data_3HSW
# 
_entry.id   3HSW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3HSW         
RCSB  RCSB053542   
WWPDB D_1000053542 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AZY 'Crystal structure of Porcine Pancreatic Phospholipase A2 in complex with Cholate'                unspecified 
PDB 2B00 'Crystal structure of Porcine Pancreatic Phospholipase A2 in complex with Glycocholate'           unspecified 
PDB 2B01 'Crystal structure of Porcine Pancreatic Phospholipase A2 in complex with Taurochenodeoxycholate' unspecified 
PDB 2B04 'Crystal structure of Porcine Pancreatic Phospholipase A2 in complex with Glycochenodeoxycholate' unspecified 
PDB 2B03 'Crystal structure of Porcine Pancreatic Phospholipase A2 in complex with Taurochenodeoxycholate' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3HSW 
_pdbx_database_status.recvd_initial_deposition_date   2009-06-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dileep, K.V.'  1 
'Tintu, I.'     2 
'Karthe, P.'    3 
'Mandal, P.K.'  4 
'Haridas, M.'   5 
'Sadasivan, C.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of porcine pancreatic phospholipase A2 in complex with 2-methoxycyclohexa-2-5-diene-1,4-dione' 
_citation.journal_abbrev            'Frontiers in life sci.' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2012 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2155-3777 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      10.1080/21553769.2012.689262 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dileep, K.V.'  1 
primary 'Tintu, I.'     2 
primary 'Mandal, P.K.'  3 
primary 'Karthe, P.'    4 
primary 'Haridas, M.'   5 
primary 'Sadasivan, C.' 6 
# 
_cell.entry_id           3HSW 
_cell.length_a           68.360 
_cell.length_b           68.360 
_cell.length_c           70.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3HSW 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Phospholipase A2, major isoenzyme'    14009.714 1  3.1.1.4 ? ? ? 
2 non-polymer syn 2-methoxycyclohexa-2,5-diene-1,4-dione 138.121   1  ?       ? ? ? 
3 non-polymer syn 'CALCIUM ION'                          40.078    2  ?       ? ? ? 
4 water       nat water                                  18.015    32 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphatidylcholine 2-acylhydrolase, Group IB phospholipase A2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT
EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT
EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   TRP n 
1 4   GLN n 
1 5   PHE n 
1 6   ARG n 
1 7   SER n 
1 8   MET n 
1 9   ILE n 
1 10  LYS n 
1 11  CYS n 
1 12  ALA n 
1 13  ILE n 
1 14  PRO n 
1 15  GLY n 
1 16  SER n 
1 17  HIS n 
1 18  PRO n 
1 19  LEU n 
1 20  MET n 
1 21  ASP n 
1 22  PHE n 
1 23  ASN n 
1 24  ASN n 
1 25  TYR n 
1 26  GLY n 
1 27  CYS n 
1 28  TYR n 
1 29  CYS n 
1 30  GLY n 
1 31  LEU n 
1 32  GLY n 
1 33  GLY n 
1 34  SER n 
1 35  GLY n 
1 36  THR n 
1 37  PRO n 
1 38  VAL n 
1 39  ASP n 
1 40  GLU n 
1 41  LEU n 
1 42  ASP n 
1 43  ARG n 
1 44  CYS n 
1 45  CYS n 
1 46  GLU n 
1 47  THR n 
1 48  HIS n 
1 49  ASP n 
1 50  ASN n 
1 51  CYS n 
1 52  TYR n 
1 53  ARG n 
1 54  ASP n 
1 55  ALA n 
1 56  LYS n 
1 57  ASN n 
1 58  LEU n 
1 59  ASP n 
1 60  SER n 
1 61  CYS n 
1 62  LYS n 
1 63  PHE n 
1 64  LEU n 
1 65  VAL n 
1 66  ASP n 
1 67  ASN n 
1 68  PRO n 
1 69  TYR n 
1 70  THR n 
1 71  GLU n 
1 72  SER n 
1 73  TYR n 
1 74  SER n 
1 75  TYR n 
1 76  SER n 
1 77  CYS n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  GLU n 
1 82  ILE n 
1 83  THR n 
1 84  CYS n 
1 85  ASN n 
1 86  SER n 
1 87  LYS n 
1 88  ASN n 
1 89  ASN n 
1 90  ALA n 
1 91  CYS n 
1 92  GLU n 
1 93  ALA n 
1 94  PHE n 
1 95  ILE n 
1 96  CYS n 
1 97  ASN n 
1 98  CYS n 
1 99  ASP n 
1 100 ARG n 
1 101 ASN n 
1 102 ALA n 
1 103 ALA n 
1 104 ILE n 
1 105 CYS n 
1 106 PHE n 
1 107 SER n 
1 108 LYS n 
1 109 ALA n 
1 110 PRO n 
1 111 TYR n 
1 112 ASN n 
1 113 LYS n 
1 114 GLU n 
1 115 HIS n 
1 116 LYS n 
1 117 ASN n 
1 118 LEU n 
1 119 ASP n 
1 120 THR n 
1 121 LYS n 
1 122 LYS n 
1 123 TYR n 
1 124 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                Pig 
_entity_src_nat.pdbx_organism_scientific   'Sus scrofa' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9823 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    Pancreas 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PA21B_PIG 
_struct_ref.pdbx_db_accession          P00592 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPVDELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNT
EITCNSKNNACEAFICNCDRNAAICFSKAPYNKEHKNLDTKKYC
;
_struct_ref.pdbx_align_begin           23 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3HSW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 124 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00592 
_struct_ref_seq.db_align_beg                  23 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       124 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                          ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1' 147.195 
MCW non-polymer         . 2-methoxycyclohexa-2,5-diene-1,4-dione ? 'C7 H6 O3'       138.121 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3HSW 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.38 
_exptl_crystal.density_percent_sol   63.57 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    
'15% MPD, 0.05M Tris Maleate, 5mM Calcium Chloride, pH7.2, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2009-03-22 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.542 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'BRUKER AXS MICROSTAR' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.542 
# 
_reflns.entry_id                     3HSW 
_reflns.observed_criterion_sigma_I   2.00 
_reflns.observed_criterion_sigma_F   2.50 
_reflns.d_resolution_low             45.24 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   6759 
_reflns.number_all                   6789 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              0.065 
_reflns.pdbx_netI_over_sigmaI        8.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   70.79 
_reflns_shell.Rmerge_I_obs           0.073 
_reflns_shell.pdbx_Rsym_value        0.065 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      955 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3HSW 
_refine.ls_number_reflns_obs                     6356 
_refine.ls_number_reflns_all                     6811 
_refine.pdbx_ls_sigma_I                          2.00 
_refine.pdbx_ls_sigma_F                          2.50 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             13.65 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    98.44 
_refine.ls_R_factor_obs                          0.18214 
_refine.ls_R_factor_all                          0.2303 
_refine.ls_R_factor_R_work                       0.17965 
_refine.ls_R_factor_R_free                       0.22883 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  349 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.B_iso_mean                               23.783 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1P2P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.333 
_refine.pdbx_overall_ESU_R_Free                  0.241 
_refine.overall_SU_ML                            0.174 
_refine.overall_SU_B                             17.329 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        971 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               1015 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        13.65 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.020  0.021  ? 1010 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    2.079  1.951  ? 1369 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 7.137  5.000  ? 123  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 40.295 25.000 ? 50   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 22.792 15.000 ? 163  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 28.049 15.000 ? 4    'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.135  0.200  ? 138  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.008  0.021  ? 788  'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.840  1.500  ? 619  'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.644  2.000  ? 993  'X-RAY DIFFRACTION' ? 
r_scbond_it            2.545  3.000  ? 391  'X-RAY DIFFRACTION' ? 
r_scangle_it           4.224  4.500  ? 376  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.563 
_refine_ls_shell.number_reflns_R_work             438 
_refine_ls_shell.R_factor_R_work                  0.282 
_refine_ls_shell.percent_reflns_obs               97.08 
_refine_ls_shell.R_factor_R_free                  0.417 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             27 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3HSW 
_struct.title                     
'Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with 2-methoxycyclohexa-2-5-diene-1,4-dione' 
_struct.pdbx_descriptor           'Phospholipase A2, major isoenzyme (E.C.3.1.1.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3HSW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Hydrolase, Curcumin binding, PLA2, Pancreatic Enzyme, Disulfide bond, Lipid degradation, Lipoprotein, Metal-binding, Palmitate, Pyrrolidone carboxylic acid, Secreted
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 1   ? ILE A 13  ? ALA A 1   ILE A 13  1 ? 13 
HELX_P HELX_P2 2 HIS A 17  ? ASN A 23  ? HIS A 17  ASN A 23  1 ? 7  
HELX_P HELX_P3 3 ASP A 39  ? ASN A 57  ? ASP A 39  ASN A 57  1 ? 19 
HELX_P HELX_P4 4 PHE A 63  ? GLU A 71  ? PHE A 63  GLU A 71  5 ? 9  
HELX_P HELX_P5 5 ASN A 89  ? ALA A 109 ? ASN A 89  ALA A 109 1 ? 21 
HELX_P HELX_P6 6 ASN A 112 ? LYS A 116 ? ASN A 112 LYS A 116 5 ? 5  
HELX_P HELX_P7 7 ASP A 119 ? CYS A 124 ? ASP A 119 CYS A 124 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 11 SG  ? ? ? 1_555 A CYS 77  SG ? ? A CYS 11  A CYS 77  1_555 ? ? ? ? ? ? ? 1.079 ? 
disulf2  disulf ? ? A CYS 27 SG  ? ? ? 1_555 A CYS 124 SG ? ? A CYS 27  A CYS 124 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf3  disulf ? ? A CYS 29 SG  ? ? ? 1_555 A CYS 45  SG ? ? A CYS 29  A CYS 45  1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf4  disulf ? ? A CYS 44 SG  ? ? ? 1_555 A CYS 105 SG ? ? A CYS 44  A CYS 105 1_555 ? ? ? ? ? ? ? 1.995 ? 
disulf5  disulf ? ? A CYS 51 SG  ? ? ? 1_555 A CYS 98  SG ? ? A CYS 51  A CYS 98  1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf6  disulf ? ? A CYS 61 SG  ? ? ? 1_555 A CYS 91  SG ? ? A CYS 61  A CYS 91  1_555 ? ? ? ? ? ? ? 2.019 ? 
disulf7  disulf ? ? A CYS 84 SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 84  A CYS 96  1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc1  metalc ? ? A TYR 28 O   ? ? ? 1_555 C CA  .   CA ? ? A TYR 28  A CA  501 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc2  metalc ? ? A GLY 30 O   ? ? ? 1_555 C CA  .   CA ? ? A GLY 30  A CA  501 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc3  metalc ? ? A GLY 32 O   ? ? ? 1_555 C CA  .   CA ? ? A GLY 32  A CA  501 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc4  metalc ? ? A ASP 49 OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASP 49  A CA  501 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc5  metalc ? ? A ASP 49 OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 49  A CA  501 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc6  metalc ? ? A GLU 71 OE1 ? ? ? 1_555 D CA  .   CA ? ? A GLU 71  A CA  502 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc7  metalc ? ? A SER 72 O   ? ? ? 1_555 D CA  .   CA ? ? A SER 72  A CA  502 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc8  metalc ? ? A GLU 92 OE1 ? ? ? 1_555 D CA  .   CA ? ? A GLU 92  A CA  502 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc9  metalc ? ? C CA  .  CA  ? ? ? 1_555 E HOH .   O  ? ? A CA  501 A HOH 518 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc10 metalc ? ? C CA  .  CA  ? ? ? 1_555 E HOH .   O  ? ? A CA  501 A HOH 520 1_555 ? ? ? ? ? ? ? 2.508 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 75 ? CYS A 77 ? TYR A 75 CYS A 77 
A 2 ILE A 82 ? CYS A 84 ? ILE A 82 CYS A 84 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   SER 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    76 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    SER 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     76 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    83 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     83 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MCW A 500' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 501'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 502'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ARG A 6  ? ARG A 6   . ? 1_555 ? 
2  AC1 5 PHE A 22 ? PHE A 22  . ? 1_555 ? 
3  AC1 5 ASN A 23 ? ASN A 23  . ? 1_555 ? 
4  AC1 5 HOH E .  ? HOH A 509 . ? 1_555 ? 
5  AC1 5 HOH E .  ? HOH A 534 . ? 1_555 ? 
6  AC2 6 TYR A 28 ? TYR A 28  . ? 1_555 ? 
7  AC2 6 GLY A 30 ? GLY A 30  . ? 1_555 ? 
8  AC2 6 GLY A 32 ? GLY A 32  . ? 1_555 ? 
9  AC2 6 ASP A 49 ? ASP A 49  . ? 1_555 ? 
10 AC2 6 HOH E .  ? HOH A 518 . ? 1_555 ? 
11 AC2 6 HOH E .  ? HOH A 520 . ? 1_555 ? 
12 AC3 6 GLU A 71 ? GLU A 71  . ? 5_554 ? 
13 AC3 6 GLU A 71 ? GLU A 71  . ? 1_555 ? 
14 AC3 6 SER A 72 ? SER A 72  . ? 5_554 ? 
15 AC3 6 SER A 72 ? SER A 72  . ? 1_555 ? 
16 AC3 6 GLU A 92 ? GLU A 92  . ? 5_554 ? 
17 AC3 6 GLU A 92 ? GLU A 92  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3HSW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3HSW 
_atom_sites.fract_transf_matrix[1][1]   0.014628 
