574  N  N     . LEU B  1  267 ? 28.505  47.351 24.566 1.00 35.45 ? 294  LEU B N     1 
ATOM   6575  C  CA    . LEU B  1  267 ? 29.201  47.042 23.321 1.00 36.75 ? 294  LEU B CA    1 
ATOM   6576  C  C     . LEU B  1  267 ? 28.254  46.746 22.153 1.00 36.40 ? 294  LEU B C     1 
ATOM   6577  O  O     . LEU B  1  267 ? 28.680  46.680 20.994 1.00 37.39 ? 294  LEU B O     1 
ATOM   6578  C  CB    . LEU B  1  267 ? 30.228  45.921 23.540 1.00 37.32 ? 294  LEU B CB    1 
ATOM   6579  C  CG    . LEU B  1  267 ? 31.354  46.195 24.564 1.00 38.78 ? 294  LEU B CG    1 
ATOM   6580  C  CD1   . LEU B  1  267 ? 32.043  44.902 25.013 1.00 38.38 ? 294  LEU B CD1   1 
ATOM   6581  C  CD2   . LEU B  1  267 ? 32.391  47.196 24.054 1.00 40.82 ? 294  LEU B CD2   1 
ATOM   6582  N  N     . VAL B  1  268 ? 26.972  46.587 22.474 1.00 34.48 ? 295  VAL B N     1 
ATOM   6583  C  CA    . VAL B  1  268 ? 25.932  46.248 21.508 1.00 34.11 ? 295  VAL B CA    1 
ATOM   6584  C  C     . VAL B  1  268 ? 24.662  47.046 21.857 1.00 32.63 ? 295  VAL B C     1 
ATOM   6585  O  O     . VAL B  1  268 ? 24.136  46.900 22.954 1.00 31.40 ? 295  VAL B O     1 
ATOM   6586  C  CB    . VAL B  1  268 ? 25.625  44.719 21.564 1.00 33.74 ? 295  VAL B CB    1 
ATOM   6587  C  CG1   . VAL B  1  268 ? 24.510  44.343 20.608 1.00 33.47 ? 295  VAL B CG1   1 
ATOM   6588  C  CG2   . VAL B  1  268 ? 26.888  43.886 21.274 1.00 35.29 ? 295  VAL B CG2   1 
ATOM   6589  N  N     . PRO B  1  269 ? 24.178  47.907 20.937 1.00 33.14 ? 296  PRO B N     1 
ATOM   6590  C  CA    . PRO B  1  269 ? 22.967  48.720 21.191 1.00 32.36 ? 296  PRO B CA    1 
ATOM   6591  C  C     . PRO B  1  269 ? 21.681  47.915 21.459 1.00 31.20 ? 296  PRO B C     1 
ATOM   6592  O  O     . PRO B  1  269 ? 20.812  48.381 22.200 1.00 30.56 ? 296  PRO B O     1 
ATOM   6593  C  CB    . PRO B  1  269 ? 22.826  49.557 19.915 1.00 34.05 ? 296  PRO B CB    1 
ATOM   6594  C  CG    . PRO B  1  269 ? 24.215  49.638 19.366 1.00 35.04 ? 296  PRO B CG    1 
ATOM   6595  C  CD    . PRO B  1  269 ? 24.855  48.315 19.691 1.00 34.69 ? 296  PRO B CD    1 
ATOM   6596  N  N     . GLY B  1  270 ? 21.558  46.725 20.871 1.00 30.93 ? 297  GLY B N     1 
ATOM   6597  C  CA    . GLY B  1  270 ? 20.463  45.807 21.210 1.00 29.34 ? 297  GLY B CA    1 
ATOM   6598  C  C     . GLY B  1  270 ? 20.513  45.334 22.658 1.00 28.10 ? 297  GLY B C     1 
ATOM   6599  O  O     . GLY B  1  270 ? 19.479  45.054 23.265 1.00 26.82 ? 297  GLY B O     1 
ATOM   6600  N  N     . LEU B  1  271 ? 21.718  45.242 23.219 1.00 27.87 ? 298  LEU B N     1 
ATOM   6601  C  CA    . LEU B  1  271 ? 21.864  44.913 24.643 1.00 26.99 ? 298  LEU B CA    1 
ATOM   6602  C  C     . LEU B  1  271 ? 21.497  46.109 25.531 1.00 26.51 ? 298  LEU B C     1 
ATOM   6603  O  O     . LEU B  1  271 ? 20.905  45.949 26.600 1.00 26.01 ? 298  LEU B O     1 
ATOM   6604  C  CB    . LEU B  1  271 ? 23.283  44.404 24.964 1.00 27.20 ? 298  LEU B CB    1 
ATOM   6605  C  CG    . LEU B  1  271 ? 23.704  43.045 24.378 1.00 28.06 ? 298  LEU B CG    1 
ATOM   6606  C  CD1   . LEU B  1  271 ? 25.175  42.757 24.647 1.00 28.21 ? 298  LEU B CD1   1 
ATOM   6607  C  CD2   . LEU B  1  271 ? 22.829  41.913 24.923 1.00 27.68 ? 298  LEU B CD2   1 
ATOM   6608  N  N     . MET B  1  272 ? 21.844  47.304 25.076 1.00 27.41 ? 299  MET B N     1 
ATOM   6609  C  CA    . MET B  1  272 ? 21.566  48.519 25.832 1.00 27.96 ? 299  MET B CA    1 
ATOM   6610  C  C     . MET B  1  272 ? 20.066  48.844 25.834 1.00 27.05 ? 299  MET B C     1 
ATOM   6611  O  O     . MET B  1  272 ? 19.556  49.413 26.795 1.00 26.78 ? 299  MET B O     1 
ATOM   6612  C  CB    . MET B  1  272 ? 22.424  49.683 25.302 1.00 29.34 ? 299  MET B CB    1 
ATOM   6613  C  CG    . MET B  1  272 ? 22.561  50.897 26.238 1.00 32.20 ? 299  MET B CG    1 
ATOM   6614  S  SD    . MET B  1  272 ? 22.917  50.577 27.996 1.00 36.09 ? 299  MET B SD    1 
ATOM   6615  C  CE    . MET B  1  272 ? 24.483  49.722 27.876 1.00 31.37 ? 299  MET B CE    1 
ATOM   6616  N  N     . MET B  1  273 ? 19.368  48.445 24.772 1.00 27.17 ? 300  MET B N     1 
ATOM   6617  C  CA    . MET B  1  273 ? 17.912  48.570 24.682 1.00 26.38 ? 300  MET B CA    1 
ATOM   6618  C  C     . MET B  1  273 ? 17.255  47.817 25.838 1.00 24.91 ? 300  MET B C     1 
ATOM   6619  O  O     . MET B  1  273 ? 16.491  48.398 26.605 1.00 24.33 ? 300  MET B O     1 
ATOM   6620  C  CB    . MET B  1  273 ? 17.410  48.058 23.323 1.00 26.86 ? 300  MET B CB    1 
ATOM   6621  C  CG    . MET B  1  273 ? 15.891  48.126 23.129 1.00 27.54 ? 300  MET B CG    1 
ATOM   6622  S  SD    . MET B  1  273 ? 15.248  47.114 21.769 1.00 28.13 ? 300  MET B SD    1 
ATOM   6623  C  CE    . MET B  1  273 ? 15.608  45.469 22.344 1.00 28.26 ? 300  MET B CE    1 
ATOM   6624  N  N     . TYR B  1  274 ? 17.581  46.536 25.985 1.00 24.19 ? 301  TYR B N     1 
ATOM   6625  C  CA    . TYR B  1  274 ? 17.042  45.731 27.094 1.00 22.83 ? 301  TYR B CA    1 
ATOM   6626  C  C     . TYR B  1  274 ? 17.509  46.176 28.475 1.00 22.00 ? 301  TYR B C     1 
ATOM   6627  O  O     . TYR B  1  274 ? 16.739  46.100 29.433 1.00 21.38 ? 301  TYR B O     1 
ATOM   6628  C  CB    . TYR B  1  274 ? 17.339  44.243 26.904 1.00 22.70 ? 301  TYR B CB    1 
ATOM   6629  C  CG    . TYR B  1  274 ? 16.377  43.568 25.964 1.00 23.63 ? 301  TYR B CG    1 
ATOM   6630  C  CD1   . TYR B  1  274 ? 15.030  43.417 26.304 1.00 23.17 ? 301  TYR B CD1   1 
ATOM   6631  C  CD2   . TYR B  1  274 ? 16.807  43.079 24.735 1.00 23.98 ? 301  TYR B CD2   1 
ATOM   6632  C  CE1   . TYR B  1  274 ? 14.136  42.801 25.443 1.00 23.68 ? 301  TYR B CE1   1 
ATOM   6633  C  CE2   . TYR B  1  274 ? 15.919  42.462 23.863 1.00 24.81 ? 301  TYR B CE2   1 
ATOM   6634  C  CZ    . TYR B  1  274 ? 14.585  42.321 24.224 1.00 24.23 ? 301  TYR B CZ    1 
ATOM   6635  O  OH    . TYR B  1  274 ? 13.704  41.696 23.366 1.00 24.69 ? 301  TYR B OH    1 
ATOM   6636  N  N     . ALA B  1  275 ? 18.759  46.629 28.583 1.00 21.91 ? 302  ALA B N     1 
ATOM   6637  C  CA    . ALA B  1  275 ? 19.259  47.165 29.860 1.00 21.90 ? 302  ALA B CA    1 
ATOM   6638  C  C     . ALA B  1  275 ? 18.414  48.365 30.316 1.00 22.02 ? 302  ALA B C     1 
ATOM   6639  O  O     . ALA B  1  275 ? 18.060  48.488 31.489 1.00 21.21 ? 302  ALA B O     1 
ATOM   6640  C  CB    . ALA B  1  275 ? 20.730  47.562 29.744 1.00 21.90 ? 302  ALA B CB    1 
ATOM   6641  N  N     . THR B  1  276 ? 18.105  49.235 29.366 1.00 23.05 ? 303  THR B N     1 
ATOM   6642  C  CA    . THR B  1  276 ? 17.266  50.399 29.596 1.00 23.77 ? 303  THR B CA    1 
ATOM   6643  C  C     . THR B  1  276 ? 15.834  50.001 29.968 1.00 23.69 ? 303  THR B C     1 
ATOM   6644  O  O     . THR B  1  276 ? 15.291  50.497 30.955 1.00 23.92 ? 303  THR B O     1 
ATOM   6645  C  CB    . THR B  1  276 ? 17.283  51.312 28.361 1.00 24.57 ? 303  THR B CB    1 
ATOM   6646  O  OG1   . THR B  1  276 ? 18.643  51.681 28.088 1.00 25.11 ? 303  THR B OG1   1 
ATOM   6647  C  CG2   . THR B  1  276 ? 16.444  52.568 28.596 1.00 25.07 ? 303  THR B CG2   1 
ATOM   6648  N  N     . ILE B  1  277 ? 15.240  49.102 29.189 1.00 23.83 ? 304  ILE B N     1 
ATOM   6649  C  CA    . ILE B  1  277 ? 13.896  48.582 29.477 1.00 24.06 ? 304  ILE B CA    1 
ATOM   6650  C  C     . ILE B  1  277 ? 13.773  47.999 30.898 1.00 23.63 ? 304  ILE B C     1 
ATOM   6651  O  O     . ILE B  1  277 ? 12.845  48.347 31.640 1.00 23.55 ? 304  ILE B O     1 
ATOM   6652  C  CB    . ILE B  1  277 ? 13.452  47.552 28.411 1.00 24.31 ? 304  ILE B CB    1 
ATOM   6653  C  CG1   . ILE B  1  277 ? 13.069  48.275 27.107 1.00 25.79 ? 304  ILE B CG1   1 
ATOM   6654  C  CG2   . ILE B  1  277 ? 12.258  46.728 28.902 1.00 23.51 ? 304  ILE B CG2   1 
ATOM   6655  C  CD1   . ILE B  1  277 ? 12.934  47.364 25.897 1.00 25.94 ? 304  ILE B CD1   1 
ATOM   6656  N  N     . TRP B  1  278 ? 14.715  47.133 31.276 1.00 23.01 ? 305  TRP B N     1 
ATOM   6657  C  CA    . TRP B  1  278 ? 14.671  46.489 32.588 1.00 22.67 ? 305  TRP B CA    1 
ATOM   6658  C  C     . TRP B  1  278 ? 14.944  47.457 33.745 1.00 22.87 ? 305  TRP B C     1 
ATOM   6659  O  O     . TRP B  1  278 ? 14.373  47.307 34.829 1.00 22.16 ? 305  TRP B O     1 
ATOM   6660  C  CB    . TRP B  1  278 ? 15.636  45.309 32.653 1.00 21.77 ? 305  TRP B CB    1 
ATOM   6661  C  CG    . TRP B  1  278 ? 15.120  44.058 31.995 1.00 21.95 ? 305  TRP B CG    1 
ATOM   6662  C  CD1   . TRP B  1  278 ? 15.582  43.489 30.836 1.00 22.40 ? 305  TRP B CD1   1 
ATOM   6663  C  CD2   . TRP B  1  278 ? 14.057  43.215 32.458 1.00 21.73 ? 305  TRP B CD2   1 
ATOM   6664  N  NE1   . TRP B  1  278 ? 14.872  42.342 30.549 1.00 22.67 ? 305  TRP B NE1   1 
ATOM   6665  C  CE2   . TRP B  1  278 ? 13.931  42.150 31.529 1.00 22.75 ? 305  TRP B CE2   1 
ATOM   6666  C  CE3   . TRP B  1  278 ? 13.193  43.255 33.565 1.00 21.94 ? 305  TRP B CE3   1 
ATOM   6667  C  CZ2   . TRP B  1  278 ? 12.982  41.135 31.676 1.00 21.69 ? 305  TRP B CZ2   1 
ATOM   6668  C  CZ3   . TRP B  1  278 ? 12.244  42.237 33.712 1.00 21.67 ? 305  TRP B CZ3   1 
ATOM   6669  C  CH2   . TRP B  1  278 ? 12.148  41.195 32.768 1.00 22.61 ? 305  TRP B CH2   1 
ATOM   6670  N  N     . LEU B  1  279 ? 15.822  48.433 33.514 1.00 23.31 ? 306  LEU B N     1 
ATOM   6671  C  CA    . LEU B  1  279 ? 16.067  49.476 34.503 1.00 24.18 ? 306  LEU B CA    1 
ATOM   6672  C  C     . LEU B  1  279 ? 14.781  50.264 34.745 1.00 24.11 ? 306  LEU B C     1 
ATOM   6673  O  O     . LEU B  1  279 ? 14.430  50.558 35.890 1.00 24.18 ? 306  LEU B O     1 
ATOM   6674  C  CB    . LEU B  1  279 ? 17.209  50.408 34.074 1.00 25.15 ? 306  LEU B CB    1 
ATOM   6675  C  CG    . LEU B  1  279 ? 17.512  51.587 35.020 1.00 27.71 ? 306  LEU B CG    1 
ATOM   6676  C  CD1   . LEU B  1  279 ? 18.974  52.007 34.946 1.00 29.87 ? 306  LEU B CD1   1 
ATOM   6677  C  CD2   . LEU B  1  279 ? 16.609  52.773 34.733 1.00 28.61 ? 306  LEU B CD2   1 
ATOM   6678  N  N     . ARG B  1  280 ? 14.077  50.590 33.664 1.00 24.25 ? 307  ARG B N     1 
ATOM   6679  C  CA    . ARG B  1  280 ? 12.777  51.247 33.772 1.00 24.37 ? 307  ARG B CA    1 
ATOM   6680  C  C     . ARG B  1  280 ? 11.769  50.361 34.497 1.00 23.74 ? 307  ARG B C     1 
ATOM   6681  O  O     . ARG B  1  280 ? 10.996  50.866 35.314 1.00 24.43 ? 307  ARG B O     1 
ATOM   6682  C  CB    . ARG B  1  280 ? 12.244  51.665 32.398 1.00 25.07 ? 307  ARG B CB    1 
ATOM   6683  C  CG    . ARG B  1  280 ? 13.025  52.807 31.743 1.00 25.34 ? 307  ARG B CG    1 
ATOM   6684  C  CD    . ARG B  1  280 ? 12.567  52.979 30.311 1.00 25.70 ? 307  ARG B CD    1 
ATOM   6685  N  NE    . ARG B  1  280 ? 13.250  54.054 29.592 1.00 26.43 ? 307  ARG B NE    1 
ATOM   6686  C  CZ    . ARG B  1  280 ? 12.845  54.527 28.416 1.00 29.09 ? 307  ARG B CZ    1 
ATOM   6687  N  NH1   . ARG B  1  280 ? 11.759  54.027 27.832 1.00 29.22 ? 307  ARG B NH1   1 
ATOM   6688  N  NH2   . ARG B  1  280 ? 13.516  55.505 27.821 1.00 30.27 ? 307  ARG B NH2   1 
ATOM   6689  N  N     . GLU B  1  281 ? 11.787  49.055 34.215 1.00 22.63 ? 308  GLU B N     1 
ATOM   6690  C  CA    . GLU B  1  281 ? 10.902  48.096 34.900 1.00 22.16 ? 308  GLU B CA    1 
ATOM   6691  C  C     . GLU B  1  281 ? 11.129  48.066 36.414 1.00 21.65 ? 308  GLU B C     1 
ATOM   6692  O  O     . GLU B  1  281 ? 10.171  48.114 37.189 1.00 21.83 ? 308  GLU B O     1 
ATOM   6693  C  CB    . GLU B  1  281 ? 11.015  46.673 34.316 1.00 21.58 ? 308  GLU B CB    1 
ATOM   6694  C  CG    . GLU B  1  281 ? 10.083  45.612 34.992 1.00 21.87 ? 308  GLU B CG    1 
ATOM   6695  C  CD    . GLU B  1  281 ? 8.590   45.986 34.997 1.00 24.23 ? 308  GLU B CD    1 
ATOM   6696  O  OE1   . GLU B  1  281 ? 8.168   46.874 34.226 1.00 25.26 ? 308  GLU B OE1   1 
ATOM   6697  O  OE2   . GLU B  1  281 ? 7.818   45.376 35.770 1.00 25.01 ? 308  GLU B OE2   1 
ATOM   6698  N  N     . HIS B  1  282 ? 12.390  47.999 36.829 1.00 20.94 ? 309  HIS B N     1 
ATOM   6699  C  CA    . HIS B  1  282 ? 12.721  48.034 38.251 1.00 21.04 ? 309  HIS B CA    1 
ATOM   6700  C  C     . HIS B  1  282 ? 12.146  49.266 38.962 1.00 21.75 ? 309  HIS B C     1 
ATOM   6701  O  O     . HIS B  1  282 ? 11.525  49.142 40.020 1.00 21.96 ? 309  HIS B O     1 
ATOM   6702  C  CB    . HIS B  1  282 ? 14.234  47.987 38.469 1.00 20.72 ? 309  HIS B CB    1 
ATOM   6703  C  CG    . HIS B  1  282 ? 14.621  48.158 39.903 1.00 21.67 ? 309  HIS B CG    1 
ATOM   6704  N  ND1   . HIS B  1  282 ? 14.785  47.090 40.760 1.00 21.14 ? 309  HIS B ND1   1 
ATOM   6705  C  CD2   . HIS B  1  282 ? 14.824  49.272 40.646 1.00 21.58 ? 309  HIS B CD2   1 
ATOM   6706  C  CE1   . HIS B  1  282 ? 15.095  47.541 41.962 1.00 22.30 ? 309  HIS B CE1   1 
ATOM   6707  N  NE2   . HIS B  1  282 ? 15.118  48.862 41.922 1.00 21.74 ? 309  HIS B NE2   1 
ATOM   6708  N  N     . ASN B  1  283 ? 12.355  50.447 38.379 1.00 22.14 ? 310  ASN B N     1 
ATOM   6709  C  CA    . ASN B  1  283 ? 11.902  51.695 38.995 1.00 22.94 ? 310  ASN B CA    1 
ATOM   6710  C  C     . ASN B  1  283 ? 10.377  51.832 38.970 1.00 23.69 ? 310  ASN B C     1 
ATOM   6711  O  O     . ASN B  1  283 ? 9.800   52.460 39.857 1.00 24.95 ? 310  ASN B O     1 
ATOM   6712  C  CB    . ASN B  1  283 ? 12.593  52.918 38.363 1.00 23.09 ? 310  ASN B CB    1 
ATOM   6713  C  CG    . ASN B  1  283 ? 14.073  53.056 38.782 1.00 23.36 ? 310  ASN B CG    1 
ATOM   6714  O  OD1   . ASN B  1  283 ? 14.600  52.245 39.550 1.00 20.82 ? 310  ASN B OD1   1 
ATOM   6715  N  ND2   . ASN B  1  283 ? 14.738  54.092 38.271 1.00 21.62 ? 310  ASN B ND2   1 
ATOM   6716  N  N     . ARG B  1  284 ? 9.738   51.238 37.960 1.00 23.48 ? 311  ARG B N     1 
ATOM   6717  C  CA    . ARG B  1  284 ? 8.278   51.186 37.863 1.00 24.43 ? 311  ARG B CA    1 
ATOM   6718  C  C     . ARG B  1  284 ? 7.701   50.324 38.996 1.00 24.20 ? 311  ARG B C     1 
ATOM   6719  O  O     . ARG B  1  284 ? 6.703   50.700 39.624 1.00 25.46 ? 311  ARG B O     1 
ATOM   6720  C  CB    . ARG B  1  284 ? 7.848   50.629 36.490 1.00 24.60 ? 311  ARG B CB    1 
ATOM   6721  C  CG    . ARG B  1  284 ? 6.357   50.776 36.156 1.00 26.36 ? 311  ARG B CG    1 
ATOM   6722  C  CD    . ARG B  1  284 ? 5.938   49.924 34.941 1.00 26.12 ? 311  ARG B CD    1 
ATOM   6723  N  NE    . ARG B  1  284 ? 6.003   48.486 35.229 1.00 25.84 ? 311  ARG B NE    1 
ATOM   6724  C  CZ    . ARG B  1  284 ? 4.986   47.744 35.673 1.00 26.02 ? 311  ARG B CZ    1 
ATOM   6725  N  NH1   . ARG B  1  284 ? 3.786   48.281 35.872 1.00 25.42 ? 311  ARG B NH1   1 
ATOM   6726  N  NH2   . ARG B  1  284 ? 5.173   46.450 35.920 1.00 25.59 ? 311  ARG B NH2   1 
ATOM   6727  N  N     . VAL B  1  285 ? 8.334   49.178 39.253 1.00 22.90 ? 312  VAL B N     1 
ATOM   6728  C  CA    . VAL B  1  285 ? 7.899   48.263 40.318 1.00 22.67 ? 312  VAL B CA    1 
ATOM   6729  C  C     . VAL B  1  285 ? 8.098   48.912 41.700 1.00 23.21 ? 312  VAL B C     1 
ATOM   6730  O  O     . VAL B  1  285 ? 7.252   48.778 42.583 1.00 23.59 ? 312  VAL B O     1 
ATOM   6731  C  CB    . VAL B  1  285 ? 8.594   46.868 40.199 1.00 21.87 ? 312  VAL B CB    1 
ATOM   6732  C  CG1   . VAL B  1  285 ? 8.417   46.015 41.467 1.00 20.78 ? 312  VAL B CG1   1 
ATOM   6733  C  CG2   . VAL B  1  285 ? 8.060   46.121 38.986 1.00 21.29 ? 312  VAL B CG2   1 
ATOM   6734  N  N     . CYS B  1  286 ? 9.201   49.640 41.858 1.00 23.04 ? 313  CYS B N     1 
ATOM   6735  C  CA    . CYS B  1  286 ? 9.434   50.465 43.044 1.00 23.74 ? 313  CYS B CA    1 
ATOM   6736  C  C     . CYS B  1  286 ? 8.285   51.424 43.309 1.00 24.62 ? 313  CYS B C     1 
ATOM   6737  O  O     . CYS B  1  286 ? 7.861   51.567 44.452 1.00 25.06 ? 313  CYS B O     1 
ATOM   6738  C  CB    . CYS B  1  286 ? 10.736  51.268 42.911 1.00 23.41 ? 313  CYS B CB    1 
ATOM   6739  S  SG    . CYS B  1  286 ? 12.229  50.301 43.174 1.00 24.18 ? 313  CYS B SG    1 
ATOM   6740  N  N     . ASP B  1  287 ? 7.800   52.093 42.256 1.00 25.20 ? 314  ASP B N     1 
ATOM   6741  C  CA    . ASP B  1  287 ? 6.680   53.020 42.389 1.00 26.43 ? 314  ASP B CA    1 
ATOM   6742  C  C     . ASP B  1  287 ? 5.445   52.295 42.909 1.00 26.92 ? 314  ASP B C     1 
ATOM   6743  O  O     . ASP B  1  287 ? 4.776   52.781 43.831 1.00 27.94 ? 314  ASP B O     1 
ATOM   6744  C  CB    . ASP B  1  287 ? 6.353   53.715 41.057 1.00 27.21 ? 314  ASP B CB    1 
ATOM   6745  C  CG    . ASP B  1  287 ? 7.403   54.739 40.640 1.00 28.42 ? 314  ASP B CG    1 
ATOM   6746  O  OD1   . ASP B  1  287 ? 8.057   55.351 41.510 1.00 29.09 ? 314  ASP B OD1   1 
ATOM   6747  O  OD2   . ASP B  1  287 ? 7.565   54.941 39.416 1.00 31.02 ? 314  ASP B OD2   1 
ATOM   6748  N  N     . ILE B  1  288 ? 5.152   51.136 42.321 1.00 26.15 ? 315  ILE B N     1 
ATOM   6749  C  CA    . ILE B  1  288 ? 3.975   50.351 42.696 1.00 27.06 ? 315  ILE B CA    1 
ATOM   6750  C  C     . ILE B  1  288 ? 4.063   49.882 44.150 1.00 27.39 ? 315  ILE B C     1 
ATOM   6751  O  O     . ILE B  1  288 ? 3.117   50.047 44.915 1.00 28.43 ? 315  ILE B O     1 
ATOM   6752  C  CB    . ILE B  1  288 ? 3.743   49.157 41.736 1.00 26.67 ? 315  ILE B CB    1 
ATOM   6753  C  CG1   . ILE B  1  288 ? 3.340   49.680 40.342 1.00 26.92 ? 315  ILE B CG1   1 
ATOM   6754  C  CG2   . ILE B  1  288 ? 2.674   48.185 42.318 1.00 26.98 ? 315  ILE B CG2   1 
ATOM   6755  C  CD1   . ILE B  1  288 ? 3.520   48.669 39.218 1.00 25.01 ? 315  ILE B CD1   1 
ATOM   6756  N  N     . LEU B  1  289 ? 5.212   49.331 44.532 1.00 26.44 ? 316  LEU B N     1 
ATOM   6757  C  CA    . LEU B  1  289 ? 5.408   48.877 45.902 1.00 27.10 ? 316  LEU B CA    1 
ATOM   6758  C  C     . LEU B  1  289 ? 5.327   50.002 46.934 1.00 28.54 ? 316  LEU B C     1 
ATOM   6759  O  O     . LEU B  1  289 ? 4.792   49.802 48.025 1.00 29.09 ? 316  LEU B O     1 
ATOM   6760  C  CB    . LEU B  1  289 ? 6.722   48.123 46.036 1.00 25.87 ? 316  LEU B CB    1 
ATOM   6761  C  CG    . LEU B  1  289 ? 6.748   46.712 45.438 1.00 25.28 ? 316  LEU B CG    1 
ATOM   6762  C  CD1   . LEU B  1  289 ? 8.181   46.196 45.392 1.00 22.12 ? 316  LEU B CD1   1 
ATOM   6763  C  CD2   . LEU B  1  289 ? 5.839   45.756 46.219 1.00 24.53 ? 316  LEU B CD2   1 
ATOM   6764  N  N     . LYS B  1  290 ? 5.857   51.175 46.580 1.00 28.95 ? 317  LYS B N     1 
ATOM   6765  C  CA    . LYS B  1  290 ? 5.835   52.342 47.459 1.00 30.59 ? 317  LYS B CA    1 
ATOM   6766  C  C     . LYS B  1  290 ? 4.408   52.806 47.777 1.00 32.01 ? 317  LYS B C     1 
ATOM   6767  O  O     . LYS B  1  290 ? 4.121   53.209 48.908 1.00 32.98 ? 317  LYS B O     1 
ATOM   6768  C  CB    . LYS B  1  290 ? 6.666   53.486 46.864 1.00 30.93 ? 317  LYS B CB    1 
ATOM   6769  C  CG    . LYS B  1  290 ? 6.697   54.735 47.722 1.00 34.07 ? 317  LYS B CG    1 
ATOM   6770  C  CD    . LYS B  1  290 ? 7.729   55.747 47.248 1.00 37.29 ? 317  LYS B CD    1 
ATOM   6771  C  CE    . LYS B  1  290 ? 7.997   56.760 48.351 1.00 40.79 ? 317  LYS B CE    1 
ATOM   6772  N  NZ    . LYS B  1  290 ? 8.606   56.082 49.551 1.00 42.15 ? 317  LYS B NZ    1 
ATOM   6773  N  N     . GLN B  1  291 ? 3.508   52.740 46.800 1.00 32.11 ? 318  GLN B N     1 
ATOM   6774  C  CA    . GLN B  1  291 ? 2.105   53.036 47.097 1.00 34.16 ? 318  GLN B CA    1 
ATOM   6775  C  C     . GLN B  1  291 ? 1.356   51.894 47.785 1.00 34.11 ? 318  GLN B C     1 
ATOM   6776  O  O     . GLN B  1  291 ? 0.357   52.130 48.461 1.00 35.67 ? 318  GLN B O     1 
ATOM   6777  C  CB    . GLN B  1  291 ? 1.338   53.604 45.893 1.00 35.14 ? 318  GLN B CB    1 
ATOM   6778  C  CG    . GLN B  1  291 ? 1.368   52.799 44.625 1.00 35.99 ? 318  GLN B CG    1 
ATOM   6779  C  CD    . GLN B  1  291 ? 0.940   53.630 43.420 1.00 39.72 ? 318  GLN B CD    1 
ATOM   6780  O  OE1   . GLN B  1  291 ? 1.730   53.868 42.505 1.00 41.60 ? 318  GLN B OE1   1 
ATOM   6781  N  NE2   . GLN B  1  291 ? -0.306  54.092 43.425 1.00 41.15 ? 318  GLN B NE2   1 
ATOM   6782  N  N     . GLU B  1  292 ? 1.846   50.667 47.628 1.00 32.53 ? 319  GLU B N     1 
ATOM   6783  C  CA    . GLU B  1  292 ? 1.344   49.543 48.412 1.00 32.75 ? 319  GLU B CA    1 
ATOM   6784  C  C     . GLU B  1  292 ? 1.855   49.630 49.847 1.00 32.62 ? 319  GLU B C     1 
ATOM   6785  O  O     . GLU B  1  292 ? 1.145   49.285 50.789 1.00 33.37 ? 319  GLU B O     1 
ATOM   6786  C  CB    . GLU B  1  292 ? 1.752   48.206 47.782 1.00 31.65 ? 319  GLU B CB    1 
ATOM   6787  C  CG    . GLU B  1  292 ? 1.015   47.869 46.487 1.00 32.38 ? 319  GLU B CG    1 
ATOM   6788  C  CD    . GLU B  1  292 ? -0.500  47.907 46.641 1.00 35.21 ? 319  GLU B CD    1 
ATOM   6789  O  OE1   . GLU B  1  292 ? -1.044  47.252 47.559 1.00 36.03 ? 319  GLU B OE1   1 
ATOM   6790  O  OE2   . GLU B  1  292 ? -1.146  48.608 45.838 1.00 37.11 ? 319  GLU B OE2   1 
ATOM   6791  N  N     . HIS B  1  293 ? 3.087   50.111 49.995 1.00 29.60 ? 320  HIS B N     1 
ATOM   6792  C  CA    . HIS B  1  293 ? 3.770   50.142 51.278 1.00 29.33 ? 320  HIS B CA    1 
ATOM   6793  C  C     . HIS B  1  293 ? 4.436   51.497 51.533 1.00 29.52 ? 320  HIS B C     1 
ATOM   6794  O  O     . HIS B  1  293 ? 5.659   51.627 51.395 1.00 28.76 ? 320  HIS B O     1 
ATOM   6795  C  CB    . HIS B  1  293 ? 4.818   49.024 51.357 1.00 28.20 ? 320  HIS B CB    1 
ATOM   6796  C  CG    . HIS B  1  293 ? 4.247   47.644 51.255 1.00 28.23 ? 320  HIS B CG    1 
ATOM   6797  N  ND1   . HIS B  1  293 ? 3.670   46.992 52.326 1.00 27.80 ? 320  HIS B ND1   1 
ATOM   6798  C  CD2   . HIS B  1  293 ? 4.168   46.789 50.208 1.00 26.97 ? 320  HIS B CD2   1 
ATOM   6799  C  CE1   . HIS B  1  293 ? 3.260   45.798 51.941 1.00 26.08 ? 320  HIS B CE1   1 
ATOM   6800  N  NE2   . HIS B  1  293 ? 3.548   45.650 50.660 1.00 25.84 ? 320  HIS B NE2   1 
ATOM   6801  N  N     . PRO B  1  294 ? 3.643   52.510 51.927 1.00 30.48 ? 321  PRO B N     1 
ATOM   6802  C  CA    . PRO B  1  294 ? 4.230   53.814 52.252 1.00 30.97 ? 321  PRO B CA    1 
ATOM   6803  C  C     . PRO B  1  294 ? 5.155   53.768 53.478 1.00 30.82 ? 321  PRO B C     1 
ATOM   6804  O  O     . PRO B  1  294 ? 5.945   54.689 53.691 1.00 31.03 ? 321  PRO B O     1 
ATOM   6805  C  CB    . PRO B  1  294 ? 3.003   54.690 52.533 1.00 32.16 ? 321  PRO B CB    1 
ATOM   6806  C  CG    . PRO B  1  294 ? 1.922   53.716 52.918 1.00 32.62 ? 321  PRO B CG    1 
ATOM   6807  C  CD    . PRO B  1  294 ? 2.171   52.521 52.059 1.00 31.64 ? 321  PRO B CD    1 
ATOM   6808  N  N     . GLU B  1  295 ? 5.058   52.692 54.255 1.00 30.42 ? 322  GLU B N     1 
ATOM   6809  C  CA    . GLU B  1  295 ? 5.869   52.500 55.456 1.00 30.56 ? 322  GLU B CA    1 
ATOM   6810  C  C     . GLU B  1  295 ? 7.271   51.922 55.185 1.00 29.07 ? 322  GLU B C     1 
ATOM   6811  O  O     . GLU B  1  295 ? 8.143   51.964 56.055 1.00 29.20 ? 322  GLU B O     1 
ATOM   6812  C  CB    . GLU B  1  295 ? 5.103   51.625 56.468 1.00 31.05 ? 322  GLU B CB    1 
ATOM   6813  C  CG    . GLU B  1  295 ? 5.079   50.119 56.171 1.00 31.40 ? 322  GLU B CG    1 
ATOM   6814  C  CD    . GLU B  1  295 ? 4.103   49.695 55.063 1.00 32.83 ? 322  GLU B CD    1 
ATOM   6815  O  OE1   . GLU B  1  295 ? 3.454   50.558 54.429 1.00 31.68 ? 322  GLU B OE1   1 
ATOM   6816  O  OE2   . GLU B  1  295 ? 3.992   48.470 54.827 1.00 32.80 ? 322  GLU B OE2   1 
ATOM   6817  N  N     . TRP B  1  296 ? 7.482   51.382 53.987 1.00 27.88 ? 323  TRP B N     1 
ATOM   6818  C  CA    . TRP B  1  296 ? 8.735   50.703 53.653 1.00 26.97 ? 323  TRP B CA    1 
ATOM   6819  C  C     . TRP B  1  296 ? 9.872   51.671 53.376 1.00 26.87 ? 323  TRP B C     1 
ATOM   6820  O  O     . TRP B  1  296 ? 9.653   52.763 52.841 1.00 27.21 ? 323  TRP B O     1 
ATOM   6821  C  CB    . TRP B  1  296 ? 8.544   49.800 52.435 1.00 26.00 ? 323  TRP B CB    1 
ATOM   6822  C  CG    . TRP B  1  296 ? 7.990   48.450 52.747 1.00 25.36 ? 323  TRP B CG    1 
ATOM   6823  C  CD1   . TRP B  1  296 ? 7.469   48.028 53.931 1.00 25.35 ? 323  TRP B CD1   1 
ATOM   6824  C  CD2   . TRP B  1  296 ? 7.885   47.343 51.842 1.00 24.68 ? 323  TRP B CD2   1 
ATOM   6825  N  NE1   . TRP B  1  296 ? 7.051   46.724 53.825 1.00 26.30 ? 323  TRP B NE1   1 
ATOM   6826  C  CE2   . TRP B  1  296 ? 7.290   46.281 52.550 1.00 25.42 ? 323  TRP B CE2   1 
ATOM   6827  C  CE3   . TRP B  1  296 ? 8.231   47.152 50.496 1.00 23.64 ? 323  TRP B CE3   1 
ATOM   6828  C  CZ2   . TRP B  1  296 ? 7.037   45.038 51.964 1.00 24.96 ? 323  TRP B CZ2   1 
ATOM   6829  C  CZ3   . TRP B  1  296 ? 7.983   45.918 49.915 1.00 23.98 ? 323  TRP B CZ3   1 
ATOM   6830  C  CH2   . TRP B  1  296 ? 7.396   44.878 50.649 1.00 24.63 ? 323  TRP B CH2   1 
ATOM   6831  N  N     . GLY B  1  297 ? 11.084  51.253 53.736 1.00 26.36 ? 324  GLY B N     1 
ATOM   6832  C  CA    . GLY B  1  297 ? 12.293  52.006 53.409 1.00 26.21 ? 324  GLY B CA    1 
ATOM   6833  C  C     . GLY B  1  297 ? 12.903  51.596 52.075 1.00 25.45 ? 324  GLY B C     1 
ATOM   6834  O  O     . GLY B  1  297 ? 12.476  50.611 51.447 1.00 24.56 ? 324  GLY B O     1 
ATOM   6835  N  N     . ASP B  1  298 ? 13.919  52.350 51.657 1.00 25.34 ? 325  ASP B N     1 
ATOM   6836  C  CA    . ASP B  1  298 ? 14.601  52.140 50.382 1.00 24.67 ? 325  ASP B CA    1 
ATOM   6837  C  C     . ASP B  1  298 ? 15.092  50.709 50.184 1.00 23.67 ? 325  ASP B C     1 
ATOM   6838  O  O     . ASP B  1  298 ? 14.931  50.139 49.100 1.00 22.91 ? 325  ASP B O     1 
ATOM   6839  C  CB    . ASP B  1  298 ? 15.769  53.119 50.239 1.00 24.62 ? 325  ASP B CB    1 
ATOM   6840  C  CG    . ASP B  1  298 ? 16.699  52.752 49.095 1.00 25.11 ? 325  ASP B CG    1 
ATOM   6841  O  OD1   . ASP B  1  298 ? 16.342  53.011 47.921 1.00 25.02 ? 325  ASP B OD1   1 
ATOM   6842  O  OD2   . ASP B  1  298 ? 17.788  52.209 49.373 1.00 24.02 ? 325  ASP B OD2   1 
ATOM   6843  N  N     . GLU B  1  299 ? 15.685  50.138 51.232 1.00 23.46 ? 326  GLU B N     1 
ATOM   6844  C  CA    . GLU B  1  299 ? 16.314  48.824 51.140 1.00 22.84 ? 326  GLU B CA    1 
ATOM   6845  C  C     . GLU B  1  299 ? 15.293  47.737 50.820 1.00 22.32 ? 326  GLU B C     1 
ATOM   6846  O  O     . GLU B  1  299 ? 15.513  46.934 49.914 1.00 21.64 ? 326  GLU B O     1 
ATOM   6847  C  CB    . GLU B  1  299 ? 17.101  48.494 52.421 1.00 23.29 ? 326  GLU B CB    1 
ATOM   6848  C  CG    . GLU B  1  299 ? 17.882  47.146 52.388 1.00 24.09 ? 326  GLU B CG    1 
ATOM   6849  C  CD    . GLU B  1  299 ? 19.012  47.097 51.349 1.00 25.54 ? 326  GLU B CD    1 
ATOM   6850  O  OE1   . GLU B  1  299 ? 19.482  48.162 50.886 1.00 26.53 ? 326  GLU B OE1   1 
ATOM   6851  O  OE2   . GLU B  1  299 ? 19.449  45.977 51.001 1.00 25.87 ? 326  GLU B OE2   1 
ATOM   6852  N  N     . GLN B  1  300 ? 14.168  47.724 51.538 1.00 22.64 ? 327  GLN B N     1 
ATOM   6853  C  CA    . GLN B  1  300 ? 13.140  46.706 51.290 1.00 22.23 ? 327  GLN B CA    1 
ATOM   6854  C  C     . GLN B  1  300 ? 12.465  46.894 49.922 1.00 22.00 ? 327  GLN B C     1 
ATOM   6855  O  O     . GLN B  1  300 ? 12.212  45.917 49.220 1.00 21.89 ? 327  GLN B O     1 
ATOM   6856  C  CB    . GLN B  1  300 ? 12.106  46.641 52.422 1.00 22.71 ? 327  GLN B CB    1 
ATOM   6857  C  CG    . GLN B  1  300 ? 11.096  45.468 52.295 1.00 22.11 ? 327  GLN B CG    1 
ATOM   6858  C  CD    . GLN B  1  300 ? 10.318  45.180 53.581 1.00 23.51 ? 327  GLN B CD    1 
ATOM   6859  O  OE1   . GLN B  1  300 ? 10.248  46.011 54.494 1.00 23.64 ? 327  GLN B OE1   1 
ATOM   6860  N  NE2   . GLN B  1  300 ? 9.723   43.996 53.649 1.00 23.80 ? 327  GLN B NE2   1 
ATOM   6861  N  N     . LEU B  1  301 ? 12.179  48.138 49.550 1.00 22.14 ? 328  LEU B N     1 
ATOM   6862  C  CA    . LEU B  1  301 ? 11.681  48.439 48.203 1.00 22.39 ? 328  LEU B CA    1 
ATOM   6863  C  C     . LEU B  1  301 ? 12.614  47.887 47.116 1.00 21.83 ? 328  LEU B C     1 
ATOM   6864  O  O     . LEU B  1  301 ? 12.155  47.252 46.157 1.00 21.74 ? 328  LEU B O     1 
ATOM   6865  C  CB    . LEU B  1  301 ? 11.469  49.949 48.018 1.00 22.62 ? 328  LEU B CB    1 
ATOM   6866  C  CG    . LEU B  1  301 ? 10.289  50.564 48.792 1.00 23.88 ? 328  LEU B CG    1 
ATOM   6867  C  CD1   . LEU B  1  301 ? 10.376  52.095 48.856 1.00 23.12 ? 328  LEU B CD1   1 
ATOM   6868  C  CD2   . LEU B  1  301 ? 8.947   50.128 48.204 1.00 22.97 ? 328  LEU B CD2   1 
ATOM   6869  N  N     . PHE B  1  302 ? 13.915  48.125 47.270 1.00 21.13 ? 329  PHE B N     1 
ATOM   6870  C  CA    . PHE B  1  302 ? 14.882  47.629 46.308 1.00 21.13 ? 329  PHE B CA    1 
ATOM   6871  C  C     . PHE B  1  302 ? 14.892  46.105 46.238 1.00 20.89 ? 329  PHE B C     1 
ATOM   6872  O  O     . PHE B  1  302 ? 14.839  45.532 45.146 1.00 20.75 ? 329  PHE B O     1 
ATOM   6873  C  CB    . PHE B  1  302 ? 16.306  48.118 46.602 1.00 20.73 ? 329  PHE B CB    1 
ATOM   6874  C  CG    . PHE B  1  302 ? 17.347  47.405 45.783 1.00 21.58 ? 329  PHE B CG    1 
ATOM   6875  C  CD1   . PHE B  1  302 ? 17.603  47.794 44.469 1.00 21.49 ? 329  PHE B CD1   1 
ATOM   6876  C  CD2   . PHE B  1  302 ? 18.034  46.303 46.306 1.00 20.71 ? 329  PHE B CD2   1 
ATOM   6877  C  CE1   . PHE B  1  302 ? 18.548  47.107 43.694 1.00 21.13 ? 329  PHE B CE1   1 
ATOM   6878  C  CE2   . PHE B  1  302 ? 18.974  45.613 45.541 1.00 20.16 ? 329  PHE B CE2   1 
ATOM   6879  C  CZ    . PHE B  1  302 ? 19.227  46.015 44.231 1.00 20.10 ? 329  PHE B CZ    1 
ATOM   6880  N  N     . GLN B  1  303 ? 14.976  45.458 47.401 1.00 20.79 ? 330  GLN B N     1 
ATOM   6881  C  CA    . GLN B  1  303 ? 15.129  44.007 47.449 1.00 20.63 ? 330  GLN B CA    1 
ATOM   6882  C  C     . GLN B  1  303 ? 13.878  43.324 46.926 1.00 20.69 ? 330  GLN B C     1 
ATOM   6883  O  O     . GLN B  1  303 ? 13.962  42.338 46.210 1.00 20.50 ? 330  GLN B O     1 
ATOM   6884  C  CB    . GLN B  1  303 ? 15.459  43.519 48.868 1.00 20.52 ? 330  GLN B CB    1 
ATOM   6885  C  CG    . GLN B  1  303 ? 16.804  44.000 49.411 1.00 20.36 ? 330  GLN B CG    1 
ATOM   6886  C  CD    . GLN B  1  303 ? 18.021  43.412 48.683 1.00 20.60 ? 330  GLN B CD    1 
ATOM   6887  O  OE1   . GLN B  1  303 ? 17.922  42.421 47.941 1.00 20.47 ? 330  GLN B OE1   1 
ATOM   6888  N  NE2   . GLN B  1  303 ? 19.178  44.020 48.908 1.00 19.71 ? 330  GLN B NE2   1 
ATOM   6889  N  N     . THR B  1  304 ? 12.716  43.864 47.274 1.00 21.25 ? 331  THR B N     1 
ATOM   6890  C  CA    . THR B  1  304 ? 11.458  43.260 46.855 1.00 21.27 ? 331  THR B CA    1 
ATOM   6891  C  C     . THR B  1  304 ? 11.277  43.407 45.347 1.00 21.28 ? 331  THR B C     1 
ATOM   6892  O  O     . THR B  1  304 ? 10.841  42.463 44.679 1.00 21.19 ? 331  THR B O     1 
ATOM   6893  C  CB    . THR B  1  304 ? 10.265  43.852 47.629 1.00 21.80 ? 331  THR B CB    1 
ATOM   6894  O  OG1   . THR B  1  304 ? 10.536  43.753 49.032 1.00 21.70 ? 331  THR B OG1   1 
ATOM   6895  C  CG2   . THR B  1  304 ? 8.986   43.089 47.324 1.00 22.29 ? 331  THR B CG2   1 
ATOM   6896  N  N     . SER B  1  305 ? 11.630  44.580 44.815 1.00 21.20 ? 332  SER B N     1 
ATOM   6897  C  CA    . SER B  1  305 ? 11.594  44.797 43.370 1.00 21.37 ? 332  SER B CA    1 
ATOM   6898  C  C     . SER B  1  305 ? 12.489  43.796 42.629 1.00 20.51 ? 332  SER B C     1 
ATOM   6899  O  O     . SER B  1  305 ? 12.049  43.183 41.652 1.00 20.85 ? 332  SER B O     1 
ATOM   6900  C  CB    . SER B  1  305 ? 11.970  46.237 43.004 1.00 21.68 ? 332  SER B CB    1 
ATOM   6901  O  OG    . SER B  1  305 ? 11.058  47.147 43.593 1.00 24.00 ? 332  SER B OG    1 
ATOM   6902  N  N     . ARG B  1  306 ? 13.726  43.627 43.095 1.00 19.57 ? 333  ARG B N     1 
ATOM   6903  C  CA    . ARG B  1  306 ? 14.625  42.617 42.512 1.00 18.75 ? 333  ARG B CA    1 
ATOM   6904  C  C     . ARG B  1  306 ? 13.971  41.229 42.430 1.00 18.70 ? 333  ARG B C     1 
ATOM   6905  O  O     . ARG B  1  306 ? 14.044  40.568 41.390 1.00 18.81 ? 333  ARG B O     1 
ATOM   6906  C  CB    . ARG B  1  306 ? 15.950  42.533 43.271 1.00 18.15 ? 333  ARG B CB    1 
ATOM   6907  C  CG    . ARG B  1  306 ? 16.951  41.568 42.633 1.00 17.52 ? 333  ARG B CG    1 
ATOM   6908  C  CD    . ARG B  1  306 ? 18.307  41.586 43.322 1.00 18.53 ? 333  ARG B CD    1 
ATOM   6909  N  NE    . ARG B  1  306 ? 19.270  40.807 42.547 1.00 19.32 ? 333  ARG B NE    1 
ATOM   6910  C  CZ    . ARG B  1  306 ? 20.593  40.921 42.642 1.00 20.21 ? 333  ARG B CZ    1 
ATOM   6911  N  NH1   . ARG B  1  306 ? 21.142  41.770 43.512 1.00 17.70 ? 333  ARG B NH1   1 
ATOM   6912  N  NH2   . ARG B  1  306 ? 21.368  40.191 41.845 1.00 18.94 ? 333  ARG B NH2   1 
ATOM   6913  N  N     . LEU B  1  307 ? 13.332  40.801 43.515 1.00 18.65 ? 334  LEU B N     1 
ATOM   6914  C  CA    . LEU B  1  307 ? 12.655  39.502 43.550 1.00 18.96 ? 334  LEU B CA    1 
ATOM   6915  C  C     . LEU B  1  307 ? 11.503  39.403 42.555 1.00 19.36 ? 334  LEU B C     1 
ATOM   6916  O  O     . LEU B  1  307 ? 11.329  38.373 41.891 1.00 19.91 ? 334  LEU B O     1 
ATOM   6917  C  CB    . LEU B  1  307 ? 12.161  39.174 44.967 1.00 19.32 ? 334  LEU B CB    1 
ATOM   6918  C  CG    . LEU B  1  307 ? 13.198  38.855 46.055 1.00 19.17 ? 334  LEU B CG    1 
ATOM   6919  C  CD1   . LEU B  1  307 ? 12.500  38.269 47.279 1.00 18.71 ? 334  LEU B CD1   1 
ATOM   6920  C  CD2   . LEU B  1  307 ? 14.291  37.912 45.570 1.00 17.74 ? 334  LEU B CD2   1 
ATOM   6921  N  N     . ILE B  1  308 ? 10.710  40.466 42.474 1.00 19.52 ? 335  ILE B N     1 
ATOM   6922  C  CA    . ILE B  1  308 ? 9.637   40.559 41.489 1.00 20.00 ? 335  ILE B CA    1 
ATOM   6923  C  C     . ILE B  1  308 ? 10.196  40.472 40.058 1.00 19.91 ? 335  ILE B C     1 
ATOM   6924  O  O     . ILE B  1  308 ? 9.664   39.726 39.236 1.00 20.45 ? 335  ILE B O     1 
ATOM   6925  C  CB    . ILE B  1  308 ? 8.807   41.847 41.687 1.00 20.49 ? 335  ILE B CB    1 
ATOM   6926  C  CG1   . ILE B  1  308 ? 7.940   41.724 42.949 1.00 20.03 ? 335  ILE B CG1   1 
ATOM   6927  C  CG2   . ILE B  1  308 ? 7.949   42.149 40.449 1.00 20.15 ? 335  ILE B CG2   1 
ATOM   6928  C  CD1   . ILE B  1  308 ? 7.426   43.050 43.450 1.00 19.83 ? 335  ILE B CD1   1 
ATOM   6929  N  N     . LEU B  1  309 ? 11.270  41.213 39.779 1.00 19.26 ? 336  LEU B N     1 
ATOM   6930  C  CA    . LEU B  1  309 ? 11.881  41.192 38.439 1.00 19.79 ? 336  LEU B CA    1 
ATOM   6931  C  C     . LEU B  1  309 ? 12.459  39.829 38.074 1.00 19.32 ? 336  LEU B C     1 
ATOM   6932  O  O     . LEU B  1  309 ? 12.349  39.412 36.922 1.00 19.86 ? 336  LEU B O     1 
ATOM   6933  C  CB    . LEU B  1  309 ? 12.929  42.310 38.253 1.00 19.20 ? 336  LEU B CB    1 
ATOM   6934  C  CG    . LEU B  1  309 ? 12.373  43.606 37.635 1.00 21.00 ? 336  LEU B CG    1 
ATOM   6935  C  CD1   . LEU B  1  309 ? 11.402  44.325 38.572 1.00 19.70 ? 336  LEU B CD1   1 
ATOM   6936  C  CD2   . LEU B  1  309 ? 13.499  44.560 37.186 1.00 21.67 ? 336  LEU B CD2   1 
ATOM   6937  N  N     . ILE B  1  310 ? 13.052  39.143 39.054 1.00 18.48 ? 337  ILE B N     1 
ATOM   6938  C  CA    . ILE B  1  310 ? 13.532  37.771 38.864 1.00 18.49 ? 337  ILE B CA    1 
ATOM   6939  C  C     . ILE B  1  310 ? 12.353  36.872 38.453 1.00 19.04 ? 337  ILE B C     1 
ATOM   6940  O  O     . ILE B  1  310 ? 12.460  36.111 37.487 1.00 19.15 ? 337  ILE B O     1 
ATOM   6941  C  CB    . ILE B  1  310 ? 14.260  37.230 40.133 1.00 17.71 ? 337  ILE B CB    1 
ATOM   6942  C  CG1   . ILE B  1  310 ? 15.642  37.877 40.282 1.00 18.34 ? 337  ILE B CG1   1 
ATOM   6943  C  CG2   . ILE B  1  310 ? 14.389  35.705 40.102 1.00 18.20 ? 337  ILE B CG2   1 
ATOM   6944  C  CD1   . ILE B  1  310 ? 16.305  37.647 41.695 1.00 17.80 ? 337  ILE B CD1   1 
ATOM   6945  N  N     . GLY B  1  311 ? 11.223  37.005 39.159 1.00 19.83 ? 338  GLY B N     1 
ATOM   6946  C  CA    . GLY B  1  311 ? 9.985   36.283 38.820 1.00 20.33 ? 338  GLY B CA    1 
ATOM   6947  C  C     . GLY B  1  311 ? 9.412   36.626 37.447 1.00 21.43 ? 338  GLY B C     1 
ATOM   6948  O  O     . GLY B  1  311 ? 9.002   35.731 36.692 1.00 21.54 ? 338  GLY B O     1 
ATOM   6949  N  N     . GLU B  1  312 ? 9.369   37.920 37.123 1.00 21.27 ? 339  GLU B N     1 
ATOM   6950  C  CA    . GLU B  1  312 ? 8.978   38.368 35.785 1.00 22.34 ? 339  GLU B CA    1 
ATOM   6951  C  C     . GLU B  1  312 ? 9.838   37.745 34.693 1.00 22.22 ? 339  GLU B C     1 
ATOM   6952  O  O     . GLU B  1  312 ? 9.329   37.360 33.638 1.00 23.16 ? 339  GLU B O     1 
ATOM   6953  C  CB    . GLU B  1  312 ? 9.137   39.881 35.652 1.00 22.46 ? 339  GLU B CB    1 
ATOM   6954  C  CG    . GLU B  1  312 ? 8.145   40.742 36.399 1.00 23.15 ? 339  GLU B CG    1 
ATOM   6955  C  CD    . GLU B  1  312 ? 8.331   42.206 36.033 1.00 24.67 ? 339  GLU B CD    1 
ATOM   6956  O  OE1   . GLU B  1  312 ? 8.590   42.499 34.847 1.00 27.75 ? 339  GLU B OE1   1 
ATOM   6957  O  OE2   . GLU B  1  312 ? 8.233   43.064 36.915 1.00 23.85 ? 339  GLU B OE2   1 
ATOM   6958  N  N     . THR B  1  313 ? 11.145  37.689 34.942 1.00 21.51 ? 340  THR B N     1 
ATOM   6959  C  CA    . THR B  1  313 ? 12.111  37.164 33.984 1.00 21.46 ? 340  THR B CA    1 
ATOM   6960  C  C     . THR B  1  313 ? 11.844  35.695 33.689 1.00 21.89 ? 340  THR B C     1 
ATOM   6961  O  O     . THR B  1  313 ? 11.806  35.297 32.523 1.00 22.78 ? 340  THR B O     1 
ATOM   6962  C  CB    . THR B  1  313 ? 13.555  37.370 34.480 1.00 21.14 ? 340  THR B CB    1 
ATOM   6963  O  OG1   . THR B  1  313 ? 13.789  38.775 34.664 1.00 21.81 ? 340  THR B OG1   1 
ATOM   6964  C  CG2   . THR B  1  313 ? 14.587  36.810 33.475 1.00 20.35 ? 340  THR B CG2   1 
ATOM   6965  N  N     . ILE B  1  314 ? 11.647  34.898 34.740 1.00 21.34 ? 341  ILE B N     1 
ATOM   6966  C  CA    . ILE B  1  314 ? 11.381  33.472 34.588 1.00 21.34 ? 341  ILE B CA    1 
ATOM   6967  C  C     . ILE B  1  314 ? 10.031  33.242 33.878 1.00 22.28 ? 341  ILE B C     1 
ATOM   6968  O  O     . ILE B  1  314 ? 9.923   32.372 33.003 1.00 22.41 ? 341  ILE B O     1 
ATOM   6969  C  CB    . ILE B  1  314 ? 11.474  32.726 35.946 1.00 21.08 ? 341  ILE B CB    1 
ATOM   6970  C  CG1   . ILE B  1  314 ? 12.914  32.785 36.479 1.00 20.51 ? 341  ILE B CG1   1 
ATOM   6971  C  CG2   . ILE B  1  314 ? 11.044  31.264 35.812 1.00 21.25 ? 341  ILE B CG2   1 
ATOM   6972  C  CD1   . ILE B  1  314 ? 13.062  32.324 37.942 1.00 21.07 ? 341  ILE B CD1   1 
ATOM   6973  N  N     . LYS B  1  315 ? 9.032   34.046 34.239 1.00 22.13 ? 342  LYS B N     1 
ATOM   6974  C  CA    . LYS B  1  315 ? 7.721   33.993 33.603 1.00 23.36 ? 342  LYS B CA    1 
ATOM   6975  C  C     . LYS B  1  315 ? 7.818   34.236 32.083 1.00 23.95 ? 342  LYS B C     1 
ATOM   6976  O  O     . LYS B  1  315 ? 7.335   33.422 31.289 1.00 24.47 ? 342  LYS B O     1 
ATOM   6977  C  CB    . LYS B  1  315 ? 6.760   34.993 34.278 1.00 23.21 ? 342  LYS B CB    1 
ATOM   6978  C  CG    . LYS B  1  315 ? 5.415   35.181 33.579 1.00 24.90 ? 342  LYS B CG    1 
ATOM   6979  C  CD    . LYS B  1  315 ? 4.403   34.129 33.979 1.00 25.18 ? 342  LYS B CD    1 
ATOM   6980  C  CE    . LYS B  1  315 ? 3.069   34.397 33.307 1.00 29.54 ? 342  LYS B CE    1 
ATOM   6981  N  NZ    . LYS B  1  315 ? 2.015   33.483 33.849 1.00 30.10 ? 342  LYS B NZ    1 
ATOM   6982  N  N     . ILE B  1  316 ? 8.458   35.339 31.694 1.00 23.86 ? 343  ILE B N     1 
ATOM   6983  C  CA    . ILE B  1  316 ? 8.667   35.675 30.279 1.00 24.49 ? 343  ILE B CA    1 
ATOM   6984  C  C     . ILE B  1  316 ? 9.482   34.594 29.552 1.00 24.88 ? 343  ILE B C     1 
ATOM   6985  O  O     . ILE B  1  316 ? 9.130   34.183 28.436 1.00 25.24 ? 343  ILE B O     1 
ATOM   6986  C  CB    . ILE B  1  316 ? 9.305   37.091 30.105 1.00 24.43 ? 343  ILE B CB    1 
ATOM   6987  C  CG1   . ILE B  1  316 ? 8.361   38.177 30.657 1.00 24.37 ? 343  ILE B CG1   1 
ATOM   6988  C  CG2   . ILE B  1  316 ? 9.659   37.383 28.631 1.00 24.36 ? 343  ILE B CG2   1 
ATOM   6989  C  CD1   . ILE B  1  316 ? 8.999   39.578 30.762 1.00 22.60 ? 343  ILE B CD1   1 
ATOM   6990  N  N     . VAL B  1  317 ? 10.550  34.115 30.183 1.00 24.17 ? 344  VAL B N     1 
ATOM   6991  C  CA    . VAL B  1  317 ? 11.403  33.115 29.535 1.00 24.84 ? 344  VAL B CA    1 
ATOM   6992  C  C     . VAL B  1  317 ? 10.635  31.821 29.201 1.00 25.55 ? 344  VAL B C     1 
ATOM   6993  O  O     . VAL B  1  317 ? 10.744  31.292 28.096 1.00 26.08 ? 344  VAL B O     1 
ATOM   6994  C  CB    . VAL B  1  317 ? 12.717  32.852 30.322 1.00 23.93 ? 344  VAL B CB    1 
ATOM   6995  C  CG1   . VAL B  1  317 ? 13.465  31.649 29.750 1.00 25.01 ? 344  VAL B CG1   1 
ATOM   6996  C  CG2   . VAL B  1  317 ? 13.608  34.084 30.261 1.00 24.23 ? 344  VAL B CG2   1 
ATOM   6997  N  N     . ILE B  1  318 ? 9.822   31.346 30.135 1.00 26.05 ? 345  ILE B N     1 
ATOM   6998  C  CA    . ILE B  1  318 ? 9.028   30.141 29.905 1.00 26.99 ? 345  ILE B CA    1 
ATOM   6999  C  C     . ILE B  1  318 ? 7.870   30.378 28.923 1.00 28.15 ? 345  ILE B C     1 
ATOM   7000  O  O     . ILE B  1  318 ? 7.706   29.648 27.936 1.00 29.02 ? 345  ILE B O     1 
ATOM   7001  C  CB    . ILE B  1  318 ? 8.512   29.538 31.245 1.00 26.96 ? 345  ILE B CB    1 
ATOM   7002  C  CG1   . ILE B  1  318 ? 9.693   29.024 32.082 1.00 25.87 ? 345  ILE B CG1   1 
ATOM   7003  C  CG2   . ILE B  1  318 ? 7.494   28.413 30.984 1.00 28.42 ? 345  ILE B CG2   1 
ATOM   7004  C  CD1   . ILE B  1  318 ? 9.323   28.544 33.501 1.00 24.88 ? 345  ILE B CD1   1 
ATOM   7005  N  N     . GLU B  1  319 ? 7.081   31.411 29.179 1.00 28.39 ? 346  GLU B N     1 
ATOM   7006  C  CA    . GLU B  1  319 ? 5.801   31.546 28.495 1.00 29.64 ? 346  GLU B CA    1 
ATOM   7007  C  C     . GLU B  1  319 ? 5.833   32.316 27.173 1.00 30.39 ? 346  GLU B C     1 
ATOM   7008  O  O     . GLU B  1  319 ? 4.901   32.201 26.372 1.00 31.31 ? 346  GLU B O     1 
ATOM   7009  C  CB    . GLU B  1  319 ? 4.742   32.078 29.456 1.00 29.81 ? 346  GLU B CB    1 
ATOM   7010  C  CG    . GLU B  1  319 ? 4.399   31.070 30.555 1.00 30.58 ? 346  GLU B CG    1 
ATOM   7011  C  CD    . GLU B  1  319 ? 3.198   31.468 31.388 1.00 32.21 ? 346  GLU B CD    1 
ATOM   7012  O  OE1   . GLU B  1  319 ? 2.355   32.244 30.892 1.00 35.84 ? 346  GLU B OE1   1 
ATOM   7013  O  OE2   . GLU B  1  319 ? 3.085   30.996 32.540 1.00 31.93 ? 346  GLU B OE2   1 
ATOM   7014  N  N     . ASP B  1  320 ? 6.900   33.086 26.940 1.00 29.67 ? 347  ASP B N     1 
ATOM   7015  C  CA    . ASP B  1  320 ? 7.072   33.786 25.661 1.00 30.35 ? 347  ASP B CA    1 
ATOM   7016  C  C     . ASP B  1  320 ? 8.270   33.236 24.890 1.00 29.83 ? 347  ASP B C     1 
ATOM   7017  O  O     . ASP B  1  320 ? 8.144   32.845 23.727 1.00 30.67 ? 347  ASP B O     1 
ATOM   7018  C  CB    . ASP B  1  320 ? 7.223   35.299 25.879 1.00 30.26 ? 347  ASP B CB    1 
ATOM   7019  C  CG    . ASP B  1  320 ? 5.953   35.947 26.418 1.00 32.60 ? 347  ASP B CG    1 
ATOM   7020  O  OD1   . ASP B  1  320 ? 4.866   35.680 25.867 1.00 35.84 ? 347  ASP B OD1   1 
ATOM   7021  O  OD2   . ASP B  1  320 ? 6.039   36.724 27.392 1.00 32.89 ? 347  ASP B OD2   1 
ATOM   7022  N  N     . TYR B  1  321 ? 9.415   33.190 25.565 1.00 28.05 ? 348  TYR B N     1 
ATOM   7023  C  CA    . TYR B  1  321 ? 10.704  32.841 24.959 1.00 27.80 ? 348  TYR B CA    1 
ATOM   7024  C  C     . TYR B  1  321 ? 10.819  31.349 24.597 1.00 27.97 ? 348  TYR B C     1 
ATOM   7025  O  O     . TYR B  1  321 ? 10.952  31.010 23.416 1.00 28.51 ? 348  TYR B O     1 
ATOM   7026  C  CB    . TYR B  1  321 ? 11.823  33.282 25.900 1.00 26.34 ? 348  TYR B CB    1 
ATOM   7027  C  CG    . TYR B  1  321 ? 13.249  33.076 25.427 1.00 26.80 ? 348  TYR B CG    1 
ATOM   7028  C  CD1   . TYR B  1  321 ? 13.916  34.070 24.709 1.00 26.44 ? 348  TYR B CD1   1 
ATOM   7029  C  CD2   . TYR B  1  321 ? 13.947  31.915 25.752 1.00 26.78 ? 348  TYR B CD2   1 
ATOM   7030  C  CE1   . TYR B  1  321 ? 15.234  33.906 24.307 1.00 28.73 ? 348  TYR B CE1   1 
ATOM   7031  C  CE2   . TYR B  1  321 ? 15.268  31.733 25.352 1.00 28.04 ? 348  TYR B CE2   1 
ATOM   7032  C  CZ    . TYR B  1  321 ? 15.904  32.734 24.633 1.00 28.46 ? 348  TYR B CZ    1 
ATOM   7033  O  OH    . TYR B  1  321 ? 17.203  32.559 24.238 1.00 29.83 ? 348  TYR B OH    1 
ATOM   7034  N  N     . VAL B  1  322 ? 10.772  30.470 25.599 1.00 27.15 ? 349  VAL B N     1 
ATOM   7035  C  CA    . VAL B  1  322 ? 10.786  29.020 25.349 1.00 27.83 ? 349  VAL B CA    1 
ATOM   7036  C  C     . VAL B  1  322 ? 9.559   28.595 24.515 1.00 29.13 ? 349  VAL B C     1 
ATOM   7037  O  O     . VAL B  1  322 ? 9.679   27.783 23.592 1.00 29.91 ? 349  VAL B O     1 
ATOM   7038  C  CB    . VAL B  1  322 ? 10.906  28.190 26.655 1.00 27.22 ? 349  VAL B CB    1 
ATOM   7039  C  CG1   . VAL B  1  322 ? 10.819  26.683 26.360 1.00 27.55 ? 349  VAL B CG1   1 
ATOM   7040  C  CG2   . VAL B  1  322 ? 12.223  28.494 27.357 1.00 26.41 ? 349  VAL B CG2   1 
ATOM   7041  N  N     . GLN B  1  323 ? 8.399   29.173 24.825 1.00 29.15 ? 350  GLN B N     1 
ATOM   7042  C  CA    . GLN B  1  323 ? 7.187   28.961 24.036 1.00 30.46 ? 350  GLN B CA    1 
ATOM   7043  C  C     . GLN B  1  323 ? 7.439   29.172 22.544 1.00 31.09 ? 350  GLN B C     1 
ATOM   7044  O  O     . GLN B  1  323 ? 7.107   28.307 21.738 1.00 31.82 ? 350  GLN B O     1 
ATOM   7045  C  CB    . GLN B  1  323 ? 6.053   29.876 24.508 1.00 30.58 ? 350  GLN B CB    1 
ATOM   7046  C  CG    . GLN B  1  323 ? 4.720   29.651 23.789 1.00 32.44 ? 350  GLN B CG    1 
ATOM   7047  C  CD    . GLN B  1  323 ? 4.081   28.310 24.129 1.00 35.07 ? 350  GLN B CD    1 
ATOM   7048  O  OE1   . GLN B  1  323 ? 3.898   27.972 25.305 1.00 35.76 ? 350  GLN B OE1   1 
ATOM   7049  N  NE2   . GLN B  1  323 ? 3.729   27.545 23.101 1.00 34.58 ? 350  GLN B NE2   1 
ATOM   7050  N  N     . HIS B  1  324 ? 8.025   30.319 22.193 1.00 30.72 ? 351  HIS B N     1 
ATOM   7051  C  CA    . HIS B  1  324 ? 8.341   30.635 20.803 1.00 31.60 ? 351  HIS B CA    1 
ATOM   7052  C  C     . HIS B  1  324 ? 9.341   29.653 20.188 1.00 32.33 ? 351  HIS B C     1 
ATOM   7053  O  O     . HIS B  1  324 ? 9.145   29.183 19.070 1.00 33.09 ? 351  HIS B O     1 
ATOM   7054  C  CB    . HIS B  1  324 ? 8.871   32.061 20.667 1.00 30.65 ? 351  HIS B CB    1 
ATOM   7055  C  CG    . HIS B  1  324 ? 9.499   32.333 19.338 1.00 31.00 ? 351  HIS B CG    1 
ATOM   7056  N  ND1   . HIS B  1  324 ? 8.757   32.545 18.197 1.00 31.18 ? 351  HIS B ND1   1 
ATOM   7057  C  CD2   . HIS B  1  324 ? 10.798  32.389 18.959 1.00 30.23 ? 351  HIS B CD2   1 
ATOM   7058  C  CE1   . HIS B  1  324 ? 9.571   32.737 17.174 1.00 32.56 ? 351  HIS B CE1   1 
ATOM   7059  N  NE2   . HIS B  1  324 ? 10.815  32.640 17.608 1.00 31.52 ? 351  HIS B NE2   1 
ATOM   7060  N  N     . LEU B  1  325 ? 10.421  29.377 20.918 1.00 31.87 ? 352  LEU B N     1 
ATOM   7061  C  CA    . LEU B  1  325 ? 11.442  28.422 20.496 1.00 32.62 ? 352  LEU B CA    1 