_atom_sites.fract_transf_matrix[1][2]   0.008446 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016891 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014261 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1   ? -34.759 6.754  -9.456  1.00 16.23 ? 1   ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1   ? -34.384 7.720  -10.544 1.00 16.62 ? 1   ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1   ? -35.229 8.974  -10.397 1.00 17.33 ? 1   ALA A C   1 
ATOM   4    O  O   . ALA A 1 1   ? -36.374 8.910  -9.900  1.00 16.83 ? 1   ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1   ? -34.565 7.111  -11.916 1.00 14.54 ? 1   ALA A CB  1 
ATOM   6    N  N   . LEU A 1 2   ? -34.656 10.100 -10.824 1.00 17.80 ? 2   LEU A N   1 
ATOM   7    C  CA  . LEU A 1 2   ? -35.308 11.398 -10.752 1.00 19.05 ? 2   LEU A CA  1 
ATOM   8    C  C   . LEU A 1 2   ? -36.836 11.329 -10.920 1.00 18.78 ? 2   LEU A C   1 
ATOM   9    O  O   . LEU A 1 2   ? -37.588 11.668 -9.992  1.00 18.93 ? 2   LEU A O   1 
ATOM   10   C  CB  . LEU A 1 2   ? -34.682 12.327 -11.770 1.00 19.55 ? 2   LEU A CB  1 
ATOM   11   C  CG  . LEU A 1 2   ? -34.909 13.834 -11.615 1.00 21.97 ? 2   LEU A CG  1 
ATOM   12   C  CD1 . LEU A 1 2   ? -34.353 14.377 -10.292 1.00 22.13 ? 2   LEU A CD1 1 
ATOM   13   C  CD2 . LEU A 1 2   ? -34.377 14.614 -12.850 1.00 21.20 ? 2   LEU A CD2 1 
ATOM   14   N  N   . TRP A 1 3   ? -37.312 10.831 -12.050 1.00 18.18 ? 3   TRP A N   1 
ATOM   15   C  CA  . TRP A 1 3   ? -38.743 10.861 -12.261 1.00 18.71 ? 3   TRP A CA  1 
ATOM   16   C  C   . TRP A 1 3   ? -39.482 10.073 -11.191 1.00 19.46 ? 3   TRP A C   1 
ATOM   17   O  O   . TRP A 1 3   ? -40.596 10.449 -10.820 1.00 21.53 ? 3   TRP A O   1 
ATOM   18   C  CB  . TRP A 1 3   ? -39.127 10.347 -13.631 1.00 19.05 ? 3   TRP A CB  1 
ATOM   19   C  CG  . TRP A 1 3   ? -38.941 8.815  -13.851 1.00 19.25 ? 3   TRP A CG  1 
ATOM   20   C  CD1 . TRP A 1 3   ? -37.790 8.161  -14.222 1.00 16.19 ? 3   TRP A CD1 1 
ATOM   21   C  CD2 . TRP A 1 3   ? -39.957 7.800  -13.747 1.00 19.49 ? 3   TRP A CD2 1 
ATOM   22   N  NE1 . TRP A 1 3   ? -38.039 6.814  -14.343 1.00 15.25 ? 3   TRP A NE1 1 
ATOM   23   C  CE2 . TRP A 1 3   ? -39.347 6.561  -14.058 1.00 16.48 ? 3   TRP A CE2 1 
ATOM   24   C  CE3 . TRP A 1 3   ? -41.315 7.815  -13.385 1.00 21.08 ? 3   TRP A CE3 1 
ATOM   25   C  CZ2 . TRP A 1 3   ? -40.043 5.347  -14.040 1.00 20.29 ? 3   TRP A CZ2 1 
ATOM   26   C  CZ3 . TRP A 1 3   ? -42.028 6.586  -13.367 1.00 22.48 ? 3   TRP A CZ3 1 
ATOM   27   C  CH2 . TRP A 1 3   ? -41.383 5.370  -13.704 1.00 21.92 ? 3   TRP A CH2 1 
ATOM   28   N  N   . GLN A 1 4   ? -38.911 8.996  -10.672 1.00 18.56 ? 4   GLN A N   1 
ATOM   29   C  CA  . GLN A 1 4   ? -39.669 8.230  -9.706  1.00 18.14 ? 4   GLN A CA  1 
ATOM   30   C  C   . GLN A 1 4   ? -39.856 9.022  -8.413  1.00 19.39 ? 4   GLN A C   1 
ATOM   31   O  O   . GLN A 1 4   ? -40.918 8.942  -7.789  1.00 21.02 ? 4   GLN A O   1 
ATOM   32   C  CB  . GLN A 1 4   ? -39.031 6.882  -9.471  1.00 18.05 ? 4   GLN A CB  1 
ATOM   33   C  CG  . GLN A 1 4   ? -38.854 6.060  -10.750 1.00 13.45 ? 4   GLN A CG  1 
ATOM   34   C  CD  . GLN A 1 4   ? -38.041 4.821  -10.489 1.00 12.67 ? 4   GLN A CD  1 
ATOM   35   O  OE1 . GLN A 1 4   ? -36.878 4.893  -10.065 1.00 13.52 ? 4   GLN A OE1 1 
ATOM   36   N  NE2 . GLN A 1 4   ? -38.648 3.670  -10.680 1.00 12.45 ? 4   GLN A NE2 1 
ATOM   37   N  N   . PHE A 1 5   ? -38.874 9.855  -8.069  1.00 19.55 ? 5   PHE A N   1 
ATOM   38   C  CA  . PHE A 1 5   ? -38.891 10.723 -6.882  1.00 19.05 ? 5   PHE A CA  1 
ATOM   39   C  C   . PHE A 1 5   ? -39.975 11.779 -7.050  1.00 18.76 ? 5   PHE A C   1 
ATOM   40   O  O   . PHE A 1 5   ? -40.779 12.019 -6.147  1.00 16.86 ? 5   PHE A O   1 
ATOM   41   C  CB  . PHE A 1 5   ? -37.517 11.410 -6.763  1.00 19.66 ? 5   PHE A CB  1 
ATOM   42   C  CG  . PHE A 1 5   ? -37.341 12.275 -5.515  1.00 21.15 ? 5   PHE A CG  1 
ATOM   43   C  CD1 . PHE A 1 5   ? -37.930 11.926 -4.289  1.00 17.88 ? 5   PHE A CD1 1 
ATOM   44   C  CD2 . PHE A 1 5   ? -36.516 13.408 -5.558  1.00 21.64 ? 5   PHE A CD2 1 
ATOM   45   C  CE1 . PHE A 1 5   ? -37.736 12.707 -3.174  1.00 16.64 ? 5   PHE A CE1 1 
ATOM   46   C  CE2 . PHE A 1 5   ? -36.322 14.209 -4.422  1.00 19.16 ? 5   PHE A CE2 1 
ATOM   47   C  CZ  . PHE A 1 5   ? -36.925 13.865 -3.249  1.00 18.26 ? 5   PHE A CZ  1 
ATOM   48   N  N   . ARG A 1 6   ? -40.001 12.404 -8.227  1.00 18.91 ? 6   ARG A N   1 
ATOM   49   C  CA  . ARG A 1 6   ? -41.083 13.347 -8.543  1.00 19.27 ? 6   ARG A CA  1 
ATOM   50   C  C   . ARG A 1 6   ? -42.378 12.655 -8.285  1.00 19.14 ? 6   ARG A C   1 
ATOM   51   O  O   . ARG A 1 6   ? -43.222 13.206 -7.625  1.00 19.76 ? 6   ARG A O   1 
ATOM   52   C  CB  . ARG A 1 6   ? -41.086 13.811 -9.980  1.00 18.98 ? 6   ARG A CB  1 
ATOM   53   C  CG  . ARG A 1 6   ? -40.280 15.051 -10.262 1.00 23.82 ? 6   ARG A CG  1 
ATOM   54   C  CD  . ARG A 1 6   ? -40.370 15.410 -11.771 1.00 30.16 ? 6   ARG A CD  1 
ATOM   55   N  NE  . ARG A 1 6   ? -39.177 14.985 -12.527 1.00 34.53 ? 6   ARG A NE  1 
ATOM   56   C  CZ  . ARG A 1 6   ? -39.201 14.199 -13.610 1.00 37.50 ? 6   ARG A CZ  1 
ATOM   57   N  NH1 . ARG A 1 6   ? -40.377 13.769 -14.082 1.00 40.60 ? 6   ARG A NH1 1 
ATOM   58   N  NH2 . ARG A 1 6   ? -38.056 13.846 -14.231 1.00 37.69 ? 6   ARG A NH2 1 
ATOM   59   N  N   . SER A 1 7   ? -42.570 11.429 -8.758  1.00 19.56 ? 7   SER A N   1 
ATOM   60   C  CA  . SER A 1 7   ? -43.877 10.860 -8.465  1.00 20.01 ? 7   SER A CA  1 
ATOM   61   C  C   . SER A 1 7   ? -44.033 10.261 -7.042  1.00 20.30 ? 7   SER A C   1 
ATOM   62   O  O   . SER A 1 7   ? -45.179 10.137 -6.575  1.00 20.28 ? 7   SER A O   1 
ATOM   63   C  CB  . SER A 1 7   ? -44.456 10.001 -9.606  1.00 20.39 ? 7   SER A CB  1 
ATOM   64   O  OG  . SER A 1 7   ? -43.730 8.832  -9.770  1.00 20.08 ? 7   SER A OG  1 
ATOM   65   N  N   . MET A 1 8   ? -42.927 9.979  -6.324  1.00 19.54 ? 8   MET A N   1 
ATOM   66   C  CA  . MET A 1 8   ? -43.058 9.713  -4.878  1.00 19.35 ? 8   MET A CA  1 
ATOM   67   C  C   . MET A 1 8   ? -43.672 10.904 -4.121  1.00 20.19 ? 8   MET A C   1 
ATOM   68   O  O   . MET A 1 8   ? -44.518 10.704 -3.252  1.00 21.11 ? 8   MET A O   1 
ATOM   69   C  CB  . MET A 1 8   ? -41.736 9.377  -4.219  1.00 19.25 ? 8   MET A CB  1 
ATOM   70   C  CG  . MET A 1 8   ? -41.299 7.964  -4.381  1.00 17.78 ? 8   MET A CG  1 
ATOM   71   S  SD  . MET A 1 8   ? -40.015 7.618  -3.188  1.00 17.29 ? 8   MET A SD  1 
ATOM   72   C  CE  . MET A 1 8   ? -39.499 5.937  -3.687  1.00 11.87 ? 8   MET A CE  1 
ATOM   73   N  N   . ILE A 1 9   ? -43.224 12.120 -4.440  1.00 19.81 ? 9   ILE A N   1 
ATOM   74   C  CA  . ILE A 1 9   ? -43.718 13.339 -3.847  1.00 19.40 ? 9   ILE A CA  1 
ATOM   75   C  C   . ILE A 1 9   ? -45.204 13.504 -4.135  1.00 20.84 ? 9   ILE A C   1 
ATOM   76   O  O   . ILE A 1 9   ? -45.969 13.773 -3.211  1.00 21.19 ? 9   ILE A O   1 
ATOM   77   C  CB  . ILE A 1 9   ? -42.916 14.571 -4.324  1.00 19.05 ? 9   ILE A CB  1 
ATOM   78   C  CG1 . ILE A 1 9   ? -41.430 14.410 -3.971  1.00 17.97 ? 9   ILE A CG1 1 
ATOM   79   C  CG2 . ILE A 1 9   ? -43.418 15.812 -3.635  1.00 17.99 ? 9   ILE A CG2 1 
ATOM   80   C  CD1 . ILE A 1 9   ? -40.503 15.211 -4.833  1.00 19.91 ? 9   ILE A CD1 1 
ATOM   81   N  N   . LYS A 1 10  ? -45.631 13.325 -5.389  1.00 21.96 ? 10  LYS A N   1 
ATOM   82   C  CA  . LYS A 1 10  ? -47.072 13.397 -5.725  1.00 23.08 ? 10  LYS A CA  1 
ATOM   83   C  C   . LYS A 1 10  ? -47.883 12.360 -4.947  1.00 22.88 ? 10  LYS A C   1 
ATOM   84   O  O   . LYS A 1 10  ? -49.074 12.559 -4.686  1.00 24.03 ? 10  LYS A O   1 
ATOM   85   C  CB  . LYS A 1 10  ? -47.381 13.224 -7.246  1.00 23.72 ? 10  LYS A CB  1 
ATOM   86   C  CG  . LYS A 1 10  ? -46.617 14.132 -8.259  1.00 28.45 ? 10  LYS A CG  1 
ATOM   87   C  CD  . LYS A 1 10  ? -47.387 14.347 -9.632  1.00 34.88 ? 10  LYS A CD  1 
ATOM   88   C  CE  . LYS A 1 10  ? -46.452 14.393 -10.946 1.00 39.26 ? 10  LYS A CE  1 
ATOM   89   N  NZ  . LYS A 1 10  ? -45.595 15.639 -11.262 1.00 40.47 ? 10  LYS A NZ  1 
ATOM   90   N  N   . CYS A 1 11  ? -47.258 11.230 -4.630  1.00 22.78 ? 11  CYS A N   1 
ATOM   91   C  CA  . CYS A 1 11  ? -47.906 10.156 -3.887  1.00 22.16 ? 11  CYS A CA  1 
ATOM   92   C  C   . CYS A 1 11  ? -48.189 10.596 -2.436  1.00 22.87 ? 11  CYS A C   1 
ATOM   93   O  O   . CYS A 1 11  ? -49.316 10.410 -1.923  1.00 22.67 ? 11  CYS A O   1 
ATOM   94   C  CB  . CYS A 1 11  ? -47.040 8.895  -3.933  1.00 21.69 ? 11  CYS A CB  1 
ATOM   95   S  SG  . CYS A 1 11  ? -47.551 7.568  -2.819  1.00 20.52 ? 11  CYS A SG  1 
ATOM   96   N  N   . ALA A 1 12  ? -47.171 11.191 -1.798  1.00 22.94 ? 12  ALA A N   1 
ATOM   97   C  CA  . ALA A 1 12  ? -47.229 11.543 -0.391  1.00 23.66 ? 12  ALA A CA  1 
ATOM   98   C  C   . ALA A 1 12  ? -47.984 12.838 -0.206  1.00 24.24 ? 12  ALA A C   1 
ATOM   99   O  O   . ALA A 1 12  ? -48.690 12.987 0.775   1.00 24.66 ? 12  ALA A O   1 
ATOM   100  C  CB  . ALA A 1 12  ? -45.831 11.650 0.207   1.00 23.34 ? 12  ALA A CB  1 
ATOM   101  N  N   . ILE A 1 13  ? -47.797 13.781 -1.134  1.00 25.05 ? 13  ILE A N   1 
ATOM   102  C  CA  . ILE A 1 13  ? -48.556 15.040 -1.178  1.00 24.95 ? 13  ILE A CA  1 
ATOM   103  C  C   . ILE A 1 13  ? -49.385 15.117 -2.482  1.00 26.27 ? 13  ILE A C   1 
ATOM   104  O  O   . ILE A 1 13  ? -48.953 15.732 -3.456  1.00 26.62 ? 13  ILE A O   1 
ATOM   105  C  CB  . ILE A 1 13  ? -47.632 16.274 -1.039  1.00 24.13 ? 13  ILE A CB  1 
ATOM   106  C  CG1 . ILE A 1 13  ? -46.507 15.979 -0.048  1.00 23.39 ? 13  ILE A CG1 1 
ATOM   107  C  CG2 . ILE A 1 13  ? -48.421 17.518 -0.595  1.00 22.91 ? 13  ILE A CG2 1 
ATOM   108  C  CD1 . ILE A 1 13  ? -45.320 16.962 -0.099  1.00 19.59 ? 13  ILE A CD1 1 
ATOM   109  N  N   . PRO A 1 14  ? -50.585 14.493 -2.505  1.00 27.22 ? 14  PRO A N   1 
ATOM   110  C  CA  . PRO A 1 14  ? -51.405 14.470 -3.707  1.00 27.57 ? 14  PRO A CA  1 
ATOM   111  C  C   . PRO A 1 14  ? -51.680 15.823 -4.375  1.00 28.09 ? 14  PRO A C   1 
ATOM   112  O  O   . PRO A 1 14  ? -51.591 15.911 -5.593  1.00 27.77 ? 14  PRO A O   1 
ATOM   113  C  CB  . PRO A 1 14  ? -52.690 13.810 -3.208  1.00 28.10 ? 14  PRO A CB  1 
ATOM   114  C  CG  . PRO A 1 14  ? -52.188 12.847 -2.153  1.00 27.37 ? 14  PRO A CG  1 
ATOM   115  C  CD  . PRO A 1 14  ? -51.227 13.714 -1.423  1.00 27.60 ? 14  PRO A CD  1 
ATOM   116  N  N   . GLY A 1 15  ? -51.986 16.869 -3.612  1.00 28.98 ? 15  GLY A N   1 
ATOM   117  C  CA  . GLY A 1 15  ? -52.296 18.171 -4.228  1.00 30.61 ? 15  GLY A CA  1 
ATOM   118  C  C   . GLY A 1 15  ? -51.080 18.981 -4.678  1.00 31.87 ? 15  GLY A C   1 
ATOM   119  O  O   . GLY A 1 15  ? -51.038 20.210 -4.470  1.00 32.44 ? 15  GLY A O   1 
ATOM   120  N  N   . SER A 1 16  ? -50.091 18.315 -5.289  1.00 32.42 ? 16  SER A N   1 
ATOM   121  C  CA  . SER A 1 16  ? -48.761 18.939 -5.486  1.00 33.19 ? 16  SER A CA  1 
ATOM   122  C  C   . SER A 1 16  ? -48.064 18.793 -6.851  1.00 33.76 ? 16  SER A C   1 
ATOM   123  O  O   . SER A 1 16  ? -48.255 17.819 -7.586  1.00 34.07 ? 16  SER A O   1 
ATOM   124  C  CB  . SER A 1 16  ? -47.790 18.566 -4.344  1.00 32.97 ? 16  SER A CB  1 
ATOM   125  O  OG  . SER A 1 16  ? -46.897 17.527 -4.705  1.00 32.05 ? 16  SER A OG  1 
ATOM   126  N  N   . HIS A 1 17  ? -47.255 19.792 -7.165  1.00 34.44 ? 17  HIS A N   1 
ATOM   127  C  CA  . HIS A 1 17  ? -46.499 19.813 -8.383  1.00 35.92 ? 17  HIS A CA  1 
ATOM   128  C  C   . HIS A 1 17  ? -45.024 19.927 -8.008  1.00 35.82 ? 17  HIS A C   1 
ATOM   129  O  O   . HIS A 1 17  ? -44.535 21.048 -7.841  1.00 35.50 ? 17  HIS A O   1 
ATOM   130  C  CB  . HIS A 1 17  ? -46.895 21.028 -9.220  1.00 36.88 ? 17  HIS A CB  1 
ATOM   131  C  CG  . HIS A 1 17  ? -46.194 21.099 -10.546 1.00 41.21 ? 17  HIS A CG  1 
ATOM   132  N  ND1 . HIS A 1 17  ? -45.091 20.320 -10.857 1.00 43.16 ? 17  HIS A ND1 1 
ATOM   133  C  CD2 . HIS A 1 17  ? -46.433 21.869 -11.639 1.00 44.73 ? 17  HIS A CD2 1 
ATOM   134  C  CE1 . HIS A 1 17  ? -44.693 20.598 -12.086 1.00 45.49 ? 17  HIS A CE1 1 
ATOM   135  N  NE2 . HIS A 1 17  ? -45.488 21.534 -12.583 1.00 47.31 ? 17  HIS A NE2 1 
ATOM   136  N  N   . PRO A 1 18  ? -44.310 18.777 -7.901  1.00 35.64 ? 18  PRO A N   1 
ATOM   137  C  CA  . PRO A 1 18  ? -42.956 18.715 -7.357  1.00 35.90 ? 18  PRO A CA  1 
ATOM   138  C  C   . PRO A 1 18  ? -41.925 19.653 -8.032  1.00 36.49 ? 18  PRO A C   1 
ATOM   139  O  O   . PRO A 1 18  ? -41.260 20.433 -7.329  1.00 36.11 ? 18  PRO A O   1 
ATOM   140  C  CB  . PRO A 1 18  ? -42.575 17.234 -7.554  1.00 35.67 ? 18  PRO A CB  1 
ATOM   141  C  CG  . PRO A 1 18  ? -43.852 16.531 -7.560  1.00 35.27 ? 18  PRO A CG  1 
ATOM   142  C  CD  . PRO A 1 18  ? -44.753 17.441 -8.340  1.00 35.59 ? 18  PRO A CD  1 
ATOM   143  N  N   . LEU A 1 19  ? -41.707 19.533 -9.296  1.00 37.17 ? 19  LEU A N   1 
ATOM   144  C  CA  . LEU A 1 19  ? -40.743 20.297 -10.102 1.00 37.80 ? 19  LEU A CA  1 
ATOM   145  C  C   . LEU A 1 19  ? -40.850 21.787 -9.709  1.00 37.86 ? 19  LEU A C   1 
ATOM   146  O  O   . LEU A 1 19  ? -39.827 22.456 -9.466  1.00 37.96 ? 19  LEU A O   1 
ATOM   147  C  CB  . LEU A 1 19  ? -40.995 20.096 -11.617 1.00 38.43 ? 19  LEU A CB  1 
ATOM   148  C  CG  . LEU A 1 19  ? -41.552 18.815 -12.378 1.00 41.93 ? 19  LEU A CG  1 
ATOM   149  C  CD1 . LEU A 1 19  ? -42.513 17.830 -11.596 1.00 42.17 ? 19  LEU A CD1 1 
ATOM   150  C  CD2 . LEU A 1 19  ? -42.190 19.144 -13.796 1.00 41.40 ? 19  LEU A CD2 1 
ATOM   151  N  N   . MET A 1 20  ? -42.204 22.300 -9.683  1.00 37.72 ? 20  MET A N   1 
ATOM   152  C  CA  . MET A 1 20  ? -42.597 23.703 -9.351  1.00 36.95 ? 20  MET A CA  1 
ATOM   153  C  C   . MET A 1 20  ? -42.523 24.053 -7.846  1.00 36.00 ? 20  MET A C   1 
ATOM   154  O  O   . MET A 1 20  ? -42.175 25.179 -7.477  1.00 36.36 ? 20  MET A O   1 
ATOM   155  C  CB  . MET A 1 20  ? -44.025 23.996 -9.901  1.00 37.43 ? 20  MET A CB  1 
ATOM   156  C  CG  . MET A 1 20  ? -44.549 25.455 -9.751  1.00 38.76 ? 20  MET A CG  1 
ATOM   157  S  SD  . MET A 1 20  ? -46.352 25.593 -9.444  1.00 43.05 ? 20  MET A SD  1 
ATOM   158  C  CE  . MET A 1 20  ? -46.505 27.181 -8.573  1.00 39.91 ? 20  MET A CE  1 
ATOM   159  N  N   . ASP A 1 21  ? -42.858 23.092 -6.987  1.00 34.82 ? 21  ASP A N   1 
ATOM   160  C  CA  . ASP A 1 21  ? -42.913 23.308 -5.537  1.00 33.76 ? 21  ASP A CA  1 
ATOM   161  C  C   . ASP A 1 21  ? -41.538 23.216 -4.849  1.00 32.68 ? 21  ASP A C   1 
ATOM   162  O  O   . ASP A 1 21  ? -41.154 24.122 -4.081  1.00 32.36 ? 21  ASP A O   1 
ATOM   163  C  CB  . ASP A 1 21  ? -43.908 22.324 -4.874  1.00 34.10 ? 21  ASP A CB  1 
ATOM   164  C  CG  . ASP A 1 21  ? -45.393 22.703 -5.114  1.00 34.98 ? 21  ASP A CG  1 
ATOM   165  O  OD1 . ASP A 1 21  ? -45.709 23.919 -5.199  1.00 35.58 ? 21  ASP A OD1 1 
ATOM   166  O  OD2 . ASP A 1 21  ? -46.241 21.778 -5.213  1.00 33.92 ? 21  ASP A OD2 1 
ATOM   167  N  N   . PHE A 1 22  ? -40.814 22.132 -5.138  1.00 31.10 ? 22  PHE A N   1 
ATOM   168  C  CA  . PHE A 1 22  ? -39.588 21.801 -4.418  1.00 30.07 ? 22  PHE A CA  1 
ATOM   169  C  C   . PHE A 1 22  ? -38.294 21.982 -5.175  1.00 29.58 ? 22  PHE A C   1 
ATOM   170  O  O   . PHE A 1 22  ? -37.277 21.570 -4.684  1.00 29.71 ? 22  PHE A O   1 
ATOM   171  C  CB  . PHE A 1 22  ? -39.658 20.378 -3.844  1.00 29.82 ? 22  PHE A CB  1 
ATOM   172  C  CG  . PHE A 1 22  ? -40.910 20.111 -3.130  1.00 29.35 ? 22  PHE A CG  1 
ATOM   173  C  CD1 . PHE A 1 22  ? -41.131 20.673 -1.881  1.00 30.85 ? 22  PHE A CD1 1 
ATOM   174  C  CD2 . PHE A 1 22  ? -41.922 19.371 -3.734  1.00 28.80 ? 22  PHE A CD2 1 
ATOM   175  C  CE1 . PHE A 1 22  ? -42.357 20.474 -1.214  1.00 31.35 ? 22  PHE A CE1 1 
ATOM   176  C  CE2 . PHE A 1 22  ? -43.152 19.156 -3.082  1.00 30.17 ? 22  PHE A CE2 1 
ATOM   177  C  CZ  . PHE A 1 22  ? -43.371 19.701 -1.818  1.00 29.59 ? 22  PHE A CZ  1 
ATOM   178  N  N   . ASN A 1 23  ? -38.305 22.598 -6.349  1.00 29.54 ? 23  ASN A N   1 
ATOM   179  C  CA  . ASN A 1 23  ? -37.051 22.900 -7.031  1.00 29.75 ? 23  ASN A CA  1 
ATOM   180  C  C   . ASN A 1 23  ? -36.767 24.373 -6.786  1.00 30.30 ? 23  ASN A C   1 
ATOM   181  O  O   . ASN A 1 23  ? -37.671 25.228 -6.829  1.00 31.31 ? 23  ASN A O   1 
ATOM   182  C  CB  . ASN A 1 23  ? -37.092 22.531 -8.533  1.00 30.40 ? 23  ASN A CB  1 
ATOM   183  C  CG  . ASN A 1 23  ? -35.685 22.391 -9.177  1.00 30.84 ? 23  ASN A CG  1 
ATOM   184  O  OD1 . ASN A 1 23  ? -34.826 21.645 -8.699  1.00 32.05 ? 23  ASN A OD1 1 
ATOM   185  N  ND2 . ASN A 1 23  ? -35.470 23.096 -10.281 1.00 30.00 ? 23  ASN A ND2 1 
ATOM   186  N  N   . ASN A 1 24  ? -35.506 24.663 -6.489  1.00 30.01 ? 24  ASN A N   1 
ATOM   187  C  CA  . ASN A 1 24  ? -35.086 25.972 -5.995  1.00 29.42 ? 24  ASN A CA  1 
ATOM   188  C  C   . ASN A 1 24  ? -36.008 26.451 -4.878  1.00 27.58 ? 24  ASN A C   1 
ATOM   189  O  O   . ASN A 1 24  ? -36.723 27.461 -4.988  1.00 27.75 ? 24  ASN A O   1 
ATOM   190  C  CB  . ASN A 1 24  ? -34.907 27.009 -7.129  1.00 30.56 ? 24  ASN A CB  1 
ATOM   191  C  CG  . ASN A 1 24  ? -33.890 26.548 -8.224  1.00 33.85 ? 24  ASN A CG  1 
ATOM   192  O  OD1 . ASN A 1 24  ? -33.580 27.310 -9.149  1.00 38.73 ? 24  ASN A OD1 1 
ATOM   193  N  ND2 . ASN A 1 24  ? -33.392 25.312 -8.125  1.00 33.92 ? 24  ASN A ND2 1 
ATOM   194  N  N   . TYR A 1 25  ? -35.995 25.663 -3.817  1.00 24.91 ? 25  TYR A N   1 
ATOM   195  C  CA  . TYR A 1 25  ? -36.556 26.057 -2.553  1.00 22.43 ? 25  TYR A CA  1 
ATOM   196  C  C   . TYR A 1 25  ? -35.400 26.103 -1.552  1.00 21.69 ? 25  TYR A C   1 
ATOM   197  O  O   . TYR A 1 25  ? -34.657 25.108 -1.413  1.00 22.25 ? 25  TYR A O   1 
ATOM   198  C  CB  . TYR A 1 25  ? -37.623 25.041 -2.104  1.00 21.81 ? 25  TYR A CB  1 
ATOM   199  C  CG  . TYR A 1 25  ? -38.332 25.449 -0.848  1.00 17.06 ? 25  TYR A CG  1 
ATOM   200  C  CD1 . TYR A 1 25  ? -37.792 25.155 0.384   1.00 15.24 ? 25  TYR A CD1 1 
ATOM   201  C  CD2 . TYR A 1 25  ? -39.529 26.129 -0.894  1.00 14.97 ? 25  TYR A CD2 1 
ATOM   202  C  CE1 . TYR A 1 25  ? -38.416 25.515 1.541   1.00 13.72 ? 25  TYR A CE1 1 
ATOM   203  C  CE2 . TYR A 1 25  ? -40.169 26.510 0.261   1.00 15.63 ? 25  TYR A CE2 1 
ATOM   204  C  CZ  . TYR A 1 25  ? -39.593 26.195 1.484   1.00 15.22 ? 25  TYR A CZ  1 
ATOM   205  O  OH  . TYR A 1 25  ? -40.190 26.551 2.664   1.00 14.23 ? 25  TYR A OH  1 
ATOM   206  N  N   . GLY A 1 26  ? -35.261 27.231 -0.851  1.00 19.73 ? 26  GLY A N   1 
ATOM   207  C  CA  . GLY A 1 26  ? -34.258 27.370 0.175   1.00 17.98 ? 26  GLY A CA  1 
ATOM   208  C  C   . GLY A 1 26  ? -32.878 27.058 -0.358  1.00 17.63 ? 26  GLY A C   1 
ATOM   209  O  O   . GLY A 1 26  ? -32.616 27.218 -1.559  1.00 19.03 ? 26  GLY A O   1 
ATOM   210  N  N   . CYS A 1 27  ? -32.013 26.546 0.513   1.00 15.86 ? 27  CYS A N   1 
ATOM   211  C  CA  . CYS A 1 27  ? -30.618 26.417 0.216   1.00 14.20 ? 27  CYS A CA  1 
ATOM   212  C  C   . CYS A 1 27  ? -30.238 25.064 -0.374  1.00 14.50 ? 27  CYS A C   1 
ATOM   213  O  O   . CYS A 1 27  ? -29.123 24.964 -0.957  1.00 14.66 ? 27  CYS A O   1 
ATOM   214  C  CB  . CYS A 1 27  ? -29.821 26.632 1.490   1.00 13.71 ? 27  CYS A CB  1 
ATOM   215  S  SG  . CYS A 1 27  ? -30.034 28.229 2.245   1.00 10.19 ? 27  CYS A SG  1 
ATOM   216  N  N   . TYR A 1 28  ? -31.092 24.032 -0.174  1.00 13.70 ? 28  TYR A N   1 
ATOM   217  C  CA  . TYR A 1 28  ? -30.772 22.615 -0.550  1.00 13.41 ? 28  TYR A CA  1 
ATOM   218  C  C   . TYR A 1 28  ? -31.811 21.874 -1.349  1.00 14.89 ? 28  TYR A C   1 
ATOM   219  O  O   . TYR A 1 28  ? -31.606 20.706 -1.681  1.00 14.96 ? 28  TYR A O   1 
ATOM   220  C  CB  . TYR A 1 28  ? -30.617 21.705 0.666   1.00 12.72 ? 28  TYR A CB  1 
ATOM   221  C  CG  . TYR A 1 28  ? -29.301 22.042 1.302   1.00 12.86 ? 28  TYR A CG  1 
ATOM   222  C  CD1 . TYR A 1 28  ? -28.137 21.352 0.940   1.00 13.26 ? 28  TYR A CD1 1 
ATOM   223  C  CD2 . TYR A 1 28  ? -29.183 23.138 2.189   1.00 10.01 ? 28  TYR A CD2 1 
ATOM   224  C  CE1 . TYR A 1 28  ? -26.880 21.704 1.476   1.00 12.21 ? 28  TYR A CE1 1 
ATOM   225  C  CE2 . TYR A 1 28  ? -27.944 23.489 2.721   1.00 10.57 ? 28  TYR A CE2 1 
ATOM   226  C  CZ  . TYR A 1 28  ? -26.797 22.774 2.347   1.00 10.91 ? 28  TYR A CZ  1 
ATOM   227  O  OH  . TYR A 1 28  ? -25.575 23.108 2.857   1.00 10.08 ? 28  TYR A OH  1 
ATOM   228  N  N   . CYS A 1 29  ? -32.889 22.553 -1.723  1.00 16.05 ? 29  CYS A N   1 
ATOM   229  C  CA  . CYS A 1 29  ? -33.897 21.937 -2.577  1.00 18.35 ? 29  CYS A CA  1 
ATOM   230  C  C   . CYS A 1 29  ? -33.589 22.318 -4.033  1.00 19.77 ? 29  CYS A C   1 
ATOM   231  O  O   . CYS A 1 29  ? -34.142 23.282 -4.549  1.00 20.83 ? 29  CYS A O   1 
ATOM   232  C  CB  . CYS A 1 29  ? -35.301 22.403 -2.229  1.00 19.05 ? 29  CYS A CB  1 
ATOM   233  S  SG  . CYS A 1 29  ? -35.838 21.820 -0.636  1.00 15.20 ? 29  CYS A SG  1 
ATOM   234  N  N   . GLY A 1 30  ? -32.755 21.556 -4.720  1.00 20.53 ? 30  GLY A N   1 
ATOM   235  C  CA  . GLY A 1 30  ? -32.360 21.975 -6.069  1.00 21.60 ? 30  GLY A CA  1 
ATOM   236  C  C   . GLY A 1 30  ? -30.923 21.572 -6.264  1.00 22.86 ? 30  GLY A C   1 
ATOM   237  O  O   . GLY A 1 30  ? -30.308 20.980 -5.344  1.00 23.44 ? 30  GLY A O   1 
ATOM   238  N  N   . LEU A 1 31  ? -30.363 21.852 -7.441  1.00 23.30 ? 31  LEU A N   1 
ATOM   239  C  CA  . LEU A 1 31  ? -29.005 21.336 -7.743  1.00 23.50 ? 31  LEU A CA  1 
ATOM   240  C  C   . LEU A 1 31  ? -27.993 21.826 -6.691  1.00 22.99 ? 31  LEU A C   1 
ATOM   241  O  O   . LEU A 1 31  ? -27.944 23.033 -6.403  1.00 22.12 ? 31  LEU A O   1 
ATOM   242  C  CB  . LEU A 1 31  ? -28.508 21.709 -9.153  1.00 23.45 ? 31  LEU A CB  1 
ATOM   243  C  CG  . LEU A 1 31  ? -27.101 21.135 -9.450  1.00 24.80 ? 31  LEU A CG  1 
ATOM   244  C  CD1 . LEU A 1 31  ? -27.058 19.589 -9.464  1.00 23.64 ? 31  LEU A CD1 1 
ATOM   245  C  CD2 . LEU A 1 31  ? -26.488 21.701 -10.729 1.00 26.06 ? 31  LEU A CD2 1 
ATOM   246  N  N   . GLY A 1 32  ? -27.203 20.869 -6.166  1.00 22.55 ? 32  GLY A N   1 
ATOM   247  C  CA  . GLY A 1 32  ? -26.230 21.091 -5.087  1.00 21.63 ? 32  GLY A CA  1 
ATOM   248  C  C   . GLY A 1 32  ? -26.913 21.624 -3.833  1.00 20.98 ? 32  GLY A C   1 
ATOM   249  O  O   . GLY A 1 32  ? -28.043 21.227 -3.495  1.00 21.05 ? 32  GLY A O   1 
ATOM   250  N  N   . GLY A 1 33  ? -26.234 22.547 -3.164  1.00 19.20 ? 33  GLY A N   1 
ATOM   251  C  CA  . GLY A 1 33  ? -26.734 23.160 -1.929  1.00 16.98 ? 33  GLY A CA  1 
ATOM   252  C  C   . GLY A 1 33  ? -25.566 23.880 -1.268  1.00 14.95 ? 33  GLY A C   1 
ATOM   253  O  O   . GLY A 1 33  ? -24.406 23.545 -1.532  1.00 15.24 ? 33  GLY A O   1 
ATOM   254  N  N   . SER A 1 34  ? -25.847 24.865 -0.424  1.00 12.51 ? 34  SER A N   1 
ATOM   255  C  CA  . SER A 1 34  ? -24.771 25.498 0.365   1.00 10.52 ? 34  SER A CA  1 
ATOM   256  C  C   . SER A 1 34  ? -25.290 25.986 1.733   1.00 10.00 ? 34  SER A C   1 
ATOM   257  O  O   . SER A 1 34  ? -26.474 26.161 1.874   1.00 10.00 ? 34  SER A O   1 
ATOM   258  C  CB  . SER A 1 34  ? -24.146 26.666 -0.442  1.00 10.63 ? 34  SER A CB  1 
ATOM   259  O  OG  . SER A 1 34  ? -25.019 27.810 -0.428  1.00 10.12 ? 34  SER A OG  1 
ATOM   260  N  N   . GLY A 1 35  ? -24.418 26.233 2.712   1.00 10.00 ? 35  GLY A N   1 
ATOM   261  C  CA  . GLY A 1 35  ? -24.828 26.869 3.976   1.00 10.00 ? 35  GLY A CA  1 
ATOM   262  C  C   . GLY A 1 35  ? -25.705 26.013 4.896   1.00 10.00 ? 35  GLY A C   1 
ATOM   263  O  O   . GLY A 1 35  ? -25.703 24.775 4.817   1.00 10.00 ? 35  GLY A O   1 
ATOM   264  N  N   . THR A 1 36  ? -26.459 26.660 5.780   1.00 10.00 ? 36  THR A N   1 
ATOM   265  C  CA  . THR A 1 36  ? -27.317 25.920 6.673   1.00 10.00 ? 36  THR A CA  1 
ATOM   266  C  C   . THR A 1 36  ? -28.736 25.908 6.089   1.00 10.00 ? 36  THR A C   1 
ATOM   267  O  O   . THR A 1 36  ? -29.203 26.908 5.629   1.00 10.00 ? 36  THR A O   1 
ATOM   268  C  CB  . THR A 1 36  ? -27.241 26.536 8.058   1.00 10.00 ? 36  THR A CB  1 
ATOM   269  O  OG1 . THR A 1 36  ? -25.894 26.436 8.502   1.00 10.00 ? 36  THR A OG1 1 
ATOM   270  C  CG2 . THR A 1 36  ? -28.094 25.815 9.054   1.00 10.00 ? 36  THR A CG2 1 
ATOM   271  N  N   . PRO A 1 37  ? -29.446 24.781 6.129   1.00 10.00 ? 37  PRO A N   1 
ATOM   272  C  CA  . PRO A 1 37  ? -30.799 24.895 5.609   1.00 10.79 ? 37  PRO A CA  1 
ATOM   273  C  C   . PRO A 1 37  ? -31.640 25.930 6.348   1.00 12.25 ? 37  PRO A C   1 
ATOM   274  O  O   . PRO A 1 37  ? -31.476 26.090 7.573   1.00 12.99 ? 37  PRO A O   1 
ATOM   275  C  CB  . PRO A 1 37  ? -31.358 23.503 5.852   1.00 10.00 ? 37  PRO A CB  1 
ATOM   276  C  CG  . PRO A 1 37  ? -30.502 22.974 6.932   1.00 10.00 ? 37  PRO A CG  1 
ATOM   277  C  CD  . PRO A 1 37  ? -29.169 23.403 6.533   1.00 10.00 ? 37  PRO A CD  1 
ATOM   278  N  N   . VAL A 1 38  ? -32.551 26.589 5.632   1.00 13.47 ? 38  VAL A N   1 
ATOM   279  C  CA  . VAL A 1 38  ? -33.380 27.665 6.219   1.00 15.16 ? 38  VAL A CA  1 
ATOM   280  C  C   . VAL A 1 38  ? -34.617 27.210 6.998   1.00 16.77 ? 38  VAL A C   1 
ATOM   281  O  O   . VAL A 1 38  ? -35.258 28.039 7.644   1.00 17.62 ? 38  VAL A O   1 
ATOM   282  C  CB  . VAL A 1 38  ? -33.911 28.648 5.135   1.00 15.06 ? 38  VAL A CB  1 
ATOM   283  C  CG1 . VAL A 1 38  ? -32.790 29.468 4.520   1.00 14.53 ? 38  VAL A CG1 1 
ATOM   284  C  CG2 . VAL A 1 38  ? -34.734 27.915 4.042   1.00 14.67 ? 38  VAL A CG2 1 
ATOM   285  N  N   . ASP A 1 39  ? -34.913 25.809 6.985   1.00 18.46 ? 39  ASP A N   1 
ATOM   286  C  CA  . ASP A 1 39  ? -36.261 25.205 7.135   1.00 19.89 ? 39  ASP A CA  1 
ATOM   287  C  C   . ASP A 1 39  ? -36.268 23.749 7.589   1.00 20.07 ? 39  ASP A C   1 
ATOM   288  O  O   . ASP A 1 39  ? -35.257 23.077 7.470   1.00 21.17 ? 39  ASP A O   1 
ATOM   289  C  CB  . ASP A 1 39  ? -36.815 25.130 5.719   1.00 20.08 ? 39  ASP A CB  1 
ATOM   290  C  CG  . ASP A 1 39  ? -38.255 25.482 5.638   1.00 21.67 ? 39  ASP A CG  1 
ATOM   291  O  OD1 . ASP A 1 39  ? -39.112 24.613 5.997   1.00 30.73 ? 39  ASP A OD1 1 
ATOM   292  O  OD2 . ASP A 1 39  ? -38.515 26.613 5.176   1.00 17.39 ? 39  ASP A OD2 1 
ATOM   293  N  N   . GLU A 1 40  ? -37.388 23.314 8.017   1.00 20.07 ? 40  GLU A N   1 
ATOM   294  C  CA  . GLU A 1 40  ? -37.555 21.857 8.023   1.00 19.96 ? 40  GLU A CA  1 
ATOM   295  C  C   . GLU A 1 40  ? -37.528 21.359 6.620   1.00 19.35 ? 40  GLU A C   1 
ATOM   296  O  O   . GLU A 1 40  ? -36.862 20.353 6.320   1.00 19.34 ? 40  GLU A O   1 
ATOM   297  C  CB  . GLU A 1 40  ? -38.919 21.434 8.517   1.00 20.78 ? 40  GLU A CB  1 
ATOM   298  C  CG  . GLU A 1 40  ? -38.937 20.928 9.908   1.00 24.55 ? 40  GLU A CG  1 
ATOM   299  C  CD  . GLU A 1 40  ? -39.590 21.919 10.839  1.00 29.06 ? 40  GLU A CD  1 
ATOM   300  O  OE1 . GLU A 1 40  ? -40.109 21.470 11.892  1.00 29.96 ? 40  GLU A OE1 1 
ATOM   301  O  OE2 . GLU A 1 40  ? -39.603 23.140 10.499  1.00 30.72 ? 40  GLU A OE2 1 
ATOM   302  N  N   . LEU A 1 41  ? -38.327 22.009 5.765   1.00 18.53 ? 41  LEU A N   1 
ATOM   303  C  CA  . LEU A 1 41  ? -38.418 21.576 4.368   1.00 18.12 ? 41  LEU A CA  1 
ATOM   304  C  C   . LEU A 1 41  ? -36.984 21.509 3.773   1.00 18.28 ? 41  LEU A C   1 
ATOM   305  O  O   . LEU A 1 41  ? -36.495 20.435 3.435   1.00 19.74 ? 41  LEU A O   1 
ATOM   306  C  CB  . LEU A 1 41  ? -39.400 22.440 3.537   1.00 17.61 ? 41  LEU A CB  1 
ATOM   307  C  CG  . LEU A 1 41  ? -40.286 21.850 2.398   1.00 16.11 ? 41  LEU A CG  1 
ATOM   308  C  CD1 . LEU A 1 41  ? -40.612 22.869 1.351   1.00 13.38 ? 41  LEU A CD1 1 
ATOM   309  C  CD2 . LEU A 1 41  ? -39.699 20.676 1.682   1.00 11.46 ? 41  LEU A CD2 1 
ATOM   310  N  N   . ASP A 1 42  ? -36.286 22.631 3.711   1.00 17.91 ? 42  ASP A N   1 
ATOM   311  C  CA  . ASP A 1 42  ? -34.916 22.702 3.194   1.00 16.99 ? 42  ASP A CA  1 
ATOM   312  C  C   . ASP A 1 42  ? -33.989 21.670 3.868   1.00 17.65 ? 42  ASP A C   1 
ATOM   313  O  O   . ASP A 1 42  ? -33.065 21.104 3.209   1.00 18.74 ? 42  ASP A O   1 
ATOM   314  C  CB  . ASP A 1 42  ? -34.440 24.123 3.402   1.00 16.17 ? 42  ASP A CB  1 
ATOM   315  C  CG  . ASP A 1 42  ? -33.267 24.456 2.613   1.00 16.67 ? 42  ASP A CG  1 