ATOM   7062  C  C     . LEU B  1  325 ? 10.871  27.046 20.181 1.00 33.82 ? 352  LEU B C     1 
ATOM   7063  O  O     . LEU B  1  325 ? 11.213  26.438 19.162 1.00 34.30 ? 352  LEU B O     1 
ATOM   7064  C  CB    . LEU B  1  325 ? 12.493  28.272 21.597 1.00 31.78 ? 352  LEU B CB    1 
ATOM   7065  C  CG    . LEU B  1  325 ? 13.946  28.655 21.326 1.00 32.56 ? 352  LEU B CG    1 
ATOM   7066  C  CD1   . LEU B  1  325 ? 14.101  29.538 20.087 1.00 33.43 ? 352  LEU B CD1   1 
ATOM   7067  C  CD2   . LEU B  1  325 ? 14.575  29.277 22.571 1.00 30.48 ? 352  LEU B CD2   1 
ATOM   7068  N  N     . SER B  1  326 ? 10.009  26.565 21.074 1.00 34.04 ? 353  SER B N     1 
ATOM   7069  C  CA    . SER B  1  326 ? 9.498   25.200 21.017 1.00 35.43 ? 353  SER B CA    1 
ATOM   7070  C  C     . SER B  1  326 ? 8.669   24.935 19.759 1.00 37.19 ? 353  SER B C     1 
ATOM   7071  O  O     . SER B  1  326 ? 8.738   23.849 19.187 1.00 38.40 ? 353  SER B O     1 
ATOM   7072  C  CB    . SER B  1  326 ? 8.655   24.900 22.261 1.00 35.16 ? 353  SER B CB    1 
ATOM   7073  O  OG    . SER B  1  326 ? 7.405   25.573 22.201 1.00 34.87 ? 353  SER B OG    1 
ATOM   7074  N  N     . GLY B  1  327 ? 7.880   25.926 19.348 1.00 37.61 ? 354  GLY B N     1 
ATOM   7075  C  CA    . GLY B  1  327 ? 6.920   25.748 18.254 1.00 39.49 ? 354  GLY B CA    1 
ATOM   7076  C  C     . GLY B  1  327 ? 5.735   24.883 18.650 1.00 40.63 ? 354  GLY B C     1 
ATOM   7077  O  O     . GLY B  1  327 ? 4.966   24.448 17.795 1.00 42.10 ? 354  GLY B O     1 
ATOM   7078  N  N     . TYR B  1  328 ? 5.588   24.635 19.950 1.00 40.19 ? 355  TYR B N     1 
ATOM   7079  C  CA    . TYR B  1  328 ? 4.487   23.824 20.474 1.00 41.65 ? 355  TYR B CA    1 
ATOM   7080  C  C     . TYR B  1  328 ? 3.140   24.525 20.334 1.00 42.37 ? 355  TYR B C     1 
ATOM   7081  O  O     . TYR B  1  328 ? 3.056   25.750 20.459 1.00 41.77 ? 355  TYR B O     1 
ATOM   7082  C  CB    . TYR B  1  328 ? 4.707   23.487 21.955 1.00 40.77 ? 355  TYR B CB    1 
ATOM   7083  C  CG    . TYR B  1  328 ? 5.922   22.637 22.263 1.00 41.12 ? 355  TYR B CG    1 
ATOM   7084  C  CD1   . TYR B  1  328 ? 6.611   21.959 21.255 1.00 42.43 ? 355  TYR B CD1   1 
ATOM   7085  C  CD2   . TYR B  1  328 ? 6.364   22.488 23.574 1.00 41.06 ? 355  TYR B CD2   1 
ATOM   7086  C  CE1   . TYR B  1  328 ? 7.718   21.178 21.545 1.00 42.59 ? 355  TYR B CE1   1 
ATOM   7087  C  CE2   . TYR B  1  328 ? 7.466   21.705 23.873 1.00 41.24 ? 355  TYR B CE2   1 
ATOM   7088  C  CZ    . TYR B  1  328 ? 8.136   21.053 22.854 1.00 42.10 ? 355  TYR B CZ    1 
ATOM   7089  O  OH    . TYR B  1  328 ? 9.230   20.276 23.146 1.00 42.72 ? 355  TYR B OH    1 
ATOM   7090  N  N     . HIS B  1  329 ? 2.094   23.739 20.080 1.00 43.82 ? 356  HIS B N     1 
ATOM   7091  C  CA    . HIS B  1  329 ? 0.718   24.219 20.180 1.00 44.74 ? 356  HIS B CA    1 
ATOM   7092  C  C     . HIS B  1  329 ? 0.257   24.241 21.637 1.00 43.99 ? 356  HIS B C     1 
ATOM   7093  O  O     . HIS B  1  329 ? -0.627  25.017 22.001 1.00 44.35 ? 356  HIS B O     1 
ATOM   7094  C  CB    . HIS B  1  329 ? -0.234  23.350 19.357 1.00 47.11 ? 356  HIS B CB    1 
ATOM   7095  C  CG    . HIS B  1  329 ? 0.033   23.380 17.886 1.00 48.64 ? 356  HIS B CG    1 
ATOM   7096  N  ND1   . HIS B  1  329 ? 0.037   24.549 17.153 1.00 49.17 ? 356  HIS B ND1   1 
ATOM   7097  C  CD2   . HIS B  1  329 ? 0.282   22.382 17.006 1.00 50.38 ? 356  HIS B CD2   1 
ATOM   7098  C  CE1   . HIS B  1  329 ? 0.287   24.269 15.886 1.00 50.69 ? 356  HIS B CE1   1 
ATOM   7099  N  NE2   . HIS B  1  329 ? 0.439   22.961 15.770 1.00 51.42 ? 356  HIS B NE2   1 
ATOM   7100  N  N     . PHE B  1  330 ? 0.848   23.378 22.461 1.00 43.06 ? 357  PHE B N     1 
ATOM   7101  C  CA    . PHE B  1  330 ? 0.623   23.397 23.908 1.00 42.18 ? 357  PHE B CA    1 
ATOM   7102  C  C     . PHE B  1  330 ? 1.182   24.691 24.514 1.00 40.46 ? 357  PHE B C     1 
ATOM   7103  O  O     . PHE B  1  330 ? 2.299   25.106 24.181 1.00 39.56 ? 357  PHE B O     1 
ATOM   7104  C  CB    . PHE B  1  330 ? 1.261   22.161 24.559 1.00 41.67 ? 357  PHE B CB    1 
ATOM   7105  C  CG    . PHE B  1  330 ? 1.247   22.179 26.068 1.00 40.93 ? 357  PHE B CG    1 
ATOM   7106  C  CD1   . PHE B  1  330 ? 0.055   22.017 26.774 1.00 41.37 ? 357  PHE B CD1   1 
ATOM   7107  C  CD2   . PHE B  1  330 ? 2.433   22.340 26.783 1.00 38.82 ? 357  PHE B CD2   1 
ATOM   7108  C  CE1   . PHE B  1  330 ? 0.040   22.035 28.169 1.00 40.76 ? 357  PHE B CE1   1 
ATOM   7109  C  CE2   . PHE B  1  330 ? 2.430   22.356 28.183 1.00 38.36 ? 357  PHE B CE2   1 
ATOM   7110  C  CZ    . PHE B  1  330 ? 1.233   22.200 28.877 1.00 39.34 ? 357  PHE B CZ    1 
ATOM   7111  N  N     . LYS B  1  331 ? 0.400   25.328 25.386 1.00 40.41 ? 358  LYS B N     1 
ATOM   7112  C  CA    . LYS B  1  331 ? 0.834   26.548 26.069 1.00 39.15 ? 358  LYS B CA    1 
ATOM   7113  C  C     . LYS B  1  331 ? 1.594   26.219 27.352 1.00 37.99 ? 358  LYS B C     1 
ATOM   7114  O  O     . LYS B  1  331 ? 1.000   25.808 28.353 1.00 38.25 ? 358  LYS B O     1 
ATOM   7115  C  CB    . LYS B  1  331 ? -0.348  27.481 26.370 1.00 39.82 ? 358  LYS B CB    1 
ATOM   7116  C  CG    . LYS B  1  331 ? -0.821  28.318 25.180 1.00 41.52 ? 358  LYS B CG    1 
ATOM   7117  N  N     . LEU B  1  332 ? 2.912   26.398 27.305 1.00 36.68 ? 359  LEU B N     1 
ATOM   7118  C  CA    . LEU B  1  332 ? 3.777   26.197 28.470 1.00 35.68 ? 359  LEU B CA    1 
ATOM   7119  C  C     . LEU B  1  332 ? 3.342   27.113 29.612 1.00 35.36 ? 359  LEU B C     1 
ATOM   7120  O  O     . LEU B  1  332 ? 2.748   28.169 29.379 1.00 35.85 ? 359  LEU B O     1 
ATOM   7121  C  CB    . LEU B  1  332 ? 5.249   26.437 28.098 1.00 34.24 ? 359  LEU B CB    1 
ATOM   7122  C  CG    . LEU B  1  332 ? 5.820   25.508 27.018 1.00 34.61 ? 359  LEU B CG    1 
ATOM   7123  C  CD1   . LEU B  1  332 ? 7.240   25.903 26.635 1.00 32.99 ? 359  LEU B CD1   1 
ATOM   7124  C  CD2   . LEU B  1  332 ? 5.773   24.048 27.466 1.00 33.90 ? 359  LEU B CD2   1 
ATOM   7125  N  N     . LYS B  1  333 ? 3.611   26.692 30.842 1.00 34.74 ? 360  LYS B N     1 
ATOM   7126  C  CA    . LYS B  1  333 ? 3.157   27.433 32.012 1.00 34.54 ? 360  LYS B CA    1 
ATOM   7127  C  C     . LYS B  1  333 ? 4.268   27.576 33.040 1.00 32.80 ? 360  LYS B C     1 
ATOM   7128  O  O     . LYS B  1  333 ? 4.957   26.609 33.338 1.00 32.92 ? 360  LYS B O     1 
ATOM   7129  C  CB    . LYS B  1  333 ? 1.962   26.711 32.644 1.00 36.17 ? 360  LYS B CB    1 
ATOM   7130  C  CG    . LYS B  1  333 ? 1.252   27.490 33.740 1.00 37.20 ? 360  LYS B CG    1 
ATOM   7131  C  CD    . LYS B  1  333 ? 0.187   26.633 34.409 1.00 41.85 ? 360  LYS B CD    1 
ATOM   7132  C  CE    . LYS B  1  333 ? -0.609  27.436 35.431 1.00 42.80 ? 360  LYS B CE    1 
ATOM   7133  N  NZ    . LYS B  1  333 ? -1.333  26.527 36.363 1.00 45.16 ? 360  LYS B NZ    1 
ATOM   7134  N  N     . PHE B  1  334 ? 4.444   28.785 33.570 1.00 31.61 ? 361  PHE B N     1 
ATOM   7135  C  CA    . PHE B  1  334 ? 5.297   28.988 34.734 1.00 30.36 ? 361  PHE B CA    1 
ATOM   7136  C  C     . PHE B  1  334 ? 4.435   28.850 35.985 1.00 30.71 ? 361  PHE B C     1 
ATOM   7137  O  O     . PHE B  1  334 ? 3.641   29.735 36.317 1.00 30.80 ? 361  PHE B O     1 
ATOM   7138  C  CB    . PHE B  1  334 ? 6.028   30.341 34.697 1.00 29.16 ? 361  PHE B CB    1 
ATOM   7139  C  CG    . PHE B  1  334 ? 6.825   30.647 35.953 1.00 28.59 ? 361  PHE B CG    1 
ATOM   7140  C  CD1   . PHE B  1  334 ? 7.716   29.708 36.489 1.00 28.66 ? 361  PHE B CD1   1 
ATOM   7141  C  CD2   . PHE B  1  334 ? 6.689   31.877 36.592 1.00 27.72 ? 361  PHE B CD2   1 
ATOM   7142  C  CE1   . PHE B  1  334 ? 8.448   29.985 37.645 1.00 27.76 ? 361  PHE B CE1   1 
ATOM   7143  C  CE2   . PHE B  1  334 ? 7.417   32.172 37.753 1.00 27.82 ? 361  PHE B CE2   1 
ATOM   7144  C  CZ    . PHE B  1  334 ? 8.305   31.222 38.280 1.00 27.89 ? 361  PHE B CZ    1 
ATOM   7145  N  N     . ASP B  1  335 ? 4.595   27.718 36.663 1.00 30.71 ? 362  ASP B N     1 
ATOM   7146  C  CA    . ASP B  1  335 ? 3.839   27.428 37.871 1.00 31.03 ? 362  ASP B CA    1 
ATOM   7147  C  C     . ASP B  1  335 ? 4.677   26.577 38.831 1.00 30.34 ? 362  ASP B C     1 
ATOM   7148  O  O     . ASP B  1  335 ? 4.661   25.347 38.747 1.00 30.80 ? 362  ASP B O     1 
ATOM   7149  C  CB    . ASP B  1  335 ? 2.522   26.734 37.507 1.00 32.56 ? 362  ASP B CB    1 
ATOM   7150  C  CG    . ASP B  1  335 ? 1.627   26.510 38.705 1.00 34.45 ? 362  ASP B CG    1 
ATOM   7151  O  OD1   . ASP B  1  335 ? 1.975   26.963 39.820 1.00 34.00 ? 362  ASP B OD1   1 
ATOM   7152  O  OD2   . ASP B  1  335 ? 0.570   25.866 38.527 1.00 38.14 ? 362  ASP B OD2   1 
ATOM   7153  N  N     . PRO B  1  336 ? 5.413   27.234 39.749 1.00 29.23 ? 363  PRO B N     1 
ATOM   7154  C  CA    . PRO B  1  336 ? 6.242   26.551 40.738 1.00 28.94 ? 363  PRO B CA    1 
ATOM   7155  C  C     . PRO B  1  336 ? 5.518   25.471 41.540 1.00 30.46 ? 363  PRO B C     1 
ATOM   7156  O  O     . PRO B  1  336 ? 6.144   24.486 41.921 1.00 30.70 ? 363  PRO B O     1 
ATOM   7157  C  CB    . PRO B  1  336 ? 6.687   27.691 41.654 1.00 27.96 ? 363  PRO B CB    1 
ATOM   7158  C  CG    . PRO B  1  336 ? 6.773   28.847 40.731 1.00 27.58 ? 363  PRO B CG    1 
ATOM   7159  C  CD    . PRO B  1  336 ? 5.574   28.698 39.840 1.00 28.31 ? 363  PRO B CD    1 
ATOM   7160  N  N     . GLU B  1  337 ? 4.215   25.637 41.767 1.00 31.73 ? 364  GLU B N     1 
ATOM   7161  C  CA    . GLU B  1  337 ? 3.431   24.657 42.533 1.00 33.68 ? 364  GLU B CA    1 
ATOM   7162  C  C     . GLU B  1  337 ? 3.397   23.267 41.897 1.00 34.35 ? 364  GLU B C     1 
ATOM   7163  O  O     . GLU B  1  337 ? 3.214   22.267 42.599 1.00 34.82 ? 364  GLU B O     1 
ATOM   7164  C  CB    . GLU B  1  337 ? 2.015   25.166 42.787 1.00 34.77 ? 364  GLU B CB    1 
ATOM   7165  C  CG    . GLU B  1  337 ? 1.973   26.513 43.512 1.00 36.87 ? 364  GLU B CG    1 
ATOM   7166  C  CD    . GLU B  1  337 ? 0.584   26.868 44.023 1.00 41.84 ? 364  GLU B CD    1 
ATOM   7167  O  OE1   . GLU B  1  337 ? 0.388   28.034 44.451 1.00 43.21 ? 364  GLU B OE1   1 
ATOM   7168  O  OE2   . GLU B  1  337 ? -0.303  25.986 43.995 1.00 44.00 ? 364  GLU B OE2   1 
ATOM   7169  N  N     . LEU B  1  338 ? 3.602   23.211 40.582 1.00 34.12 ? 365  LEU B N     1 
ATOM   7170  C  CA    . LEU B  1  338 ? 3.617   21.945 39.833 1.00 35.09 ? 365  LEU B CA    1 
ATOM   7171  C  C     . LEU B  1  338 ? 4.675   20.964 40.328 1.00 34.90 ? 365  LEU B C     1 
ATOM   7172  O  O     . LEU B  1  338 ? 4.550   19.759 40.120 1.00 36.08 ? 365  LEU B O     1 
ATOM   7173  C  CB    . LEU B  1  338 ? 3.835   22.203 38.335 1.00 34.79 ? 365  LEU B CB    1 
ATOM   7174  C  CG    . LEU B  1  338 ? 2.720   22.937 37.580 1.00 35.67 ? 365  LEU B CG    1 
ATOM   7175  C  CD1   . LEU B  1  338 ? 3.186   23.292 36.185 1.00 36.34 ? 365  LEU B CD1   1 
ATOM   7176  C  CD2   . LEU B  1  338 ? 1.438   22.117 37.529 1.00 37.09 ? 365  LEU B CD2   1 
ATOM   7177  N  N     . LEU B  1  339 ? 5.713   21.484 40.977 1.00 33.48 ? 366  LEU B N     1 
ATOM   7178  C  CA    . LEU B  1  339 ? 6.790   20.655 41.489 1.00 33.07 ? 366  LEU B CA    1 
ATOM   7179  C  C     . LEU B  1  339 ? 6.710   20.370 42.992 1.00 33.45 ? 366  LEU B C     1 
ATOM   7180  O  O     . LEU B  1  339 ? 7.548   19.639 43.516 1.00 33.49 ? 366  LEU B O     1 
ATOM   7181  C  CB    . LEU B  1  339 ? 8.145   21.273 41.141 1.00 31.46 ? 366  LEU B CB    1 
ATOM   7182  C  CG    . LEU B  1  339 ? 8.498   21.372 39.654 1.00 31.63 ? 366  LEU B CG    1 
ATOM   7183  C  CD1   . LEU B  1  339 ? 9.729   22.254 39.447 1.00 30.37 ? 366  LEU B CD1   1 
ATOM   7184  C  CD2   . LEU B  1  339 ? 8.687   19.982 39.024 1.00 32.61 ? 366  LEU B CD2   1 
ATOM   7185  N  N     . PHE B  1  340 ? 5.711   20.925 43.678 1.00 33.69 ? 367  PHE B N     1 
ATOM   7186  C  CA    . PHE B  1  340 ? 5.673   20.845 45.145 1.00 34.48 ? 367  PHE B CA    1 
ATOM   7187  C  C     . PHE B  1  340 ? 5.452   19.434 45.693 1.00 36.44 ? 367  PHE B C     1 
ATOM   7188  O  O     . PHE B  1  340 ? 5.806   19.155 46.835 1.00 37.07 ? 367  PHE B O     1 
ATOM   7189  C  CB    . PHE B  1  340 ? 4.662   21.833 45.764 1.00 34.18 ? 367  PHE B CB    1 
ATOM   7190  C  CG    . PHE B  1  340 ? 5.080   23.290 45.686 1.00 32.54 ? 367  PHE B CG    1 
ATOM   7191  C  CD1   . PHE B  1  340 ? 6.349   23.656 45.253 1.00 30.58 ? 367  PHE B CD1   1 
ATOM   7192  C  CD2   . PHE B  1  340 ? 4.194   24.297 46.071 1.00 32.69 ? 367  PHE B CD2   1 
ATOM   7193  C  CE1   . PHE B  1  340 ? 6.732   25.009 45.181 1.00 30.22 ? 367  PHE B CE1   1 
ATOM   7194  C  CE2   . PHE B  1  340 ? 4.558   25.649 46.009 1.00 31.49 ? 367  PHE B CE2   1 
ATOM   7195  C  CZ    . PHE B  1  340 ? 5.835   26.007 45.560 1.00 30.61 ? 367  PHE B CZ    1 
ATOM   7196  N  N     . ASN B  1  341 ? 4.874   18.549 44.884 1.00 38.15 ? 368  ASN B N     1 
ATOM   7197  C  CA    . ASN B  1  341 ? 4.737   17.135 45.257 1.00 40.32 ? 368  ASN B CA    1 
ATOM   7198  C  C     . ASN B  1  341 ? 5.772   16.239 44.557 1.00 40.20 ? 368  ASN B C     1 
ATOM   7199  O  O     . ASN B  1  341 ? 5.628   15.016 44.529 1.00 41.60 ? 368  ASN B O     1 
ATOM   7200  C  CB    . ASN B  1  341 ? 3.305   16.631 44.986 1.00 42.13 ? 368  ASN B CB    1 
ATOM   7201  C  CG    . ASN B  1  341 ? 2.925   16.673 43.496 1.00 44.01 ? 368  ASN B CG    1 
ATOM   7202  O  OD1   . ASN B  1  341 ? 3.687   17.156 42.648 1.00 46.05 ? 368  ASN B OD1   1 
ATOM   7203  N  ND2   . ASN B  1  341 ? 1.734   16.175 43.179 1.00 47.85 ? 368  ASN B ND2   1 
ATOM   7204  N  N     . GLN B  1  342 ? 6.808   16.858 43.992 1.00 38.96 ? 369  GLN B N     1 
ATOM   7205  C  CA    . GLN B  1  342 ? 7.812   16.142 43.210 1.00 38.99 ? 369  GLN B CA    1 
ATOM   7206  C  C     . GLN B  1  342 ? 9.186   16.234 43.853 1.00 37.86 ? 369  GLN B C     1 
ATOM   7207  O  O     . GLN B  1  342 ? 9.451   17.141 44.642 1.00 37.01 ? 369  GLN B O     1 
ATOM   7208  C  CB    . GLN B  1  342 ? 7.892   16.713 41.791 1.00 38.68 ? 369  GLN B CB    1 
ATOM   7209  C  CG    . GLN B  1  342 ? 6.602   16.654 40.995 1.00 41.71 ? 369  GLN B CG    1 
ATOM   7210  C  CD    . GLN B  1  342 ? 6.125   15.238 40.769 1.00 45.94 ? 369  GLN B CD    1 
ATOM   7211  O  OE1   . GLN B  1  342 ? 6.890   14.369 40.343 1.00 47.98 ? 369  GLN B OE1   1 
ATOM   7212  N  NE2   . GLN B  1  342 ? 4.856   14.993 41.060 1.00 48.16 ? 369  GLN B NE2   1 
ATOM   7213  N  N     . GLN B  1  343 ? 10.058  15.295 43.499 1.00 37.92 ? 370  GLN B N     1 
ATOM   7214  C  CA    . GLN B  1  343 ? 11.459  15.345 43.900 1.00 36.85 ? 370  GLN B CA    1 
ATOM   7215  C  C     . GLN B  1  343 ? 12.197  16.281 42.956 1.00 35.46 ? 370  GLN B C     1 
ATOM   7216  O  O     . GLN B  1  343 ? 12.315  16.002 41.760 1.00 35.61 ? 370  GLN B O     1 
ATOM   7217  C  CB    . GLN B  1  343 ? 12.084  13.948 43.864 1.00 37.77 ? 370  GLN B CB    1 
ATOM   7218  C  CG    . GLN B  1  343 ? 11.590  13.022 44.956 1.00 39.69 ? 370  GLN B CG    1 
ATOM   7219  C  CD    . GLN B  1  343 ? 12.266  11.661 44.917 1.00 41.70 ? 370  GLN B CD    1 
ATOM   7220  O  OE1   . GLN B  1  343 ? 12.028  10.865 44.015 1.00 43.18 ? 370  GLN B OE1   1 
ATOM   7221  N  NE2   . GLN B  1  343 ? 13.113  11.393 45.900 1.00 42.22 ? 370  GLN B NE2   1 
ATOM   7222  N  N     . PHE B  1  344 ? 12.674  17.402 43.495 1.00 33.84 ? 371  PHE B N     1 
ATOM   7223  C  CA    . PHE B  1  344 ? 13.361  18.419 42.704 1.00 32.14 ? 371  PHE B CA    1 
ATOM   7224  C  C     . PHE B  1  344 ? 14.293  19.228 43.588 1.00 30.65 ? 371  PHE B C     1 
ATOM   7225  O  O     . PHE B  1  344 ? 13.912  19.627 44.689 1.00 30.42 ? 371  PHE B O     1 
ATOM   7226  C  CB    . PHE B  1  344 ? 12.352  19.340 42.006 1.00 32.02 ? 371  PHE B CB    1 
ATOM   7227  C  CG    . PHE B  1  344 ? 12.977  20.320 41.052 1.00 31.42 ? 371  PHE B CG    1 
ATOM   7228  C  CD1   . PHE B  1  344 ? 13.308  19.935 39.756 1.00 32.26 ? 371  PHE B CD1   1 
ATOM   7229  C  CD2   . PHE B  1  344 ? 13.237  21.628 41.445 1.00 31.23 ? 371  PHE B CD2   1 
ATOM   7230  C  CE1   . PHE B  1  344 ? 13.887  20.840 38.867 1.00 31.63 ? 371  PHE B CE1   1 
ATOM   7231  C  CE2   . PHE B  1  344 ? 13.821  22.546 40.561 1.00 30.29 ? 371  PHE B CE2   1 
ATOM   7232  C  CZ    . PHE B  1  344 ? 14.145  22.151 39.275 1.00 30.33 ? 371  PHE B CZ    1 
ATOM   7233  N  N     . GLN B  1  345 ? 15.509  19.468 43.092 1.00 29.56 ? 372  GLN B N     1 
ATOM   7234  C  CA    . GLN B  1  345 ? 16.523  20.240 43.811 1.00 27.90 ? 372  GLN B CA    1 
ATOM   7235  C  C     . GLN B  1  345 ? 16.484  21.712 43.419 1.00 26.96 ? 372  GLN B C     1 
ATOM   7236  O  O     . GLN B  1  345 ? 16.738  22.050 42.257 1.00 26.22 ? 372  GLN B O     1 
ATOM   7237  C  CB    . GLN B  1  345 ? 17.926  19.669 43.549 1.00 27.86 ? 372  GLN B CB    1 
ATOM   7238  C  CG    . GLN B  1  345 ? 18.145  18.233 44.045 1.00 28.01 ? 372  GLN B CG    1 
ATOM   7239  C  CD    . GLN B  1  345 ? 17.907  18.088 45.540 1.00 27.98 ? 372  GLN B CD    1 
ATOM   7240  O  OE1   . GLN B  1  345 ? 18.514  18.785 46.343 1.00 26.74 ? 372  GLN B OE1   1 
ATOM   7241  N  NE2   . GLN B  1  345 ? 17.013  17.180 45.915 1.00 29.14 ? 372  GLN B NE2   1 
ATOM   7242  N  N     . TYR B  1  346 ? 16.181  22.585 44.388 1.00 26.20 ? 373  TYR B N     1 
ATOM   7243  C  CA    . TYR B  1  346 ? 16.157  24.026 44.143 1.00 25.34 ? 373  TYR B CA    1 
ATOM   7244  C  C     . TYR B  1  346 ? 17.582  24.589 44.226 1.00 25.16 ? 373  TYR B C     1 
ATOM   7245  O  O     . TYR B  1  346 ? 17.957  25.302 45.165 1.00 25.09 ? 373  TYR B O     1 
ATOM   7246  C  CB    . TYR B  1  346 ? 15.175  24.751 45.078 1.00 24.91 ? 373  TYR B CB    1 
ATOM   7247  C  CG    . TYR B  1  346 ? 13.729  24.336 44.846 1.00 25.17 ? 373  TYR B CG    1 
ATOM   7248  C  CD1   . TYR B  1  346 ? 13.019  24.804 43.736 1.00 25.15 ? 373  TYR B CD1   1 
ATOM   7249  C  CD2   . TYR B  1  346 ? 13.082  23.452 45.717 1.00 26.32 ? 373  TYR B CD2   1 
ATOM   7250  C  CE1   . TYR B  1  346 ? 11.704  24.409 43.501 1.00 25.46 ? 373  TYR B CE1   1 
ATOM   7251  C  CE2   . TYR B  1  346 ? 11.750  23.052 45.493 1.00 25.75 ? 373  TYR B CE2   1 
ATOM   7252  C  CZ    . TYR B  1  346 ? 11.078  23.537 44.381 1.00 26.98 ? 373  TYR B CZ    1 
ATOM   7253  O  OH    . TYR B  1  346 ? 9.778   23.160 44.134 1.00 28.37 ? 373  TYR B OH    1 
ATOM   7254  N  N     . GLN B  1  347 ? 18.378  24.226 43.231 1.00 25.11 ? 374  GLN B N     1 
ATOM   7255  C  CA    . GLN B  1  347 ? 19.745  24.709 43.100 1.00 24.96 ? 374  GLN B CA    1 
ATOM   7256  C  C     . GLN B  1  347 ? 20.165  24.492 41.662 1.00 25.02 ? 374  GLN B C     1 
ATOM   7257  O  O     . GLN B  1  347 ? 19.577  23.672 40.963 1.00 25.64 ? 374  GLN B O     1 
ATOM   7258  C  CB    . GLN B  1  347 ? 20.700  23.984 44.065 1.00 25.13 ? 374  GLN B CB    1 
ATOM   7259  C  CG    . GLN B  1  347 ? 20.662  22.457 44.009 1.00 26.10 ? 374  GLN B CG    1 
ATOM   7260  C  CD    . GLN B  1  347 ? 21.677  21.821 44.950 1.00 27.95 ? 374  GLN B CD    1 
ATOM   7261  O  OE1   . GLN B  1  347 ? 22.881  21.876 44.709 1.00 30.06 ? 374  GLN B OE1   1 
ATOM   7262  N  NE2   . GLN B  1  347 ? 21.193  21.210 46.020 1.00 28.44 ? 374  GLN B NE2   1 
ATOM   7263  N  N     . ASN B  1  348 ? 21.167  25.236 41.214 1.00 24.47 ? 375  ASN B N     1 
ATOM   7264  C  CA    . ASN B  1  348 ? 21.666  25.079 39.852 1.00 24.05 ? 375  ASN B CA    1 
ATOM   7265  C  C     . ASN B  1  348 ? 23.146  25.423 39.789 1.00 23.23 ? 375  ASN B C     1 
ATOM   7266  O  O     . ASN B  1  348 ? 23.627  26.230 40.573 1.00 22.56 ? 375  ASN B O     1 
ATOM   7267  C  CB    . ASN B  1  348 ? 20.868  25.971 38.895 1.00 23.82 ? 375  ASN B CB    1 
ATOM   7268  C  CG    . ASN B  1  348 ? 21.191  25.705 37.425 1.00 24.07 ? 375  ASN B CG    1 
ATOM   7269  O  OD1   . ASN B  1  348 ? 21.120  24.573 36.958 1.00 25.43 ? 375  ASN B OD1   1 
ATOM   7270  N  ND2   . ASN B  1  348 ? 21.533  26.761 36.692 1.00 24.60 ? 375  ASN B ND2   1 
ATOM   7271  N  N     . ARG B  1  349 ? 23.868  24.762 38.883 1.00 23.01 ? 376  ARG B N     1 
ATOM   7272  C  CA    . ARG B  1  349 ? 25.232  25.153 38.529 1.00 21.40 ? 376  ARG B CA    1 
ATOM   7273  C  C     . ARG B  1  349 ? 25.308  25.186 37.004 1.00 21.02 ? 376  ARG B C     1 
ATOM   7274  O  O     . ARG B  1  349 ? 24.944  24.216 36.348 1.00 21.70 ? 376  ARG B O     1 
ATOM   7275  C  CB    . ARG B  1  349 ? 26.246  24.158 39.103 1.00 21.54 ? 376  ARG B CB    1 
ATOM   7276  C  CG    . ARG B  1  349 ? 27.700  24.643 39.131 1.00 19.83 ? 376  ARG B CG    1 
ATOM   7277  C  CD    . ARG B  1  349 ? 28.017  25.580 40.316 1.00 18.26 ? 376  ARG B CD    1 
ATOM   7278  N  NE    . ARG B  1  349 ? 27.766  24.965 41.625 1.00 18.57 ? 376  ARG B NE    1 
ATOM   7279  C  CZ    . ARG B  1  349 ? 28.616  24.185 42.290 1.00 19.14 ? 376  ARG B CZ    1 
ATOM   7280  N  NH1   . ARG B  1  349 ? 29.828  23.906 41.801 1.00 19.79 ? 376  ARG B NH1   1 
ATOM   7281  N  NH2   . ARG B  1  349 ? 28.254  23.684 43.468 1.00 19.42 ? 376  ARG B NH2   1 
ATOM   7282  N  N     . ILE B  1  350 ? 25.770  26.298 36.443 1.00 19.97 ? 377  ILE B N     1 
ATOM   7283  C  CA    . ILE B  1  350 ? 25.804  26.470 34.986 1.00 19.42 ? 377  ILE B CA    1 
ATOM   7284  C  C     . ILE B  1  350 ? 26.807  25.509 34.335 1.00 20.14 ? 377  ILE B C     1 
ATOM   7285  O  O     . ILE B  1  350 ? 27.981  25.501 34.692 1.00 19.91 ? 377  ILE B O     1 
ATOM   7286  C  CB    . ILE B  1  350 ? 26.159  27.932 34.593 1.00 18.56 ? 377  ILE B CB    1 
ATOM   7287  C  CG1   . ILE B  1  350 ? 25.136  28.920 35.159 1.00 17.72 ? 377  ILE B CG1   1 
ATOM   7288  C  CG2   . ILE B  1  350 ? 26.281  28.079 33.075 1.00 18.70 ? 377  ILE B CG2   1 
ATOM   7289  C  CD1   . ILE B  1  350 ? 23.717  28.742 34.623 1.00 17.11 ? 377  ILE B CD1   1 
ATOM   7290  N  N     . ALA B  1  351 ? 26.335  24.702 33.389 1.00 20.73 ? 378  ALA B N     1 
ATOM   7291  C  CA    . ALA B  1  351 ? 27.202  23.768 32.667 1.00 21.36 ? 378  ALA B CA    1 
ATOM   7292  C  C     . ALA B  1  351 ? 27.922  24.439 31.506 1.00 21.58 ? 378  ALA B C     1 
ATOM   7293  O  O     . ALA B  1  351 ? 27.343  25.253 30.789 1.00 21.80 ? 378  ALA B O     1 
ATOM   7294  C  CB    . ALA B  1  351 ? 26.403  22.576 32.166 1.00 21.79 ? 378  ALA B CB    1 
ATOM   7295  N  N     . SER B  1  352 ? 29.188  24.084 31.334 1.00 22.20 ? 379  SER B N     1 
ATOM   7296  C  CA    . SER B  1  352 ? 29.999  24.576 30.237 1.00 23.05 ? 379  SER B CA    1 
ATOM   7297  C  C     . SER B  1  352 ? 29.354  24.239 28.887 1.00 23.62 ? 379  SER B C     1 
ATOM   7298  O  O     . SER B  1  352 ? 29.397  25.051 27.947 1.00 23.72 ? 379  SER B O     1 
ATOM   7299  C  CB    . SER B  1  352 ? 31.414  23.985 30.331 1.00 23.79 ? 379  SER B CB    1 
ATOM   7300  O  OG    . SER B  1  352 ? 32.174  24.275 29.173 1.00 24.88 ? 379  SER B OG    1 
ATOM   7301  N  N     . GLU B  1  353 ? 28.743  23.057 28.798 1.00 23.54 ? 380  GLU B N     1 
ATOM   7302  C  CA    . GLU B  1  353 ? 28.115  22.626 27.553 1.00 24.16 ? 380  GLU B CA    1 
ATOM   7303  C  C     . GLU B  1  353 ? 26.865  23.436 27.220 1.00 24.07 ? 380  GLU B C     1 
ATOM   7304  O  O     . GLU B  1  353 ? 26.570  23.663 26.035 1.00 24.29 ? 380  GLU B O     1 
ATOM   7305  C  CB    . GLU B  1  353 ? 27.810  21.125 27.563 1.00 24.72 ? 380  GLU B CB    1 
ATOM   7306  C  CG    . GLU B  1  353 ? 29.048  20.247 27.710 1.00 24.94 ? 380  GLU B CG    1 
ATOM   7307  C  CD    . GLU B  1  353 ? 29.308  19.793 29.146 1.00 24.78 ? 380  GLU B CD    1 
ATOM   7308  O  OE1   . GLU B  1  353 ? 28.881  20.491 30.099 1.00 23.07 ? 380  GLU B OE1   1 
ATOM   7309  O  OE2   . GLU B  1  353 ? 29.958  18.735 29.322 1.00 25.28 ? 380  GLU B OE2   1 
ATOM   7310  N  N     . PHE B  1  354 ? 26.142  23.862 28.259 1.00 23.42 ? 381  PHE B N     1 
ATOM   7311  C  CA    . PHE B  1  354 ? 25.015  24.799 28.108 1.00 23.26 ? 381  PHE B CA    1 
ATOM   7312  C  C     . PHE B  1  354 ? 25.478  26.120 27.484 1.00 23.09 ? 381  PHE B C     1 
ATOM   7313  O  O     . PHE B  1  354 ? 24.860  26.615 26.541 1.00 22.98 ? 381  PHE B O     1 
ATOM   7314  C  CB    . PHE B  1  354 ? 24.345  25.063 29.458 1.00 22.67 ? 381  PHE B CB    1 
ATOM   7315  C  CG    . PHE B  1  354 ? 23.004  25.771 29.363 1.00 22.69 ? 381  PHE B CG    1 
ATOM   7316  C  CD1   . PHE B  1  354 ? 22.146  25.554 28.286 1.00 23.76 ? 381  PHE B CD1   1 
ATOM   7317  C  CD2   . PHE B  1  354 ? 22.577  26.604 30.393 1.00 22.84 ? 381  PHE B CD2   1 
ATOM   7318  C  CE1   . PHE B  1  354 ? 20.898  26.180 28.224 1.00 24.37 ? 381  PHE B CE1   1 
ATOM   7319  C  CE2   . PHE B  1  354 ? 21.331  27.237 30.339 1.00 22.53 ? 381  PHE B CE2   1 
ATOM   7320  C  CZ    . PHE B  1  354 ? 20.498  27.032 29.249 1.00 23.02 ? 381  PHE B CZ    1 
ATOM   7321  N  N     . ASN B  1  355 ? 26.568  26.678 28.013 1.00 23.34 ? 382  ASN B N     1 
ATOM   7322  C  CA    . ASN B  1  355 ? 27.243  27.829 27.390 1.00 23.69 ? 382  ASN B CA    1 
ATOM   7323  C  C     . ASN B  1  355 ? 27.564  27.554 25.919 1.00 24.47 ? 382  ASN B C     1 
ATOM   7324  O  O     . ASN B  1  355 ? 27.177  28.324 25.042 1.00 24.87 ? 382  ASN B O     1 
ATOM   7325  C  CB    . ASN B  1  355 ? 28.511  28.203 28.173 1.00 23.75 ? 382  ASN B CB    1 
ATOM   7326  C  CG    . ASN B  1  355 ? 29.146  29.505 27.700 1.00 25.63 ? 382  ASN B CG    1 
ATOM   7327  O  OD1   . ASN B  1  355 ? 28.693  30.136 26.745 1.00 29.04 ? 382  ASN B OD1   1 
ATOM   7328  N  ND2   . ASN B  1  355 ? 30.205  29.913 28.378 1.00 29.00 ? 382  ASN B ND2   1 
ATOM   7329  N  N     . THR B  1  356 ? 28.229  26.433 25.649 1.00 25.07 ? 383  THR B N     1 
ATOM   7330  C  CA    . THR B  1  356 ? 28.651  26.089 24.289 1.00 26.03 ? 383  THR B CA    1 
ATOM   7331  C  C     . THR B  1  356 ? 27.492  25.991 23.291 1.00 26.37 ? 383  THR B C     1 
ATOM   7332  O  O     . THR B  1  356 ? 27.555  26.564 22.201 1.00 26.37 ? 383  THR B O     1 
ATOM   7333  C  CB    . THR B  1  356 ? 29.506  24.811 24.284 1.00 26.72 ? 383  THR B CB    1 
ATOM   7334  O  OG1   . THR B  1  356 ? 30.733  25.081 24.974 1.00 27.10 ? 383  THR B OG1   1 
ATOM   7335  C  CG2   . THR B  1  356 ? 29.818  24.356 22.858 1.00 27.87 ? 383  THR B CG2   1 
ATOM   7336  N  N     . LEU B  1  357 ? 26.433  25.281 23.672 1.00 26.20 ? 384  LEU B N     1 
ATOM   7337  C  CA    . LEU B  1  357 ? 25.290  25.093 22.781 1.00 26.73 ? 384  LEU B CA    1 
ATOM   7338  C  C     . LEU B  1  357 ? 24.512  26.395 22.534 1.00 26.58 ? 384  LEU B C     1 
ATOM   7339  O  O     . LEU B  1  357 ? 23.751  26.489 21.567 1.00 27.12 ? 384  LEU B O     1 
ATOM   7340  C  CB    . LEU B  1  357 ? 24.357  23.985 23.297 1.00 26.33 ? 384  LEU B CB    1 
ATOM   7341  C  CG    . LEU B  1  357 ? 23.485  24.185 24.539 1.00 25.48 ? 384  LEU B CG    1 
ATOM   7342  C  CD1   . LEU B  1  357 ? 22.154  24.876 24.216 1.00 23.76 ? 384  LEU B CD1   1 
ATOM   7343  C  CD2   . LEU B  1  357 ? 23.226  22.824 25.192 1.00 23.85 ? 384  LEU B CD2   1 
ATOM   7344  N  N     . TYR B  1  358 ? 24.710  27.381 23.407 1.00 25.99 ? 385  TYR B N     1 
ATOM   7345  C  CA    . TYR B  1  358 ? 24.010  28.663 23.315 1.00 26.12 ? 385  TYR B CA    1 
ATOM   7346  C  C     . TYR B  1  358 ? 24.732  29.686 22.440 1.00 26.38 ? 385  TYR B C     1 
ATOM   7347  O  O     . TYR B  1  358 ? 24.371  30.865 22.414 1.00 25.62 ? 385  TYR B O     1 
ATOM   7348  C  CB    . TYR B  1  358 ? 23.793  29.253 24.704 1.00 25.32 ? 385  TYR B CB    1 
ATOM   7349  C  CG    . TYR B  1  358 ? 22.350  29.598 24.965 1.00 25.82 ? 385  TYR B CG    1 
ATOM   7350  C  CD1   . TYR B  1  358 ? 21.625  28.925 25.942 1.00 26.01 ? 385  TYR B CD1   1 
ATOM   7351  C  CD2   . TYR B  1  358 ? 21.700  30.577 24.213 1.00 26.98 ? 385  TYR B CD2   1 
ATOM   7352  C  CE1   . TYR B  1  358 ? 20.290  29.236 26.185 1.00 26.92 ? 385  TYR B CE1   1 
ATOM   7353  C  CE2   . TYR B  1  358 ? 20.363  30.890 24.438 1.00 26.37 ? 385  TYR B CE2   1 
ATOM   7354  C  CZ    . TYR B  1  358 ? 19.666  30.217 25.423 1.00 27.83 ? 385  TYR B CZ    1 
ATOM   7355  O  OH    . TYR B  1  358 ? 18.343  30.533 25.643 1.00 28.76 ? 385  TYR B OH    1 
ATOM   7356  N  N     . HIS B  1  359 ? 25.764  29.240 21.737 1.00 27.31 ? 386  HIS B N     1 
ATOM   7357  C  CA    . HIS B  1  359 ? 26.480  30.123 20.829 1.00 28.50 ? 386  HIS B CA    1 
ATOM   7358  C  C     . HIS B  1  359 ? 25.716  30.229 19.508 1.00 28.87 ? 386  HIS B C     1 
ATOM   7359  O  O     . HIS B  1  359 ? 26.161  29.728 18.475 1.00 29.98 ? 386  HIS B O     1 
ATOM   7360  C  CB    . HIS B  1  359 ? 27.931  29.658 20.650 1.00 29.05 ? 386  HIS B CB    1 
ATOM   7361  C  CG    . HIS B  1  359 ? 28.785  29.893 21.859 1.00 31.11 ? 386  HIS B CG    1 
ATOM   7362  N  ND1   . HIS B  1  359 ? 30.071  30.382 21.784 1.00 34.59 ? 386  HIS B ND1   1 
ATOM   7363  C  CD2   . HIS B  1  359 ? 28.520  29.742 23.176 1.00 32.01 ? 386  HIS B CD2   1 
ATOM   7364  C  CE1   . HIS B  1  359 ? 30.568  30.498 23.002 1.00 34.07 ? 386  HIS B CE1   1 
ATOM   7365  N  NE2   . HIS B  1  359 ? 29.644  30.121 23.865 1.00 32.38 ? 386  HIS B NE2   1 
ATOM   7366  N  N     . TRP B  1  360 ? 24.555  30.890 19.562 1.00 28.42 ? 387  TRP B N     1 
ATOM   7367  C  CA    . TRP B  1  360 ? 23.639  30.987 18.420 1.00 28.74 ? 387  TRP B CA    1 
ATOM   7368  C  C     . TRP B  1  360 ? 23.976  32.144 17.479 1.00 29.27 ? 387  TRP B C     1 
ATOM   7369  O  O     . TRP B  1  360 ? 23.099  32.936 17.122 1.00 29.43 ? 387  TRP B O     1 
ATOM   7370  C  CB    . TRP B  1  360 ? 22.179  31.134 18.896 1.00 28.37 ? 387  TRP B CB    1 
ATOM   7371  C  CG    . TRP B  1  360 ? 21.651  30.007 19.759 1.00 27.75 ? 387  TRP B CG    1 
ATOM   7372  C  CD1   . TRP B  1  360 ? 22.203  28.760 19.929 1.00 27.59 ? 387  TRP B CD1   1 
ATOM   7373  C  CD2   . TRP B  1  360 ? 20.444  30.016 20.533 1.00 27.36 ? 387  TRP B CD2   1 
ATOM   7374  N  NE1   . TRP B  1  360 ? 21.425  28.009 20.773 1.00 26.86 ? 387  TRP B NE1   1 
ATOM   7375  C  CE2   . TRP B  1  360 ? 20.339  28.751 21.158 1.00 27.27 ? 387  TRP B CE2   1 
ATOM   7376  C  CE3   . TRP B  1  360 ? 19.444  30.972 20.765 1.00 27.12 ? 387  TRP B CE3   1 
ATOM   7377  C  CZ2   . TRP B  1  360 ? 19.276  28.420 22.009 1.00 27.22 ? 387  TRP B CZ2   1 
ATOM   7378  C  CZ3   . TRP B  1  360 ? 18.386  30.641 21.602 1.00 27.17 ? 387  TRP B CZ3   1 
ATOM   7379  C  CH2   . TRP B  1  360 ? 18.312  29.373 22.217 1.00 27.19 ? 387  TRP B CH2   1 
ATOM   7380  N  N     A HIS B  1  361 ? 25.220  32.247 17.041 0.50 29.59 ? 388  HIS B N     1 
ATOM   7381  N  N     B HIS B  1  361 ? 25.257  32.219 17.104 0.50 29.40 ? 388  HIS B N     1 
ATOM   7382  C  CA    A HIS B  1  361 ? 25.575  33.368 16.178 0.50 30.25 ? 388  HIS B CA    1 
ATOM   7383  C  CA    B HIS B  1  361 ? 25.775  33.183 16.129 0.50 30.08 ? 388  HIS B CA    1 
ATOM   7384  C  C     A HIS B  1  361 ? 25.003  33.353 14.743 0.50 31.04 ? 388  HIS B C     1 
ATOM   7385  C  C     B HIS B  1  361 ? 24.880  33.330 14.893 0.50 30.73 ? 388  HIS B C     1 
ATOM   7386  O  O     A HIS B  1  361 ? 25.014  34.389 14.084 0.50 31.66 ? 388  HIS B O     1 
ATOM   7387  O  O     B HIS B  1  361 ? 24.544  34.454 14.517 0.50 30.90 ? 388  HIS B O     1 
ATOM   7388  C  CB    A HIS B  1  361 ? 27.076  33.633 16.222 0.50 30.58 ? 388  HIS B CB    1 
ATOM   7389  C  CB    B HIS B  1  361 ? 27.195  32.803 15.670 0.50 30.60 ? 388  HIS B CB    1 
ATOM   7390  C  CG    A HIS B  1  361 ? 27.568  33.955 17.596 0.50 30.38 ? 388  HIS B CG    1 
ATOM   7391  C  CG    B HIS B  1  361 ? 28.165  32.579 16.786 0.50 30.19 ? 388  HIS B CG    1 
ATOM   7392  N  ND1   A HIS B  1  361 ? 28.133  33.010 18.423 0.50 29.99 ? 388  HIS B ND1   1 
ATOM   7393  N  ND1   B HIS B  1  361 ? 28.898  31.418 16.912 0.50 30.48 ? 388  HIS B ND1   1 
ATOM   7394  C  CD2   A HIS B  1  361 ? 27.531  35.107 18.308 0.50 30.66 ? 388  HIS B CD2   1 
ATOM   7395  C  CD2   B HIS B  1  361 ? 28.534  33.370 17.821 0.50 29.40 ? 388  HIS B CD2   1 
ATOM   7396  C  CE1   A HIS B  1  361 ? 28.451  33.572 19.576 0.50 29.81 ? 388  HIS B CE1   1 
ATOM   7397  C  CE1   B HIS B  1  361 ? 29.673  31.502 17.978 0.50 29.96 ? 388  HIS B CE1   1 
ATOM   7398  N  NE2   A HIS B  1  361 ? 28.094  34.843 19.532 0.50 30.43 ? 388  HIS B NE2   1 
ATOM   7399  N  NE2   B HIS B  1  361 ? 29.470  32.677 18.548 0.50 29.94 ? 388  HIS B NE2   1 
ATOM   7400  N  N     . PRO B  1  362 ? 24.481  32.198 14.265 1.00 27.12 ? 389  PRO B N     1 
ATOM   7401  C  CA    . PRO B  1  362 ? 23.691  32.253 13.021 1.00 26.98 ? 389  PRO B CA    1 
ATOM   7402  C  C     . PRO B  1  362 ? 22.411  33.087 13.125 1.00 25.73 ? 389  PRO B C     1 
ATOM   7403  O  O     . PRO B  1  362 ? 21.885  33.526 12.116 1.00 26.05 ? 389  PRO B O     1 
ATOM   7404  C  CB    . PRO B  1  362 ? 23.340  30.787 12.762 1.00 27.43 ? 389  PRO B CB    1 
ATOM   7405  C  CG    . PRO B  1  362 ? 24.423  30.031 13.407 1.00 28.29 ? 389  PRO B CG    1 
ATOM   7406  C  CD    . PRO B  1  362 ? 24.716  30.791 14.662 1.00 27.57 ? 389  PRO B CD    1 
ATOM   7407  N  N     . LEU B  1  363 ? 21.932  33.303 14.345 1.00 24.90 ? 390  LEU B N     1 
ATOM   7408  C  CA    . LEU B  1  363 ? 20.789  34.178 14.613 1.00 24.30 ? 390  LEU B CA    1 
ATOM   7409  C  C     . LEU B  1  363 ? 21.008  35.598 14.070 1.00 24.12 ? 390  LEU B C     1 
ATOM   7410  O  O     . LEU B  1  363 ? 20.062  36.258 13.644 1.00 23.89 ? 390  LEU B O     1 
ATOM   7411  C  CB    . LEU B  1  363 ? 20.565  34.231 16.124 1.00 23.47 ? 390  LEU B CB    1 
ATOM   7412  C  CG    . LEU B  1  363 ? 19.197  34.225 16.793 1.00 23.65 ? 390  LEU B CG    1 
ATOM   7413  C  CD1   . LEU B  1  363 ? 18.223  33.204 16.197 1.00 23.19 ? 390  LEU B CD1   1 
ATOM   7414  C  CD2   . LEU B  1  363 ? 19.409  33.978 18.282 1.00 22.81 ? 390  LEU B CD2   1 
ATOM   7415  N  N     . LEU B  1  364 ? 22.261  36.052 14.079 1.00 24.52 ? 391  LEU B N     1 
ATOM   7416  C  CA    . LEU B  1  364 ? 22.599  37.430 13.718 1.00 25.05 ? 391  LEU B CA    1 
ATOM   7417  C  C     . LEU B  1  364 ? 22.398  37.716 12.219 1.00 25.81 ? 391  LEU B C     1 
ATOM   7418  O  O     . LEU B  1  364 ? 22.806  36.913 11.372 1.00 26.19 ? 391  LEU B O     1 
ATOM   7419  C  CB    . LEU B  1  364 ? 24.039  37.770 14.151 1.00 25.87 ? 391  LEU B CB    1 
ATOM   7420  C  CG    . LEU B  1  364 ? 24.375  37.710 15.651 1.00 26.41 ? 391  LEU B CG    1 
ATOM   7421  C  CD1   . LEU B  1  364 ? 25.888  37.730 15.891 1.00 28.43 ? 391  LEU B CD1   1 
ATOM   7422  C  CD2   . LEU B  1  364 ? 23.674  38.823 16.428 1.00 26.36 ? 391  LEU B CD2   1 
ATOM   7423  N  N     . PRO B  1  365 ? 21.754  38.855 11.895 1.00 25.80 ? 392  PRO B N     1 
ATOM   7424  C  CA    . PRO B  1  365 ? 21.519  39.277 10.510 1.00 27.02 ? 392  PRO B CA    1 
ATOM   7425  C  C     . PRO B  1  365 ? 22.786  39.827 9.855  1.00 28.36 ? 392  PRO B C     1 
ATOM   7426  O  O     . PRO B  1  365 ? 23.813  39.982 10.524 1.00 28.49 ? 392  PRO B O     1 
ATOM   7427  C  CB    . PRO B  1  365 ? 20.493  40.393 10.665 1.00 26.75 ? 392  PRO B CB    1 
ATOM   7428  C  CG    . PRO B  1  365 ? 20.823  40.996 11.995 1.00 25.93 ? 392  PRO B CG    1 
ATOM   7429  C  CD    . PRO B  1  365 ? 21.237  39.842 12.861 1.00 25.04 ? 392  PRO B CD    1 
ATOM   7430  N  N     . ASP B  1  366 ? 22.713  40.112 8.560  1.00 29.71 ? 393  ASP B N     1 
ATOM   7431  C  CA    . ASP B  1  366 ? 23.839  40.705 7.842  1.00 31.38 ? 393  ASP B CA    1 
ATOM   7432  C  C     . ASP B  1  366 ? 23.985  42.180 8.180  1.00 31.40 ? 393  ASP B C     1 
ATOM   7433  O  O     . ASP B  1  366 ? 25.096  42.700 8.244  1.00 32.05 ? 393  ASP B O     1 
ATOM   7434  C  CB    . ASP B  1  366 ? 23.675  40.521 6.331  1.00 32.92 ? 393  ASP B CB    1 
ATOM   7435  C  CG    . ASP B  1  366 ? 23.767  39.064 5.909  1.00 34.39 ? 393  ASP B CG    1 
ATOM   7436  O  OD1   . ASP B  1  366 ? 24.496  38.289 6.567  1.00 34.09 ? 393  ASP B OD1   1 
ATOM   7437  O  OD2   . ASP B  1  366 ? 23.109  38.695 4.917  1.00 37.04 ? 393  ASP B OD2   1 
ATOM   7438  N  N     . THR B  1  367 ? 22.848  42.842 8.380  1.00 30.96 ? 394  THR B N     1 
ATOM   7439  C  CA    . THR B  1  367 ? 22.805  44.235 8.804  1.00 31.09 ? 394  THR B CA    1 
ATOM   7440  C  C     . THR B  1  367 ? 21.705  44.408 9.844  1.00 30.24 ? 394  THR B C     1 
ATOM   7441  O  O     . THR B  1  367 ? 20.786  43.585 9.934  1.00 29.65 ? 394  THR B O     1 
ATOM   7442  C  CB    . THR B  1  367 ? 22.505  45.190 7.631  1.00 32.69 ? 394  THR B CB    1 
ATOM   7443  O  OG1   . THR B  1  367 ? 21.242  44.851 7.050  1.00 32.68 ? 394  THR B OG1   1 
ATOM   7444  C  CG2   . THR B  1  367 ? 23.600  45.130 6.556  1.00 33.84 ? 394  THR B CG2   1 
ATOM   7445  N  N     . PHE B  1  368 ? 21.793  45.485 10.620 1.00 30.07 ? 395  PHE B N     1 
ATOM   7446  C  CA    . PHE B  1  368 ? 20.791  45.782 11.631 1.00 29.44 ? 395  PHE B CA    1 
ATOM   7447  C  C     . PHE B  1  368 ? 19.919  46.919 11.132 1.00 30.78 ? 395  PHE B C     1 
ATOM   7448  O  O     . PHE B  1  368 ? 20.387  48.043 10.932 1.00 31.36 ? 395  PHE B O     1 
ATOM   7449  C  CB    . PHE B  1  368 ? 21.455  46.096 12.974 1.00 28.38 ? 395  PHE B CB    1 
ATOM   7450  C  CG    . PHE B  1  368 ? 22.338  44.991 13.473 1.00 27.62 ? 395  PHE B CG    1 
ATOM   7451  C  CD1   . PHE B  1  368 ? 21.819  43.977 14.274 1.00 26.47 ? 395  PHE B CD1   1 
ATOM   7452  C  CD2   . PHE B  1  368 ? 23.689  44.948 13.123 1.00 27.96 ? 395  PHE B CD2   1 
ATOM   7453  C  CE1   . PHE B  1  368 ? 22.629  42.945 14.732 1.00 26.43 ? 395  PHE B CE1   1 
ATOM   7454  C  CE2   . PHE B  1  368 ? 24.513  43.919 13.571 1.00 28.01 ? 395  PHE B CE2   1 
ATOM   7455  C  CZ    . PHE B  1  368 ? 23.982  42.911 14.379 1.00 27.70 ? 395  PHE B CZ    1 
ATOM   7456  N  N     . ASN B  1  369 ? 18.647  46.604 10.906 1.00 31.71 ? 396  ASN B N     1 
ATOM   7457  C  CA    . ASN B  1  369 ? 17.747  47.510 10.211 1.00 33.56 ? 396  ASN B CA    1 
ATOM   7458  C  C     . ASN B  1  369 ? 16.847  48.262 11.181 1.00 33.84 ? 396  ASN B C     1 
ATOM   7459  O  O     . ASN B  1  369 ? 15.880  47.705 11.705 1.00 33.61 ? 396  ASN B O     1 
ATOM   7460  C  CB    . ASN B  1  369 ? 16.907  46.745 9.179  1.00 34.64 ? 396  ASN B CB    1 
ATOM   7461  C  CG    . ASN B  1  369 ? 17.747  45.869 8.256  1.00 35.27 ? 396  ASN B CG    1 
ATOM   7462  O  OD1   . ASN B  1  369 ? 18.955  46.056 8.117  1.00 35.71 ? 396  ASN B OD1   1 
ATOM   7463  N  ND2   . ASN B  1  369 ? 17.100  44.903 7.619  1.00 36.28 ? 396  ASN B ND2   1 
ATOM   7464  N  N     . ILE B  1  370 ? 17.179  49.526 11.427 1.00 34.70 ? 397  ILE B N     1 
ATOM   7465  C  CA    . ILE B  1  370 ? 16.359  50.385 12.271 1.00 35.06 ? 397  ILE B CA    1 
ATOM   7466  C  C     . ILE B  1  370 ? 15.829  51.547 11.448 1.00 37.51 ? 397  ILE B C     1 
ATOM   7467  O  O     . ILE B  1  370 ? 16.602  52.287 10.823 1.00 38.21 ? 397  ILE B O     1 
ATOM   7468  C  CB    . ILE B  1  370 ? 17.129  50.904 13.504 1.00 34.18 ? 397  ILE B CB    1 
ATOM   7469  C  CG1   . ILE B  1  370 ? 17.805  49.737 14.231 1.00 33.07 ? 397  ILE B CG1   1 
ATOM   7470  C  CG2   . ILE B  1  370 ? 16.183  51.650 14.450 1.00 33.19 ? 397  ILE B CG2   1 
ATOM   7471  C  CD1   . ILE B  1  370 ? 19.021  50.124 15.009 1.00 33.77 ? 397  ILE B CD1   1 
ATOM   7472  N  N     . GLU B  1  371 ? 14.505  51.686 11.447 1.00 39.00 ? 398  GLU B N     1 
ATOM   7473  C  CA    . GLU B  1  371 ? 13.811  52.725 10.693 1.00 42.05 ? 398  GLU B CA    1 
ATOM   7474  C  C     . GLU B  1  371 ? 14.181  52.641 9.205  1.00 43.73 ? 398  GLU B C     1 
ATOM   7475  O  O     . GLU B  1  371 ? 13.849  51.654 8.546  1.00 44.20 ? 398  GLU B O     1 
ATOM   7476  C  CB    . GLU B  1  371 ? 14.093  54.106 11.300 1.00 42.47 ? 398  GLU B CB    1 
ATOM   7477  C  CG    . GLU B  1  371 ? 12.995  55.130 11.080 1.00 45.99 ? 398  GLU B CG    1 
ATOM   7478  C  CD    . GLU B  1  371 ? 13.002  56.228 12.131 1.00 47.50 ? 398  GLU B CD    1 
ATOM   7479  O  OE1   . GLU B  1  371 ? 12.278  57.228 11.939 1.00 49.62 ? 398  GLU B OE1   1 
ATOM   7480  O  OE2   . GLU B  1  371 ? 13.723  56.089 13.148 1.00 46.68 ? 398  GLU B OE2   1 
ATOM   7481  N  N     . ASP B  1  372 ? 14.878  53.653 8.688  1.00 45.10 ? 399  ASP B N     1 
ATOM   7482  C  CA    . ASP B  1  372 ? 15.329  53.660 7.294  1.00 46.95 ? 399  ASP B CA    1 
ATOM   7483  C  C     . ASP B  1  372 ? 16.788  53.237 7.103  1.00 45.86 ? 399  ASP B C     1 
ATOM   7484  O  O     . ASP B  1  372 ? 17.258  53.114 5.968  1.00 47.33 ? 399  ASP B O     1 
ATOM   7485  C  CB    . ASP B  1  372 ? 15.105  55.040 6.670  1.00 49.64 ? 399  ASP B CB    1 
ATOM   7486  C  CG    . ASP B  1  372 ? 13.661  55.274 6.286  1.00 53.18 ? 399  ASP B CG    1 
ATOM   7487  O  OD1   . ASP B  1  372 ? 12.907  54.281 6.166  1.00 55.24 ? 399  ASP B OD1   1 
ATOM   7488  O  OD2   . ASP B  1  372 ? 13.278  56.450 6.096  1.00 57.08 ? 399  ASP B OD2   1 
ATOM   7489  N  N     . GLN B  1  373 ? 17.497  53.018 8.207  1.00 43.52 ? 400  GLN B N     1 
ATOM   7490  C  CA    . GLN B  1  373 ? 18.921  52.704 8.170  1.00 42.72 ? 400  GLN B CA    1 
ATOM   7491  C  C     . GLN B  1  373 ? 19.212  51.208 8.174  1.00 40.95 ? 400  GLN B C     1 
ATOM   7492  O  O     . GLN B  1  373 ? 18.431  50.414 8.707  1.00 39.56 ? 400  GLN B O     1 
ATOM   7493  C  CB    . GLN B  1  373 ? 19.633  53.366 9.354  1.00 42.16 ? 400  GLN B CB    1 
ATOM   7494  C  CG    . GLN B  1  373 ? 20.338  54.680 9.027  1.00 45.64 ? 400  GLN B CG    1 
ATOM   7495  C  CD    . GLN B  1  373 ? 19.384  55.774 8.601  1.00 49.40 ? 400  GLN B CD    1 
ATOM   7496  O  OE1   . GLN B  1  373 ? 18.275  55.896 9.130  1.00 51.72 ? 400  GLN B OE1   1 
ATOM   7497  N  NE2   . GLN B  1  373 ? 19.812  56.584 7.648  1.00 51.06 ? 400  GLN B NE2   1 
ATOM   7498  N  N     . GLU B  1  374 ? 20.345  50.841 7.578  1.00 40.55 ? 401  GLU B N     1 
ATOM   7499  C  CA    . GLU B  1  374 ? 20.857  49.474 7.619  1.00 38.93 ? 401  GLU B CA    1 
ATOM   7500  C  C     . GLU B  1  374 ? 22.308  49.497 8.067  1.00 37.74 ? 401  GLU B C     1 
ATOM   7501  O  O     . GLU B  1  374 ? 23.209  49.785 7.280  1.00 38.91 ? 401  GLU B O     1 
ATOM   7502  C  CB    . GLU B  1  374 ? 20.735  48.794 6.253  1.00 40.60 ? 401  GLU B CB    1 
ATOM   7503  C  CG    . GLU B  1  374 ? 19.302  48.437 5.880  1.00 42.49 ? 401  GLU B CG    1 
ATOM   7504  C  CD    . GLU B  1  374 ? 19.196  47.724 4.548  1.00 46.22 ? 401  GLU B CD    1 
ATOM   7505  O  OE1   . GLU B  1  374 ? 20.217  47.624 3.830  1.00 48.19 ? 401  GLU B OE1   1 
ATOM   7506  O  OE2   . GLU B  1  374 ? 18.078  47.275 4.214  1.00 48.18 ? 401  GLU B OE2   1 
ATOM   7507  N  N     . TYR B  1  375 ? 22.523  49.194 9.340  1.00 35.04 ? 402  TYR B N     1 
ATOM   7508  C  CA    . TYR B  1  375 ? 23.845  49.304 9.937  1.00 34.13 ? 402  TYR B CA    1 
ATOM   7509  C  C     . TYR B  1  375 ? 24.659  48.023 9.773  1.00 33.30 ? 402  TYR B C     1 
ATOM   7510  O  O     . TYR B  1  375 ? 24.179  46.928 10.058 1.00 31.99 ? 402  TYR B O     1 
ATOM   7511  C  CB    . TYR B  1  375 ? 23.727  49.683 11.418 1.00 32.54 ? 402  TYR B CB    1 
ATOM   7512  C  CG    . TYR B  1  375 ? 23.048  51.013 11.665 1.00 32.49 ? 402  TYR B CG    1 
ATOM   7513  C  CD1   . TYR B  1  375 ? 23.727  52.218 11.460 1.00 33.95 ? 402  TYR B CD1   1 
ATOM   7514  C  CD2   . TYR B  1  375 ? 21.727  51.070 12.109 1.00 31.50 ? 402  TYR B CD2   1 
ATOM   7515  C  CE1   . TYR B  1  375 ? 23.102  53.444 11.689 1.00 33.85 ? 402  TYR B CE1   1 
ATOM   7516  C  CE2   . TYR B  1  375 ? 21.098  52.284 12.350 1.00 31.00 ? 402  TYR B CE2   1 
ATOM   7517  C  CZ    . TYR B  1  375 ? 21.788  53.467 12.138 1.00 33.24 ? 402  TYR B CZ    1 
ATOM   7518  O  OH    . TYR B  1  375 ? 21.161  54.670 12.364 1.00 33.56 ? 402  TYR B OH    1 
ATOM   7519  N  N     . SER B  1  376 ? 25.891  48.171 9.299  1.00 34.09 ? 403  SER B N     1 
ATOM   7520  C  CA    . SER B  1  376 ? 26.831  47.060 9.269  1.00 33.76 ? 403  SER B CA    1 
ATOM   7521  C  C     . SER B  1  376 ? 27.202  46.712 10.708 1.00 32.77 ? 403  SER B C     1 
ATOM   7522  O  O     . SER B  1  376 ? 26.881  47.460 11.631 1.00 31.85 ? 403  SER B O     1 
ATOM   7523  C  CB    . SER B  1  376 ? 28.087  47.453 8.490  1.00 35.95 ? 403  SER B CB    1 
ATOM   7524  O  OG    . SER B  1  376 ? 28.748  48.534 9.122  1.00 35.67 ? 403  SER B OG    1 
ATOM   7525  N  N     . PHE B  1  377 ? 27.875  45.580 10.896 1.00 32.83 ? 404  PHE B N     1 
ATOM   7526  C  CA    . PHE B  1  377 ? 28.445  45.235 12.194 1.00 32.82 ? 404  PHE B CA    1 
ATOM   7527  C  C     . PHE B  1  377 ? 29.387  46.317 12.717 1.00 34.28 ? 404  PHE B C     1 
ATOM   7528  O  O     . PHE B  1  377 ? 29.309  46.681 13.889 1.00 33.73 ? 404  PHE B O     1 
ATOM   7529  C  CB    . PHE B  1  377 ? 29.153  43.877 12.135 1.00 32.98 ? 404  PHE B CB    1 
ATOM   7530  C  CG    . PHE B  1  377 ? 28.217  42.717 12.252 1.00 31.27 ? 404  PHE B CG    1 
ATOM   7531  C  CD1   . PHE B  1  377 ? 27.428  42.332 11.169 1.00 30.25 ? 404  PHE B CD1   1 
ATOM   7532  C  CD2   . PHE B  1  377 ? 28.107  42.017 13.452 1.00 29.55 ? 404  PHE B CD2   1 
ATOM   7533  C  CE1   . PHE B  1  377 ? 26.546  41.264 11.283 1.00 30.07 ? 404  PHE B CE1   1 
ATOM   7534  C  CE2   . PHE B  1  377 ? 27.230  40.946 13.575 1.00 28.32 ? 404  PHE B CE2   1 
ATOM   7535  C  CZ    . PHE B  1  377 ? 26.444  40.570 12.495 1.00 28.18 ? 404  PHE B CZ    1 
ATOM   7536  N  N     . LYS B  1  378 ? 30.246  46.841 11.836 1.00 36.33 ? 405  LYS B N     1 
ATOM   7537  C  CA    . LYS B  1  378 ? 31.208  47.887 12.198 1.00 38.31 ? 405  LYS B CA    1 
ATOM   7538  C  C     . LYS B  1  378 ? 30.512  49.147 12.720 1.00 37.92 ? 405  LYS B C     1 
ATOM   7539  O  O     . LYS B  1  378 ? 30.956  49.745 13.700 1.00 38.37 ? 405  LYS B O     1 
ATOM   7540  C  CB    . LYS B  1  378 ? 32.127  48.222 11.013 1.00 40.52 ? 405  LYS B CB    1 
ATOM   7541  C  CG    . LYS B  1  378 ? 33.300  49.145 11.361 1.00 42.82 ? 405  LYS B CG    1 
ATOM   7542  C  CD    . LYS B  1  378 ? 34.281  49.292 10.200 1.00 45.37 ? 405  LYS B CD    1 
ATOM   7543  N  N     . GLN B  1  379 ? 29.416  49.532 12.072 1.00 37.44 ? 406  GLN B N     1 
ATOM   7544  C  CA    . GLN B  1  379 ? 28.652  50.708 12.473 1.00 37.30 ? 406  GLN B CA    1 
ATOM   7545  C  C     . GLN B  1  379 ? 27.844  50.463 13.741 1.00 35.84 ? 406  GLN B C     1 
ATOM   7546  O  O     . GLN B  1  379 ? 27.664  51.373 14.547 1.00 35.78 ? 406  GLN B O     1 
ATOM   7547  C  CB    . GLN B  1  379 ? 27.721  51.160 11.350 1.00 37.40 ? 406  GLN B CB    1 
ATOM   7548  C  CG    . GLN B  1  379 ? 28.437  51.648 10.105 1.00 39.71 ? 406  GLN B CG    1 
ATOM   7549  C  CD    . GLN B  1  379 ? 27.502  51.812 8.919  1.00 40.67 ? 406  GLN B CD    1 
ATOM   7550  O  OE1   . GLN B  1  379 ? 26.573  51.029 8.722  1.00 39.36 ? 406  GLN B OE1   1 