ATOM   316  O  OD1 . ASP A 1 42  ? -32.998 23.762 1.604   1.00 16.17 ? 42  ASP A OD1 1 
ATOM   317  O  OD2 . ASP A 1 42  ? -32.602 25.450 3.005   1.00 17.33 ? 42  ASP A OD2 1 
ATOM   318  N  N   . ARG A 1 43  ? -34.255 21.380 5.148   1.00 17.01 ? 43  ARG A N   1 
ATOM   319  C  CA  . ARG A 1 43  ? -33.518 20.355 5.866   1.00 18.21 ? 43  ARG A CA  1 
ATOM   320  C  C   . ARG A 1 43  ? -33.787 18.994 5.192   1.00 17.84 ? 43  ARG A C   1 
ATOM   321  O  O   . ARG A 1 43  ? -32.849 18.203 4.969   1.00 17.68 ? 43  ARG A O   1 
ATOM   322  C  CB  . ARG A 1 43  ? -33.960 20.314 7.334   1.00 19.74 ? 43  ARG A CB  1 
ATOM   323  C  CG  . ARG A 1 43  ? -32.873 20.199 8.455   1.00 25.62 ? 43  ARG A CG  1 
ATOM   324  C  CD  . ARG A 1 43  ? -32.276 18.786 8.657   1.00 33.80 ? 43  ARG A CD  1 
ATOM   325  N  NE  . ARG A 1 43  ? -31.195 18.463 7.697   1.00 39.93 ? 43  ARG A NE  1 
ATOM   326  C  CZ  . ARG A 1 43  ? -30.161 17.639 7.950   1.00 42.58 ? 43  ARG A CZ  1 
ATOM   327  N  NH1 . ARG A 1 43  ? -29.244 17.419 7.003   1.00 42.45 ? 43  ARG A NH1 1 
ATOM   328  N  NH2 . ARG A 1 43  ? -30.041 17.023 9.141   1.00 42.47 ? 43  ARG A NH2 1 
ATOM   329  N  N   . CYS A 1 44  ? -35.054 18.708 4.863   1.00 17.00 ? 44  CYS A N   1 
ATOM   330  C  CA  . CYS A 1 44  ? -35.361 17.422 4.202   1.00 16.50 ? 44  CYS A CA  1 
ATOM   331  C  C   . CYS A 1 44  ? -34.521 17.258 2.943   1.00 17.01 ? 44  CYS A C   1 
ATOM   332  O  O   . CYS A 1 44  ? -34.091 16.134 2.639   1.00 17.22 ? 44  CYS A O   1 
ATOM   333  C  CB  . CYS A 1 44  ? -36.817 17.318 3.817   1.00 15.81 ? 44  CYS A CB  1 
ATOM   334  S  SG  . CYS A 1 44  ? -37.975 17.429 5.200   1.00 14.67 ? 44  CYS A SG  1 
ATOM   335  N  N   . CYS A 1 45  ? -34.288 18.373 2.232   1.00 16.85 ? 45  CYS A N   1 
ATOM   336  C  CA  . CYS A 1 45  ? -33.529 18.397 0.965   1.00 17.32 ? 45  CYS A CA  1 
ATOM   337  C  C   . CYS A 1 45  ? -32.047 18.217 1.212   1.00 17.08 ? 45  CYS A C   1 
ATOM   338  O  O   . CYS A 1 45  ? -31.373 17.567 0.414   1.00 15.98 ? 45  CYS A O   1 
ATOM   339  C  CB  . CYS A 1 45  ? -33.718 19.723 0.233   1.00 17.43 ? 45  CYS A CB  1 
ATOM   340  S  SG  . CYS A 1 45  ? -35.313 19.839 -0.584  1.00 21.26 ? 45  CYS A SG  1 
ATOM   341  N  N   . GLU A 1 46  ? -31.540 18.824 2.293   1.00 17.49 ? 46  GLU A N   1 
ATOM   342  C  CA  . GLU A 1 46  ? -30.128 18.658 2.656   1.00 17.63 ? 46  GLU A CA  1 
ATOM   343  C  C   . GLU A 1 46  ? -29.828 17.199 2.996   1.00 18.05 ? 46  GLU A C   1 
ATOM   344  O  O   . GLU A 1 46  ? -28.814 16.623 2.513   1.00 18.81 ? 46  GLU A O   1 
ATOM   345  C  CB  . GLU A 1 46  ? -29.689 19.573 3.822   1.00 17.59 ? 46  GLU A CB  1 
ATOM   346  C  CG  . GLU A 1 46  ? -28.189 19.419 4.166   1.00 17.30 ? 46  GLU A CG  1 
ATOM   347  C  CD  . GLU A 1 46  ? -27.817 19.914 5.542   1.00 19.18 ? 46  GLU A CD  1 
ATOM   348  O  OE1 . GLU A 1 46  ? -28.746 20.241 6.314   1.00 20.57 ? 46  GLU A OE1 1 
ATOM   349  O  OE2 . GLU A 1 46  ? -26.602 19.943 5.876   1.00 15.82 ? 46  GLU A OE2 1 
ATOM   350  N  N   . THR A 1 47  ? -30.693 16.599 3.821   1.00 17.70 ? 47  THR A N   1 
ATOM   351  C  CA  . THR A 1 47  ? -30.581 15.166 4.146   1.00 16.91 ? 47  THR A CA  1 
ATOM   352  C  C   . THR A 1 47  ? -30.609 14.278 2.877   1.00 17.77 ? 47  THR A C   1 
ATOM   353  O  O   . THR A 1 47  ? -29.887 13.283 2.809   1.00 18.06 ? 47  THR A O   1 
ATOM   354  C  CB  . THR A 1 47  ? -31.714 14.714 5.122   1.00 17.28 ? 47  THR A CB  1 
ATOM   355  O  OG1 . THR A 1 47  ? -31.689 15.513 6.312   1.00 15.88 ? 47  THR A OG1 1 
ATOM   356  C  CG2 . THR A 1 47  ? -31.607 13.205 5.486   1.00 14.17 ? 47  THR A CG2 1 
ATOM   357  N  N   . HIS A 1 48  ? -31.445 14.633 1.892   1.00 17.60 ? 48  HIS A N   1 
ATOM   358  C  CA  . HIS A 1 48  ? -31.564 13.888 0.638   1.00 18.10 ? 48  HIS A CA  1 
ATOM   359  C  C   . HIS A 1 48  ? -30.242 14.048 -0.116  1.00 18.66 ? 48  HIS A C   1 
ATOM   360  O  O   . HIS A 1 48  ? -29.632 13.054 -0.583  1.00 18.52 ? 48  HIS A O   1 
ATOM   361  C  CB  . HIS A 1 48  ? -32.761 14.426 -0.150  1.00 18.11 ? 48  HIS A CB  1 
ATOM   362  C  CG  . HIS A 1 48  ? -33.122 13.629 -1.373  1.00 21.44 ? 48  HIS A CG  1 
ATOM   363  N  ND1 . HIS A 1 48  ? -33.035 14.150 -2.655  1.00 21.19 ? 48  HIS A ND1 1 
ATOM   364  C  CD2 . HIS A 1 48  ? -33.628 12.375 -1.510  1.00 22.49 ? 48  HIS A CD2 1 
ATOM   365  C  CE1 . HIS A 1 48  ? -33.420 13.233 -3.525  1.00 23.14 ? 48  HIS A CE1 1 
ATOM   366  N  NE2 . HIS A 1 48  ? -33.781 12.146 -2.861  1.00 22.98 ? 48  HIS A NE2 1 
ATOM   367  N  N   . ASP A 1 49  ? -29.789 15.295 -0.204  1.00 18.21 ? 49  ASP A N   1 
ATOM   368  C  CA  . ASP A 1 49  ? -28.520 15.564 -0.801  1.00 18.79 ? 49  ASP A CA  1 
ATOM   369  C  C   . ASP A 1 49  ? -27.484 14.678 -0.137  1.00 19.81 ? 49  ASP A C   1 
ATOM   370  O  O   . ASP A 1 49  ? -26.638 14.092 -0.842  1.00 20.08 ? 49  ASP A O   1 
ATOM   371  C  CB  . ASP A 1 49  ? -28.138 17.013 -0.654  1.00 17.39 ? 49  ASP A CB  1 
ATOM   372  C  CG  . ASP A 1 49  ? -28.807 17.884 -1.665  1.00 17.83 ? 49  ASP A CG  1 
ATOM   373  O  OD1 . ASP A 1 49  ? -29.759 17.423 -2.318  1.00 15.60 ? 49  ASP A OD1 1 
ATOM   374  O  OD2 . ASP A 1 49  ? -28.380 19.060 -1.835  1.00 19.17 ? 49  ASP A OD2 1 
ATOM   375  N  N   . ASN A 1 50  ? -27.533 14.572 1.197   1.00 20.33 ? 50  ASN A N   1 
ATOM   376  C  CA  . ASN A 1 50  ? -26.488 13.815 1.908   1.00 21.19 ? 50  ASN A CA  1 
ATOM   377  C  C   . ASN A 1 50  ? -26.708 12.330 1.718   1.00 20.81 ? 50  ASN A C   1 
ATOM   378  O  O   . ASN A 1 50  ? -25.751 11.547 1.697   1.00 21.96 ? 50  ASN A O   1 
ATOM   379  C  CB  . ASN A 1 50  ? -26.467 14.104 3.414   1.00 22.83 ? 50  ASN A CB  1 
ATOM   380  C  CG  . ASN A 1 50  ? -25.857 15.472 3.772   1.00 26.03 ? 50  ASN A CG  1 
ATOM   381  O  OD1 . ASN A 1 50  ? -24.695 15.748 3.458   1.00 30.76 ? 50  ASN A OD1 1 
ATOM   382  N  ND2 . ASN A 1 50  ? -26.642 16.319 4.457   1.00 26.56 ? 50  ASN A ND2 1 
ATOM   383  N  N   . CYS A 1 51  ? -27.969 11.934 1.601   1.00 19.41 ? 51  CYS A N   1 
ATOM   384  C  CA  . CYS A 1 51  ? -28.304 10.567 1.353   1.00 18.66 ? 51  CYS A CA  1 
ATOM   385  C  C   . CYS A 1 51  ? -27.705 10.107 0.005   1.00 19.13 ? 51  CYS A C   1 
ATOM   386  O  O   . CYS A 1 51  ? -27.280 8.974  -0.119  1.00 19.04 ? 51  CYS A O   1 
ATOM   387  C  CB  . CYS A 1 51  ? -29.809 10.436 1.335   1.00 18.34 ? 51  CYS A CB  1 
ATOM   388  S  SG  . CYS A 1 51  ? -30.397 8.768  1.578   1.00 17.48 ? 51  CYS A SG  1 
ATOM   389  N  N   . TYR A 1 52  ? -27.650 10.992 -0.990  1.00 19.86 ? 52  TYR A N   1 
ATOM   390  C  CA  . TYR A 1 52  ? -27.152 10.634 -2.334  1.00 19.91 ? 52  TYR A CA  1 
ATOM   391  C  C   . TYR A 1 52  ? -25.645 10.623 -2.318  1.00 21.08 ? 52  TYR A C   1 
ATOM   392  O  O   . TYR A 1 52  ? -25.010 9.931  -3.126  1.00 20.89 ? 52  TYR A O   1 
ATOM   393  C  CB  . TYR A 1 52  ? -27.695 11.572 -3.422  1.00 18.68 ? 52  TYR A CB  1 
ATOM   394  C  CG  . TYR A 1 52  ? -29.004 11.128 -4.015  1.00 16.98 ? 52  TYR A CG  1 
ATOM   395  C  CD1 . TYR A 1 52  ? -30.056 10.752 -3.211  1.00 19.55 ? 52  TYR A CD1 1 
ATOM   396  C  CD2 . TYR A 1 52  ? -29.197 11.062 -5.402  1.00 17.20 ? 52  TYR A CD2 1 
ATOM   397  C  CE1 . TYR A 1 52  ? -31.310 10.283 -3.780  1.00 17.44 ? 52  TYR A CE1 1 
ATOM   398  C  CE2 . TYR A 1 52  ? -30.417 10.622 -5.955  1.00 13.86 ? 52  TYR A CE2 1 
ATOM   399  C  CZ  . TYR A 1 52  ? -31.476 10.248 -5.119  1.00 16.64 ? 52  TYR A CZ  1 
ATOM   400  O  OH  . TYR A 1 52  ? -32.728 9.845  -5.619  1.00 18.06 ? 52  TYR A OH  1 
ATOM   401  N  N   . ARG A 1 53  ? -25.073 11.363 -1.373  1.00 22.70 ? 53  ARG A N   1 
ATOM   402  C  CA  . ARG A 1 53  ? -23.635 11.378 -1.160  1.00 24.30 ? 53  ARG A CA  1 
ATOM   403  C  C   . ARG A 1 53  ? -23.184 10.039 -0.586  1.00 24.92 ? 53  ARG A C   1 
ATOM   404  O  O   . ARG A 1 53  ? -22.197 9.476  -1.069  1.00 25.21 ? 53  ARG A O   1 
ATOM   405  C  CB  . ARG A 1 53  ? -23.293 12.549 -0.266  1.00 25.48 ? 53  ARG A CB  1 
ATOM   406  C  CG  . ARG A 1 53  ? -21.863 12.678 0.334   1.00 30.96 ? 53  ARG A CG  1 
ATOM   407  C  CD  . ARG A 1 53  ? -21.839 13.951 1.234   1.00 38.22 ? 53  ARG A CD  1 
ATOM   408  N  NE  . ARG A 1 53  ? -22.934 14.853 0.820   1.00 44.57 ? 53  ARG A NE  1 
ATOM   409  C  CZ  . ARG A 1 53  ? -22.810 16.094 0.325   1.00 47.83 ? 53  ARG A CZ  1 
ATOM   410  N  NH1 . ARG A 1 53  ? -21.603 16.689 0.209   1.00 48.27 ? 53  ARG A NH1 1 
ATOM   411  N  NH2 . ARG A 1 53  ? -23.921 16.764 -0.011  1.00 45.97 ? 53  ARG A NH2 1 
ATOM   412  N  N   . ASP A 1 54  ? -23.912 9.504  0.397   1.00 24.83 ? 54  ASP A N   1 
ATOM   413  C  CA  . ASP A 1 54  ? -23.553 8.207  0.971   1.00 26.04 ? 54  ASP A CA  1 
ATOM   414  C  C   . ASP A 1 54  ? -23.590 7.033  0.009   1.00 26.78 ? 54  ASP A C   1 
ATOM   415  O  O   . ASP A 1 54  ? -22.638 6.241  -0.010  1.00 27.79 ? 54  ASP A O   1 
ATOM   416  C  CB  . ASP A 1 54  ? -24.438 7.868  2.152   1.00 26.39 ? 54  ASP A CB  1 
ATOM   417  C  CG  . ASP A 1 54  ? -24.415 8.926  3.197   1.00 27.83 ? 54  ASP A CG  1 
ATOM   418  O  OD1 . ASP A 1 54  ? -25.271 8.849  4.112   1.00 27.98 ? 54  ASP A OD1 1 
ATOM   419  O  OD2 . ASP A 1 54  ? -23.550 9.828  3.086   1.00 29.52 ? 54  ASP A OD2 1 
ATOM   420  N  N   . ALA A 1 55  ? -24.713 6.869  -0.707  1.00 27.10 ? 55  ALA A N   1 
ATOM   421  C  CA  . ALA A 1 55  ? -24.848 5.933  -1.833  1.00 27.21 ? 55  ALA A CA  1 
ATOM   422  C  C   . ALA A 1 55  ? -23.701 6.094  -2.857  1.00 28.09 ? 55  ALA A C   1 
ATOM   423  O  O   . ALA A 1 55  ? -23.029 5.117  -3.213  1.00 27.60 ? 55  ALA A O   1 
ATOM   424  C  CB  . ALA A 1 55  ? -26.179 6.155  -2.516  1.00 26.20 ? 55  ALA A CB  1 
ATOM   425  N  N   . LYS A 1 56  ? -23.480 7.319  -3.337  1.00 29.26 ? 56  LYS A N   1 
ATOM   426  C  CA  . LYS A 1 56  ? -22.361 7.555  -4.222  1.00 30.70 ? 56  LYS A CA  1 
ATOM   427  C  C   . LYS A 1 56  ? -21.154 6.907  -3.560  1.00 32.35 ? 56  LYS A C   1 
ATOM   428  O  O   . LYS A 1 56  ? -20.389 6.233  -4.243  1.00 33.40 ? 56  LYS A O   1 
ATOM   429  C  CB  . LYS A 1 56  ? -22.099 9.049  -4.454  1.00 30.80 ? 56  LYS A CB  1 
ATOM   430  C  CG  . LYS A 1 56  ? -22.836 9.747  -5.640  1.00 31.30 ? 56  LYS A CG  1 
ATOM   431  C  CD  . LYS A 1 56  ? -21.972 10.876 -6.361  1.00 32.73 ? 56  LYS A CD  1 
ATOM   432  C  CE  . LYS A 1 56  ? -21.951 12.267 -5.656  1.00 34.02 ? 56  LYS A CE  1 
ATOM   433  N  NZ  . LYS A 1 56  ? -23.326 12.932 -5.572  1.00 35.82 ? 56  LYS A NZ  1 
ATOM   434  N  N   . ASN A 1 57  ? -21.007 7.082  -2.234  1.00 33.91 ? 57  ASN A N   1 
ATOM   435  C  CA  . ASN A 1 57  ? -19.825 6.614  -1.443  1.00 35.21 ? 57  ASN A CA  1 
ATOM   436  C  C   . ASN A 1 57  ? -19.856 5.169  -0.868  1.00 35.86 ? 57  ASN A C   1 
ATOM   437  O  O   . ASN A 1 57  ? -19.221 4.884  0.155   1.00 35.34 ? 57  ASN A O   1 
ATOM   438  C  CB  . ASN A 1 57  ? -19.463 7.647  -0.351  1.00 35.09 ? 57  ASN A CB  1 
ATOM   439  C  CG  . ASN A 1 57  ? -18.734 8.871  -0.925  1.00 36.52 ? 57  ASN A CG  1 
ATOM   440  O  OD1 . ASN A 1 57  ? -19.249 10.008 -0.919  1.00 39.27 ? 57  ASN A OD1 1 
ATOM   441  N  ND2 . ASN A 1 57  ? -17.542 8.635  -1.460  1.00 36.36 ? 57  ASN A ND2 1 
ATOM   442  N  N   . LEU A 1 58  ? -20.592 4.278  -1.548  1.00 36.90 ? 58  LEU A N   1 
ATOM   443  C  CA  . LEU A 1 58  ? -20.682 2.841  -1.234  1.00 38.00 ? 58  LEU A CA  1 
ATOM   444  C  C   . LEU A 1 58  ? -19.879 2.094  -2.301  1.00 38.54 ? 58  LEU A C   1 
ATOM   445  O  O   . LEU A 1 58  ? -20.151 2.283  -3.477  1.00 38.54 ? 58  LEU A O   1 
ATOM   446  C  CB  . LEU A 1 58  ? -22.144 2.400  -1.303  1.00 38.28 ? 58  LEU A CB  1 
ATOM   447  C  CG  . LEU A 1 58  ? -23.139 2.525  -0.135  1.00 40.39 ? 58  LEU A CG  1 
ATOM   448  C  CD1 . LEU A 1 58  ? -24.579 2.761  -0.634  1.00 40.50 ? 58  LEU A CD1 1 
ATOM   449  C  CD2 . LEU A 1 58  ? -23.097 1.287  0.786   1.00 42.17 ? 58  LEU A CD2 1 
ATOM   450  N  N   . ASP A 1 59  ? -18.885 1.268  -1.940  1.00 39.20 ? 59  ASP A N   1 
ATOM   451  C  CA  . ASP A 1 59  ? -17.984 0.726  -2.996  1.00 39.64 ? 59  ASP A CA  1 
ATOM   452  C  C   . ASP A 1 59  ? -18.747 -0.155 -3.965  1.00 39.13 ? 59  ASP A C   1 
ATOM   453  O  O   . ASP A 1 59  ? -18.361 -0.274 -5.136  1.00 39.75 ? 59  ASP A O   1 
ATOM   454  C  CB  . ASP A 1 59  ? -16.771 -0.109 -2.517  1.00 40.26 ? 59  ASP A CB  1 
ATOM   455  C  CG  . ASP A 1 59  ? -16.592 -0.137 -1.012  1.00 42.25 ? 59  ASP A CG  1 
ATOM   456  O  OD1 . ASP A 1 59  ? -16.056 0.859  -0.442  1.00 43.07 ? 59  ASP A OD1 1 
ATOM   457  O  OD2 . ASP A 1 59  ? -16.927 -1.204 -0.425  1.00 43.07 ? 59  ASP A OD2 1 
ATOM   458  N  N   . SER A 1 60  ? -19.815 -0.771 -3.464  1.00 37.76 ? 60  SER A N   1 
ATOM   459  C  CA  . SER A 1 60  ? -20.535 -1.827 -4.180  1.00 36.85 ? 60  SER A CA  1 
ATOM   460  C  C   . SER A 1 60  ? -21.351 -1.265 -5.367  1.00 36.28 ? 60  SER A C   1 
ATOM   461  O  O   . SER A 1 60  ? -21.659 -1.978 -6.340  1.00 36.54 ? 60  SER A O   1 
ATOM   462  C  CB  . SER A 1 60  ? -21.429 -2.550 -3.178  1.00 36.66 ? 60  SER A CB  1 
ATOM   463  O  OG  . SER A 1 60  ? -21.436 -1.810 -1.957  1.00 36.98 ? 60  SER A OG  1 
ATOM   464  N  N   . CYS A 1 61  ? -21.655 0.034  -5.280  1.00 34.90 ? 61  CYS A N   1 
ATOM   465  C  CA  . CYS A 1 61  ? -22.534 0.744  -6.208  1.00 32.51 ? 61  CYS A CA  1 
ATOM   466  C  C   . CYS A 1 61  ? -21.763 1.602  -7.207  1.00 32.18 ? 61  CYS A C   1 
ATOM   467  O  O   . CYS A 1 61  ? -20.992 2.464  -6.821  1.00 32.77 ? 61  CYS A O   1 
ATOM   468  C  CB  . CYS A 1 61  ? -23.486 1.609  -5.394  1.00 31.63 ? 61  CYS A CB  1 
ATOM   469  S  SG  . CYS A 1 61  ? -24.478 0.666  -4.191  1.00 27.41 ? 61  CYS A SG  1 
ATOM   470  N  N   . LYS A 1 62  ? -21.957 1.359  -8.493  1.00 31.48 ? 62  LYS A N   1 
ATOM   471  C  CA  . LYS A 1 62  ? -21.347 2.210  -9.490  1.00 30.93 ? 62  LYS A CA  1 
ATOM   472  C  C   . LYS A 1 62  ? -22.433 2.720  -10.413 1.00 29.46 ? 62  LYS A C   1 
ATOM   473  O  O   . LYS A 1 62  ? -22.723 2.087  -11.436 1.00 29.63 ? 62  LYS A O   1 