ATOM   7551  N  NE2   . GLN B  1  379 ? 27.755  52.832 8.115  1.00 44.21 ? 406  GLN B NE2   1 
ATOM   7552  N  N     . PHE B  1  380 ? 27.364  49.236 13.912 1.00 34.96 ? 407  PHE B N     1 
ATOM   7553  C  CA    . PHE B  1  380 ? 26.487  48.907 15.032 1.00 34.19 ? 407  PHE B CA    1 
ATOM   7554  C  C     . PHE B  1  380 ? 27.226  48.791 16.363 1.00 34.66 ? 407  PHE B C     1 
ATOM   7555  O  O     . PHE B  1  380 ? 26.769  49.335 17.363 1.00 33.72 ? 407  PHE B O     1 
ATOM   7556  C  CB    . PHE B  1  380 ? 25.696  47.633 14.734 1.00 32.92 ? 407  PHE B CB    1 
ATOM   7557  C  CG    . PHE B  1  380 ? 24.428  47.508 15.515 1.00 31.65 ? 407  PHE B CG    1 
ATOM   7558  C  CD1   . PHE B  1  380 ? 23.393  48.420 15.340 1.00 31.26 ? 407  PHE B CD1   1 
ATOM   7559  C  CD2   . PHE B  1  380 ? 24.253  46.459 16.413 1.00 31.35 ? 407  PHE B CD2   1 
ATOM   7560  C  CE1   . PHE B  1  380 ? 22.217  48.302 16.051 1.00 29.88 ? 407  PHE B CE1   1 
ATOM   7561  C  CE2   . PHE B  1  380 ? 23.075  46.331 17.132 1.00 29.88 ? 407  PHE B CE2   1 
ATOM   7562  C  CZ    . PHE B  1  380 ? 22.051  47.255 16.948 1.00 29.79 ? 407  PHE B CZ    1 
ATOM   7563  N  N     . LEU B  1  381 ? 28.370  48.105 16.355 1.00 36.47 ? 408  LEU B N     1 
ATOM   7564  C  CA    . LEU B  1  381 ? 29.146  47.821 17.569 1.00 38.23 ? 408  LEU B CA    1 
ATOM   7565  C  C     . LEU B  1  381 ? 29.596  49.053 18.345 1.00 39.86 ? 408  LEU B C     1 
ATOM   7566  O  O     . LEU B  1  381 ? 30.105  50.018 17.762 1.00 41.11 ? 408  LEU B O     1 
ATOM   7567  C  CB    . LEU B  1  381 ? 30.389  46.990 17.237 1.00 39.89 ? 408  LEU B CB    1 
ATOM   7568  C  CG    . LEU B  1  381 ? 30.286  45.489 16.973 1.00 40.34 ? 408  LEU B CG    1 
ATOM   7569  C  CD1   . LEU B  1  381 ? 31.636  44.986 16.462 1.00 43.23 ? 408  LEU B CD1   1 
ATOM   7570  C  CD2   . LEU B  1  381 ? 29.871  44.736 18.227 1.00 40.12 ? 408  LEU B CD2   1 
ATOM   7571  N  N     . TYR B  1  382 ? 29.436  48.980 19.668 1.00 40.25 ? 409  TYR B N     1 
ATOM   7572  C  CA    . TYR B  1  382 ? 29.830  50.034 20.618 1.00 42.23 ? 409  TYR B CA    1 
ATOM   7573  C  C     . TYR B  1  382 ? 29.175  51.389 20.338 1.00 42.15 ? 409  TYR B C     1 
ATOM   7574  O  O     . TYR B  1  382 ? 29.607  52.412 20.873 1.00 43.35 ? 409  TYR B O     1 
ATOM   7575  C  CB    . TYR B  1  382 ? 31.359  50.229 20.681 1.00 44.79 ? 409  TYR B CB    1 
ATOM   7576  C  CG    . TYR B  1  382 ? 32.213  49.073 20.216 1.00 47.48 ? 409  TYR B CG    1 
ATOM   7577  C  CD1   . TYR B  1  382 ? 32.278  47.887 20.943 1.00 48.92 ? 409  TYR B CD1   1 
ATOM   7578  C  CD2   . TYR B  1  382 ? 32.994  49.186 19.061 1.00 50.98 ? 409  TYR B CD2   1 
ATOM   7579  C  CE1   . TYR B  1  382 ? 33.078  46.829 20.523 1.00 51.16 ? 409  TYR B CE1   1 
ATOM   7580  C  CE2   . TYR B  1  382 ? 33.802  48.135 18.631 1.00 53.15 ? 409  TYR B CE2   1 
ATOM   7581  C  CZ    . TYR B  1  382 ? 33.838  46.959 19.366 1.00 53.32 ? 409  TYR B CZ    1 
ATOM   7582  O  OH    . TYR B  1  382 ? 34.632  45.917 18.946 1.00 55.17 ? 409  TYR B OH    1 
ATOM   7583  N  N     . ASN B  1  383 ? 28.147  51.396 19.500 1.00 41.09 ? 410  ASN B N     1 
ATOM   7584  C  CA    . ASN B  1  383 ? 27.584  52.639 19.017 1.00 41.93 ? 410  ASN B CA    1 
ATOM   7585  C  C     . ASN B  1  383 ? 26.217  52.936 19.618 1.00 39.68 ? 410  ASN B C     1 
ATOM   7586  O  O     . ASN B  1  383 ? 25.188  52.750 18.971 1.00 38.94 ? 410  ASN B O     1 
ATOM   7587  C  CB    . ASN B  1  383 ? 27.527  52.617 17.489 1.00 43.18 ? 410  ASN B CB    1 
ATOM   7588  C  CG    . ASN B  1  383 ? 27.415  54.001 16.881 1.00 48.09 ? 410  ASN B CG    1 
ATOM   7589  O  OD1   . ASN B  1  383 ? 27.021  54.968 17.543 1.00 48.45 ? 410  ASN B OD1   1 
ATOM   7590  N  ND2   . ASN B  1  383 ? 27.767  54.100 15.603 1.00 55.83 ? 410  ASN B ND2   1 
ATOM   7591  N  N     . ASN B  1  384 ? 26.216  53.407 20.859 1.00 38.93 ? 411  ASN B N     1 
ATOM   7592  C  CA    . ASN B  1  384 ? 24.972  53.731 21.558 1.00 37.29 ? 411  ASN B CA    1 
ATOM   7593  C  C     . ASN B  1  384 ? 24.295  55.026 21.114 1.00 36.95 ? 411  ASN B C     1 
ATOM   7594  O  O     . ASN B  1  384 ? 23.172  55.308 21.524 1.00 36.10 ? 411  ASN B O     1 
ATOM   7595  C  CB    . ASN B  1  384 ? 25.183  53.730 23.070 1.00 37.55 ? 411  ASN B CB    1 
ATOM   7596  C  CG    . ASN B  1  384 ? 25.319  52.334 23.625 1.00 37.72 ? 411  ASN B CG    1 
ATOM   7597  O  OD1   . ASN B  1  384 ? 24.617  51.415 23.199 1.00 37.72 ? 411  ASN B OD1   1 
ATOM   7598  N  ND2   . ASN B  1  384 ? 26.228  52.161 24.574 1.00 38.63 ? 411  ASN B ND2   1 
ATOM   7599  N  N     . SER B  1  385 ? 24.963  55.806 20.271 1.00 37.30 ? 412  SER B N     1 
ATOM   7600  C  CA    . SER B  1  385 ? 24.328  57.008 19.735 1.00 37.36 ? 412  SER B CA    1 
ATOM   7601  C  C     . SER B  1  385 ? 23.193  56.630 18.776 1.00 36.02 ? 412  SER B C     1 
ATOM   7602  O  O     . SER B  1  385 ? 22.260  57.403 18.582 1.00 36.10 ? 412  SER B O     1 
ATOM   7603  C  CB    . SER B  1  385 ? 25.352  57.955 19.096 1.00 38.77 ? 412  SER B CB    1 
ATOM   7604  O  OG    . SER B  1  385 ? 25.887  57.414 17.910 1.00 40.10 ? 412  SER B OG    1 
ATOM   7605  N  N     . ILE B  1  386 ? 23.266  55.423 18.212 1.00 34.89 ? 413  ILE B N     1 
ATOM   7606  C  CA    . ILE B  1  386 ? 22.178  54.873 17.393 1.00 33.83 ? 413  ILE B CA    1 
ATOM   7607  C  C     . ILE B  1  386 ? 20.918  54.674 18.236 1.00 32.56 ? 413  ILE B C     1 
ATOM   7608  O  O     . ILE B  1  386 ? 19.806  54.947 17.778 1.00 32.76 ? 413  ILE B O     1 
ATOM   7609  C  CB    . ILE B  1  386 ? 22.571  53.537 16.713 1.00 33.42 ? 413  ILE B CB    1 
ATOM   7610  C  CG1   . ILE B  1  386 ? 23.683  53.767 15.683 1.00 34.48 ? 413  ILE B CG1   1 
ATOM   7611  C  CG2   . ILE B  1  386 ? 21.350  52.885 16.047 1.00 32.24 ? 413  ILE B CG2   1 
ATOM   7612  C  CD1   . ILE B  1  386 ? 24.325  52.490 15.167 1.00 34.58 ? 413  ILE B CD1   1 
ATOM   7613  N  N     . LEU B  1  387 ? 21.098  54.195 19.463 1.00 31.37 ? 414  LEU B N     1 
ATOM   7614  C  CA    . LEU B  1  387 ? 19.981  54.048 20.388 1.00 30.46 ? 414  LEU B CA    1 
ATOM   7615  C  C     . LEU B  1  387 ? 19.363  55.409 20.694 1.00 31.15 ? 414  LEU B C     1 
ATOM   7616  O  O     . LEU B  1  387 ? 18.141  55.555 20.692 1.00 30.85 ? 414  LEU B O     1 
ATOM   7617  C  CB    . LEU B  1  387 ? 20.411  53.347 21.683 1.00 29.63 ? 414  LEU B CB    1 
ATOM   7618  C  CG    . LEU B  1  387 ? 19.290  53.058 22.688 1.00 29.09 ? 414  LEU B CG    1 
ATOM   7619  C  CD1   . LEU B  1  387 ? 18.109  52.334 22.026 1.00 28.10 ? 414  LEU B CD1   1 
ATOM   7620  C  CD2   . LEU B  1  387 ? 19.815  52.271 23.881 1.00 28.42 ? 414  LEU B CD2   1 
ATOM   7621  N  N     . LEU B  1  388 ? 20.217  56.402 20.935 1.00 31.85 ? 415  LEU B N     1 
ATOM   7622  C  CA    . LEU B  1  388 ? 19.749  57.739 21.305 1.00 32.95 ? 415  LEU B CA    1 
ATOM   7623  C  C     . LEU B  1  388 ? 19.061  58.435 20.142 1.00 33.60 ? 415  LEU B C     1 
ATOM   7624  O  O     . LEU B  1  388 ? 18.051  59.111 20.329 1.00 34.12 ? 415  LEU B O     1 
ATOM   7625  C  CB    . LEU B  1  388 ? 20.905  58.592 21.849 1.00 33.75 ? 415  LEU B CB    1 
ATOM   7626  C  CG    . LEU B  1  388 ? 21.527  58.124 23.172 1.00 34.29 ? 415  LEU B CG    1 
ATOM   7627  C  CD1   . LEU B  1  388 ? 22.607  59.093 23.618 1.00 37.07 ? 415  LEU B CD1   1 
ATOM   7628  C  CD2   . LEU B  1  388 ? 20.472  57.957 24.277 1.00 34.27 ? 415  LEU B CD2   1 
ATOM   7629  N  N     . GLU B  1  389 ? 19.606  58.244 18.943 1.00 33.68 ? 416  GLU B N     1 
ATOM   7630  C  CA    . GLU B  1  389 ? 19.102  58.899 17.743 1.00 34.84 ? 416  GLU B CA    1 
ATOM   7631  C  C     . GLU B  1  389 ? 17.727  58.375 17.347 1.00 34.08 ? 416  GLU B C     1 
ATOM   7632  O  O     . GLU B  1  389 ? 16.847  59.154 16.990 1.00 35.05 ? 416  GLU B O     1 
ATOM   7633  C  CB    . GLU B  1  389 ? 20.076  58.707 16.576 1.00 35.35 ? 416  GLU B CB    1 
ATOM   7634  C  CG    . GLU B  1  389 ? 19.842  59.666 15.415 1.00 39.58 ? 416  GLU B CG    1 
ATOM   7635  C  CD    . GLU B  1  389 ? 20.558  59.244 14.144 1.00 43.09 ? 416  GLU B CD    1 
ATOM   7636  O  OE1   . GLU B  1  389 ? 21.517  58.437 14.222 1.00 43.74 ? 416  GLU B OE1   1 
ATOM   7637  O  OE2   . GLU B  1  389 ? 20.158  59.721 13.060 1.00 45.82 ? 416  GLU B OE2   1 
ATOM   7638  N  N     . HIS B  1  390 ? 17.558  57.055 17.392 1.00 32.13 ? 417  HIS B N     1 
ATOM   7639  C  CA    . HIS B  1  390 ? 16.311  56.436 16.960 1.00 31.70 ? 417  HIS B CA    1 
ATOM   7640  C  C     . HIS B  1  390 ? 15.284  56.398 18.085 1.00 31.26 ? 417  HIS B C     1 
ATOM   7641  O  O     . HIS B  1  390 ? 14.096  56.608 17.852 1.00 31.78 ? 417  HIS B O     1 
ATOM   7642  C  CB    . HIS B  1  390 ? 16.559  55.034 16.404 1.00 30.47 ? 417  HIS B CB    1 
ATOM   7643  C  CG    . HIS B  1  390 ? 17.278  55.025 15.090 1.00 31.03 ? 417  HIS B CG    1 
ATOM   7644  N  ND1   . HIS B  1  390 ? 16.648  55.310 13.897 1.00 31.80 ? 417  HIS B ND1   1 
ATOM   7645  C  CD2   . HIS B  1  390 ? 18.568  54.760 14.780 1.00 29.95 ? 417  HIS B CD2   1 
ATOM   7646  C  CE1   . HIS B  1  390 ? 17.521  55.228 12.909 1.00 32.47 ? 417  HIS B CE1   1 
ATOM   7647  N  NE2   . HIS B  1  390 ? 18.694  54.896 13.418 1.00 32.19 ? 417  HIS B NE2   1 
ATOM   7648  N  N     . GLY B  1  391 ? 15.756  56.136 19.301 1.00 29.88 ? 418  GLY B N     1 
ATOM   7649  C  CA    . GLY B  1  391 ? 14.876  55.999 20.452 1.00 29.71 ? 418  GLY B CA    1 
ATOM   7650  C  C     . GLY B  1  391 ? 14.430  54.561 20.629 1.00 28.65 ? 418  GLY B C     1 
ATOM   7651  O  O     . GLY B  1  391 ? 14.520  53.750 19.699 1.00 28.46 ? 418  GLY B O     1 
ATOM   7652  N  N     . LEU B  1  392 ? 13.939  54.254 21.825 1.00 27.99 ? 419  LEU B N     1 
ATOM   7653  C  CA    . LEU B  1  392 ? 13.503  52.905 22.192 1.00 27.02 ? 419  LEU B CA    1 
ATOM   7654  C  C     . LEU B  1  392 ? 12.291  52.417 21.392 1.00 26.99 ? 419  LEU B C     1 
ATOM   7655  O  O     . LEU B  1  392 ? 12.253  51.258 20.976 1.00 26.16 ? 419  LEU B O     1 
ATOM   7656  C  CB    . LEU B  1  392 ? 13.188  52.843 23.694 1.00 27.30 ? 419  LEU B CB    1 
ATOM   7657  C  CG    . LEU B  1  392 ? 14.261  52.465 24.726 1.00 27.47 ? 419  LEU B CG    1 
ATOM   7658  C  CD1   . LEU B  1  392 ? 14.323  50.971 24.894 1.00 28.21 ? 419  LEU B CD1   1 
ATOM   7659  C  CD2   . LEU B  1  392 ? 15.633  53.013 24.408 1.00 28.09 ? 419  LEU B CD2   1 
ATOM   7660  N  N     . THR B  1  393 ? 11.315  53.300 21.180 1.00 27.54 ? 420  THR B N     1 
ATOM   7661  C  CA    . THR B  1  393 ? 10.094  52.951 20.448 1.00 28.40 ? 420  THR B CA    1 
ATOM   7662  C  C     . THR B  1  393 ? 10.422  52.446 19.041 1.00 28.37 ? 420  THR B C     1 
ATOM   7663  O  O     . THR B  1  393 ? 9.921   51.399 18.620 1.00 28.17 ? 420  THR B O     1 
ATOM   7664  C  CB    . THR B  1  393 ? 9.117   54.140 20.388 1.00 30.49 ? 420  THR B CB    1 
ATOM   7665  O  OG1   . THR B  1  393 ? 8.934   54.664 21.708 1.00 30.28 ? 420  THR B OG1   1 
ATOM   7666  C  CG2   . THR B  1  393 ? 7.752   53.716 19.812 1.00 31.58 ? 420  THR B CG2   1 
ATOM   7667  N  N     . GLN B  1  394 ? 11.277  53.188 18.336 1.00 28.36 ? 421  GLN B N     1 
ATOM   7668  C  CA    . GLN B  1  394 ? 11.753  52.804 17.008 1.00 28.89 ? 421  GLN B CA    1 
ATOM   7669  C  C     . GLN B  1  394 ? 12.583  51.517 17.010 1.00 26.90 ? 421  GLN B C     1 
ATOM   7670  O  O     . GLN B  1  394 ? 12.439  50.683 16.121 1.00 26.58 ? 421  GLN B O     1 
ATOM   7671  C  CB    . GLN B  1  394 ? 12.559  53.943 16.380 1.00 29.83 ? 421  GLN B CB    1 
ATOM   7672  C  CG    . GLN B  1  394 ? 11.725  54.859 15.519 1.00 34.78 ? 421  GLN B CG    1 
ATOM   7673  C  CD    . GLN B  1  394 ? 11.064  54.116 14.369 1.00 38.60 ? 421  GLN B CD    1 
ATOM   7674  O  OE1   . GLN B  1  394 ? 11.665  53.226 13.752 1.00 39.33 ? 421  GLN B OE1   1 
ATOM   7675  N  NE2   . GLN B  1  394 ? 9.819   54.467 14.084 1.00 41.89 ? 421  GLN B NE2   1 
ATOM   7676  N  N     . PHE B  1  395 ? 13.451  51.370 18.007 1.00 25.41 ? 422  PHE B N     1 
ATOM   7677  C  CA    . PHE B  1  395 ? 14.194  50.130 18.203 1.00 24.41 ? 422  PHE B CA    1 
ATOM   7678  C  C     . PHE B  1  395 ? 13.254  48.927 18.305 1.00 24.04 ? 422  PHE B C     1 
ATOM   7679  O  O     . PHE B  1  395 ? 13.423  47.946 17.587 1.00 23.76 ? 422  PHE B O     1 
ATOM   7680  C  CB    . PHE B  1  395 ? 15.096  50.223 19.442 1.00 23.52 ? 422  PHE B CB    1 
ATOM   7681  C  CG    . PHE B  1  395 ? 16.544  50.466 19.118 1.00 23.59 ? 422  PHE B CG    1 
ATOM   7682  C  CD1   . PHE B  1  395 ? 16.948  51.637 18.474 1.00 25.04 ? 422  PHE B CD1   1 
ATOM   7683  C  CD2   . PHE B  1  395 ? 17.507  49.530 19.467 1.00 22.90 ? 422  PHE B CD2   1 
ATOM   7684  C  CE1   . PHE B  1  395 ? 18.295  51.856 18.175 1.00 25.02 ? 422  PHE B CE1   1 
ATOM   7685  C  CE2   . PHE B  1  395 ? 18.858  49.744 19.174 1.00 24.75 ? 422  PHE B CE2   1 
ATOM   7686  C  CZ    . PHE B  1  395 ? 19.248  50.912 18.525 1.00 23.96 ? 422  PHE B CZ    1 
ATOM   7687  N  N     . VAL B  1  396 ? 12.247  49.028 19.168 1.00 24.37 ? 423  VAL B N     1 
ATOM   7688  C  CA    . VAL B  1  396 ? 11.266  47.955 19.337 1.00 24.21 ? 423  VAL B CA    1 
ATOM   7689  C  C     . VAL B  1  396 ? 10.523  47.663 18.029 1.00 25.54 ? 423  VAL B C     1 
ATOM   7690  O  O     . VAL B  1  396 ? 10.465  46.520 17.585 1.00 24.74 ? 423  VAL B O     1 
ATOM   7691  C  CB    . VAL B  1  396 ? 10.278  48.245 20.498 1.00 24.79 ? 423  VAL B CB    1 
ATOM   7692  C  CG1   . VAL B  1  396 ? 9.152   47.214 20.524 1.00 24.46 ? 423  VAL B CG1   1 
ATOM   7693  C  CG2   . VAL B  1  396 ? 11.023  48.252 21.843 1.00 23.02 ? 423  VAL B CG2   1 
ATOM   7694  N  N     . GLU B  1  397 ? 9.988   48.705 17.401 1.00 28.83 ? 424  GLU B N     1 
ATOM   7695  C  CA    . GLU B  1  397 ? 9.235   48.537 16.158 1.00 30.43 ? 424  GLU B CA    1 
ATOM   7696  C  C     . GLU B  1  397 ? 10.061  47.865 15.059 1.00 30.22 ? 424  GLU B C     1 
ATOM   7697  O  O     . GLU B  1  397 ? 9.567   46.956 14.387 1.00 30.21 ? 424  GLU B O     1 
ATOM   7698  C  CB    . GLU B  1  397 ? 8.667   49.874 15.677 1.00 31.50 ? 424  GLU B CB    1 
ATOM   7699  C  CG    . GLU B  1  397 ? 7.557   50.409 16.582 1.00 34.08 ? 424  GLU B CG    1 
ATOM   7700  C  CD    . GLU B  1  397 ? 7.042   51.772 16.160 1.00 37.52 ? 424  GLU B CD    1 
ATOM   7701  O  OE1   . GLU B  1  397 ? 7.688   52.432 15.314 1.00 40.13 ? 424  GLU B OE1   1 
ATOM   7702  O  OE2   . GLU B  1  397 ? 5.984   52.181 16.677 1.00 39.33 ? 424  GLU B OE2   1 
ATOM   7703  N  N     . SER B  1  398 ? 11.313  48.308 14.905 1.00 30.03 ? 425  SER B N     1 
ATOM   7704  C  CA    . SER B  1  398 ? 12.222  47.793 13.878 1.00 30.47 ? 425  SER B CA    1 
ATOM   7705  C  C     . SER B  1  398 ? 12.671  46.368 14.170 1.00 30.09 ? 425  SER B C     1 
ATOM   7706  O  O     . SER B  1  398 ? 12.621  45.507 13.290 1.00 30.66 ? 425  SER B O     1 
ATOM   7707  C  CB    . SER B  1  398 ? 13.458  48.696 13.733 1.00 30.32 ? 425  SER B CB    1 
ATOM   7708  O  OG    . SER B  1  398 ? 13.093  50.031 13.412 1.00 30.68 ? 425  SER B OG    1 
ATOM   7709  N  N     . PHE B  1  399 ? 13.121  46.120 15.399 1.00 29.77 ? 426  PHE B N     1 
ATOM   7710  C  CA    . PHE B  1  399 ? 13.564  44.785 15.791 1.00 29.56 ? 426  PHE B CA    1 
ATOM   7711  C  C     . PHE B  1  399 ? 12.448  43.743 15.812 1.00 29.32 ? 426  PHE B C     1 
ATOM   7712  O  O     . PHE B  1  399 ? 12.708  42.558 15.609 1.00 29.20 ? 426  PHE B O     1 
ATOM   7713  C  CB    . PHE B  1  399 ? 14.299  44.814 17.137 1.00 29.23 ? 426  PHE B CB    1 
ATOM   7714  C  CG    . PHE B  1  399 ? 15.679  45.406 17.054 1.00 31.88 ? 426  PHE B CG    1 
ATOM   7715  C  CD1   . PHE B  1  399 ? 16.350  45.476 15.835 1.00 33.70 ? 426  PHE B CD1   1 
ATOM   7716  C  CD2   . PHE B  1  399 ? 16.318  45.871 18.195 1.00 34.71 ? 426  PHE B CD2   1 
ATOM   7717  C  CE1   . PHE B  1  399 ? 17.621  46.016 15.750 1.00 36.56 ? 426  PHE B CE1   1 
ATOM   7718  C  CE2   . PHE B  1  399 ? 17.599  46.410 18.118 1.00 36.19 ? 426  PHE B CE2   1 
ATOM   7719  C  CZ    . PHE B  1  399 ? 18.247  46.486 16.896 1.00 36.34 ? 426  PHE B CZ    1 
ATOM   7720  N  N     . THR B  1  400 ? 11.216  44.181 16.064 1.00 29.55 ? 427  THR B N     1 
ATOM   7721  C  CA    . THR B  1  400 ? 10.066  43.280 16.021 1.00 30.01 ? 427  THR B CA    1 
ATOM   7722  C  C     . THR B  1  400 ? 9.825   42.776 14.595 1.00 30.72 ? 427  THR B C     1 
ATOM   7723  O  O     . THR B  1  400 ? 9.469   41.615 14.394 1.00 30.64 ? 427  THR B O     1 
ATOM   7724  C  CB    . THR B  1  400 ? 8.803   43.947 16.607 1.00 30.72 ? 427  THR B CB    1 
ATOM   7725  O  OG1   . THR B  1  400 ? 9.081   44.365 17.948 1.00 30.88 ? 427  THR B OG1   1 
ATOM   7726  C  CG2   . THR B  1  400 ? 7.627   42.987 16.636 1.00 31.08 ? 427  THR B CG2   1 
ATOM   7727  N  N     . ARG B  1  401 ? 10.045  43.633 13.603 1.00 31.63 ? 428  ARG B N     1 
ATOM   7728  C  CA    . ARG B  1  401 ? 9.818   43.218 12.220 1.00 32.94 ? 428  ARG B CA    1 
ATOM   7729  C  C     . ARG B  1  401 ? 11.021  42.589 11.483 1.00 32.92 ? 428  ARG B C     1 
ATOM   7730  O  O     . ARG B  1  401 ? 10.837  41.995 10.421 1.00 34.03 ? 428  ARG B O     1 
ATOM   7731  C  CB    . ARG B  1  401 ? 9.136   44.321 11.393 1.00 33.97 ? 428  ARG B CB    1 
ATOM   7732  C  CG    . ARG B  1  401 ? 9.997   45.513 11.026 1.00 34.69 ? 428  ARG B CG    1 
ATOM   7733  C  CD    . ARG B  1  401 ? 9.212   46.442 10.078 1.00 37.02 ? 428  ARG B CD    1 
ATOM   7734  N  N     . GLN B  1  402 ? 12.236  42.714 12.023 1.00 32.03 ? 429  GLN B N     1 
ATOM   7735  C  CA    . GLN B  1  402 ? 13.411  42.152 11.338 1.00 32.11 ? 429  GLN B CA    1 
ATOM   7736  C  C     . GLN B  1  402 ? 13.688  40.697 11.731 1.00 31.72 ? 429  GLN B C     1 
ATOM   7737  O  O     . GLN B  1  402 ? 13.895  40.392 12.902 1.00 31.06 ? 429  GLN B O     1 
ATOM   7738  C  CB    . GLN B  1  402 ? 14.673  43.006 11.543 1.00 31.61 ? 429  GLN B CB    1 
ATOM   7739  C  CG    . GLN B  1  402 ? 15.930  42.334 10.962 1.00 31.88 ? 429  GLN B CG    1 
ATOM   7740  C  CD    . GLN B  1  402 ? 17.187  43.192 11.005 1.00 32.39 ? 429  GLN B CD    1 
ATOM   7741  O  OE1   . GLN B  1  402 ? 17.277  44.171 11.749 1.00 33.07 ? 429  GLN B OE1   1 
ATOM   7742  N  NE2   . GLN B  1  402 ? 18.168  42.818 10.204 1.00 31.02 ? 429  GLN B NE2   1 
ATOM   7743  N  N     . ILE B  1  403 ? 13.720  39.819 10.733 1.00 32.26 ? 430  ILE B N     1 
ATOM   7744  C  CA    . ILE B  1  403 ? 13.888  38.375 10.942 1.00 31.98 ? 430  ILE B CA    1 
ATOM   7745  C  C     . ILE B  1  403 ? 15.334  37.967 11.273 1.00 31.03 ? 430  ILE B C     1 
ATOM   7746  O  O     . ILE B  1  403 ? 16.279  38.542 10.742 1.00 31.05 ? 430  ILE B O     1 
ATOM   7747  C  CB    . ILE B  1  403 ? 13.355  37.577 9.714  1.00 33.17 ? 430  ILE B CB    1 
ATOM   7748  C  CG1   . ILE B  1  403 ? 13.142  36.100 10.070 1.00 33.91 ? 430  ILE B CG1   1 
ATOM   7749  C  CG2   . ILE B  1  403 ? 14.269  37.765 8.481  1.00 33.39 ? 430  ILE B CG2   1 
ATOM   7750  C  CD1   . ILE B  1  403 ? 12.163  35.392 9.163  1.00 36.47 ? 430  ILE B CD1   1 
ATOM   7751  N  N     . ALA B  1  404 ? 15.476  36.973 12.153 1.00 30.45 ? 431  ALA B N     1 
ATOM   7752  C  CA    . ALA B  1  404 ? 16.770  36.388 12.526 1.00 29.65 ? 431  ALA B CA    1 
ATOM   7753  C  C     . ALA B  1  404 ? 17.127  35.198 11.651 1.00 29.83 ? 431  ALA B C     1 
ATOM   7754  O  O     . ALA B  1  404 ? 16.288  34.691 10.912 1.00 30.56 ? 431  ALA B O     1 
ATOM   7755  C  CB    . ALA B  1  404 ? 16.751  35.963 14.000 1.00 28.75 ? 431  ALA B CB    1 
ATOM   7756  N  N     . GLY B  1  405 ? 18.375  34.747 11.748 1.00 29.53 ? 432  GLY B N     1 
ATOM   7757  C  CA    . GLY B  1  405 ? 18.842  33.595 10.986 1.00 30.05 ? 432  GLY B CA    1 
ATOM   7758  C  C     . GLY B  1  405 ? 18.480  32.259 11.608 1.00 30.24 ? 432  GLY B C     1 
ATOM   7759  O  O     . GLY B  1  405 ? 18.247  32.163 12.821 1.00 29.94 ? 432  GLY B O     1 
ATOM   7760  N  N     . ARG B  1  406 ? 18.429  31.229 10.767 1.00 30.97 ? 433  ARG B N     1 
ATOM   7761  C  CA    . ARG B  1  406 ? 18.266  29.848 11.211 1.00 31.23 ? 433  ARG B CA    1 
ATOM   7762  C  C     . ARG B  1  406 ? 19.561  29.363 11.854 1.00 30.76 ? 433  ARG B C     1 
ATOM   7763  O  O     . ARG B  1  406 ? 20.644  29.577 11.305 1.00 31.17 ? 433  ARG B O     1 
ATOM   7764  C  CB    . ARG B  1  406 ? 17.932  28.950 10.021 1.00 32.16 ? 433  ARG B CB    1 
ATOM   7765  C  CG    . ARG B  1  406 ? 17.404  27.589 10.403 1.00 32.30 ? 433  ARG B CG    1 
ATOM   7766  C  CD    . ARG B  1  406 ? 17.005  26.790 9.172  1.00 34.18 ? 433  ARG B CD    1 
ATOM   7767  N  NE    . ARG B  1  406 ? 15.961  25.822 9.500  1.00 35.41 ? 433  ARG B NE    1 
ATOM   7768  C  CZ    . ARG B  1  406 ? 15.369  25.013 8.624  1.00 36.64 ? 433  ARG B CZ    1 
ATOM   7769  N  NH1   . ARG B  1  406 ? 15.721  25.029 7.341  1.00 37.12 ? 433  ARG B NH1   1 
ATOM   7770  N  NH2   . ARG B  1  406 ? 14.424  24.182 9.037  1.00 36.49 ? 433  ARG B NH2   1 
ATOM   7771  N  N     . VAL B  1  407 ? 19.446  28.704 13.004 1.00 30.07 ? 434  VAL B N     1 
ATOM   7772  C  CA    . VAL B  1  407 ? 20.623  28.256 13.754 1.00 29.70 ? 434  VAL B CA    1 
ATOM   7773  C  C     . VAL B  1  407 ? 21.136  26.893 13.274 1.00 30.63 ? 434  VAL B C     1 
ATOM   7774  O  O     . VAL B  1  407 ? 22.322  26.746 12.992 1.00 31.15 ? 434  VAL B O     1 
ATOM   7775  C  CB    . VAL B  1  407 ? 20.369  28.267 15.278 1.00 28.59 ? 434  VAL B CB    1 
ATOM   7776  C  CG1   . VAL B  1  407 ? 21.535  27.656 16.034 1.00 27.73 ? 434  VAL B CG1   1 
ATOM   7777  C  CG2   . VAL B  1  407 ? 20.094  29.707 15.756 1.00 27.65 ? 434  VAL B CG2   1 
ATOM   7778  N  N     . ALA B  1  408 ? 20.248  25.906 13.191 1.00 31.35 ? 435  ALA B N     1 
ATOM   7779  C  CA    . ALA B  1  408 ? 20.601  24.603 12.626 1.00 32.34 ? 435  ALA B CA    1 
ATOM   7780  C  C     . ALA B  1  408 ? 20.528  24.650 11.100 1.00 33.24 ? 435  ALA B C     1 
ATOM   7781  O  O     . ALA B  1  408 ? 20.085  25.647 10.527 1.00 33.75 ? 435  ALA B O     1 
ATOM   7782  C  CB    . ALA B  1  408 ? 19.689  23.514 13.180 1.00 32.43 ? 435  ALA B CB    1 
ATOM   7783  N  N     . GLY B  1  409 ? 20.974  23.582 10.441 1.00 34.24 ? 436  GLY B N     1 
ATOM   7784  C  CA    . GLY B  1  409 ? 20.877  23.481 8.982  1.00 35.06 ? 436  GLY B CA    1 
ATOM   7785  C  C     . GLY B  1  409 ? 22.146  23.859 8.239  1.00 35.36 ? 436  GLY B C     1 
ATOM   7786  O  O     . GLY B  1  409 ? 22.220  23.703 7.017  1.00 36.31 ? 436  GLY B O     1 
ATOM   7787  N  N     . GLY B  1  410 ? 23.138  24.366 8.971  1.00 34.21 ? 437  GLY B N     1 
ATOM   7788  C  CA    . GLY B  1  410 ? 24.450  24.668 8.404  1.00 34.24 ? 437  GLY B CA    1 
ATOM   7789  C  C     . GLY B  1  410 ? 24.597  25.972 7.642  1.00 34.39 ? 437  GLY B C     1 
ATOM   7790  O  O     . GLY B  1  410 ? 23.604  26.606 7.245  1.00 34.15 ? 437  GLY B O     1 
ATOM   7791  N  N     . ARG B  1  411 ? 25.858  26.369 7.467  1.00 34.09 ? 438  ARG B N     1 
ATOM   7792  C  CA    . ARG B  1  411 ? 26.261  27.501 6.624  1.00 34.42 ? 438  ARG B CA    1 
ATOM   7793  C  C     . ARG B  1  411 ? 25.475  28.794 6.845  1.00 33.88 ? 438  ARG B C     1 
ATOM   7794  O  O     . ARG B  1  411 ? 25.008  29.428 5.893  1.00 34.50 ? 438  ARG B O     1 
ATOM   7795  C  CB    . ARG B  1  411 ? 26.258  27.092 5.146  1.00 35.87 ? 438  ARG B CB    1 
ATOM   7796  C  CG    . ARG B  1  411 ? 27.395  26.146 4.784  1.00 36.62 ? 438  ARG B CG    1 
ATOM   7797  C  CD    . ARG B  1  411 ? 27.198  25.501 3.418  1.00 39.00 ? 438  ARG B CD    1 
ATOM   7798  N  NE    . ARG B  1  411 ? 28.354  24.679 3.078  1.00 40.99 ? 438  ARG B NE    1 
ATOM   7799  C  CZ    . ARG B  1  411 ? 28.398  23.803 2.078  1.00 43.12 ? 438  ARG B CZ    1 
ATOM   7800  N  NH1   . ARG B  1  411 ? 27.343  23.615 1.294  1.00 44.42 ? 438  ARG B NH1   1 
ATOM   7801  N  NH2   . ARG B  1  411 ? 29.505  23.108 1.866  1.00 43.34 ? 438  ARG B NH2   1 
ATOM   7802  N  N     . ASN B  1  412 ? 25.343  29.198 8.103  1.00 32.53 ? 439  ASN B N     1 
ATOM   7803  C  CA    . ASN B  1  412 ? 24.610  30.422 8.396  1.00 32.13 ? 439  ASN B CA    1 
ATOM   7804  C  C     . ASN B  1  412 ? 25.233  31.323 9.470  1.00 31.36 ? 439  ASN B C     1 
ATOM   7805  O  O     . ASN B  1  412 ? 24.559  32.210 10.001 1.00 31.06 ? 439  ASN B O     1 
ATOM   7806  C  CB    . ASN B  1  412 ? 23.145  30.111 8.713  1.00 31.75 ? 439  ASN B CB    1 
ATOM   7807  C  CG    . ASN B  1  412 ? 22.224  31.286 8.430  1.00 31.66 ? 439  ASN B CG    1 
ATOM   7808  O  OD1   . ASN B  1  412 ? 22.441  32.061 7.488  1.00 31.67 ? 439  ASN B OD1   1 
ATOM   7809  N  ND2   . ASN B  1  412 ? 21.191  31.428 9.248  1.00 29.66 ? 439  ASN B ND2   1 
ATOM   7810  N  N     . VAL B  1  413 ? 26.513  31.102 9.773  1.00 30.93 ? 440  VAL B N     1 
ATOM   7811  C  CA    . VAL B  1  413 ? 27.262  31.986 10.674 1.00 30.25 ? 440  VAL B CA    1 
ATOM   7812  C  C     . VAL B  1  413 ? 27.746  33.213 9.894  1.00 30.90 ? 440  VAL B C     1 
ATOM   7813  O  O     . VAL B  1  413 ? 28.508  33.064 8.938  1.00 31.67 ? 440  VAL B O     1 
ATOM   7814  C  CB    . VAL B  1  413 ? 28.485  31.268 11.321 1.00 30.06 ? 440  VAL B CB    1 
ATOM   7815  C  CG1   . VAL B  1  413 ? 29.302  32.244 12.173 1.00 28.90 ? 440  VAL B CG1   1 
ATOM   7816  C  CG2   . VAL B  1  413 ? 28.037  30.073 12.157 1.00 29.04 ? 440  VAL B CG2   1 
ATOM   7817  N  N     . PRO B  1  414 ? 27.325  34.432 10.302 1.00 31.07 ? 441  PRO B N     1 
ATOM   7818  C  CA    . PRO B  1  414 ? 27.766  35.591 9.520  1.00 32.04 ? 441  PRO B CA    1 
ATOM   7819  C  C     . PRO B  1  414 ? 29.286  35.756 9.572  1.00 32.63 ? 441  PRO B C     1 
ATOM   7820  O  O     . PRO B  1  414 ? 29.901  35.508 10.608 1.00 32.16 ? 441  PRO B O     1 
ATOM   7821  C  CB    . PRO B  1  414 ? 27.066  36.776 10.192 1.00 31.80 ? 441  PRO B CB    1 
ATOM   7822  C  CG    . PRO B  1  414 ? 26.721  36.324 11.556 1.00 30.63 ? 441  PRO B CG    1 
ATOM   7823  C  CD    . PRO B  1  414 ? 26.646  34.821 11.552 1.00 30.23 ? 441  PRO B CD    1 
ATOM   7824  N  N     . ILE B  1  415 ? 29.861  36.167 8.449  1.00 33.88 ? 442  ILE B N     1 
ATOM   7825  C  CA    . ILE B  1  415 ? 31.304  36.340 8.285  1.00 34.99 ? 442  ILE B CA    1 
ATOM   7826  C  C     . ILE B  1  415 ? 31.895  37.272 9.332  1.00 34.57 ? 442  ILE B C     1 
ATOM   7827  O  O     . ILE B  1  415 ? 33.024  37.073 9.784  1.00 34.82 ? 442  ILE B O     1 
ATOM   7828  C  CB    . ILE B  1  415 ? 31.637  36.908 6.878  1.00 36.23 ? 442  ILE B CB    1 
ATOM   7829  C  CG1   . ILE B  1  415 ? 31.145  35.971 5.760  1.00 38.08 ? 442  ILE B CG1   1 
ATOM   7830  C  CG2   . ILE B  1  415 ? 33.120  37.226 6.752  1.00 36.82 ? 442  ILE B CG2   1 
ATOM   7831  C  CD1   . ILE B  1  415 ? 31.889  34.656 5.620  1.00 39.71 ? 442  ILE B CD1   1 
ATOM   7832  N  N     . ALA B  1  416 ? 31.127  38.295 9.701  1.00 34.44 ? 443  ALA B N     1 
ATOM   7833  C  CA    . ALA B  1  416 ? 31.567  39.302 10.661 1.00 34.30 ? 443  ALA B CA    1 
ATOM   7834  C  C     . ALA B  1  416 ? 31.997  38.709 12.000 1.00 33.58 ? 443  ALA B C     1 
ATOM   7835  O  O     . ALA B  1  416 ? 32.857  39.272 12.672 1.00 34.04 ? 443  ALA B O     1 
ATOM   7836  C  CB    . ALA B  1  416 ? 30.472  40.342 10.870 1.00 34.30 ? 443  ALA B CB    1 
ATOM   7837  N  N     . VAL B  1  417 ? 31.406  37.577 12.382 1.00 32.68 ? 444  VAL B N     1 
ATOM   7838  C  CA    . VAL B  1  417 ? 31.760  36.923 13.650 1.00 32.15 ? 444  VAL B CA    1 
ATOM   7839  C  C     . VAL B  1  417 ? 32.496  35.594 13.457 1.00 32.17 ? 444  VAL B C     1 
ATOM   7840  O  O     . VAL B  1  417 ? 32.418  34.712 14.311 1.00 31.89 ? 444  VAL B O     1 
ATOM   7841  C  CB    . VAL B  1  417 ? 30.532  36.726 14.601 1.00 31.43 ? 444  VAL B CB    1 
ATOM   7842  C  CG1   . VAL B  1  417 ? 29.961  38.075 15.038 1.00 31.93 ? 444  VAL B CG1   1 
ATOM   7843  C  CG2   . VAL B  1  417 ? 29.444  35.859 13.956 1.00 31.20 ? 444  VAL B CG2   1 
ATOM   7844  N  N     . GLN B  1  418 ? 33.228  35.454 12.351 1.00 32.37 ? 445  GLN B N     1 
ATOM   7845  C  CA    . GLN B  1  418 ? 33.916  34.185 12.082 1.00 32.18 ? 445  GLN B CA    1 
ATOM   7846  C  C     . GLN B  1  418 ? 34.948  33.796 13.155 1.00 31.69 ? 445  GLN B C     1 
ATOM   7847  O  O     . GLN B  1  418 ? 35.151  32.610 13.412 1.00 31.15 ? 445  GLN B O     1 
ATOM   7848  C  CB    . GLN B  1  418 ? 34.526  34.150 10.675 1.00 33.13 ? 445  GLN B CB    1 
ATOM   7849  C  CG    . GLN B  1  418 ? 35.713  35.073 10.433 1.00 33.86 ? 445  GLN B CG    1 
ATOM   7850  C  CD    . GLN B  1  418 ? 36.421  34.750 9.134  1.00 35.55 ? 445  GLN B CD    1 
ATOM   7851  O  OE1   . GLN B  1  418 ? 36.209  33.688 8.549  1.00 36.38 ? 445  GLN B OE1   1 
ATOM   7852  N  NE2   . GLN B  1  418 ? 37.267  35.662 8.674  1.00 35.62 ? 445  GLN B NE2   1 
ATOM   7853  N  N     . ALA B  1  419 ? 35.588  34.787 13.776 1.00 31.77 ? 446  ALA B N     1 
ATOM   7854  C  CA    . ALA B  1  419 ? 36.598  34.528 14.813 1.00 32.02 ? 446  ALA B CA    1 
ATOM   7855  C  C     . ALA B  1  419 ? 35.978  33.955 16.094 1.00 31.35 ? 446  ALA B C     1 
ATOM   7856  O  O     . ALA B  1  419 ? 36.618  33.184 16.820 1.00 30.89 ? 446  ALA B O     1 
ATOM   7857  C  CB    . ALA B  1  419 ? 37.391  35.792 15.120 1.00 32.25 ? 446  ALA B CB    1 
ATOM   7858  N  N     . VAL B  1  420 ? 34.731  34.338 16.361 1.00 31.34 ? 447  VAL B N     1 
ATOM   7859  C  CA    . VAL B  1  420 ? 34.011  33.883 17.547 1.00 31.30 ? 447  VAL B CA    1 
ATOM   7860  C  C     . VAL B  1  420 ? 33.550  32.441 17.349 1.00 31.29 ? 447  VAL B C     1 
ATOM   7861  O  O     . VAL B  1  420 ? 33.676  31.616 18.254 1.00 31.17 ? 447  VAL B O     1 
ATOM   7862  C  CB    . VAL B  1  420 ? 32.823  34.817 17.884 1.00 31.31 ? 447  VAL B CB    1 
ATOM   7863  C  CG1   . VAL B  1  420 ? 32.248  34.481 19.258 1.00 30.90 ? 447  VAL B CG1   1 
ATOM   7864  C  CG2   . VAL B  1  420 ? 33.269  36.283 17.844 1.00 32.20 ? 447  VAL B CG2   1 
ATOM   7865  N  N     . ALA B  1  421 ? 33.034  32.139 16.156 1.00 31.59 ? 448  ALA B N     1 
ATOM   7866  C  CA    . ALA B  1  421 ? 32.660  30.770 15.800 1.00 31.54 ? 448  ALA B CA    1 
ATOM   7867  C  C     . ALA B  1  421 ? 33.867  29.818 15.881 1.00 31.97 ? 448  ALA B C     1 
ATOM   7868  O  O     . ALA B  1  421 ? 33.760  28.712 16.423 1.00 31.98 ? 448  ALA B O     1 
ATOM   7869  C  CB    . ALA B  1  421 ? 32.029  30.733 14.413 1.00 31.87 ? 448  ALA B CB    1 
ATOM   7870  N  N     . LYS B  1  422 ? 35.010  30.258 15.353 1.00 32.44 ? 449  LYS B N     1 
ATOM   7871  C  CA    . LYS B  1  422 ? 36.247  29.475 15.418 1.00 33.03 ? 449  LYS B CA    1 
ATOM   7872  C  C     . LYS B  1  422 ? 36.713  29.259 16.870 1.00 32.45 ? 449  LYS B C     1 
ATOM   7873  O  O     . LYS B  1  422 ? 37.124  28.157 17.233 1.00 32.42 ? 449  LYS B O     1 
ATOM   7874  C  CB    . LYS B  1  422 ? 37.346  30.113 14.565 1.00 33.86 ? 449  LYS B CB    1 
ATOM   7875  C  CG    . LYS B  1  422 ? 38.668  29.359 14.595 1.00 34.91 ? 449  LYS B CG    1 
ATOM   7876  C  CD    . LYS B  1  422 ? 39.526  29.668 13.389 1.00 36.76 ? 449  LYS B CD    1 
ATOM   7877  C  CE    . LYS B  1  422 ? 41.006  29.701 13.735 1.00 38.40 ? 449  LYS B CE    1 
ATOM   7878  N  NZ    . LYS B  1  422 ? 41.476  28.509 14.497 1.00 38.52 ? 449  LYS B NZ    1 
ATOM   7879  N  N     . ALA B  1  423 ? 36.625  30.310 17.686 1.00 31.99 ? 450  ALA B N     1 
ATOM   7880  C  CA    . ALA B  1  423 ? 36.875  30.225 19.128 1.00 31.64 ? 450  ALA B CA    1 
ATOM   7881  C  C     . ALA B  1  423 ? 35.993  29.189 19.849 1.00 30.91 ? 450  ALA B C     1 
ATOM   7882  O  O     . ALA B  1  423 ? 36.457  28.502 20.755 1.00 30.90 ? 450  ALA B O     1 
ATOM   7883  C  CB    . ALA B  1  423 ? 36.713  31.594 19.771 1.00 31.19 ? 450  ALA B CB    1 
ATOM   7884  N  N     . SER B  1  424 ? 34.729  29.075 19.448 1.00 30.55 ? 451  SER B N     1 
ATOM   7885  C  CA    . SER B  1  424 ? 33.832  28.097 20.065 1.00 30.13 ? 451  SER B CA    1 
ATOM   7886  C  C     . SER B  1  424 ? 34.333  26.672 19.860 1.00 30.41 ? 451  SER B C     1 
ATOM   7887  O  O     . SER B  1  424 ? 34.281  25.853 20.791 1.00 30.13 ? 451  SER B O     1 
ATOM   7888  C  CB    . SER B  1  424 ? 32.411  28.233 19.531 1.00 30.11 ? 451  SER B CB    1 
ATOM   7889  O  OG    . SER B  1  424 ? 31.820  29.443 19.974 1.00 31.17 ? 451  SER B OG    1 
ATOM   7890  N  N     . ILE B  1  425 ? 34.815  26.386 18.650 1.00 30.47 ? 452  ILE B N     1 
ATOM   7891  C  CA    . ILE B  1  425 ? 35.386  25.084 18.327 1.00 30.88 ? 452  ILE B CA    1 
ATOM   7892  C  C     . ILE B  1  425 ? 36.695  24.893 19.091 1.00 31.34 ? 452  ILE B C     1 
ATOM   7893  O  O     . ILE B  1  425 ? 36.870  23.884 19.772 1.00 31.19 ? 452  ILE B O     1 
ATOM   7894  C  CB    . ILE B  1  425 ? 35.627  24.884 16.791 1.00 31.63 ? 452  ILE B CB    1 
ATOM   7895  C  CG1   . ILE B  1  425 ? 34.324  25.039 16.003 1.00 31.23 ? 452  ILE B CG1   1 
ATOM   7896  C  CG2   . ILE B  1  425 ? 36.241  23.501 16.518 1.00 32.09 ? 452  ILE B CG2   1 
ATOM   7897  C  CD1   . ILE B  1  425 ? 34.505  25.150 14.477 1.00 33.17 ? 452  ILE B CD1   1 
ATOM   7898  N  N     . ASP B  1  426 ? 37.599  25.871 18.981 1.00 31.66 ? 453  ASP B N     1 
ATOM   7899  C  CA    . ASP B  1  426 ? 38.911  25.799 19.620 1.00 32.22 ? 453  ASP B CA    1 
ATOM   7900  C  C     . ASP B  1  426 ? 38.823  25.623 21.136 1.00 31.68 ? 453  ASP B C     1 
ATOM   7901  O  O     . ASP B  1  426 ? 39.577  24.840 21.721 1.00 31.65 ? 453  ASP B O     1 
ATOM   7902  C  CB    . ASP B  1  426 ? 39.745  27.039 19.291 1.00 32.90 ? 453  ASP B CB    1 
ATOM   7903  C  CG    . ASP B  1  426 ? 40.139  27.112 17.823 1.00 34.32 ? 453  ASP B CG    1 
ATOM   7904  O  OD1   . ASP B  1  426 ? 40.281  26.055 17.174 1.00 35.28 ? 453  ASP B OD1   1 
ATOM   7905  O  OD2   . ASP B  1  426 ? 40.307  28.237 17.317 1.00 35.26 ? 453  ASP B OD2   1 
ATOM   7906  N  N     . GLN B  1  427 ? 37.902  26.350 21.763 1.00 30.95 ? 454  GLN B N     1 
ATOM   7907  C  CA    . GLN B  1  427 ? 37.773  26.326 23.218 1.00 31.03 ? 454  GLN B CA    1 
ATOM   7908  C  C     . GLN B  1  427 ? 37.114  25.043 23.711 1.00 30.29 ? 454  GLN B C     1 
ATOM   7909  O  O     . GLN B  1  427 ? 37.443  24.566 24.791 1.00 30.20 ? 454  GLN B O     1 
ATOM   7910  C  CB    . GLN B  1  427 ? 37.053  27.582 23.730 1.00 30.90 ? 454  GLN B CB    1 
ATOM   7911  C  CG    . GLN B  1  427 ? 37.939  28.820 23.624 1.00 33.45 ? 454  GLN B CG    1 
ATOM   7912  C  CD    . GLN B  1  427 ? 37.295  30.098 24.115 1.00 37.68 ? 454  GLN B CD    1 
ATOM   7913  O  OE1   . GLN B  1  427 ? 36.084  30.300 24.001 1.00 39.35 ? 454  GLN B OE1   1 
ATOM   7914  N  NE2   . GLN B  1  427 ? 38.117  30.984 24.661 1.00 40.29 ? 454  GLN B NE2   1 
ATOM   7915  N  N     . SER B  1  428 ? 36.215  24.475 22.906 1.00 29.96 ? 455  SER B N     1 
ATOM   7916  C  CA    . SER B  1  428 ? 35.659  23.143 23.176 1.00 30.20 ? 455  SER B CA    1 
ATOM   7917  C  C     . SER B  1  428 ? 36.761  22.083 23.232 1.00 30.51 ? 455  SER B C     1 
ATOM   7918  O  O     . SER B  1  428 ? 36.737  21.204 24.099 1.00 30.16 ? 455  SER B O     1 
ATOM   7919  C  CB    . SER B  1  428 ? 34.638  22.744 22.109 1.00 30.31 ? 455  SER B CB    1 
ATOM   7920  O  OG    . SER B  1  428 ? 33.551  23.650 22.079 1.00 32.54 ? 455  SER B OG    1 
ATOM   7921  N  N     . ARG B  1  429 ? 37.713  22.177 22.300 1.00 30.62 ? 456  ARG B N     1 
ATOM   7922  C  CA    . ARG B  1  429 ? 38.857  21.266 22.248 1.00 31.66 ? 456  ARG B CA    1 
ATOM   7923  C  C     . ARG B  1  429 ? 39.820  21.497 23.411 1.00 31.86 ? 456  ARG B C     1 
ATOM   7924  O  O     . ARG B  1  429 ? 40.327  20.546 24.003 1.00 31.85 ? 456  ARG B O     1 
ATOM   7925  C  CB    . ARG B  1  429 ? 39.606  21.414 20.923 1.00 32.33 ? 456  ARG B CB    1 
ATOM   7926  C  CG    . ARG B  1  429 ? 38.808  20.958 19.718 1.00 32.83 ? 456  ARG B CG    1 
ATOM   7927  C  CD    . ARG B  1  429 ? 39.460  21.382 18.415 1.00 32.98 ? 456  ARG B CD    1 
ATOM   7928  N  NE    . ARG B  1  429 ? 38.640  21.022 17.258 1.00 33.13 ? 456  ARG B NE    1 
ATOM   7929  C  CZ    . ARG B  1  429 ? 39.068  21.060 15.999 1.00 33.75 ? 456  ARG B CZ    1 
ATOM   7930  N  NH1   . ARG B  1  429 ? 40.306  21.447 15.727 1.00 32.90 ? 456  ARG B NH1   1 
ATOM   7931  N  NH2   . ARG B  1  429 ? 38.258  20.710 15.009 1.00 34.33 ? 456  ARG B NH2   1 
ATOM   7932  N  N     . GLU B  1  430 ? 40.068  22.768 23.723 1.00 31.73 ? 457  GLU B N     1 
ATOM   7933  C  CA    . GLU B  1  430 ? 40.903  23.144 24.855 1.00 32.39 ? 457  GLU B CA    1 
ATOM   7934  C  C     . GLU B  1  430 ? 40.331  22.547 26.155 1.00 31.53 ? 457  GLU B C     1 
ATOM   7935  O  O     . GLU B  1  430 ? 41.075  22.063 27.010 1.00 31.99 ? 457  GLU B O     1 
ATOM   7936  C  CB    . GLU B  1  430 ? 40.971  24.668 24.946 1.00 32.56 ? 457  GLU B CB    1 
ATOM   7937  C  CG    . GLU B  1  430 ? 41.932  25.190 25.998 1.00 36.48 ? 457  GLU B CG    1 
ATOM   7938  C  CD    . GLU B  1  430 ? 41.858  26.700 26.153 1.00 39.70 ? 457  GLU B CD    1 
ATOM   7939  O  OE1   . GLU B  1  430 ? 41.416  27.384 25.197 1.00 40.64 ? 457  GLU B OE1   1 
ATOM   7940  O  OE2   . GLU B  1  430 ? 42.244  27.197 27.235 1.00 40.37 ? 457  GLU B OE2   1 
ATOM   7941  N  N     . MET B  1  431 ? 39.004  22.571 26.271 1.00 30.12 ? 458  MET B N     1 
ATOM   7942  C  CA    . MET B  1  431 ? 38.291  22.051 27.439 1.00 29.36 ? 458  MET B CA    1 
ATOM   7943  C  C     . MET B  1  431 ? 38.126  20.524 27.399 1.00 29.55 ? 458  MET B C     1 
ATOM   7944  O  O     . MET B  1  431 ? 37.541  19.925 28.313 1.00 29.41 ? 458  MET B O     1 
ATOM   7945  C  CB    . MET B  1  431 ? 36.936  22.764 27.591 1.00 28.19 ? 458  MET B CB    1 
ATOM   7946  C  CG    . MET B  1  431 ? 37.058  24.214 28.082 1.00 27.55 ? 458  MET B CG    1 
ATOM   7947  S  SD    . MET B  1  431 ? 35.491  25.076 28.428 1.00 27.33 ? 458  MET B SD    1 
ATOM   7948  C  CE    . MET B  1  431 ? 34.790  25.271 26.789 1.00 27.22 ? 458  MET B CE    1 
ATOM   7949  N  N     . LYS B  1  432 ? 38.655  19.909 26.340 1.00 29.96 ? 459  LYS B N     1 
ATOM   7950  C  CA    . LYS B  1  432 ? 38.634  18.451 26.152 1.00 30.43 ? 459  LYS B CA    1 
ATOM   7951  C  C     . LYS B  1  432 ? 37.210  17.866 26.162 1.00 29.53 ? 459  LYS B C     1 
ATOM   7952  O  O     . LYS B  1  432 ? 36.946  16.854 26.821 1.00 29.19 ? 459  LYS B O     1 
ATOM   7953  C  CB    . LYS B  1  432 ? 39.530  17.741 27.196 1.00 31.43 ? 459  LYS B CB    1 
ATOM   7954  C  CG    . LYS B  1  432 ? 41.029  18.101 27.151 1.00 33.53 ? 459  LYS B CG    1 
ATOM   7955  C  CD    . LYS B  1  432 ? 41.692  17.786 25.805 1.00 37.72 ? 459  LYS B CD    1 
ATOM   7956  C  CE    . LYS B  1  432 ? 41.734  16.281 25.458 1.00 41.75 ? 459  LYS B CE    1 
ATOM   7957  N  NZ    . LYS B  1  432 ? 42.797  15.481 26.153 1.00 44.54 ? 459  LYS B NZ    1 
ATOM   7958  N  N     . TYR B  1  433 ? 36.304  18.516 25.432 1.00 28.38 ? 460  TYR B N     1 
ATOM   7959  C  CA    . TYR B  1  433 ? 34.943  18.016 25.241 1.00 28.22 ? 460  TYR B CA    1 
ATOM   7960  C  C     . TYR B  1  433 ? 34.944  16.630 24.600 1.00 29.19 ? 460  TYR B C     1 
ATOM   7961  O  O     . TYR B  1  433 ? 35.728  16.362 23.683 1.00 29.41 ? 460  TYR B O     1 
ATOM   7962  C  CB    . TYR B  1  433 ? 34.155  18.974 24.335 1.00 27.72 ? 460  TYR B CB    1 
ATOM   7963  C  CG    . TYR B  1  433 ? 33.466  20.132 25.036 1.00 27.67 ? 460  TYR B CG    1 
ATOM   7964  C  CD1   . TYR B  1  433 ? 34.005  20.719 26.187 1.00 26.83 ? 460  TYR B CD1   1 
ATOM   7965  C  CD2   . TYR B  1  433 ? 32.275  20.661 24.520 1.00 27.16 ? 460  TYR B CD2   1 
ATOM   7966  C  CE1   . TYR B  1  433 ? 33.357  21.797 26.816 1.00 27.39 ? 460  TYR B CE1   1 
ATOM   7967  C  CE2   . TYR B  1  433 ? 31.631  21.719 25.135 1.00 26.66 ? 460  TYR B CE2   1 
ATOM   7968  C  CZ    . TYR B  1  433 ? 32.171  22.284 26.276 1.00 26.68 ? 460  TYR B CZ    1 
ATOM   7969  O  OH    . TYR B  1  433 ? 31.515  23.340 26.867 1.00 27.81 ? 460  TYR B OH    1 
ATOM   7970  N  N     . GLN B  1  434 ? 34.066  15.755 25.091 1.00 29.32 ? 461  GLN B N     1 
ATOM   7971  C  CA    . GLN B  1  434 ? 33.800  14.479 24.436 1.00 30.11 ? 461  GLN B CA    1 
ATOM   7972  C  C     . GLN B  1  434 ? 33.027  14.730 23.132 1.00 29.84 ? 461  GLN B C     1 
ATOM   7973  O  O     . GLN B  1  434 ? 32.622  15.859 22.850 1.00 28.61 ? 461  GLN B O     1 
ATOM   7974  C  CB    . GLN B  1  434 ? 33.027  13.535 25.367 1.00 30.67 ? 461  GLN B CB    1 
ATOM   7975  C  CG    . GLN B  1  434 ? 33.837  13.000 26.547 1.00 31.63 ? 461  GLN B CG    1 
ATOM   7976  C  CD    . GLN B  1  434 ? 33.090  11.939 27.342 1.00 34.63 ? 461  GLN B CD    1 
ATOM   7977  O  OE1   . GLN B  1  434 ? 32.476  11.028 26.769 1.00 36.77 ? 461  GLN B OE1   1 
ATOM   7978  N  NE2   . GLN B  1  434 ? 33.150  12.040 28.670 1.00 32.03 ? 461  GLN B NE2   1 
ATOM   7979  N  N     . SER B  1  435 ? 32.841  13.679 22.338 1.00 30.63 ? 462  SER B N     1 
ATOM   7980  C  CA    . SER B  1  435 ? 32.242  13.806 21.010 1.00 30.89 ? 462  SER B CA    1 
ATOM   7981  C  C     . SER B  1  435 ? 30.736  14.065 21.037 1.00 30.44 ? 462  SER B C     1 
ATOM   7982  O  O     . SER B  1  435 ? 30.078  13.875 22.065 1.00 29.98 ? 462  SER B O     1 
ATOM   7983  C  CB    . SER B  1  435 ? 32.520  12.542 20.201 1.00 32.21 ? 462  SER B CB    1 
ATOM   7984  O  OG    . SER B  1  435 ? 31.759  11.465 20.711 1.00 33.26 ? 462  SER B OG    1 
ATOM   7985  N  N     . LEU B  1  436 ? 30.208  14.492 19.890 1.00 30.37 ? 463  LEU B N     1 
ATOM   7986  C  CA    . LEU B  1  436 ? 28.773  14.645 19.673 1.00 30.42 ? 463  LEU B CA    1 
ATOM   7987  C  C     . LEU B  1  436 ? 27.978  13.421 20.118 1.00 31.25 ? 463  LEU B C     1 
ATOM   7988  O  O     . LEU B  1  436 ? 26.988  13.549 20.853 1.00 31.23 ? 463  LEU B O     1 
ATOM   7989  C  CB    . LEU B  1  436 ? 28.469  14.919 18.188 1.00 30.46 ? 463  LEU B CB    1 
ATOM   7990  C  CG    . LEU B  1  436 ? 27.011  14.732 17.743 1.00 30.05 ? 463  LEU B CG    1 
ATOM   7991  C  CD1   . LEU B  1  436 ? 26.090  15.806 18.341 1.00 28.62 ? 463  LEU B CD1   1 
ATOM   7992  C  CD2   . LEU B  1  436 ? 26.909  14.709 16.231 1.00 30.58 ? 463  LEU B CD2   1 
ATOM   7993  N  N     . ASN B  1  437 ? 28.398  12.248 19.655 1.00 32.16 ? 464  ASN B N     1 
ATOM   7994  C  CA    . ASN B  1  437 ? 27.686  11.019 19.968 1.00 33.50 ? 464  ASN B CA    1 
ATOM   7995  C  C     . ASN B  1  437 ? 27.722  10.641 21.450 1.00 33.37 ? 464  ASN B C     1 
ATOM   7996  O  O     . ASN B  1  437 ? 26.758  10.068 21.961 1.00 34.20 ? 464  ASN B O     1 
ATOM   7997  C  CB    . ASN B  1  437 ? 28.139  9.861  19.071 1.00 34.60 ? 464  ASN B CB    1 
ATOM   7998  C  CG    . ASN B  1  437 ? 27.386  9.823  17.742 1.00 35.50 ? 464  ASN B CG    1 
ATOM   7999  O  OD1   . ASN B  1  437 ? 26.414  10.561 17.539 1.00 35.41 ? 464  ASN B OD1   1 
ATOM   8000  N  ND2   . ASN B  1  437 ? 27.828  8.960  16.837 1.00 34.31 ? 464  ASN B ND2   1 
ATOM   8001  N  N     . GLU B  1  438 ? 28.816  10.976 22.133 1.00 32.84 ? 465  GLU B N     1 
ATOM   8002  C  CA    . GLU B  1  438 ? 28.895  10.787 23.586 1.00 32.77 ? 465  GLU B CA    1 
ATOM   8003  C  C     . GLU B  1  438 ? 27.860  11.668 24.283 1.00 31.62 ? 465  GLU B C     1 
ATOM   8004  O  O     . GLU B  1  438 ? 27.138  11.197 25.163 1.00 31.52 ? 465  GLU B O     1 
ATOM   8005  C  CB    . GLU B  1  438 ? 30.300  11.083 24.133 1.00 32.31 ? 465  GLU B CB    1 
ATOM   8006  C  CG    . GLU B  1  438 ? 31.411  10.142 23.633 1.00 34.99 ? 465  GLU B CG    1 
ATOM   8007  C  CD    . GLU B  1  438 ? 31.161  8.669  23.924 1.00 37.65 ? 465  GLU B CD    1 
ATOM   8008  O  OE1   . GLU B  1  438 ? 30.523  8.330  24.941 1.00 39.11 ? 465  GLU B OE1   1 
ATOM   8009  O  OE2   . GLU B  1  438 ? 31.630  7.836  23.124 1.00 41.16 ? 465  GLU B OE2   1 
ATOM   8010  N  N     . TYR B  1  439 ? 27.780  12.935 23.870 1.00 30.53 ? 466  TYR B N     1 
ATOM   8011  C  CA    . TYR B  1  439 ? 26.769  13.848 24.409 1.00 30.23 ? 466  TYR B CA    1 
ATOM   8012  C  C     . TYR B  1  439 ? 25.337  13.408 24.081 1.00 30.99 ? 466  TYR B C     1 
ATOM   8013  O  O     . TYR B  1  439 ? 24.449  13.529 24.923 1.00 31.31 ? 466  TYR B O     1 
ATOM   8014  C  CB    . TYR B  1  439 ? 27.039  15.315 24.017 1.00 29.27 ? 466  TYR B CB    1 
ATOM   8015  C  CG    . TYR B  1  439 ? 28.095  15.952 24.898 1.00 28.99 ? 466  TYR B CG    1 
ATOM   8016  C  CD1   . TYR B  1  439 ? 29.410  16.088 24.459 1.00 28.88 ? 466  TYR B CD1   1 
ATOM   8017  C  CD2   . TYR B  1  439 ? 27.783  16.372 26.195 1.00 28.88 ? 466  TYR B CD2   1 
ATOM   8018  C  CE1   . TYR B  1  439 ? 30.388  16.645 25.270 1.00 27.65 ? 466  TYR B CE1   1 
ATOM   8019  C  CE2   . TYR B  1  439 ? 28.754  16.925 27.024 1.00 28.24 ? 466  TYR B CE2   1 
ATOM   8020  C  CZ    . TYR B  1  439 ? 30.055  17.063 26.557 1.00 29.06 ? 466  TYR B CZ    1 
ATOM   8021  O  OH    . TYR B  1  439 ? 31.021  17.617 27.381 1.00 27.05 ? 466  TYR B OH    1 
ATOM   8022  N  N     . ARG B  1  440 ? 25.128  12.881 22.875 1.00 31.71 ? 467  ARG B N     1 
ATOM   8023  C  CA    . ARG B  1  440 ? 23.814  12.357 22.482 1.00 32.89 ? 467  ARG B CA    1 
ATOM   8024  C  C     . ARG B  1  440 ? 23.356  11.224 23.401 1.00 33.57 ? 467  ARG B C     1 
ATOM   8025  O  O     . ARG B  1  440 ? 22.242  11.263 23.919 1.00 33.61 ? 467  ARG B O     1 
ATOM   8026  C  CB    . ARG B  1  440 ? 23.785  11.937 21.002 1.00 33.57 ? 467  ARG B CB    1 
ATOM   8027  C  CG    . ARG B  1  440 ? 23.666  13.130 20.058 1.00 33.30 ? 467  ARG B CG    1 
ATOM   8028  C  CD    . ARG B  1  440 ? 23.510  12.740 18.603 1.00 35.04 ? 467  ARG B CD    1 
ATOM   8029  N  NE    . ARG B  1  440 ? 22.335  11.905 18.333 1.00 36.82 ? 467  ARG B NE    1 
ATOM   8030  C  CZ    . ARG B  1  440 ? 21.087  12.350 18.182 1.00 37.13 ? 467  ARG B CZ    1 
ATOM   8031  N  NH1   . ARG B  1  440 ? 20.799  13.645 18.283 1.00 36.30 ? 467  ARG B NH1   1 
ATOM   8032  N  NH2   . ARG B  1  440 ? 20.114  11.484 17.937 1.00 37.68 ? 467  ARG B NH2   1 
ATOM   8033  N  N     . LYS B  1  441 ? 24.231  10.246 23.630 1.00 34.14 ? 468  LYS B N     1 
ATOM   8034  C  CA    . LYS B  1  441 ? 23.940  9.139  24.547 1.00 35.19 ? 468  LYS B CA    1 
ATOM   8035  C  C     . LYS B  1  441 ? 23.720  9.616  25.987 1.00 34.58 ? 468  LYS B C     1 
ATOM   8036  O  O     . LYS B  1  441 ? 22.841  9.115  26.688 1.00 35.38 ? 468  LYS B O     1 
ATOM   8037  C  CB    . LYS B  1  441 ? 25.050  8.081  24.502 1.00 35.74 ? 468  LYS B CB    1 
ATOM   8038  C  CG    . LYS B  1  441 ? 25.143  7.322  23.187 1.00 37.26 ? 468  LYS B CG    1 
ATOM   8039  C  CD    . LYS B  1  441 ? 26.104  6.129  23.288 1.00 39.03 ? 468  LYS B CD    1 
ATOM   8040  C  CE    . LYS B  1  441 ? 27.561  6.586  23.281 1.00 38.10 ? 468  LYS B CE    1 
ATOM   8041  N  NZ    . LYS B  1  441 ? 28.483  5.436  23.341 1.00 39.42 ? 468  LYS B NZ    1 
ATOM   8042  N  N     . ARG B  1  442 ? 24.521  10.585 26.417 1.00 33.48 ? 469  ARG B N     1 
ATOM   8043  C  CA    . ARG B  1  442 ? 24.379  11.185 27.743 1.00 33.23 ? 469  ARG B CA    1 
ATOM   8044  C  C     . ARG B  1  442 ? 22.962  11.733 27.969 1.00 33.19 ? 469  ARG B C     1 
ATOM   8045  O  O     . ARG B  1  442 ? 22.454  11.697 29.093 1.00 33.33 ? 469  ARG B O     1 
ATOM   8046  C  CB    . ARG B  1  442 ? 25.453  12.272 27.952 1.00 32.11 ? 469  ARG B CB    1 
ATOM   8047  C  CG    . ARG B  1  442 ? 25.286  13.176 29.180 1.00 31.96 ? 469  ARG B CG    1 
ATOM   8048  C  CD    . ARG B  1  442 ? 25.410  12.417 30.496 1.00 33.15 ? 469  ARG B CD    1 
ATOM   8049  N  NE    . ARG B  1  442 ? 25.246  13.306 31.643 1.00 34.90 ? 469  ARG B NE    1 
ATOM   8050  C  CZ    . ARG B  1  442 ? 24.075  13.717 32.131 1.00 34.80 ? 469  ARG B CZ    1 
ATOM   8051  N  NH1   . ARG B  1  442 ? 22.933  13.331 31.575 1.00 34.38 ? 469  ARG B NH1   1 
ATOM   8052  N  NH2   . ARG B  1  442 ? 24.050  14.521 33.186 1.00 35.23 ? 469  ARG B NH2   1 
ATOM   8053  N  N     . PHE B  1  443 ? 22.323  12.197 26.897 1.00 33.25 ? 470  PHE B N     1 
ATOM   8054  C  CA    . PHE B  1  443 ? 20.972  12.760 26.978 1.00 33.74 ? 470  PHE B CA    1 
ATOM   8055  C  C     . PHE B  1  443 ? 19.887  11.860 26.375 1.00 35.57 ? 470  PHE B C     1 
ATOM   8056  O  O     . PHE B  1  443 ? 18.868  12.343 25.878 1.00 35.66 ? 470  PHE B O     1 
ATOM   8057  C  CB    . PHE B  1  443 ? 20.954  14.185 26.399 1.00 32.50 ? 470  PHE B CB    1 
ATOM   8058  C  CG    . PHE B  1  443 ? 21.615  15.192 27.300 1.00 31.21 ? 470  PHE B CG    1 
ATOM   8059  C  CD1   . PHE B  1  443 ? 23.003  15.286 27.356 1.00 30.43 ? 470  PHE B CD1   1 
ATOM   8060  C  CD2   . PHE B  1  443 ? 20.852  16.004 28.131 1.00 30.50 ? 470  PHE B CD2   1 
ATOM   8061  C  CE1   . PHE B  1  443 ? 23.628  16.195 28.217 1.00 30.88 ? 470  PHE B CE1   1 
ATOM   8062  C  CE2   . PHE B  1  443 ? 21.461  16.913 28.994 1.00 31.46 ? 470  PHE B CE2   1 
ATOM   8063  C  CZ    . PHE B  1  443 ? 22.854  17.013 29.038 1.00 30.44 ? 470  PHE B CZ    1 
ATOM   8064  N  N     . SER B  1  444 ? 20.132  10.550 26.436 1.00 37.17 ? 471  SER B N     1 
ATOM   8065  C  CA    . SER B  1  444 ? 19.179  9.512  26.016 1.00 39.27 ? 471  SER B CA    1 
ATOM   8066  C  C     . SER B  1  444 ? 18.760  9.612  24.551 1.00 39.97 ? 471  SER B C     1 
ATOM   8067  O  O     . SER B  1  444 ? 17.597  9.376  24.211 1.00 40.90 ? 471  SER B O     1 
ATOM   8068  C  CB    . SER B  1  444 ? 17.948  9.489  26.934 1.00 39.80 ? 471  SER B CB    1 
ATOM   8069  O  OG    . SER B  1  444 ? 18.329  9.344  28.288 1.00 40.46 ? 471  SER B OG    1 
ATOM   8070  N  N     . LEU B  1  445 ? 19.716  9.970  23.695 1.00 39.76 ? 472  LEU B N     1 
ATOM   8071  C  CA    . LEU B  1  445 ? 19.492  10.029 22.255 1.00 40.64 ? 472  LEU B CA    1 
ATOM   8072  C  C     . LEU B  1  445 ? 20.348  8.990  21.566 1.00 41.68 ? 472  LEU B C     1 
ATOM   8073  O  O     . LEU B  1  445 ? 21.446  8.682  22.028 1.00 41.50 ? 472  LEU B O     1 
ATOM   8074  C  CB    . LEU B  1  445 ? 19.843  11.412 21.698 1.00 39.44 ? 472  LEU B CB    1 
ATOM   8075  C  CG    . LEU B  1  445 ? 19.334  12.643 22.449 1.00 38.80 ? 472  LEU B CG    1 
ATOM   8076  C  CD1   . LEU B  1  445 ? 19.950  13.903 21.864 1.00 38.00 ? 472  LEU B CD1   1 
ATOM   8077  C  CD2   . LEU B  1  445 ? 17.815  12.698 22.405 1.00 39.96 ? 472  LEU B CD2   1 
ATOM   8078  N  N     . LYS B  1  446 ? 19.840  8.460  20.456 1.00 43.04 ? 473  LYS B N     1 
ATOM   8079  C  CA    . LYS B  1  446 ? 20.564  7.488  19.645 1.00 44.11 ? 473  LYS B CA    1 
ATOM   8080  C  C     . LYS B  1  446 ? 21.768  8.161  18.989 1.00 43.04 ? 473  LYS B C     1 
ATOM   8081  O  O     . LYS B  1  446 ? 21.642  9.270  18.478 1.00 42.47 ? 473  LYS B O     1 
ATOM   8082  C  CB    . LYS B  1  446 ? 19.632  6.908  18.579 1.00 45.60 ? 473  LYS B CB    1 
ATOM   8083  C  CG    . LYS B  1  446 ? 20.191  5.714  17.809 1.00 48.05 ? 473  LYS B CG    1 
ATOM   8084  N  N     . PRO B  1  447 ? 22.943  7.502  19.008 1.00 43.25 ? 474  PRO B N     1 
ATOM   8085  C  CA    . PRO B  1  447 ? 24.088  8.052  18.274 1.00 42.64 ? 474  PRO B CA    1 
ATOM   8086  C  C     . PRO B  1  447 ? 23.795  8.136  16.776 1.00 43.25 ? 474  PRO B C     1 
ATOM   8087  O  O     . PRO B  1  447 ? 23.034  7.317  16.247 1.00 44.70 ? 474  PRO B O     1 
ATOM   8088  C  CB    . PRO B  1  447 ? 25.199  7.018  18.512 1.00 43.12 ? 474  PRO B CB    1 
ATOM   8089  C  CG    . PRO B  1  447 ? 24.761  6.221  19.676 1.00 43.75 ? 474  PRO B CG    1 
ATOM   8090  C  CD    . PRO B  1  447 ? 23.272  6.231  19.680 1.00 44.09 ? 474  PRO B CD    1 
ATOM   8091  N  N     . TYR B  1  448 ? 24.386  9.119  16.101 1.00 42.39 ? 475  TYR B N     1 
ATOM   8092  C  CA    . TYR B  1  448 ? 24.309  9.185  14.639 1.00 42.89 ? 475  TYR B CA    1 
ATOM   8093  C  C     . TYR B  1  448 ? 25.237  8.143  14.038 1.00 43.98 ? 475  TYR B C     1 
ATOM   8094  O  O     . TYR B  1  448 ? 26.363  7.965  14.509 1.00 43.24 ? 475  TYR B O     1 
ATOM   8095  C  CB    . TYR B  1  448 ? 24.667  10.581 14.123 1.00 41.72 ? 475  TYR B CB    1 
ATOM   8096  C  CG    . TYR B  1  448 ? 23.575  11.609 14.311 1.00 40.49 ? 475  TYR B CG    1 
ATOM   8097  C  CD1   . TYR B  1  448 ? 22.325  11.439 13.721 1.00 40.85 ? 475  TYR B CD1   1 
ATOM   8098  C  CD2   . TYR B  1  448 ? 23.799  12.761 15.063 1.00 38.99 ? 475  TYR B CD2   1 
ATOM   8099  C  CE1   . TYR B  1  448 ? 21.320  12.379 13.882 1.00 40.36 ? 475  TYR B CE1   1 
ATOM   8100  C  CE2   . TYR B  1  448 ? 22.792  13.713 15.235 1.00 37.95 ? 475  TYR B CE2   1 
ATOM   8101  C  CZ    . TYR B  1  448 ? 21.560  13.515 14.636 1.00 38.76 ? 475  TYR B CZ    1 
ATOM   8102  O  OH    . TYR B  1  448 ? 20.564  14.444 14.793 1.00 37.83 ? 475  TYR B OH    1 
ATOM   8103  N  N     . THR B  1  449 ? 24.750  7.452  13.009 1.00 45.71 ? 476  THR B N     1 
ATOM   8104  C  CA    . THR B  1  449 ? 25.493  6.361  12.374 1.00 47.36 ? 476  THR B CA    1 
ATOM   8105  C  C     . THR B  1  449 ? 26.263  6.815  11.131 1.00 47.67 ? 476  THR B C     1 
ATOM   8106  O  O     . THR B  1  449 ? 27.057  6.049  10.572 1.00 48.87 ? 476  THR B O     1 
ATOM   8107  C  CB    . THR B  1  449 ? 24.570  5.160  12.011 1.00 49.22 ? 476  THR B CB    1 
ATOM   8108  O  OG1   . THR B  1  449 ? 23.446  5.621  11.251 1.00 50.13 ? 476  THR B OG1   1 
ATOM   8109  C  CG2   . THR B  1  449 ? 24.072  4.459  13.263 1.00 49.43 ? 476  THR B CG2   1 
ATOM   8110  N  N     . SER B  1  450 ? 26.021  8.053  10.703 1.00 46.76 ? 477  SER B N     1 
ATOM   8111  C  CA    . SER B  1  450 ? 26.707  8.644  9.550  1.00 47.03 ? 477  SER B CA    1 
ATOM   8112  C  C     . SER B  1  450 ? 26.544  10.157 9.553  1.00 45.59 ? 477  SER B C     1 
ATOM   8113  O  O     . SER B  1  450 ? 25.647  10.693 10.212 1.00 44.90 ? 477  SER B O     1 
ATOM   8114  C  CB    . SER B  1  450 ? 26.158  8.077  8.234  1.00 48.70 ? 477  SER B CB    1 
ATOM   8115  O  OG    . SER B  1  450 ? 24.866  8.594  7.965  1.00 49.26 ? 477  SER B OG    1 
ATOM   8116  N  N     . PHE B  1  451 ? 27.405  10.840 8.801  1.00 45.38 ? 478  PHE B N     1 
ATOM   8117  C  CA    . PHE B  1  451 ? 27.318  12.290 8.651  1.00 44.28 ? 478  PHE B CA    1 
ATOM   8118  C  C     . PHE B  1  451 ? 26.045  12.710 7.920  1.00 44.68 ? 478  PHE B C     1 
ATOM   8119  O  O     . PHE B  1  451 ? 25.438  13.721 8.270  1.00 43.77 ? 478  PHE B O     1 
ATOM   8120  C  CB    . PHE B  1  451 ? 28.567  12.843 7.956  1.00 44.07 ? 478  PHE B CB    1 
ATOM   8121  C  CG    . PHE B  1  451 ? 29.810  12.734 8.785  1.00 43.79 ? 478  PHE B CG    1 
ATOM   8122  C  CD1   . PHE B  1  451 ? 30.076  13.664 9.788  1.00 42.39 ? 478  PHE B CD1   1 
ATOM   8123  C  CD2   . PHE B  1  451 ? 30.703  11.686 8.588  1.00 45.13 ? 478  PHE B CD2   1 
ATOM   8124  C  CE1   . PHE B  1  451 ? 31.220  13.560 10.565 1.00 41.89 ? 478  PHE B CE1   1 
ATOM   8125  C  CE2   . PHE B  1  451 ? 31.851  11.573 9.368  1.00 44.11 ? 478  PHE B CE2   1 
ATOM   8126  C  CZ    . PHE B  1  451 ? 32.111  12.510 10.352 1.00 42.96 ? 478  PHE B CZ    1 
ATOM   8127  N  N     . GLU B  1  452 ? 25.648  11.924 6.919  1.00 46.44 ? 479  GLU B N     1 
ATOM   8128  C  CA    . GLU B  1  452 ? 24.396  12.143 6.187  1.00 47.29 ? 479  GLU B CA    1 
ATOM   8129  C  C     . GLU B  1  452 ? 23.170  12.100 7.101  1.00 47.04 ? 479  GLU B C     1 
ATOM   8130  O  O     . GLU B  1  452 ? 22.224  12.863 6.905  1.00 46.83 ? 479  GLU B O     1 
ATOM   8131  C  CB    . GLU B  1  452 ? 24.230  11.122 5.056  1.00 49.24 ? 479  GLU B CB    1 
ATOM   8132  C  CG    . GLU B  1  452 ? 25.091  11.377 3.828  1.00 49.82 ? 479  GLU B CG    1 
ATOM   8133  C  CD    . GLU B  1  452 ? 24.691  10.519 2.636  1.00 52.25 ? 479  GLU B CD    1 
ATOM   8134  O  OE1   . GLU B  1  452 ? 23.963  9.519  2.819  1.00 53.32 ? 479  GLU B OE1   1 
ATOM   8135  O  OE2   . GLU B  1  452 ? 25.108  10.845 1.507  1.00 52.95 ? 479  GLU B OE2   1 
ATOM   8136  N  N     . GLU B  1  453 ? 23.187  11.204 8.088  1.00 46.78 ? 480  GLU B N     1 
ATOM   8137  C  CA    . GLU B  1  453 ? 22.098  11.120 9.058  1.00 46.86 ? 480  GLU B CA    1 
ATOM   8138  C  C     . GLU B  1  453 ? 22.054  12.375 9.936  1.00 44.58 ? 480  GLU B C     1 
ATOM   8139  O  O     . GLU B  1  453 ? 20.978  12.870 10.265 1.00 44.33 ? 480  GLU B O     1 
ATOM   8140  C  CB    . GLU B  1  453 ? 22.211  9.858  9.912  1.00 47.50 ? 480  GLU B CB    1 
ATOM   8141  C  CG    . GLU B  1  453 ? 20.928  9.533  10.682 1.00 49.81 ? 480  GLU B CG    1 
ATOM   8142  C  CD    . GLU B  1  453 ? 21.125  8.531  11.822 1.00 52.28 ? 480  GLU B CD    1 
ATOM   8143  O  OE1   . GLU B  1  453 ? 22.240  7.980  11.987 1.00 52.66 ? 480  GLU B OE1   1 
ATOM   8144  O  OE2   . GLU B  1  453 ? 20.145  8.296  12.560 1.00 53.19 ? 480  GLU B OE2   1 
ATOM   8145  N  N     . LEU B  1  454 ? 23.227  12.890 10.293 1.00 43.31 ? 481  LEU B N     1 
ATOM   8146  C  CA    . LEU B  1  454 ? 23.334  14.141 11.049 1.00 41.51 ? 481  LEU B CA    1 
ATOM   8147  C  C     . LEU B  1  454 ? 22.744  15.349 10.307 1.00 41.40 ? 481  LEU B C     1 
ATOM   8148  O  O     . LEU B  1  454 ? 21.925  16.083 10.867 1.00 40.70 ? 481  LEU B O     1 
ATOM   8149  C  CB    . LEU B  1  454 ? 24.796  14.415 11.442 1.00 40.44 ? 481  LEU B CB    1 
ATOM   8150  C  CG    . LEU B  1  454 ? 25.212  15.816 11.923 1.00 38.93 ? 481  LEU B CG    1 
ATOM   8151  C  CD1   . LEU B  1  454 ? 24.469  16.236 13.188 1.00 38.32 ? 481  LEU B CD1   1 
ATOM   8152  C  CD2   . LEU B  1  454 ? 26.712  15.871 12.160 1.00 37.45 ? 481  LEU B CD2   1 
ATOM   8153  N  N     . THR B  1  455 ? 23.160  15.546 9.057  1.00 42.07 ? 482  THR B N     1 
ATOM   8154  C  CA    . THR B  1  455 ? 22.807  16.756 8.299  1.00 41.87 ? 482  THR B CA    1 
ATOM   8155  C  C     . THR B  1  455 ? 21.493  16.650 7.519  1.00 43.46 ? 482  THR B C     1 
ATOM   8156  O  O     . THR B  1  455 ? 20.864  17.668 7.208  1.00 43.17 ? 482  THR B O     1 
ATOM   8157  C  CB    . THR B  1  455 ? 23.922  17.145 7.305  1.00 42.31 ? 482  THR B CB    1 
ATOM   8158  O  OG1   . THR B  1  455 ? 24.020  16.147 6.279  1.00 43.22 ? 482  THR B OG1   1 
ATOM   8159  C  CG2   . THR B  1  455 ? 25.267  17.283 8.022  1.00 40.38 ? 482  THR B CG2   1 
ATOM   8160  N  N     . GLY B  1  456 ? 21.094  15.422 7.186  1.00 45.03 ? 483  GLY B N     1 
ATOM   8161  C  CA    . GLY B  1  456 ? 19.896  15.195 6.377  1.00 46.88 ? 483  GLY B CA    1 
ATOM   8162  C  C     . GLY B  1  456 ? 20.075  15.599 4.922  1.00 48.28 ? 483  GLY B C     1 
ATOM   8163  O  O     . GLY B  1  456 ? 19.099  15.739 4.183  1.00 49.57 ? 483  GLY B O     1 
ATOM   8164  N  N     . GLU B  1  457 ? 21.327  15.792 4.517  1.00 48.01 ? 484  GLU B N     1 
ATOM   8165  C  CA    . GLU B  1  457 ? 21.670  16.117 3.131  1.00 49.68 ? 484  GLU B CA    1 
ATOM   8166  C  C     . GLU B  1  457 ? 22.987  15.433 2.757  1.00 50.21 ? 484  GLU B C     1 
ATOM   8167  O  O     . GLU B  1  457 ? 23.531  14.653 3.551  1.00 49.49 ? 484  GLU B O     1 
ATOM   8168  C  CB    . GLU B  1  457 ? 21.729  17.639 2.919  1.00 48.89 ? 484  GLU B CB    1 
ATOM   8169  C  CG    . GLU B  1  457 ? 22.607  18.399 3.912  1.00 47.00 ? 484  GLU B CG    1 
ATOM   8170  C  CD    . GLU B  1  457 ? 24.078  18.375 3.525  1.00 47.63 ? 484  GLU B CD    1 
ATOM   8171  O  OE1   . GLU B  1  457 ? 24.475  19.173 2.653  1.00 49.11 ? 484  GLU B OE1   1 
ATOM   8172  O  OE2   . GLU B  1  457 ? 24.840  17.562 4.090  1.00 46.94 ? 484  GLU B OE2   1 
ATOM   8173  N  N     . LYS B  1  458 ? 23.506  15.731 1.567  1.00 51.54 ? 485  LYS B N     1 
ATOM   8174  C  CA    . LYS B  1  458 ? 24.676  15.021 1.047  1.00 52.52 ? 485  LYS B CA    1 
ATOM   8175  C  C     . LYS B  1  458 ? 25.971  15.838 1.021  1.00 51.54 ? 485  LYS B C     1 
ATOM   8176  O  O     . LYS B  1  458 ? 27.050  15.304 1.294  1.00 51.18 ? 485  LYS B O     1 
ATOM   8177  C  CB    . LYS B  1  458 ? 24.379  14.469 -0.349 1.00 55.18 ? 485  LYS B CB    1 
ATOM   8178  C  CG    . LYS B  1  458 ? 23.208  13.494 -0.401 1.00 57.35 ? 485  LYS B CG    1 
ATOM   8179  C  CD    . LYS B  1  458 ? 22.868  13.141 -1.840 1.00 61.77 ? 485  LYS B CD    1 
ATOM   8180  C  CE    . LYS B  1  458 ? 21.806  12.050 -1.923 1.00 64.67 ? 485  LYS B CE    1 
ATOM   8181  N  NZ    . LYS B  1  458 ? 22.260  10.768 -1.312 1.00 65.41 ? 485  LYS B NZ    1 
ATOM   8182  N  N     . GLU B  1  459 ? 25.860  17.124 0.697  1.00 51.32 ? 486  GLU B N     1 
ATOM   8183  C  CA    . GLU B  1  459 ? 27.030  17.960 0.415  1.00 51.20 ? 486  GLU B CA    1 
ATOM   8184  C  C     . GLU B  1  459 ? 27.875  18.295 1.652  1.00 49.04 ? 486  GLU B C     1 
ATOM   8185  O  O     . GLU B  1  459 ? 29.091  18.087 1.647  1.00 49.08 ? 486  GLU B O     1 
ATOM   8186  C  CB    . GLU B  1  459 ? 26.609  19.233 -0.327 1.00 52.08 ? 486  GLU B CB    1 
ATOM   8187  C  CG    . GLU B  1  459 ? 27.762  20.132 -0.741 1.00 53.19 ? 486  GLU B CG    1 
ATOM   8188  C  CD    . GLU B  1  459 ? 27.297  21.346 -1.523 1.00 55.16 ? 486  GLU B CD    1 
ATOM   8189  O  OE1   . GLU B  1  459 ? 27.570  22.482 -1.083 1.00 54.58 ? 486  GLU B OE1   1 
ATOM   8190  O  OE2   . GLU B  1  459 ? 26.652  21.163 -2.576 1.00 57.88 ? 486  GLU B OE2   1 
ATOM   8191  N  N     . MET B  1  460 ? 27.240  18.816 2.701  1.00 47.17 ? 487  MET B N     1 
ATOM   8192  C  CA    . MET B  1  460 ? 27.956  19.125 3.940  1.00 45.38 ? 487  MET B CA    1 
ATOM   8193  C  C     . MET B  1  460 ? 28.459  17.842 4.595  1.00 44.87 ? 487  MET B C     1 
ATOM   8194  O  O     . MET B  1  460 ? 29.574  17.799 5.118  1.00 44.19 ? 487  MET B O     1 
ATOM   8195  C  CB    . MET B  1  460 ? 27.082  19.914 4.919  1.00 43.95 ? 487  MET B CB    1 
ATOM   8196  C  CG    . MET B  1  460 ? 26.832  21.358 4.520  1.00 45.00 ? 487  MET B CG    1 
ATOM   8197  S  SD    . MET B  1  460 ? 25.928  22.254 5.800  1.00 45.98 ? 487  MET B SD    1 
ATOM   8198  C  CE    . MET B  1  460 ? 24.320  21.456 5.691  1.00 46.18 ? 487  MET B CE    1 
ATOM   8199  N  N     . ALA B  1  461 ? 27.636  16.798 4.544  1.00 45.16 ? 488  ALA B N     1 
ATOM   8200  C  CA    . ALA B  1  461 ? 27.997  15.505 5.106  1.00 45.02 ? 488  ALA B CA    1 
ATOM   8201  C  C     . ALA B  1  461 ? 29.306  14.989 4.512  1.00 45.88 ? 488  ALA B C     1 
ATOM   8202  O  O     . ALA B  1  461 ? 30.195  14.546 5.249  1.00 45.16 ? 488  ALA B O     1 
ATOM   8203  C  CB    . ALA B  1  461 ? 26.878  14.509 4.895  1.00 46.08 ? 488  ALA B CB    1 
ATOM   8204  N  N     . ALA B  1  462 ? 29.421  15.070 3.185  1.00 47.28 ? 489  ALA B N     1 
ATOM   8205  C  CA    . ALA B  1  462 ? 30.622  14.646 2.468  1.00 48.38 ? 489  ALA B CA    1 
ATOM   8206  C  C     . ALA B  1  462 ? 31.856  15.446 2.876  1.00 47.43 ? 489  ALA B C     1 
ATOM   8207  O  O     . ALA B  1  462 ? 32.943  14.882 3.003  1.00 47.75 ? 489  ALA B O     1 
ATOM   8208  C  CB    . ALA B  1  462 ? 30.402  14.723 0.956  1.00 50.49 ? 489  ALA B CB    1 
ATOM   8209  N  N     . GLU B  1  463 ? 31.681  16.752 3.085  1.00 46.51 ? 490  GLU B N     1 
ATOM   8210  C  CA    . GLU B  1  463 ? 32.750  17.616 3.596  1.00 46.02 ? 490  GLU B CA    1 
ATOM   8211  C  C     . GLU B  1  463 ? 33.218  17.184 4.985  1.00 44.34 ? 490  GLU B C     1 
ATOM   8212  O  O     . GLU B  1  463 ? 34.413  17.138 5.252  1.00 44.24 ? 490  GLU B O     1 
ATOM   8213  C  CB    . GLU B  1  463 ? 32.291  19.077 3.664  1.00 45.58 ? 490  GLU B CB    1 
ATOM   8214  C  CG    . GLU B  1  463 ? 31.977  19.719 2.320  1.00 48.97 ? 490  GLU B CG    1 
ATOM   8215  C  CD    . GLU B  1  463 ? 33.203  20.294 1.635  1.00 52.74 ? 490  GLU B CD    1 
ATOM   8216  O  OE1   . GLU B  1  463 ? 34.251  19.613 1.584  1.00 54.49 ? 490  GLU B OE1   1 
ATOM   8217  O  OE2   . GLU B  1  463 ? 33.113  21.432 1.128  1.00 54.97 ? 490  GLU B OE2   1 
ATOM   8218  N  N     . LEU B  1  464 ? 32.264  16.872 5.855  1.00 43.15 ? 491  LEU B N     1 
ATOM   8219  C  CA    . LEU B  1  464 ? 32.552  16.485 7.236  1.00 42.05 ? 491  LEU B CA    1 
ATOM   8220  C  C     . LEU B  1  464 ? 33.201  15.102 7.315  1.00 43.08 ? 491  LEU B C     1 
ATOM   8221  O  O     . LEU B  1  464 ? 34.078  14.874 8.147  1.00 42.93 ? 491  LEU B O     1 
ATOM   8222  C  CB    . LEU B  1  464 ? 31.274  16.536 8.081  1.00 40.84 ? 491  LEU B CB    1 
ATOM   8223  C  CG    . LEU B  1  464 ? 30.662  17.921 8.337  1.00 39.77 ? 491  LEU B CG    1 
ATOM   8224  C  CD1   . LEU B  1  464 ? 29.212  17.794 8.761  1.00 39.26 ? 491  LEU B CD1   1 
ATOM   8225  C  CD2   . LEU B  1  464 ? 31.461  18.708 9.381  1.00 38.10 ? 491  LEU B CD2   1 
ATOM   8226  N  N     . LYS B  1  465 ? 32.773  14.196 6.437  1.00 44.44 ? 492  LYS B N     1 
ATOM   8227  C  CA    . LYS B  1  465 ? 33.358  12.864 6.326  1.00 45.67 ? 492  LYS B CA    1 
ATOM   8228  C  C     . LYS B  1  465 ? 34.833  12.969 5.943  1.00 46.36 ? 492  LYS B C     1 
ATOM   8229  O  O     . LYS B  1  465 ? 35.678  12.257 6.493  1.00 46.63 ? 492  LYS B O     1 
ATOM   8230  C  CB    . LYS B  1  465 ? 32.579  12.026 5.298  1.00 47.48 ? 492  LYS B CB    1 
ATOM   8231  C  CG    . LYS B  1  465 ? 33.123  10.610 5.026  1.00 49.23 ? 492  LYS B CG    1 
ATOM   8232  C  CD    . LYS B  1  465 ? 32.910  9.676  6.204  1.00 49.21 ? 492  LYS B CD    1 
ATOM   8233  C  CE    . LYS B  1  465 ? 33.305  8.242  5.855  1.00 51.81 ? 492  LYS B CE    1 
ATOM   8234  N  NZ    . LYS B  1  465 ? 33.117  7.344  7.032  1.00 51.43 ? 492  LYS B NZ    1 
ATOM   8235  N  N     . ALA B  1  466 ? 35.130  13.870 5.008  1.00 46.38 ? 493  ALA B N     1 
ATOM   8236  C  CA    . ALA B  1  466 ? 36.502  14.128 4.583  1.00 46.92 ? 493  ALA B CA    1 
ATOM   8237  C  C     . ALA B  1  466 ? 37.326  14.766 5.703  1.00 45.59 ? 493  ALA B C     1 
ATOM   8238  O  O     . ALA B  1  466 ? 38.524  14.518 5.807  1.00 46.20 ? 493  ALA B O     1 
ATOM   8239  C  CB    . ALA B  1  466 ? 36.516  15.011 3.348  1.00 47.53 ? 493  ALA B CB    1 
ATOM   8240  N  N     . LEU B  1  467 ? 36.686  15.590 6.531  1.00 43.76 ? 494  LEU B N     1 
ATOM   8241  C  CA    . LEU B  1  467 ? 37.389  16.256 7.627  1.00 42.48 ? 494  LEU B CA    1 
ATOM   8242  C  C     . LEU B  1  467 ? 37.575  15.379 8.874  1.00 41.87 ? 494  LEU B C     1 
ATOM   8243  O  O     . LEU B  1  467 ? 38.650  15.391 9.472  1.00 42.23 ? 494  LEU B O     1 
ATOM   8244  C  CB    . LEU B  1  467 ? 36.706  17.580 7.998  1.00 41.00 ? 494  LEU B CB    1 
ATOM   8245  C  CG    . LEU B  1  467 ? 36.713  18.721 6.968  1.00 41.96 ? 494  LEU B CG    1 
ATOM   8246  C  CD1   . LEU B  1  467 ? 35.703  19.798 7.355  1.00 39.96 ? 494  LEU B CD1   1 
ATOM   8247  C  CD2   . LEU B  1  467 ? 38.108  19.326 6.766  1.00 42.57 ? 494  LEU B CD2   1 
ATOM   8248  N  N     . TYR B  1  468 ? 36.544  14.618 9.250  1.00 41.19 ? 495  TYR B N     1 
ATOM   8249  C  CA    . TYR B  1  468 ? 36.540  13.856 10.510 1.00 40.85 ? 495  TYR B CA    1 
ATOM   8250  C  C     . TYR B  1  468 ? 36.730  12.339 10.404 1.00 42.61 ? 495  TYR B C     1 
ATOM   8251  O  O     . TYR B  1  468 ? 37.081  11.696 11.396 1.00 42.62 ? 495  TYR B O     1 
ATOM   8252  C  CB    . TYR B  1  468 ? 35.251  14.119 11.290 1.00 39.18 ? 495  TYR B CB    1 
ATOM   8253  C  CG    . TYR B  1  468 ? 35.126  15.501 11.891 1.00 36.81 ? 495  TYR B CG    1 
ATOM   8254  C  CD1   . TYR B  1  468 ? 35.536  15.756 13.201 1.00 35.28 ? 495  TYR B CD1   1 
ATOM   8255  C  CD2   . TYR B  1  468 ? 34.561  16.548 11.161 1.00 35.24 ? 495  TYR B CD2   1 
ATOM   8256  C  CE1   . TYR B  1  468 ? 35.400  17.036 13.765 1.00 33.13 ? 495  TYR B CE1   1 
ATOM   8257  C  CE2   . TYR B  1  468 ? 34.433  17.817 11.703 1.00 33.47 ? 495  TYR B CE2   1 
ATOM   8258  C  CZ    . TYR B  1  468 ? 34.847  18.056 13.006 1.00 32.72 ? 495  TYR B CZ    1 
ATOM   8259  O  OH    . TYR B  1  468 ? 34.702  19.319 13.536 1.00 31.55 ? 495  TYR B OH    1 
ATOM   8260  N  N     . SER B  1  469 ? 36.460  11.777 9.224  1.00 44.42 ? 496  SER B N     1 
ATOM   8261  C  CA    . SER B  1  469 ? 36.562  10.326 8.938  1.00 46.80 ? 496  SER B CA    1 
ATOM   8262  C  C     . SER B  1  469 ? 35.491  9.470  9.618  1.00 46.83 ? 496  SER B C     1 
ATOM   8263  O  O     . SER B  1  469 ? 34.797  8.699  8.955  1.00 48.16 ? 496  SER B O     1 
ATOM   8264  C  CB    . SER B  1  469 ? 37.961  9.766  9.248  1.00 47.62 ? 496  SER B CB    1 
ATOM   8265  O  OG    . SER B  1  469 ? 38.958  10.499 8.564  1.00 49.25 ? 496  SER B OG    1 
ATOM   8266  N  N     . ASP B  1  470 ? 35.370  9.605  10.934 1.00 45.74 ? 497  ASP B N     1 
ATOM   8267  C  CA    . ASP B  1  470 ? 34.461  8.780  11.715 1.00 45.96 ? 497  ASP B CA    1 
ATOM   8268  C  C     . ASP B  1  470 ? 33.413  9.665  12.390 1.00 44.33 ? 497  ASP B C     1 
ATOM   8269  O  O     . ASP B  1  470 ? 33.756  10.648 13.061 1.00 43.04 ? 497  ASP B O     1 
ATOM   8270  C  CB    . ASP B  1  470 ? 35.261  7.978  12.748 1.00 46.58 ? 497  ASP B CB    1 
ATOM   8271  C  CG    . ASP B  1  470 ? 34.417  6.973  13.519 1.00 47.52 ? 497  ASP B CG    1 
ATOM   8272  O  OD1   . ASP B  1  470 ? 33.171  7.025  13.460 1.00 48.23 ? 497  ASP B OD1   1 
ATOM   8273  O  OD2   . ASP B  1  470 ? 35.016  6.126  14.209 1.00 49.80 ? 497  ASP B OD2   1 
ATOM   8274  N  N     . ILE B  1  471 ? 32.140  9.303  12.211 1.00 44.26 ? 498  ILE B N     1 
ATOM   8275  C  CA    . ILE B  1  471 ? 31.010  10.022 12.826 1.00 42.65 ? 498  ILE B CA    1 
ATOM   8276  C  C     . ILE B  1  471 ? 31.129  10.109 14.356 1.00 41.50 ? 498  ILE B C     1 
ATOM   8277  O  O     . ILE B  1  471 ? 30.633  11.051 14.978 1.00 40.11 ? 498  ILE B O     1 
ATOM   8278  C  CB    . ILE B  1  471 ? 29.631  9.402  12.408 1.00 43.34 ? 498  ILE B CB    1 
ATOM   8279  C  CG1   . ILE B  1  471 ? 28.453  10.213 12.965 1.00 42.05 ? 498  ILE B CG1   1 
ATOM   8280  C  CG2   . ILE B  1  471 ? 29.525  7.932  12.823 1.00 44.97 ? 498  ILE B CG2   1 
ATOM   8281  C  CD1   . ILE B  1  471 ? 28.391  11.663 12.482 1.00 40.08 ? 498  ILE B CD1   1 
ATOM   8282  N  N     . ASP B  1  472 ? 31.814  9.132  14.944 1.00 41.99 ? 499  ASP B N     1 
ATOM   8283  C  CA    . ASP B  1  472 ? 31.963  9.047  16.391 1.00 41.34 ? 499  ASP B CA    1 
ATOM   8284  C  C     . ASP B  1  472 ? 32.981  10.022 16.987 1.00 39.82 ? 499  ASP B C     1 
ATOM   8285  O  O     . ASP B  1  472 ? 33.099  10.112 18.203 1.00 39.33 ? 499  ASP B O     1 
ATOM   8286  C  CB    . ASP B  1  472 ? 32.274  7.606  16.810 1.00 42.96 ? 499  ASP B CB    1 
ATOM   8287  C  CG    . ASP B  1  472 ? 31.034  6.724  16.842 1.00 44.34 ? 499  ASP B CG    1 
ATOM   8288  O  OD1   . ASP B  1  472 ? 29.903  7.257  16.849 1.00 44.47 ? 499  ASP B OD1   1 
ATOM   8289  O  OD2   . ASP B  1  472 ? 31.193  5.490  16.867 1.00 46.03 ? 499  ASP B OD2   1 
ATOM   8290  N  N     . VAL B  1  473 ? 33.696  10.760 16.140 1.00 39.19 ? 500  VAL B N     1 
ATOM   8291  C  CA    . VAL B  1  473 ? 34.576  11.834 16.622 1.00 37.87 ? 500  VAL B CA    1 
ATOM   8292  C  C     . VAL B  1  473 ? 34.114  13.225 16.175 1.00 36.48 ? 500  VAL B C     1 
ATOM   8293  O  O     . VAL B  1  473 ? 34.845  14.208 16.326 1.00 35.74 ? 500  VAL B O     1 
ATOM   8294  C  CB    . VAL B  1  473 ? 36.075  11.608 16.252 1.00 38.89 ? 500  VAL B CB    1 
ATOM   8295  C  CG1   . VAL B  1  473 ? 36.561  10.275 16.782 1.00 40.23 ? 500  VAL B CG1   1 
ATOM   8296  C  CG2   . VAL B  1  473 ? 36.306  11.723 14.750 1.00 39.51 ? 500  VAL B CG2   1 
ATOM   8297  N  N     . MET B  1  474 ? 32.907  13.303 15.619 1.00 36.11 ? 501  MET B N     1 
ATOM   8298  C  CA    . MET B  1  474 ? 32.319  14.588 15.268 1.00 35.14 ? 501  MET B CA    1 
ATOM   8299  C  C     . MET B  1  474 ? 32.132  15.407 16.550 1.00 33.84 ? 501  MET B C     1 
ATOM   8300  O  O     . MET B  1  474 ? 31.700  14.869 17.571 1.00 33.86 ? 501  MET B O     1 
ATOM   8301  C  CB    . MET B  1  474 ? 30.989  14.392 14.525 1.00 35.40 ? 501  MET B CB    1 
ATOM   8302  C  CG    . MET B  1  474 ? 30.275  15.693 14.144 1.00 34.58 ? 501  MET B CG    1 
ATOM   8303  S  SD    . MET B  1  474 ? 31.289  16.769 13.105 1.00 35.85 ? 501  MET B SD    1 
ATOM   8304  C  CE    . MET B  1  474 ? 30.265  18.238 12.999 1.00 32.80 ? 501  MET B CE    1 
ATOM   8305  N  N     . GLU B  1  475 ? 32.489  16.690 16.500 1.00 33.00 ? 502  GLU B N     1 
ATOM   8306  C  CA    . GLU B  1  475 ? 32.409  17.566 17.673 1.00 31.85 ? 502  GLU B CA    1 
ATOM   8307  C  C     . GLU B  1  475 ? 31.000  18.111 17.887 1.00 31.26 ? 502  GLU B C     1 
ATOM   8308  O  O     . GLU B  1  475 ? 30.243  18.273 16.926 1.00 31.23 ? 502  GLU B O     1 
ATOM   8309  C  CB    . GLU B  1  475 ? 33.390  18.727 17.542 1.00 31.75 ? 502  GLU B CB    1 
ATOM   8310  C  CG    . GLU B  1  475 ? 34.837  18.310 17.473 1.00 32.31 ? 502  GLU B CG    1 
ATOM   8311  C  CD    . GLU B  1  475 ? 35.743  19.468 17.151 1.00 32.54 ? 502  GLU B CD    1 
ATOM   8312  O  OE1   . GLU B  1  475 ? 35.877  19.816 15.951 1.00 33.10 ? 502  GLU B OE1   1 
ATOM   8313  O  OE2   . GLU B  1  475 ? 36.318  20.030 18.103 1.00 31.06 ? 502  GLU B OE2   1 
ATOM   8314  N  N     . LEU B  1  476 ? 30.671  18.417 19.145 1.00 30.36 ? 503  LEU B N     1 
ATOM   8315  C  CA    . LEU B  1  476 ? 29.333  18.859 19.534 1.00 29.91 ? 503  LEU B CA    1 
ATOM   8316  C  C     . LEU B  1  476 ? 28.911  20.194 18.911 1.00 29.61 ? 503  LEU B C     1 
ATOM   8317  O  O     . LEU B  1  476 ? 27.836  20.286 18.326 1.00 29.30 ? 503  LEU B O     1 
ATOM   8318  C  CB    . LEU B  1  476 ? 29.216  18.926 21.067 1.00 29.61 ? 503  LEU B CB    1 
ATOM   8319  C  CG    . LEU B  1  476 ? 27.952  19.524 21.705 1.00 29.37 ? 503  LEU B CG    1 
ATOM   8320  C  CD1   . LEU B  1  476 ? 26.689  18.709 21.379 1.00 29.29 ? 503  LEU B CD1   1 
ATOM   8321  C  CD2   . LEU B  1  476 ? 28.130  19.664 23.218 1.00 28.24 ? 503  LEU B CD2   1 
ATOM   8322  N  N     . TYR B  1  477 ? 29.748  21.223 19.046 1.00 29.40 ? 504  TYR B N     1 
ATOM   8323  C  CA    . TYR B  1  477 ? 29.365  22.573 18.630 1.00 29.78 ? 504  TYR B CA    1 
ATOM   8324  C  C     . TYR B  1  477 ? 29.116  22.731 17.110 1.00 30.23 ? 504  TYR B C     1 
ATOM   8325  O  O     . TYR B  1  477 ? 28.048  23.208 16.709 1.00 29.96 ? 504  TYR B O     1 
ATOM   8326  C  CB    . TYR B  1  477 ? 30.357  23.632 19.136 1.00 29.69 ? 504  TYR B CB    1 
ATOM   8327  C  CG    . TYR B  1  477 ? 30.107  24.980 18.511 1.00 31.88 ? 504  TYR B CG    1 
ATOM   8328  C  CD1   . TYR B  1  477 ? 29.051  25.780 18.946 1.00 33.30 ? 504  TYR B CD1   1 
ATOM   8329  C  CD2   . TYR B  1  477 ? 30.905  25.447 17.460 1.00 33.85 ? 504  TYR B CD2   1 
ATOM   8330  C  CE1   . TYR B  1  477 ? 28.804  27.020 18.365 1.00 35.14 ? 504  TYR B CE1   1 
ATOM   8331  C  CE2   . TYR B  1  477 ? 30.663  26.683 16.874 1.00 35.66 ? 504  TYR B CE2   1 
ATOM   8332  C  CZ    . TYR B  1  477 ? 29.612  27.462 17.338 1.00 36.93 ? 504  TYR B CZ    1 
ATOM   8333  O  OH    . TYR B  1  477 ? 29.361  28.691 16.770 1.00 41.24 ? 504  TYR B OH    1 
ATOM   8334  N  N     . PRO B  1  478 ? 30.097  22.344 16.261 1.00 30.87 ? 505  PRO B N     1 
ATOM   8335  C  CA    . PRO B  1  478 ? 29.799  22.437 14.830 1.00 31.41 ? 505  PRO B CA    1 
ATOM   8336  C  C     . PRO B  1  478 ? 28.618  21.548 14.439 1.00 31.62 ? 505  PRO B C     1 
ATOM   8337  O  O     . PRO B  1  478 ? 27.844  21.922 13.559 1.00 32.66 ? 505  PRO B O     1 
ATOM   8338  C  CB    . PRO B  1  478 ? 31.100  21.965 14.155 1.00 31.82 ? 505  PRO B CB    1 
ATOM   8339  C  CG    . PRO B  1  478 ? 31.831  21.222 15.183 1.00 31.73 ? 505  PRO B CG    1 
ATOM   8340  C  CD    . PRO B  1  478 ? 31.461  21.836 16.501 1.00 31.03 ? 505  PRO B CD    1 
ATOM   8341  N  N     . ALA B  1  479 ? 28.454  20.408 15.107 1.00 31.23 ? 506  ALA B N     1 
ATOM   8342  C  CA    . ALA B  1  479 ? 27.311  19.523 14.828 1.00 31.66 ? 506  ALA B CA    1 
ATOM   8343  C  C     . ALA B  1  479 ? 25.956  20.210 15.052 1.00 31.20 ? 506  ALA B C     1 
ATOM   8344  O  O     . ALA B  1  479 ? 25.036  20.041 14.255 1.00 31.69 ? 506  ALA B O     1 
ATOM   8345  C  CB    . ALA B  1  479 ? 27.409  18.234 15.625 1.00 31.54 ? 506  ALA B CB    1 
ATOM   8346  N  N     . LEU B  1  480 ? 25.841  20.994 16.123 1.00 30.26 ? 507  LEU B N     1 
ATOM   8347  C  CA    . LEU B  1  480 ? 24.591  21.715 16.416 1.00 30.15 ? 507  LEU B CA    1 
ATOM   8348  C  C     . LEU B  1  480 ? 24.214  22.720 15.322 1.00 30.44 ? 507  LEU B C     1 
ATOM   8349  O  O     . LEU B  1  480 ? 23.033  22.943 15.043 1.00 30.65 ? 507  LEU B O     1 
ATOM   8350  C  CB    . LEU B  1  480 ? 24.684  22.435 17.764 1.00 29.46 ? 507  LEU B CB    1 
ATOM   8351  C  CG    . LEU B  1  480 ? 24.859  21.566 19.014 1.00 29.88 ? 507  LEU B CG    1 
ATOM   8352  C  CD1   . LEU B  1  480 ? 25.399  22.412 20.163 1.00 29.89 ? 507  LEU B CD1   1 
ATOM   8353  C  CD2   . LEU B  1  480 ? 23.561  20.875 19.402 1.00 30.21 ? 507  LEU B CD2   1 
ATOM   8354  N  N     . LEU B  1  481 ? 25.224  23.314 14.697 1.00 30.43 ? 508  LEU B N     1 
ATOM   8355  C  CA    . LEU B  1  481 ? 24.990  24.328 13.675 1.00 31.20 ? 508  LEU B CA    1 
ATOM   8356  C  C     . LEU B  1  481 ? 24.750  23.756 12.277 1.00 32.13 ? 508  LEU B C     1 
ATOM   8357  O  O     . LEU B  1  481 ? 24.246  24.461 11.411 1.00 33.06 ? 508  LEU B O     1 
ATOM   8358  C  CB    . LEU B  1  481 ? 26.132  25.353 13.658 1.00 30.91 ? 508  LEU B CB    1 
ATOM   8359  C  CG    . LEU B  1  481 ? 26.402  26.159 14.935 1.00 31.28 ? 508  LEU B CG    1 
ATOM   8360  C  CD1   . LEU B  1  481 ? 27.325  27.346 14.627 1.00 30.80 ? 508  LEU B CD1   1 
ATOM   8361  C  CD2   . LEU B  1  481 ? 25.115  26.644 15.588 1.00 30.35 ? 508  LEU B CD2   1 
ATOM   8362  N  N     . VAL B  1  482 ? 25.105  22.487 12.065 1.00 32.65 ? 509  VAL B N     1 
ATOM   8363  C  CA    . VAL B  1  482 ? 24.913  21.824 10.763 1.00 33.96 ? 509  VAL B CA    1 
ATOM   8364  C  C     . VAL B  1  482 ? 23.819  20.754 10.809 1.00 34.56 ? 509  VAL B C     1 
ATOM   8365  O  O     . VAL B  1  482 ? 23.456  20.183 9.772  1.00 35.90 ? 509  VAL B O     1 
ATOM   8366  C  CB    . VAL B  1  482 ? 26.235  21.189 10.209 1.00 34.43 ? 509  VAL B CB    1 
ATOM   8367  C  CG1   . VAL B  1  482 ? 27.350  22.217 10.132 1.00 34.33 ? 509  VAL B CG1   1 
ATOM   8368  C  CG2   . VAL B  1  482 ? 26.670  19.984 11.053 1.00 34.27 ? 509  VAL B CG2   1 
ATOM   8369  N  N     . GLU B  1  483 ? 23.305  20.483 12.009 1.00 33.61 ? 510  GLU B N     1 
ATOM   8370  C  CA    . GLU B  1  483 ? 22.344  19.396 12.224 1.00 34.20 ? 510  GLU B CA    1 
ATOM   8371  C  C     . GLU B  1  483 ? 21.059  19.598 11.427 1.00 35.31 ? 510  GLU B C     1 
ATOM   8372  O  O     . GLU B  1  483 ? 20.575  20.725 11.294 1.00 34.71 ? 510  GLU B O     1 
ATOM   8373  C  CB    . GLU B  1  483 ? 22.014  19.255 13.718 1.00 33.27 ? 510  GLU B CB    1 
ATOM   8374  C  CG    . GLU B  1  483 ? 21.025  18.135 14.044 1.00 33.86 ? 510  GLU B CG    1 
ATOM   8375  C  CD    . GLU B  1  483 ? 20.847  17.895 15.538 1.00 33.15 ? 510  GLU B CD    1 
ATOM   8376  O  OE1   . GLU B  1  483 ? 20.724  18.880 16.306 1.00 32.18 ? 510  GLU B OE1   1 
ATOM   8377  O  OE2   . GLU B  1  483 ? 20.812  16.712 15.936 1.00 31.98 ? 510  GLU B OE2   1 
ATOM   8378  N  N     . LYS B  1  484 ? 20.522  18.501 10.899 1.00 36.98 ? 511  LYS B N     1 
ATOM   8379  C  CA    . LYS B  1  484 ? 19.216  18.514 10.255 1.00 38.71 ? 511  LYS B CA    1 
ATOM   8380  C  C     . LYS B  1  484 ? 18.188  19.106 11.220 1.00 38.20 ? 511  LYS B C     1 
ATOM   8381  O  O     . LYS B  1  484 ? 17.942  18.542 12.287 1.00 38.13 ? 511  LYS B O     1 
ATOM   8382  C  CB    . LYS B  1  484 ? 18.798  17.101 9.827  1.00 40.31 ? 511  LYS B CB    1 
ATOM   8383  C  CG    . LYS B  1  484 ? 17.510  17.063 8.993  1.00 43.18 ? 511  LYS B CG    1 
ATOM   8384  C  CD    . LYS B  1  484 ? 16.999  15.646 8.763  1.00 47.23 ? 511  LYS B CD    1 
ATOM   8385  C  CE    . LYS B  1  484 ? 16.508  15.007 10.059 1.00 48.91 ? 511  LYS B CE    1 
ATOM   8386  N  NZ    . LYS B  1  484 ? 16.143  13.572 9.870  1.00 52.05 ? 511  LYS B NZ    1 
ATOM   8387  N  N     . PRO B  1  485 ? 17.600  20.258 10.860 1.00 38.38 ? 512  PRO B N     1 
ATOM   8388  C  CA    . PRO B  1  485 ? 16.600  20.868 11.728 1.00 38.09 ? 512  PRO B CA    1 
ATOM   8389  C  C     . PRO B  1  485 ? 15.296  20.075 11.701 1.00 39.54 ? 512  PRO B C     1 
ATOM   8390  O  O     . PRO B  1  485 ? 15.028  19.376 10.727 1.00 41.25 ? 512  PRO B O     1 
ATOM   8391  C  CB    . PRO B  1  485 ? 16.377  22.254 11.103 1.00 38.41 ? 512  PRO B CB    1 
ATOM   8392  C  CG    . PRO B  1  485 ? 17.414  22.401 10.019 1.00 38.74 ? 512  PRO B CG    1 
ATOM   8393  C  CD    . PRO B  1  485 ? 17.770  21.013 9.607  1.00 39.30 ? 512  PRO B CD    1 
ATOM   8394  N  N     . ARG B  1  486 ? 14.500  20.180 12.765 1.00 39.29 ? 513  ARG B N     1 
ATOM   8395  C  CA    . ARG B  1  486 ? 13.124  19.674 12.758 1.00 40.64 ? 513  ARG B CA    1 
ATOM   8396  C  C     . ARG B  1  486 ? 12.359  20.379 11.646 1.00 41.91 ? 513  ARG B C     1 
ATOM   8397  O  O     . ARG B  1  486 ? 12.800  21.440 11.199 1.00 41.59 ? 513  ARG B O     1 
ATOM   8398  C  CB    . ARG B  1  486 ? 12.456  19.918 14.115 1.00 40.01 ? 513  ARG B CB    1 
ATOM   8399  C  CG    . ARG B  1  486 ? 12.460  18.717 15.036 1.00 39.89 ? 513  ARG B CG    1 
ATOM   8400  C  CD    . ARG B  1  486 ? 13.834  18.430 15.630 1.00 38.32 ? 513  ARG B CD    1 
ATOM   8401  N  NE    . ARG B  1  486 ? 13.769  17.324 16.582 1.00 38.24 ? 513  ARG B NE    1 
ATOM   8402  C  CZ    . ARG B  1  486 ? 13.480  17.457 17.874 1.00 38.03 ? 513  ARG B CZ    1 
ATOM   8403  N  NH1   . ARG B  1  486 ? 13.237  18.659 18.392 1.00 36.33 ? 513  ARG B NH1   1 
ATOM   8404  N  NH2   . ARG B  1  486 ? 13.440  16.383 18.651 1.00 38.26 ? 513  ARG B NH2   1 
ATOM   8405  N  N     . PRO B  1  487 ? 11.223  19.802 11.184 1.00 43.83 ? 514  PRO B N     1 
ATOM   8406  C  CA    . PRO B  1  487 ? 10.545  20.376 10.009 1.00 45.42 ? 514  PRO B CA    1 
ATOM   8407  C  C     . PRO B  1  487 ? 10.168  21.843 10.200 1.00 44.68 ? 514  PRO B C     1 
ATOM   8408  O  O     . PRO B  1  487 ? 9.401   22.168 11.105 1.00 44.95 ? 514  PRO B O     1 
ATOM   8409  C  CB    . PRO B  1  487 ? 9.286   19.506 9.862  1.00 47.47 ? 514  PRO B CB    1 
ATOM   8410  C  CG    . PRO B  1  487 ? 9.622   18.236 10.539 1.00 47.14 ? 514  PRO B CG    1 
ATOM   8411  C  CD    . PRO B  1  487 ? 10.506  18.616 11.691 1.00 44.91 ? 514  PRO B CD    1 
ATOM   8412  N  N     . ASP B  1  488 ? 10.728  22.709 9.354  1.00 44.37 ? 515  ASP B N     1 
ATOM   8413  C  CA    . ASP B  1  488 ? 10.515  24.165 9.406  1.00 43.78 ? 515  ASP B CA    1 
ATOM   8414  C  C     . ASP B  1  488 ? 10.917  24.798 10.746 1.00 41.55 ? 515  ASP B C     1 
ATOM   8415  O  O     . ASP B  1  488 ? 10.410  25.859 11.114 1.00 41.11 ? 515  ASP B O     1 
ATOM   8416  C  CB    . ASP B  1  488 ? 9.065   24.523 9.063  1.00 45.77 ? 515  ASP B CB    1 
ATOM   8417  C  CG    . ASP B  1  488 ? 8.663   24.080 7.668  1.00 49.00 ? 515  ASP B CG    1 
ATOM   8418  O  OD1   . ASP B  1  488 ? 9.466   24.229 6.718  1.00 49.87 ? 515  ASP B OD1   1 
ATOM   8419  O  OD2   . ASP B  1  488 ? 7.528   23.588 7.519  1.00 51.65 ? 515  ASP B OD2   1 
ATOM   8420  N  N     . ALA B  1  489 ? 11.836  24.149 11.458 1.00 39.81 ? 516  ALA B N     1 
ATOM   8421  C  CA    . ALA B  1  489 ? 12.261  24.611 12.777 1.00 38.18 ? 516  ALA B CA    1 
ATOM   8422  C  C     . ALA B  1  489 ? 13.644  25.259 12.769 1.00 36.85 ? 516  ALA B C     1 
ATOM   8423  O  O     . ALA B  1  489 ? 14.440  25.061 11.853 1.00 36.97 ? 516  ALA B O     1 
ATOM   8424  C  CB    . ALA B  1  489 ? 12.217  23.470 13.781 1.00 37.57 ? 516  ALA B CB    1 
ATOM   8425  N  N     . ILE B  1  490 ? 13.916  26.032 13.812 1.00 35.68 ? 517  ILE B N     1 
ATOM   8426  C  CA    . ILE B  1  490 ? 15.192  26.718 13.962 1.00 34.65 ? 517  ILE B CA    1 
ATOM   8427  C  C     . ILE B  1  490 ? 16.319  25.767 14.417 1.00 33.88 ? 517  ILE B C     1 
ATOM   8428  O  O     . ILE B  1  490 ? 17.483  25.983 14.077 1.00 33.42 ? 517  ILE B O     1 
ATOM   8429  C  CB    . ILE B  1  490 ? 15.050  27.952 14.906 1.00 33.99 ? 517  ILE B CB    1 
ATOM   8430  C  CG1   . ILE B  1  490 ? 16.220  28.928 14.728 1.00 33.72 ? 517  ILE B CG1   1 
ATOM   8431  C  CG2   . ILE B  1  490 ? 14.839  27.525 16.366 1.00 32.53 ? 517  ILE B CG2   1 
ATOM   8432  C  CD1   . ILE B  1  490 ? 16.096  30.184 15.562 1.00 33.21 ? 517  ILE B CD1   1 
ATOM   8433  N  N     . PHE B  1  491 ? 15.959  24.710 15.152 1.00 33.86 ? 518  PHE B N     1 
ATOM   8434  C  CA    . PHE B  1  491 ? 16.930  23.798 15.757 1.00 33.51 ? 518  PHE B CA    1 
ATOM   8435  C  C     . PHE B  1  491 ? 16.709  22.356 15.333 1.00 34.41 ? 518  PHE B C     1 
ATOM   8436  O  O     . PHE B  1  491 ? 15.601  21.972 14.960 1.00 35.77 ? 518  PHE B O     1 
ATOM   8437  C  CB    . PHE B  1  491 ? 16.828  23.821 17.294 1.00 32.46 ? 518  PHE B CB    1 
ATOM   8438  C  CG    . PHE B  1  491 ? 17.115  25.149 17.922 1.00 32.29 ? 518  PHE B CG    1 
ATOM   8439  C  CD1   . PHE B  1  491 ? 16.319  25.608 18.976 1.00 33.16 ? 518  PHE B CD1   1 
ATOM   8440  C  CD2   . PHE B  1  491 ? 18.182  25.932 17.496 1.00 31.61 ? 518  PHE B CD2   1 
ATOM   8441  C  CE1   . PHE B  1  491 ? 16.573  26.832 19.584 1.00 32.65 ? 518  PHE B CE1   1 
ATOM   8442  C  CE2   . PHE B  1  491 ? 18.442  27.165 18.099 1.00 31.86 ? 518  PHE B CE2   1 
ATOM   8443  C  CZ    . PHE B  1  491 ? 17.638  27.615 19.144 1.00 32.27 ? 518  PHE B CZ    1 
ATOM   8444  N  N     . GLY B  1  492 ? 17.773  21.562 15.422 1.00 34.15 ? 519  GLY B N     1 
ATOM   8445  C  CA    . GLY B  1  492 ? 17.673  20.110 15.350 1.00 34.94 ? 519  GLY B CA    1 
ATOM   8446  C  C     . GLY B  1  492 ? 17.488  19.490 16.729 1.00 34.68 ? 519  GLY B C     1 
ATOM   8447  O  O     . GLY B  1  492 ? 17.466  20.195 17.742 1.00 33.22 ? 519  GLY B O     1 
ATOM   8448  N  N     . GLU B  1  493 ? 17.374  18.162 16.749 1.00 35.79 ? 520  GLU B N     1 
ATOM   8449  C  CA    . GLU B  1  493 ? 17.099  17.367 17.952 1.00 35.96 ? 520  GLU B CA    1 
ATOM   8450  C  C     . GLU B  1  493 ? 18.106  17.561 19.094 1.00 34.72 ? 520  GLU B C     1 
ATOM   8451  O  O     . GLU B  1  493 ? 17.709  17.686 20.257 1.00 34.54 ? 520  GLU B O     1 
ATOM   8452  C  CB    . GLU B  1  493 ? 17.033  15.880 17.571 1.00 37.42 ? 520  GLU B CB    1 
ATOM   8453  C  CG    . GLU B  1  493 ? 16.659  14.927 18.709 1.00 38.55 ? 520  GLU B CG    1 
ATOM   8454  C  CD    . GLU B  1  493 ? 17.112  13.494 18.449 1.00 41.20 ? 520  GLU B CD    1 
ATOM   8455  O  OE1   . GLU B  1  493 ? 17.928  13.275 17.523 1.00 41.68 ? 520  GLU B OE1   1 
ATOM   8456  O  OE2   . GLU B  1  493 ? 16.658  12.582 19.177 1.00 43.19 ? 520  GLU B OE2   1 
ATOM   8457  N  N     . THR B  1  494 ? 19.397  17.570 18.760 1.00 33.85 ? 521  THR B N     1 
ATOM   8458  C  CA    . THR B  1  494 ? 20.455  17.643 19.768 1.00 32.67 ? 521  THR B CA    1 
ATOM   8459  C  C     . THR B  1  494 ? 20.394  18.950 20.556 1.00 31.75 ? 521  THR B C     1 
ATOM   8460  O  O     . THR B  1  494 ? 20.561  18.942 21.775 1.00 31.11 ? 521  THR B O     1 
ATOM   8461  C  CB    . THR B  1  494 ? 21.869  17.440 19.154 1.00 32.26 ? 521  THR B CB    1 
ATOM   8462  O  OG1   . THR B  1  494 ? 21.874  16.280 18.310 1.00 33.42 ? 521  THR B OG1   1 
ATOM   8463  C  CG2   . THR B  1  494 ? 22.916  17.254 20.247 1.00 31.94 ? 521  THR B CG2   1 
ATOM   8464  N  N     . MET B  1  495 ? 20.154  20.064 19.858 1.00 31.53 ? 522  MET B N     1 
ATOM   8465  C  CA    . MET B  1  495 ? 20.056  21.377 20.507 1.00 30.84 ? 522  MET B CA    1 
ATOM   8466  C  C     . MET B  1  495 ? 18.952  21.391 21.559 1.00 31.05 ? 522  MET B C     1 
ATOM   8467  O  O     . MET B  1  495 ? 19.165  21.837 22.692 1.00 30.11 ? 522  MET B O     1 
ATOM   8468  C  CB    . MET B  1  495 ? 19.798  22.486 19.479 1.00 30.99 ? 522  MET B CB    1 
ATOM   8469  C  CG    . MET B  1  495 ? 19.830  23.906 20.069 1.00 30.38 ? 522  MET B CG    1 
ATOM   8470  S  SD    . MET B  1  495 ? 21.493  24.448 20.517 1.00 30.64 ? 522  MET B SD    1 
ATOM   8471  C  CE    . MET B  1  495 ? 22.124  24.966 18.924 1.00 29.14 ? 522  MET B CE    1 
ATOM   8472  N  N     . VAL B  1  496 ? 17.775  20.908 21.166 1.00 32.00 ? 523  VAL B N     1 
ATOM   8473  C  CA    . VAL B  1  496 ? 16.603  20.911 22.034 1.00 32.48 ? 523  VAL B CA    1 
ATOM   8474  C  C     . VAL B  1  496 ? 16.800  19.961 23.210 1.00 32.54 ? 523  VAL B C     1 
ATOM   8475  O  O     . VAL B  1  496 ? 16.541  20.326 24.357 1.00 32.33 ? 523  VAL B O     1 
ATOM   8476  C  CB    . VAL B  1  496 ? 15.312  20.553 21.256 1.00 33.65 ? 523  VAL B CB    1 
ATOM   8477  C  CG1   . VAL B  1  496 ? 14.138  20.339 22.208 1.00 34.05 ? 523  VAL B CG1   1 
ATOM   8478  C  CG2   . VAL B  1  496 ? 14.981  21.644 20.243 1.00 33.97 ? 523  VAL B CG2   1 
ATOM   8479  N  N     . GLU B  1  497 ? 17.274  18.753 22.925 1.00 33.14 ? 524  GLU B N     1 
ATOM   8480  C  CA    . GLU B  1  497 ? 17.361  17.713 23.952 1.00 33.92 ? 524  GLU B CA    1 
ATOM   8481  C  C     . GLU B  1  497 ? 18.455  17.958 24.992 1.00 32.74 ? 524  GLU B C     1 
ATOM   8482  O  O     . GLU B  1  497 ? 18.370  17.463 26.115 1.00 32.82 ? 524  GLU B O     1 
ATOM   8483  C  CB    . GLU B  1  497 ? 17.490  16.326 23.322 1.00 35.34 ? 524  GLU B CB    1 
ATOM   8484  C  CG    . GLU B  1  497 ? 16.211  15.862 22.620 1.00 38.70 ? 524  GLU B CG    1 
ATOM   8485  C  CD    . GLU B  1  497 ? 14.986  15.987 23.504 1.00 41.53 ? 524  GLU B CD    1 
ATOM   8486  O  OE1   . GLU B  1  497 ? 14.990  15.412 24.613 1.00 43.70 ? 524  GLU B OE1   1 
ATOM   8487  O  OE2   . GLU B  1  497 ? 14.020  16.665 23.101 1.00 43.07 ? 524  GLU B OE2   1 
ATOM   8488  N  N     . LEU B  1  498 ? 19.465  18.733 24.616 1.00 31.51 ? 525  LEU B N     1 
ATOM   8489  C  CA    . LEU B  1  498 ? 20.496  19.151 25.553 1.00 31.01 ? 525  LEU B CA    1 
ATOM   8490  C  C     . LEU B  1  498 ? 20.097  20.455 26.228 1.00 30.33 ? 525  LEU B C     1 
ATOM   8491  O  O     . LEU B  1  498 ? 20.248  20.603 27.441 1.00 30.32 ? 525  LEU B O     1 
ATOM   8492  C  CB    . LEU B  1  498 ? 21.853  19.294 24.848 1.00 30.77 ? 525  LEU B CB    1 
ATOM   8493  C  CG    . LEU B  1  498 ? 22.742  18.047 24.809 1.00 31.33 ? 525  LEU B CG    1 
ATOM   8494  C  CD1   . LEU B  1  498 ? 22.131  16.921 23.967 1.00 32.55 ? 525  LEU B CD1   1 
ATOM   8495  C  CD2   . LEU B  1  498 ? 24.120  18.419 24.277 1.00 32.38 ? 525  LEU B CD2   1 
ATOM   8496  N  N     . GLY B  1  499 ? 19.564  21.383 25.435 1.00 30.10 ? 526  GLY B N     1 
ATOM   8497  C  CA    . GLY B  1  499 ? 19.200  22.717 25.908 1.00 29.31 ? 526  GLY B CA    1 
ATOM   8498  C  C     . GLY B  1  499 ? 18.081  22.760 26.932 1.00 29.76 ? 526  GLY B C     1 
ATOM   8499  O  O     . GLY B  1  499 ? 18.176  23.489 27.909 1.00 29.47 ? 526  GLY B O     1 
ATOM   8500  N  N     . ALA B  1  500 ? 17.021  21.982 26.716 1.00 30.21 ? 527  ALA B N     1 
ATOM   8501  C  CA    . ALA B  1  500 ? 15.839  22.044 27.586 1.00 30.56 ? 527  ALA B CA    1 
ATOM   8502  C  C     . ALA B  1  500 ? 16.068  21.641 29.058 1.00 30.42 ? 527  ALA B C     1 
ATOM   8503  O  O     . ALA B  1  500 ? 15.543  22.306 29.948 1.00 30.52 ? 527  ALA B O     1 
ATOM   8504  C  CB    . ALA B  1  500 ? 14.658  21.271 26.975 1.00 31.55 ? 527  ALA B CB    1 
ATOM   8505  N  N     . PRO B  1  501 ? 16.827  20.548 29.321 1.00 30.18 ? 528  PRO B N     1 
ATOM   8506  C  CA    . PRO B  1  501 ? 17.113  20.192 30.717 1.00 29.99 ? 528  PRO B CA    1 
ATOM   8507  C  C     . PRO B  1  501 ? 17.976  21.217 31.466 1.00 28.82 ? 528  PRO B C     1 
ATOM   8508  O  O     . PRO B  1  501 ? 17.746  21.456 32.648 1.00 28.89 ? 528  PRO B O     1 
ATOM   8509  C  CB    . PRO B  1  501 ? 17.861  18.857 30.601 1.00 30.24 ? 528  PRO B CB    1 
ATOM   8510  C  CG    . PRO B  1  501 ? 17.469  18.314 29.297 1.00 31.13 ? 528  PRO B CG    1 
ATOM   8511  C  CD    . PRO B  1  501 ? 17.256  19.482 28.397 1.00 30.33 ? 528  PRO B CD    1 
ATOM   8512  N  N     . PHE B  1  502 ? 18.966  21.798 30.796 1.00 27.80 ? 529  PHE B N     1 
ATOM   8513  C  CA    . PHE B  1  502 ? 19.788  22.840 31.408 1.00 27.45 ? 529  PHE B CA    1 
ATOM   8514  C  C     . PHE B  1  502 ? 18.919  24.071 31.713 1.00 27.77 ? 529  PHE B C     1 
ATOM   8515  O  O     . PHE B  1  502 ? 19.073  24.721 32.758 1.00 27.61 ? 529  PHE B O     1 
ATOM   8516  C  CB    . PHE B  1  502 ? 20.936  23.246 30.474 1.00 26.72 ? 529  PHE B CB    1 
ATOM   8517  C  CG    . PHE B  1  502 ? 22.027  22.210 30.316 1.00 26.13 ? 529  PHE B CG    1 
ATOM   8518  C  CD1   . PHE B  1  502 ? 22.628  21.617 31.426 1.00 26.57 ? 529  PHE B CD1   1 
ATOM   8519  C  CD2   . PHE B  1  502 ? 22.504  21.886 29.048 1.00 25.17 ? 529  PHE B CD2   1 
ATOM   8520  C  CE1   . PHE B  1  502 ? 23.657  20.678 31.270 1.00 26.86 ? 529  PHE B CE1   1 
ATOM   8521  C  CE2   . PHE B  1  502 ? 23.536  20.957 28.874 1.00 26.25 ? 529  PHE B CE2   1 
ATOM   8522  C  CZ    . PHE B  1  502 ? 24.114  20.345 29.995 1.00 25.73 ? 529  PHE B CZ    1 
ATOM   8523  N  N     . SER B  1  503 ? 18.007  24.361 30.783 1.00 27.97 ? 530  SER B N     1 
ATOM   8524  C  CA    A SER B  1  503 ? 17.135  25.525 30.861 0.50 28.54 ? 530  SER B CA    1 
ATOM   8525  C  CA    B SER B  1  503 ? 17.128  25.526 30.864 0.50 28.64 ? 530  SER B CA    1 
ATOM   8526  C  C     . SER B  1  503 ? 16.160  25.466 32.034 1.00 29.61 ? 530  SER B C     1 