ATOM   474  C  CB  . LYS A 1 62  ? -20.284 1.452  -10.284 1.00 31.52 ? 62  LYS A CB  1 
ATOM   475  C  CG  . LYS A 1 62  ? -19.340 2.391  -11.101 1.00 36.59 ? 62  LYS A CG  1 
ATOM   476  C  CD  . LYS A 1 62  ? -19.981 3.069  -12.376 1.00 40.99 ? 62  LYS A CD  1 
ATOM   477  C  CE  . LYS A 1 62  ? -19.416 4.482  -12.652 1.00 42.02 ? 62  LYS A CE  1 
ATOM   478  N  NZ  . LYS A 1 62  ? -19.785 5.500  -11.584 1.00 42.20 ? 62  LYS A NZ  1 
ATOM   479  N  N   . PHE A 1 63  ? -23.027 3.858  -10.050 1.00 27.72 ? 63  PHE A N   1 
ATOM   480  C  CA  . PHE A 1 63  ? -24.119 4.480  -10.834 1.00 26.30 ? 63  PHE A CA  1 
ATOM   481  C  C   . PHE A 1 63  ? -23.748 5.019  -12.191 1.00 25.35 ? 63  PHE A C   1 
ATOM   482  O  O   . PHE A 1 63  ? -22.594 5.405  -12.409 1.00 25.37 ? 63  PHE A O   1 
ATOM   483  C  CB  . PHE A 1 63  ? -24.804 5.573  -10.036 1.00 25.85 ? 63  PHE A CB  1 
ATOM   484  C  CG  . PHE A 1 63  ? -25.312 5.094  -8.743  1.00 24.37 ? 63  PHE A CG  1 
ATOM   485  C  CD1 . PHE A 1 63  ? -26.426 4.271  -8.711  1.00 21.59 ? 63  PHE A CD1 1 
ATOM   486  C  CD2 . PHE A 1 63  ? -24.624 5.405  -7.551  1.00 24.19 ? 63  PHE A CD2 1 
ATOM   487  C  CE1 . PHE A 1 63  ? -26.919 3.805  -7.497  1.00 23.48 ? 63  PHE A CE1 1 
ATOM   488  C  CE2 . PHE A 1 63  ? -25.094 4.950  -6.314  1.00 24.10 ? 63  PHE A CE2 1 
ATOM   489  C  CZ  . PHE A 1 63  ? -26.252 4.143  -6.277  1.00 24.93 ? 63  PHE A CZ  1 
ATOM   490  N  N   . LEU A 1 64  ? -24.725 5.032  -13.104 1.00 24.55 ? 64  LEU A N   1 
ATOM   491  C  CA  . LEU A 1 64  ? -24.472 5.532  -14.450 1.00 24.81 ? 64  LEU A CA  1 
ATOM   492  C  C   . LEU A 1 64  ? -24.132 7.022  -14.377 1.00 25.43 ? 64  LEU A C   1 
ATOM   493  O  O   . LEU A 1 64  ? -24.852 7.795  -13.737 1.00 25.16 ? 64  LEU A O   1 
ATOM   494  C  CB  . LEU A 1 64  ? -25.645 5.276  -15.405 1.00 24.11 ? 64  LEU A CB  1 
ATOM   495  C  CG  . LEU A 1 64  ? -25.322 5.416  -16.898 1.00 23.26 ? 64  LEU A CG  1 
ATOM   496  C  CD1 . LEU A 1 64  ? -24.683 4.156  -17.425 1.00 21.90 ? 64  LEU A CD1 1 
ATOM   497  C  CD2 . LEU A 1 64  ? -26.568 5.734  -17.690 1.00 22.08 ? 64  LEU A CD2 1 
ATOM   498  N  N   . VAL A 1 65  ? -23.005 7.416  -14.984 1.00 26.68 ? 65  VAL A N   1 
ATOM   499  C  CA  . VAL A 1 65  ? -22.704 8.845  -15.123 1.00 27.45 ? 65  VAL A CA  1 
ATOM   500  C  C   . VAL A 1 65  ? -22.490 9.425  -13.701 1.00 28.11 ? 65  VAL A C   1 
ATOM   501  O  O   . VAL A 1 65  ? -22.260 10.635 -13.517 1.00 27.92 ? 65  VAL A O   1 
ATOM   502  C  CB  . VAL A 1 65  ? -23.822 9.527  -16.056 1.00 27.16 ? 65  VAL A CB  1 
ATOM   503  C  CG1 . VAL A 1 65  ? -24.534 10.703 -15.448 1.00 26.86 ? 65  VAL A CG1 1 
ATOM   504  C  CG2 . VAL A 1 65  ? -23.257 9.839  -17.398 1.00 27.34 ? 65  VAL A CG2 1 
ATOM   505  N  N   . ASP A 1 66  ? -22.577 8.502  -12.757 1.00 28.17 ? 66  ASP A N   1 
ATOM   506  C  CA  . ASP A 1 66  ? -22.201 8.693  -11.377 1.00 28.19 ? 66  ASP A CA  1 
ATOM   507  C  C   . ASP A 1 66  ? -23.223 9.373  -10.564 1.00 27.20 ? 66  ASP A C   1 
ATOM   508  O  O   . ASP A 1 66  ? -22.921 10.006 -9.593  1.00 26.89 ? 66  ASP A O   1 
ATOM   509  C  CB  . ASP A 1 66  ? -20.941 9.481  -11.285 1.00 29.75 ? 66  ASP A CB  1 
ATOM   510  C  CG  . ASP A 1 66  ? -20.089 9.011  -10.201 1.00 34.93 ? 66  ASP A CG  1 
ATOM   511  O  OD1 . ASP A 1 66  ? -20.240 9.472  -9.078  1.00 39.28 ? 66  ASP A OD1 1 
ATOM   512  O  OD2 . ASP A 1 66  ? -19.281 8.129  -10.461 1.00 41.77 ? 66  ASP A OD2 1 
ATOM   513  N  N   . ASN A 1 67  ? -24.449 9.227  -10.971 1.00 26.10 ? 67  ASN A N   1 
ATOM   514  C  CA  . ASN A 1 67  ? -25.505 10.021 -10.452 1.00 25.47 ? 67  ASN A CA  1 
ATOM   515  C  C   . ASN A 1 67  ? -26.525 8.995  -10.051 1.00 24.46 ? 67  ASN A C   1 
ATOM   516  O  O   . ASN A 1 67  ? -27.056 8.303  -10.915 1.00 24.89 ? 67  ASN A O   1 
ATOM   517  C  CB  . ASN A 1 67  ? -25.978 10.965 -11.574 1.00 25.43 ? 67  ASN A CB  1 
ATOM   518  C  CG  . ASN A 1 67  ? -27.100 11.935 -11.167 1.00 25.65 ? 67  ASN A CG  1 
ATOM   519  O  OD1 . ASN A 1 67  ? -27.482 12.743 -12.024 1.00 29.97 ? 67  ASN A OD1 1 
ATOM   520  N  ND2 . ASN A 1 67  ? -27.641 11.875 -9.911  1.00 21.04 ? 67  ASN A ND2 1 
ATOM   521  N  N   . PRO A 1 68  ? -26.761 8.861  -8.733  1.00 23.79 ? 68  PRO A N   1 
ATOM   522  C  CA  . PRO A 1 68  ? -27.784 7.966  -8.222  1.00 23.24 ? 68  PRO A CA  1 
ATOM   523  C  C   . PRO A 1 68  ? -29.121 8.241  -8.849  1.00 23.09 ? 68  PRO A C   1 
ATOM   524  O  O   . PRO A 1 68  ? -29.900 7.303  -8.939  1.00 24.59 ? 68  PRO A O   1 
ATOM   525  C  CB  . PRO A 1 68  ? -27.831 8.285  -6.729  1.00 22.60 ? 68  PRO A CB  1 
ATOM   526  C  CG  . PRO A 1 68  ? -26.451 8.670  -6.430  1.00 23.12 ? 68  PRO A CG  1 
ATOM   527  C  CD  . PRO A 1 68  ? -25.918 9.385  -7.645  1.00 23.46 ? 68  PRO A CD  1 
ATOM   528  N  N   . TYR A 1 69  ? -29.366 9.462  -9.335  1.00 21.61 ? 69  TYR A N   1 
ATOM   529  C  CA  . TYR A 1 69  ? -30.659 9.837  -9.941  1.00 20.97 ? 69  TYR A CA  1 
ATOM   530  C  C   . TYR A 1 69  ? -31.016 9.067  -11.186 1.00 19.26 ? 69  TYR A C   1 
ATOM   531  O  O   . TYR A 1 69  ? -32.179 9.066  -11.677 1.00 18.50 ? 69  TYR A O   1 
ATOM   532  C  CB  . TYR A 1 69  ? -30.648 11.291 -10.365 1.00 22.53 ? 69  TYR A CB  1 
ATOM   533  C  CG  . TYR A 1 69  ? -31.246 12.194 -9.351  1.00 28.50 ? 69  TYR A CG  1 
ATOM   534  C  CD1 . TYR A 1 69  ? -30.489 13.231 -8.820  1.00 33.23 ? 69  TYR A CD1 1 
ATOM   535  C  CD2 . TYR A 1 69  ? -32.564 11.992 -8.869  1.00 32.52 ? 69  TYR A CD2 1 
ATOM   536  C  CE1 . TYR A 1 69  ? -31.021 14.082 -7.863  1.00 36.53 ? 69  TYR A CE1 1 
ATOM   537  C  CE2 . TYR A 1 69  ? -33.114 12.840 -7.893  1.00 35.35 ? 69  TYR A CE2 1 
ATOM   538  C  CZ  . TYR A 1 69  ? -32.321 13.900 -7.410  1.00 38.14 ? 69  TYR A CZ  1 
ATOM   539  O  OH  . TYR A 1 69  ? -32.772 14.786 -6.443  1.00 42.50 ? 69  TYR A OH  1 
ATOM   540  N  N   . THR A 1 70  ? -29.978 8.453  -11.718 1.00 16.68 ? 70  THR A N   1 
ATOM   541  C  CA  . THR A 1 70  ? -30.020 7.718  -12.948 1.00 14.60 ? 70  THR A CA  1 
ATOM   542  C  C   . THR A 1 70  ? -30.580 6.303  -12.673 1.00 14.10 ? 70  THR A C   1 
ATOM   543  O  O   . THR A 1 70  ? -30.843 5.534  -13.567 1.00 14.17 ? 70  THR A O   1 
ATOM   544  C  CB  . THR A 1 70  ? -28.571 7.743  -13.366 1.00 14.29 ? 70  THR A CB  1 
ATOM   545  O  OG1 . THR A 1 70  ? -28.351 8.758  -14.383 1.00 13.86 ? 70  THR A OG1 1 
ATOM   546  C  CG2 . THR A 1 70  ? -28.112 6.436  -13.745 1.00 13.09 ? 70  THR A CG2 1 
ATOM   547  N  N   . GLU A 1 71  ? -30.768 5.970  -11.409 1.00 13.38 ? 71  GLU A N   1 
ATOM   548  C  CA  . GLU A 1 71  ? -30.951 4.599  -11.034 1.00 13.67 ? 71  GLU A CA  1 
ATOM   549  C  C   . GLU A 1 71  ? -32.429 4.377  -10.709 1.00 14.08 ? 71  GLU A C   1 
ATOM   550  O  O   . GLU A 1 71  ? -32.930 4.920  -9.724  1.00 11.73 ? 71  GLU A O   1 
ATOM   551  C  CB  . GLU A 1 71  ? -30.068 4.329  -9.808  1.00 14.73 ? 71  GLU A CB  1 
ATOM   552  C  CG  . GLU A 1 71  ? -30.374 3.024  -9.059  1.00 15.17 ? 71  GLU A CG  1 
ATOM   553  C  CD  . GLU A 1 71  ? -29.919 1.860  -9.892  1.00 20.28 ? 71  GLU A CD  1 
ATOM   554  O  OE1 . GLU A 1 71  ? -30.739 1.154  -10.528 1.00 17.41 ? 71  GLU A OE1 1 
ATOM   555  O  OE2 . GLU A 1 71  ? -28.696 1.713  -9.993  1.00 23.39 ? 71  GLU A OE2 1 
ATOM   556  N  N   . SER A 1 72  ? -33.110 3.600  -11.568 1.00 14.66 ? 72  SER A N   1 
ATOM   557  C  CA  . SER A 1 72  ? -34.533 3.267  -11.443 1.00 13.89 ? 72  SER A CA  1 
ATOM   558  C  C   . SER A 1 72  ? -34.684 2.121  -10.480 1.00 14.86 ? 72  SER A C   1 
ATOM   559  O  O   . SER A 1 72  ? -33.878 1.192  -10.501 1.00 14.29 ? 72  SER A O   1 
ATOM   560  C  CB  . SER A 1 72  ? -35.083 2.767  -12.781 1.00 14.16 ? 72  SER A CB  1 
ATOM   561  O  OG  . SER A 1 72  ? -34.692 3.578  -13.878 1.00 11.00 ? 72  SER A OG  1 
ATOM   562  N  N   . TYR A 1 73  ? -35.746 2.147  -9.675  1.00 16.08 ? 73  TYR A N   1 
ATOM   563  C  CA  . TYR A 1 73  ? -35.913 1.165  -8.635  1.00 16.50 ? 73  TYR A CA  1 
ATOM   564  C  C   . TYR A 1 73  ? -37.277 0.502  -8.557  1.00 18.17 ? 73  TYR A C   1 
ATOM   565  O  O   . TYR A 1 73  ? -37.447 -0.538 -7.857  1.00 19.70 ? 73  TYR A O   1 
ATOM   566  C  CB  . TYR A 1 73  ? -35.556 1.724  -7.263  1.00 15.76 ? 73  TYR A CB  1 
ATOM   567  C  CG  . TYR A 1 73  ? -36.087 3.111  -6.982  1.00 15.53 ? 73  TYR A CG  1 
ATOM   568  C  CD1 . TYR A 1 73  ? -37.447 3.343  -6.863  1.00 15.88 ? 73  TYR A CD1 1 
ATOM   569  C  CD2 . TYR A 1 73  ? -35.227 4.181  -6.809  1.00 15.27 ? 73  TYR A CD2 1 
ATOM   570  C  CE1 . TYR A 1 73  ? -37.934 4.570  -6.611  1.00 12.30 ? 73  TYR A CE1 1 
ATOM   571  C  CE2 . TYR A 1 73  ? -35.719 5.439  -6.548  1.00 13.08 ? 73  TYR A CE2 1 
ATOM   572  C  CZ  . TYR A 1 73  ? -37.075 5.608  -6.458  1.00 14.11 ? 73  TYR A CZ  1 
ATOM   573  O  OH  . TYR A 1 73  ? -37.588 6.835  -6.177  1.00 12.31 ? 73  TYR A OH  1 
ATOM   574  N  N   . SER A 1 74  ? -38.350 0.998  -9.024  1.00 17.65 ? 74  SER A N   1 
ATOM   575  C  CA  . SER A 1 74  ? -39.459 0.178  -8.558  1.00 19.81 ? 74  SER A CA  1 
ATOM   576  C  C   . SER A 1 74  ? -39.940 0.358  -7.114  1.00 18.96 ? 74  SER A C   1 
ATOM   577  O  O   . SER A 1 74  ? -39.720 -0.399 -6.224  1.00 19.30 ? 74  SER A O   1 
ATOM   578  C  CB  . SER A 1 74  ? -39.069 -1.288 -8.633  1.00 19.62 ? 74  SER A CB  1 
ATOM   579  O  OG  . SER A 1 74  ? -40.169 -2.108 -8.359  1.00 22.62 ? 74  SER A OG  1 
ATOM   580  N  N   . TYR A 1 75  ? -40.946 1.196  -7.048  1.00 18.70 ? 75  TYR A N   1 
ATOM   581  C  CA  . TYR A 1 75  ? -41.790 1.360  -5.897  1.00 17.83 ? 75  TYR A CA  1 
ATOM   582  C  C   . TYR A 1 75  ? -43.308 1.303  -6.190  1.00 17.96 ? 75  TYR A C   1 
ATOM   583  O  O   . TYR A 1 75  ? -43.742 1.330  -7.296  1.00 17.66 ? 75  TYR A O   1 
ATOM   584  C  CB  . TYR A 1 75  ? -41.484 2.722  -5.319  1.00 17.95 ? 75  TYR A CB  1 
ATOM   585  C  CG  . TYR A 1 75  ? -42.116 3.814  -6.102  1.00 17.09 ? 75  TYR A CG  1 
ATOM   586  C  CD1 . TYR A 1 75  ? -41.762 4.049  -7.401  1.00 19.17 ? 75  TYR A CD1 1 
ATOM   587  C  CD2 . TYR A 1 75  ? -43.042 4.620  -5.545  1.00 16.27 ? 75  TYR A CD2 1 
ATOM   588  C  CE1 . TYR A 1 75  ? -42.309 5.038  -8.096  1.00 17.66 ? 75  TYR A CE1 1 
ATOM   589  C  CE2 . TYR A 1 75  ? -43.584 5.616  -6.249  1.00 18.20 ? 75  TYR A CE2 1 
ATOM   590  C  CZ  . TYR A 1 75  ? -43.220 5.811  -7.523  1.00 18.98 ? 75  TYR A CZ  1 
ATOM   591  O  OH  . TYR A 1 75  ? -43.778 6.803  -8.232  1.00 24.25 ? 75  TYR A OH  1 
ATOM   592  N  N   . SER A 1 76  ? -44.108 1.271  -5.150  1.00 18.55 ? 76  SER A N   1 
ATOM   593  C  CA  . SER A 1 76  ? -45.549 1.424  -5.225  1.00 19.17 ? 76  SER A CA  1 
ATOM   594  C  C   . SER A 1 76  ? -46.146 2.443  -4.273  1.00 19.82 ? 76  SER A C   1 
ATOM   595  O  O   . SER A 1 76  ? -45.619 2.737  -3.235  1.00 19.71 ? 76  SER A O   1 
ATOM   596  C  CB  . SER A 1 76  ? -46.250 0.082  -5.048  1.00 19.09 ? 76  SER A CB  1 
ATOM   597  O  OG  . SER A 1 76  ? -45.959 -0.525 -3.824  1.00 18.54 ? 76  SER A OG  1 
ATOM   598  N  N   . CYS A 1 77  ? -47.270 3.024  -4.671  1.00 20.57 ? 77  CYS A N   1 
ATOM   599  C  CA  . CYS A 1 77  ? -47.870 4.080  -3.868  1.00 21.29 ? 77  CYS A CA  1 
ATOM   600  C  C   . CYS A 1 77  ? -49.359 3.865  -3.659  1.00 22.46 ? 77  CYS A C   1 
ATOM   601  O  O   . CYS A 1 77  ? -50.164 4.145  -4.548  1.00 22.53 ? 77  CYS A O   1 
ATOM   602  C  CB  . CYS A 1 77  ? -47.625 5.446  -4.515  1.00 21.30 ? 77  CYS A CB  1 
ATOM   603  S  SG  . CYS A 1 77  ? -48.044 6.856  -3.463  1.00 20.64 ? 77  CYS A SG  1 
ATOM   604  N  N   . SER A 1 78  ? -49.729 3.374  -2.481  1.00 23.48 ? 78  SER A N   1 
ATOM   605  C  CA  . SER A 1 78  ? -51.131 3.209  -2.178  1.00 24.47 ? 78  SER A CA  1 
ATOM   606  C  C   . SER A 1 78  ? -51.643 4.240  -1.164  1.00 24.69 ? 78  SER A C   1 
ATOM   607  O  O   . SER A 1 78  ? -51.508 4.097  0.071   1.00 24.82 ? 78  SER A O   1 
ATOM   608  C  CB  . SER A 1 78  ? -51.462 1.797  -1.769  1.00 23.91 ? 78  SER A CB  1 
ATOM   609  O  OG  . SER A 1 78  ? -52.841 1.753  -1.423  1.00 28.10 ? 78  SER A OG  1 
ATOM   610  N  N   . ASN A 1 79  ? -52.278 5.278  -1.699  1.00 24.76 ? 79  ASN A N   1 
ATOM   611  C  CA  . ASN A 1 79  ? -52.937 6.289  -0.882  1.00 24.42 ? 79  ASN A CA  1 
ATOM   612  C  C   . ASN A 1 79  ? -52.021 6.930  0.153   1.00 23.88 ? 79  ASN A C   1 
ATOM   613  O  O   . ASN A 1 79  ? -52.227 6.780  1.357   1.00 23.63 ? 79  ASN A O   1 
ATOM   614  C  CB  . ASN A 1 79  ? -54.169 5.698  -0.193  1.00 24.65 ? 79  ASN A CB  1 
ATOM   615  C  CG  . ASN A 1 79  ? -53.870 4.392  0.516   1.00 25.16 ? 79  ASN A CG  1 
ATOM   616  O  OD1 . ASN A 1 79  ? -54.495 3.367  0.244   1.00 22.81 ? 79  ASN A OD1 1 
ATOM   617  N  ND2 . ASN A 1 79  ? -52.910 4.423  1.433   1.00 24.85 ? 79  ASN A ND2 1 
ATOM   618  N  N   . THR A 1 80  ? -51.012 7.651  -0.324  1.00 23.16 ? 80  THR A N   1 
ATOM   619  C  CA  . THR A 1 80  ? -50.117 8.383  0.560   1.00 22.19 ? 80  THR A CA  1 
ATOM   620  C  C   . THR A 1 80  ? -49.209 7.455  1.354   1.00 21.99 ? 80  THR A C   1 
ATOM   621  O  O   . THR A 1 80  ? -48.770 7.800  2.452   1.00 22.99 ? 80  THR A O   1 
ATOM   622  C  CB  . THR A 1 80  ? -50.902 9.276  1.541   1.00 21.89 ? 80  THR A CB  1 
ATOM   623  O  OG1 . THR A 1 80  ? -51.423 10.414 0.844   1.00 21.02 ? 80  THR A OG1 1 
ATOM   624  C  CG2 . THR A 1 80  ? -49.999 9.748  2.671   1.00 21.53 ? 80  THR A CG2 1 
ATOM   625  N  N   . GLU A 1 81  ? -48.924 6.279  0.804   1.00 21.49 ? 81  GLU A N   1 
ATOM   626  C  CA  . GLU A 1 81  ? -48.037 5.345  1.491   1.00 21.37 ? 81  GLU A CA  1 
ATOM   627  C  C   . GLU A 1 81  ? -47.057 4.885  0.447   1.00 20.19 ? 81  GLU A C   1 
ATOM   628  O  O   . GLU A 1 81  ? -47.402 4.103  -0.455  1.00 21.54 ? 81  GLU A O   1 
ATOM   629  C  CB  . GLU A 1 81  ? -48.642 4.122  2.212   1.00 22.33 ? 81  GLU A CB  1 
ATOM   630  C  CG  . GLU A 1 81  ? -49.391 4.409  3.561   1.00 27.30 ? 81  GLU A CG  1 
ATOM   631  C  CD  . GLU A 1 81  ? -48.642 5.352  4.565   1.00 33.94 ? 81  GLU A CD  1 