ATOM   8527  O  O     . SER B  1  503 ? 16.120  26.369 32.866 1.00 29.70 ? 530  SER B O     1 
ATOM   8528  C  CB    A SER B  1  503 ? 16.361  25.690 29.555 0.50 28.49 ? 530  SER B CB    1 
ATOM   8529  C  CB    B SER B  1  503 ? 16.329  25.687 29.572 0.50 28.61 ? 530  SER B CB    1 
ATOM   8530  O  OG    A SER B  1  503 ? 15.376  26.696 29.676 0.50 28.92 ? 530  SER B OG    1 
ATOM   8531  O  OG    B SER B  1  503 ? 17.190  25.850 28.466 0.50 28.51 ? 530  SER B OG    1 
ATOM   8532  N  N     . LEU B  1  504 ? 15.371  24.400 32.091 1.00 30.73 ? 531  LEU B N     1 
ATOM   8533  C  CA    . LEU B  1  504 ? 14.336  24.297 33.105 0.88 32.23 ? 531  LEU B CA    1 
ATOM   8534  C  C     . LEU B  1  504 ? 14.933  24.183 34.511 1.00 32.52 ? 531  LEU B C     1 
ATOM   8535  O  O     . LEU B  1  504 ? 14.350  24.651 35.489 1.00 32.94 ? 531  LEU B O     1 
ATOM   8536  C  CB    . LEU B  1  504 ? 13.368  23.160 32.767 0.88 33.45 ? 531  LEU B CB    1 
ATOM   8537  C  CG    . LEU B  1  504 ? 12.602  23.288 31.431 0.88 35.02 ? 531  LEU B CG    1 
ATOM   8538  C  CD1   . LEU B  1  504 ? 11.830  22.012 31.134 0.88 37.52 ? 531  LEU B CD1   1 
ATOM   8539  C  CD2   . LEU B  1  504 ? 11.649  24.497 31.381 0.88 36.51 ? 531  LEU B CD2   1 
ATOM   8540  N  N     . LYS B  1  505 ? 16.124  23.604 34.586 1.00 32.09 ? 532  LYS B N     1 
ATOM   8541  C  CA    . LYS B  1  505 ? 16.880  23.537 35.821 1.00 32.42 ? 532  LYS B CA    1 
ATOM   8542  C  C     . LYS B  1  505 ? 17.281  24.931 36.312 1.00 32.10 ? 532  LYS B C     1 
ATOM   8543  O  O     . LYS B  1  505 ? 17.130  25.242 37.491 1.00 33.04 ? 532  LYS B O     1 
ATOM   8544  C  CB    . LYS B  1  505 ? 18.107  22.645 35.612 1.00 32.09 ? 532  LYS B CB    1 
ATOM   8545  C  CG    . LYS B  1  505 ? 18.857  22.282 36.862 1.00 33.07 ? 532  LYS B CG    1 
ATOM   8546  C  CD    . LYS B  1  505 ? 18.052  21.415 37.818 1.00 32.64 ? 532  LYS B CD    1 
ATOM   8547  C  CE    . LYS B  1  505 ? 18.832  21.304 39.104 1.00 32.05 ? 532  LYS B CE    1 
ATOM   8548  N  NZ    . LYS B  1  505 ? 18.061  20.777 40.235 1.00 33.49 ? 532  LYS B NZ    1 
ATOM   8549  N  N     . GLY B  1  506 ? 17.773  25.776 35.407 1.00 30.94 ? 533  GLY B N     1 
ATOM   8550  C  CA    . GLY B  1  506 ? 18.122  27.154 35.767 1.00 30.01 ? 533  GLY B CA    1 
ATOM   8551  C  C     . GLY B  1  506 ? 16.919  28.019 36.107 1.00 30.19 ? 533  GLY B C     1 
ATOM   8552  O  O     . GLY B  1  506 ? 17.014  28.954 36.906 1.00 30.71 ? 533  GLY B O     1 
ATOM   8553  N  N     . LEU B  1  507 ? 15.777  27.704 35.506 1.00 28.75 ? 534  LEU B N     1 
ATOM   8554  C  CA    . LEU B  1  507 ? 14.573  28.499 35.710 1.00 27.72 ? 534  LEU B CA    1 
ATOM   8555  C  C     . LEU B  1  507 ? 13.821  28.094 36.989 1.00 27.85 ? 534  LEU B C     1 
ATOM   8556  O  O     . LEU B  1  507 ? 13.559  28.937 37.857 1.00 27.03 ? 534  LEU B O     1 
ATOM   8557  C  CB    . LEU B  1  507 ? 13.672  28.435 34.466 1.00 27.78 ? 534  LEU B CB    1 
ATOM   8558  C  CG    . LEU B  1  507 ? 14.283  29.051 33.201 1.00 26.95 ? 534  LEU B CG    1 
ATOM   8559  C  CD1   . LEU B  1  507 ? 13.613  28.555 31.917 1.00 25.52 ? 534  LEU B CD1   1 
ATOM   8560  C  CD2   . LEU B  1  507 ? 14.269  30.576 33.270 1.00 25.49 ? 534  LEU B CD2   1 
ATOM   8561  N  N     . MET B  1  508 ? 13.493  26.806 37.093 1.00 28.60 ? 535  MET B N     1 
ATOM   8562  C  CA    . MET B  1  508 ? 12.743  26.256 38.226 1.00 29.06 ? 535  MET B CA    1 
ATOM   8563  C  C     . MET B  1  508 ? 13.621  26.033 39.462 1.00 28.72 ? 535  MET B C     1 
ATOM   8564  O  O     . MET B  1  508 ? 13.115  25.993 40.585 1.00 28.47 ? 535  MET B O     1 
ATOM   8565  C  CB    . MET B  1  508 ? 12.043  24.938 37.842 1.00 29.97 ? 535  MET B CB    1 
ATOM   8566  C  CG    . MET B  1  508 ? 11.098  25.035 36.640 1.00 31.48 ? 535  MET B CG    1 
ATOM   8567  S  SD    . MET B  1  508 ? 9.907   26.397 36.759 1.00 32.46 ? 535  MET B SD    1 
ATOM   8568  C  CE    . MET B  1  508 ? 8.818   25.805 38.060 1.00 30.85 ? 535  MET B CE    1 
ATOM   8569  N  N     . GLY B  1  509 ? 14.926  25.878 39.243 1.00 28.54 ? 536  GLY B N     1 
ATOM   8570  C  CA    . GLY B  1  509 ? 15.894  25.723 40.329 1.00 28.47 ? 536  GLY B CA    1 
ATOM   8571  C  C     . GLY B  1  509 ? 16.101  26.970 41.169 1.00 27.69 ? 536  GLY B C     1 
ATOM   8572  O  O     . GLY B  1  509 ? 16.644  26.894 42.264 1.00 28.23 ? 536  GLY B O     1 
ATOM   8573  N  N     . ASN B  1  510 ? 15.666  28.120 40.663 1.00 27.17 ? 537  ASN B N     1 
ATOM   8574  C  CA    . ASN B  1  510 ? 15.776  29.389 41.394 1.00 26.11 ? 537  ASN B CA    1 
ATOM   8575  C  C     . ASN B  1  510 ? 15.054  29.308 42.751 1.00 25.93 ? 537  ASN B C     1 
ATOM   8576  O  O     . ASN B  1  510 ? 13.967  28.725 42.833 1.00 26.42 ? 537  ASN B O     1 
ATOM   8577  C  CB    . ASN B  1  510 ? 15.215  30.525 40.531 1.00 25.30 ? 537  ASN B CB    1 
ATOM   8578  C  CG    . ASN B  1  510 ? 15.639  31.897 41.011 1.00 25.19 ? 537  ASN B CG    1 
ATOM   8579  O  OD1   . ASN B  1  510 ? 15.086  32.423 41.978 1.00 24.99 ? 537  ASN B OD1   1 
ATOM   8580  N  ND2   . ASN B  1  510 ? 16.617  32.500 40.322 1.00 23.70 ? 537  ASN B ND2   1 
ATOM   8581  N  N     . PRO B  1  511 ? 15.663  29.875 43.821 1.00 25.17 ? 538  PRO B N     1 
ATOM   8582  C  CA    . PRO B  1  511 ? 15.058  29.833 45.156 1.00 24.87 ? 538  PRO B CA    1 
ATOM   8583  C  C     . PRO B  1  511 ? 13.657  30.432 45.252 1.00 24.74 ? 538  PRO B C     1 
ATOM   8584  O  O     . PRO B  1  511 ? 12.882  29.989 46.110 1.00 24.82 ? 538  PRO B O     1 
ATOM   8585  C  CB    . PRO B  1  511 ? 16.037  30.632 46.024 1.00 24.87 ? 538  PRO B CB    1 
ATOM   8586  C  CG    . PRO B  1  511 ? 16.878  31.399 45.059 1.00 24.01 ? 538  PRO B CG    1 
ATOM   8587  C  CD    . PRO B  1  511 ? 16.983  30.531 43.854 1.00 24.36 ? 538  PRO B CD    1 
ATOM   8588  N  N     . ILE B  1  512 ? 13.317  31.395 44.388 1.00 24.19 ? 539  ILE B N     1 
ATOM   8589  C  CA    . ILE B  1  512 ? 11.961  31.979 44.416 1.00 24.52 ? 539  ILE B CA    1 
ATOM   8590  C  C     . ILE B  1  512 ? 10.878  30.974 44.019 1.00 24.86 ? 539  ILE B C     1 
ATOM   8591  O  O     . ILE B  1  512 ? 9.690   31.188 44.293 1.00 24.98 ? 539  ILE B O     1 
ATOM   8592  C  CB    . ILE B  1  512 ? 11.807  33.314 43.593 1.00 24.45 ? 539  ILE B CB    1 
ATOM   8593  C  CG1   . ILE B  1  512 ? 11.669  33.044 42.094 1.00 25.49 ? 539  ILE B CG1   1 
ATOM   8594  C  CG2   . ILE B  1  512 ? 12.944  34.311 43.897 1.00 23.85 ? 539  ILE B CG2   1 
ATOM   8595  C  CD1   . ILE B  1  512 ? 10.907  34.136 41.375 1.00 27.14 ? 539  ILE B CD1   1 
ATOM   8596  N  N     . CYS B  1  513 ? 11.293  29.883 43.376 1.00 24.99 ? 540  CYS B N     1 
ATOM   8597  C  CA    . CYS B  1  513 ? 10.367  28.819 42.977 1.00 25.81 ? 540  CYS B CA    1 
ATOM   8598  C  C     . CYS B  1  513 ? 10.120  27.792 44.086 1.00 26.29 ? 540  CYS B C     1 
ATOM   8599  O  O     . CYS B  1  513 ? 9.182   27.002 43.996 1.00 27.47 ? 540  CYS B O     1 
ATOM   8600  C  CB    . CYS B  1  513 ? 10.850  28.125 41.703 1.00 25.93 ? 540  CYS B CB    1 
ATOM   8601  S  SG    . CYS B  1  513 ? 10.904  29.201 40.275 1.00 25.75 ? 540  CYS B SG    1 
ATOM   8602  N  N     . SER B  1  514 ? 10.947  27.817 45.128 1.00 25.88 ? 541  SER B N     1 
ATOM   8603  C  CA    . SER B  1  514 ? 10.798  26.909 46.274 1.00 26.46 ? 541  SER B CA    1 
ATOM   8604  C  C     . SER B  1  514 ? 9.549   27.237 47.101 1.00 26.85 ? 541  SER B C     1 
ATOM   8605  O  O     . SER B  1  514 ? 9.118   28.388 47.118 1.00 26.96 ? 541  SER B O     1 
ATOM   8606  C  CB    . SER B  1  514 ? 12.039  26.953 47.166 1.00 26.16 ? 541  SER B CB    1 
ATOM   8607  O  OG    . SER B  1  514 ? 12.146  28.190 47.854 1.00 25.57 ? 541  SER B OG    1 
ATOM   8608  N  N     . PRO B  1  515 ? 8.970   26.229 47.792 1.00 27.61 ? 542  PRO B N     1 
ATOM   8609  C  CA    . PRO B  1  515 ? 7.727   26.466 48.537 1.00 28.38 ? 542  PRO B CA    1 
ATOM   8610  C  C     . PRO B  1  515 ? 7.791   27.588 49.584 1.00 28.04 ? 542  PRO B C     1 
ATOM   8611  O  O     . PRO B  1  515 ? 6.805   28.303 49.750 1.00 27.59 ? 542  PRO B O     1 
ATOM   8612  C  CB    . PRO B  1  515 ? 7.414   25.103 49.184 1.00 29.44 ? 542  PRO B CB    1 
ATOM   8613  C  CG    . PRO B  1  515 ? 8.592   24.218 48.899 1.00 29.33 ? 542  PRO B CG    1 
ATOM   8614  C  CD    . PRO B  1  515 ? 9.298   24.793 47.718 1.00 28.28 ? 542  PRO B CD    1 
ATOM   8615  N  N     . GLN B  1  516 ? 8.933   27.781 50.248 1.00 27.93 ? 543  GLN B N     1 
ATOM   8616  C  CA    . GLN B  1  516 ? 9.003   28.840 51.274 1.00 28.07 ? 543  GLN B CA    1 
ATOM   8617  C  C     . GLN B  1  516 ? 9.118   30.245 50.699 1.00 26.87 ? 543  GLN B C     1 
ATOM   8618  O  O     . GLN B  1  516 ? 8.867   31.227 51.396 1.00 27.29 ? 543  GLN B O     1 
ATOM   8619  C  CB    . GLN B  1  516 ? 10.093  28.577 52.328 1.00 28.57 ? 543  GLN B CB    1 
ATOM   8620  C  CG    . GLN B  1  516 ? 9.727   27.501 53.374 1.00 31.33 ? 543  GLN B CG    1 
ATOM   8621  C  CD    . GLN B  1  516 ? 8.507   27.856 54.213 1.00 34.91 ? 543  GLN B CD    1 
ATOM   8622  O  OE1   . GLN B  1  516 ? 7.362   27.777 53.748 1.00 37.23 ? 543  GLN B OE1   1 
ATOM   8623  N  NE2   . GLN B  1  516 ? 8.745   28.242 55.461 1.00 35.79 ? 543  GLN B NE2   1 
ATOM   8624  N  N     . TYR B  1  517 ? 9.481   30.347 49.428 1.00 25.84 ? 544  TYR B N     1 
ATOM   8625  C  CA    . TYR B  1  517 ? 9.554   31.637 48.769 1.00 24.97 ? 544  TYR B CA    1 
ATOM   8626  C  C     . TYR B  1  517 ? 8.311   31.937 47.950 1.00 25.26 ? 544  TYR B C     1 
ATOM   8627  O  O     . TYR B  1  517 ? 7.930   33.094 47.817 1.00 25.25 ? 544  TYR B O     1 
ATOM   8628  C  CB    . TYR B  1  517 ? 10.777  31.707 47.847 1.00 24.34 ? 544  TYR B CB    1 
ATOM   8629  C  CG    . TYR B  1  517 ? 12.078  32.118 48.514 1.00 23.69 ? 544  TYR B CG    1 
ATOM   8630  C  CD1   . TYR B  1  517 ? 12.770  31.232 49.339 1.00 23.44 ? 544  TYR B CD1   1 
ATOM   8631  C  CD2   . TYR B  1  517 ? 12.636  33.380 48.284 1.00 23.18 ? 544  TYR B CD2   1 
ATOM   8632  C  CE1   . TYR B  1  517 ? 13.977  31.587 49.937 1.00 23.19 ? 544  TYR B CE1   1 
ATOM   8633  C  CE2   . TYR B  1  517 ? 13.851  33.751 48.879 1.00 23.45 ? 544  TYR B CE2   1 
ATOM   8634  C  CZ    . TYR B  1  517 ? 14.512  32.840 49.704 1.00 23.43 ? 544  TYR B CZ    1 
ATOM   8635  O  OH    . TYR B  1  517 ? 15.699  33.182 50.307 1.00 22.99 ? 544  TYR B OH    1 
ATOM   8636  N  N     . TRP B  1  518 ? 7.687   30.909 47.384 1.00 25.44 ? 545  TRP B N     1 
ATOM   8637  C  CA    . TRP B  1  518 ? 6.614   31.145 46.419 1.00 25.69 ? 545  TRP B CA    1 
ATOM   8638  C  C     . TRP B  1  518 ? 5.300   31.462 47.128 1.00 26.49 ? 545  TRP B C     1 
ATOM   8639  O  O     . TRP B  1  518 ? 4.393   30.630 47.198 1.00 27.73 ? 545  TRP B O     1 
ATOM   8640  C  CB    . TRP B  1  518 ? 6.483   29.973 45.447 1.00 25.77 ? 545  TRP B CB    1 
ATOM   8641  C  CG    . TRP B  1  518 ? 5.564   30.252 44.304 1.00 26.63 ? 545  TRP B CG    1 
ATOM   8642  C  CD1   . TRP B  1  518 ? 4.333   29.690 44.084 1.00 26.66 ? 545  TRP B CD1   1 
ATOM   8643  C  CD2   . TRP B  1  518 ? 5.788   31.165 43.224 1.00 25.71 ? 545  TRP B CD2   1 
ATOM   8644  N  NE1   . TRP B  1  518 ? 3.791   30.183 42.927 1.00 27.60 ? 545  TRP B NE1   1 
ATOM   8645  C  CE2   . TRP B  1  518 ? 4.657   31.093 42.380 1.00 25.88 ? 545  TRP B CE2   1 
ATOM   8646  C  CE3   . TRP B  1  518 ? 6.839   32.036 42.882 1.00 24.92 ? 545  TRP B CE3   1 
ATOM   8647  C  CZ2   . TRP B  1  518 ? 4.537   31.866 41.220 1.00 25.50 ? 545  TRP B CZ2   1 
ATOM   8648  C  CZ3   . TRP B  1  518 ? 6.723   32.796 41.725 1.00 25.14 ? 545  TRP B CZ3   1 
ATOM   8649  C  CH2   . TRP B  1  518 ? 5.578   32.705 40.908 1.00 25.56 ? 545  TRP B CH2   1 
ATOM   8650  N  N     . LYS B  1  519 ? 5.225   32.685 47.652 1.00 26.29 ? 546  LYS B N     1 
ATOM   8651  C  CA    . LYS B  1  519 ? 4.144   33.142 48.529 1.00 27.44 ? 546  LYS B CA    1 
ATOM   8652  C  C     . LYS B  1  519 ? 3.977   34.631 48.279 1.00 26.85 ? 546  LYS B C     1 
ATOM   8653  O  O     . LYS B  1  519 ? 4.969   35.315 48.032 1.00 26.20 ? 546  LYS B O     1 
ATOM   8654  C  CB    . LYS B  1  519 ? 4.530   32.978 50.006 1.00 27.41 ? 546  LYS B CB    1 
ATOM   8655  C  CG    . LYS B  1  519 ? 4.710   31.574 50.501 1.00 28.90 ? 546  LYS B CG    1 
ATOM   8656  C  CD    . LYS B  1  519 ? 5.133   31.582 51.965 1.00 27.79 ? 546  LYS B CD    1 
ATOM   8657  C  CE    . LYS B  1  519 ? 5.172   30.171 52.524 1.00 29.39 ? 546  LYS B CE    1 
ATOM   8658  N  NZ    . LYS B  1  519 ? 5.516   30.167 53.980 1.00 29.71 ? 546  LYS B NZ    1 
ATOM   8659  N  N     . PRO B  1  520 ? 2.736   35.151 48.380 1.00 28.02 ? 547  PRO B N     1 
ATOM   8660  C  CA    . PRO B  1  520 ? 2.516   36.580 48.100 1.00 27.87 ? 547  PRO B CA    1 
ATOM   8661  C  C     . PRO B  1  520 ? 3.386   37.526 48.942 1.00 27.57 ? 547  PRO B C     1 
ATOM   8662  O  O     . PRO B  1  520 ? 3.837   38.549 48.427 1.00 27.34 ? 547  PRO B O     1 
ATOM   8663  C  CB    . PRO B  1  520 ? 1.032   36.791 48.414 1.00 29.45 ? 547  PRO B CB    1 
ATOM   8664  C  CG    . PRO B  1  520 ? 0.401   35.419 48.316 1.00 30.44 ? 547  PRO B CG    1 
ATOM   8665  C  CD    . PRO B  1  520 ? 1.476   34.414 48.621 1.00 29.11 ? 547  PRO B CD    1 
ATOM   8666  N  N     . SER B  1  521 ? 3.634   37.184 50.208 1.00 27.60 ? 548  SER B N     1 
ATOM   8667  C  CA    . SER B  1  521 ? 4.393   38.067 51.111 1.00 27.37 ? 548  SER B CA    1 
ATOM   8668  C  C     . SER B  1  521 ? 5.876   38.260 50.734 1.00 25.88 ? 548  SER B C     1 
ATOM   8669  O  O     . SER B  1  521 ? 6.463   39.299 51.049 1.00 25.36 ? 548  SER B O     1 
ATOM   8670  C  CB    . SER B  1  521 ? 4.270   37.601 52.562 1.00 28.05 ? 548  SER B CB    1 
ATOM   8671  O  OG    . SER B  1  521 ? 4.768   36.283 52.713 1.00 29.69 ? 548  SER B OG    1 
ATOM   8672  N  N     . THR B  1  522 ? 6.459   37.267 50.063 1.00 24.84 ? 549  THR B N     1 
ATOM   8673  C  CA    . THR B  1  522 ? 7.818   37.364 49.501 1.00 23.96 ? 549  THR B CA    1 
ATOM   8674  C  C     . THR B  1  522 ? 7.960   38.548 48.532 1.00 23.84 ? 549  THR B C     1 
ATOM   8675  O  O     . THR B  1  522 ? 9.034   39.138 48.400 1.00 23.32 ? 549  THR B O     1 
ATOM   8676  C  CB    . THR B  1  522 ? 8.198   36.055 48.765 1.00 23.48 ? 549  THR B CB    1 
ATOM   8677  O  OG1   . THR B  1  522 ? 8.046   34.950 49.664 1.00 23.67 ? 549  THR B OG1   1 
ATOM   8678  C  CG2   . THR B  1  522 ? 9.642   36.081 48.249 1.00 21.86 ? 549  THR B CG2   1 
ATOM   8679  N  N     . PHE B  1  523 ? 6.854   38.896 47.884 1.00 24.36 ? 550  PHE B N     1 
ATOM   8680  C  CA    . PHE B  1  523 ? 6.835   39.899 46.822 1.00 24.52 ? 550  PHE B CA    1 
ATOM   8681  C  C     . PHE B  1  523 ? 6.033   41.143 47.216 1.00 25.17 ? 550  PHE B C     1 
ATOM   8682  O  O     . PHE B  1  523 ? 5.610   41.924 46.356 1.00 25.79 ? 550  PHE B O     1 
ATOM   8683  C  CB    . PHE B  1  523 ? 6.287   39.252 45.544 1.00 24.01 ? 550  PHE B CB    1 
ATOM   8684  C  CG    . PHE B  1  523 ? 6.986   37.961 45.184 1.00 24.32 ? 550  PHE B CG    1 
ATOM   8685  C  CD1   . PHE B  1  523 ? 8.297   37.976 44.701 1.00 22.29 ? 550  PHE B CD1   1 
ATOM   8686  C  CD2   . PHE B  1  523 ? 6.347   36.735 45.355 1.00 24.41 ? 550  PHE B CD2   1 
ATOM   8687  C  CE1   . PHE B  1  523 ? 8.956   36.796 44.382 1.00 22.58 ? 550  PHE B CE1   1 
ATOM   8688  C  CE2   . PHE B  1  523 ? 6.997   35.537 45.034 1.00 24.30 ? 550  PHE B CE2   1 
ATOM   8689  C  CZ    . PHE B  1  523 ? 8.303   35.568 44.539 1.00 24.04 ? 550  PHE B CZ    1 
ATOM   8690  N  N     . GLY B  1  524 ? 5.829   41.322 48.521 1.00 25.63 ? 551  GLY B N     1 
ATOM   8691  C  CA    . GLY B  1  524 ? 5.181   42.520 49.051 1.00 26.32 ? 551  GLY B CA    1 
ATOM   8692  C  C     . GLY B  1  524 ? 3.669   42.454 49.060 1.00 27.29 ? 551  GLY B C     1 
ATOM   8693  O  O     . GLY B  1  524 ? 2.997   43.481 49.171 1.00 27.87 ? 551  GLY B O     1 
ATOM   8694  N  N     . GLY B  1  525 ? 3.128   41.244 48.954 1.00 27.66 ? 552  GLY B N     1 
ATOM   8695  C  CA    . GLY B  1  525 ? 1.676   41.055 48.928 1.00 28.91 ? 552  GLY B CA    1 
ATOM   8696  C  C     . GLY B  1  525 ? 1.153   40.647 47.560 1.00 29.23 ? 552  GLY B C     1 
ATOM   8697  O  O     . GLY B  1  525 ? 1.928   40.392 46.626 1.00 27.90 ? 552  GLY B O     1 
ATOM   8698  N  N     . GLU B  1  526 ? -0.170  40.606 47.444 1.00 30.63 ? 553  GLU B N     1 
ATOM   8699  C  CA    . GLU B  1  526 ? -0.847  40.101 46.252 1.00 31.75 ? 553  GLU B CA    1 
ATOM   8700  C  C     . GLU B  1  526 ? -0.589  40.906 44.965 1.00 31.06 ? 553  GLU B C     1 
ATOM   8701  O  O     . GLU B  1  526 ? -0.569  40.336 43.866 1.00 30.56 ? 553  GLU B O     1 
ATOM   8702  C  CB    . GLU B  1  526 ? -2.348  39.979 46.523 1.00 34.17 ? 553  GLU B CB    1 
ATOM   8703  C  CG    . GLU B  1  526 ? -2.986  38.715 45.945 1.00 37.65 ? 553  GLU B CG    1 
ATOM   8704  C  CD    . GLU B  1  526 ? -2.477  37.430 46.598 1.00 39.59 ? 553  GLU B CD    1 
ATOM   8705  O  OE1   . GLU B  1  526 ? -2.573  37.320 47.839 1.00 41.61 ? 553  GLU B OE1   1 
ATOM   8706  O  OE2   . GLU B  1  526 ? -1.992  36.532 45.865 1.00 39.55 ? 553  GLU B OE2   1 
ATOM   8707  N  N     . VAL B  1  527 ? -0.375  42.213 45.094 1.00 30.91 ? 554  VAL B N     1 
ATOM   8708  C  CA    . VAL B  1  527 ? -0.105  43.051 43.924 1.00 30.26 ? 554  VAL B CA    1 
ATOM   8709  C  C     . VAL B  1  527 ? 1.250   42.703 43.304 1.00 29.05 ? 554  VAL B C     1 
ATOM   8710  O  O     . VAL B  1  527 ? 1.345   42.490 42.094 1.00 28.68 ? 554  VAL B O     1 
ATOM   8711  C  CB    . VAL B  1  527 ? -0.205  44.566 44.238 1.00 31.05 ? 554  VAL B CB    1 
ATOM   8712  C  CG1   . VAL B  1  527 ? 0.292   45.406 43.052 1.00 30.02 ? 554  VAL B CG1   1 
ATOM   8713  C  CG2   . VAL B  1  527 ? -1.649  44.941 44.596 1.00 32.42 ? 554  VAL B CG2   1 
ATOM   8714  N  N     . GLY B  1  528 ? 2.288   42.636 44.139 1.00 28.07 ? 555  GLY B N     1 
ATOM   8715  C  CA    . GLY B  1  528 ? 3.625   42.288 43.679 1.00 26.66 ? 555  GLY B CA    1 
ATOM   8716  C  C     . GLY B  1  528 ? 3.684   40.897 43.077 1.00 26.09 ? 555  GLY B C     1 
ATOM   8717  O  O     . GLY B  1  528 ? 4.353   40.675 42.066 1.00 25.42 ? 555  GLY B O     1 
ATOM   8718  N  N     . PHE B  1  529 ? 2.979   39.967 43.711 1.00 26.26 ? 556  PHE B N     1 
ATOM   8719  C  CA    . PHE B  1  529 ? 2.854   38.597 43.229 1.00 26.31 ? 556  PHE B CA    1 
ATOM   8720  C  C     . PHE B  1  529 ? 2.176   38.538 41.856 1.00 26.43 ? 556  PHE B C     1 
ATOM   8721  O  O     . PHE B  1  529 ? 2.604   37.774 40.991 1.00 25.64 ? 556  PHE B O     1 
ATOM   8722  C  CB    . PHE B  1  529 ? 2.064   37.763 44.247 1.00 27.27 ? 556  PHE B CB    1 
ATOM   8723  C  CG    . PHE B  1  529 ? 2.311   36.275 44.163 1.00 27.84 ? 556  PHE B CG    1 
ATOM   8724  C  CD1   . PHE B  1  529 ? 3.553   35.771 43.772 1.00 29.16 ? 556  PHE B CD1   1 
ATOM   8725  C  CD2   . PHE B  1  529 ? 1.313   35.377 44.533 1.00 30.73 ? 556  PHE B CD2   1 
ATOM   8726  C  CE1   . PHE B  1  529 ? 3.791   34.392 43.726 1.00 30.11 ? 556  PHE B CE1   1 
ATOM   8727  C  CE2   . PHE B  1  529 ? 1.533   33.995 44.493 1.00 31.77 ? 556  PHE B CE2   1 
ATOM   8728  C  CZ    . PHE B  1  529 ? 2.777   33.500 44.088 1.00 30.53 ? 556  PHE B CZ    1 
ATOM   8729  N  N     . LYS B  1  530 ? 1.122   39.338 41.664 1.00 27.17 ? 557  LYS B N     1 
ATOM   8730  C  CA    . LYS B  1  530 ? 0.400   39.358 40.388 1.00 28.12 ? 557  LYS B CA    1 
ATOM   8731  C  C     . LYS B  1  530 ? 1.243   39.926 39.226 1.00 27.80 ? 557  LYS B C     1 
ATOM   8732  O  O     . LYS B  1  530 ? 1.047   39.539 38.070 1.00 27.97 ? 557  LYS B O     1 
ATOM   8733  C  CB    . LYS B  1  530 ? -0.953  40.077 40.512 1.00 29.36 ? 557  LYS B CB    1 
ATOM   8734  C  CG    . LYS B  1  530 ? -1.811  39.979 39.243 1.00 30.85 ? 557  LYS B CG    1 
ATOM   8735  C  CD    . LYS B  1  530 ? -3.319  39.963 39.504 1.00 32.32 ? 557  LYS B CD    1 
ATOM   8736  C  CE    . LYS B  1  530 ? -4.072  39.823 38.173 1.00 33.79 ? 557  LYS B CE    1 
ATOM   8737  N  NZ    . LYS B  1  530 ? -5.570  39.911 38.248 1.00 34.68 ? 557  LYS B NZ    1 
ATOM   8738  N  N     . ILE B  1  531 ? 2.164   40.839 39.539 1.00 27.36 ? 558  ILE B N     1 
ATOM   8739  C  CA    . ILE B  1  531 ? 3.107   41.384 38.549 1.00 27.23 ? 558  ILE B CA    1 
ATOM   8740  C  C     . ILE B  1  531 ? 3.934   40.268 37.897 1.00 26.75 ? 558  ILE B C     1 
ATOM   8741  O  O     . ILE B  1  531 ? 4.048   40.213 36.671 1.00 26.86 ? 558  ILE B O     1 
ATOM   8742  C  CB    . ILE B  1  531 ? 4.032   42.480 39.153 1.00 26.90 ? 558  ILE B CB    1 
ATOM   8743  C  CG1   . ILE B  1  531 ? 3.204   43.702 39.595 1.00 27.79 ? 558  ILE B CG1   1 
ATOM   8744  C  CG2   . ILE B  1  531 ? 5.112   42.912 38.134 1.00 26.64 ? 558  ILE B CG2   1 
ATOM   8745  C  CD1   . ILE B  1  531 ? 4.019   44.776 40.328 1.00 28.67 ? 558  ILE B CD1   1 
ATOM   8746  N  N     . ILE B  1  532 ? 4.483   39.374 38.719 1.00 26.51 ? 559  ILE B N     1 
ATOM   8747  C  CA    . ILE B  1  532 ? 5.189   38.187 38.231 1.00 26.36 ? 559  ILE B CA    1 
ATOM   8748  C  C     . ILE B  1  532 ? 4.292   37.313 37.351 1.00 27.49 ? 559  ILE B C     1 
ATOM   8749  O  O     . ILE B  1  532 ? 4.667   36.949 36.234 1.00 27.20 ? 559  ILE B O     1 
ATOM   8750  C  CB    . ILE B  1  532 ? 5.689   37.315 39.407 1.00 26.18 ? 559  ILE B CB    1 
ATOM   8751  C  CG1   . ILE B  1  532 ? 6.809   38.035 40.169 1.00 24.82 ? 559  ILE B CG1   1 
ATOM   8752  C  CG2   . ILE B  1  532 ? 6.148   35.932 38.913 1.00 25.89 ? 559  ILE B CG2   1 
ATOM   8753  C  CD1   . ILE B  1  532 ? 7.189   37.340 41.449 1.00 23.57 ? 559  ILE B CD1   1 
ATOM   8754  N  N     . ASN B  1  533 ? 3.102   36.998 37.866 1.00 28.37 ? 560  ASN B N     1 
ATOM   8755  C  CA    . ASN B  1  533 ? 2.230   36.008 37.260 1.00 29.64 ? 560  ASN B CA    1 
ATOM   8756  C  C     . ASN B  1  533 ? 1.466   36.477 36.029 1.00 30.50 ? 560  ASN B C     1 
ATOM   8757  O  O     . ASN B  1  533 ? 0.760   35.684 35.413 1.00 31.48 ? 560  ASN B O     1 
ATOM   8758  C  CB    . ASN B  1  533 ? 1.269   35.441 38.304 1.00 30.49 ? 560  ASN B CB    1 
ATOM   8759  C  CG    . ASN B  1  533 ? 1.967   34.552 39.301 1.00 31.15 ? 560  ASN B CG    1 
ATOM   8760  O  OD1   . ASN B  1  533 ? 1.933   34.805 40.512 1.00 33.39 ? 560  ASN B OD1   1 
ATOM   8761  N  ND2   . ASN B  1  533 ? 2.630   33.514 38.802 1.00 29.78 ? 560  ASN B ND2   1 
ATOM   8762  N  N     . THR B  1  534 ? 1.625   37.752 35.668 1.00 30.33 ? 561  THR B N     1 
ATOM   8763  C  CA    . THR B  1  534 ? 0.977   38.320 34.477 1.00 30.73 ? 561  THR B CA    1 
ATOM   8764  C  C     . THR B  1  534 ? 1.998   38.975 33.551 1.00 30.04 ? 561  THR B C     1 
ATOM   8765  O  O     . THR B  1  534 ? 1.631   39.671 32.603 1.00 30.52 ? 561  THR B O     1 
ATOM   8766  C  CB    . THR B  1  534 ? -0.059  39.405 34.843 1.00 31.42 ? 561  THR B CB    1 
ATOM   8767  O  OG1   . THR B  1  534 ? 0.593   40.469 35.556 1.00 29.57 ? 561  THR B OG1   1 
ATOM   8768  C  CG2   . THR B  1  534 ? -1.217  38.819 35.667 1.00 31.91 ? 561  THR B CG2   1 
ATOM   8769  N  N     . ALA B  1  535 ? 3.275   38.766 33.844 1.00 28.66 ? 562  ALA B N     1 
ATOM   8770  C  CA    . ALA B  1  535 ? 4.345   39.372 33.069 1.00 28.08 ? 562  ALA B CA    1 
ATOM   8771  C  C     . ALA B  1  535 ? 4.434   38.727 31.683 1.00 28.17 ? 562  ALA B C     1 
ATOM   8772  O  O     . ALA B  1  535 ? 4.177   37.532 31.527 1.00 28.80 ? 562  ALA B O     1 
ATOM   8773  C  CB    . ALA B  1  535 ? 5.679   39.255 33.811 1.00 26.72 ? 562  ALA B CB    1 
ATOM   8774  N  N     . SER B  1  536 ? 4.778   39.530 30.684 1.00 27.81 ? 563  SER B N     1 
ATOM   8775  C  CA    . SER B  1  536 ? 4.959   39.041 29.316 1.00 27.89 ? 563  SER B CA    1 
ATOM   8776  C  C     . SER B  1  536 ? 5.958   39.936 28.612 1.00 27.63 ? 563  SER B C     1 
ATOM   8777  O  O     . SER B  1  536 ? 6.216   41.056 29.065 1.00 27.36 ? 563  SER B O     1 
ATOM   8778  C  CB    . SER B  1  536 ? 3.628   39.025 28.551 1.00 28.92 ? 563  SER B CB    1 
ATOM   8779  O  OG    . SER B  1  536 ? 3.102   40.336 28.376 1.00 28.46 ? 563  SER B OG    1 
ATOM   8780  N  N     . ILE B  1  537 ? 6.529   39.452 27.509 1.00 27.93 ? 564  ILE B N     1 
ATOM   8781  C  CA    . ILE B  1  537 ? 7.403   40.301 26.697 1.00 27.57 ? 564  ILE B CA    1 
ATOM   8782  C  C     . ILE B  1  537 ? 6.662   41.580 26.257 1.00 28.09 ? 564  ILE B C     1 
ATOM   8783  O  O     . ILE B  1  537 ? 7.240   42.672 26.262 1.00 27.54 ? 564  ILE B O     1 
ATOM   8784  C  CB    . ILE B  1  537 ? 8.087   39.535 25.510 1.00 27.72 ? 564  ILE B CB    1 
ATOM   8785  C  CG1   . ILE B  1  537 ? 9.178   40.396 24.853 1.00 27.94 ? 564  ILE B CG1   1 
ATOM   8786  C  CG2   . ILE B  1  537 ? 7.076   39.043 24.474 1.00 28.78 ? 564  ILE B CG2   1 
ATOM   8787  C  CD1   . ILE B  1  537 ? 10.300  40.806 25.796 1.00 25.84 ? 564  ILE B CD1   1 
ATOM   8788  N  N     . GLN B  1  538 ? 5.375   41.446 25.938 1.00 28.69 ? 565  GLN B N     1 
ATOM   8789  C  CA    . GLN B  1  538 ? 4.580   42.594 25.509 1.00 29.86 ? 565  GLN B CA    1 
ATOM   8790  C  C     . GLN B  1  538 ? 4.344   43.616 26.630 1.00 29.49 ? 565  GLN B C     1 
ATOM   8791  O  O     . GLN B  1  538 ? 4.468   44.823 26.397 1.00 29.31 ? 565  GLN B O     1 
ATOM   8792  C  CB    . GLN B  1  538 ? 3.249   42.148 24.876 1.00 31.11 ? 565  GLN B CB    1 
ATOM   8793  C  CG    . GLN B  1  538 ? 2.326   43.281 24.480 1.00 33.48 ? 565  GLN B CG    1 
ATOM   8794  C  CD    . GLN B  1  538 ? 2.821   44.117 23.286 1.00 35.67 ? 565  GLN B CD    1 
ATOM   8795  O  OE1   . GLN B  1  538 ? 2.336   43.948 22.155 1.00 38.62 ? 565  GLN B OE1   1 
ATOM   8796  N  NE2   . GLN B  1  538 ? 3.754   45.042 23.541 1.00 31.83 ? 565  GLN B NE2   1 
ATOM   8797  N  N     . SER B  1  539 ? 4.000   43.134 27.829 1.00 28.85 ? 566  SER B N     1 
ATOM   8798  C  CA    . SER B  1  539 ? 3.792   44.018 28.976 1.00 29.03 ? 566  SER B CA    1 
ATOM   8799  C  C     . SER B  1  539 ? 5.087   44.738 29.385 1.00 28.19 ? 566  SER B C     1 
ATOM   8800  O  O     . SER B  1  539 ? 5.068   45.935 29.682 1.00 28.46 ? 566  SER B O     1 
ATOM   8801  C  CB    . SER B  1  539 ? 3.162   43.270 30.166 1.00 28.98 ? 566  SER B CB    1 
ATOM   8802  O  OG    . SER B  1  539 ? 4.085   42.386 30.800 1.00 29.19 ? 566  SER B OG    1 
ATOM   8803  N  N     . LEU B  1  540 ? 6.203   44.013 29.383 1.00 27.15 ? 567  LEU B N     1 
ATOM   8804  C  CA    . LEU B  1  540 ? 7.511   44.631 29.644 1.00 27.01 ? 567  LEU B CA    1 
ATOM   8805  C  C     . LEU B  1  540 ? 7.741   45.863 28.757 1.00 27.40 ? 567  LEU B C     1 
ATOM   8806  O  O     . LEU B  1  540 ? 8.153   46.921 29.240 1.00 27.61 ? 567  LEU B O     1 
ATOM   8807  C  CB    . LEU B  1  540 ? 8.643   43.614 29.474 1.00 25.87 ? 567  LEU B CB    1 
ATOM   8808  C  CG    . LEU B  1  540 ? 10.060  44.089 29.809 1.00 25.95 ? 567  LEU B CG    1 
ATOM   8809  C  CD1   . LEU B  1  540 ? 10.240  44.323 31.326 1.00 24.33 ? 567  LEU B CD1   1 
ATOM   8810  C  CD2   . LEU B  1  540 ? 11.088  43.096 29.282 1.00 23.70 ? 567  LEU B CD2   1 
ATOM   8811  N  N     . ILE B  1  541 ? 7.441   45.719 27.469 1.00 27.89 ? 568  ILE B N     1 
ATOM   8812  C  CA    . ILE B  1  541 ? 7.637   46.790 26.500 1.00 28.30 ? 568  ILE B CA    1 
ATOM   8813  C  C     . ILE B  1  541 ? 6.570   47.876 26.659 1.00 29.56 ? 568  ILE B C     1 
ATOM   8814  O  O     . ILE B  1  541 ? 6.878   49.075 26.655 1.00 29.41 ? 568  ILE B O     1 
ATOM   8815  C  CB    . ILE B  1  541 ? 7.696   46.230 25.042 1.00 28.61 ? 568  ILE B CB    1 
ATOM   8816  C  CG1   . ILE B  1  541 ? 9.134   45.842 24.664 1.00 27.76 ? 568  ILE B CG1   1 
ATOM   8817  C  CG2   . ILE B  1  541 ? 7.188   47.266 24.022 1.00 28.85 ? 568  ILE B CG2   1 
ATOM   8818  C  CD1   . ILE B  1  541 ? 9.806   44.773 25.535 1.00 25.35 ? 568  ILE B CD1   1 
ATOM   8819  N  N     . CYS B  1  542 ? 5.321   47.447 26.825 1.00 30.46 ? 569  CYS B N     1 
ATOM   8820  C  CA    . CYS B  1  542 ? 4.196   48.362 26.921 1.00 32.43 ? 569  CYS B CA    1 
ATOM   8821  C  C     . CYS B  1  542 ? 4.307   49.314 28.119 1.00 32.19 ? 569  CYS B C     1 
ATOM   8822  O  O     . CYS B  1  542 ? 4.023   50.505 27.998 1.00 32.87 ? 569  CYS B O     1 
ATOM   8823  C  CB    . CYS B  1  542 ? 2.885   47.580 26.999 1.00 33.08 ? 569  CYS B CB    1 
ATOM   8824  S  SG    . CYS B  1  542 ? 1.449   48.626 26.763 1.00 38.77 ? 569  CYS B SG    1 
ATOM   8825  N  N     . ASN B  1  543 ? 4.715   48.770 29.264 1.00 31.16 ? 570  ASN B N     1 
ATOM   8826  C  CA    . ASN B  1  543 ? 4.811   49.521 30.512 1.00 31.02 ? 570  ASN B CA    1 
ATOM   8827  C  C     . ASN B  1  543 ? 5.980   50.499 30.530 1.00 30.57 ? 570  ASN B C     1 
ATOM   8828  O  O     . ASN B  1  543 ? 5.957   51.485 31.268 1.00 31.45 ? 570  ASN B O     1 
ATOM   8829  C  CB    . ASN B  1  543 ? 4.959   48.558 31.699 1.00 30.22 ? 570  ASN B CB    1 
ATOM   8830  C  CG    . ASN B  1  543 ? 3.665   47.837 32.049 1.00 31.30 ? 570  ASN B CG    1 
ATOM   8831  O  OD1   . ASN B  1  543 ? 2.569   48.369 31.863 1.00 33.79 ? 570  ASN B OD1   1 
ATOM   8832  N  ND2   . ASN B  1  543 ? 3.788   46.621 32.570 1.00 29.03 ? 570  ASN B ND2   1 
ATOM   8833  N  N     . ASN B  1  544 ? 6.996   50.222 29.718 1.00 29.29 ? 571  ASN B N     1 
ATOM   8834  C  CA    . ASN B  1  544 ? 8.279   50.900 29.839 1.00 28.43 ? 571  ASN B CA    1 
ATOM   8835  C  C     . ASN B  1  544 ? 8.772   51.640 28.593 1.00 29.04 ? 571  ASN B C     1 
ATOM   8836  O  O     . ASN B  1  544 ? 9.818   52.290 28.637 1.00 29.29 ? 571  ASN B O     1 
ATOM   8837  C  CB    . ASN B  1  544 ? 9.331   49.892 30.317 1.00 26.77 ? 571  ASN B CB    1 
ATOM   8838  C  CG    . ASN B  1  544 ? 9.040   49.384 31.713 1.00 25.45 ? 571  ASN B CG    1 
ATOM   8839  O  OD1   . ASN B  1  544 ? 8.972   50.167 32.661 1.00 23.77 ? 571  ASN B OD1   1 
ATOM   8840  N  ND2   . ASN B  1  544 ? 8.852   48.070 31.848 1.00 23.24 ? 571  ASN B ND2   1 
ATOM   8841  N  N     . VAL B  1  545 ? 8.035   51.535 27.492 1.00 29.11 ? 572  VAL B N     1 
ATOM   8842  C  CA    . VAL B  1  545 ? 8.472   52.132 26.225 1.00 29.86 ? 572  VAL B CA    1 
ATOM   8843  C  C     . VAL B  1  545 ? 7.394   53.060 25.701 1.00 31.22 ? 572  VAL B C     1 
ATOM   8844  O  O     . VAL B  1  545 ? 6.241   52.661 25.567 1.00 31.58 ? 572  VAL B O     1 
ATOM   8845  C  CB    . VAL B  1  545 ? 8.835   51.057 25.158 1.00 29.37 ? 572  VAL B CB    1 
ATOM   8846  C  CG1   . VAL B  1  545 ? 9.198   51.701 23.817 1.00 29.93 ? 572  VAL B CG1   1 
ATOM   8847  C  CG2   . VAL B  1  545 ? 9.984   50.185 25.649 1.00 27.80 ? 572  VAL B CG2   1 
ATOM   8848  N  N     . LYS B  1  546 ? 7.783   54.304 25.431 1.00 32.41 ? 573  LYS B N     1 
ATOM   8849  C  CA    . LYS B  1  546 ? 6.872   55.336 24.950 1.00 34.08 ? 573  LYS B CA    1 
ATOM   8850  C  C     . LYS B  1  546 ? 6.032   54.818 23.781 1.00 34.32 ? 573  LYS B C     1 
ATOM   8851  O  O     . LYS B  1  546 ? 6.565   54.241 22.824 1.00 34.00 ? 573  LYS B O     1 
ATOM   8852  C  CB    . LYS B  1  546 ? 7.659   56.580 24.537 1.00 34.91 ? 573  LYS B CB    1 
ATOM   8853  C  CG    . LYS B  1  546 ? 6.805   57.825 24.333 1.00 37.65 ? 573  LYS B CG    1 
ATOM   8854  C  CD    . LYS B  1  546 ? 7.632   59.001 23.829 1.00 38.86 ? 573  LYS B CD    1 
ATOM   8855  C  CE    . LYS B  1  546 ? 6.729   60.190 23.485 1.00 43.35 ? 573  LYS B CE    1 
ATOM   8856  N  N     . GLY B  1  547 ? 4.721   55.000 23.892 1.00 34.97 ? 574  GLY B N     1 
ATOM   8857  C  CA    . GLY B  1  547 ? 3.784   54.639 22.831 1.00 35.78 ? 574  GLY B CA    1 
ATOM   8858  C  C     . GLY B  1  547 ? 3.247   53.221 22.918 1.00 35.12 ? 574  GLY B C     1 
ATOM   8859  O  O     . GLY B  1  547 ? 2.290   52.885 22.219 1.00 35.59 ? 574  GLY B O     1 
ATOM   8860  N  N     . CYS B  1  548 ? 3.848   52.396 23.780 1.00 33.89 ? 575  CYS B N     1 
ATOM   8861  C  CA    . CYS B  1  548 ? 3.494   50.974 23.894 1.00 33.79 ? 575  CYS B CA    1 
ATOM   8862  C  C     . CYS B  1  548 ? 3.430   50.326 22.499 1.00 33.82 ? 575  CYS B C     1 
ATOM   8863  O  O     . CYS B  1  548 ? 2.354   49.945 22.034 1.00 34.11 ? 575  CYS B O     1 
ATOM   8864  C  CB    . CYS B  1  548 ? 2.175   50.787 24.678 1.00 34.47 ? 575  CYS B CB    1 
ATOM   8865  S  SG    . CYS B  1  548 ? 1.506   49.072 24.776 1.00 36.86 ? 575  CYS B SG    1 
ATOM   8866  N  N     . PRO B  1  549 ? 4.586   50.231 21.810 1.00 33.12 ? 576  PRO B N     1 
ATOM   8867  C  CA    . PRO B  1  549 ? 4.585   49.557 20.518 1.00 33.43 ? 576  PRO B CA    1 
ATOM   8868  C  C     . PRO B  1  549 ? 4.290   48.077 20.706 1.00 33.06 ? 576  PRO B C     1 
ATOM   8869  O  O     . PRO B  1  549 ? 4.615   47.507 21.754 1.00 31.69 ? 576  PRO B O     1 
ATOM   8870  C  CB    . PRO B  1  549 ? 6.028   49.741 20.025 1.00 33.02 ? 576  PRO B CB    1 
ATOM   8871  C  CG    . PRO B  1  549 ? 6.831   49.911 21.264 1.00 31.88 ? 576  PRO B CG    1 
ATOM   8872  C  CD    . PRO B  1  549 ? 5.937   50.690 22.184 1.00 32.59 ? 576  PRO B CD    1 
ATOM   8873  N  N     . PHE B  1  550 ? 3.687   47.469 19.691 1.00 34.19 ? 577  PHE B N     1 
ATOM   8874  C  CA    . PHE B  1  550 ? 3.380   46.049 19.713 1.00 34.66 ? 577  PHE B CA    1 
ATOM   8875  C  C     . PHE B  1  550 ? 4.650   45.220 19.575 1.00 33.70 ? 577  PHE B C     1 
ATOM   8876  O  O     . PHE B  1  550 ? 5.580   45.596 18.846 1.00 33.67 ? 577  PHE B O     1 
ATOM   8877  C  CB    . PHE B  1  550 ? 2.404   45.710 18.592 1.00 36.30 ? 577  PHE B CB    1 
ATOM   8878  C  CG    . PHE B  1  550 ? 0.993   46.128 18.878 1.00 39.05 ? 577  PHE B CG    1 
ATOM   8879  C  CD1   . PHE B  1  550 ? 0.072   45.212 19.368 1.00 41.26 ? 577  PHE B CD1   1 
ATOM   8880  C  CD2   . PHE B  1  550 ? 0.579   47.437 18.659 1.00 41.77 ? 577  PHE B CD2   1 
ATOM   8881  C  CE1   . PHE B  1  550 ? -1.242  45.593 19.634 1.00 42.85 ? 577  PHE B CE1   1 
ATOM   8882  C  CE2   . PHE B  1  550 ? -0.733  47.824 18.921 1.00 43.27 ? 577  PHE B CE2   1 
ATOM   8883  C  CZ    . PHE B  1  550 ? -1.642  46.898 19.414 1.00 43.25 ? 577  PHE B CZ    1 
ATOM   8884  N  N     . THR B  1  551 ? 4.701   44.097 20.276 1.00 32.81 ? 578  THR B N     1 
ATOM   8885  C  CA    . THR B  1  551 ? 5.881   43.249 20.184 1.00 32.60 ? 578  THR B CA    1 
ATOM   8886  C  C     . THR B  1  551 ? 5.624   41.771 20.448 1.00 32.77 ? 578  THR B C     1 
ATOM   8887  O  O     . THR B  1  551 ? 4.565   41.382 20.962 1.00 33.27 ? 578  THR B O     1 
ATOM   8888  C  CB    . THR B  1  551 ? 7.045   43.778 21.076 1.00 31.54 ? 578  THR B CB    1 
ATOM   8889  O  OG1   . THR B  1  551 ? 8.294   43.270 20.587 1.00 32.02 ? 578  THR B OG1   1 
ATOM   8890  C  CG2   . THR B  1  551 ? 6.846   43.398 22.542 1.00 30.16 ? 578  THR B CG2   1 
ATOM   8891  N  N     . SER B  1  552 ? 6.614   40.969 20.062 1.00 32.81 ? 579  SER B N     1 
ATOM   8892  C  CA    . SER B  1  552 ? 6.685   39.538 20.329 1.00 32.91 ? 579  SER B CA    1 
ATOM   8893  C  C     . SER B  1  552 ? 8.046   39.040 19.839 1.00 33.19 ? 579  SER B C     1 
ATOM   8894  O  O     . SER B  1  552 ? 8.856   39.829 19.344 1.00 33.10 ? 579  SER B O     1 
ATOM   8895  C  CB    . SER B  1  552 ? 5.566   38.793 19.613 1.00 34.19 ? 579  SER B CB    1 
ATOM   8896  O  OG    . SER B  1  552 ? 5.659   38.978 18.217 1.00 34.26 ? 579  SER B OG    1 
ATOM   8897  N  N     . PHE B  1  553 ? 8.291   37.737 19.968 1.00 33.65 ? 580  PHE B N     1 
ATOM   8898  C  CA    . PHE B  1  553 ? 9.552   37.155 19.526 1.00 33.94 ? 580  PHE B CA    1 
ATOM   8899  C  C     . PHE B  1  553 ? 9.510   36.654 18.085 1.00 35.78 ? 580  PHE B C     1 
ATOM   8900  O  O     . PHE B  1  553 ? 10.511  36.156 17.566 1.00 35.97 ? 580  PHE B O     1 
ATOM   8901  C  CB    . PHE B  1  553 ? 9.998   36.048 20.482 1.00 33.21 ? 580  PHE B CB    1 
ATOM   8902  C  CG    . PHE B  1  553 ? 10.412  36.550 21.838 1.00 31.54 ? 580  PHE B CG    1 
ATOM   8903  C  CD1   . PHE B  1  553 ? 11.346  37.579 21.960 1.00 30.30 ? 580  PHE B CD1   1 
ATOM   8904  C  CD2   . PHE B  1  553 ? 9.876   35.985 22.994 1.00 30.15 ? 580  PHE B CD2   1 
ATOM   8905  C  CE1   . PHE B  1  553 ? 11.749  38.038 23.210 1.00 29.98 ? 580  PHE B CE1   1 
ATOM   8906  C  CE2   . PHE B  1  553 ? 10.259  36.438 24.249 1.00 30.05 ? 580  PHE B CE2   1 
ATOM   8907  C  CZ    . PHE B  1  553 ? 11.206  37.465 24.364 1.00 29.68 ? 580  PHE B CZ    1 
ATOM   8908  N  N     . ASN B  1  554 ? 8.359   36.807 17.437 1.00 37.47 ? 581  ASN B N     1 
ATOM   8909  C  CA    . ASN B  1  554 ? 8.196   36.377 16.048 1.00 39.79 ? 581  ASN B CA    1 
ATOM   8910  C  C     . ASN B  1  554 ? 7.852   37.505 15.075 1.00 40.60 ? 581  ASN B C     1 
ATOM   8911  O  O     . ASN B  1  554 ? 7.285   38.526 15.473 1.00 39.96 ? 581  ASN B O     1 
ATOM   8912  C  CB    . ASN B  1  554 ? 7.159   35.249 15.942 1.00 41.13 ? 581  ASN B CB    1 
ATOM   8913  C  CG    . ASN B  1  554 ? 5.764   35.692 16.348 1.00 42.89 ? 581  ASN B CG    1 
ATOM   8914  O  OD1   . ASN B  1  554 ? 5.518   36.061 17.497 1.00 45.07 ? 581  ASN B OD1   1 
ATOM   8915  N  ND2   . ASN B  1  554 ? 4.840   35.643 15.407 1.00 46.60 ? 581  ASN B ND2   1 
ATOM   8916  N  N     . VAL B  1  555 ? 8.226   37.290 13.812 1.00 42.09 ? 582  VAL B N     1 
ATOM   8917  C  CA    . VAL B  1  555 ? 7.852   38.089 12.617 1.00 44.15 ? 582  VAL B CA    1 
ATOM   8918  C  C     . VAL B  1  555 ? 8.995   38.959 12.097 1.00 44.33 ? 582  VAL B C     1 
ATOM   8919  O  O     . VAL B  1  555 ? 10.085  38.457 11.794 1.00 44.99 ? 582  VAL B O     1 
ATOM   8920  C  CB    . VAL B  1  555 ? 6.501   38.857 12.752 1.00 44.27 ? 582  VAL B CB    1 
ATOM   8921  C  CG1   . VAL B  1  555 ? 6.330   39.870 11.631 1.00 46.22 ? 582  VAL B CG1   1 
ATOM   8922  C  CG2   . VAL B  1  555 ? 5.344   37.870 12.738 1.00 45.17 ? 582  VAL B CG2   1 
HETATM 8923  C  C1    . NAG C  2  .   ? -4.831  38.498 65.983 1.00 41.39 ? 1    NAG C C1    1 
HETATM 8924  C  C2    . NAG C  2  .   ? -6.239  38.541 66.577 1.00 47.68 ? 1    NAG C C2    1 
HETATM 8925  C  C3    . NAG C  2  .   ? -6.571  39.885 67.192 1.00 49.91 ? 1    NAG C C3    1 
HETATM 8926  C  C4    . NAG C  2  .   ? -5.464  40.253 68.163 1.00 52.07 ? 1    NAG C C4    1 
HETATM 8927  C  C5    . NAG C  2  .   ? -4.242  40.330 67.254 1.00 49.90 ? 1    NAG C C5    1 
HETATM 8928  C  C6    . NAG C  2  .   ? -3.060  41.099 67.827 1.00 50.75 ? 1    NAG C C6    1 
HETATM 8929  C  C7    . NAG C  2  .   ? -8.020  37.238 65.587 1.00 48.12 ? 1    NAG C C7    1 
HETATM 8930  C  C8    . NAG C  2  .   ? -8.987  37.167 64.455 1.00 47.40 ? 1    NAG C C8    1 
HETATM 8931  N  N2    . NAG C  2  .   ? -7.228  38.288 65.568 1.00 47.96 ? 1    NAG C N2    1 
HETATM 8932  O  O3    . NAG C  2  .   ? -7.826  39.813 67.816 1.00 51.76 ? 1    NAG C O3    1 
HETATM 8933  O  O4    . NAG C  2  .   ? -5.749  41.440 68.871 1.00 56.29 ? 1    NAG C O4    1 
HETATM 8934  O  O5    . NAG C  2  .   ? -3.912  39.005 66.908 1.00 45.42 ? 1    NAG C O5    1 
HETATM 8935  O  O6    . NAG C  2  .   ? -2.153  40.207 68.413 1.00 52.29 ? 1    NAG C O6    1 
HETATM 8936  O  O7    . NAG C  2  .   ? -7.973  36.378 66.452 1.00 48.46 ? 1    NAG C O7    1 
HETATM 8937  C  C1    . NAG C  2  .   ? -5.783  41.207 70.303 1.00 61.00 ? 2    NAG C C1    1 
HETATM 8938  C  C2    . NAG C  2  .   ? -5.651  42.555 71.012 1.00 62.56 ? 2    NAG C C2    1 
HETATM 8939  C  C3    . NAG C  2  .   ? -5.701  42.412 72.534 1.00 63.70 ? 2    NAG C C3    1 
HETATM 8940  C  C4    . NAG C  2  .   ? -6.695  41.366 73.046 1.00 64.33 ? 2    NAG C C4    1 
HETATM 8941  C  C5    . NAG C  2  .   ? -6.833  40.139 72.141 1.00 64.24 ? 2    NAG C C5    1 
HETATM 8942  C  C6    . NAG C  2  .   ? -8.071  39.334 72.524 1.00 65.14 ? 2    NAG C C6    1 
HETATM 8943  C  C7    . NAG C  2  .   ? -4.360  44.151 69.690 1.00 63.41 ? 2    NAG C C7    1 
HETATM 8944  C  C8    . NAG C  2  .   ? -3.145  45.036 69.695 1.00 63.29 ? 2    NAG C C8    1 
HETATM 8945  N  N2    . NAG C  2  .   ? -4.408  43.206 70.630 1.00 62.79 ? 2    NAG C N2    1 
HETATM 8946  O  O3    . NAG C  2  .   ? -6.053  43.658 73.093 1.00 64.63 ? 2    NAG C O3    1 
HETATM 8947  O  O4    . NAG C  2  .   ? -6.257  40.947 74.321 1.00 65.26 ? 2    NAG C O4    1 
HETATM 8948  O  O5    . NAG C  2  .   ? -6.927  40.517 70.777 1.00 63.11 ? 2    NAG C O5    1 
HETATM 8949  O  O6    . NAG C  2  .   ? -7.672  38.079 73.034 1.00 65.95 ? 2    NAG C O6    1 
HETATM 8950  O  O7    . NAG C  2  .   ? -5.246  44.313 68.845 1.00 63.25 ? 2    NAG C O7    1 
HETATM 8951  C  C1    . NAG D  3  .   ? 27.860  40.148 52.180 1.00 26.02 ? 1    NAG D C1    1 
HETATM 8952  C  C2    . NAG D  3  .   ? 28.803  40.799 51.175 1.00 30.68 ? 1    NAG D C2    1 
HETATM 8953  C  C3    . NAG D  3  .   ? 29.851  41.677 51.849 1.00 32.32 ? 1    NAG D C3    1 
HETATM 8954  C  C4    . NAG D  3  .   ? 29.186  42.624 52.845 1.00 33.71 ? 1    NAG D C4    1 
HETATM 8955  C  C5    . NAG D  3  .   ? 28.329  41.840 53.843 1.00 32.02 ? 1    NAG D C5    1 
HETATM 8956  C  C6    . NAG D  3  .   ? 27.570  42.737 54.827 1.00 32.20 ? 1    NAG D C6    1 
HETATM 8957  C  C7    . NAG D  3  .   ? 29.183  39.672 49.109 1.00 31.67 ? 1    NAG D C7    1 
HETATM 8958  C  C8    . NAG D  3  .   ? 29.872  38.571 48.355 1.00 31.82 ? 1    NAG D C8    1 
HETATM 8959  N  N2    . NAG D  3  .   ? 29.464  39.780 50.392 1.00 30.91 ? 1    NAG D N2    1 
HETATM 8960  O  O3    . NAG D  3  .   ? 30.545  42.398 50.852 1.00 32.73 ? 1    NAG D O3    1 
HETATM 8961  O  O4    . NAG D  3  .   ? 30.186  43.337 53.519 1.00 39.41 ? 1    NAG D O4    1 
HETATM 8962  O  O5    . NAG D  3  .   ? 27.377  41.090 53.121 1.00 28.80 ? 1    NAG D O5    1 
HETATM 8963  O  O6    . NAG D  3  .   ? 26.768  43.650 54.103 1.00 32.75 ? 1    NAG D O6    1 
HETATM 8964  O  O7    . NAG D  3  .   ? 28.390  40.433 48.557 1.00 32.84 ? 1    NAG D O7    1 
HETATM 8965  C  C1    . NAG D  3  .   ? 30.053  44.752 53.279 1.00 43.56 ? 2    NAG D C1    1 
HETATM 8966  C  C2    . NAG D  3  .   ? 30.824  45.474 54.375 1.00 45.68 ? 2    NAG D C2    1 
HETATM 8967  C  C3    . NAG D  3  .   ? 30.931  46.982 54.141 1.00 48.14 ? 2    NAG D C3    1 
HETATM 8968  C  C4    . NAG D  3  .   ? 31.148  47.381 52.676 1.00 50.23 ? 2    NAG D C4    1 
HETATM 8969  C  C5    . NAG D  3  .   ? 30.266  46.523 51.754 1.00 48.58 ? 2    NAG D C5    1 
HETATM 8970  C  C6    . NAG D  3  .   ? 30.474  46.804 50.270 1.00 48.73 ? 2    NAG D C6    1 
HETATM 8971  C  C7    . NAG D  3  .   ? 30.730  44.425 56.591 1.00 45.61 ? 2    NAG D C7    1 
HETATM 8972  C  C8    . NAG D  3  .   ? 32.167  44.021 56.448 1.00 45.87 ? 2    NAG D C8    1 
HETATM 8973  N  N2    . NAG D  3  .   ? 30.188  45.205 55.652 1.00 45.08 ? 2    NAG D N2    1 
HETATM 8974  O  O3    . NAG D  3  .   ? 32.010  47.455 54.908 1.00 48.89 ? 2    NAG D O3    1 
HETATM 8975  O  O4    . NAG D  3  .   ? 30.850  48.763 52.552 1.00 54.69 ? 2    NAG D O4    1 
HETATM 8976  O  O5    . NAG D  3  .   ? 30.518  45.152 52.004 1.00 45.37 ? 2    NAG D O5    1 
HETATM 8977  O  O6    . NAG D  3  .   ? 31.503  45.987 49.754 1.00 48.99 ? 2    NAG D O6    1 
HETATM 8978  O  O7    . NAG D  3  .   ? 30.102  44.042 57.572 1.00 46.14 ? 2    NAG D O7    1 
HETATM 8979  C  C1    . MAN D  3  .   ? 31.976  49.532 52.049 1.00 58.35 ? 3    MAN D C1    1 
HETATM 8980  C  C2    . MAN D  3  .   ? 32.711  50.218 53.206 1.00 59.66 ? 3    MAN D C2    1 
HETATM 8981  C  C3    . MAN D  3  .   ? 32.108  51.585 53.533 1.00 60.89 ? 3    MAN D C3    1 
HETATM 8982  C  C4    . MAN D  3  .   ? 31.930  52.498 52.315 1.00 61.45 ? 3    MAN D C4    1 
HETATM 8983  C  C5    . MAN D  3  .   ? 31.963  51.788 50.953 1.00 61.10 ? 3    MAN D C5    1 
HETATM 8984  C  C6    . MAN D  3  .   ? 33.308  51.958 50.236 1.00 61.35 ? 3    MAN D C6    1 
HETATM 8985  O  O2    . MAN D  3  .   ? 34.090  50.324 52.908 1.00 60.55 ? 3    MAN D O2    1 
HETATM 8986  O  O3    . MAN D  3  .   ? 32.911  52.246 54.489 1.00 61.00 ? 3    MAN D O3    1 
HETATM 8987  O  O4    . MAN D  3  .   ? 30.700  53.186 52.440 1.00 61.86 ? 3    MAN D O4    1 
HETATM 8988  O  O5    . MAN D  3  .   ? 31.569  50.414 50.998 1.00 59.91 ? 3    MAN D O5    1 
HETATM 8989  O  O6    . MAN D  3  .   ? 33.143  52.864 49.166 1.00 62.11 ? 3    MAN D O6    1 
HETATM 8990  C  C1    . NAG E  2  .   ? 32.745  -3.966 27.256 1.00 44.45 ? 1    NAG E C1    1 
HETATM 8991  C  C2    . NAG E  2  .   ? 32.600  -5.335 26.579 1.00 50.66 ? 1    NAG E C2    1 
HETATM 8992  C  C3    . NAG E  2  .   ? 33.907  -5.818 25.947 1.00 52.97 ? 1    NAG E C3    1 
HETATM 8993  C  C4    . NAG E  2  .   ? 34.703  -4.718 25.235 1.00 54.98 ? 1    NAG E C4    1 
HETATM 8994  C  C5    . NAG E  2  .   ? 34.732  -3.446 26.094 1.00 52.64 ? 1    NAG E C5    1 
HETATM 8995  C  C6    . NAG E  2  .   ? 35.439  -2.276 25.419 1.00 53.29 ? 1    NAG E C6    1 
HETATM 8996  C  C7    . NAG E  2  .   ? 30.985  -6.892 27.569 1.00 52.08 ? 1    NAG E C7    1 
HETATM 8997  C  C8    . NAG E  2  .   ? 30.724  -7.862 28.684 1.00 52.36 ? 1    NAG E C8    1 
HETATM 8998  N  N2    . NAG E  2  .   ? 32.187  -6.323 27.561 1.00 51.19 ? 1    NAG E N2    1 
HETATM 8999  O  O3    . NAG E  2  .   ? 33.616  -6.855 25.036 1.00 54.66 ? 1    NAG E O3    1 
HETATM 9000  O  O4    . NAG E  2  .   ? 36.027  -5.180 25.042 1.00 60.12 ? 1    NAG E O4    1 
HETATM 9001  O  O5    . NAG E  2  .   ? 33.411  -3.054 26.406 1.00 48.46 ? 1    NAG E O5    1 
HETATM 9002  O  O6    . NAG E  2  .   ? 34.535  -1.596 24.574 1.00 54.16 ? 1    NAG E O6    1 
HETATM 9003  O  O7    . NAG E  2  .   ? 30.115  -6.658 26.729 1.00 53.21 ? 1    NAG E O7    1 
HETATM 9004  C  C1    . NAG E  2  .   ? 36.367  -4.920 23.675 1.00 64.53 ? 2    NAG E C1    1 
HETATM 9005  C  C2    . NAG E  2  .   ? 37.850  -5.250 23.579 1.00 66.09 ? 2    NAG E C2    1 
HETATM 9006  C  C3    . NAG E  2  .   ? 38.340  -5.505 22.161 1.00 67.22 ? 2    NAG E C3    1 
HETATM 9007  C  C4    . NAG E  2  .   ? 37.319  -6.260 21.338 1.00 67.39 ? 2    NAG E C4    1 
HETATM 9008  C  C5    . NAG E  2  .   ? 35.978  -5.563 21.432 1.00 67.12 ? 2    NAG E C5    1 
HETATM 9009  C  C6    . NAG E  2  .   ? 34.965  -6.274 20.554 1.00 67.40 ? 2    NAG E C6    1 
HETATM 9010  C  C7    . NAG E  2  .   ? 39.146  -4.100 25.279 1.00 68.11 ? 2    NAG E C7    1 
HETATM 9011  C  C8    . NAG E  2  .   ? 39.002  -5.340 26.108 1.00 67.99 ? 2    NAG E C8    1 
HETATM 9012  N  N2    . NAG E  2  .   ? 38.566  -4.108 24.087 1.00 67.13 ? 2    NAG E N2    1 
HETATM 9013  O  O3    . NAG E  2  .   ? 39.547  -6.238 22.168 1.00 67.61 ? 2    NAG E O3    1 
HETATM 9014  O  O4    . NAG E  2  .   ? 37.765  -6.269 20.007 1.00 68.50 ? 2    NAG E O4    1 
HETATM 9015  O  O5    . NAG E  2  .   ? 35.535  -5.610 22.762 1.00 65.88 ? 2    NAG E O5    1 