ATOM   632  O  OE1 . GLU A 1 81  ? -49.340 6.068  5.356   1.00 33.50 ? 81  GLU A OE1 1 
ATOM   633  O  OE2 . GLU A 1 81  ? -47.361 5.385  4.561   1.00 36.51 ? 81  GLU A OE2 1 
ATOM   634  N  N   . ILE A 1 82  ? -45.820 5.327  0.565   1.00 18.45 ? 82  ILE A N   1 
ATOM   635  C  CA  . ILE A 1 82  ? -44.797 4.837  -0.363  1.00 16.85 ? 82  ILE A CA  1 
ATOM   636  C  C   . ILE A 1 82  ? -44.269 3.476  0.125   1.00 17.09 ? 82  ILE A C   1 
ATOM   637  O  O   . ILE A 1 82  ? -44.122 3.253  1.325   1.00 17.85 ? 82  ILE A O   1 
ATOM   638  C  CB  . ILE A 1 82  ? -43.704 5.879  -0.549  1.00 15.79 ? 82  ILE A CB  1 
ATOM   639  C  CG1 . ILE A 1 82  ? -44.345 7.195  -0.972  1.00 13.59 ? 82  ILE A CG1 1 
ATOM   640  C  CG2 . ILE A 1 82  ? -42.823 5.497  -1.637  1.00 14.40 ? 82  ILE A CG2 1 
ATOM   641  C  CD1 . ILE A 1 82  ? -43.458 8.355  -0.813  1.00 10.00 ? 82  ILE A CD1 1 
ATOM   642  N  N   . THR A 1 83  ? -44.069 2.533  -0.782  1.00 16.89 ? 83  THR A N   1 
ATOM   643  C  CA  . THR A 1 83  ? -43.441 1.274  -0.431  1.00 16.61 ? 83  THR A CA  1 
ATOM   644  C  C   . THR A 1 83  ? -42.288 0.963  -1.396  1.00 16.88 ? 83  THR A C   1 
ATOM   645  O  O   . THR A 1 83  ? -42.506 0.901  -2.601  1.00 18.41 ? 83  THR A O   1 
ATOM   646  C  CB  . THR A 1 83  ? -44.471 0.132  -0.443  1.00 17.29 ? 83  THR A CB  1 
ATOM   647  O  OG1 . THR A 1 83  ? -45.621 0.475  0.387   1.00 17.22 ? 83  THR A OG1 1 
ATOM   648  C  CG2 . THR A 1 83  ? -43.809 -1.184 0.051   1.00 17.05 ? 83  THR A CG2 1 
ATOM   649  N  N   . CYS A 1 84  ? -41.055 0.820  -0.893  1.00 15.85 ? 84  CYS A N   1 
ATOM   650  C  CA  . CYS A 1 84  ? -39.934 0.390  -1.716  1.00 14.14 ? 84  CYS A CA  1 
ATOM   651  C  C   . CYS A 1 84  ? -39.943 -1.123 -1.810  1.00 14.38 ? 84  CYS A C   1 
ATOM   652  O  O   . CYS A 1 84  ? -39.788 -1.848 -0.816  1.00 14.18 ? 84  CYS A O   1 
ATOM   653  C  CB  . CYS A 1 84  ? -38.612 0.828  -1.110  1.00 14.08 ? 84  CYS A CB  1 
ATOM   654  S  SG  . CYS A 1 84  ? -38.289 2.598  -1.282  1.00 13.96 ? 84  CYS A SG  1 
ATOM   655  N  N   . ASN A 1 85  ? -40.128 -1.611 -3.017  1.00 14.59 ? 85  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 85  ? -40.004 -3.026 -3.320  1.00 14.38 ? 85  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 85  ? -38.787 -3.610 -2.687  1.00 14.01 ? 85  ASN A C   1 
ATOM   658  O  O   . ASN A 1 85  ? -37.706 -3.035 -2.819  1.00 12.55 ? 85  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 85  ? -39.771 -3.161 -4.786  1.00 15.13 ? 85  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 85  ? -40.478 -4.312 -5.348  1.00 16.30 ? 85  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 85  ? -40.439 -5.405 -4.796  1.00 18.10 ? 85  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 85  ? -41.145 -4.088 -6.463  1.00 17.89 ? 85  ASN A ND2 1 
ATOM   663  N  N   . SER A 1 86  ? -38.964 -4.773 -2.049  1.00 14.08 ? 86  SER A N   1 
ATOM   664  C  CA  . SER A 1 86  ? -37.905 -5.465 -1.290  1.00 13.66 ? 86  SER A CA  1 
ATOM   665  C  C   . SER A 1 86  ? -36.936 -6.156 -2.279  1.00 13.77 ? 86  SER A C   1 
ATOM   666  O  O   . SER A 1 86  ? -35.793 -6.477 -1.967  1.00 14.42 ? 86  SER A O   1 
ATOM   667  C  CB  . SER A 1 86  ? -38.548 -6.470 -0.320  1.00 13.08 ? 86  SER A CB  1 
ATOM   668  O  OG  . SER A 1 86  ? -39.418 -7.345 -1.038  1.00 13.92 ? 86  SER A OG  1 
ATOM   669  N  N   . LYS A 1 87  ? -37.418 -6.363 -3.491  1.00 13.42 ? 87  LYS A N   1 
ATOM   670  C  CA  . LYS A 1 87  ? -36.649 -6.969 -4.527  1.00 13.03 ? 87  LYS A CA  1 
ATOM   671  C  C   . LYS A 1 87  ? -35.748 -5.926 -5.265  1.00 13.27 ? 87  LYS A C   1 
ATOM   672  O  O   . LYS A 1 87  ? -35.048 -6.263 -6.220  1.00 13.38 ? 87  LYS A O   1 
ATOM   673  C  CB  . LYS A 1 87  ? -37.617 -7.661 -5.493  1.00 12.95 ? 87  LYS A CB  1 
ATOM   674  C  CG  . LYS A 1 87  ? -38.211 -8.975 -4.995  1.00 10.83 ? 87  LYS A CG  1 
ATOM   675  C  CD  . LYS A 1 87  ? -39.404 -9.355 -5.882  1.00 15.07 ? 87  LYS A CD  1 
ATOM   676  C  CE  . LYS A 1 87  ? -40.708 -8.738 -5.290  1.00 21.91 ? 87  LYS A CE  1 
ATOM   677  N  NZ  . LYS A 1 87  ? -41.750 -8.198 -6.248  1.00 23.67 ? 87  LYS A NZ  1 
ATOM   678  N  N   . ASN A 1 88  ? -35.758 -4.667 -4.843  1.00 12.70 ? 88  ASN A N   1 
ATOM   679  C  CA  . ASN A 1 88  ? -34.684 -3.740 -5.250  1.00 12.50 ? 88  ASN A CA  1 
ATOM   680  C  C   . ASN A 1 88  ? -33.325 -4.301 -4.860  1.00 12.73 ? 88  ASN A C   1 
ATOM   681  O  O   . ASN A 1 88  ? -33.230 -4.875 -3.800  1.00 12.91 ? 88  ASN A O   1 
ATOM   682  C  CB  . ASN A 1 88  ? -34.901 -2.380 -4.567  1.00 12.43 ? 88  ASN A CB  1 
ATOM   683  C  CG  . ASN A 1 88  ? -36.056 -1.593 -5.216  1.00 11.87 ? 88  ASN A CG  1 
ATOM   684  O  OD1 . ASN A 1 88  ? -36.688 -0.734 -4.573  1.00 11.89 ? 88  ASN A OD1 1 
ATOM   685  N  ND2 . ASN A 1 88  ? -36.378 -1.945 -6.470  1.00 10.00 ? 88  ASN A ND2 1 
ATOM   686  N  N   . ASN A 1 89  ? -32.290 -4.209 -5.709  1.00 13.06 ? 89  ASN A N   1 
ATOM   687  C  CA  . ASN A 1 89  ? -30.922 -4.565 -5.258  1.00 12.17 ? 89  ASN A CA  1 
ATOM   688  C  C   . ASN A 1 89  ? -30.487 -3.563 -4.215  1.00 12.62 ? 89  ASN A C   1 
ATOM   689  O  O   . ASN A 1 89  ? -31.146 -2.517 -4.049  1.00 12.90 ? 89  ASN A O   1 
ATOM   690  C  CB  . ASN A 1 89  ? -29.866 -4.699 -6.410  1.00 12.41 ? 89  ASN A CB  1 
ATOM   691  C  CG  . ASN A 1 89  ? -29.479 -3.368 -7.075  1.00 10.29 ? 89  ASN A CG  1 
ATOM   692  O  OD1 . ASN A 1 89  ? -29.216 -2.345 -6.403  1.00 10.00 ? 89  ASN A OD1 1 
ATOM   693  N  ND2 . ASN A 1 89  ? -29.467 -3.368 -8.410  1.00 10.00 ? 89  ASN A ND2 1 
ATOM   694  N  N   . ALA A 1 90  ? -29.388 -3.864 -3.521  1.00 12.85 ? 90  ALA A N   1 
ATOM   695  C  CA  . ALA A 1 90  ? -28.957 -3.020 -2.399  1.00 13.28 ? 90  ALA A CA  1 
ATOM   696  C  C   . ALA A 1 90  ? -28.821 -1.542 -2.757  1.00 13.32 ? 90  ALA A C   1 
ATOM   697  O  O   . ALA A 1 90  ? -29.243 -0.698 -1.974  1.00 13.90 ? 90  ALA A O   1 
ATOM   698  C  CB  . ALA A 1 90  ? -27.672 -3.562 -1.758  1.00 12.43 ? 90  ALA A CB  1 
ATOM   699  N  N   . CYS A 1 91  ? -28.241 -1.221 -3.914  1.00 13.68 ? 91  CYS A N   1 
ATOM   700  C  CA  . CYS A 1 91  ? -28.029 0.173  -4.290  1.00 15.08 ? 91  CYS A CA  1 
ATOM   701  C  C   . CYS A 1 91  ? -29.335 0.873  -4.649  1.00 15.36 ? 91  CYS A C   1 
ATOM   702  O  O   . CYS A 1 91  ? -29.524 2.039  -4.264  1.00 17.04 ? 91  CYS A O   1 
ATOM   703  C  CB  . CYS A 1 91  ? -27.133 0.283  -5.512  1.00 15.90 ? 91  CYS A CB  1 
ATOM   704  S  SG  . CYS A 1 91  ? -25.573 -0.582 -5.340  1.00 19.96 ? 91  CYS A SG  1 
ATOM   705  N  N   . GLU A 1 92  ? -30.184 0.202  -5.443  1.00 13.46 ? 92  GLU A N   1 
ATOM   706  C  CA  . GLU A 1 92  ? -31.541 0.651  -5.736  1.00 11.95 ? 92  GLU A CA  1 
ATOM   707  C  C   . GLU A 1 92  ? -32.381 0.851  -4.459  1.00 12.52 ? 92  GLU A C   1 
ATOM   708  O  O   . GLU A 1 92  ? -33.105 1.868  -4.332  1.00 12.60 ? 92  GLU A O   1 
ATOM   709  C  CB  . GLU A 1 92  ? -32.237 -0.374 -6.633  1.00 11.30 ? 92  GLU A CB  1 
ATOM   710  C  CG  . GLU A 1 92  ? -31.544 -0.641 -7.959  1.00 10.29 ? 92  GLU A CG  1 
ATOM   711  C  CD  . GLU A 1 92  ? -32.207 -1.708 -8.782  1.00 13.45 ? 92  GLU A CD  1 
ATOM   712  O  OE1 . GLU A 1 92  ? -32.134 -1.606 -10.033 1.00 14.39 ? 92  GLU A OE1 1 
ATOM   713  O  OE2 . GLU A 1 92  ? -32.812 -2.660 -8.210  1.00 12.55 ? 92  GLU A OE2 1 
ATOM   714  N  N   . ALA A 1 93  ? -32.327 -0.117 -3.535  1.00 10.96 ? 93  ALA A N   1 
ATOM   715  C  CA  . ALA A 1 93  ? -33.037 0.028  -2.239  1.00 11.60 ? 93  ALA A CA  1 
ATOM   716  C  C   . ALA A 1 93  ? -32.559 1.272  -1.469  1.00 12.95 ? 93  ALA A C   1 
ATOM   717  O  O   . ALA A 1 93  ? -33.371 1.991  -0.891  1.00 14.08 ? 93  ALA A O   1 
ATOM   718  C  CB  . ALA A 1 93  ? -32.870 -1.216 -1.371  1.00 10.06 ? 93  ALA A CB  1 
ATOM   719  N  N   . PHE A 1 94  ? -31.244 1.542  -1.484  1.00 13.28 ? 94  PHE A N   1 
ATOM   720  C  CA  . PHE A 1 94  ? -30.711 2.663  -0.767  1.00 13.47 ? 94  PHE A CA  1 
ATOM   721  C  C   . PHE A 1 94  ? -31.206 3.899  -1.439  1.00 13.50 ? 94  PHE A C   1 
ATOM   722  O  O   . PHE A 1 94  ? -31.777 4.766  -0.781  1.00 12.87 ? 94  PHE A O   1 
ATOM   723  C  CB  . PHE A 1 94  ? -29.224 2.637  -0.813  1.00 14.07 ? 94  PHE A CB  1 
ATOM   724  C  CG  . PHE A 1 94  ? -28.568 3.654  0.090   1.00 17.76 ? 94  PHE A CG  1 
ATOM   725  C  CD1 . PHE A 1 94  ? -28.618 5.028  -0.195  1.00 17.62 ? 94  PHE A CD1 1 
ATOM   726  C  CD2 . PHE A 1 94  ? -27.860 3.240  1.229   1.00 20.88 ? 94  PHE A CD2 1 
ATOM   727  C  CE1 . PHE A 1 94  ? -27.971 5.973  0.664   1.00 19.80 ? 94  PHE A CE1 1 
ATOM   728  C  CE2 . PHE A 1 94  ? -27.218 4.187  2.091   1.00 19.08 ? 94  PHE A CE2 1 
ATOM   729  C  CZ  . PHE A 1 94  ? -27.292 5.542  1.805   1.00 18.14 ? 94  PHE A CZ  1 
ATOM   730  N  N   . ILE A 1 95  ? -30.996 4.008  -2.751  1.00 14.38 ? 95  ILE A N   1 
ATOM   731  C  CA  . ILE A 1 95  ? -31.564 5.170  -3.478  1.00 14.74 ? 95  ILE A CA  1 
ATOM   732  C  C   . ILE A 1 95  ? -33.076 5.250  -3.169  1.00 16.04 ? 95  ILE A C   1 
ATOM   733  O  O   . ILE A 1 95  ? -33.537 6.280  -2.658  1.00 16.51 ? 95  ILE A O   1 
ATOM   734  C  CB  . ILE A 1 95  ? -31.357 5.123  -4.997  1.00 15.15 ? 95  ILE A CB  1 
ATOM   735  C  CG1 . ILE A 1 95  ? -29.862 5.108  -5.358  1.00 14.11 ? 95  ILE A CG1 1 
ATOM   736  C  CG2 . ILE A 1 95  ? -32.106 6.285  -5.717  1.00 12.95 ? 95  ILE A CG2 1 
ATOM   737  C  CD1 . ILE A 1 95  ? -29.102 6.039  -4.532  1.00 12.67 ? 95  ILE A CD1 1 
ATOM   738  N  N   . CYS A 1 96  ? -33.837 4.181  -3.399  1.00 15.39 ? 96  CYS A N   1 
ATOM   739  C  CA  . CYS A 1 96  ? -35.272 4.232  -3.117  1.00 15.88 ? 96  CYS A CA  1 
ATOM   740  C  C   . CYS A 1 96  ? -35.589 4.917  -1.746  1.00 17.01 ? 96  CYS A C   1 
ATOM   741  O  O   . CYS A 1 96  ? -36.350 5.886  -1.689  1.00 17.59 ? 96  CYS A O   1 
ATOM   742  C  CB  . CYS A 1 96  ? -35.900 2.812  -3.220  1.00 15.83 ? 96  CYS A CB  1 
ATOM   743  S  SG  . CYS A 1 96  ? -37.730 2.769  -3.256  1.00 16.19 ? 96  CYS A SG  1 
ATOM   744  N  N   . ASN A 1 97  ? -34.970 4.444  -0.662  1.00 17.29 ? 97  ASN A N   1 
ATOM   745  C  CA  . ASN A 1 97  ? -35.186 4.967  0.667   1.00 17.67 ? 97  ASN A CA  1 
ATOM   746  C  C   . ASN A 1 97  ? -34.771 6.402  0.859   1.00 17.60 ? 97  ASN A C   1 
ATOM   747  O  O   . ASN A 1 97  ? -35.335 7.087  1.717   1.00 18.51 ? 97  ASN A O   1 
ATOM   748  C  CB  . ASN A 1 97  ? -34.436 4.116  1.691   1.00 18.83 ? 97  ASN A CB  1 
ATOM   749  C  CG  . ASN A 1 97  ? -35.104 2.752  1.929   1.00 22.94 ? 97  ASN A CG  1 
ATOM   750  O  OD1 . ASN A 1 97  ? -34.439 1.711  1.837   1.00 29.41 ? 97  ASN A OD1 1 
ATOM   751  N  ND2 . ASN A 1 97  ? -36.424 2.746  2.189   1.00 23.72 ? 97  ASN A ND2 1 
ATOM   752  N  N   . CYS A 1 98  ? -33.763 6.873  0.132   1.00 16.66 ? 98  CYS A N   1 
ATOM   753  C  CA  . CYS A 1 98  ? -33.488 8.308  0.170   1.00 16.68 ? 98  CYS A CA  1 
ATOM   754  C  C   . CYS A 1 98  ? -34.705 9.059  -0.343  1.00 16.91 ? 98  CYS A C   1 
ATOM   755  O  O   . CYS A 1 98  ? -35.114 10.026 0.269   1.00 18.15 ? 98  CYS A O   1 
ATOM   756  C  CB  . CYS A 1 98  ? -32.301 8.719  -0.715  1.00 16.61 ? 98  CYS A CB  1 
ATOM   757  S  SG  . CYS A 1 98  ? -30.758 7.998  -0.293  1.00 14.75 ? 98  CYS A SG  1 
ATOM   758  N  N   . ASP A 1 99  ? -35.255 8.640  -1.491  1.00 16.72 ? 99  ASP A N   1 
ATOM   759  C  CA  . ASP A 1 99  ? -36.365 9.371  -2.139  1.00 15.99 ? 99  ASP A CA  1 
ATOM   760  C  C   . ASP A 1 99  ? -37.569 9.292  -1.231  1.00 16.24 ? 99  ASP A C   1 
ATOM   761  O  O   . ASP A 1 99  ? -38.217 10.309 -0.959  1.00 17.29 ? 99  ASP A O   1 
ATOM   762  C  CB  . ASP A 1 99  ? -36.713 8.822  -3.538  1.00 14.82 ? 99  ASP A CB  1 
ATOM   763  C  CG  . ASP A 1 99  ? -35.659 9.182  -4.593  1.00 14.82 ? 99  ASP A CG  1 
ATOM   764  O  OD1 . ASP A 1 99  ? -35.861 8.828  -5.785  1.00 11.43 ? 99  ASP A OD1 1 
ATOM   765  O  OD2 . ASP A 1 99  ? -34.602 9.785  -4.233  1.00 10.59 ? 99  ASP A OD2 1 
ATOM   766  N  N   . ARG A 1 100 ? -37.868 8.129  -0.713  1.00 15.52 ? 100 ARG A N   1 
ATOM   767  C  CA  . ARG A 1 100 ? -39.059 7.930  0.084   1.00 16.26 ? 100 ARG A CA  1 
ATOM   768  C  C   . ARG A 1 100 ? -39.050 8.727  1.369   1.00 16.98 ? 100 ARG A C   1 
ATOM   769  O  O   . ARG A 1 100 ? -39.982 9.410  1.667   1.00 18.09 ? 100 ARG A O   1 
ATOM   770  C  CB  . ARG A 1 100 ? -39.294 6.436  0.317   1.00 16.98 ? 100 ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 100 ? -40.071 6.025  1.514   1.00 16.29 ? 100 ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 100 ? -39.361 4.916  2.199   1.00 19.74 ? 100 ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 100 ? -39.932 4.617  3.495   1.00 25.64 ? 100 ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 100 ? -41.217 4.447  3.680   1.00 25.85 ? 100 ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 100 ? -42.012 4.563  2.658   1.00 28.62 ? 100 ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 100 ? -41.695 4.185  4.861   1.00 24.54 ? 100 ARG A NH2 1 
ATOM   777  N  N   . ASN A 1 101 ? -37.962 8.643  2.097   1.00 16.02 ? 101 ASN A N   1 
ATOM   778  C  CA  . ASN A 1 101 ? -37.730 9.445  3.276   1.00 14.89 ? 101 ASN A CA  1 
ATOM   779  C  C   . ASN A 1 101 ? -37.848 10.917 2.966   1.00 15.51 ? 101 ASN A C   1 
ATOM   780  O  O   . ASN A 1 101 ? -38.402 11.690 3.759   1.00 15.76 ? 101 ASN A O   1 
ATOM   781  C  CB  . ASN A 1 101 ? -36.356 9.145  3.832   1.00 15.10 ? 101 ASN A CB  1 
ATOM   782  C  CG  . ASN A 1 101 ? -36.295 7.788  4.526   1.00 16.21 ? 101 ASN A CG  1 
ATOM   783  O  OD1 . ASN A 1 101 ? -37.310 7.240  4.924   1.00 19.13 ? 101 ASN A OD1 1 
ATOM   784  N  ND2 . ASN A 1 101 ? -35.104 7.243  4.665   1.00 17.54 ? 101 ASN A ND2 1 
ATOM   785  N  N   . ALA A 1 102 ? -37.356 11.337 1.812   1.00 15.34 ? 102 ALA A N   1 
ATOM   786  C  CA  . ALA A 1 102 ? -37.487 12.748 1.481   1.00 15.44 ? 102 ALA A CA  1 
ATOM   787  C  C   . ALA A 1 102 ? -38.956 13.079 1.176   1.00 16.17 ? 102 ALA A C   1 