HETATM 9016  O  O6    . NAG E  2  .   ? 34.427  -7.355 21.268 1.00 68.17 ? 2    NAG E O6    1 
HETATM 9017  O  O7    . NAG E  2  .   ? 39.773  -3.131 25.710 1.00 68.77 ? 2    NAG E O7    1 
HETATM 9018  C  C1    . NAG F  2  .   ? 38.733  27.794 42.334 1.00 24.55 ? 1    NAG F C1    1 
HETATM 9019  C  C2    . NAG F  2  .   ? 39.399  28.556 43.472 1.00 28.74 ? 1    NAG F C2    1 
HETATM 9020  C  C3    . NAG F  2  .   ? 40.425  29.559 42.957 1.00 30.96 ? 1    NAG F C3    1 
HETATM 9021  C  C4    . NAG F  2  .   ? 41.404  28.889 41.997 1.00 32.52 ? 1    NAG F C4    1 
HETATM 9022  C  C5    . NAG F  2  .   ? 40.627  28.185 40.884 1.00 29.90 ? 1    NAG F C5    1 
HETATM 9023  C  C6    . NAG F  2  .   ? 41.543  27.406 39.934 1.00 29.73 ? 1    NAG F C6    1 
HETATM 9024  C  C7    . NAG F  2  .   ? 38.316  29.003 45.593 1.00 28.99 ? 1    NAG F C7    1 
HETATM 9025  C  C8    . NAG F  2  .   ? 37.242  29.746 46.337 1.00 29.25 ? 1    NAG F C8    1 
HETATM 9026  N  N2    . NAG F  2  .   ? 38.399  29.218 44.283 1.00 28.50 ? 1    NAG F N2    1 
HETATM 9027  O  O3    . NAG F  2  .   ? 41.123  30.089 44.058 1.00 31.49 ? 1    NAG F O3    1 
HETATM 9028  O  O4    . NAG F  2  .   ? 42.264  29.875 41.470 1.00 39.06 ? 1    NAG F O4    1 
HETATM 9029  O  O5    . NAG F  2  .   ? 39.719  27.268 41.465 1.00 25.79 ? 1    NAG F O5    1 
HETATM 9030  O  O6    . NAG F  2  .   ? 42.333  26.494 40.677 1.00 29.09 ? 1    NAG F O6    1 
HETATM 9031  O  O7    . NAG F  2  .   ? 39.076  28.246 46.199 1.00 29.18 ? 1    NAG F O7    1 
HETATM 9032  C  C1    . NAG F  2  .   ? 43.664  29.588 41.696 1.00 43.33 ? 2    NAG F C1    1 
HETATM 9033  C  C2    . NAG F  2  .   ? 44.435  30.431 40.680 1.00 44.96 ? 2    NAG F C2    1 
HETATM 9034  C  C3    . NAG F  2  .   ? 45.909  30.718 40.994 1.00 47.06 ? 2    NAG F C3    1 
HETATM 9035  C  C4    . NAG F  2  .   ? 46.300  30.615 42.474 1.00 48.01 ? 2    NAG F C4    1 
HETATM 9036  C  C5    . NAG F  2  .   ? 45.467  29.567 43.219 1.00 47.59 ? 2    NAG F C5    1 
HETATM 9037  C  C6    . NAG F  2  .   ? 45.772  29.516 44.716 1.00 48.44 ? 2    NAG F C6    1 
HETATM 9038  C  C7    . NAG F  2  .   ? 43.562  30.365 38.434 1.00 43.98 ? 2    NAG F C7    1 
HETATM 9039  C  C8    . NAG F  2  .   ? 43.220  31.814 38.618 1.00 45.48 ? 2    NAG F C8    1 
HETATM 9040  N  N2    . NAG F  2  .   ? 44.314  29.810 39.375 1.00 44.23 ? 2    NAG F N2    1 
HETATM 9041  O  O3    . NAG F  2  .   ? 46.160  32.038 40.561 1.00 48.06 ? 2    NAG F O3    1 
HETATM 9042  O  O4    . NAG F  2  .   ? 47.676  30.317 42.566 1.00 49.87 ? 2    NAG F O4    1 
HETATM 9043  O  O5    . NAG F  2  .   ? 44.096  29.860 43.017 1.00 46.44 ? 2    NAG F O5    1 
HETATM 9044  O  O6    . NAG F  2  .   ? 45.267  30.660 45.372 1.00 49.30 ? 2    NAG F O6    1 
HETATM 9045  O  O7    . NAG F  2  .   ? 43.158  29.753 37.451 1.00 43.73 ? 2    NAG F O7    1 
HETATM 9046  C  C1    A ACD G  4  .   ? 25.389  17.793 65.082 0.50 32.70 ? 1    ACD A C1    1 
HETATM 9047  C  C1    B ACD G  4  .   ? 25.280  17.742 65.274 0.50 53.29 ? 1    ACD A C1    1 
HETATM 9048  C  C2    A ACD G  4  .   ? 24.802  16.818 66.075 0.50 32.92 ? 1    ACD A C2    1 
HETATM 9049  C  C2    B ACD G  4  .   ? 24.498  17.078 66.384 0.50 53.16 ? 1    ACD A C2    1 
HETATM 9050  C  C3    A ACD G  4  .   ? 24.396  17.510 67.370 0.50 32.51 ? 1    ACD A C3    1 
HETATM 9051  C  C3    B ACD G  4  .   ? 23.424  18.030 66.897 0.50 53.09 ? 1    ACD A C3    1 
HETATM 9052  C  C4    A ACD G  4  .   ? 22.998  18.112 67.276 0.50 32.99 ? 1    ACD A C4    1 
HETATM 9053  C  C4    B ACD G  4  .   ? 23.443  18.097 68.419 0.50 52.75 ? 1    ACD A C4    1 
HETATM 9054  C  C5    A ACD G  4  .   ? 22.868  19.248 68.263 0.50 32.67 ? 1    ACD A C5    1 
HETATM 9055  C  C5    B ACD G  4  .   ? 22.463  19.142 68.893 0.50 52.53 ? 1    ACD A C5    1 
HETATM 9056  C  C6    A ACD G  4  .   ? 21.920  19.197 69.191 0.50 33.07 ? 1    ACD A C6    1 
HETATM 9057  C  C6    B ACD G  4  .   ? 21.355  18.762 69.521 0.50 52.41 ? 1    ACD A C6    1 
HETATM 9058  C  C7    A ACD G  4  .   ? 21.007  17.996 69.229 0.50 33.24 ? 1    ACD A C7    1 
HETATM 9059  C  C7    B ACD G  4  .   ? 21.091  17.293 69.748 0.50 52.28 ? 1    ACD A C7    1 
HETATM 9060  C  C8    A ACD G  4  .   ? 20.878  17.531 70.657 0.50 33.74 ? 1    ACD A C8    1 
HETATM 9061  C  C8    B ACD G  4  .   ? 20.607  16.657 68.467 0.50 52.14 ? 1    ACD A C8    1 
HETATM 9062  C  C9    A ACD G  4  .   ? 20.544  16.272 70.930 0.50 34.28 ? 1    ACD A C9    1 
HETATM 9063  C  C9    B ACD G  4  .   ? 20.390  15.345 68.419 0.50 51.96 ? 1    ACD A C9    1 
HETATM 9064  C  C10   A ACD G  4  .   ? 20.279  15.271 69.829 0.50 34.68 ? 1    ACD A C10   1 
HETATM 9065  C  C10   B ACD G  4  .   ? 20.634  14.497 69.645 0.50 51.79 ? 1    ACD A C10   1 
HETATM 9066  C  C11   A ACD G  4  .   ? 19.521  14.115 70.434 0.50 35.53 ? 1    ACD A C11   1 
HETATM 9067  C  C11   B ACD G  4  .   ? 19.317  14.112 70.278 0.50 51.93 ? 1    ACD A C11   1 
HETATM 9068  C  C12   A ACD G  4  .   ? 18.772  13.316 69.681 0.50 36.11 ? 1    ACD A C12   1 
HETATM 9069  C  C12   B ACD G  4  .   ? 18.365  13.541 69.545 0.50 51.93 ? 1    ACD A C12   1 
HETATM 9070  C  C13   A ACD G  4  .   ? 18.654  13.532 68.192 0.50 36.33 ? 1    ACD A C13   1 
HETATM 9071  C  C13   B ACD G  4  .   ? 18.603  13.283 68.077 0.50 51.76 ? 1    ACD A C13   1 
HETATM 9072  C  C14   A ACD G  4  .   ? 17.563  12.627 67.672 0.50 36.85 ? 1    ACD A C14   1 
HETATM 9073  C  C14   B ACD G  4  .   ? 17.374  12.657 67.462 0.50 51.72 ? 1    ACD A C14   1 
HETATM 9074  C  C15   A ACD G  4  .   ? 17.529  12.298 66.387 0.50 37.27 ? 1    ACD A C15   1 
HETATM 9075  C  C15   B ACD G  4  .   ? 17.235  12.661 66.139 0.50 51.73 ? 1    ACD A C15   1 
HETATM 9076  C  C16   A ACD G  4  .   ? 18.590  12.841 65.462 0.50 38.06 ? 1    ACD A C16   1 
HETATM 9077  C  C16   B ACD G  4  .   ? 18.312  13.293 65.288 0.50 51.89 ? 1    ACD A C16   1 
HETATM 9078  C  C17   A ACD G  4  .   ? 18.266  12.475 64.017 0.50 38.50 ? 1    ACD A C17   1 
HETATM 9079  C  C17   B ACD G  4  .   ? 18.216  12.777 63.853 0.50 51.76 ? 1    ACD A C17   1 
HETATM 9080  C  C18   A ACD G  4  .   ? 19.486  12.671 63.118 0.50 38.82 ? 1    ACD A C18   1 
HETATM 9081  C  C18   B ACD G  4  .   ? 19.019  13.657 62.902 0.50 51.58 ? 1    ACD A C18   1 
HETATM 9082  C  C19   A ACD G  4  .   ? 19.186  13.680 62.018 0.50 38.86 ? 1    ACD A C19   1 
HETATM 9083  C  C19   B ACD G  4  .   ? 20.444  13.142 62.734 0.50 51.11 ? 1    ACD A C19   1 
HETATM 9084  C  C20   A ACD G  4  .   ? 17.735  14.104 62.093 0.50 39.29 ? 1    ACD A C20   1 
HETATM 9085  C  C20   B ACD G  4  .   ? 20.682  12.661 61.319 0.50 50.73 ? 1    ACD A C20   1 
HETATM 9086  O  O1    A ACD G  4  .   ? 25.069  17.682 63.878 0.50 32.71 ? 1    ACD A O1    1 
HETATM 9087  O  O1    B ACD G  4  .   ? 24.802  17.733 64.118 0.50 53.37 ? 1    ACD A O1    1 
HETATM 9088  O  O2    A ACD G  4  .   ? 26.175  18.668 65.495 0.50 32.86 ? 1    ACD A O2    1 
HETATM 9089  O  O2    B ACD G  4  .   ? 26.376  18.275 65.551 0.50 53.41 ? 1    ACD A O2    1 
HETATM 9090  C  CA    . AKR H  5  .   ? 6.816   32.583 87.323 1.00 53.57 ? 2    AKR A CA    1 
HETATM 9091  C  CB    . AKR H  5  .   ? 5.857   32.500 86.317 1.00 53.46 ? 2    AKR A CB    1 
HETATM 9092  C  C     . AKR H  5  .   ? 7.353   31.487 87.992 1.00 53.42 ? 2    AKR A C     1 
HETATM 9093  O  O     . AKR H  5  .   ? 6.973   30.337 87.705 1.00 53.50 ? 2    AKR A O     1 
HETATM 9094  O  OXT   . AKR H  5  .   ? 8.211   31.730 88.861 1.00 53.81 ? 2    AKR A OXT   1 
HETATM 9095  C  CA    . AKR I  5  .   ? 45.609  31.141 55.967 1.00 51.17 ? 3    AKR A CA    1 
HETATM 9096  C  CB    . AKR I  5  .   ? 44.447  31.186 55.201 1.00 51.07 ? 3    AKR A CB    1 
HETATM 9097  C  C     . AKR I  5  .   ? 46.861  30.852 55.426 1.00 51.03 ? 3    AKR A C     1 
HETATM 9098  O  O     . AKR I  5  .   ? 46.953  30.633 54.200 1.00 51.34 ? 3    AKR A O     1 
HETATM 9099  O  OXT   . AKR I  5  .   ? 47.836  30.847 56.204 1.00 51.00 ? 3    AKR A OXT   1 
HETATM 9100  CO CO    . COH J  6  .   ? 34.040  27.221 73.005 1.00 77.60 ? 619  COH A CO    1 
HETATM 9101  C  CHA   . COH J  6  .   ? 33.068  29.888 71.078 1.00 78.23 ? 619  COH A CHA   1 
HETATM 9102  C  CHB   . COH J  6  .   ? 36.534  29.251 74.417 1.00 78.47 ? 619  COH A CHB   1 
HETATM 9103  C  CHC   . COH J  6  .   ? 35.269  24.555 74.792 1.00 78.07 ? 619  COH A CHC   1 
HETATM 9104  C  CHD   . COH J  6  .   ? 31.358  25.370 71.991 1.00 77.25 ? 619  COH A CHD   1 
HETATM 9105  N  NA    . COH J  6  .   ? 34.654  29.257 72.837 1.00 78.54 ? 619  COH A NA    1 
HETATM 9106  C  C1A   . COH J  6  .   ? 34.188  30.114 71.855 1.00 78.90 ? 619  COH A C1A   1 
HETATM 9107  C  C2A   . COH J  6  .   ? 35.083  31.265 71.799 1.00 79.69 ? 619  COH A C2A   1 
HETATM 9108  C  C3A   . COH J  6  .   ? 36.038  31.083 72.727 1.00 79.29 ? 619  COH A C3A   1 
HETATM 9109  C  C4A   . COH J  6  .   ? 35.788  29.817 73.398 1.00 78.79 ? 619  COH A C4A   1 
HETATM 9110  C  CMA   . COH J  6  .   ? 37.207  32.051 73.033 1.00 79.14 ? 619  COH A CMA   1 
HETATM 9111  C  CAA   . COH J  6  .   ? 34.970  32.497 70.856 1.00 80.89 ? 619  COH A CAA   1 
HETATM 9112  C  CBA   . COH J  6  .   ? 34.842  32.104 69.380 1.00 82.55 ? 619  COH A CBA   1 
HETATM 9113  C  CGA   . COH J  6  .   ? 36.163  32.131 68.645 1.00 83.42 ? 619  COH A CGA   1 
HETATM 9114  O  O1A   . COH J  6  .   ? 36.906  33.145 68.745 1.00 83.78 ? 619  COH A O1A   1 
HETATM 9115  O  O2A   . COH J  6  .   ? 36.472  31.134 67.937 1.00 83.91 ? 619  COH A O2A   1 
HETATM 9116  N  NB    . COH J  6  .   ? 35.607  26.968 74.401 1.00 78.07 ? 619  COH A NB    1 
HETATM 9117  C  C1B   . COH J  6  .   ? 36.553  27.913 74.768 1.00 78.15 ? 619  COH A C1B   1 
HETATM 9118  C  C2B   . COH J  6  .   ? 37.558  27.242 75.572 1.00 78.06 ? 619  COH A C2B   1 
HETATM 9119  C  C3B   . COH J  6  .   ? 37.216  25.952 75.675 1.00 77.92 ? 619  COH A C3B   1 
HETATM 9120  C  C4B   . COH J  6  .   ? 35.974  25.745 74.939 1.00 78.07 ? 619  COH A C4B   1 
HETATM 9121  C  CMB   . COH J  6  .   ? 38.807  27.902 76.203 1.00 78.17 ? 619  COH A CMB   1 
HETATM 9122  C  CAB   . COH J  6  .   ? 38.015  24.881 76.453 1.00 77.63 ? 619  COH A CAB   1 
HETATM 9123  C  CBB   . COH J  6  .   ? 38.502  23.811 75.820 1.00 77.50 ? 619  COH A CBB   1 
HETATM 9124  N  NC    . COH J  6  .   ? 33.425  25.292 73.326 1.00 77.74 ? 619  COH A NC    1 
HETATM 9125  C  C1C   . COH J  6  .   ? 34.071  24.355 74.115 1.00 77.75 ? 619  COH A C1C   1 
HETATM 9126  C  C2C   . COH J  6  .   ? 33.262  23.145 74.093 1.00 77.47 ? 619  COH A C2C   1 
HETATM 9127  C  C3C   . COH J  6  .   ? 32.187  23.371 73.320 1.00 77.02 ? 619  COH A C3C   1 
HETATM 9128  C  C4C   . COH J  6  .   ? 32.266  24.731 72.819 1.00 77.30 ? 619  COH A C4C   1 
HETATM 9129  C  CMC   . COH J  6  .   ? 33.588  21.824 74.831 1.00 77.09 ? 619  COH A CMC   1 
HETATM 9130  C  CAC   . COH J  6  .   ? 31.057  22.365 73.011 1.00 76.40 ? 619  COH A CAC   1 
HETATM 9131  C  CBC   . COH J  6  .   ? 30.838  21.975 71.753 1.00 75.94 ? 619  COH A CBC   1 
HETATM 9132  N  ND    . COH J  6  .   ? 32.387  27.606 71.782 1.00 77.70 ? 619  COH A ND    1 
HETATM 9133  C  C1D   . COH J  6  .   ? 31.532  26.589 71.357 1.00 77.43 ? 619  COH A C1D   1 
HETATM 9134  C  C2D   . COH J  6  .   ? 30.866  27.028 70.144 1.00 77.26 ? 619  COH A C2D   1 
HETATM 9135  C  C3D   . COH J  6  .   ? 31.408  28.439 69.872 1.00 77.20 ? 619  COH A C3D   1 
HETATM 9136  C  C4D   . COH J  6  .   ? 32.347  28.714 70.938 1.00 77.71 ? 619  COH A C4D   1 
HETATM 9137  C  CMD   . COH J  6  .   ? 29.829  26.251 69.302 1.00 77.09 ? 619  COH A CMD   1 
HETATM 9138  C  CAD   . COH J  6  .   ? 31.052  29.378 68.701 1.00 76.56 ? 619  COH A CAD   1 
HETATM 9139  C  CBD   . COH J  6  .   ? 32.145  29.218 67.645 1.00 76.15 ? 619  COH A CBD   1 
HETATM 9140  C  CGD   . COH J  6  .   ? 32.175  30.393 66.702 1.00 75.65 ? 619  COH A CGD   1 
HETATM 9141  O  O1D   . COH J  6  .   ? 31.085  30.944 66.404 1.00 75.59 ? 619  COH A O1D   1 
HETATM 9142  O  O2D   . COH J  6  .   ? 33.285  30.772 66.243 1.00 74.60 ? 619  COH A O2D   1 
HETATM 9143  C  C1    . NAG K  7  .   ? 52.383  23.110 79.976 1.00 42.04 ? 681  NAG A C1    1 
HETATM 9144  C  C2    . NAG K  7  .   ? 52.491  23.907 81.276 1.00 45.95 ? 681  NAG A C2    1 
HETATM 9145  C  C3    . NAG K  7  .   ? 53.599  23.408 82.206 1.00 46.35 ? 681  NAG A C3    1 
HETATM 9146  C  C4    . NAG K  7  .   ? 53.725  21.888 82.246 1.00 47.09 ? 681  NAG A C4    1 
HETATM 9147  C  C5    . NAG K  7  .   ? 53.629  21.287 80.844 1.00 46.50 ? 681  NAG A C5    1 
HETATM 9148  C  C6    . NAG K  7  .   ? 53.650  19.762 80.870 1.00 47.05 ? 681  NAG A C6    1 
HETATM 9149  C  C7    . NAG K  7  .   ? 52.043  26.278 81.536 1.00 48.03 ? 681  NAG A C7    1 
HETATM 9150  C  C8    . NAG K  7  .   ? 52.362  27.666 81.062 1.00 47.84 ? 681  NAG A C8    1 
HETATM 9151  N  N2    . NAG K  7  .   ? 52.737  25.300 80.965 1.00 46.90 ? 681  NAG A N2    1 
HETATM 9152  O  O3    . NAG K  7  .   ? 53.331  23.863 83.511 1.00 47.77 ? 681  NAG A O3    1 
HETATM 9153  O  O4    . NAG K  7  .   ? 54.967  21.570 82.829 1.00 48.59 ? 681  NAG A O4    1 
HETATM 9154  O  O5    . NAG K  7  .   ? 52.419  21.724 80.261 1.00 44.84 ? 681  NAG A O5    1 
HETATM 9155  O  O6    . NAG K  7  .   ? 53.517  19.252 79.558 1.00 47.86 ? 681  NAG A O6    1 
HETATM 9156  O  O7    . NAG K  7  .   ? 51.185  26.080 82.402 1.00 48.74 ? 681  NAG A O7    1 
HETATM 9157  C  C1    . BOG L  8  .   ? 22.992  33.632 94.116 0.50 38.56 ? 703  BOG A C1    1 
HETATM 9158  O  O1    . BOG L  8  .   ? 23.679  34.401 93.132 0.50 38.01 ? 703  BOG A O1    1 
HETATM 9159  C  C2    . BOG L  8  .   ? 21.551  33.400 93.682 0.50 38.12 ? 703  BOG A C2    1 
HETATM 9160  O  O2    . BOG L  8  .   ? 20.898  34.669 93.598 0.50 38.79 ? 703  BOG A O2    1 
HETATM 9161  C  C3    . BOG L  8  .   ? 20.821  32.502 94.678 0.50 38.49 ? 703  BOG A C3    1 
HETATM 9162  O  O3    . BOG L  8  .   ? 19.540  32.108 94.163 0.50 37.78 ? 703  BOG A O3    1 
HETATM 9163  C  C4    . BOG L  8  .   ? 21.647  31.259 94.993 0.50 38.52 ? 703  BOG A C4    1 
HETATM 9164  O  O4    . BOG L  8  .   ? 21.047  30.539 96.076 0.50 38.55 ? 703  BOG A O4    1 
HETATM 9165  C  C5    . BOG L  8  .   ? 23.072  31.645 95.360 0.50 38.50 ? 703  BOG A C5    1 
HETATM 9166  O  O5    . BOG L  8  .   ? 23.641  32.374 94.281 0.50 38.91 ? 703  BOG A O5    1 
HETATM 9167  C  C6    . BOG L  8  .   ? 23.930  30.418 95.613 0.50 38.89 ? 703  BOG A C6    1 
HETATM 9168  O  O6    . BOG L  8  .   ? 23.908  29.571 94.457 0.50 38.49 ? 703  BOG A O6    1 
HETATM 9169  C  "C1'" . BOG L  8  .   ? 24.670  35.240 93.718 0.50 37.80 ? 703  BOG A "C1'" 1 
HETATM 9170  C  "C2'" . BOG L  8  .   ? 25.776  35.501 92.705 0.50 37.51 ? 703  BOG A "C2'" 1 
HETATM 9171  C  "C3'" . BOG L  8  .   ? 27.051  34.758 93.082 0.50 37.26 ? 703  BOG A "C3'" 1 
HETATM 9172  C  "C4'" . BOG L  8  .   ? 27.882  34.441 91.843 0.50 37.62 ? 703  BOG A "C4'" 1 
HETATM 9173  C  "C5'" . BOG L  8  .   ? 28.249  32.963 91.791 0.50 37.45 ? 703  BOG A "C5'" 1 
HETATM 9174  C  "C6'" . BOG L  8  .   ? 29.593  32.766 91.101 0.50 37.50 ? 703  BOG A "C6'" 1 
HETATM 9175  C  "C7'" . BOG L  8  .   ? 29.909  31.283 90.949 0.50 36.99 ? 703  BOG A "C7'" 1 
HETATM 9176  C  "C8'" . BOG L  8  .   ? 29.675  30.539 92.246 0.50 37.05 ? 703  BOG A "C8'" 1 
HETATM 9177  C  C1    . EDO M  9  .   ? 19.032  14.482 75.405 1.00 42.70 ? 620  EDO A C1    1 
HETATM 9178  O  O1    . EDO M  9  .   ? 19.789  14.483 76.618 1.00 41.76 ? 620  EDO A O1    1 
HETATM 9179  C  C2    . EDO M  9  .   ? 17.584  14.061 75.684 1.00 42.41 ? 620  EDO A C2    1 
HETATM 9180  O  O2    . EDO M  9  .   ? 16.814  15.166 76.172 1.00 41.55 ? 620  EDO A O2    1 
HETATM 9181  C  C1    . EDO N  9  .   ? 17.308  41.706 71.720 1.00 41.76 ? 4    EDO A C1    1 
HETATM 9182  O  O1    . EDO N  9  .   ? 16.354  41.971 70.685 1.00 44.61 ? 4    EDO A O1    1 
HETATM 9183  C  C2    . EDO N  9  .   ? 16.882  40.444 72.475 1.00 42.08 ? 4    EDO A C2    1 
HETATM 9184  O  O2    . EDO N  9  .   ? 17.273  39.264 71.766 1.00 41.10 ? 4    EDO A O2    1 
HETATM 9185  C  C1    . EDO O  9  .   ? -2.145  35.113 52.113 1.00 66.09 ? 5    EDO A C1    1 
HETATM 9186  O  O1    . EDO O  9  .   ? -2.618  35.563 50.840 1.00 67.06 ? 5    EDO A O1    1 
HETATM 9187  C  C2    . EDO O  9  .   ? -2.993  33.931 52.595 1.00 66.00 ? 5    EDO A C2    1 
HETATM 9188  O  O2    . EDO O  9  .   ? -2.989  33.893 54.025 1.00 64.64 ? 5    EDO A O2    1 
HETATM 9189  C  C1    . EDO P  9  .   ? 38.378  5.307  60.956 1.00 37.60 ? 12   EDO A C1    1 
HETATM 9190  O  O1    . EDO P  9  .   ? 39.750  4.883  60.955 1.00 36.64 ? 12   EDO A O1    1 
HETATM 9191  C  C2    . EDO P  9  .   ? 37.582  4.521  59.912 1.00 38.05 ? 12   EDO A C2    1 
HETATM 9192  O  O2    . EDO P  9  .   ? 37.523  3.147  60.294 1.00 37.28 ? 12   EDO A O2    1 
HETATM 9193  C  C1    . ACD Q  4  .   ? 11.021  22.538 26.591 1.00 58.36 ? 1    ACD B C1    1 
HETATM 9194  C  C2    . ACD Q  4  .   ? 12.014  23.321 25.759 1.00 57.73 ? 1    ACD B C2    1 
HETATM 9195  C  C3    . ACD Q  4  .   ? 11.562  23.465 24.309 1.00 56.36 ? 1    ACD B C3    1 
HETATM 9196  C  C4    . ACD Q  4  .   ? 12.759  23.614 23.375 1.00 56.47 ? 1    ACD B C4    1 
HETATM 9197  C  C5    . ACD Q  4  .   ? 13.266  25.042 23.380 1.00 55.62 ? 1    ACD B C5    1 
HETATM 9198  C  C6    . ACD Q  4  .   ? 14.498  25.408 23.753 1.00 55.15 ? 1    ACD B C6    1 
HETATM 9199  C  C7    . ACD Q  4  .   ? 15.590  24.474 24.235 1.00 54.35 ? 1    ACD B C7    1 
HETATM 9200  C  C8    . ACD Q  4  .   ? 16.928  24.954 23.709 1.00 53.83 ? 1    ACD B C8    1 
HETATM 9201  C  C9    . ACD Q  4  .   ? 17.760  25.814 24.323 1.00 53.26 ? 1    ACD B C9    1 
HETATM 9202  C  C10   . ACD Q  4  .   ? 17.555  26.480 25.674 1.00 52.65 ? 1    ACD B C10   1 
HETATM 9203  C  C11   . ACD Q  4  .   ? 16.395  27.460 25.679 1.00 52.10 ? 1    ACD B C11   1 
HETATM 9204  C  C12   . ACD Q  4  .   ? 16.216  28.455 26.559 1.00 50.72 ? 1    ACD B C12   1 
HETATM 9205  C  C13   . ACD Q  4  .   ? 17.142  28.799 27.709 1.00 50.51 ? 1    ACD B C13   1 
HETATM 9206  C  C14   . ACD Q  4  .   ? 16.293  29.392 28.801 1.00 49.81 ? 1    ACD B C14   1 
HETATM 9207  C  C15   . ACD Q  4  .   ? 16.621  29.475 30.091 1.00 48.90 ? 1    ACD B C15   1 
HETATM 9208  C  C16   . ACD Q  4  .   ? 17.921  29.012 30.698 1.00 48.36 ? 1    ACD B C16   1 
HETATM 9209  C  C17   . ACD Q  4  .   ? 17.707  28.809 32.193 1.00 45.93 ? 1    ACD B C17   1 
HETATM 9210  C  C18   . ACD Q  4  .   ? 18.559  29.758 33.016 1.00 46.62 ? 1    ACD B C18   1 
HETATM 9211  C  C19   . ACD Q  4  .   ? 19.542  29.016 33.905 1.00 45.54 ? 1    ACD B C19   1 
HETATM 9212  C  C20   . ACD Q  4  .   ? 20.867  28.846 33.225 1.00 45.88 ? 1    ACD B C20   1 
HETATM 9213  O  O1    . ACD Q  4  .   ? 10.032  22.024 26.018 1.00 58.70 ? 1    ACD B O1    1 
HETATM 9214  O  O2    . ACD Q  4  .   ? 11.211  22.430 27.820 1.00 59.71 ? 1    ACD B O2    1 
HETATM 9215  CO CO    . COH R  6  .   ? 27.875  36.353 21.221 1.00 63.83 ? 619  COH B CO    1 
HETATM 9216  C  CHA   . COH R  6  .   ? 30.349  35.071 23.283 1.00 64.48 ? 619  COH B CHA   1 
HETATM 9217  C  CHB   . COH R  6  .   ? 30.230  38.414 19.762 1.00 64.64 ? 619  COH B CHB   1 
HETATM 9218  C  CHC   . COH R  6  .   ? 25.376  38.082 19.574 1.00 63.96 ? 619  COH B CHC   1 
HETATM 9219  C  CHD   . COH R  6  .   ? 25.623  34.097 22.359 1.00 63.68 ? 619  COH B CHD   1 
HETATM 9220  N  NA    . COH R  6  .   ? 29.949  36.649 21.448 1.00 64.66 ? 619  COH B NA    1 
HETATM 9221  C  C1A   . COH R  6  .   ? 30.742  36.083 22.428 1.00 65.07 ? 619  COH B C1A   1 
HETATM 9222  C  C2A   . COH R  6  .   ? 32.040  36.741 22.392 1.00 66.06 ? 619  COH B C2A   1 
HETATM 9223  C  C3A   . COH R  6  .   ? 32.006  37.670 21.416 1.00 65.53 ? 619  COH B C3A   1 
HETATM 9224  C  C4A   . COH R  6  .   ? 30.686  37.627 20.804 1.00 65.03 ? 619  COH B C4A   1 
HETATM 9225  C  CMA   . COH R  6  .   ? 33.150  38.628 20.994 1.00 65.05 ? 619  COH B CMA   1 
HETATM 9226  C  CAA   . COH R  6  .   ? 33.234  36.409 23.326 1.00 67.41 ? 619  COH B CAA   1 
HETATM 9227  C  CBA   . COH R  6  .   ? 34.251  35.558 22.563 1.00 69.25 ? 619  COH B CBA   1 
HETATM 9228  C  CGA   . COH R  6  .   ? 34.380  34.151 23.098 1.00 70.51 ? 619  COH B CGA   1 
HETATM 9229  O  O1A   . COH R  6  .   ? 35.497  33.581 22.960 1.00 71.02 ? 619  COH B O1A   1 
HETATM 9230  O  O2A   . COH R  6  .   ? 33.391  33.587 23.647 1.00 71.18 ? 619  COH B O2A   1 
HETATM 9231  N  NB    . COH R  6  .   ? 27.820  37.942 19.853 1.00 64.25 ? 619  COH B NB    1 
HETATM 9232  C  C1B   . COH R  6  .   ? 28.911  38.711 19.484 1.00 64.30 ? 619  COH B C1B   1 
HETATM 9233  C  C2B   . COH R  6  .   ? 28.415  39.870 18.765 1.00 64.33 ? 619  COH B C2B   1 
HETATM 9234  C  C3B   . COH R  6  .   ? 27.078  39.784 18.715 1.00 64.23 ? 619  COH B C3B   1 
HETATM 9235  C  C4B   . COH R  6  .   ? 26.668  38.562 19.399 1.00 64.12 ? 619  COH B C4B   1 
HETATM 9236  C  CMB   . COH R  6  .   ? 29.288  41.001 18.169 1.00 64.20 ? 619  COH B CMB   1 
HETATM 9237  C  CAB   . COH R  6  .   ? 26.137  40.808 18.041 1.00 64.02 ? 619  COH B CAB   1 
HETATM 9238  C  CBB   . COH R  6  .   ? 25.324  41.558 18.790 1.00 63.71 ? 619  COH B CBB   1 
HETATM 9239  N  NC    . COH R  6  .   ? 25.835  36.150 21.030 1.00 63.93 ? 619  COH B NC    1 
HETATM 9240  C  C1C   . COH R  6  .   ? 24.998  36.925 20.246 1.00 64.01 ? 619  COH B C1C   1 
HETATM 9241  C  C2C   . COH R  6  .   ? 23.682  36.301 20.275 1.00 63.50 ? 619  COH B C2C   1 
HETATM 9242  C  C3C   . COH R  6  .   ? 23.753  35.205 21.048 1.00 63.32 ? 619  COH B C3C   1 
HETATM 9243  C  C4C   . COH R  6  .   ? 25.115  35.086 21.538 1.00 63.56 ? 619  COH B C4C   1 
HETATM 9244  C  CMC   . COH R  6  .   ? 22.420  36.818 19.544 1.00 63.12 ? 619  COH B CMC   1 
HETATM 9245  C  CAC   . COH R  6  .   ? 22.593  34.229 21.360 1.00 62.82 ? 619  COH B CAC   1 
HETATM 9246  C  CBC   . COH R  6  .   ? 22.369  33.801 22.607 1.00 62.69 ? 619  COH B CBC   1 
HETATM 9247  N  ND    . COH R  6  .   ? 27.996  34.759 22.573 1.00 63.99 ? 619  COH B ND    1 
HETATM 9248  C  C1D   . COH R  6  .   ? 26.852  34.081 22.992 1.00 63.84 ? 619  COH B C1D   1 
HETATM 9249  C  C2D   . COH R  6  .   ? 27.167  33.355 24.204 1.00 63.66 ? 619  COH B C2D   1 
HETATM 9250  C  C3D   . COH R  6  .   ? 28.647  33.663 24.489 1.00 63.75 ? 619  COH B C3D   1 
HETATM 9251  C  C4D   . COH R  6  .   ? 29.078  34.544 23.425 1.00 63.90 ? 619  COH B C4D   1 
HETATM 9252  C  CMD   . COH R  6  .   ? 26.216  32.464 25.030 1.00 63.51 ? 619  COH B CMD   1 
HETATM 9253  C  CAD   . COH R  6  .   ? 29.499  33.154 25.669 1.00 62.99 ? 619  COH B CAD   1 
HETATM 9254  C  CBD   . COH R  6  .   ? 29.419  34.192 26.784 1.00 62.69 ? 619  COH B CBD   1 
HETATM 9255  C  CGD   . COH R  6  .   ? 30.484  33.948 27.821 1.00 62.66 ? 619  COH B CGD   1 
HETATM 9256  O  O1D   . COH R  6  .   ? 30.844  32.761 28.046 1.00 63.13 ? 619  COH B O1D   1 
HETATM 9257  O  O2D   . COH R  6  .   ? 30.972  34.941 28.426 1.00 61.77 ? 619  COH B O2D   1 
HETATM 9258  C  C1    . NAG S  7  .   ? 27.701  55.338 14.876 1.00 44.86 ? 681  NAG B C1    1 
HETATM 9259  C  C2    . NAG S  7  .   ? 28.626  55.432 13.660 1.00 49.56 ? 681  NAG B C2    1 
HETATM 9260  C  C3    . NAG S  7  .   ? 28.435  56.765 12.943 1.00 50.76 ? 681  NAG B C3    1 
HETATM 9261  C  C4    . NAG S  7  .   ? 26.961  57.088 12.687 1.00 50.65 ? 681  NAG B C4    1 
HETATM 9262  C  C5    . NAG S  7  .   ? 26.090  56.822 13.916 1.00 49.92 ? 681  NAG B C5    1 
HETATM 9263  C  C6    . NAG S  7  .   ? 24.604  56.916 13.573 1.00 49.63 ? 681  NAG B C6    1 
HETATM 9264  C  C7    . NAG S  7  .   ? 30.814  54.329 13.556 1.00 52.22 ? 681  NAG B C7    1 
HETATM 9265  C  C8    . NAG S  7  .   ? 32.211  54.277 14.102 1.00 52.64 ? 681  NAG B C8    1 
HETATM 9266  N  N2    . NAG S  7  .   ? 30.022  55.288 14.044 1.00 51.05 ? 681  NAG B N2    1 
HETATM 9267  O  O3    . NAG S  7  .   ? 29.120  56.728 11.708 1.00 52.56 ? 681  NAG B O3    1 
HETATM 9268  O  O4    . NAG S  7  .   ? 26.864  58.450 12.332 1.00 53.01 ? 681  NAG B O4    1 
HETATM 9269  O  O5    . NAG S  7  .   ? 26.362  55.538 14.455 1.00 47.76 ? 681  NAG B O5    1 
HETATM 9270  O  O6    . NAG S  7  .   ? 23.887  57.263 14.738 1.00 50.15 ? 681  NAG B O6    1 
HETATM 9271  O  O7    . NAG S  7  .   ? 30.458  53.511 12.703 1.00 53.08 ? 681  NAG B O7    1 
HETATM 9272  C  C1    . BOG T  8  .   ? 37.244  32.538 3.706  0.50 32.53 ? 703  BOG B C1    1 
HETATM 9273  O  O1    . BOG T  8  .   ? 36.649  31.827 2.630  0.50 32.23 ? 703  BOG B O1    1 
HETATM 9274  C  C2    . BOG T  8  .   ? 38.501  33.237 3.223  0.50 32.09 ? 703  BOG B C2    1 
HETATM 9275  O  O2    . BOG T  8  .   ? 39.406  32.265 2.694  0.50 32.85 ? 703  BOG B O2    1 
HETATM 9276  C  C3    . BOG T  8  .   ? 39.124  33.987 4.391  0.50 32.34 ? 703  BOG B C3    1 
HETATM 9277  O  O3    . BOG T  8  .   ? 40.315  34.686 3.995  0.50 31.31 ? 703  BOG B O3    1 
HETATM 9278  C  C4    . BOG T  8  .   ? 38.095  34.970 4.937  0.50 32.16 ? 703  BOG B C4    1 
HETATM 9279  O  O4    . BOG T  8  .   ? 38.624  35.607 6.103  0.50 32.18 ? 703  BOG B O4    1 
HETATM 9280  C  C5    . BOG T  8  .   ? 36.795  34.256 5.286  0.50 32.35 ? 703  BOG B C5    1 
HETATM 9281  O  O5    . BOG T  8  .   ? 36.315  33.513 4.169  0.50 33.02 ? 703  BOG B O5    1 
HETATM 9282  C  C6    . BOG T  8  .   ? 35.709  35.251 5.656  0.50 32.44 ? 703  BOG B C6    1 
HETATM 9283  O  O6    . BOG T  8  .   ? 35.243  35.901 4.470  0.50 32.57 ? 703  BOG B O6    1 
HETATM 9284  C  "C1'" . BOG T  8  .   ? 35.327  31.429 2.970  0.50 32.12 ? 703  BOG B "C1'" 1 
HETATM 9285  C  "C2'" . BOG T  8  .   ? 34.829  30.431 1.939  0.50 32.03 ? 703  BOG B "C2'" 1 
HETATM 9286  C  "C3'" . BOG T  8  .   ? 33.491  29.865 2.392  0.50 31.83 ? 703  BOG B "C3'" 1 
HETATM 9287  C  "C4'" . BOG T  8  .   ? 32.341  30.752 1.938  0.50 31.91 ? 703  BOG B "C4'" 1 
HETATM 9288  C  "C5'" . BOG T  8  .   ? 32.214  32.007 2.791  0.50 31.89 ? 703  BOG B "C5'" 1 
HETATM 9289  C  "C6'" . BOG T  8  .   ? 31.152  32.935 2.208  0.50 31.34 ? 703  BOG B "C6'" 1 
HETATM 9290  C  "C7'" . BOG T  8  .   ? 31.761  34.251 1.741  0.50 30.81 ? 703  BOG B "C7'" 1 
HETATM 9291  C  "C8'" . BOG T  8  .   ? 30.785  35.017 0.871  0.50 31.15 ? 703  BOG B "C8'" 1 
HETATM 9292  C  C1    . EDO U  9  .   ? 12.544  22.377 17.363 1.00 50.32 ? 2    EDO B C1    1 
HETATM 9293  O  O1    . EDO U  9  .   ? 13.658  21.531 17.078 1.00 49.69 ? 2    EDO B O1    1 
HETATM 9294  C  C2    . EDO U  9  .   ? 13.024  23.726 17.915 1.00 50.93 ? 2    EDO B C2    1 
HETATM 9295  O  O2    . EDO U  9  .   ? 13.369  24.596 16.835 1.00 51.16 ? 2    EDO B O2    1 
HETATM 9296  C  C1    . EDO V  9  .   ? 11.912  57.267 37.230 1.00 36.71 ? 3    EDO B C1    1 
HETATM 9297  O  O1    . EDO V  9  .   ? 11.524  56.563 38.405 1.00 34.45 ? 3    EDO B O1    1 
HETATM 9298  C  C2    . EDO V  9  .   ? 13.252  56.750 36.710 1.00 35.77 ? 3    EDO B C2    1 
HETATM 9299  O  O2    . EDO V  9  .   ? 13.097  55.467 36.134 1.00 35.67 ? 3    EDO B O2    1 
HETATM 9300  C  C1    . EDO W  9  .   ? 39.771  17.579 22.500 1.00 43.70 ? 6    EDO B C1    1 
HETATM 9301  O  O1    . EDO W  9  .   ? 39.477  16.611 23.507 1.00 45.51 ? 6    EDO B O1    1 
HETATM 9302  C  C2    . EDO W  9  .   ? 38.560  17.645 21.572 1.00 44.40 ? 6    EDO B C2    1 
HETATM 9303  O  O2    . EDO W  9  .   ? 37.379  17.959 22.322 1.00 43.08 ? 6    EDO B O2    1 
HETATM 9304  C  C1    . EDO X  9  .   ? 33.247  -0.113 42.001 1.00 67.75 ? 7    EDO B C1    1 
HETATM 9305  O  O1    . EDO X  9  .   ? 32.051  -0.882 42.162 1.00 68.41 ? 7    EDO B O1    1 
HETATM 9306  C  C2    . EDO X  9  .   ? 32.896  1.248  41.405 1.00 67.49 ? 7    EDO B C2    1 
HETATM 9307  O  O2    . EDO X  9  .   ? 33.814  1.582  40.359 1.00 67.63 ? 7    EDO B O2    1 
HETATM 9308  C  C1    . EDO Y  9  .   ? 5.617   43.273 33.794 1.00 39.10 ? 8    EDO B C1    1 
HETATM 9309  O  O1    . EDO Y  9  .   ? 4.288   43.170 33.276 1.00 39.23 ? 8    EDO B O1    1 
HETATM 9310  C  C2    . EDO Y  9  .   ? 6.494   44.004 32.786 1.00 37.76 ? 8    EDO B C2    1 
HETATM 9311  O  O2    . EDO Y  9  .   ? 6.288   45.417 32.889 1.00 36.80 ? 8    EDO B O2    1 
HETATM 9312  C  C1    . EDO Z  9  .   ? 31.204  28.100 49.094 1.00 42.82 ? 9    EDO B C1    1 
HETATM 9313  O  O1    . EDO Z  9  .   ? 32.486  27.482 49.185 1.00 43.96 ? 9    EDO B O1    1 
HETATM 9314  C  C2    . EDO Z  9  .   ? 30.545  27.628 47.805 1.00 43.64 ? 9    EDO B C2    1 
HETATM 9315  O  O2    . EDO Z  9  .   ? 30.890  26.251 47.583 1.00 42.68 ? 9    EDO B O2    1 
HETATM 9316  C  C1    . EDO AA 9  .   ? 17.047  52.461 53.575 1.00 37.52 ? 10   EDO B C1    1 
HETATM 9317  O  O1    . EDO AA 9  .   ? 16.450  51.377 54.277 1.00 36.93 ? 10   EDO B O1    1 
HETATM 9318  C  C2    . EDO AA 9  .   ? 18.498  52.141 53.200 1.00 37.96 ? 10   EDO B C2    1 
HETATM 9319  O  O2    . EDO AA 9  .   ? 18.665  52.195 51.778 1.00 35.69 ? 10   EDO B O2    1 
HETATM 9320  C  C1    . EDO BA 9  .   ? 32.364  47.408 40.217 1.00 52.21 ? 11   EDO B C1    1 
HETATM 9321  O  O1    . EDO BA 9  .   ? 32.373  48.172 41.429 1.00 53.10 ? 11   EDO B O1    1 
HETATM 9322  C  C2    . EDO BA 9  .   ? 33.330  48.023 39.221 1.00 52.25 ? 11   EDO B C2    1 
HETATM 9323  O  O2    . EDO BA 9  .   ? 33.064  49.416 39.113 1.00 53.08 ? 11   EDO B O2    1 
HETATM 9324  O  O     . HOH CA 10 .   ? 41.566  21.314 46.072 1.00 15.85 ? 7    HOH A O     1 
HETATM 9325  O  O     . HOH CA 10 .   ? 41.663  19.493 62.533 1.00 2.86  ? 8    HOH A O     1 
HETATM 9326  O  O     . HOH CA 10 .   ? 48.398  14.872 40.675 1.00 16.72 ? 10   HOH A O     1 
HETATM 9327  O  O     . HOH CA 10 .   ? 49.020  16.062 48.560 1.00 7.42  ? 13   HOH A O     1 
HETATM 9328  O  O     . HOH CA 10 .   ? 16.535  35.068 72.804 1.00 15.13 ? 17   HOH A O     1 
HETATM 9329  O  O     . HOH CA 10 .   ? 22.169  25.141 60.767 1.00 12.88 ? 19   HOH A O     1 
HETATM 9330  O  O     . HOH CA 10 .   ? 18.912  42.699 63.402 1.00 17.73 ? 23   HOH A O     1 
HETATM 9331  O  O     . HOH CA 10 .   ? 19.593  25.162 52.893 1.00 19.21 ? 25   HOH A O     1 
HETATM 9332  O  O     . HOH CA 10 .   ? 18.039  22.191 77.302 1.00 12.71 ? 26   HOH A O     1 
HETATM 9333  O  O     . HOH CA 10 .   ? 19.392  33.906 73.283 1.00 18.47 ? 27   HOH A O     1 
HETATM 9334  O  O     . HOH CA 10 .   ? 10.216  33.519 76.114 1.00 14.11 ? 28   HOH A O     1 
HETATM 9335  O  O     . HOH CA 10 .   ? 56.423  27.036 63.710 1.00 17.30 ? 621  HOH A O     1 
HETATM 9336  O  O     . HOH CA 10 .   ? 22.002  36.199 63.120 1.00 12.31 ? 622  HOH A O     1 
HETATM 9337  O  O     . HOH CA 10 .   ? 40.923  25.040 86.557 1.00 33.81 ? 623  HOH A O     1 
HETATM 9338  O  O     . HOH CA 10 .   ? 13.875  46.081 70.009 1.00 37.59 ? 624  HOH A O     1 
HETATM 9339  O  O     . HOH CA 10 .   ? 4.980   28.600 64.533 1.00 16.48 ? 625  HOH A O     1 
HETATM 9340  O  O     . HOH CA 10 .   ? 29.770  41.196 46.586 1.00 37.46 ? 626  HOH A O     1 
HETATM 9341  O  O     . HOH CA 10 .   ? 39.467  26.142 58.544 1.00 20.11 ? 627  HOH A O     1 
HETATM 9342  O  O     . HOH CA 10 .   ? 20.264  27.266 47.651 1.00 27.28 ? 628  HOH A O     1 
HETATM 9343  O  O     . HOH CA 10 .   ? 15.218  35.930 65.849 1.00 13.19 ? 629  HOH A O     1 
HETATM 9344  O  O     . HOH CA 10 .   ? 12.994  27.999 50.581 1.00 20.69 ? 630  HOH A O     1 
HETATM 9345  O  O     . HOH CA 10 .   ? 32.547  2.960  68.512 1.00 16.81 ? 631  HOH A O     1 
HETATM 9346  O  O     . HOH CA 10 .   ? 30.293  35.965 50.774 1.00 39.04 ? 632  HOH A O     1 
HETATM 9347  O  O     . HOH CA 10 .   ? 13.252  16.656 46.614 1.00 28.86 ? 633  HOH A O     1 
HETATM 9348  O  O     . HOH CA 10 .   ? 8.699   35.614 62.978 1.00 23.10 ? 634  HOH A O     1 
HETATM 9349  O  O     . HOH CA 10 .   ? 15.016  19.908 52.860 1.00 20.76 ? 635  HOH A O     1 
HETATM 9350  O  O     . HOH CA 10 .   ? 33.327  26.005 55.218 1.00 15.63 ? 636  HOH A O     1 
HETATM 9351  O  O     . HOH CA 10 .   ? 52.634  7.946  64.499 1.00 9.61  ? 637  HOH A O     1 
HETATM 9352  O  O     . HOH CA 10 .   ? 9.462   38.088 52.811 1.00 15.88 ? 638  HOH A O     1 
HETATM 9353  O  O     . HOH CA 10 .   ? -4.431  41.617 60.004 1.00 26.70 ? 639  HOH A O     1 
HETATM 9354  O  O     . HOH CA 10 .   ? 38.344  29.898 58.507 1.00 20.09 ? 640  HOH A O     1 
HETATM 9355  O  O     . HOH CA 10 .   ? 36.345  27.329 86.052 1.00 16.28 ? 641  HOH A O     1 
HETATM 9356  O  O     . HOH CA 10 .   ? 18.279  37.427 73.381 1.00 19.89 ? 642  HOH A O     1 
HETATM 9357  O  O     . HOH CA 10 .   ? 37.638  15.949 47.583 1.00 9.86  ? 643  HOH A O     1 
HETATM 9358  O  O     . HOH CA 10 .   ? 23.743  33.011 54.472 1.00 21.25 ? 644  HOH A O     1 
HETATM 9359  O  O     . HOH CA 10 .   ? 20.426  10.934 50.797 1.00 10.69 ? 645  HOH A O     1 
HETATM 9360  O  O     . HOH CA 10 .   ? 37.171  6.939  41.639 1.00 10.34 ? 646  HOH A O     1 
HETATM 9361  O  O     . HOH CA 10 .   ? -10.871 22.929 56.652 1.00 3.69  ? 647  HOH A O     1 
HETATM 9362  O  O     . HOH CA 10 .   ? 49.262  19.158 56.962 1.00 9.42  ? 648  HOH A O     1 
HETATM 9363  O  O     . HOH CA 10 .   ? 17.954  45.370 76.801 1.00 21.36 ? 649  HOH A O     1 
HETATM 9364  O  O     . HOH CA 10 .   ? 16.840  30.266 56.800 1.00 10.99 ? 650  HOH A O     1 
HETATM 9365  O  O     . HOH CA 10 .   ? 28.621  34.976 49.121 1.00 13.48 ? 651  HOH A O     1 
HETATM 9366  O  O     . HOH CA 10 .   ? 45.023  19.541 59.394 1.00 13.04 ? 652  HOH A O     1 
HETATM 9367  O  O     . HOH CA 10 .   ? 18.620  21.383 46.746 1.00 15.54 ? 653  HOH A O     1 
HETATM 9368  O  O     . HOH CA 10 .   ? 4.250   27.650 54.614 1.00 23.39 ? 654  HOH A O     1 
HETATM 9369  O  O     . HOH CA 10 .   ? 13.224  42.144 61.195 1.00 19.79 ? 655  HOH A O     1 
HETATM 9370  O  O     . HOH CA 10 .   ? 43.418  29.616 69.501 1.00 40.96 ? 656  HOH A O     1 
HETATM 9371  O  O     . HOH CA 10 .   ? 33.498  23.977 51.166 1.00 16.68 ? 657  HOH A O     1 
HETATM 9372  O  O     . HOH CA 10 .   ? 26.277  40.620 63.125 1.00 3.03  ? 658  HOH A O     1 
HETATM 9373  O  O     . HOH CA 10 .   ? 41.481  8.535  37.179 1.00 22.17 ? 659  HOH A O     1 
HETATM 9374  O  O     . HOH CA 10 .   ? 31.124  39.812 89.952 1.00 20.45 ? 660  HOH A O     1 
HETATM 9375  O  O     . HOH CA 10 .   ? 17.094  14.283 85.522 1.00 21.15 ? 663  HOH A O     1 
HETATM 9376  O  O     . HOH CA 10 .   ? 20.870  8.333  57.702 1.00 12.43 ? 664  HOH A O     1 
HETATM 9377  O  O     . HOH CA 10 .   ? 39.128  19.582 48.173 1.00 13.70 ? 665  HOH A O     1 
HETATM 9378  O  O     . HOH CA 10 .   ? 12.256  48.878 62.412 1.00 28.52 ? 666  HOH A O     1 
HETATM 9379  O  O     . HOH CA 10 .   ? 13.638  43.115 82.774 1.00 25.04 ? 667  HOH A O     1 
HETATM 9380  O  O     . HOH CA 10 .   ? 5.864   45.656 77.553 1.00 22.62 ? 668  HOH A O     1 
HETATM 9381  O  O     . HOH CA 10 .   ? 19.535  -3.474 70.199 1.00 17.69 ? 669  HOH A O     1 
HETATM 9382  O  O     . HOH CA 10 .   ? 37.039  29.116 69.626 1.00 42.66 ? 670  HOH A O     1 
HETATM 9383  O  O     . HOH CA 10 .   ? 19.470  33.289 54.672 1.00 17.46 ? 674  HOH A O     1 
HETATM 9384  O  O     . HOH CA 10 .   ? 11.340  42.375 75.930 1.00 17.58 ? 675  HOH A O     1 
HETATM 9385  O  O     . HOH CA 10 .   ? 27.041  17.930 91.947 1.00 21.65 ? 676  HOH A O     1 
HETATM 9386  O  O     . HOH CA 10 .   ? 14.297  3.246  51.980 1.00 45.00 ? 677  HOH A O     1 
HETATM 9387  O  O     . HOH CA 10 .   ? 14.957  43.595 58.255 1.00 18.03 ? 678  HOH A O     1 
HETATM 9388  O  O     . HOH CA 10 .   ? 26.660  24.072 90.450 1.00 9.41  ? 679  HOH A O     1 
HETATM 9389  O  O     . HOH CA 10 .   ? 27.636  5.942  71.006 1.00 30.63 ? 680  HOH A O     1 
HETATM 9390  O  O     . HOH CA 10 .   ? 12.474  23.917 49.304 1.00 12.09 ? 682  HOH A O     1 
HETATM 9391  O  O     . HOH CA 10 .   ? 49.821  7.129  68.947 1.00 17.81 ? 683  HOH A O     1 
HETATM 9392  O  O     . HOH CA 10 .   ? 24.461  42.818 53.047 1.00 10.51 ? 684  HOH A O     1 
HETATM 9393  O  O     . HOH CA 10 .   ? 48.743  5.894  43.168 1.00 12.08 ? 685  HOH A O     1 
HETATM 9394  O  O     . HOH CA 10 .   ? 23.238  45.067 52.493 1.00 25.20 ? 686  HOH A O     1 
HETATM 9395  O  O     . HOH CA 10 .   ? 24.695  14.329 87.581 1.00 25.26 ? 687  HOH A O     1 
HETATM 9396  O  O     . HOH CA 10 .   ? 44.798  10.186 39.137 1.00 13.50 ? 688  HOH A O     1 
HETATM 9397  O  O     . HOH CA 10 .   ? -7.643  37.798 69.643 1.00 58.53 ? 689  HOH A O     1 
HETATM 9398  O  O     . HOH CA 10 .   ? 5.560   25.939 56.656 1.00 38.18 ? 690  HOH A O     1 
HETATM 9399  O  O     . HOH CA 10 .   ? 22.942  21.269 85.622 1.00 5.04  ? 691  HOH A O     1 
HETATM 9400  O  O     . HOH CA 10 .   ? 22.929  36.228 60.489 1.00 15.01 ? 692  HOH A O     1 
HETATM 9401  O  O     . HOH CA 10 .   ? 7.285   37.001 59.564 1.00 28.42 ? 693  HOH A O     1 
HETATM 9402  O  O     . HOH CA 10 .   ? 18.159  10.941 76.870 1.00 22.82 ? 694  HOH A O     1 
HETATM 9403  O  O     . HOH CA 10 .   ? 7.404   31.702 66.320 1.00 11.41 ? 695  HOH A O     1 
HETATM 9404  O  O     . HOH CA 10 .   ? 47.927  19.683 59.429 1.00 15.96 ? 696  HOH A O     1 
HETATM 9405  O  O     . HOH CA 10 .   ? 36.145  2.041  58.227 1.00 13.74 ? 697  HOH A O     1 
HETATM 9406  O  O     . HOH CA 10 .   ? 1.581   27.172 76.518 1.00 25.99 ? 698  HOH A O     1 
HETATM 9407  O  O     . HOH CA 10 .   ? 55.584  16.066 55.440 1.00 22.70 ? 699  HOH A O     1 
HETATM 9408  O  O     . HOH CA 10 .   ? 50.603  7.777  75.096 1.00 14.35 ? 700  HOH A O     1 
HETATM 9409  O  O     . HOH CA 10 .   ? 45.546  12.762 40.035 1.00 10.38 ? 701  HOH A O     1 
HETATM 9410  O  O     . HOH CA 10 .   ? 26.315  6.314  75.168 1.00 27.95 ? 702  HOH A O     1 
HETATM 9411  O  O     . HOH CA 10 .   ? 52.106  10.976 44.212 1.00 20.37 ? 704  HOH A O     1 
HETATM 9412  O  O     . HOH CA 10 .   ? 47.351  5.751  60.888 1.00 12.20 ? 705  HOH A O     1 
HETATM 9413  O  O     . HOH CA 10 .   ? 43.695  9.352  84.156 1.00 27.60 ? 706  HOH A O     1 
HETATM 9414  O  O     . HOH CA 10 .   ? 26.395  43.032 82.025 1.00 36.37 ? 707  HOH A O     1 
HETATM 9415  O  O     . HOH CA 10 .   ? 48.984  27.892 48.177 1.00 32.38 ? 708  HOH A O     1 
HETATM 9416  O  O     . HOH CA 10 .   ? 54.353  12.269 71.991 1.00 20.05 ? 709  HOH A O     1 
HETATM 9417  O  O     . HOH CA 10 .   ? 31.326  24.979 56.890 1.00 5.72  ? 710  HOH A O     1 
HETATM 9418  O  O     . HOH CA 10 .   ? 10.412  49.059 81.552 1.00 27.56 ? 711  HOH A O     1 
HETATM 9419  O  O     . HOH CA 10 .   ? 46.703  2.328  55.253 1.00 36.73 ? 712  HOH A O     1 
HETATM 9420  O  O     . HOH CA 10 .   ? 54.120  9.607  73.165 1.00 23.75 ? 713  HOH A O     1 
HETATM 9421  O  O     . HOH CA 10 .   ? 12.889  23.578 93.781 1.00 31.63 ? 714  HOH A O     1 
HETATM 9422  O  O     . HOH CA 10 .   ? 37.434  23.742 52.535 1.00 19.93 ? 715  HOH A O     1 
HETATM 9423  O  O     . HOH CA 10 .   ? 14.410  5.810  50.023 1.00 28.56 ? 716  HOH A O     1 
HETATM 9424  O  O     . HOH CA 10 .   ? 35.910  -1.538 43.104 1.00 26.62 ? 717  HOH A O     1 
HETATM 9425  O  O     . HOH CA 10 .   ? 4.396   37.432 63.244 1.00 13.97 ? 718  HOH A O     1 
HETATM 9426  O  O     . HOH CA 10 .   ? 15.616  46.495 55.003 1.00 24.47 ? 719  HOH A O     1 
HETATM 9427  O  O     . HOH CA 10 .   ? 10.502  39.547 50.723 1.00 8.48  ? 720  HOH A O     1 
HETATM 9428  O  O     . HOH CA 10 .   ? 33.994  26.574 87.902 1.00 16.34 ? 721  HOH A O     1 
HETATM 9429  O  O     . HOH CA 10 .   ? 0.429   45.435 64.998 1.00 19.90 ? 722  HOH A O     1 
HETATM 9430  O  O     . HOH CA 10 .   ? 40.865  10.903 83.213 1.00 16.38 ? 723  HOH A O     1 
HETATM 9431  O  O     . HOH CA 10 .   ? 13.514  8.737  79.309 1.00 21.74 ? 724  HOH A O     1 
HETATM 9432  O  O     . HOH CA 10 .   ? 40.298  23.108 51.275 1.00 16.89 ? 725  HOH A O     1 
HETATM 9433  O  O     . HOH CA 10 .   ? 18.453  44.167 74.398 1.00 28.67 ? 726  HOH A O     1 
HETATM 9434  O  O     . HOH CA 10 .   ? 37.945  31.056 61.099 1.00 45.52 ? 727  HOH A O     1 
HETATM 9435  O  O     . HOH CA 10 .   ? 17.763  24.361 91.757 1.00 22.27 ? 728  HOH A O     1 
HETATM 9436  O  O     . HOH CA 10 .   ? 43.787  17.892 61.240 1.00 15.76 ? 729  HOH A O     1 
HETATM 9437  O  O     . HOH CA 10 .   ? 44.294  -1.283 49.743 1.00 31.86 ? 730  HOH A O     1 
HETATM 9438  O  O     . HOH CA 10 .   ? 28.729  2.516  63.595 1.00 25.45 ? 731  HOH A O     1 
HETATM 9439  O  O     . HOH CA 10 .   ? 29.428  28.651 58.590 1.00 5.89  ? 732  HOH A O     1 
HETATM 9440  O  O     . HOH CA 10 .   ? 54.269  8.909  51.259 1.00 26.63 ? 733  HOH A O     1 
HETATM 9441  O  O     . HOH CA 10 .   ? 19.492  -4.686 61.599 1.00 7.96  ? 734  HOH A O     1 
HETATM 9442  O  O     . HOH CA 10 .   ? 54.847  6.722  63.684 1.00 26.81 ? 735  HOH A O     1 
HETATM 9443  O  O     . HOH CA 10 .   ? 21.134  23.668 89.096 1.00 27.94 ? 736  HOH A O     1 
HETATM 9444  O  O     . HOH CA 10 .   ? 9.873   29.878 92.194 1.00 11.37 ? 737  HOH A O     1 
HETATM 9445  O  O     . HOH CA 10 .   ? 13.533  48.256 82.129 1.00 30.89 ? 738  HOH A O     1 
HETATM 9446  O  O     . HOH CA 10 .   ? 49.028  2.949  56.222 1.00 26.99 ? 739  HOH A O     1 
HETATM 9447  O  O     . HOH CA 10 .   ? 9.193   41.031 67.076 1.00 15.03 ? 740  HOH A O     1 
HETATM 9448  O  O     . HOH CA 10 .   ? 23.456  8.173  76.292 1.00 29.80 ? 741  HOH A O     1 
HETATM 9449  O  O     . HOH CA 10 .   ? 47.992  3.399  59.897 1.00 31.54 ? 742  HOH A O     1 
HETATM 9450  O  O     . HOH CA 10 .   ? 25.592  38.001 47.547 1.00 15.63 ? 743  HOH A O     1 
HETATM 9451  O  O     . HOH CA 10 .   ? 64.282  30.584 60.714 1.00 18.85 ? 744  HOH A O     1 
HETATM 9452  O  O     . HOH CA 10 .   ? 56.552  29.822 64.173 1.00 24.35 ? 745  HOH A O     1 
HETATM 9453  O  O     . HOH CA 10 .   ? -1.431  36.898 67.531 1.00 13.46 ? 746  HOH A O     1 
HETATM 9454  O  O     . HOH CA 10 .   ? 16.925  37.572 90.619 1.00 19.13 ? 747  HOH A O     1 
HETATM 9455  O  O     . HOH CA 10 .   ? 24.998  0.828  61.801 1.00 18.95 ? 748  HOH A O     1 
HETATM 9456  O  O     . HOH CA 10 .   ? 51.367  10.290 70.446 1.00 18.11 ? 749  HOH A O     1 
HETATM 9457  O  O     . HOH CA 10 .   ? 23.986  3.673  66.215 1.00 21.89 ? 750  HOH A O     1 
HETATM 9458  O  O     . HOH CA 10 .   ? 3.500   25.983 69.730 1.00 22.89 ? 751  HOH A O     1 
HETATM 9459  O  O     . HOH CA 10 .   ? 48.435  7.388  58.936 1.00 9.97  ? 752  HOH A O     1 
HETATM 9460  O  O     . HOH CA 10 .   ? 6.911   24.574 63.692 1.00 12.49 ? 753  HOH A O     1 
HETATM 9461  O  O     . HOH CA 10 .   ? -5.549  34.999 66.557 1.00 18.65 ? 754  HOH A O     1 
HETATM 9462  O  O     . HOH CA 10 .   ? -8.397  20.618 70.431 1.00 60.26 ? 755  HOH A O     1 
HETATM 9463  O  O     . HOH CA 10 .   ? 18.102  6.229  77.595 1.00 16.93 ? 756  HOH A O     1 
HETATM 9464  O  O     . HOH CA 10 .   ? 12.873  19.332 79.123 1.00 9.26  ? 757  HOH A O     1 
HETATM 9465  O  O     . HOH CA 10 .   ? 10.351  37.643 70.832 1.00 4.85  ? 758  HOH A O     1 
HETATM 9466  O  O     . HOH CA 10 .   ? 6.859   40.745 72.294 1.00 12.70 ? 759  HOH A O     1 
HETATM 9467  O  O     . HOH CA 10 .   ? 4.438   32.366 73.884 1.00 25.38 ? 760  HOH A O     1 
HETATM 9468  O  O     . HOH CA 10 .   ? 27.383  19.210 55.160 1.00 16.79 ? 761  HOH A O     1 
HETATM 9469  O  O     . HOH CA 10 .   ? 8.855   13.305 50.916 1.00 26.64 ? 762  HOH A O     1 
HETATM 9470  O  O     . HOH CA 10 .   ? 1.810   12.750 73.519 1.00 14.85 ? 763  HOH A O     1 
HETATM 9471  O  O     . HOH CA 10 .   ? 44.381  12.616 86.413 1.00 32.79 ? 764  HOH A O     1 
HETATM 9472  O  O     . HOH CA 10 .   ? 30.049  0.651  62.072 1.00 37.67 ? 765  HOH A O     1 
HETATM 9473  O  O     . HOH CA 10 .   ? 50.882  32.025 62.730 1.00 25.91 ? 766  HOH A O     1 
HETATM 9474  O  O     . HOH CA 10 .   ? 18.968  43.292 85.656 1.00 21.99 ? 767  HOH A O     1 
HETATM 9475  O  O     . HOH CA 10 .   ? 24.421  3.330  46.635 1.00 23.48 ? 768  HOH A O     1 
HETATM 9476  O  O     . HOH CA 10 .   ? 22.349  40.883 46.545 1.00 14.15 ? 769  HOH A O     1 
HETATM 9477  O  O     . HOH CA 10 .   ? 27.580  36.428 47.014 1.00 25.89 ? 770  HOH A O     1 
HETATM 9478  O  O     . HOH CA 10 .   ? 23.667  35.934 43.176 1.00 16.91 ? 771  HOH A O     1 
HETATM 9479  O  O     . HOH CA 10 .   ? 10.413  39.977 60.286 1.00 30.42 ? 772  HOH A O     1 
HETATM 9480  O  O     . HOH CA 10 .   ? 31.123  17.837 91.849 1.00 16.26 ? 773  HOH A O     1 
HETATM 9481  O  O     . HOH CA 10 .   ? 5.142   18.673 67.601 1.00 29.37 ? 774  HOH A O     1 
HETATM 9482  O  O     . HOH CA 10 .   ? 25.430  33.409 65.380 1.00 32.10 ? 775  HOH A O     1 
HETATM 9483  O  O     . HOH CA 10 .   ? 7.804   34.345 66.103 1.00 13.16 ? 776  HOH A O     1 
HETATM 9484  O  O     . HOH CA 10 .   ? 8.085   40.260 56.191 1.00 30.62 ? 777  HOH A O     1 
HETATM 9485  O  O     . HOH CA 10 .   ? 42.002  -0.656 56.888 1.00 34.85 ? 778  HOH A O     1 
HETATM 9486  O  O     . HOH CA 10 .   ? 14.800  25.267 94.135 1.00 27.25 ? 779  HOH A O     1 
HETATM 9487  O  O     . HOH CA 10 .   ? 58.144  10.146 57.250 1.00 24.96 ? 780  HOH A O     1 
HETATM 9488  O  O     . HOH CA 10 .   ? 31.843  38.652 77.593 1.00 19.21 ? 781  HOH A O     1 
HETATM 9489  O  O     . HOH CA 10 .   ? 12.279  19.122 49.375 1.00 40.91 ? 782  HOH A O     1 
HETATM 9490  O  O     . HOH CA 10 .   ? 59.708  15.224 60.640 1.00 27.92 ? 783  HOH A O     1 
HETATM 9491  O  O     . HOH CA 10 .   ? -3.923  38.956 58.548 1.00 16.14 ? 784  HOH A O     1 
HETATM 9492  O  O     . HOH CA 10 .   ? 48.931  5.685  62.999 1.00 12.27 ? 785  HOH A O     1 
HETATM 9493  O  O     . HOH CA 10 .   ? 19.663  24.856 55.631 1.00 31.58 ? 786  HOH A O     1 
HETATM 9494  O  O     . HOH CA 10 .   ? 16.424  23.016 85.768 1.00 13.23 ? 787  HOH A O     1 
HETATM 9495  O  O     . HOH CA 10 .   ? 7.480   48.201 57.633 1.00 20.34 ? 788  HOH A O     1 
HETATM 9496  O  O     . HOH CA 10 .   ? 4.513   31.784 66.323 1.00 18.06 ? 789  HOH A O     1 
HETATM 9497  O  O     . HOH CA 10 .   ? 3.931   24.049 78.584 1.00 25.89 ? 790  HOH A O     1 
HETATM 9498  O  O     . HOH CA 10 .   ? 2.511   36.487 69.677 1.00 42.57 ? 791  HOH A O     1 
HETATM 9499  O  O     . HOH CA 10 .   ? 35.560  15.704 85.312 1.00 9.04  ? 792  HOH A O     1 
HETATM 9500  O  O     . HOH CA 10 .   ? 58.801  23.729 54.275 1.00 33.76 ? 793  HOH A O     1 
HETATM 9501  O  O     . HOH CA 10 .   ? 35.831  33.915 81.085 1.00 19.50 ? 794  HOH A O     1 
HETATM 9502  O  O     . HOH CA 10 .   ? 61.048  11.229 65.526 1.00 18.71 ? 795  HOH A O     1 
HETATM 9503  O  O     . HOH CA 10 .   ? 25.737  40.690 47.661 1.00 12.20 ? 796  HOH A O     1 