ATOM   788  O  O   . ALA A 1 102 ? -39.451 14.096 1.643   1.00 17.14 ? 102 ALA A O   1 
ATOM   789  C  CB  . ALA A 1 102 ? -36.608 13.108 0.348   1.00 15.01 ? 102 ALA A CB  1 
ATOM   790  N  N   . ALA A 1 103 ? -39.684 12.221 0.444   1.00 16.42 ? 103 ALA A N   1 
ATOM   791  C  CA  . ALA A 1 103 ? -41.094 12.508 0.188   1.00 15.78 ? 103 ALA A CA  1 
ATOM   792  C  C   . ALA A 1 103 ? -41.921 12.494 1.492   1.00 16.67 ? 103 ALA A C   1 
ATOM   793  O  O   . ALA A 1 103 ? -42.752 13.385 1.713   1.00 18.31 ? 103 ALA A O   1 
ATOM   794  C  CB  . ALA A 1 103 ? -41.637 11.578 -0.817  1.00 16.24 ? 103 ALA A CB  1 
ATOM   795  N  N   . ILE A 1 104 ? -41.697 11.512 2.373   1.00 16.20 ? 104 ILE A N   1 
ATOM   796  C  CA  . ILE A 1 104 ? -42.375 11.468 3.672   1.00 15.38 ? 104 ILE A CA  1 
ATOM   797  C  C   . ILE A 1 104 ? -42.036 12.801 4.389   1.00 16.31 ? 104 ILE A C   1 
ATOM   798  O  O   . ILE A 1 104 ? -42.940 13.482 4.888   1.00 17.15 ? 104 ILE A O   1 
ATOM   799  C  CB  . ILE A 1 104 ? -41.970 10.171 4.495   1.00 15.29 ? 104 ILE A CB  1 
ATOM   800  C  CG1 . ILE A 1 104 ? -42.690 8.927  3.982   1.00 14.45 ? 104 ILE A CG1 1 
ATOM   801  C  CG2 . ILE A 1 104 ? -42.257 10.302 5.992   1.00 12.24 ? 104 ILE A CG2 1 
ATOM   802  C  CD1 . ILE A 1 104 ? -42.025 7.662  4.434   1.00 13.36 ? 104 ILE A CD1 1 
ATOM   803  N  N   . CYS A 1 105 ? -40.742 13.176 4.390   1.00 15.71 ? 105 CYS A N   1 
ATOM   804  C  CA  . CYS A 1 105 ? -40.234 14.425 4.990   1.00 14.71 ? 105 CYS A CA  1 
ATOM   805  C  C   . CYS A 1 105 ? -40.924 15.680 4.448   1.00 15.03 ? 105 CYS A C   1 
ATOM   806  O  O   . CYS A 1 105 ? -41.462 16.463 5.223   1.00 15.44 ? 105 CYS A O   1 
ATOM   807  C  CB  . CYS A 1 105 ? -38.730 14.535 4.783   1.00 14.42 ? 105 CYS A CB  1 
ATOM   808  S  SG  . CYS A 1 105 ? -37.835 15.592 5.965   1.00 13.62 ? 105 CYS A SG  1 
ATOM   809  N  N   . PHE A 1 106 ? -40.953 15.861 3.124   1.00 15.20 ? 106 PHE A N   1 
ATOM   810  C  CA  . PHE A 1 106 ? -41.654 17.007 2.544   1.00 14.42 ? 106 PHE A CA  1 
ATOM   811  C  C   . PHE A 1 106 ? -43.111 17.024 2.999   1.00 15.37 ? 106 PHE A C   1 
ATOM   812  O  O   . PHE A 1 106 ? -43.626 18.091 3.310   1.00 15.78 ? 106 PHE A O   1 
ATOM   813  C  CB  . PHE A 1 106 ? -41.646 16.990 1.025   1.00 13.78 ? 106 PHE A CB  1 
ATOM   814  C  CG  . PHE A 1 106 ? -40.284 17.058 0.386   1.00 12.51 ? 106 PHE A CG  1 
ATOM   815  C  CD1 . PHE A 1 106 ? -39.116 17.204 1.125   1.00 10.00 ? 106 PHE A CD1 1 
ATOM   816  C  CD2 . PHE A 1 106 ? -40.190 16.970 -1.010  1.00 11.01 ? 106 PHE A CD2 1 
ATOM   817  C  CE1 . PHE A 1 106 ? -37.880 17.240 0.477   1.00 10.57 ? 106 PHE A CE1 1 
ATOM   818  C  CE2 . PHE A 1 106 ? -38.972 17.028 -1.670  1.00 10.61 ? 106 PHE A CE2 1 
ATOM   819  C  CZ  . PHE A 1 106 ? -37.806 17.180 -0.940  1.00 10.96 ? 106 PHE A CZ  1 
ATOM   820  N  N   . SER A 1 107 ? -43.780 15.865 3.047   1.00 15.99 ? 107 SER A N   1 
ATOM   821  C  CA  . SER A 1 107 ? -45.209 15.852 3.397   1.00 16.97 ? 107 SER A CA  1 
ATOM   822  C  C   . SER A 1 107 ? -45.487 16.488 4.748   1.00 17.68 ? 107 SER A C   1 
ATOM   823  O  O   . SER A 1 107 ? -46.590 16.982 4.984   1.00 17.59 ? 107 SER A O   1 
ATOM   824  C  CB  . SER A 1 107 ? -45.835 14.443 3.323   1.00 17.26 ? 107 SER A CB  1 
ATOM   825  O  OG  . SER A 1 107 ? -45.432 13.571 4.373   1.00 16.93 ? 107 SER A OG  1 
ATOM   826  N  N   . LYS A 1 108 ? -44.465 16.489 5.609   1.00 18.55 ? 108 LYS A N   1 
ATOM   827  C  CA  . LYS A 1 108 ? -44.594 16.900 7.007   1.00 18.95 ? 108 LYS A CA  1 
ATOM   828  C  C   . LYS A 1 108 ? -43.864 18.190 7.345   1.00 19.21 ? 108 LYS A C   1 
ATOM   829  O  O   . LYS A 1 108 ? -44.052 18.708 8.417   1.00 19.96 ? 108 LYS A O   1 
ATOM   830  C  CB  . LYS A 1 108 ? -44.135 15.769 7.938   1.00 18.72 ? 108 LYS A CB  1 
ATOM   831  C  CG  . LYS A 1 108 ? -45.203 14.710 8.122   1.00 19.07 ? 108 LYS A CG  1 
ATOM   832  C  CD  . LYS A 1 108 ? -44.626 13.374 8.536   1.00 20.82 ? 108 LYS A CD  1 
ATOM   833  C  CE  . LYS A 1 108 ? -45.733 12.287 8.616   1.00 24.46 ? 108 LYS A CE  1 
ATOM   834  N  NZ  . LYS A 1 108 ? -46.822 12.326 7.568   1.00 23.67 ? 108 LYS A NZ  1 
ATOM   835  N  N   . ALA A 1 109 ? -43.024 18.707 6.458   1.00 19.41 ? 109 ALA A N   1 
ATOM   836  C  CA  . ALA A 1 109 ? -42.449 20.050 6.662   1.00 19.58 ? 109 ALA A CA  1 
ATOM   837  C  C   . ALA A 1 109 ? -43.490 21.108 6.375   1.00 20.21 ? 109 ALA A C   1 
ATOM   838  O  O   . ALA A 1 109 ? -44.403 20.884 5.545   1.00 20.30 ? 109 ALA A O   1 
ATOM   839  C  CB  . ALA A 1 109 ? -41.308 20.271 5.779   1.00 18.74 ? 109 ALA A CB  1 
ATOM   840  N  N   . PRO A 1 110 ? -43.406 22.235 7.101   1.00 20.65 ? 110 PRO A N   1 
ATOM   841  C  CA  . PRO A 1 110 ? -44.180 23.397 6.714   1.00 21.22 ? 110 PRO A CA  1 
ATOM   842  C  C   . PRO A 1 110 ? -43.597 23.944 5.432   1.00 21.53 ? 110 PRO A C   1 
ATOM   843  O  O   . PRO A 1 110 ? -42.369 23.918 5.268   1.00 22.95 ? 110 PRO A O   1 
ATOM   844  C  CB  . PRO A 1 110 ? -43.961 24.393 7.879   1.00 21.02 ? 110 PRO A CB  1 
ATOM   845  C  CG  . PRO A 1 110 ? -42.968 23.806 8.768   1.00 20.43 ? 110 PRO A CG  1 
ATOM   846  C  CD  . PRO A 1 110 ? -42.937 22.336 8.494   1.00 21.01 ? 110 PRO A CD  1 
ATOM   847  N  N   . TYR A 1 111 ? -44.461 24.405 4.531   1.00 21.24 ? 111 TYR A N   1 
ATOM   848  C  CA  . TYR A 1 111 ? -44.026 25.023 3.296   1.00 21.02 ? 111 TYR A CA  1 
ATOM   849  C  C   . TYR A 1 111 ? -44.138 26.479 3.503   1.00 21.69 ? 111 TYR A C   1 
ATOM   850  O  O   . TYR A 1 111 ? -45.216 26.951 3.810   1.00 22.34 ? 111 TYR A O   1 
ATOM   851  C  CB  . TYR A 1 111 ? -44.934 24.657 2.129   1.00 20.86 ? 111 TYR A CB  1 
ATOM   852  C  CG  . TYR A 1 111 ? -44.361 25.079 0.787   1.00 20.61 ? 111 TYR A CG  1 
ATOM   853  C  CD1 . TYR A 1 111 ? -44.694 26.316 0.208   1.00 18.61 ? 111 TYR A CD1 1 
ATOM   854  C  CD2 . TYR A 1 111 ? -43.452 24.243 0.102   1.00 19.63 ? 111 TYR A CD2 1 
ATOM   855  C  CE1 . TYR A 1 111 ? -44.139 26.704 -1.026  1.00 18.30 ? 111 TYR A CE1 1 
ATOM   856  C  CE2 . TYR A 1 111 ? -42.894 24.631 -1.123  1.00 20.11 ? 111 TYR A CE2 1 
ATOM   857  C  CZ  . TYR A 1 111 ? -43.247 25.862 -1.675  1.00 19.92 ? 111 TYR A CZ  1 
ATOM   858  O  OH  . TYR A 1 111 ? -42.712 26.209 -2.892  1.00 22.44 ? 111 TYR A OH  1 
ATOM   859  N  N   . ASN A 1 112 ? -43.029 27.200 3.357   1.00 22.86 ? 112 ASN A N   1 
ATOM   860  C  CA  . ASN A 1 112 ? -43.025 28.673 3.476   1.00 23.10 ? 112 ASN A CA  1 
ATOM   861  C  C   . ASN A 1 112 ? -42.805 29.276 2.116   1.00 24.04 ? 112 ASN A C   1 
ATOM   862  O  O   . ASN A 1 112 ? -41.776 29.039 1.483   1.00 23.77 ? 112 ASN A O   1 
ATOM   863  C  CB  . ASN A 1 112 ? -41.937 29.151 4.421   1.00 22.19 ? 112 ASN A CB  1 
ATOM   864  C  CG  . ASN A 1 112 ? -42.232 28.816 5.847   1.00 21.65 ? 112 ASN A CG  1 
ATOM   865  O  OD1 . ASN A 1 112 ? -43.145 29.378 6.449   1.00 24.00 ? 112 ASN A OD1 1 
ATOM   866  N  ND2 . ASN A 1 112 ? -41.453 27.913 6.413   1.00 18.71 ? 112 ASN A ND2 1 
ATOM   867  N  N   . LYS A 1 113 ? -43.789 30.029 1.648   1.00 25.68 ? 113 LYS A N   1 
ATOM   868  C  CA  . LYS A 1 113 ? -43.695 30.608 0.319   1.00 27.62 ? 113 LYS A CA  1 
ATOM   869  C  C   . LYS A 1 113 ? -42.428 31.444 0.214   1.00 28.12 ? 113 LYS A C   1 
ATOM   870  O  O   . LYS A 1 113 ? -41.708 31.349 -0.781  1.00 28.69 ? 113 LYS A O   1 
ATOM   871  C  CB  . LYS A 1 113 ? -44.960 31.400 -0.055  1.00 27.91 ? 113 LYS A CB  1 
ATOM   872  C  CG  . LYS A 1 113 ? -45.898 30.627 -1.051  1.00 30.22 ? 113 LYS A CG  1 
ATOM   873  C  CD  . LYS A 1 113 ? -47.135 31.446 -1.503  1.00 31.61 ? 113 LYS A CD  1 
ATOM   874  C  CE  . LYS A 1 113 ? -46.804 32.939 -1.784  1.00 30.74 ? 113 LYS A CE  1 
ATOM   875  N  NZ  . LYS A 1 113 ? -46.999 33.794 -0.576  1.00 31.39 ? 113 LYS A NZ  1 
ATOM   876  N  N   . GLU A 1 114 ? -42.146 32.201 1.272   1.00 28.68 ? 114 GLU A N   1 
ATOM   877  C  CA  . GLU A 1 114 ? -40.969 33.062 1.389   1.00 29.49 ? 114 GLU A CA  1 
ATOM   878  C  C   . GLU A 1 114 ? -39.622 32.524 0.856   1.00 29.22 ? 114 GLU A C   1 
ATOM   879  O  O   . GLU A 1 114 ? -38.794 33.296 0.329   1.00 29.48 ? 114 GLU A O   1 
ATOM   880  C  CB  . GLU A 1 114 ? -40.801 33.471 2.849   1.00 29.86 ? 114 GLU A CB  1 
ATOM   881  C  CG  . GLU A 1 114 ? -41.884 34.409 3.322   1.00 33.37 ? 114 GLU A CG  1 
ATOM   882  C  CD  . GLU A 1 114 ? -42.775 33.814 4.397   1.00 37.69 ? 114 GLU A CD  1 
ATOM   883  O  OE1 . GLU A 1 114 ? -43.365 34.635 5.175   1.00 38.41 ? 114 GLU A OE1 1 
ATOM   884  O  OE2 . GLU A 1 114 ? -42.865 32.553 4.471   1.00 35.77 ? 114 GLU A OE2 1 
ATOM   885  N  N   . HIS A 1 115 ? -39.417 31.213 0.986   1.00 28.32 ? 115 HIS A N   1 
ATOM   886  C  CA  . HIS A 1 115 ? -38.151 30.590 0.678   1.00 27.32 ? 115 HIS A CA  1 
ATOM   887  C  C   . HIS A 1 115 ? -38.030 29.890 -0.691  1.00 27.26 ? 115 HIS A C   1 
ATOM   888  O  O   . HIS A 1 115 ? -36.995 29.250 -0.955  1.00 26.80 ? 115 HIS A O   1 
ATOM   889  C  CB  . HIS A 1 115 ? -37.832 29.589 1.772   1.00 27.73 ? 115 HIS A CB  1 
ATOM   890  C  CG  . HIS A 1 115 ? -37.646 30.201 3.132   1.00 26.85 ? 115 HIS A CG  1 
ATOM   891  N  ND1 . HIS A 1 115 ? -38.275 29.718 4.258   1.00 25.28 ? 115 HIS A ND1 1 
ATOM   892  C  CD2 . HIS A 1 115 ? -36.877 31.232 3.551   1.00 26.24 ? 115 HIS A CD2 1 
ATOM   893  C  CE1 . HIS A 1 115 ? -37.903 30.420 5.312   1.00 26.14 ? 115 HIS A CE1 1 
ATOM   894  N  NE2 . HIS A 1 115 ? -37.061 31.353 4.908   1.00 26.88 ? 115 HIS A NE2 1 
ATOM   895  N  N   . LYS A 1 116 ? -39.072 29.984 -1.530  1.00 26.70 ? 116 LYS A N   1 
ATOM   896  C  CA  . LYS A 1 116 ? -39.062 29.485 -2.916  1.00 26.45 ? 116 LYS A CA  1 
ATOM   897  C  C   . LYS A 1 116 ? -38.157 30.441 -3.657  1.00 26.41 ? 116 LYS A C   1 
ATOM   898  O  O   . LYS A 1 116 ? -38.291 31.645 -3.444  1.00 26.52 ? 116 LYS A O   1 
ATOM   899  C  CB  . LYS A 1 116 ? -40.463 29.650 -3.535  1.00 27.00 ? 116 LYS A CB  1 
ATOM   900  C  CG  . LYS A 1 116 ? -40.925 28.557 -4.539  1.00 27.10 ? 116 LYS A CG  1 
ATOM   901  C  CD  . LYS A 1 116 ? -40.171 28.485 -5.885  1.00 28.06 ? 116 LYS A CD  1 
ATOM   902  C  CE  . LYS A 1 116 ? -39.870 27.003 -6.245  1.00 27.33 ? 116 LYS A CE  1 
ATOM   903  N  NZ  . LYS A 1 116 ? -39.682 26.715 -7.709  1.00 29.45 ? 116 LYS A NZ  1 
ATOM   904  N  N   . ASN A 1 117 ? -37.275 29.950 -4.534  1.00 25.75 ? 117 ASN A N   1 
ATOM   905  C  CA  . ASN A 1 117 ? -36.360 30.841 -5.259  1.00 26.21 ? 117 ASN A CA  1 
ATOM   906  C  C   . ASN A 1 117 ? -35.712 31.878 -4.339  1.00 26.05 ? 117 ASN A C   1 
ATOM   907  O  O   . ASN A 1 117 ? -35.851 33.108 -4.557  1.00 26.34 ? 117 ASN A O   1 
ATOM   908  C  CB  . ASN A 1 117 ? -37.059 31.546 -6.444  1.00 26.30 ? 117 ASN A CB  1 
ATOM   909  C  CG  . ASN A 1 117 ? -36.996 30.715 -7.736  1.00 29.42 ? 117 ASN A CG  1 
ATOM   910  O  OD1 . ASN A 1 117 ? -37.893 30.788 -8.583  1.00 32.34 ? 117 ASN A OD1 1 
ATOM   911  N  ND2 . ASN A 1 117 ? -35.939 29.897 -7.877  1.00 31.88 ? 117 ASN A ND2 1 
ATOM   912  N  N   . LEU A 1 118 ? -35.043 31.375 -3.296  1.00 25.45 ? 118 LEU A N   1 
ATOM   913  C  CA  . LEU A 1 118 ? -34.313 32.203 -2.326  1.00 25.04 ? 118 LEU A CA  1 
ATOM   914  C  C   . LEU A 1 118 ? -33.119 32.769 -3.036  1.00 25.63 ? 118 LEU A C   1 
ATOM   915  O  O   . LEU A 1 118 ? -32.523 32.119 -3.923  1.00 26.15 ? 118 LEU A O   1 
ATOM   916  C  CB  . LEU A 1 118 ? -33.760 31.356 -1.172  1.00 24.67 ? 118 LEU A CB  1 
ATOM   917  C  CG  . LEU A 1 118 ? -33.976 31.753 0.278   1.00 22.98 ? 118 LEU A CG  1 
ATOM   918  C  CD1 . LEU A 1 118 ? -32.812 31.333 1.097   1.00 20.27 ? 118 LEU A CD1 1 
ATOM   919  C  CD2 . LEU A 1 118 ? -34.145 33.235 0.377   1.00 26.68 ? 118 LEU A CD2 1 
ATOM   920  N  N   . ASP A 1 119 ? -32.691 33.935 -2.613  1.00 25.92 ? 119 ASP A N   1 
ATOM   921  C  CA  . ASP A 1 119 ? -31.423 34.433 -3.054  1.00 26.07 ? 119 ASP A CA  1 
ATOM   922  C  C   . ASP A 1 119 ? -30.348 33.623 -2.347  1.00 26.40 ? 119 ASP A C   1 
ATOM   923  O  O   . ASP A 1 119 ? -29.967 33.927 -1.255  1.00 26.90 ? 119 ASP A O   1 
ATOM   924  C  CB  . ASP A 1 119 ? -31.303 35.901 -2.712  1.00 25.76 ? 119 ASP A CB  1 
ATOM   925  C  CG  . ASP A 1 119 ? -30.095 36.520 -3.291  1.00 26.07 ? 119 ASP A CG  1 
ATOM   926  O  OD1 . ASP A 1 119 ? -29.316 35.808 -3.914  1.00 22.56 ? 119 ASP A OD1 1 
ATOM   927  O  OD2 . ASP A 1 119 ? -29.920 37.721 -3.123  1.00 25.56 ? 119 ASP A OD2 1 
ATOM   928  N  N   . THR A 1 120 ? -29.894 32.560 -2.971  1.00 25.41 ? 120 THR A N   1 
ATOM   929  C  CA  . THR A 1 120 ? -28.867 31.694 -2.374  1.00 25.26 ? 120 THR A CA  1 
ATOM   930  C  C   . THR A 1 120 ? -27.529 32.367 -2.084  1.00 25.87 ? 120 THR A C   1 
ATOM   931  O  O   . THR A 1 120 ? -26.829 31.998 -1.131  1.00 26.29 ? 120 THR A O   1 
ATOM   932  C  CB  . THR A 1 120 ? -28.578 30.413 -3.195  1.00 25.49 ? 120 THR A CB  1 
ATOM   933  O  OG1 . THR A 1 120 ? -28.285 30.746 -4.562  1.00 25.68 ? 120 THR A OG1 1 
ATOM   934  C  CG2 . THR A 1 120 ? -29.744 29.401 -3.093  1.00 23.33 ? 120 THR A CG2 1 
ATOM   935  N  N   . LYS A 1 121 ? -27.148 33.362 -2.869  1.00 26.32 ? 121 LYS A N   1 
ATOM   936  C  CA  . LYS A 1 121 ? -25.826 33.931 -2.627  1.00 26.84 ? 121 LYS A CA  1 
ATOM   937  C  C   . LYS A 1 121 ? -25.792 34.949 -1.505  1.00 26.08 ? 121 LYS A C   1 
ATOM   938  O  O   . LYS A 1 121 ? -24.723 35.355 -1.060  1.00 26.36 ? 121 LYS A O   1 
ATOM   939  C  CB  . LYS A 1 121 ? -25.152 34.390 -3.918  1.00 27.30 ? 121 LYS A CB  1 
ATOM   940  C  CG  . LYS A 1 121 ? -24.673 33.175 -4.804  1.00 30.72 ? 121 LYS A CG  1 
ATOM   941  C  CD  . LYS A 1 121 ? -23.736 32.135 -4.064  1.00 34.26 ? 121 LYS A CD  1 
ATOM   942  C  CE  . LYS A 1 121 ? -24.463 30.801 -3.551  1.00 36.43 ? 121 LYS A CE  1 
ATOM   943  N  NZ  . LYS A 1 121 ? -24.503 30.640 -2.025  1.00 35.05 ? 121 LYS A NZ  1 
ATOM   944  N  N   . LYS A 1 122 ? -26.979 35.304 -1.024  1.00 25.17 ? 122 LYS A N   1 
ATOM   945  C  CA  . LYS A 1 122 ? -27.143 36.147 0.155   1.00 23.90 ? 122 LYS A CA  1 