HETATM 9504  O  O     . HOH CA 10 .   ? 12.103  19.301 66.177 1.00 13.52 ? 797  HOH A O     1 
HETATM 9505  O  O     . HOH CA 10 .   ? 16.348  9.837  44.089 1.00 31.45 ? 798  HOH A O     1 
HETATM 9506  O  O     . HOH CA 10 .   ? 35.559  18.230 86.777 1.00 18.92 ? 799  HOH A O     1 
HETATM 9507  O  O     . HOH CA 10 .   ? 50.833  7.581  62.620 1.00 15.93 ? 800  HOH A O     1 
HETATM 9508  O  O     . HOH CA 10 .   ? 19.500  26.354 58.116 1.00 31.47 ? 801  HOH A O     1 
HETATM 9509  O  O     . HOH CA 10 .   ? 7.004   17.499 74.593 1.00 4.58  ? 802  HOH A O     1 
HETATM 9510  O  O     . HOH CA 10 .   ? 40.820  3.437  77.039 1.00 15.86 ? 803  HOH A O     1 
HETATM 9511  O  O     . HOH CA 10 .   ? 4.446   39.668 71.724 1.00 15.70 ? 804  HOH A O     1 
HETATM 9512  O  O     . HOH CA 10 .   ? 3.571   31.658 78.003 1.00 17.01 ? 805  HOH A O     1 
HETATM 9513  O  O     . HOH CA 10 .   ? 25.378  18.735 61.573 1.00 21.11 ? 806  HOH A O     1 
HETATM 9514  O  O     . HOH CA 10 .   ? -3.429  44.972 61.614 1.00 15.76 ? 807  HOH A O     1 
HETATM 9515  O  O     . HOH CA 10 .   ? 17.683  22.039 90.265 1.00 31.13 ? 808  HOH A O     1 
HETATM 9516  O  O     . HOH CA 10 .   ? 12.952  15.250 72.028 1.00 20.18 ? 809  HOH A O     1 
HETATM 9517  O  O     . HOH CA 10 .   ? 18.350  9.277  78.821 1.00 32.01 ? 810  HOH A O     1 
HETATM 9518  O  O     . HOH CA 10 .   ? 5.437   26.301 52.069 1.00 14.31 ? 811  HOH A O     1 
HETATM 9519  O  O     . HOH CA 10 .   ? 54.410  24.910 75.956 1.00 45.06 ? 812  HOH A O     1 
HETATM 9520  O  O     . HOH CA 10 .   ? 7.682   37.352 54.344 1.00 26.09 ? 813  HOH A O     1 
HETATM 9521  O  O     . HOH CA 10 .   ? 56.945  20.735 60.337 1.00 22.74 ? 814  HOH A O     1 
HETATM 9522  O  O     . HOH CA 10 .   ? 21.532  19.678 87.072 1.00 7.82  ? 815  HOH A O     1 
HETATM 9523  O  O     . HOH CA 10 .   ? 46.987  0.889  62.933 1.00 39.44 ? 816  HOH A O     1 
HETATM 9524  O  O     . HOH CA 10 .   ? 35.572  11.394 85.829 1.00 30.39 ? 817  HOH A O     1 
HETATM 9525  O  O     . HOH CA 10 .   ? 6.345   39.083 63.041 1.00 22.59 ? 818  HOH A O     1 
HETATM 9526  O  O     . HOH CA 10 .   ? 15.448  32.097 94.410 1.00 27.61 ? 819  HOH A O     1 
HETATM 9527  O  O     . HOH CA 10 .   ? 37.722  7.606  39.189 1.00 17.99 ? 820  HOH A O     1 
HETATM 9528  O  O     . HOH CA 10 .   ? 7.230   49.835 59.794 1.00 23.46 ? 821  HOH A O     1 
HETATM 9529  O  O     . HOH CA 10 .   ? 23.497  43.568 79.780 1.00 21.19 ? 822  HOH A O     1 
HETATM 9530  O  O     . HOH CA 10 .   ? 47.033  1.088  65.553 1.00 25.32 ? 823  HOH A O     1 
HETATM 9531  O  O     . HOH CA 10 .   ? 14.456  46.488 61.570 1.00 22.85 ? 824  HOH A O     1 
HETATM 9532  O  O     . HOH CA 10 .   ? 23.256  22.684 60.026 1.00 20.38 ? 825  HOH A O     1 
HETATM 9533  O  O     . HOH CA 10 .   ? 15.126  44.046 60.926 1.00 33.78 ? 826  HOH A O     1 
HETATM 9534  O  O     . HOH CA 10 .   ? 21.147  46.087 55.137 1.00 46.31 ? 827  HOH A O     1 
HETATM 9535  O  O     . HOH CA 10 .   ? 23.183  46.706 56.779 1.00 42.81 ? 828  HOH A O     1 
HETATM 9536  O  O     . HOH CA 10 .   ? 19.280  45.866 60.981 1.00 45.96 ? 829  HOH A O     1 
HETATM 9537  O  O     . HOH CA 10 .   ? 24.871  41.682 65.014 1.00 12.02 ? 830  HOH A O     1 
HETATM 9538  O  O     . HOH CA 10 .   ? 50.401  8.763  60.065 1.00 17.20 ? 831  HOH A O     1 
HETATM 9539  O  O     . HOH CA 10 .   ? 54.469  3.880  64.038 1.00 44.99 ? 832  HOH A O     1 
HETATM 9540  O  O     . HOH CA 10 .   ? 6.232   20.911 73.956 1.00 18.65 ? 833  HOH A O     1 
HETATM 9541  O  O     . HOH CA 10 .   ? 28.557  -3.192 58.447 1.00 13.91 ? 834  HOH A O     1 
HETATM 9542  O  O     . HOH CA 10 .   ? 24.534  27.221 51.440 1.00 25.94 ? 835  HOH A O     1 
HETATM 9543  O  O     . HOH CA 10 .   ? 45.912  0.471  74.919 1.00 41.71 ? 836  HOH A O     1 
HETATM 9544  O  O     . HOH CA 10 .   ? 14.509  12.989 72.041 1.00 24.49 ? 837  HOH A O     1 
HETATM 9545  O  O     . HOH CA 10 .   ? 14.963  27.357 58.998 1.00 18.57 ? 838  HOH A O     1 
HETATM 9546  O  O     . HOH CA 10 .   ? 42.840  27.991 85.434 1.00 20.29 ? 839  HOH A O     1 
HETATM 9547  O  O     . HOH CA 10 .   ? 16.610  3.679  48.071 1.00 51.26 ? 840  HOH A O     1 
HETATM 9548  O  O     . HOH CA 10 .   ? 53.824  23.844 52.588 1.00 15.89 ? 841  HOH A O     1 
HETATM 9549  O  O     . HOH CA 10 .   ? 50.162  2.308  49.806 1.00 17.65 ? 842  HOH A O     1 
HETATM 9550  O  O     . HOH CA 10 .   ? 39.083  24.933 49.504 1.00 26.18 ? 843  HOH A O     1 
HETATM 9551  O  O     . HOH CA 10 .   ? 55.598  19.108 83.725 1.00 42.54 ? 844  HOH A O     1 
HETATM 9552  O  O     . HOH CA 10 .   ? 31.453  38.642 52.163 1.00 37.25 ? 845  HOH A O     1 
HETATM 9553  O  O     . HOH CA 10 .   ? 4.166   34.152 67.668 1.00 30.44 ? 846  HOH A O     1 
HETATM 9554  O  O     . HOH CA 10 .   ? 30.207  6.004  72.358 1.00 23.49 ? 847  HOH A O     1 
HETATM 9555  O  O     . HOH CA 10 .   ? 6.769   44.292 55.862 1.00 7.73  ? 848  HOH A O     1 
HETATM 9556  O  O     . HOH CA 10 .   ? -2.390  26.029 54.365 1.00 20.48 ? 849  HOH A O     1 
HETATM 9557  O  O     . HOH CA 10 .   ? 46.921  23.308 72.510 1.00 29.08 ? 850  HOH A O     1 
HETATM 9558  O  O     . HOH CA 10 .   ? 4.245   39.455 83.351 1.00 43.24 ? 851  HOH A O     1 
HETATM 9559  O  O     . HOH CA 10 .   ? 5.181   41.626 79.472 1.00 35.07 ? 852  HOH A O     1 
HETATM 9560  O  O     . HOH CA 10 .   ? 52.878  4.964  54.828 1.00 24.54 ? 853  HOH A O     1 
HETATM 9561  O  O     . HOH CA 10 .   ? 25.261  32.564 46.627 1.00 29.94 ? 854  HOH A O     1 
HETATM 9562  O  O     . HOH CA 10 .   ? 50.875  12.689 41.136 1.00 22.11 ? 855  HOH A O     1 
HETATM 9563  O  O     . HOH CA 10 .   ? 11.589  13.360 70.622 1.00 31.18 ? 856  HOH A O     1 
HETATM 9564  O  O     . HOH CA 10 .   ? 47.691  18.977 42.341 1.00 26.71 ? 857  HOH A O     1 
HETATM 9565  O  O     . HOH CA 10 .   ? 14.626  14.450 46.817 1.00 45.08 ? 858  HOH A O     1 
HETATM 9566  O  O     . HOH CA 10 .   ? -1.040  18.596 68.650 1.00 17.73 ? 859  HOH A O     1 
HETATM 9567  O  O     . HOH CA 10 .   ? 17.903  21.954 87.800 1.00 12.96 ? 860  HOH A O     1 
HETATM 9568  O  O     . HOH CA 10 .   ? 26.463  4.800  38.191 1.00 8.74  ? 861  HOH A O     1 
HETATM 9569  O  O     . HOH CA 10 .   ? 49.935  6.719  56.778 1.00 15.95 ? 862  HOH A O     1 
HETATM 9570  O  O     . HOH CA 10 .   ? 36.419  4.643  80.620 1.00 37.12 ? 863  HOH A O     1 
HETATM 9571  O  O     . HOH CA 10 .   ? 23.535  42.760 77.210 1.00 30.07 ? 864  HOH A O     1 
HETATM 9572  O  O     . HOH CA 10 .   ? 14.676  20.451 87.526 1.00 28.59 ? 865  HOH A O     1 
HETATM 9573  O  O     . HOH CA 10 .   ? 12.692  43.006 78.223 1.00 19.11 ? 866  HOH A O     1 
HETATM 9574  O  O     . HOH CA 10 .   ? 9.526   40.766 88.301 1.00 37.08 ? 867  HOH A O     1 
HETATM 9575  O  O     . HOH CA 10 .   ? 49.260  26.657 79.511 1.00 20.19 ? 868  HOH A O     1 
HETATM 9576  O  O     . HOH CA 10 .   ? 39.829  4.569  79.159 1.00 20.83 ? 869  HOH A O     1 
HETATM 9577  O  O     . HOH CA 10 .   ? 30.024  4.649  63.733 1.00 30.09 ? 870  HOH A O     1 
HETATM 9578  O  O     . HOH CA 10 .   ? -2.127  27.294 51.661 1.00 33.90 ? 871  HOH A O     1 
HETATM 9579  O  O     . HOH CA 10 .   ? 9.600   19.508 67.215 1.00 29.65 ? 872  HOH A O     1 
HETATM 9580  O  O     . HOH CA 10 .   ? 56.380  11.873 70.760 1.00 18.21 ? 873  HOH A O     1 
HETATM 9581  O  O     . HOH CA 10 .   ? 59.860  32.089 57.998 1.00 22.40 ? 874  HOH A O     1 
HETATM 9582  O  O     . HOH CA 10 .   ? 61.486  27.337 69.477 1.00 23.46 ? 875  HOH A O     1 
HETATM 9583  O  O     . HOH CA 10 .   ? 33.542  24.096 90.525 1.00 29.02 ? 876  HOH A O     1 
HETATM 9584  O  O     . HOH CA 10 .   ? 20.234  45.118 70.358 1.00 37.68 ? 877  HOH A O     1 
HETATM 9585  O  O     . HOH CA 10 .   ? 52.731  32.498 58.235 1.00 47.45 ? 878  HOH A O     1 
HETATM 9586  O  O     . HOH CA 10 .   ? -4.436  35.823 56.936 1.00 22.44 ? 879  HOH A O     1 
HETATM 9587  O  O     . HOH CA 10 .   ? 2.169   32.239 72.369 1.00 48.57 ? 880  HOH A O     1 
HETATM 9588  O  O     . HOH CA 10 .   ? 39.189  1.492  57.472 1.00 21.03 ? 881  HOH A O     1 
HETATM 9589  O  O     . HOH CA 10 .   ? 35.704  29.784 51.505 1.00 31.69 ? 882  HOH A O     1 
HETATM 9590  O  O     . HOH CA 10 .   ? 51.881  6.481  66.677 1.00 20.87 ? 883  HOH A O     1 
HETATM 9591  O  O     . HOH CA 10 .   ? 22.753  28.399 48.504 1.00 27.08 ? 884  HOH A O     1 
HETATM 9592  O  O     . HOH CA 10 .   ? 29.938  40.170 76.156 1.00 24.77 ? 885  HOH A O     1 
HETATM 9593  O  O     . HOH CA 10 .   ? 4.021   26.046 67.065 1.00 30.51 ? 886  HOH A O     1 
HETATM 9594  O  O     . HOH CA 10 .   ? 34.870  -0.397 71.518 1.00 20.03 ? 887  HOH A O     1 
HETATM 9595  O  O     . HOH CA 10 .   ? 21.941  5.722  72.790 1.00 17.33 ? 888  HOH A O     1 
HETATM 9596  O  O     . HOH CA 10 .   ? 30.161  40.145 73.147 1.00 32.57 ? 889  HOH A O     1 
HETATM 9597  O  O     . HOH CA 10 .   ? 23.364  25.975 93.187 1.00 27.61 ? 890  HOH A O     1 
HETATM 9598  O  O     . HOH CA 10 .   ? 7.080   30.537 63.917 1.00 24.09 ? 891  HOH A O     1 
HETATM 9599  O  O     . HOH CA 10 .   ? 5.308   47.689 74.364 1.00 22.66 ? 892  HOH A O     1 
HETATM 9600  O  O     . HOH CA 10 .   ? 55.296  9.980  75.703 1.00 32.26 ? 893  HOH A O     1 
HETATM 9601  O  O     . HOH CA 10 .   ? 50.517  7.620  71.548 1.00 18.87 ? 894  HOH A O     1 
HETATM 9602  O  O     . HOH CA 10 .   ? 30.130  0.079  52.027 1.00 22.84 ? 895  HOH A O     1 
HETATM 9603  O  O     . HOH CA 10 .   ? 2.015   25.429 60.259 1.00 21.35 ? 896  HOH A O     1 
HETATM 9604  O  O     . HOH CA 10 .   ? 49.452  4.269  65.133 1.00 30.93 ? 897  HOH A O     1 
HETATM 9605  O  O     . HOH CA 10 .   ? 44.952  -2.746 42.641 1.00 39.74 ? 898  HOH A O     1 
HETATM 9606  O  O     . HOH CA 10 .   ? 52.853  22.423 50.344 1.00 17.08 ? 899  HOH A O     1 
HETATM 9607  O  O     . HOH CA 10 .   ? 36.206  32.411 54.746 1.00 22.78 ? 900  HOH A O     1 
HETATM 9608  O  O     . HOH CA 10 .   ? 51.232  24.774 71.227 1.00 21.13 ? 901  HOH A O     1 
HETATM 9609  O  O     . HOH CA 10 .   ? 39.124  11.644 85.360 1.00 40.00 ? 902  HOH A O     1 
HETATM 9610  O  O     . HOH CA 10 .   ? 26.659  44.391 79.926 1.00 33.82 ? 903  HOH A O     1 
HETATM 9611  O  O     . HOH CA 10 .   ? 27.701  27.182 50.881 1.00 23.24 ? 904  HOH A O     1 
HETATM 9612  O  O     . HOH CA 10 .   ? 28.709  2.473  66.099 1.00 39.29 ? 905  HOH A O     1 
HETATM 9613  O  O     . HOH CA 10 .   ? 33.334  21.516 91.784 1.00 22.84 ? 906  HOH A O     1 
HETATM 9614  O  O     . HOH CA 10 .   ? 54.369  29.497 51.212 1.00 43.40 ? 907  HOH A O     1 
HETATM 9615  O  O     . HOH CA 10 .   ? 49.335  34.177 66.226 1.00 21.94 ? 908  HOH A O     1 
HETATM 9616  O  O     . HOH CA 10 .   ? -6.469  33.769 63.123 1.00 19.92 ? 909  HOH A O     1 
HETATM 9617  O  O     . HOH CA 10 .   ? 25.999  21.154 60.184 1.00 12.60 ? 910  HOH A O     1 
HETATM 9618  O  O     . HOH CA 10 .   ? 3.189   35.120 80.335 1.00 35.70 ? 911  HOH A O     1 
HETATM 9619  O  O     . HOH CA 10 .   ? 24.250  30.091 46.780 1.00 34.01 ? 912  HOH A O     1 
HETATM 9620  O  O     . HOH CA 10 .   ? 0.059   38.449 51.594 1.00 29.09 ? 913  HOH A O     1 
HETATM 9621  O  O     . HOH CA 10 .   ? 51.239  1.061  47.806 1.00 17.72 ? 914  HOH A O     1 
HETATM 9622  O  O     . HOH CA 10 .   ? 8.216   31.145 60.948 1.00 33.03 ? 915  HOH A O     1 
HETATM 9623  O  O     . HOH CA 10 .   ? 55.066  9.818  53.475 1.00 32.45 ? 916  HOH A O     1 
HETATM 9624  O  O     . HOH CA 10 .   ? 0.094   25.329 47.805 1.00 22.43 ? 917  HOH A O     1 
HETATM 9625  O  O     . HOH CA 10 .   ? 27.481  6.160  82.069 1.00 37.26 ? 918  HOH A O     1 
HETATM 9626  O  O     . HOH CA 10 .   ? 38.105  9.306  42.642 1.00 14.20 ? 919  HOH A O     1 
HETATM 9627  O  O     . HOH CA 10 .   ? 0.516   29.870 68.568 1.00 25.54 ? 920  HOH A O     1 
HETATM 9628  O  O     . HOH CA 10 .   ? 49.248  16.879 42.745 1.00 19.40 ? 921  HOH A O     1 
HETATM 9629  O  O     . HOH CA 10 .   ? 44.006  32.089 52.249 1.00 47.03 ? 922  HOH A O     1 
HETATM 9630  O  O     . HOH CA 10 .   ? 16.646  44.130 63.536 1.00 14.07 ? 923  HOH A O     1 
HETATM 9631  O  O     . HOH CA 10 .   ? 21.970  34.920 54.472 1.00 20.90 ? 924  HOH A O     1 
HETATM 9632  O  O     . HOH CA 10 .   ? 40.775  27.625 57.144 1.00 32.85 ? 925  HOH A O     1 
HETATM 9633  O  O     . HOH CA 10 .   ? 46.931  27.007 87.237 1.00 22.15 ? 926  HOH A O     1 
HETATM 9634  O  O     . HOH CA 10 .   ? 35.277  6.789  84.670 1.00 33.45 ? 927  HOH A O     1 
HETATM 9635  O  O     . HOH CA 10 .   ? 56.807  10.704 78.696 1.00 42.04 ? 928  HOH A O     1 
HETATM 9636  O  O     . HOH CA 10 .   ? 21.207  26.190 51.359 1.00 18.96 ? 929  HOH A O     1 
HETATM 9637  O  O     . HOH CA 10 .   ? 57.832  30.152 57.144 1.00 32.59 ? 930  HOH A O     1 
HETATM 9638  O  O     . HOH CA 10 .   ? 42.855  30.448 47.957 1.00 30.03 ? 931  HOH A O     1 
HETATM 9639  O  O     . HOH CA 10 .   ? 43.573  21.245 44.320 1.00 15.84 ? 932  HOH A O     1 
HETATM 9640  O  O     . HOH CA 10 .   ? 52.341  11.854 83.899 1.00 38.37 ? 933  HOH A O     1 
HETATM 9641  O  O     . HOH CA 10 .   ? 15.150  17.824 86.914 1.00 32.15 ? 934  HOH A O     1 
HETATM 9642  O  O     . HOH CA 10 .   ? 8.440   21.755 84.779 1.00 35.52 ? 935  HOH A O     1 
HETATM 9643  O  O     . HOH CA 10 .   ? 20.207  12.081 87.317 1.00 25.22 ? 936  HOH A O     1 
HETATM 9644  O  O     . HOH CA 10 .   ? 26.698  3.740  56.807 1.00 19.29 ? 937  HOH A O     1 
HETATM 9645  O  O     . HOH CA 10 .   ? 34.064  43.368 52.915 1.00 41.26 ? 938  HOH A O     1 
HETATM 9646  O  O     . HOH CA 10 .   ? 28.299  -1.145 56.726 1.00 17.76 ? 939  HOH A O     1 
HETATM 9647  O  O     . HOH CA 10 .   ? 10.368  25.378 56.999 1.00 27.39 ? 940  HOH A O     1 
HETATM 9648  O  O     . HOH CA 10 .   ? 29.882  41.682 69.434 1.00 45.13 ? 941  HOH A O     1 
HETATM 9649  O  O     . HOH CA 10 .   ? 43.614  32.764 57.859 1.00 39.96 ? 942  HOH A O     1 
HETATM 9650  O  O     . HOH CA 10 .   ? 13.455  29.718 58.972 1.00 30.25 ? 943  HOH A O     1 
HETATM 9651  O  O     . HOH CA 10 .   ? 10.493  40.398 62.976 1.00 28.40 ? 944  HOH A O     1 
HETATM 9652  O  O     . HOH CA 10 .   ? 22.197  13.467 42.721 1.00 11.64 ? 945  HOH A O     1 
HETATM 9653  O  O     . HOH CA 10 .   ? 35.189  16.452 62.575 1.00 8.80  ? 946  HOH A O     1 
HETATM 9654  O  O     . HOH CA 10 .   ? 36.039  15.337 64.887 1.00 8.58  ? 947  HOH A O     1 
HETATM 9655  O  O     . HOH CA 10 .   ? 36.354  14.988 60.540 1.00 12.22 ? 948  HOH A O     1 
HETATM 9656  O  O     . HOH CA 10 .   ? 27.296  10.881 85.921 1.00 27.47 ? 949  HOH A O     1 
HETATM 9657  O  O     . HOH CA 10 .   ? 20.085  44.854 90.097 1.00 43.39 ? 950  HOH A O     1 
HETATM 9658  O  O     . HOH CA 10 .   ? 9.994   42.531 64.790 1.00 16.56 ? 951  HOH A O     1 
HETATM 9659  O  O     . HOH CA 10 .   ? 17.198  27.691 57.021 1.00 20.18 ? 952  HOH A O     1 
HETATM 9660  O  O     . HOH CA 10 .   ? 20.421  35.889 75.284 1.00 40.52 ? 953  HOH A O     1 
HETATM 9661  O  O     . HOH CA 10 .   ? 20.475  23.909 59.070 1.00 36.29 ? 954  HOH A O     1 
HETATM 9662  O  O     . HOH CA 10 .   ? 4.588   32.014 62.910 1.00 23.01 ? 955  HOH A O     1 
HETATM 9663  O  O     . HOH CA 10 .   ? 23.640  3.092  51.550 1.00 29.31 ? 956  HOH A O     1 
HETATM 9664  O  O     . HOH CA 10 .   ? 24.938  20.045 47.974 1.00 33.42 ? 957  HOH A O     1 
HETATM 9665  O  O     . HOH CA 10 .   ? 21.039  43.513 64.767 1.00 13.89 ? 958  HOH A O     1 
HETATM 9666  O  O     . HOH CA 10 .   ? 24.956  23.613 50.578 1.00 29.70 ? 959  HOH A O     1 
HETATM 9667  O  O     . HOH CA 10 .   ? 15.043  16.031 85.074 1.00 20.48 ? 960  HOH A O     1 
HETATM 9668  O  O     . HOH CA 10 .   ? 44.995  0.452  57.678 1.00 23.05 ? 961  HOH A O     1 
HETATM 9669  O  O     . HOH CA 10 .   ? 11.904  42.115 80.652 1.00 17.39 ? 962  HOH A O     1 
HETATM 9670  O  O     . HOH CA 10 .   ? 59.070  19.943 62.128 1.00 30.15 ? 963  HOH A O     1 
HETATM 9671  O  O     . HOH CA 10 .   ? 15.894  10.373 79.558 1.00 11.03 ? 964  HOH A O     1 
HETATM 9672  O  O     . HOH CA 10 .   ? 24.402  43.298 73.755 1.00 44.53 ? 965  HOH A O     1 
HETATM 9673  O  O     . HOH CA 10 .   ? 26.541  23.531 52.680 1.00 34.92 ? 970  HOH A O     1 
HETATM 9674  O  O     . HOH CA 10 .   ? 49.532  -1.979 43.972 1.00 30.87 ? 975  HOH A O     1 
HETATM 9675  O  O     . HOH CA 10 .   ? 10.885  31.892 60.268 1.00 42.15 ? 977  HOH A O     1 
HETATM 9676  O  O     . HOH CA 10 .   ? 39.947  -0.623 43.057 1.00 46.07 ? 991  HOH A O     1 
HETATM 9677  O  O     . HOH CA 10 .   ? 5.305   55.011 64.922 1.00 35.38 ? 996  HOH A O     1 
HETATM 9678  O  O     . HOH CA 10 .   ? 53.164  17.233 83.255 1.00 24.80 ? 1007 HOH A O     1 
HETATM 9679  O  O     . HOH CA 10 .   ? 24.666  23.877 92.093 1.00 32.92 ? 1008 HOH A O     1 
HETATM 9680  O  O     . HOH CA 10 .   ? 52.047  30.778 64.992 1.00 35.15 ? 1021 HOH A O     1 
HETATM 9681  O  O     . HOH CA 10 .   ? 7.622   47.965 78.596 1.00 29.99 ? 1029 HOH A O     1 
HETATM 9682  O  O     . HOH CA 10 .   ? 10.334  11.964 77.895 1.00 16.26 ? 1030 HOH A O     1 
HETATM 9683  O  O     . HOH CA 10 .   ? 51.007  6.137  39.347 1.00 29.73 ? 1038 HOH A O     1 
HETATM 9684  O  O     . HOH CA 10 .   ? 29.989  33.502 72.733 1.00 43.38 ? 1039 HOH A O     1 
HETATM 9685  O  O     . HOH CA 10 .   ? 5.343   16.291 78.661 1.00 20.50 ? 1041 HOH A O     1 
HETATM 9686  O  O     . HOH CA 10 .   ? 14.267  -8.445 73.416 1.00 22.32 ? 1044 HOH A O     1 
HETATM 9687  O  O     . HOH CA 10 .   ? 16.997  -2.567 54.773 1.00 31.96 ? 1047 HOH A O     1 
HETATM 9688  O  O     . HOH CA 10 .   ? 56.245  8.010  59.317 1.00 54.33 ? 1052 HOH A O     1 
HETATM 9689  O  O     . HOH CA 10 .   ? 34.076  -0.481 65.281 1.00 37.82 ? 1054 HOH A O     1 
HETATM 9690  O  O     . HOH CA 10 .   ? 29.903  32.510 68.507 1.00 36.96 ? 1058 HOH A O     1 
HETATM 9691  O  O     . HOH CA 10 .   ? 2.993   37.396 78.098 1.00 33.50 ? 1065 HOH A O     1 
HETATM 9692  O  O     . HOH CA 10 .   ? 20.434  44.914 79.840 1.00 36.58 ? 1069 HOH A O     1 
HETATM 9693  O  O     . HOH CA 10 .   ? 27.393  3.721  69.164 1.00 32.21 ? 1077 HOH A O     1 
HETATM 9694  O  O     . HOH CA 10 .   ? -7.746  33.476 56.000 1.00 25.91 ? 1084 HOH A O     1 
HETATM 9695  O  O     . HOH CA 10 .   ? 29.187  22.991 51.090 1.00 31.62 ? 1089 HOH A O     1 
HETATM 9696  O  O     . HOH CA 10 .   ? 55.529  4.041  66.564 1.00 45.67 ? 1091 HOH A O     1 
HETATM 9697  O  O     . HOH CA 10 .   ? 25.808  1.631  65.760 1.00 34.35 ? 1092 HOH A O     1 
HETATM 9698  O  O     . HOH CA 10 .   ? 13.447  21.946 52.082 1.00 31.79 ? 1093 HOH A O     1 
HETATM 9699  O  O     . HOH CA 10 .   ? 32.104  5.634  85.902 1.00 45.80 ? 1109 HOH A O     1 
HETATM 9700  O  O     . HOH CA 10 .   ? 25.765  45.308 87.469 1.00 42.60 ? 1113 HOH A O     1 
HETATM 9701  O  O     . HOH CA 10 .   ? 50.332  0.883  44.738 1.00 19.76 ? 1116 HOH A O     1 
HETATM 9702  O  O     . HOH CA 10 .   ? 25.143  1.741  53.261 1.00 32.28 ? 1124 HOH A O     1 
HETATM 9703  O  O     . HOH CA 10 .   ? 7.626   13.780 66.451 1.00 20.85 ? 1128 HOH A O     1 
HETATM 9704  O  O     . HOH CA 10 .   ? 46.103  -2.843 40.283 1.00 25.24 ? 1130 HOH A O     1 
HETATM 9705  O  O     . HOH CA 10 .   ? 62.502  30.047 64.160 1.00 28.42 ? 1148 HOH A O     1 
HETATM 9706  O  O     . HOH CA 10 .   ? 24.602  6.842  78.287 1.00 38.39 ? 1149 HOH A O     1 
HETATM 9707  O  O     . HOH CA 10 .   ? 21.721  45.340 67.941 1.00 34.10 ? 1152 HOH A O     1 
HETATM 9708  O  O     . HOH CA 10 .   ? 6.406   48.904 76.391 1.00 27.32 ? 1153 HOH A O     1 
HETATM 9709  O  O     . HOH CA 10 .   ? 2.054   32.844 79.425 1.00 28.77 ? 1166 HOH A O     1 
HETATM 9710  O  O     . HOH CA 10 .   ? 50.882  5.314  76.708 1.00 31.95 ? 1170 HOH A O     1 
HETATM 9711  O  O     . HOH CA 10 .   ? 20.811  -2.578 60.074 1.00 23.25 ? 1185 HOH A O     1 
HETATM 9712  O  O     . HOH CA 10 .   ? 1.532   34.018 76.035 1.00 35.05 ? 1192 HOH A O     1 
HETATM 9713  O  O     . HOH CA 10 .   ? -9.036  33.442 62.946 1.00 22.11 ? 1194 HOH A O     1 
HETATM 9714  O  O     . HOH CA 10 .   ? 40.126  35.884 56.025 1.00 67.14 ? 1209 HOH A O     1 
HETATM 9715  O  O     . HOH CA 10 .   ? 54.771  6.643  53.917 1.00 38.83 ? 1212 HOH A O     1 
HETATM 9716  O  O     . HOH CA 10 .   ? 15.662  43.509 85.412 1.00 31.53 ? 1218 HOH A O     1 
HETATM 9717  O  O     . HOH CA 10 .   ? 9.542   19.349 88.377 1.00 39.03 ? 1220 HOH A O     1 
HETATM 9718  O  O     . HOH CA 10 .   ? 49.780  0.170  67.477 1.00 30.14 ? 1222 HOH A O     1 
HETATM 9719  O  O     . HOH CA 10 .   ? 27.621  42.948 62.283 1.00 21.50 ? 1239 HOH A O     1 
HETATM 9720  O  O     . HOH CA 10 .   ? 57.722  11.487 75.619 1.00 30.57 ? 1245 HOH A O     1 
HETATM 9721  O  O     . HOH CA 10 .   ? 21.968  8.313  36.698 1.00 31.46 ? 1249 HOH A O     1 
HETATM 9722  O  O     . HOH CA 10 .   ? 15.110  1.594  79.867 1.00 16.14 ? 1251 HOH A O     1 
HETATM 9723  O  O     . HOH CA 10 .   ? 11.043  9.822  79.456 1.00 20.12 ? 1253 HOH A O     1 
HETATM 9724  O  O     . HOH CA 10 .   ? 13.804  51.502 62.390 1.00 42.38 ? 1255 HOH A O     1 
HETATM 9725  O  O     . HOH CA 10 .   ? 1.540   30.481 76.797 1.00 30.50 ? 1258 HOH A O     1 
HETATM 9726  O  O     . HOH CA 10 .   ? 33.135  39.797 79.555 1.00 34.52 ? 1260 HOH A O     1 
HETATM 9727  O  O     . HOH CA 10 .   ? 59.147  11.100 73.391 1.00 56.22 ? 1262 HOH A O     1 
HETATM 9728  O  O     . HOH CA 10 .   ? 17.645  47.315 56.130 1.00 38.63 ? 1265 HOH A O     1 
HETATM 9729  O  O     . HOH CA 10 .   ? 5.297   12.798 78.692 1.00 25.70 ? 1266 HOH A O     1 
HETATM 9730  O  O     . HOH CA 10 .   ? 52.660  2.070  44.089 1.00 30.44 ? 1268 HOH A O     1 
HETATM 9731  O  O     . HOH CA 10 .   ? 28.003  24.735 49.737 1.00 43.16 ? 1270 HOH A O     1 
HETATM 9732  O  O     . HOH CA 10 .   ? 26.779  43.004 67.100 1.00 18.96 ? 1272 HOH A O     1 
HETATM 9733  O  O     . HOH CA 10 .   ? 54.511  2.133  46.059 1.00 42.46 ? 1275 HOH A O     1 
HETATM 9734  O  O     . HOH CA 10 .   ? 5.226   10.085 79.747 1.00 27.60 ? 1277 HOH A O     1 
HETATM 9735  O  O     . HOH CA 10 .   ? 12.070  24.710 53.041 1.00 17.41 ? 1281 HOH A O     1 
HETATM 9736  O  O     . HOH CA 10 .   ? 44.042  -2.841 72.140 1.00 34.03 ? 1288 HOH A O     1 
HETATM 9737  O  O     . HOH CA 10 .   ? 26.337  46.090 56.534 1.00 43.26 ? 1293 HOH A O     1 
HETATM 9738  O  O     . HOH CA 10 .   ? -4.012  28.321 54.609 1.00 29.63 ? 1303 HOH A O     1 
HETATM 9739  O  O     . HOH CA 10 .   ? 21.228  44.342 77.322 1.00 43.26 ? 1309 HOH A O     1 
HETATM 9740  O  O     . HOH CA 10 .   ? 36.948  34.200 84.780 1.00 36.25 ? 1314 HOH A O     1 
HETATM 9741  O  O     . HOH CA 10 .   ? 33.693  38.899 50.628 1.00 41.40 ? 1320 HOH A O     1 
HETATM 9742  O  O     . HOH CA 10 .   ? 31.899  -1.083 62.229 1.00 24.62 ? 1322 HOH A O     1 
HETATM 9743  O  O     . HOH CA 10 .   ? 1.529   49.108 65.330 1.00 39.52 ? 1326 HOH A O     1 
HETATM 9744  O  O     . HOH CA 10 .   ? 3.028   29.572 66.225 1.00 9.63  ? 1328 HOH A O     1 
HETATM 9745  O  O     . HOH CA 10 .   ? 4.808   26.143 63.826 1.00 27.14 ? 1329 HOH A O     1 
HETATM 9746  O  O     . HOH CA 10 .   ? -0.570  53.611 55.703 1.00 22.65 ? 1330 HOH A O     1 
HETATM 9747  O  O     . HOH CA 10 .   ? -7.171  32.948 51.661 1.00 55.15 ? 1331 HOH A O     1 
HETATM 9748  O  O     . HOH CA 10 .   ? 3.590   5.943  76.169 1.00 51.36 ? 1332 HOH A O     1 
HETATM 9749  O  O     . HOH CA 10 .   ? 10.011  -8.310 74.671 1.00 70.27 ? 1334 HOH A O     1 
HETATM 9750  O  O     . HOH CA 10 .   ? 8.581   -6.853 68.058 1.00 48.33 ? 1335 HOH A O     1 
HETATM 9751  O  O     . HOH CA 10 .   ? 20.630  3.403  76.053 1.00 45.96 ? 1336 HOH A O     1 
HETATM 9752  O  O     . HOH CA 10 .   ? 7.121   35.039 52.209 1.00 26.63 ? 1337 HOH A O     1 
HETATM 9753  O  O     . HOH CA 10 .   ? 27.045  20.879 53.013 1.00 33.78 ? 1339 HOH A O     1 
HETATM 9754  O  O     . HOH CA 10 .   ? 33.292  35.380 49.900 1.00 40.11 ? 1342 HOH A O     1 
HETATM 9755  O  O     . HOH CA 10 .   ? 35.033  34.871 54.689 1.00 28.14 ? 1343 HOH A O     1 
HETATM 9756  O  O     . HOH CA 10 .   ? 32.835  35.728 55.883 1.00 30.90 ? 1344 HOH A O     1 
HETATM 9757  O  O     . HOH CA 10 .   ? 35.423  28.774 65.633 1.00 29.27 ? 1345 HOH A O     1 
HETATM 9758  O  O     . HOH CA 10 .   ? 45.477  27.882 67.386 1.00 16.05 ? 1346 HOH A O     1 
HETATM 9759  O  O     . HOH CA 10 .   ? 46.361  34.826 71.229 1.00 30.15 ? 1347 HOH A O     1 
HETATM 9760  O  O     . HOH CA 10 .   ? 24.750  33.903 70.521 1.00 28.29 ? 1350 HOH A O     1 
HETATM 9761  O  O     . HOH CA 10 .   ? 2.268   43.779 80.538 1.00 38.40 ? 1351 HOH A O     1 
HETATM 9762  O  O     . HOH CA 10 .   ? 32.676  38.165 82.450 1.00 27.64 ? 1352 HOH A O     1 
HETATM 9763  O  O     . HOH CA 10 .   ? 30.878  38.791 84.170 1.00 37.58 ? 1353 HOH A O     1 
HETATM 9764  O  O     . HOH CA 10 .   ? 24.249  24.919 83.121 1.00 15.29 ? 1354 HOH A O     1 
HETATM 9765  O  O     . HOH CA 10 .   ? 35.999  13.767 87.123 1.00 29.99 ? 1355 HOH A O     1 
HETATM 9766  O  O     . HOH CA 10 .   ? 34.189  14.379 88.954 1.00 35.45 ? 1356 HOH A O     1 
HETATM 9767  O  O     . HOH CA 10 .   ? 31.638  13.511 88.946 1.00 32.72 ? 1357 HOH A O     1 
HETATM 9768  O  O     . HOH CA 10 .   ? 57.361  14.222 55.123 1.00 42.29 ? 1359 HOH A O     1 
HETATM 9769  O  O     . HOH CA 10 .   ? 47.092  18.886 39.723 1.00 35.26 ? 1360 HOH A O     1 
HETATM 9770  O  O     . HOH CA 10 .   ? 52.483  15.913 42.909 1.00 38.08 ? 1362 HOH A O     1 
HETATM 9771  O  O     . HOH CA 10 .   ? 51.342  10.301 58.113 1.00 19.66 ? 1363 HOH A O     1 
HETATM 9772  O  O     . HOH CA 10 .   ? 52.020  8.467  56.014 1.00 14.04 ? 1364 HOH A O     1 
HETATM 9773  O  O     . HOH CA 10 .   ? 47.737  0.344  53.153 1.00 32.77 ? 1365 HOH A O     1 
HETATM 9774  O  O     . HOH CA 10 .   ? 45.604  -0.717 55.478 1.00 34.35 ? 1366 HOH A O     1 
HETATM 9775  O  O     . HOH CA 10 .   ? 41.152  -0.666 59.299 1.00 28.21 ? 1370 HOH A O     1 
HETATM 9776  O  O     . HOH CA 10 .   ? 52.225  26.615 77.382 1.00 38.45 ? 1373 HOH A O     1 
HETATM 9777  O  O     . HOH CA 10 .   ? 48.737  -4.948 54.464 1.00 57.77 ? 1374 HOH A O     1 
HETATM 9778  O  O     . HOH CA 10 .   ? 16.424  5.404  44.008 1.00 36.10 ? 1375 HOH A O     1 
HETATM 9779  O  O     . HOH CA 10 .   ? 37.819  0.353  79.556 1.00 27.10 ? 1378 HOH A O     1 
HETATM 9780  O  O     . HOH CA 10 .   ? 32.733  2.456  78.191 1.00 46.68 ? 1379 HOH A O     1 
HETATM 9781  O  O     . HOH CA 10 .   ? 5.712   35.019 83.453 1.00 21.05 ? 1380 HOH A O     1 
HETATM 9782  O  O     . HOH CA 10 .   ? 12.650  14.121 85.321 1.00 31.22 ? 1381 HOH A O     1 
HETATM 9783  O  O     . HOH CA 10 .   ? 41.708  -3.556 73.263 1.00 39.68 ? 1382 HOH A O     1 
HETATM 9784  O  O     . HOH CA 10 .   ? 42.450  1.281  76.717 1.00 32.15 ? 1383 HOH A O     1 
HETATM 9785  O  O     . HOH CA 10 .   ? 33.028  2.957  71.187 1.00 32.93 ? 1384 HOH A O     1 
HETATM 9786  O  O     . HOH CA 10 .   ? 50.853  1.898  73.354 1.00 33.39 ? 1385 HOH A O     1 
HETATM 9787  O  O     . HOH CA 10 .   ? 39.051  0.085  60.159 1.00 22.18 ? 1410 HOH A O     1 
HETATM 9788  O  O     . HOH CA 10 .   ? 12.378  11.496 66.486 1.00 25.59 ? 1423 HOH A O     1 
HETATM 9789  O  O     . HOH CA 10 .   ? -11.579 26.415 54.525 1.00 64.77 ? 1424 HOH A O     1 
HETATM 9790  O  O     . HOH CA 10 .   ? 37.083  29.879 64.322 1.00 31.68 ? 1431 HOH A O     1 
HETATM 9791  O  O     . HOH CA 10 .   ? 40.017  31.738 82.432 1.00 29.39 ? 1432 HOH A O     1 
HETATM 9792  O  O     . HOH CA 10 .   ? 41.275  30.252 84.610 1.00 28.47 ? 1433 HOH A O     1 
HETATM 9793  O  O     . HOH CA 10 .   ? 40.734  35.188 85.045 1.00 42.07 ? 1434 HOH A O     1 
HETATM 9794  O  O     . HOH CA 10 .   ? -10.254 26.343 66.460 1.00 27.20 ? 1435 HOH A O     1 
HETATM 9795  O  O     . HOH DA 10 .   ? 35.707  10.628 43.085 1.00 5.46  ? 4    HOH B O     1 
HETATM 9796  O  O     . HOH DA 10 .   ? 25.904  35.416 39.105 1.00 12.36 ? 5    HOH B O     1 
HETATM 9797  O  O     . HOH DA 10 .   ? 32.398  16.728 41.998 1.00 10.75 ? 14   HOH B O     1 
HETATM 9798  O  O     . HOH DA 10 .   ? 40.670  24.272 41.517 1.00 15.71 ? 15   HOH B O     1 
HETATM 9799  O  O     . HOH DA 10 .   ? 33.234  16.379 27.948 1.00 12.76 ? 21   HOH B O     1 
HETATM 9800  O  O     . HOH DA 10 .   ? 49.189  32.591 42.701 1.00 73.81 ? 620  HOH B O     1 
HETATM 9801  O  O     . HOH DA 10 .   ? 9.773   49.164 11.112 1.00 31.75 ? 621  HOH B O     1 
HETATM 9802  O  O     . HOH DA 10 .   ? 34.575  23.058 31.029 1.00 9.56  ? 622  HOH B O     1 
HETATM 9803  O  O     . HOH DA 10 .   ? 16.214  40.911 46.516 1.00 10.05 ? 623  HOH B O     1 
HETATM 9804  O  O     . HOH DA 10 .   ? 22.961  21.668 40.904 1.00 19.00 ? 624  HOH B O     1 
HETATM 9805  O  O     . HOH DA 10 .   ? 18.151  30.686 38.603 1.00 15.24 ? 625  HOH B O     1 
HETATM 9806  O  O     . HOH DA 10 .   ? 27.460  6.436  30.289 1.00 16.34 ? 626  HOH B O     1 
HETATM 9807  O  O     . HOH DA 10 .   ? 15.921  35.403 51.801 1.00 11.47 ? 627  HOH B O     1 
HETATM 9808  O  O     . HOH DA 10 .   ? 16.326  40.193 28.945 1.00 15.41 ? 628  HOH B O     1 
HETATM 9809  O  O     . HOH DA 10 .   ? 40.953  14.536 11.596 1.00 25.81 ? 629  HOH B O     1 
HETATM 9810  O  O     . HOH DA 10 .   ? 30.826  58.173 31.587 1.00 15.15 ? 630  HOH B O     1 
HETATM 9811  O  O     . HOH DA 10 .   ? 11.829  55.970 19.188 1.00 4.43  ? 631  HOH B O     1 
HETATM 9812  O  O     . HOH DA 10 .   ? 30.192  47.512 27.797 1.00 14.33 ? 632  HOH B O     1 
HETATM 9813  O  O     . HOH DA 10 .   ? 8.765   24.856 42.320 1.00 25.84 ? 633  HOH B O     1 
HETATM 9814  O  O     . HOH DA 10 .   ? 32.869  5.267  30.308 1.00 11.17 ? 634  HOH B O     1 
HETATM 9815  O  O     . HOH DA 10 .   ? 9.790   57.004 27.614 1.00 33.37 ? 635  HOH B O     1 
HETATM 9816  O  O     . HOH DA 10 .   ? 22.906  6.479  38.770 1.00 29.76 ? 636  HOH B O     1 
HETATM 9817  O  O     . HOH DA 10 .   ? 11.399  57.324 29.774 1.00 12.55 ? 637  HOH B O     1 
HETATM 9818  O  O     . HOH DA 10 .   ? 50.089  3.632  29.565 1.00 36.77 ? 638  HOH B O     1 
HETATM 9819  O  O     . HOH DA 10 .   ? 31.242  24.927 39.624 1.00 19.32 ? 639  HOH B O     1 
HETATM 9820  O  O     . HOH DA 10 .   ? 20.650  21.578 16.143 1.00 14.13 ? 640  HOH B O     1 
HETATM 9821  O  O     . HOH DA 10 .   ? 35.289  19.281 20.743 1.00 22.05 ? 641  HOH B O     1 
HETATM 9822  O  O     . HOH DA 10 .   ? 22.228  45.989 50.234 1.00 9.79  ? 642  HOH B O     1 
HETATM 9823  O  O     . HOH DA 10 .   ? 20.731  4.531  32.718 1.00 18.79 ? 643  HOH B O     1 
HETATM 9824  O  O     . HOH DA 10 .   ? 38.605  26.030 3.499  1.00 21.07 ? 644  HOH B O     1 
HETATM 9825  O  O     . HOH DA 10 .   ? 21.211  14.491 40.256 1.00 16.34 ? 645  HOH B O     1 
HETATM 9826  O  O     . HOH DA 10 .   ? -1.738  33.808 46.194 1.00 39.25 ? 646  HOH B O     1 
HETATM 9827  O  O     . HOH DA 10 .   ? 35.239  37.691 13.397 1.00 20.23 ? 647  HOH B O     1 
HETATM 9828  O  O     . HOH DA 10 .   ? 35.053  6.869  30.408 1.00 20.64 ? 648  HOH B O     1 
HETATM 9829  O  O     . HOH DA 10 .   ? 39.569  11.945 18.058 1.00 17.99 ? 649  HOH B O     1 
HETATM 9830  O  O     . HOH DA 10 .   ? 20.231  0.080  38.401 1.00 12.15 ? 650  HOH B O     1 
HETATM 9831  O  O     . HOH DA 10 .   ? 8.383   55.439 55.138 1.00 33.20 ? 651  HOH B O     1 
HETATM 9832  O  O     . HOH DA 10 .   ? 27.806  -4.645 30.026 1.00 9.98  ? 652  HOH B O     1 
HETATM 9833  O  O     . HOH DA 10 .   ? 23.848  42.578 43.389 1.00 12.64 ? 653  HOH B O     1 
HETATM 9834  O  O     . HOH DA 10 .   ? 24.851  17.248 34.452 1.00 14.35 ? 654  HOH B O     1 
HETATM 9835  O  O     . HOH DA 10 .   ? 26.544  9.115  29.637 1.00 20.40 ? 655  HOH B O     1 
HETATM 9836  O  O     . HOH DA 10 .   ? 8.487   52.665 33.129 1.00 18.38 ? 656  HOH B O     1 
HETATM 9837  O  O     . HOH DA 10 .   ? 27.229  12.727 1.366  1.00 21.14 ? 657  HOH B O     1 
HETATM 9838  O  O     . HOH DA 10 .   ? 6.998   46.002 14.292 1.00 17.03 ? 658  HOH B O     1 
HETATM 9839  O  O     . HOH DA 10 .   ? 22.234  50.869 35.309 1.00 12.73 ? 659  HOH B O     1 
HETATM 9840  O  O     . HOH DA 10 .   ? 3.040   55.697 49.019 1.00 17.81 ? 660  HOH B O     1 
HETATM 9841  O  O     . HOH DA 10 .   ? 23.589  24.568 32.986 1.00 15.50 ? 663  HOH B O     1 
HETATM 9842  O  O     . HOH DA 10 .   ? 39.404  26.400 31.298 1.00 11.00 ? 664  HOH B O     1 
HETATM 9843  O  O     . HOH DA 10 .   ? 15.516  -7.385 36.540 1.00 2.00  ? 665  HOH B O     1 
HETATM 9844  O  O     . HOH DA 10 .   ? 30.420  12.296 17.453 1.00 20.13 ? 666  HOH B O     1 
HETATM 9845  O  O     . HOH DA 10 .   ? 3.202   31.134 55.040 1.00 12.36 ? 667  HOH B O     1 
HETATM 9846  O  O     . HOH DA 10 .   ? 27.996  31.224 35.645 1.00 15.76 ? 668  HOH B O     1 
HETATM 9847  O  O     . HOH DA 10 .   ? 39.452  -3.693 32.232 1.00 19.37 ? 669  HOH B O     1 
HETATM 9848  O  O     . HOH DA 10 .   ? 21.831  7.712  41.119 1.00 17.18 ? 670  HOH B O     1 
HETATM 9849  O  O     . HOH DA 10 .   ? 4.774   41.381 14.168 1.00 40.95 ? 673  HOH B O     1 
HETATM 9850  O  O     . HOH DA 10 .   ? 7.552   41.956 54.560 1.00 9.86  ? 674  HOH B O     1 
HETATM 9851  O  O     . HOH DA 10 .   ? 2.648   32.396 36.353 1.00 14.38 ? 675  HOH B O     1 
HETATM 9852  O  O     . HOH DA 10 .   ? 18.246  52.196 45.948 1.00 13.52 ? 676  HOH B O     1 
HETATM 9853  O  O     . HOH DA 10 .   ? 7.697   53.473 50.907 1.00 15.07 ? 677  HOH B O     1 
HETATM 9854  O  O     . HOH DA 10 .   ? 28.633  39.045 8.092  1.00 18.22 ? 678  HOH B O     1 
HETATM 9855  O  O     . HOH DA 10 .   ? 27.669  18.702 36.941 1.00 15.25 ? 679  HOH B O     1 
HETATM 9856  O  O     . HOH DA 10 .   ? 43.520  14.892 39.090 1.00 24.82 ? 680  HOH B O     1 
HETATM 9857  O  O     . HOH DA 10 .   ? 19.792  2.656  45.065 1.00 21.19 ? 682  HOH B O     1 
HETATM 9858  O  O     . HOH DA 10 .   ? 25.724  29.501 43.194 1.00 18.60 ? 683  HOH B O     1 
HETATM 9859  O  O     . HOH DA 10 .   ? 8.903   21.384 13.736 1.00 16.65 ? 684  HOH B O     1 
HETATM 9860  O  O     . HOH DA 10 .   ? 12.776  17.501 21.014 1.00 19.45 ? 685  HOH B O     1 
HETATM 9861  O  O     . HOH DA 10 .   ? 32.834  18.120 21.018 1.00 10.88 ? 686  HOH B O     1 
HETATM 9862  O  O     . HOH DA 10 .   ? 39.875  6.515  37.986 1.00 17.89 ? 687  HOH B O     1 
HETATM 9863  O  O     . HOH DA 10 .   ? 17.956  31.296 2.189  1.00 26.54 ? 688  HOH B O     1 
HETATM 9864  O  O     . HOH DA 10 .   ? 6.994   41.709 51.891 1.00 12.04 ? 689  HOH B O     1 
HETATM 9865  O  O     . HOH DA 10 .   ? 3.740   38.955 25.003 1.00 32.09 ? 690  HOH B O     1 
HETATM 9866  O  O     . HOH DA 10 .   ? 40.461  18.979 30.725 1.00 24.81 ? 691  HOH B O     1 
HETATM 9867  O  O     . HOH DA 10 .   ? 19.621  63.265 33.869 1.00 22.33 ? 692  HOH B O     1 
HETATM 9868  O  O     . HOH DA 10 .   ? 40.251  30.642 18.119 1.00 16.26 ? 693  HOH B O     1 
HETATM 9869  O  O     . HOH DA 10 .   ? 37.801  5.927  14.329 1.00 32.06 ? 694  HOH B O     1 
HETATM 9870  O  O     . HOH DA 10 .   ? 14.028  56.126 24.086 1.00 28.37 ? 695  HOH B O     1 
HETATM 9871  O  O     . HOH DA 10 .   ? 5.951   56.738 51.898 1.00 31.14 ? 696  HOH B O     1 
HETATM 9872  O  O     . HOH DA 10 .   ? -4.483  29.796 28.467 1.00 27.30 ? 697  HOH B O     1 
HETATM 9873  O  O     . HOH DA 10 .   ? 37.394  10.174 5.578  1.00 38.78 ? 698  HOH B O     1 
HETATM 9874  O  O     . HOH DA 10 .   ? 45.654  11.902 31.565 1.00 36.26 ? 699  HOH B O     1 
HETATM 9875  O  O     . HOH DA 10 .   ? 21.869  43.796 48.449 1.00 11.15 ? 700  HOH B O     1 
HETATM 9876  O  O     . HOH DA 10 .   ? 10.063  53.298 35.292 1.00 12.01 ? 701  HOH B O     1 
HETATM 9877  O  O     . HOH DA 10 .   ? 9.677   42.243 51.183 1.00 8.69  ? 702  HOH B O     1 
HETATM 9878  O  O     . HOH DA 10 .   ? -0.212  43.623 40.090 1.00 19.48 ? 704  HOH B O     1 
HETATM 9879  O  O     . HOH DA 10 .   ? 17.467  40.280 8.717  1.00 10.79 ? 705  HOH B O     1 
HETATM 9880  O  O     . HOH DA 10 .   ? 38.118  21.904 47.770 1.00 15.29 ? 706  HOH B O     1 
HETATM 9881  O  O     . HOH DA 10 .   ? 15.389  65.921 29.113 1.00 14.01 ? 707  HOH B O     1 
HETATM 9882  O  O     . HOH DA 10 .   ? 16.782  18.385 40.513 1.00 17.31 ? 708  HOH B O     1 
HETATM 9883  O  O     . HOH DA 10 .   ? 30.998  45.243 9.165  1.00 18.03 ? 709  HOH B O     1 
HETATM 9884  O  O     . HOH DA 10 .   ? 18.872  16.142 41.105 1.00 25.03 ? 710  HOH B O     1 
HETATM 9885  O  O     . HOH DA 10 .   ? 21.593  52.493 37.692 1.00 12.73 ? 711  HOH B O     1 
HETATM 9886  O  O     . HOH DA 10 .   ? 11.126  32.828 7.777  1.00 27.51 ? 712  HOH B O     1 
HETATM 9887  O  O     . HOH DA 10 .   ? 43.560  13.858 32.677 1.00 18.33 ? 713  HOH B O     1 
HETATM 9888  O  O     . HOH DA 10 .   ? 19.964  42.037 46.223 1.00 16.24 ? 714  HOH B O     1 
HETATM 9889  O  O     . HOH DA 10 .   ? 51.257  32.939 44.629 1.00 47.43 ? 715  HOH B O     1 
HETATM 9890  O  O     . HOH DA 10 .   ? 39.028  13.267 32.860 1.00 12.76 ? 716  HOH B O     1 
HETATM 9891  O  O     . HOH DA 10 .   ? 15.983  49.667 8.100  1.00 24.61 ? 717  HOH B O     1 
HETATM 9892  O  O     . HOH DA 10 .   ? 32.177  10.083 30.365 1.00 30.11 ? 718  HOH B O     1 
HETATM 9893  O  O     . HOH DA 10 .   ? 31.806  7.352  10.025 1.00 25.62 ? 719  HOH B O     1 
HETATM 9894  O  O     . HOH DA 10 .   ? 14.404  29.505 5.971  1.00 21.43 ? 720  HOH B O     1 
HETATM 9895  O  O     . HOH DA 10 .   ? 24.389  61.951 25.816 1.00 28.76 ? 721  HOH B O     1 
HETATM 9896  O  O     . HOH DA 10 .   ? 13.982  49.074 54.286 1.00 13.36 ? 722  HOH B O     1 
HETATM 9897  O  O     . HOH DA 10 .   ? 31.526  27.229 26.398 1.00 35.82 ? 723  HOH B O     1 
HETATM 9898  O  O     . HOH DA 10 .   ? 27.939  36.083 4.411  1.00 33.44 ? 724  HOH B O     1 
HETATM 9899  O  O     . HOH DA 10 .   ? 10.523  55.096 25.369 1.00 15.65 ? 725  HOH B O     1 
HETATM 9900  O  O     . HOH DA 10 .   ? 2.833   30.084 26.951 1.00 13.93 ? 726  HOH B O     1 
HETATM 9901  O  O     . HOH DA 10 .   ? 33.862  10.177 40.902 1.00 14.36 ? 727  HOH B O     1 
HETATM 9902  O  O     . HOH DA 10 .   ? 36.950  49.813 29.367 1.00 29.92 ? 728  HOH B O     1 
HETATM 9903  O  O     . HOH DA 10 .   ? 4.684   53.498 27.924 1.00 25.30 ? 729  HOH B O     1 
HETATM 9904  O  O     . HOH DA 10 .   ? 22.132  -0.228 41.400 1.00 20.45 ? 730  HOH B O     1 
HETATM 9905  O  O     . HOH DA 10 .   ? 28.398  44.041 8.344  1.00 28.73 ? 731  HOH B O     1 
HETATM 9906  O  O     . HOH DA 10 .   ? 34.644  11.290 23.028 1.00 2.00  ? 732  HOH B O     1 
HETATM 9907  O  O     . HOH DA 10 .   ? 3.444   48.767 17.095 1.00 30.96 ? 733  HOH B O     1 
HETATM 9908  O  O     . HOH DA 10 .   ? 40.402  14.599 35.908 1.00 22.05 ? 734  HOH B O     1 
HETATM 9909  O  O     . HOH DA 10 .   ? 41.483  16.430 30.664 1.00 19.48 ? 735  HOH B O     1 
HETATM 9910  O  O     . HOH DA 10 .   ? 0.781   42.607 32.984 1.00 30.48 ? 736  HOH B O     1 
HETATM 9911  O  O     . HOH DA 10 .   ? 14.670  54.394 53.293 1.00 29.26 ? 737  HOH B O     1 
HETATM 9912  O  O     . HOH DA 10 .   ? 16.256  15.899 26.973 1.00 13.89 ? 738  HOH B O     1 
HETATM 9913  O  O     . HOH DA 10 .   ? 21.421  20.215 7.809  1.00 12.04 ? 739  HOH B O     1 
HETATM 9914  O  O     . HOH DA 10 .   ? 32.906  48.537 15.617 1.00 38.61 ? 740  HOH B O     1 
HETATM 9915  O  O     . HOH DA 10 .   ? -0.013  45.291 51.057 1.00 31.48 ? 741  HOH B O     1 
HETATM 9916  O  O     . HOH DA 10 .   ? 5.749   54.504 37.470 1.00 21.86 ? 742  HOH B O     1 
HETATM 9917  O  O     . HOH DA 10 .   ? 7.033   55.472 28.971 1.00 47.43 ? 743  HOH B O     1 
HETATM 9918  O  O     . HOH DA 10 .   ? 40.287  24.912 29.340 1.00 28.87 ? 744  HOH B O     1 
HETATM 9919  O  O     . HOH DA 10 .   ? 11.073  48.541 54.935 1.00 13.07 ? 745  HOH B O     1 
HETATM 9920  O  O     . HOH DA 10 .   ? 21.889  27.067 43.367 1.00 26.57 ? 746  HOH B O     1 
HETATM 9921  O  O     . HOH DA 10 .   ? 22.373  -0.296 26.243 1.00 19.52 ? 747  HOH B O     1 
HETATM 9922  O  O     . HOH DA 10 .   ? 38.902  9.939  29.199 1.00 13.67 ? 748  HOH B O     1 
HETATM 9923  O  O     . HOH DA 10 .   ? 25.138  54.935 44.836 1.00 25.71 ? 749  HOH B O     1 
HETATM 9924  O  O     . HOH DA 10 .   ? 12.725  41.038 7.934  1.00 30.51 ? 750  HOH B O     1 
HETATM 9925  O  O     . HOH DA 10 .   ? 23.127  21.710 38.335 1.00 41.03 ? 751  HOH B O     1 
HETATM 9926  O  O     . HOH DA 10 .   ? 7.724   3.638  30.450 1.00 11.26 ? 752  HOH B O     1 
HETATM 9927  O  O     . HOH DA 10 .   ? 16.055  61.065 23.910 1.00 38.00 ? 753  HOH B O     1 
HETATM 9928  O  O     . HOH DA 10 .   ? 14.631  19.863 8.122  1.00 24.92 ? 754  HOH B O     1 
HETATM 9929  O  O     . HOH DA 10 .   ? 33.033  -3.192 34.725 1.00 7.54  ? 755  HOH B O     1 
HETATM 9930  O  O     . HOH DA 10 .   ? 30.955  20.715 39.160 1.00 15.51 ? 756  HOH B O     1 
HETATM 9931  O  O     . HOH DA 10 .   ? 17.932  35.532 2.300  1.00 27.07 ? 757  HOH B O     1 
HETATM 9932  O  O     . HOH DA 10 .   ? 27.947  9.413  27.131 1.00 12.89 ? 758  HOH B O     1 
HETATM 9933  O  O     . HOH DA 10 .   ? 23.903  30.367 -0.333 1.00 23.47 ? 759  HOH B O     1 
HETATM 9934  O  O     . HOH DA 10 .   ? -6.388  18.774 15.229 1.00 13.75 ? 760  HOH B O     1 
HETATM 9935  O  O     . HOH DA 10 .   ? 9.570   23.504 16.362 1.00 25.82 ? 761  HOH B O     1 
HETATM 9936  O  O     . HOH DA 10 .   ? 13.616  46.450 10.860 1.00 8.25  ? 762  HOH B O     1 
HETATM 9937  O  O     . HOH DA 10 .   ? 6.569   25.928 35.498 1.00 8.91  ? 763  HOH B O     1 
HETATM 9938  O  O     . HOH DA 10 .   ? 42.340  23.537 14.470 1.00 16.88 ? 764  HOH B O     1 
HETATM 9939  O  O     . HOH DA 10 .   ? 26.250  24.394 45.289 1.00 28.47 ? 765  HOH B O     1 
HETATM 9940  O  O     . HOH DA 10 .   ? 27.603  6.425  27.086 1.00 7.46  ? 766  HOH B O     1 
HETATM 9941  O  O     . HOH DA 10 .   ? 29.974  50.502 46.913 1.00 25.87 ? 767  HOH B O     1 
HETATM 9942  O  O     . HOH DA 10 .   ? 12.952  22.188 7.734  1.00 17.05 ? 768  HOH B O     1 
HETATM 9943  O  O     . HOH DA 10 .   ? 25.128  19.349 36.648 1.00 21.87 ? 769  HOH B O     1 
HETATM 9944  O  O     . HOH DA 10 .   ? -0.318  36.299 41.289 1.00 21.79 ? 770  HOH B O     1 
HETATM 9945  O  O     . HOH DA 10 .   ? 33.697  9.307  35.384 1.00 30.35 ? 771  HOH B O     1 
HETATM 9946  O  O     . HOH DA 10 .   ? 50.023  30.437 43.882 1.00 52.69 ? 772  HOH B O     1 
HETATM 9947  O  O     . HOH DA 10 .   ? 43.339  13.250 24.285 1.00 35.41 ? 773  HOH B O     1 
HETATM 9948  O  O     . HOH DA 10 .   ? 11.207  22.275 20.136 1.00 20.30 ? 774  HOH B O     1 
HETATM 9949  O  O     . HOH DA 10 .   ? 40.551  3.393  26.700 1.00 27.28 ? 775  HOH B O     1 
HETATM 9950  O  O     . HOH DA 10 .   ? 20.748  21.770 5.773  1.00 16.54 ? 776  HOH B O     1 
HETATM 9951  O  O     . HOH DA 10 .   ? 32.570  7.853  33.853 1.00 22.32 ? 777  HOH B O     1 
HETATM 9952  O  O     . HOH DA 10 .   ? 21.213  25.945 33.821 1.00 21.02 ? 778  HOH B O     1 
HETATM 9953  O  O     . HOH DA 10 .   ? 10.669  55.726 31.841 1.00 17.12 ? 779  HOH B O     1 
HETATM 9954  O  O     . HOH DA 10 .   ? 33.480  29.213 45.244 1.00 20.32 ? 780  HOH B O     1 
HETATM 9955  O  O     . HOH DA 10 .   ? 10.965  52.738 8.714  1.00 25.53 ? 781  HOH B O     1 
HETATM 9956  O  O     . HOH DA 10 .   ? 24.307  30.260 3.522  1.00 6.86  ? 782  HOH B O     1 
HETATM 9957  O  O     . HOH DA 10 .   ? 39.409  51.772 19.413 1.00 34.26 ? 783  HOH B O     1 
HETATM 9958  O  O     . HOH DA 10 .   ? 37.140  7.301  21.492 1.00 19.34 ? 784  HOH B O     1 
HETATM 9959  O  O     . HOH DA 10 .   ? 25.160  61.929 33.967 1.00 28.12 ? 785  HOH B O     1 
HETATM 9960  O  O     . HOH DA 10 .   ? 28.703  6.263  19.349 1.00 23.54 ? 786  HOH B O     1 
HETATM 9961  O  O     . HOH DA 10 .   ? 27.724  5.762  15.388 1.00 16.73 ? 787  HOH B O     1 
HETATM 9962  O  O     . HOH DA 10 .   ? 0.421   43.444 37.508 1.00 22.79 ? 788  HOH B O     1 
HETATM 9963  O  O     . HOH DA 10 .   ? 42.246  18.666 19.854 1.00 31.88 ? 789  HOH B O     1 
HETATM 9964  O  O     . HOH DA 10 .   ? 9.799   49.296 57.270 1.00 37.32 ? 790  HOH B O     1 
HETATM 9965  O  O     . HOH DA 10 .   ? 42.820  22.718 42.036 1.00 27.73 ? 791  HOH B O     1 
HETATM 9966  O  O     . HOH DA 10 .   ? 2.965   42.072 35.193 1.00 16.23 ? 792  HOH B O     1 
HETATM 9967  O  O     . HOH DA 10 .   ? 38.949  25.637 46.706 1.00 17.54 ? 793  HOH B O     1 
HETATM 9968  O  O     . HOH DA 10 .   ? 27.339  32.766 45.145 1.00 43.05 ? 794  HOH B O     1 
HETATM 9969  O  O     . HOH DA 10 .   ? 32.305  20.991 20.484 1.00 19.08 ? 795  HOH B O     1 
HETATM 9970  O  O     . HOH DA 10 .   ? 30.650  39.990 36.511 1.00 30.55 ? 796  HOH B O     1 
HETATM 9971  O  O     . HOH DA 10 .   ? 1.620   29.039 41.281 1.00 22.18 ? 797  HOH B O     1 
HETATM 9972  O  O     . HOH DA 10 .   ? 8.677   51.128 12.469 1.00 36.68 ? 798  HOH B O     1 
HETATM 9973  O  O     . HOH DA 10 .   ? -2.609  43.133 40.313 1.00 26.21 ? 799  HOH B O     1 
HETATM 9974  O  O     . HOH DA 10 .   ? 36.001  33.219 37.956 1.00 41.76 ? 800  HOH B O     1 
HETATM 9975  O  O     . HOH DA 10 .   ? 23.276  33.416 44.323 1.00 25.21 ? 801  HOH B O     1 
HETATM 9976  O  O     . HOH DA 10 .   ? 41.535  21.148 29.610 1.00 22.96 ? 802  HOH B O     1 
HETATM 9977  O  O     . HOH DA 10 .   ? 1.352   45.161 33.389 1.00 29.15 ? 803  HOH B O     1 
HETATM 9978  O  O     . HOH DA 10 .   ? 24.386  7.472  28.847 1.00 13.60 ? 804  HOH B O     1 
HETATM 9979  O  O     . HOH DA 10 .   ? 16.414  15.158 4.793  1.00 31.07 ? 805  HOH B O     1 
HETATM 9980  O  O     . HOH DA 10 .   ? 28.285  -1.722 39.264 1.00 18.83 ? 806  HOH B O     1 
HETATM 9981  O  O     . HOH DA 10 .   ? 10.904  19.514 20.739 1.00 21.42 ? 807  HOH B O     1 
HETATM 9982  O  O     . HOH DA 10 .   ? 23.996  39.734 41.808 1.00 17.55 ? 808  HOH B O     1 
HETATM 9983  O  O     . HOH DA 10 .   ? 0.994   47.936 14.979 1.00 27.52 ? 809  HOH B O     1 
HETATM 9984  O  O     . HOH DA 10 .   ? 31.174  24.142 49.742 1.00 23.80 ? 810  HOH B O     1 
HETATM 9985  O  O     . HOH DA 10 .   ? 32.703  37.192 39.815 1.00 5.96  ? 811  HOH B O     1 
HETATM 9986  O  O     . HOH DA 10 .   ? 19.834  59.039 39.306 1.00 22.67 ? 812  HOH B O     1 
HETATM 9987  O  O     . HOH DA 10 .   ? 22.066  31.627 42.948 1.00 22.25 ? 813  HOH B O     1 
HETATM 9988  O  O     . HOH DA 10 .   ? 25.221  5.278  26.924 1.00 11.53 ? 814  HOH B O     1 
HETATM 9989  O  O     . HOH DA 10 .   ? 11.126  55.320 50.337 1.00 35.39 ? 815  HOH B O     1 
HETATM 9990  O  O     . HOH DA 10 .   ? 19.234  8.165  40.675 1.00 28.90 ? 816  HOH B O     1 
HETATM 9991  O  O     . HOH DA 10 .   ? 8.754   6.590  19.336 1.00 15.13 ? 817  HOH B O     1 
HETATM 9992  O  O     . HOH DA 10 .   ? 2.589   44.790 36.013 1.00 11.66 ? 818  HOH B O     1 