ATOM   946  C  C   . LYS A 1 122 ? -27.416 35.292 1.399   1.00 23.03 ? 122 LYS A C   1 
ATOM   947  O  O   . LYS A 1 122 ? -26.830 35.557 2.431   1.00 23.57 ? 122 LYS A O   1 
ATOM   948  C  CB  . LYS A 1 122 ? -28.288 37.154 -0.055  1.00 24.46 ? 122 LYS A CB  1 
ATOM   949  C  CG  . LYS A 1 122 ? -27.967 38.600 0.258   1.00 24.04 ? 122 LYS A CG  1 
ATOM   950  C  CD  . LYS A 1 122 ? -28.776 39.561 -0.612  1.00 25.75 ? 122 LYS A CD  1 
ATOM   951  C  CE  . LYS A 1 122 ? -28.094 40.947 -0.723  1.00 27.10 ? 122 LYS A CE  1 
ATOM   952  N  NZ  . LYS A 1 122 ? -27.550 41.509 0.587   1.00 25.55 ? 122 LYS A NZ  1 
ATOM   953  N  N   . TYR A 1 123 ? -28.260 34.258 1.312   1.00 21.48 ? 123 TYR A N   1 
ATOM   954  C  CA  . TYR A 1 123 ? -28.807 33.646 2.532   1.00 20.03 ? 123 TYR A CA  1 
ATOM   955  C  C   . TYR A 1 123 ? -28.387 32.214 2.844   1.00 18.48 ? 123 TYR A C   1 
ATOM   956  O  O   . TYR A 1 123 ? -28.818 31.640 3.873   1.00 17.81 ? 123 TYR A O   1 
ATOM   957  C  CB  . TYR A 1 123 ? -30.338 33.789 2.575   1.00 20.78 ? 123 TYR A CB  1 
ATOM   958  C  CG  . TYR A 1 123 ? -30.814 35.235 2.389   1.00 24.57 ? 123 TYR A CG  1 
ATOM   959  C  CD1 . TYR A 1 123 ? -30.404 36.265 3.265   1.00 26.45 ? 123 TYR A CD1 1 
ATOM   960  C  CD2 . TYR A 1 123 ? -31.677 35.574 1.326   1.00 27.03 ? 123 TYR A CD2 1 
ATOM   961  C  CE1 . TYR A 1 123 ? -30.845 37.603 3.082   1.00 29.68 ? 123 TYR A CE1 1 
ATOM   962  C  CE2 . TYR A 1 123 ? -32.128 36.892 1.136   1.00 29.45 ? 123 TYR A CE2 1 
ATOM   963  C  CZ  . TYR A 1 123 ? -31.708 37.898 2.005   1.00 30.63 ? 123 TYR A CZ  1 
ATOM   964  O  OH  . TYR A 1 123 ? -32.154 39.176 1.777   1.00 31.30 ? 123 TYR A OH  1 
ATOM   965  N  N   . CYS A 1 124 ? -27.531 31.651 1.995   1.00 16.47 ? 124 CYS A N   1 
ATOM   966  C  CA  . CYS A 1 124 ? -27.172 30.249 2.097   1.00 15.73 ? 124 CYS A CA  1 
ATOM   967  C  C   . CYS A 1 124 ? -25.688 30.122 2.213   1.00 16.10 ? 124 CYS A C   1 
ATOM   968  O  O   . CYS A 1 124 ? -24.979 29.495 1.440   1.00 16.05 ? 124 CYS A O   1 
ATOM   969  C  CB  . CYS A 1 124 ? -27.684 29.460 0.893   1.00 15.41 ? 124 CYS A CB  1 
ATOM   970  S  SG  . CYS A 1 124 ? -29.480 29.471 0.747   1.00 14.14 ? 124 CYS A SG  1 
ATOM   971  O  OXT . CYS A 1 124 ? -25.140 30.700 3.126   1.00 17.80 ? 124 CYS A OXT 1 
HETATM 972  C  C7  . MCW B 2 .   ? -33.428 18.242 -8.124  1.00 74.15 ? 500 MCW A C7  1 
HETATM 973  O  O3  . MCW B 2 .   ? -34.256 18.635 -6.956  1.00 75.82 ? 500 MCW A O3  1 
HETATM 974  C  C6  . MCW B 2 .   ? -35.604 18.312 -6.965  1.00 73.11 ? 500 MCW A C6  1 
HETATM 975  C  C5  . MCW B 2 .   ? -36.307 18.121 -8.156  1.00 71.31 ? 500 MCW A C5  1 
HETATM 976  C  C3  . MCW B 2 .   ? -37.638 17.789 -8.119  1.00 68.93 ? 500 MCW A C3  1 
HETATM 977  O  O1  . MCW B 2 .   ? -38.259 17.627 -9.140  1.00 71.24 ? 500 MCW A O1  1 
HETATM 978  C  C1  . MCW B 2 .   ? -38.319 17.653 -6.950  1.00 70.39 ? 500 MCW A C1  1 
HETATM 979  C  C2  . MCW B 2 .   ? -37.645 17.855 -5.760  1.00 71.90 ? 500 MCW A C2  1 
HETATM 980  C  C4  . MCW B 2 .   ? -36.299 18.180 -5.764  1.00 71.62 ? 500 MCW A C4  1 
HETATM 981  O  O2  . MCW B 2 .   ? -35.752 18.338 -4.681  1.00 69.65 ? 500 MCW A O2  1 
HETATM 982  CA CA  . CA  C 3 .   ? -29.843 19.732 -3.473  1.00 36.34 ? 501 CA  A CA  1 
HETATM 983  CA CA  . CA  D 3 .   ? -32.058 0.000  -11.687 0.50 29.54 ? 502 CA  A CA  1 
HETATM 984  O  O   . HOH E 4 .   ? -34.031 8.354  -7.593  1.00 10.00 ? 503 HOH A O   1 
HETATM 985  O  O   . HOH E 4 .   ? -33.046 -7.070 -7.684  1.00 22.61 ? 504 HOH A O   1 
HETATM 986  O  O   . HOH E 4 .   ? -22.780 29.480 1.162   1.00 12.09 ? 505 HOH A O   1 
HETATM 987  O  O   . HOH E 4 .   ? -39.848 -2.851 1.216   1.00 26.05 ? 506 HOH A O   1 
HETATM 988  O  O   . HOH E 4 .   ? -37.543 27.017 7.347   1.00 10.00 ? 507 HOH A O   1 
HETATM 989  O  O   . HOH E 4 .   ? -21.562 5.659  -8.711  1.00 20.84 ? 508 HOH A O   1 
HETATM 990  O  O   . HOH E 4 .   ? -37.246 17.166 -11.371 1.00 15.10 ? 509 HOH A O   1 
HETATM 991  O  O   . HOH E 4 .   ? -30.636 15.406 -3.686  1.00 10.00 ? 510 HOH A O   1 
HETATM 992  O  O   . HOH E 4 .   ? -28.827 -1.286 -10.304 1.00 20.84 ? 511 HOH A O   1 
HETATM 993  O  O   . HOH E 4 .   ? -26.801 29.542 5.713   1.00 10.00 ? 512 HOH A O   1 
HETATM 994  O  O   . HOH E 4 .   ? -33.838 23.802 10.519  1.00 15.33 ? 513 HOH A O   1 
HETATM 995  O  O   . HOH E 4 .   ? -34.876 13.608 3.574   1.00 15.04 ? 514 HOH A O   1 
HETATM 996  O  O   . HOH E 4 .   ? -27.118 3.960  -12.388 1.00 12.06 ? 515 HOH A O   1 
HETATM 997  O  O   . HOH E 4 .   ? -41.961 1.054  -9.773  1.00 18.00 ? 516 HOH A O   1 
HETATM 998  O  O   . HOH E 4 .   ? -33.324 11.343 2.587   1.00 16.22 ? 517 HOH A O   1 
HETATM 999  O  O   . HOH E 4 .   ? -28.408 18.479 -4.865  1.00 17.12 ? 518 HOH A O   1 
HETATM 1000 O  O   . HOH E 4 .   ? -28.596 14.532 -5.229  1.00 19.85 ? 519 HOH A O   1 
HETATM 1001 O  O   . HOH E 4 .   ? -32.144 19.096 -4.242  1.00 18.08 ? 520 HOH A O   1 
HETATM 1002 O  O   . HOH E 4 .   ? -37.504 4.899  3.897   1.00 15.99 ? 521 HOH A O   1 
HETATM 1003 O  O   . HOH E 4 .   ? -51.547 9.494  -3.286  1.00 10.00 ? 522 HOH A O   1 
HETATM 1004 O  O   . HOH E 4 .   ? -27.498 13.681 -7.804  1.00 21.30 ? 523 HOH A O   1 
HETATM 1005 O  O   . HOH E 4 .   ? -28.279 10.845 -17.111 1.00 41.18 ? 524 HOH A O   1 
HETATM 1006 O  O   . HOH E 4 .   ? -30.449 -0.466 0.946   1.00 16.62 ? 525 HOH A O   1 
HETATM 1007 O  O   . HOH E 4 .   ? -32.435 9.965  4.326   1.00 23.07 ? 526 HOH A O   1 
HETATM 1008 O  O   . HOH E 4 .   ? -31.171 26.300 -4.454  1.00 20.10 ? 527 HOH A O   1 
HETATM 1009 O  O   . HOH E 4 .   ? -40.541 0.778  1.623   1.00 21.84 ? 528 HOH A O   1 
HETATM 1010 O  O   . HOH E 4 .   ? -25.602 19.054 -1.324  1.00 22.09 ? 529 HOH A O   1 
HETATM 1011 O  O   . HOH E 4 .   ? -25.677 11.288 4.915   1.00 20.10 ? 530 HOH A O   1 
HETATM 1012 O  O   . HOH E 4 .   ? -29.180 25.352 -5.885  1.00 22.94 ? 531 HOH A O   1 
HETATM 1013 O  O   . HOH E 4 .   ? -28.881 15.857 -11.901 1.00 38.57 ? 532 HOH A O   1 
HETATM 1014 O  O   . HOH E 4 .   ? -41.119 32.793 7.207   1.00 15.58 ? 533 HOH A O   1 
HETATM 1015 O  O   . HOH E 4 .   ? -31.381 17.549 -7.000  1.00 42.15 ? 534 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   TRP 3   3   3   TRP TRP A . n 
A 1 4   GLN 4   4   4   GLN GLN A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   MET 8   8   8   MET MET A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  CYS 11  11  11  CYS CYS A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  HIS 17  17  17  HIS HIS A . n 
A 1 18  PRO 18  18  18  PRO PRO A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  ASN 23  23  23  ASN ASN A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  CYS 27  27  27  CYS CYS A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  CYS 29  29  29  CYS CYS A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  ASP 39  39  39  ASP ASP A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  LEU 41  41  41  LEU LEU A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  CYS 44  44  44  CYS CYS A . n 
A 1 45  CYS 45  45  45  CYS CYS A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  CYS 51  51  51  CYS CYS A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  CYS 61  61  61  CYS CYS A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  PRO 68  68  68  PRO PRO A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  CYS 91  91  91  CYS CYS A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  CYS 98  98  98  CYS CYS A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 PHE 106 106 106 PHE PHE A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 LYS 108 108 108 LYS LYS A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 PRO 110 110 110 PRO PRO A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 CYS 124 124 124 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MCW 1  500 500 MCW MCH A . 
C 3 CA  1  501 501 CA  CA  A . 
D 3 CA  1  502 502 CA  CA  A . 
E 4 HOH 1  503 503 HOH HOH A . 
E 4 HOH 2  504 504 HOH HOH A . 
E 4 HOH 3  505 505 HOH HOH A . 
E 4 HOH 4  506 506 HOH HOH A . 
E 4 HOH 5  507 507 HOH HOH A . 
E 4 HOH 6  508 508 HOH HOH A . 
E 4 HOH 7  509 509 HOH HOH A . 
E 4 HOH 8  510 510 HOH HOH A . 
E 4 HOH 9  511 511 HOH HOH A . 
E 4 HOH 10 512 512 HOH HOH A . 
E 4 HOH 11 513 513 HOH HOH A . 
E 4 HOH 12 514 514 HOH HOH A . 
E 4 HOH 13 515 515 HOH HOH A . 
E 4 HOH 14 516 516 HOH HOH A . 
E 4 HOH 15 517 517 HOH HOH A . 
E 4 HOH 16 518 518 HOH HOH A . 
E 4 HOH 17 519 519 HOH HOH A . 
E 4 HOH 18 520 520 HOH HOH A . 
E 4 HOH 19 521 521 HOH HOH A . 
E 4 HOH 20 522 522 HOH HOH A . 
E 4 HOH 21 523 523 HOH HOH A . 
E 4 HOH 22 524 524 HOH HOH A . 
E 4 HOH 23 525 525 HOH HOH A . 
E 4 HOH 24 526 526 HOH HOH A . 
E 4 HOH 25 527 527 HOH HOH A . 
E 4 HOH 26 528 528 HOH HOH A . 
E 4 HOH 27 529 529 HOH HOH A . 
E 4 HOH 28 530 530 HOH HOH A . 
E 4 HOH 29 531 531 HOH HOH A . 
E 4 HOH 30 532 532 HOH HOH A . 
E 4 HOH 31 533 533 HOH HOH A . 
E 4 HOH 32 534 534 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1560  ? 
1 MORE         -50   ? 
1 'SSA (A^2)'  12870 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 5_554 x-y,-y,-z-1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -23.3733333333 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CA 
_pdbx_struct_special_symmetry.auth_seq_id     502 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   CA 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A TYR 28 ? A TYR 28  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? A GLY 30 ? A GLY 30  ? 1_555 102.3 ? 
2  O   ? A TYR 28 ? A TYR 28  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? A GLY 32 ? A GLY 32  ? 1_555 106.2 ? 
3  O   ? A GLY 30 ? A GLY 30  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? A GLY 32 ? A GLY 32  ? 1_555 78.5  ? 
4  O   ? A TYR 28 ? A TYR 28  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 92.7  ? 
5  O   ? A GLY 30 ? A GLY 30  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 148.9 ? 
6  O   ? A GLY 32 ? A GLY 32  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 123.4 ? 
7  O   ? A TYR 28 ? A TYR 28  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 49 ? A ASP 49  ? 1_555 92.8  ? 
8  O   ? A GLY 30 ? A GLY 30  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 49 ? A ASP 49  ? 1_555 150.3 ? 
9  O   ? A GLY 32 ? A GLY 32  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 49 ? A ASP 49  ? 1_555 72.8  ? 
10 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD2 ? A ASP 49 ? A ASP 49  ? 1_555 53.0  ? 
11 O   ? A TYR 28 ? A TYR 28  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 518 ? 1_555 169.0 ? 
12 O   ? A GLY 30 ? A GLY 30  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 518 ? 1_555 86.0  ? 
13 O   ? A GLY 32 ? A GLY 32  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 518 ? 1_555 82.3  ? 
14 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 518 ? 1_555 76.7  ? 
15 OD2 ? A ASP 49 ? A ASP 49  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 518 ? 1_555 83.0  ? 
16 O   ? A TYR 28 ? A TYR 28  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 520 ? 1_555 72.3  ? 
17 O   ? A GLY 30 ? A GLY 30  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 520 ? 1_555 72.7  ? 
18 O   ? A GLY 32 ? A GLY 32  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 520 ? 1_555 149.9 ? 
19 OD1 ? A ASP 49 ? A ASP 49  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 520 ? 1_555 86.6  ? 
20 OD2 ? A ASP 49 ? A ASP 49  ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 520 ? 1_555 136.8 ? 
21 O   ? E HOH .  ? A HOH 518 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O   ? E HOH .  ? A HOH 520 ? 1_555 104.0 ? 
22 OE1 ? A GLU 71 ? A GLU 71  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O   ? A SER 72 ? A SER 72  ? 1_555 86.2  ? 
23 OE1 ? A GLU 71 ? A GLU 71  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE1 ? A GLU 92 ? A GLU 92  ? 1_555 90.4  ? 
24 O   ? A SER 72 ? A SER 72  ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE1 ? A GLU 92 ? A GLU 92  ? 1_555 88.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-30 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-08-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Database references'       
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -35.2910 
_pdbx_refine_tls.origin_y         14.1300 
_pdbx_refine_tls.origin_z         -2.7170 
_pdbx_refine_tls.T[1][1]          0.1635 
_pdbx_refine_tls.T[2][2]          0.2206 
_pdbx_refine_tls.T[3][3]          0.1219 
_pdbx_refine_tls.T[1][2]          -0.0893 
_pdbx_refine_tls.T[1][3]          -0.0062 
_pdbx_refine_tls.T[2][3]          -0.0362 
_pdbx_refine_tls.L[1][1]          1.4708 
_pdbx_refine_tls.L[2][2]          9.9967 
_pdbx_refine_tls.L[3][3]          2.6842 
_pdbx_refine_tls.L[1][2]          1.2050 
_pdbx_refine_tls.L[1][3]          0.6102 
_pdbx_refine_tls.L[2][3]          2.5009 
_pdbx_refine_tls.S[1][1]          0.2397 
_pdbx_refine_tls.S[1][2]          -0.1670 
_pdbx_refine_tls.S[1][3]          0.2022 
_pdbx_refine_tls.S[2][1]          0.3095 
_pdbx_refine_tls.S[2][2]          -0.6234 
_pdbx_refine_tls.S[2][3]          0.3245 
_pdbx_refine_tls.S[3][1]          -0.1750 
_pdbx_refine_tls.S[3][2]          -0.2479 
_pdbx_refine_tls.S[3][3]          0.3837 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     124 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
Auto      'model building'  MR       ? 2 
REFMAC    refinement        5.5.0072 ? 3 
iMOSFLM   'data reduction'  .        ? 4 
SCALA     'data scaling'    .        ? 5 
Auto      phasing           MR       ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 66 ? ? 81.04 26.82 
2 1 SER A 74 ? ? 77.57 94.77 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-methoxycyclohexa-2,5-diene-1,4-dione MCW 
3 'CALCIUM ION'                          CA  
4 water                                  HOH 
#