HETATM 9993  O  O     . HOH DA 10 .   ? 6.517   35.829 20.949 1.00 20.21 ? 819  HOH B O     1 
HETATM 9994  O  O     . HOH DA 10 .   ? 12.293  48.838 10.164 1.00 25.67 ? 820  HOH B O     1 
HETATM 9995  O  O     . HOH DA 10 .   ? 15.428  40.960 6.543  1.00 20.11 ? 821  HOH B O     1 
HETATM 9996  O  O     . HOH DA 10 .   ? 19.619  29.827 40.757 1.00 35.70 ? 822  HOH B O     1 
HETATM 9997  O  O     . HOH DA 10 .   ? 27.029  27.709 47.730 1.00 42.68 ? 823  HOH B O     1 
HETATM 9998  O  O     . HOH DA 10 .   ? 5.174   22.546 49.679 1.00 34.08 ? 824  HOH B O     1 
HETATM 9999  O  O     . HOH DA 10 .   ? 5.359   23.567 52.062 1.00 18.89 ? 825  HOH B O     1 
HETATM 10000 O  O     . HOH DA 10 .   ? 39.601  12.736 13.135 1.00 26.78 ? 826  HOH B O     1 
HETATM 10001 O  O     . HOH DA 10 .   ? 25.528  26.564 42.395 1.00 21.94 ? 827  HOH B O     1 
HETATM 10002 O  O     . HOH DA 10 .   ? 24.311  27.514 10.739 1.00 11.99 ? 828  HOH B O     1 
HETATM 10003 O  O     . HOH DA 10 .   ? 1.844   29.756 46.367 1.00 19.15 ? 829  HOH B O     1 
HETATM 10004 O  O     . HOH DA 10 .   ? 21.848  12.953 36.188 1.00 28.43 ? 830  HOH B O     1 
HETATM 10005 O  O     . HOH DA 10 .   ? 40.328  12.880 15.710 1.00 15.48 ? 831  HOH B O     1 
HETATM 10006 O  O     . HOH DA 10 .   ? 15.525  15.646 44.152 1.00 29.75 ? 832  HOH B O     1 
HETATM 10007 O  O     . HOH DA 10 .   ? 34.409  21.881 18.906 1.00 29.88 ? 833  HOH B O     1 
HETATM 10008 O  O     . HOH DA 10 .   ? 9.550   54.944 37.506 1.00 19.12 ? 834  HOH B O     1 
HETATM 10009 O  O     . HOH DA 10 .   ? 18.519  27.774 45.768 1.00 28.58 ? 835  HOH B O     1 
HETATM 10010 O  O     . HOH DA 10 .   ? 34.979  62.382 26.382 1.00 35.61 ? 836  HOH B O     1 
HETATM 10011 O  O     . HOH DA 10 .   ? 38.546  32.042 8.044  1.00 17.48 ? 837  HOH B O     1 
HETATM 10012 O  O     . HOH DA 10 .   ? 43.621  5.055  19.468 1.00 24.66 ? 838  HOH B O     1 
HETATM 10013 O  O     . HOH DA 10 .   ? 25.734  0.800  45.289 1.00 33.02 ? 839  HOH B O     1 
HETATM 10014 O  O     . HOH DA 10 .   ? 2.420   51.192 33.010 1.00 31.21 ? 840  HOH B O     1 
HETATM 10015 O  O     . HOH DA 10 .   ? 34.973  51.728 32.808 1.00 26.80 ? 841  HOH B O     1 
HETATM 10016 O  O     . HOH DA 10 .   ? 43.241  20.003 23.887 1.00 40.83 ? 842  HOH B O     1 
HETATM 10017 O  O     . HOH DA 10 .   ? 42.515  -3.154 22.349 1.00 62.81 ? 843  HOH B O     1 
HETATM 10018 O  O     . HOH DA 10 .   ? 35.456  5.011  21.989 1.00 12.88 ? 844  HOH B O     1 
HETATM 10019 O  O     . HOH DA 10 .   ? 4.562   52.419 38.430 1.00 35.59 ? 845  HOH B O     1 
HETATM 10020 O  O     . HOH DA 10 .   ? 19.911  39.626 7.285  1.00 23.18 ? 846  HOH B O     1 
HETATM 10021 O  O     . HOH DA 10 .   ? 11.521  55.085 34.201 1.00 22.58 ? 847  HOH B O     1 
HETATM 10022 O  O     . HOH DA 10 .   ? 8.501   54.298 30.955 1.00 26.25 ? 848  HOH B O     1 
HETATM 10023 O  O     . HOH DA 10 .   ? 18.529  61.270 39.823 1.00 31.77 ? 849  HOH B O     1 
HETATM 10024 O  O     . HOH DA 10 .   ? 3.551   39.425 22.573 1.00 22.80 ? 850  HOH B O     1 
HETATM 10025 O  O     . HOH DA 10 .   ? 32.508  27.065 28.897 1.00 28.60 ? 851  HOH B O     1 
HETATM 10026 O  O     . HOH DA 10 .   ? 41.900  24.125 20.638 1.00 26.30 ? 852  HOH B O     1 
HETATM 10027 O  O     . HOH DA 10 .   ? 36.299  25.675 46.806 1.00 14.86 ? 853  HOH B O     1 
HETATM 10028 O  O     . HOH DA 10 .   ? 41.070  16.273 8.644  1.00 39.95 ? 854  HOH B O     1 
HETATM 10029 O  O     . HOH DA 10 .   ? 8.954   45.406 56.704 1.00 8.23  ? 855  HOH B O     1 
HETATM 10030 O  O     . HOH DA 10 .   ? 20.701  9.665  29.632 1.00 11.80 ? 856  HOH B O     1 
HETATM 10031 O  O     . HOH DA 10 .   ? 31.129  43.813 47.319 1.00 33.04 ? 857  HOH B O     1 
HETATM 10032 O  O     . HOH DA 10 .   ? 5.740   47.261 16.835 1.00 21.67 ? 858  HOH B O     1 
HETATM 10033 O  O     . HOH DA 10 .   ? 28.314  25.416 47.332 1.00 31.51 ? 859  HOH B O     1 
HETATM 10034 O  O     . HOH DA 10 .   ? 4.578   28.087 20.206 1.00 15.05 ? 860  HOH B O     1 
HETATM 10035 O  O     . HOH DA 10 .   ? 24.757  22.235 46.465 1.00 35.55 ? 861  HOH B O     1 
HETATM 10036 O  O     . HOH DA 10 .   ? 37.246  9.805  26.553 1.00 16.26 ? 862  HOH B O     1 
HETATM 10037 O  O     . HOH DA 10 .   ? 43.761  6.623  36.405 1.00 29.12 ? 863  HOH B O     1 
HETATM 10038 O  O     . HOH DA 10 .   ? -1.442  41.450 49.924 1.00 18.88 ? 864  HOH B O     1 
HETATM 10039 O  O     . HOH DA 10 .   ? -1.790  21.178 13.728 1.00 27.32 ? 865  HOH B O     1 
HETATM 10040 O  O     . HOH DA 10 .   ? 11.346  58.150 43.422 1.00 27.69 ? 866  HOH B O     1 
HETATM 10041 O  O     . HOH DA 10 .   ? 22.156  22.994 34.623 1.00 32.92 ? 867  HOH B O     1 
HETATM 10042 O  O     . HOH DA 10 .   ? 13.005  21.080 35.121 1.00 31.04 ? 868  HOH B O     1 
HETATM 10043 O  O     . HOH DA 10 .   ? 38.314  37.637 32.457 1.00 35.14 ? 869  HOH B O     1 
HETATM 10044 O  O     . HOH DA 10 .   ? 26.767  15.197 34.661 1.00 29.08 ? 870  HOH B O     1 
HETATM 10045 O  O     . HOH DA 10 .   ? 39.170  32.676 16.747 1.00 19.43 ? 871  HOH B O     1 
HETATM 10046 O  O     . HOH DA 10 .   ? 37.867  31.593 42.404 1.00 34.92 ? 872  HOH B O     1 
HETATM 10047 O  O     . HOH DA 10 .   ? 22.932  60.078 11.790 1.00 34.38 ? 873  HOH B O     1 
HETATM 10048 O  O     . HOH DA 10 .   ? 32.268  38.111 42.112 1.00 18.51 ? 874  HOH B O     1 
HETATM 10049 O  O     . HOH DA 10 .   ? 2.523   53.093 40.273 1.00 34.06 ? 875  HOH B O     1 
HETATM 10050 O  O     . HOH DA 10 .   ? 1.870   43.804 46.769 1.00 37.85 ? 876  HOH B O     1 
HETATM 10051 O  O     . HOH DA 10 .   ? 5.797   33.394 22.227 1.00 32.22 ? 877  HOH B O     1 
HETATM 10052 O  O     . HOH DA 10 .   ? 23.013  20.962 1.750  1.00 20.78 ? 878  HOH B O     1 
HETATM 10053 O  O     . HOH DA 10 .   ? 34.728  27.883 47.584 1.00 30.96 ? 879  HOH B O     1 
HETATM 10054 O  O     . HOH DA 10 .   ? 16.907  16.957 14.128 1.00 15.63 ? 880  HOH B O     1 
HETATM 10055 O  O     . HOH DA 10 .   ? 40.937  15.022 33.198 1.00 25.59 ? 881  HOH B O     1 
HETATM 10056 O  O     . HOH DA 10 .   ? -4.595  27.173 22.046 1.00 8.57  ? 882  HOH B O     1 
HETATM 10057 O  O     . HOH DA 10 .   ? 45.599  6.315  34.368 1.00 15.16 ? 883  HOH B O     1 
HETATM 10058 O  O     . HOH DA 10 .   ? 31.300  -0.622 25.837 1.00 25.77 ? 884  HOH B O     1 
HETATM 10059 O  O     . HOH DA 10 .   ? 24.238  21.760 35.665 1.00 23.81 ? 885  HOH B O     1 
HETATM 10060 O  O     . HOH DA 10 .   ? 21.957  7.473  29.349 1.00 19.84 ? 886  HOH B O     1 
HETATM 10061 O  O     . HOH DA 10 .   ? 35.109  38.822 9.548  1.00 26.82 ? 887  HOH B O     1 
HETATM 10062 O  O     . HOH DA 10 .   ? 30.576  51.779 15.751 1.00 20.25 ? 888  HOH B O     1 
HETATM 10063 O  O     . HOH DA 10 .   ? 29.515  -1.158 41.569 1.00 21.67 ? 889  HOH B O     1 
HETATM 10064 O  O     . HOH DA 10 .   ? 39.266  31.442 10.645 1.00 23.74 ? 890  HOH B O     1 
HETATM 10065 O  O     . HOH DA 10 .   ? 20.710  50.131 52.170 1.00 30.83 ? 891  HOH B O     1 
HETATM 10066 O  O     . HOH DA 10 .   ? 14.620  15.667 13.358 1.00 19.36 ? 892  HOH B O     1 
HETATM 10067 O  O     . HOH DA 10 .   ? 30.120  37.051 43.146 1.00 26.30 ? 893  HOH B O     1 
HETATM 10068 O  O     . HOH DA 10 .   ? 35.181  51.690 44.054 1.00 46.19 ? 894  HOH B O     1 
HETATM 10069 O  O     . HOH DA 10 .   ? 8.061   26.388 11.794 1.00 22.93 ? 895  HOH B O     1 
HETATM 10070 O  O     . HOH DA 10 .   ? 1.206   27.186 17.775 1.00 42.90 ? 896  HOH B O     1 
HETATM 10071 O  O     . HOH DA 10 .   ? -0.636  43.333 30.043 1.00 29.13 ? 897  HOH B O     1 
HETATM 10072 O  O     . HOH DA 10 .   ? 38.727  33.652 12.028 1.00 26.00 ? 898  HOH B O     1 
HETATM 10073 O  O     . HOH DA 10 .   ? 34.567  23.869 33.805 1.00 9.98  ? 899  HOH B O     1 
HETATM 10074 O  O     . HOH DA 10 .   ? 24.521  33.887 37.288 1.00 14.46 ? 900  HOH B O     1 
HETATM 10075 O  O     . HOH DA 10 .   ? 24.053  23.429 42.390 1.00 22.00 ? 901  HOH B O     1 
HETATM 10076 O  O     . HOH DA 10 .   ? 29.512  37.571 29.361 1.00 40.88 ? 902  HOH B O     1 
HETATM 10077 O  O     . HOH DA 10 .   ? 20.631  7.391  14.939 1.00 33.59 ? 903  HOH B O     1 
HETATM 10078 O  O     . HOH DA 10 .   ? 18.973  65.491 26.948 1.00 20.24 ? 904  HOH B O     1 
HETATM 10079 O  O     . HOH DA 10 .   ? 40.774  0.056  28.414 1.00 17.38 ? 905  HOH B O     1 
HETATM 10080 O  O     . HOH DA 10 .   ? 15.737  56.754 9.460  1.00 37.20 ? 906  HOH B O     1 
HETATM 10081 O  O     . HOH DA 10 .   ? 30.652  17.814 -0.483 1.00 21.81 ? 907  HOH B O     1 
HETATM 10082 O  O     . HOH DA 10 .   ? 2.947   51.378 35.875 1.00 33.69 ? 908  HOH B O     1 
HETATM 10083 O  O     . HOH DA 10 .   ? 32.722  22.821 39.559 1.00 21.14 ? 909  HOH B O     1 
HETATM 10084 O  O     . HOH DA 10 .   ? 8.394   10.796 12.635 1.00 64.18 ? 910  HOH B O     1 
HETATM 10085 O  O     . HOH DA 10 .   ? 46.174  10.216 12.468 1.00 31.66 ? 911  HOH B O     1 
HETATM 10086 O  O     . HOH DA 10 .   ? 14.231  11.450 18.547 1.00 14.04 ? 912  HOH B O     1 
HETATM 10087 O  O     . HOH DA 10 .   ? -0.508  44.275 47.563 1.00 34.79 ? 913  HOH B O     1 
HETATM 10088 O  O     . HOH DA 10 .   ? 20.678  16.529 -0.236 1.00 25.88 ? 914  HOH B O     1 
HETATM 10089 O  O     . HOH DA 10 .   ? 39.712  29.201 48.279 1.00 31.80 ? 915  HOH B O     1 
HETATM 10090 O  O     . HOH DA 10 .   ? 37.740  -7.893 26.159 1.00 60.26 ? 916  HOH B O     1 
HETATM 10091 O  O     . HOH DA 10 .   ? 0.393   55.362 49.757 1.00 28.91 ? 917  HOH B O     1 
HETATM 10092 O  O     . HOH DA 10 .   ? 6.829   29.882 56.712 1.00 26.41 ? 918  HOH B O     1 
HETATM 10093 O  O     . HOH DA 10 .   ? 6.109   32.774 18.183 1.00 30.30 ? 919  HOH B O     1 
HETATM 10094 O  O     . HOH DA 10 .   ? 0.726   40.879 30.582 1.00 29.27 ? 920  HOH B O     1 
HETATM 10095 O  O     . HOH DA 10 .   ? 40.693  34.033 7.683  1.00 27.55 ? 921  HOH B O     1 
HETATM 10096 O  O     . HOH DA 10 .   ? 35.489  30.776 43.681 1.00 42.38 ? 922  HOH B O     1 
HETATM 10097 O  O     . HOH DA 10 .   ? 30.644  9.237  27.489 1.00 21.26 ? 923  HOH B O     1 
HETATM 10098 O  O     . HOH DA 10 .   ? 18.655  19.142 5.649  1.00 27.80 ? 924  HOH B O     1 
HETATM 10099 O  O     . HOH DA 10 .   ? 28.163  62.245 35.331 1.00 21.65 ? 925  HOH B O     1 
HETATM 10100 O  O     . HOH DA 10 .   ? 40.602  29.959 25.289 1.00 28.01 ? 926  HOH B O     1 
HETATM 10101 O  O     . HOH DA 10 .   ? 31.877  53.417 17.566 1.00 40.28 ? 927  HOH B O     1 
HETATM 10102 O  O     . HOH DA 10 .   ? 19.851  47.081 33.285 1.00 10.81 ? 928  HOH B O     1 
HETATM 10103 O  O     . HOH DA 10 .   ? 6.279   43.010 13.075 1.00 31.24 ? 929  HOH B O     1 
HETATM 10104 O  O     . HOH DA 10 .   ? 15.646  40.355 33.546 1.00 14.63 ? 930  HOH B O     1 
HETATM 10105 O  O     . HOH DA 10 .   ? 20.976  45.021 31.922 1.00 7.64  ? 931  HOH B O     1 
HETATM 10106 O  O     . HOH DA 10 .   ? 16.910  39.036 31.486 1.00 14.61 ? 932  HOH B O     1 
HETATM 10107 O  O     . HOH DA 10 .   ? 29.370  4.560  13.579 1.00 19.41 ? 933  HOH B O     1 
HETATM 10108 O  O     . HOH DA 10 .   ? 13.459  56.161 50.277 1.00 22.36 ? 934  HOH B O     1 
HETATM 10109 O  O     . HOH DA 10 .   ? 24.549  14.796 42.997 1.00 12.38 ? 935  HOH B O     1 
HETATM 10110 O  O     . HOH DA 10 .   ? 22.752  24.864 4.615  1.00 26.57 ? 936  HOH B O     1 
HETATM 10111 O  O     . HOH DA 10 .   ? 24.455  59.560 34.721 1.00 25.78 ? 937  HOH B O     1 
HETATM 10112 O  O     . HOH DA 10 .   ? 30.055  5.977  26.577 1.00 24.52 ? 938  HOH B O     1 
HETATM 10113 O  O     . HOH DA 10 .   ? 20.371  14.832 44.018 1.00 17.14 ? 939  HOH B O     1 
HETATM 10114 O  O     . HOH DA 10 .   ? -1.606  37.826 43.173 1.00 22.59 ? 940  HOH B O     1 
HETATM 10115 O  O     . HOH DA 10 .   ? 2.443   47.931 12.950 1.00 24.54 ? 941  HOH B O     1 
HETATM 10116 O  O     . HOH DA 10 .   ? 32.335  8.856  20.324 1.00 30.52 ? 942  HOH B O     1 
HETATM 10117 O  O     . HOH DA 10 .   ? 21.623  48.082 35.096 1.00 14.12 ? 943  HOH B O     1 
HETATM 10118 O  O     . HOH DA 10 .   ? 27.193  9.856  32.292 1.00 21.28 ? 944  HOH B O     1 
HETATM 10119 O  O     . HOH DA 10 .   ? 10.209  62.111 25.279 1.00 23.82 ? 945  HOH B O     1 
HETATM 10120 O  O     . HOH DA 10 .   ? 22.974  47.603 3.549  1.00 32.71 ? 946  HOH B O     1 
HETATM 10121 O  O     . HOH DA 10 .   ? 1.134   30.665 39.192 1.00 40.58 ? 947  HOH B O     1 
HETATM 10122 O  O     . HOH DA 10 .   ? -1.917  50.499 50.228 1.00 30.17 ? 948  HOH B O     1 
HETATM 10123 O  O     . HOH DA 10 .   ? 32.839  26.312 23.396 1.00 29.27 ? 949  HOH B O     1 
HETATM 10124 O  O     . HOH DA 10 .   ? 33.639  12.719 1.848  1.00 14.74 ? 950  HOH B O     1 
HETATM 10125 O  O     . HOH DA 10 .   ? 31.941  3.736  24.118 1.00 30.62 ? 951  HOH B O     1 
HETATM 10126 O  O     . HOH DA 10 .   ? 23.455  -2.198 38.456 1.00 28.85 ? 954  HOH B O     1 
HETATM 10127 O  O     . HOH DA 10 .   ? 11.815  25.417 6.220  1.00 28.85 ? 957  HOH B O     1 
HETATM 10128 O  O     . HOH DA 10 .   ? 35.187  33.555 44.619 1.00 37.58 ? 958  HOH B O     1 
HETATM 10129 O  O     . HOH DA 10 .   ? 21.470  -2.738 25.895 1.00 19.85 ? 974  HOH B O     1 
HETATM 10130 O  O     . HOH DA 10 .   ? 19.281  34.671 -0.757 1.00 39.27 ? 978  HOH B O     1 
HETATM 10131 O  O     . HOH DA 10 .   ? 5.059   47.780 12.409 1.00 29.99 ? 984  HOH B O     1 
HETATM 10132 O  O     . HOH DA 10 .   ? 34.729  30.140 48.906 1.00 31.58 ? 995  HOH B O     1 
HETATM 10133 O  O     . HOH DA 10 .   ? 28.320  55.914 42.644 1.00 34.45 ? 1003 HOH B O     1 
HETATM 10134 O  O     . HOH DA 10 .   ? 7.997   59.017 45.327 1.00 40.90 ? 1004 HOH B O     1 
HETATM 10135 O  O     . HOH DA 10 .   ? 28.174  55.308 45.310 1.00 38.52 ? 1011 HOH B O     1 
HETATM 10136 O  O     . HOH DA 10 .   ? 33.523  29.635 28.130 1.00 34.36 ? 1018 HOH B O     1 
HETATM 10137 O  O     . HOH DA 10 .   ? 7.161   19.357 13.531 1.00 19.18 ? 1019 HOH B O     1 
HETATM 10138 O  O     . HOH DA 10 .   ? 35.132  32.618 48.069 1.00 35.65 ? 1024 HOH B O     1 
HETATM 10139 O  O     . HOH DA 10 .   ? 17.859  -9.024 31.693 1.00 23.03 ? 1033 HOH B O     1 
HETATM 10140 O  O     . HOH DA 10 .   ? 24.785  60.804 20.421 1.00 27.85 ? 1042 HOH B O     1 
HETATM 10141 O  O     . HOH DA 10 .   ? 20.834  35.317 -3.632 1.00 32.77 ? 1043 HOH B O     1 
HETATM 10142 O  O     . HOH DA 10 .   ? 21.559  6.515  23.410 1.00 25.99 ? 1048 HOH B O     1 
HETATM 10143 O  O     . HOH DA 10 .   ? -1.065  26.740 40.541 1.00 39.64 ? 1049 HOH B O     1 
HETATM 10144 O  O     . HOH DA 10 .   ? 9.124   13.316 41.580 1.00 38.23 ? 1055 HOH B O     1 
HETATM 10145 O  O     . HOH DA 10 .   ? 5.275   24.623 15.123 1.00 22.43 ? 1057 HOH B O     1 
HETATM 10146 O  O     . HOH DA 10 .   ? 43.364  26.147 14.294 1.00 35.61 ? 1064 HOH B O     1 
HETATM 10147 O  O     . HOH DA 10 .   ? 41.673  23.761 17.209 1.00 31.50 ? 1081 HOH B O     1 
HETATM 10148 O  O     . HOH DA 10 .   ? 36.890  1.572  17.774 1.00 32.09 ? 1088 HOH B O     1 
HETATM 10149 O  O     . HOH DA 10 .   ? 25.671  51.093 6.308  1.00 27.66 ? 1090 HOH B O     1 
HETATM 10150 O  O     . HOH DA 10 .   ? 42.825  33.109 43.640 1.00 56.74 ? 1094 HOH B O     1 
HETATM 10151 O  O     . HOH DA 10 .   ? 42.823  26.494 20.987 1.00 48.52 ? 1103 HOH B O     1 
HETATM 10152 O  O     . HOH DA 10 .   ? 25.775  41.049 44.933 1.00 26.03 ? 1104 HOH B O     1 
HETATM 10153 O  O     . HOH DA 10 .   ? 34.579  9.163  30.004 1.00 22.74 ? 1105 HOH B O     1 
HETATM 10154 O  O     . HOH DA 10 .   ? 3.550   55.849 26.257 1.00 38.27 ? 1117 HOH B O     1 
HETATM 10155 O  O     . HOH DA 10 .   ? 11.287  56.068 22.694 1.00 25.44 ? 1118 HOH B O     1 
HETATM 10156 O  O     . HOH DA 10 .   ? 25.113  8.154  36.662 1.00 19.60 ? 1121 HOH B O     1 
HETATM 10157 O  O     . HOH DA 10 .   ? 42.055  19.447 8.429  1.00 32.51 ? 1122 HOH B O     1 
HETATM 10158 O  O     . HOH DA 10 .   ? 23.657  50.703 53.055 1.00 40.75 ? 1127 HOH B O     1 
HETATM 10159 O  O     . HOH DA 10 .   ? 36.718  11.077 30.747 1.00 28.57 ? 1143 HOH B O     1 
HETATM 10160 O  O     . HOH DA 10 .   ? 4.790   55.387 44.245 1.00 33.13 ? 1147 HOH B O     1 
HETATM 10161 O  O     . HOH DA 10 .   ? 43.122  27.765 29.634 1.00 31.41 ? 1154 HOH B O     1 
HETATM 10162 O  O     . HOH DA 10 .   ? 6.061   33.869 11.315 1.00 39.04 ? 1157 HOH B O     1 
HETATM 10163 O  O     . HOH DA 10 .   ? 31.107  6.866  28.970 1.00 21.91 ? 1162 HOH B O     1 
HETATM 10164 O  O     . HOH DA 10 .   ? 16.159  58.893 22.400 1.00 36.74 ? 1168 HOH B O     1 
HETATM 10165 O  O     . HOH DA 10 .   ? 17.644  9.900  19.289 1.00 28.07 ? 1175 HOH B O     1 
HETATM 10166 O  O     . HOH DA 10 .   ? 14.187  59.008 8.284  1.00 46.49 ? 1187 HOH B O     1 
HETATM 10167 O  O     . HOH DA 10 .   ? 48.168  16.016 32.457 1.00 39.69 ? 1190 HOH B O     1 
HETATM 10168 O  O     . HOH DA 10 .   ? 5.887   4.512  22.160 1.00 22.79 ? 1207 HOH B O     1 
HETATM 10169 O  O     . HOH DA 10 .   ? 23.589  -4.615 23.981 1.00 10.89 ? 1237 HOH B O     1 
HETATM 10170 O  O     . HOH DA 10 .   ? 6.960   20.643 49.014 1.00 39.22 ? 1240 HOH B O     1 
HETATM 10171 O  O     . HOH DA 10 .   ? 34.035  41.606 11.835 1.00 41.27 ? 1241 HOH B O     1 
HETATM 10172 O  O     . HOH DA 10 .   ? 32.712  43.706 12.895 1.00 31.28 ? 1248 HOH B O     1 
HETATM 10173 O  O     . HOH DA 10 .   ? 6.016   53.517 33.776 1.00 43.22 ? 1254 HOH B O     1 
HETATM 10174 O  O     . HOH DA 10 .   ? 23.408  28.670 1.727  1.00 30.09 ? 1256 HOH B O     1 
HETATM 10175 O  O     . HOH DA 10 .   ? -4.197  38.286 42.582 1.00 31.92 ? 1261 HOH B O     1 
HETATM 10176 O  O     . HOH DA 10 .   ? 35.233  57.919 34.139 1.00 63.59 ? 1263 HOH B O     1 
HETATM 10177 O  O     . HOH DA 10 .   ? 8.242   33.568 8.854  1.00 32.24 ? 1264 HOH B O     1 
HETATM 10178 O  O     . HOH DA 10 .   ? 11.172  25.872 50.632 1.00 15.26 ? 1283 HOH B O     1 
HETATM 10179 O  O     . HOH DA 10 .   ? 12.064  13.745 27.944 1.00 40.20 ? 1285 HOH B O     1 
HETATM 10180 O  O     . HOH DA 10 .   ? 1.831   51.751 19.098 1.00 31.22 ? 1286 HOH B O     1 
HETATM 10181 O  O     . HOH DA 10 .   ? 7.387   11.473 32.388 1.00 32.26 ? 1289 HOH B O     1 
HETATM 10182 O  O     . HOH DA 10 .   ? 0.000   48.367 29.963 1.00 27.38 ? 1290 HOH B O     1 
HETATM 10183 O  O     . HOH DA 10 .   ? 21.747  60.130 40.943 1.00 53.41 ? 1299 HOH B O     1 
HETATM 10184 O  O     . HOH DA 10 .   ? 45.387  15.115 21.548 1.00 61.84 ? 1300 HOH B O     1 
HETATM 10185 O  O     . HOH DA 10 .   ? 24.933  60.884 28.808 1.00 23.39 ? 1306 HOH B O     1 
HETATM 10186 O  O     . HOH DA 10 .   ? 10.533  59.939 30.865 1.00 37.53 ? 1317 HOH B O     1 
HETATM 10187 O  O     . HOH DA 10 .   ? 10.007  42.621 57.684 1.00 36.19 ? 1319 HOH B O     1 
HETATM 10188 O  O     . HOH DA 10 .   ? 31.999  36.318 46.088 1.00 32.70 ? 1325 HOH B O     1 
HETATM 10189 O  O     . HOH DA 10 .   ? 12.134  46.411 58.409 1.00 31.66 ? 1327 HOH B O     1 
HETATM 10190 O  O     . HOH DA 10 .   ? 29.592  33.067 46.017 1.00 34.51 ? 1338 HOH B O     1 
HETATM 10191 O  O     . HOH DA 10 .   ? 52.270  33.226 48.822 1.00 69.05 ? 1358 HOH B O     1 
HETATM 10192 O  O     . HOH DA 10 .   ? 43.725  19.927 39.435 1.00 53.24 ? 1361 HOH B O     1 
HETATM 10193 O  O     . HOH DA 10 .   ? 9.572   20.459 45.114 1.00 27.87 ? 1376 HOH B O     1 
HETATM 10194 O  O     . HOH DA 10 .   ? 11.262  18.923 46.128 1.00 23.88 ? 1377 HOH B O     1 
HETATM 10195 O  O     . HOH DA 10 .   ? 19.473  -8.805 37.985 1.00 48.12 ? 1386 HOH B O     1 
HETATM 10196 O  O     . HOH DA 10 .   ? 8.851   16.534 26.634 1.00 30.68 ? 1387 HOH B O     1 
HETATM 10197 O  O     . HOH DA 10 .   ? -2.519  15.236 22.233 1.00 20.39 ? 1388 HOH B O     1 
HETATM 10198 O  O     . HOH DA 10 .   ? -6.558  12.782 14.968 1.00 61.12 ? 1389 HOH B O     1 
HETATM 10199 O  O     . HOH DA 10 .   ? -8.192  16.653 25.178 1.00 18.17 ? 1390 HOH B O     1 
HETATM 10200 O  O     . HOH DA 10 .   ? 37.067  23.568 49.639 1.00 40.90 ? 1391 HOH B O     1 
HETATM 10201 O  O     . HOH DA 10 .   ? 43.461  18.169 17.557 1.00 15.75 ? 1392 HOH B O     1 
HETATM 10202 O  O     . HOH DA 10 .   ? 41.969  31.321 10.835 1.00 27.76 ? 1393 HOH B O     1 
HETATM 10203 O  O     . HOH DA 10 .   ? 40.458  33.792 14.508 1.00 24.62 ? 1394 HOH B O     1 
HETATM 10204 O  O     . HOH DA 10 .   ? 43.613  27.539 18.464 1.00 39.23 ? 1395 HOH B O     1 
HETATM 10205 O  O     . HOH DA 10 .   ? 20.912  26.915 8.059  1.00 6.63  ? 1396 HOH B O     1 
HETATM 10206 O  O     . HOH DA 10 .   ? 18.854  25.706 6.534  1.00 9.54  ? 1397 HOH B O     1 
HETATM 10207 O  O     . HOH DA 10 .   ? 17.691  26.404 4.201  1.00 36.46 ? 1398 HOH B O     1 
HETATM 10208 O  O     . HOH DA 10 .   ? 21.110  21.961 3.228  1.00 32.02 ? 1399 HOH B O     1 
HETATM 10209 O  O     . HOH DA 10 .   ? 29.291  41.588 22.945 1.00 34.33 ? 1400 HOH B O     1 
HETATM 10210 O  O     . HOH DA 10 .   ? 30.250  43.336 21.542 1.00 33.45 ? 1401 HOH B O     1 
HETATM 10211 O  O     . HOH DA 10 .   ? 36.868  46.810 23.627 1.00 48.48 ? 1402 HOH B O     1 
HETATM 10212 O  O     . HOH DA 10 .   ? 37.030  48.105 33.571 1.00 44.31 ? 1403 HOH B O     1 
HETATM 10213 O  O     . HOH DA 10 .   ? 35.765  54.329 36.726 1.00 52.63 ? 1404 HOH B O     1 
HETATM 10214 O  O     . HOH DA 10 .   ? 27.051  41.522 36.025 1.00 24.32 ? 1406 HOH B O     1 
HETATM 10215 O  O     . HOH DA 10 .   ? 34.976  35.633 40.024 1.00 26.65 ? 1407 HOH B O     1 
HETATM 10216 O  O     . HOH DA 10 .   ? 22.487  65.208 24.150 1.00 50.94 ? 1412 HOH B O     1 
HETATM 10217 O  O     . HOH DA 10 .   ? 21.676  63.385 22.607 1.00 58.30 ? 1413 HOH B O     1 
HETATM 10218 O  O     . HOH DA 10 .   ? 27.152  62.264 22.066 1.00 28.24 ? 1414 HOH B O     1 
HETATM 10219 O  O     . HOH DA 10 .   ? 20.395  44.194 0.745  1.00 58.48 ? 1415 HOH B O     1 
HETATM 10220 O  O     . HOH DA 10 .   ? 4.251   45.252 12.867 1.00 31.13 ? 1416 HOH B O     1 
HETATM 10221 O  O     . HOH DA 10 .   ? 28.374  9.847  5.609  1.00 9.74  ? 1417 HOH B O     1 
HETATM 10222 O  O     . HOH DA 10 .   ? 30.337  8.122  7.798  1.00 35.54 ? 1418 HOH B O     1 
HETATM 10223 O  O     . HOH DA 10 .   ? 3.076   41.968 17.684 1.00 39.23 ? 1419 HOH B O     1 
HETATM 10224 O  O     . HOH DA 10 .   ? -2.335  47.828 15.488 1.00 29.24 ? 1420 HOH B O     1 
HETATM 10225 O  O     . HOH DA 10 .   ? 36.607  38.813 5.185  1.00 44.94 ? 1425 HOH B O     1 
HETATM 10226 O  O     . HOH DA 10 .   ? 2.271   58.153 21.542 1.00 54.82 ? 1426 HOH B O     1 
HETATM 10227 O  O     . HOH DA 10 .   ? 36.890  36.558 47.808 1.00 56.98 ? 1427 HOH B O     1 
HETATM 10228 O  O     . HOH DA 10 .   ? 32.280  30.769 48.139 1.00 38.00 ? 1428 HOH B O     1 
HETATM 10229 O  O     . HOH DA 10 .   ? 38.586  56.707 43.931 1.00 62.23 ? 1429 HOH B O     1 
HETATM 10230 O  O     . HOH DA 10 .   ? -3.636  48.325 45.227 1.00 35.91 ? 1430 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 5   ? 0.6299 0.4929 0.5001 0.0000 0.0000 0.0000 33  HIS A N   
2    C CA  . HIS A 5   ? 0.5890 0.4876 0.4987 0.0000 0.0000 0.0000 33  HIS A CA  
3    C C   . HIS A 5   ? 0.5460 0.4826 0.4881 0.0000 0.0000 0.0000 33  HIS A C   
4    O O   . HIS A 5   ? 0.5448 0.4900 0.4844 0.0000 0.0000 0.0000 33  HIS A O   
5    C CB  . HIS A 5   ? 0.5909 0.4974 0.4994 0.0000 0.0000 0.0000 33  HIS A CB  
6    C CG  . HIS A 5   ? 0.5919 0.5170 0.4958 0.0000 0.0000 0.0000 33  HIS A CG  
7    N ND1 . HIS A 5   ? 0.5689 0.5344 0.5043 0.0000 0.0000 0.0000 33  HIS A ND1 
8    C CD2 . HIS A 5   ? 0.6286 0.5359 0.4993 0.0000 0.0000 0.0000 33  HIS A CD2 
9    C CE1 . HIS A 5   ? 0.5607 0.5353 0.4857 0.0000 0.0000 0.0000 33  HIS A CE1 
10   N NE2 . HIS A 5   ? 0.6077 0.5475 0.4938 0.0000 0.0000 0.0000 33  HIS A NE2 
11   N N   . HIS A 6   ? 0.5131 0.4725 0.4885 0.0000 0.0000 0.0000 34  HIS A N   
12   C CA  . HIS A 6   ? 0.4781 0.4691 0.4807 0.0000 0.0000 0.0000 34  HIS A CA  
13   C C   . HIS A 6   ? 0.4609 0.4801 0.4691 0.0000 0.0000 0.0000 34  HIS A C   
14   O O   . HIS A 6   ? 0.4620 0.4864 0.4670 0.0000 0.0000 0.0000 34  HIS A O   
15   C CB  . HIS A 6   ? 0.4506 0.4608 0.4898 0.0000 0.0000 0.0000 34  HIS A CB  
16   C CG  . HIS A 6   ? 0.4326 0.4584 0.4900 0.0000 0.0000 0.0000 34  HIS A CG  
17   N ND1 . HIS A 6   ? 0.3957 0.4492 0.4649 0.0000 0.0000 0.0000 34  HIS A ND1 
18   C CD2 . HIS A 6   ? 0.4515 0.4644 0.5125 0.0000 0.0000 0.0000 34  HIS A CD2 
19   C CE1 . HIS A 6   ? 0.4038 0.4600 0.4817 0.0000 0.0000 0.0000 34  HIS A CE1 
20   N NE2 . HIS A 6   ? 0.4286 0.4587 0.4997 0.0000 0.0000 0.0000 34  HIS A NE2 
21   N N   . PRO A 7   ? 0.4518 0.4856 0.4655 0.0000 0.0000 0.0000 35  PRO A N   
22   C CA  . PRO A 7   ? 0.4387 0.5034 0.4640 0.0000 0.0000 0.0000 35  PRO A CA  
23   C C   . PRO A 7   ? 0.4095 0.5042 0.4576 0.0000 0.0000 0.0000 35  PRO A C   
24   O O   . PRO A 7   ? 0.4005 0.5178 0.4549 0.0000 0.0000 0.0000 35  PRO A O   
25   C CB  . PRO A 7   ? 0.4412 0.5127 0.4723 0.0000 0.0000 0.0000 35  PRO A CB  
26   C CG  . PRO A 7   ? 0.4487 0.4926 0.4673 0.0000 0.0000 0.0000 35  PRO A CG  
27   C CD  . PRO A 7   ? 0.4636 0.4798 0.4678 0.0000 0.0000 0.0000 35  PRO A CD  
28   N N   . CYS A 8   ? 0.3943 0.4874 0.4553 0.0000 0.0000 0.0000 36  CYS A N   
29   C CA  . CYS A 8   ? 0.3778 0.4915 0.4577 0.0000 0.0000 0.0000 36  CYS A CA  
30   C C   . CYS A 8   ? 0.3877 0.4887 0.4585 0.0000 0.0000 0.0000 36  CYS A C   
31   O O   . CYS A 8   ? 0.3764 0.4854 0.4557 0.0000 0.0000 0.0000 36  CYS A O   
32   C CB  . CYS A 8   ? 0.3596 0.4786 0.4620 0.0000 0.0000 0.0000 36  CYS A CB  
33   S SG  . CYS A 8   ? 0.3793 0.5067 0.4815 0.0000 0.0000 0.0000 36  CYS A SG  
34   N N   . CYS A 9   ? 0.4132 0.4889 0.4614 0.0000 0.0000 0.0000 37  CYS A N   
35   C CA  . CYS A 9   ? 0.4374 0.4927 0.4705 0.0000 0.0000 0.0000 37  CYS A CA  
36   C C   . CYS A 9   ? 0.4469 0.5018 0.4617 0.0000 0.0000 0.0000 37  CYS A C   
37   O O   . CYS A 9   ? 0.4570 0.5001 0.4706 0.0000 0.0000 0.0000 37  CYS A O   
38   C CB  . CYS A 9   ? 0.4732 0.4966 0.4738 0.0000 0.0000 0.0000 37  CYS A CB  
39   S SG  . CYS A 9   ? 0.4945 0.5029 0.5094 0.0000 0.0000 0.0000 37  CYS A SG  
40   N N   . SER A 10  ? 0.4459 0.5123 0.4479 0.0000 0.0000 0.0000 38  SER A N   
41   C CA  . SER A 10  ? 0.4642 0.5261 0.4422 0.0000 0.0000 0.0000 38  SER A CA  
42   C C   . SER A 10  ? 0.4377 0.5178 0.4369 0.0000 0.0000 0.0000 38  SER A C   
43   O O   . SER A 10  ? 0.4588 0.5288 0.4332 0.0000 0.0000 0.0000 38  SER A O   
44   C CB  . SER A 10  ? 0.4745 0.5483 0.4410 0.0000 0.0000 0.0000 38  SER A CB  
45   O OG  . SER A 10  ? 0.4517 0.5662 0.4574 0.0000 0.0000 0.0000 38  SER A OG  
46   N N   . ASN A 11  ? 0.3972 0.4972 0.4356 0.0000 0.0000 0.0000 39  ASN A N   
47   C CA  . ASN A 11  ? 0.3746 0.4915 0.4343 0.0000 0.0000 0.0000 39  ASN A CA  
48   C C   . ASN A 11  ? 0.3698 0.5075 0.4243 0.0000 0.0000 0.0000 39  ASN A C   
49   O O   . ASN A 11  ? 0.3864 0.5170 0.4246 0.0000 0.0000 0.0000 39  ASN A O   
50   C CB  . ASN A 11  ? 0.3926 0.4859 0.4440 0.0000 0.0000 0.0000 39  ASN A CB  
51   C CG  . ASN A 11  ? 0.3954 0.4751 0.4633 0.0000 0.0000 0.0000 39  ASN A CG  
52   O OD1 . ASN A 11  ? 0.3584 0.4541 0.4628 0.0000 0.0000 0.0000 39  ASN A OD1 
53   N ND2 . ASN A 11  ? 0.4239 0.4712 0.4625 0.0000 0.0000 0.0000 39  ASN A ND2 
54   N N   . PRO A 12  ? 0.3532 0.5149 0.4222 0.0000 0.0000 0.0000 40  PRO A N   
55   C CA  . PRO A 12  ? 0.3515 0.5393 0.4250 0.0000 0.0000 0.0000 40  PRO A CA  
56   C C   . PRO A 12  ? 0.3324 0.5398 0.4234 0.0000 0.0000 0.0000 40  PRO A C   
57   O O   . PRO A 12  ? 0.3363 0.5577 0.4239 0.0000 0.0000 0.0000 40  PRO A O   
58   C CB  . PRO A 12  ? 0.3393 0.5461 0.4317 0.0000 0.0000 0.0000 40  PRO A CB  
59   C CG  . PRO A 12  ? 0.3312 0.5237 0.4302 0.0000 0.0000 0.0000 40  PRO A CG  
60   C CD  . PRO A 12  ? 0.3375 0.5013 0.4204 0.0000 0.0000 0.0000 40  PRO A CD  
61   N N   . CYS A 13  ? 0.3131 0.5188 0.4205 0.0000 0.0000 0.0000 41  CYS A N   
62   C CA  . CYS A 13  ? 0.3013 0.5208 0.4220 0.0000 0.0000 0.0000 41  CYS A CA  
63   C C   . CYS A 13  ? 0.3170 0.5166 0.4216 0.0000 0.0000 0.0000 41  CYS A C   
64   O O   . CYS A 13  ? 0.3289 0.5043 0.4295 0.0000 0.0000 0.0000 41  CYS A O   
65   C CB  . CYS A 13  ? 0.2879 0.5063 0.4258 0.0000 0.0000 0.0000 41  CYS A CB  
66   S SG  . CYS A 13  ? 0.2850 0.5080 0.4281 0.0000 0.0000 0.0000 41  CYS A SG  
67   N N   . GLN A 14  ? 0.3252 0.5341 0.4223 0.0000 0.0000 0.0000 42  GLN A N   
68   C CA  . GLN A 14  ? 0.3500 0.5315 0.4208 0.0000 0.0000 0.0000 42  GLN A CA  
69   C C   . GLN A 14  ? 0.3343 0.5164 0.4172 0.0000 0.0000 0.0000 42  GLN A C   
70   O O   . GLN A 14  ? 0.3097 0.5138 0.4171 0.0000 0.0000 0.0000 42  GLN A O   
71   C CB  . GLN A 14  ? 0.3798 0.5619 0.4235 0.0000 0.0000 0.0000 42  GLN A CB  
72   C CG  . GLN A 14  ? 0.4025 0.5832 0.4313 0.0000 0.0000 0.0000 42  GLN A CG  
73   C CD  . GLN A 14  ? 0.4487 0.5873 0.4481 0.0000 0.0000 0.0000 42  GLN A CD  
74   O OE1 . GLN A 14  ? 0.4912 0.5895 0.4565 0.0000 0.0000 0.0000 42  GLN A OE1 
75   N NE2 . GLN A 14  ? 0.4256 0.5702 0.4370 0.0000 0.0000 0.0000 42  GLN A NE2 
76   N N   . ASN A 15  ? 0.3600 0.5108 0.4195 0.0000 0.0000 0.0000 43  ASN A N   
77   C CA  . ASN A 15  ? 0.3595 0.5031 0.4209 0.0000 0.0000 0.0000 43  ASN A CA  
78   C C   . ASN A 15  ? 0.3361 0.4872 0.4302 0.0000 0.0000 0.0000 43  ASN A C   
79   O O   . ASN A 15  ? 0.3298 0.4880 0.4290 0.0000 0.0000 0.0000 43  ASN A O   
80   C CB  . ASN A 15  ? 0.3569 0.5213 0.4111 0.0000 0.0000 0.0000 43  ASN A CB  
81   C CG  . ASN A 15  ? 0.3888 0.5395 0.4065 0.0000 0.0000 0.0000 43  ASN A CG  
82   O OD1 . ASN A 15  ? 0.4369 0.5426 0.4149 0.0000 0.0000 0.0000 43  ASN A OD1 
83   N ND2 . ASN A 15  ? 0.3632 0.5493 0.3925 0.0000 0.0000 0.0000 43  ASN A ND2 
84   N N   . ARG A 16  ? 0.3255 0.4718 0.4383 0.0000 0.0000 0.0000 44  ARG A N   
85   C CA  . ARG A 16  ? 0.3161 0.4659 0.4595 0.0000 0.0000 0.0000 44  ARG A CA  
86   C C   . ARG A 16  ? 0.2969 0.4689 0.4484 0.0000 0.0000 0.0000 44  ARG A C   
87   O O   . ARG A 16  ? 0.2965 0.4641 0.4605 0.0000 0.0000 0.0000 44  ARG A O   
88   C CB  . ARG A 16  ? 0.3268 0.4584 0.4759 0.0000 0.0000 0.0000 44  ARG A CB  
89   C CG  . ARG A 16  ? 0.3674 0.4688 0.5032 0.0000 0.0000 0.0000 44  ARG A CG  
90   C CD  . ARG A 16  ? 0.3802 0.4696 0.5469 0.0000 0.0000 0.0000 44  ARG A CD  
91   N NE  . ARG A 16  ? 0.3749 0.4834 0.5832 0.0000 0.0000 0.0000 44  ARG A NE  
92   C CZ  . ARG A 16  ? 0.3817 0.4876 0.6191 0.0000 0.0000 0.0000 44  ARG A CZ  
93   N NH1 . ARG A 16  ? 0.3940 0.4793 0.6257 0.0000 0.0000 0.0000 44  ARG A NH1 
94   N NH2 . ARG A 16  ? 0.3581 0.4778 0.6267 0.0000 0.0000 0.0000 44  ARG A NH2 
95   N N   . GLY A 17  ? 0.2967 0.4882 0.4393 0.0000 0.0000 0.0000 45  GLY A N   
96   C CA  . GLY A 17  ? 0.2818 0.4886 0.4312 0.0000 0.0000 0.0000 45  GLY A CA  
97   C C   . GLY A 17  ? 0.2779 0.4739 0.4355 0.0000 0.0000 0.0000 45  GLY A C   
98   O O   . GLY A 17  ? 0.2740 0.4612 0.4344 0.0000 0.0000 0.0000 45  GLY A O   
99   N N   . GLU A 18  ? 0.2842 0.4758 0.4414 0.0000 0.0000 0.0000 46  GLU A N   
100  C CA  . GLU A 18  ? 0.2975 0.4740 0.4596 0.0000 0.0000 0.0000 46  GLU A CA  
101  C C   . GLU A 18  ? 0.2993 0.4771 0.4497 0.0000 0.0000 0.0000 46  GLU A C   
102  O O   . GLU A 18  ? 0.3085 0.4916 0.4486 0.0000 0.0000 0.0000 46  GLU A O   
103  C CB  . GLU A 18  ? 0.3068 0.4637 0.4701 0.0000 0.0000 0.0000 46  GLU A CB  
104  C CG  . GLU A 18  ? 0.3502 0.5040 0.5277 0.0000 0.0000 0.0000 46  GLU A CG  
105  C CD  . GLU A 18  ? 0.4140 0.5468 0.5941 0.0000 0.0000 0.0000 46  GLU A CD  
106  O OE1 . GLU A 18  ? 0.4571 0.5743 0.6237 0.0000 0.0000 0.0000 46  GLU A OE1 
107  O OE2 . GLU A 18  ? 0.4425 0.5695 0.6346 0.0000 0.0000 0.0000 46  GLU A OE2 
108  N N   . CYS A 19  ? 0.2972 0.4684 0.4495 0.0000 0.0000 0.0000 47  CYS A N   
109  C CA  . CYS A 19  ? 0.3065 0.4742 0.4449 0.0000 0.0000 0.0000 47  CYS A CA  
110  C C   . CYS A 19  ? 0.3195 0.4601 0.4450 0.0000 0.0000 0.0000 47  CYS A C   
111  O O   . CYS A 19  ? 0.3277 0.4540 0.4612 0.0000 0.0000 0.0000 47  CYS A O   
112  C CB  . CYS A 19  ? 0.3112 0.4791 0.4473 0.0000 0.0000 0.0000 47  CYS A CB  
113  S SG  . CYS A 19  ? 0.3384 0.5053 0.4569 0.0000 0.0000 0.0000 47  CYS A SG  
114  N N   . MET A 20  ? 0.3253 0.4577 0.4315 0.0000 0.0000 0.0000 48  MET A N   
115  C CA  . MET A 20  ? 0.3479 0.4435 0.4273 0.0000 0.0000 0.0000 48  MET A CA  
116  C C   . MET A 20  ? 0.3588 0.4474 0.4227 0.0000 0.0000 0.0000 48  MET A C   
117  O O   . MET A 20  ? 0.3478 0.4610 0.4217 0.0000 0.0000 0.0000 48  MET A O   
118  C CB  . MET A 20  ? 0.3620 0.4414 0.4226 0.0000 0.0000 0.0000 48  MET A CB  
119  C CG  . MET A 20  ? 0.4174 0.4465 0.4347 0.0000 0.0000 0.0000 48  MET A CG  
120  S SD  . MET A 20  ? 0.4593 0.4564 0.4381 0.0000 0.0000 0.0000 48  MET A SD  
121  C CE  . MET A 20  ? 0.4437 0.4635 0.4275 0.0000 0.0000 0.0000 48  MET A CE  
122  N N   . SER A 21  ? 0.3799 0.4355 0.4224 0.0000 0.0000 0.0000 49  SER A N   
123  C CA  . SER A 21  ? 0.4059 0.4447 0.4276 0.0000 0.0000 0.0000 49  SER A CA  
124  C C   . SER A 21  ? 0.4420 0.4554 0.4368 0.0000 0.0000 0.0000 49  SER A C   
125  O O   . SER A 21  ? 0.4556 0.4426 0.4290 0.0000 0.0000 0.0000 49  SER A O   
126  C CB  . SER A 21  ? 0.4284 0.4320 0.4286 0.0000 0.0000 0.0000 49  SER A CB  
127  O OG  . SER A 21  ? 0.4469 0.4120 0.4232 0.0000 0.0000 0.0000 49  SER A OG  
128  N N   . THR A 22  ? 0.4586 0.4776 0.4541 0.0000 0.0000 0.0000 50  THR A N   
129  C CA  . THR A 22  ? 0.5059 0.4987 0.4773 0.0000 0.0000 0.0000 50  THR A CA  
130  C C   . THR A 22  ? 0.5534 0.5065 0.4958 0.0000 0.0000 0.0000 50  THR A C   
131  O O   . THR A 22  ? 0.6011 0.5288 0.5239 0.0000 0.0000 0.0000 50  THR A O   
132  C CB  . THR A 22  ? 0.4834 0.5260 0.4944 0.0000 0.0000 0.0000 50  THR A CB  
133  O OG1 . THR A 22  ? 0.4677 0.5571 0.5203 0.0000 0.0000 0.0000 50  THR A OG1 
134  C CG2 . THR A 22  ? 0.4652 0.5313 0.4903 0.0000 0.0000 0.0000 50  THR A CG2 
135  N N   . GLY A 23  ? 0.5527 0.4973 0.4909 0.0000 0.0000 0.0000 51  GLY A N   
136  C CA  . GLY A 23  ? 0.5982 0.4990 0.5040 0.0000 0.0000 0.0000 51  GLY A CA  
137  C C   . GLY A 23  ? 0.5812 0.4867 0.4919 0.0000 0.0000 0.0000 51  GLY A C   
138  O O   . GLY A 23  ? 0.5413 0.4787 0.4774 0.0000 0.0000 0.0000 51  GLY A O   
139  N N   . PHE A 24  ? 0.6205 0.4906 0.5045 0.0000 0.0000 0.0000 52  PHE A N   
140  C CA  . PHE A 24  ? 0.6170 0.4835 0.4977 0.0000 0.0000 0.0000 52  PHE A CA  
141  C C   . PHE A 24  ? 0.5798 0.5014 0.5019 0.0000 0.0000 0.0000 52  PHE A C   
142  O O   . PHE A 24  ? 0.5628 0.4917 0.4884 0.0000 0.0000 0.0000 52  PHE A O   
143  C CB  . PHE A 24  ? 0.6742 0.4830 0.5099 0.0000 0.0000 0.0000 52  PHE A CB  
144  C CG  . PHE A 24  ? 0.7179 0.4595 0.4996 0.0000 0.0000 0.0000 52  PHE A CG  
145  C CD1 . PHE A 24  ? 0.7164 0.4371 0.4825 0.0000 0.0000 0.0000 52  PHE A CD1 
146  C CD2 . PHE A 24  ? 0.7537 0.4503 0.4991 0.0000 0.0000 0.0000 52  PHE A CD2 
147  C CE1 . PHE A 24  ? 0.7584 0.4149 0.4727 0.0000 0.0000 0.0000 52  PHE A CE1 
148  C CE2 . PHE A 24  ? 0.8195 0.4424 0.5021 0.0000 0.0000 0.0000 52  PHE A CE2 
149  C CZ  . PHE A 24  ? 0.8205 0.4236 0.4870 0.0000 0.0000 0.0000 52  PHE A CZ  
150  N N   . ASP A 25  ? 0.5739 0.5318 0.5262 0.0000 0.0000 0.0000 53  ASP A N   
151  C CA  . ASP A 25  ? 0.5553 0.5582 0.5393 0.0000 0.0000 0.0000 53  ASP A CA  
152  C C   . ASP A 25  ? 0.5128 0.5728 0.5418 0.0000 0.0000 0.0000 53  ASP A C   
153  O O   . ASP A 25  ? 0.5002 0.5973 0.5561 0.0000 0.0000 0.0000 53  ASP A O   
154  C CB  . ASP A 25  ? 0.5968 0.5905 0.5778 0.0000 0.0000 0.0000 53  ASP A CB  
155  C CG  . ASP A 25  ? 0.6623 0.5966 0.5939 0.0000 0.0000 0.0000 53  ASP A CG  
156  O OD1 . ASP A 25  ? 0.6832 0.6054 0.5963 0.0000 0.0000 0.0000 53  ASP A OD1 
157  O OD2 . ASP A 25  ? 0.7256 0.6229 0.6362 0.0000 0.0000 0.0000 53  ASP A OD2 
158  N N   . GLN A 26  ? 0.4962 0.5591 0.5291 0.0000 0.0000 0.0000 54  GLN A N   
159  C CA  . GLN A 26  ? 0.4600 0.5715 0.5313 0.0000 0.0000 0.0000 54  GLN A CA  
160  C C   . GLN A 26  ? 0.4282 0.5429 0.4977 0.0000 0.0000 0.0000 54  GLN A C   
161  O O   . GLN A 26  ? 0.4343 0.5122 0.4763 0.0000 0.0000 0.0000 54  GLN A O   
162  C CB  . GLN A 26  ? 0.4798 0.5943 0.5626 0.0000 0.0000 0.0000 54  GLN A CB  
163  C CG  . GLN A 26  ? 0.5239 0.6334 0.6148 0.0000 0.0000 0.0000 54  GLN A CG  
164  C CD  . GLN A 26  ? 0.5232 0.6788 0.6532 0.0000 0.0000 0.0000 54  GLN A CD  
165  N N   . TYR A 27  ? 0.3913 0.5487 0.4910 0.0000 0.0000 0.0000 55  TYR A N   
166  C CA  . TYR A 27  ? 0.3703 0.5315 0.4715 0.0000 0.0000 0.0000 55  TYR A CA  
167  C C   . TYR A 27  ? 0.3581 0.5519 0.4833 0.0000 0.0000 0.0000 55  TYR A C   
168  O O   . TYR A 27  ? 0.3529 0.5784 0.5043 0.0000 0.0000 0.0000 55  TYR A O   
169  C CB  . TYR A 27  ? 0.3467 0.5168 0.4519 0.0000 0.0000 0.0000 55  TYR A CB  
170  C CG  . TYR A 27  ? 0.3395 0.5456 0.4642 0.0000 0.0000 0.0000 55  TYR A CG  
171  C CD1 . TYR A 27  ? 0.3136 0.5477 0.4568 0.0000 0.0000 0.0000 55  TYR A CD1 
172  C CD2 . TYR A 27  ? 0.3491 0.5564 0.4690 0.0000 0.0000 0.0000 55  TYR A CD2 
173  C CE1 . TYR A 27  ? 0.3106 0.5741 0.4676 0.0000 0.0000 0.0000 55  TYR A CE1 
174  C CE2 . TYR A 27  ? 0.3442 0.5799 0.4770 0.0000 0.0000 0.0000 55  TYR A CE2 
175  C CZ  . TYR A 27  ? 0.3286 0.5925 0.4800 0.0000 0.0000 0.0000 55  TYR A CZ  
176  O OH  . TYR A 27  ? 0.3252 0.6127 0.4849 0.0000 0.0000 0.0000 55  TYR A OH  
177  N N   . LYS A 28  ? 0.3518 0.5382 0.4708 0.0000 0.0000 0.0000 56  LYS A N   
178  C CA  . LYS A 28  ? 0.3464 0.5584 0.4823 0.0000 0.0000 0.0000 56  LYS A CA  
179  C C   . LYS A 28  ? 0.3234 0.5382 0.4610 0.0000 0.0000 0.0000 56  LYS A C   
180  O O   . LYS A 28  ? 0.3244 0.5124 0.4478 0.0000 0.0000 0.0000 56  LYS A O   
181  C CB  . LYS A 28  ? 0.3779 0.5610 0.4909 0.0000 0.0000 0.0000 56  LYS A CB  
182  C CG  . LYS A 28  ? 0.3982 0.5900 0.5134 0.0000 0.0000 0.0000 56  LYS A CG  
183  C CD  . LYS A 28  ? 0.4166 0.6530 0.5662 0.0000 0.0000 0.0000 56  LYS A CD  
184  C CE  . LYS A 28  ? 0.4377 0.6712 0.5792 0.0000 0.0000 0.0000 56  LYS A CE  
185  N NZ  . LYS A 28  ? 0.4534 0.7183 0.6233 0.0000 0.0000 0.0000 56  LYS A NZ  
186  N N   . CYS A 29  ? 0.3043 0.5509 0.4614 0.0000 0.0000 0.0000 57  CYS A N   
187  C CA  . CYS A 29  ? 0.2901 0.5342 0.4457 0.0000 0.0000 0.0000 57  CYS A CA  
188  C C   . CYS A 29  ? 0.2959 0.5359 0.4470 0.0000 0.0000 0.0000 57  CYS A C   
189  O O   . CYS A 29  ? 0.3023 0.5609 0.4623 0.0000 0.0000 0.0000 57  CYS A O   
190  C CB  . CYS A 29  ? 0.2808 0.5499 0.4479 0.0000 0.0000 0.0000 57  CYS A CB  
191  S SG  . CYS A 29  ? 0.2948 0.5586 0.4542 0.0000 0.0000 0.0000 57  CYS A SG  
192  N N   . ASP A 30  ? 0.2943 0.5097 0.4335 0.0000 0.0000 0.0000 58  ASP A N   
193  C CA  . ASP A 30  ? 0.3051 0.5092 0.4332 0.0000 0.0000 0.0000 58  ASP A CA  
194  C C   . ASP A 30  ? 0.2905 0.5082 0.4282 0.0000 0.0000 0.0000 58  ASP A C   
195  O O   . ASP A 30  ? 0.2825 0.4879 0.4224 0.0000 0.0000 0.0000 58  ASP A O   
196  C CB  . ASP A 30  ? 0.3222 0.4854 0.4289 0.0000 0.0000 0.0000 58  ASP A CB  
197  C CG  . ASP A 30  ? 0.3481 0.4895 0.4330 0.0000 0.0000 0.0000 58  ASP A CG  
198  O OD1 . ASP A 30  ? 0.3511 0.5103 0.4396 0.0000 0.0000 0.0000 58  ASP A OD1 
199  O OD2 . ASP A 30  ? 0.3787 0.4823 0.4402 0.0000 0.0000 0.0000 58  ASP A OD2 
200  N N   . CYS A 31  ? 0.2883 0.5295 0.4323 0.0000 0.0000 0.0000 59  CYS A N   
201  C CA  . CYS A 31  ? 0.2833 0.5343 0.4304 0.0000 0.0000 0.0000 59  CYS A CA  
202  C C   . CYS A 31  ? 0.2922 0.5210 0.4223 0.0000 0.0000 0.0000 59  CYS A C   
203  O O   . CYS A 31  ? 0.2977 0.5305 0.4252 0.0000 0.0000 0.0000 59  CYS A O   
204  C CB  . CYS A 31  ? 0.2821 0.5732 0.4486 0.0000 0.0000 0.0000 59  CYS A CB  
205  S SG  . CYS A 31  ? 0.2923 0.6080 0.4774 0.0000 0.0000 0.0000 59  CYS A SG  
206  N N   . THR A 32  ? 0.2997 0.4991 0.4126 0.0000 0.0000 0.0000 60  THR A N   
207  C CA  . THR A 32  ? 0.3125 0.4826 0.4025 0.0000 0.0000 0.0000 60  THR A CA  
208  C C   . THR A 32  ? 0.3136 0.4720 0.4051 0.0000 0.0000 0.0000 60  THR A C   
209  O O   . THR A 32  ? 0.3099 0.4601 0.4138 0.0000 0.0000 0.0000 60  THR A O   
210  C CB  . THR A 32  ? 0.3366 0.4670 0.4024 0.0000 0.0000 0.0000 60  THR A CB  
211  O OG1 . THR A 32  ? 0.3323 0.4630 0.3877 0.0000 0.0000 0.0000 60  THR A OG1 
212  C CG2 . THR A 32  ? 0.3628 0.4574 0.3974 0.0000 0.0000 0.0000 60  THR A CG2 
213  N N   . ARG A 33  ? 0.3240 0.4797 0.4029 0.0000 0.0000 0.0000 61  ARG A N   
214  C CA  . ARG A 33  ? 0.3352 0.4711 0.4069 0.0000 0.0000 0.0000 61  ARG A CA  
215  C C   . ARG A 33  ? 0.3199 0.4653 0.4050 0.0000 0.0000 0.0000 61  ARG A C   
216  O O   . ARG A 33  ? 0.3400 0.4602 0.4190 0.0000 0.0000 0.0000 61  ARG A O   
217  C CB  . ARG A 33  ? 0.3516 0.4475 0.4130 0.0000 0.0000 0.0000 61  ARG A CB  
218  C CG  . ARG A 33  ? 0.3855 0.4547 0.4146 0.0000 0.0000 0.0000 61  ARG A CG  
219  C CD  . ARG A 33  ? 0.3987 0.4264 0.4173 0.0000 0.0000 0.0000 61  ARG A CD  
220  N NE  . ARG A 33  ? 0.3803 0.4052 0.4109 0.0000 0.0000 0.0000 61  ARG A NE  
221  C CZ  . ARG A 33  ? 0.3983 0.4074 0.4024 0.0000 0.0000 0.0000 61  ARG A CZ  
222  N NH1 . ARG A 33  ? 0.4244 0.4218 0.3918 0.0000 0.0000 0.0000 61  ARG A NH1 
223  N NH2 . ARG A 33  ? 0.3776 0.3793 0.3894 0.0000 0.0000 0.0000 61  ARG A NH2 
224  N N   . THR A 34  ? 0.2978 0.4734 0.3966 0.0000 0.0000 0.0000 62  THR A N   
225  C CA  . THR A 34  ? 0.2961 0.4721 0.3947 0.0000 0.0000 0.0000 62  THR A CA  
226  C C   . THR A 34  ? 0.3162 0.4938 0.3970 0.0000 0.0000 0.0000 62  THR A C   
227  O O   . THR A 34  ? 0.3329 0.4907 0.3962 0.0000 0.0000 0.0000 62  THR A O   
228  C CB  . THR A 34  ? 0.2766 0.4771 0.3898 0.0000 0.0000 0.0000 62  THR A CB  
229  O OG1 . THR A 34  ? 0.2735 0.5092 0.3965 0.0000 0.0000 0.0000 62  THR A OG1 
230  C CG2 . THR A 34  ? 0.2609 0.4563 0.3879 0.0000 0.0000 0.0000 62  THR A CG2 
231  N N   . GLY A 35  ? 0.3185 0.5162 0.4010 0.0000 0.0000 0.0000 63  GLY A N   
232  C CA  . GLY A 35  ? 0.3426 0.5508 0.4148 0.0000 0.0000 0.0000 63  GLY A CA  
233  C C   . GLY A 35  ? 0.3352 0.5841 0.4277 0.0000 0.0000 0.0000 63  GLY A C   
234  O O   . GLY A 35  ? 0.3545 0.6164 0.4426 0.0000 0.0000 0.0000 63  GLY A O   
235  N N   . PHE A 36  ? 0.3110 0.5777 0.4247 0.0000 0.0000 0.0000 64  PHE A N   
236  C CA  . PHE A 36  ? 0.3027 0.6076 0.4392 0.0000 0.0000 0.0000 64  PHE A CA  
237  C C   . PHE A 36  ? 0.2849 0.6224 0.4554 0.0000 0.0000 0.0000 64  PHE A C   
238  O O   . PHE A 36  ? 0.2844 0.6050 0.4503 0.0000 0.0000 0.0000 64  PHE A O   
239  C CB  . PHE A 36  ? 0.3007 0.5858 0.4213 0.0000 0.0000 0.0000 64  PHE A CB  
240  C CG  . PHE A 36  ? 0.3329 0.5800 0.4131 0.0000 0.0000 0.0000 64  PHE A CG  
241  C CD1 . PHE A 36  ? 0.3534 0.6055 0.4189 0.0000 0.0000 0.0000 64  PHE A CD1 
242  C CD2 . PHE A 36  ? 0.3458 0.5474 0.4003 0.0000 0.0000 0.0000 64  PHE A CD2 
243  C CE1 . PHE A 36  ? 0.4018 0.6059 0.4161 0.0000 0.0000 0.0000 64  PHE A CE1 
244  C CE2 . PHE A 36  ? 0.3945 0.5520 0.4058 0.0000 0.0000 0.0000 64  PHE A CE2 
245  C CZ  . PHE A 36  ? 0.4159 0.5706 0.4013 0.0000 0.0000 0.0000 64  PHE A CZ  
246  N N   . TYR A 37  ? 0.2811 0.6610 0.4833 0.0000 0.0000 0.0000 65  TYR A N   
247  C CA  . TYR A 37  ? 0.2731 0.6799 0.5072 0.0000 0.0000 0.0000 65  TYR A CA  
248  C C   . TYR A 37  ? 0.2726 0.7090 0.5323 0.0000 0.0000 0.0000 65  TYR A C   
249  O O   . TYR A 37  ? 0.2831 0.7113 0.5270 0.0000 0.0000 0.0000 65  TYR A O   
250  C CB  . TYR A 37  ? 0.2719 0.7075 0.5319 0.0000 0.0000 0.0000 65  TYR A CB  
251  C CG  . TYR A 37  ? 0.2819 0.7626 0.5744 0.0000 0.0000 0.0000 65  TYR A CG  
252  C CD1 . TYR A 37  ? 0.2731 0.8089 0.6210 0.0000 0.0000 0.0000 65  TYR A CD1 
253  C CD2 . TYR A 37  ? 0.3028 0.7706 0.5729 0.0000 0.0000 0.0000 65  TYR A CD2 
254  C CE1 . TYR A 37  ? 0.2812 0.8639 0.6674 0.0000 0.0000 0.0000 65  TYR A CE1 
255  C CE2 . TYR A 37  ? 0.2979 0.8057 0.5965 0.0000 0.0000 0.0000 65  TYR A CE2 
256  C CZ  . TYR A 37  ? 0.2992 0.8673 0.6589 0.0000 0.0000 0.0000 65  TYR A CZ  
257  O OH  . TYR A 37  ? 0.2890 0.9020 0.6852 0.0000 0.0000 0.0000 65  TYR A OH  
258  N N   . GLY A 38  ? 0.2670 0.7316 0.5613 0.0000 0.0000 0.0000 66  GLY A N   
259  C CA  . GLY A 38  ? 0.2692 0.7584 0.5894 0.0000 0.0000 0.0000 66  GLY A CA  
260  C C   . GLY A 38  ? 0.2705 0.7219 0.5629 0.0000 0.0000 0.0000 66  GLY A C   
261  O O   . GLY A 38  ? 0.2700 0.6808 0.5277 0.0000 0.0000 0.0000 66  GLY A O   
262  N N   . GLU A 39  ? 0.2767 0.7414 0.5858 0.0000 0.0000 0.0000 67  GLU A N   
263  C CA  . GLU A 39  ? 0.2891 0.7200 0.5750 0.0000 0.0000 0.0000 67  GLU A CA  
264  C C   . GLU A 39  ? 0.2922 0.6753 0.5306 0.0000 0.0000 0.0000 67  GLU A C   
265  O O   . GLU A 39  ? 0.2954 0.6474 0.5147 0.0000 0.0000 0.0000 67  GLU A O   
266  C CB  . GLU A 39  ? 0.2997 0.7488 0.6061 0.0000 0.0000 0.0000 67  GLU A CB  
267  C CG  . GLU A 39  ? 0.3223 0.7345 0.6041 0.0000 0.0000 0.0000 67  GLU A CG  
268  C CD  . GLU A 39  ? 0.3626 0.7857 0.6586 0.0000 0.0000 0.0000 67  GLU A CD  
269  O OE1 . GLU A 39  ? 0.3576 0.8154 0.6805 0.0000 0.0000 0.0000 67  GLU A OE1 
270  O OE2 . GLU A 39  ? 0.4002 0.7939 0.6783 0.0000 0.0000 0.0000 67  GLU A OE2 
271  N N   . ASN A 40  ? 0.2820 0.6743 0.5485 0.0000 0.0000 0.0000 68  ASN A N   
272  C CA  . ASN A 40  ? 0.2942 0.6555 0.5707 0.0000 0.0000 0.0000 68  ASN A CA  
273  C C   . ASN A 40  ? 0.2671 0.6303 0.5507 0.0000 0.0000 0.0000 68  ASN A C   
274  O O   . ASN A 40  ? 0.2708 0.6114 0.5574 0.0000 0.0000 0.0000 68  ASN A O   
275  C CB  . ASN A 40  ? 0.3408 0.6738 0.5851 0.0000 0.0000 0.0000 68  ASN A CB  
276  C CG  . ASN A 40  ? 0.4246 0.7394 0.6513 0.0000 0.0000 0.0000 68  ASN A CG  
277  O OD1 . ASN A 40  ? 0.4117 0.7180 0.6692 0.0000 0.0000 0.0000 68  ASN A OD1 
278  N ND2 . ASN A 40  ? 0.5673 0.8756 0.7437 0.0000 0.0000 0.0000 68  ASN A ND2 
279  N N   . CYS A 41  ? 0.2421 0.6262 0.5256 0.0000 0.0000 0.0000 69  CYS A N   
280  C CA  . CYS A 41  ? 0.2351 0.6146 0.5164 0.0000 0.0000 0.0000 69  CYS A CA  
281  C C   . CYS A 41  ? 0.2398 0.6161 0.5130 0.0000 0.0000 0.0000 69  CYS A C   
282  O O   . CYS A 41  ? 0.2385 0.5982 0.5129 0.0000 0.0000 0.0000 69  CYS A O   
283  C CB  . CYS A 41  ? 0.2363 0.5988 0.5304 0.0000 0.0000 0.0000 69  CYS A CB  
284  S SG  . CYS A 41  ? 0.2267 0.5978 0.5425 0.0000 0.0000 0.0000 69  CYS A SG  
285  N N   . THR A 42  ? 0.2435 0.6382 0.5090 0.0000 0.0000 0.0000 70  THR A N   
286  C CA  . THR A 42  ? 0.2548 0.6534 0.5141 0.0000 0.0000 0.0000 70  THR A CA  
287  C C   . THR A 42  ? 0.2526 0.6820 0.5333 0.0000 0.0000 0.0000 70  THR A C   
288  O O   . THR A 42  ? 0.2609 0.6977 0.5495 0.0000 0.0000 0.0000 70  THR A O   
289  C CB  . THR A 42  ? 0.2796 0.6714 0.5100 0.0000 0.0000 0.0000 70  THR A CB  
290  O OG1 . THR A 4