data_3I40
# 
_entry.id   3I40 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I40         
RCSB  RCSB053935   
WWPDB D_1000053935 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3I3Z 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I40 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Timofeev, V.I.'         1 
'Bezuglov, V.V.'         2 
'Miroshnikov, K.A.'      3 
'Chuprov-Netochin, R.N.' 4 
'Kuranova, I.P.'         5 
# 
_citation.id                        primary 
_citation.title                     
'X-ray investigation of gene-engineered human insulin crystallized from a solution containing polysialic acid.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_volume            66 
_citation.page_first                259 
_citation.page_last                 263 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   DK 
_citation.journal_id_ISSN           1744-3091 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20208155 
_citation.pdbx_database_id_DOI      10.1107/S1744309110000461 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Timofeev, V.I.'         1 
primary 'Chuprov-Netochin, R.N.' 2 
primary 'Samigina, V.R.'         3 
primary 'Bezuglov, V.V.'         4 
primary 'Miroshnikov, K.A.'      5 
primary 'Kuranova, I.P.'         6 
# 
_cell.entry_id           3I40 
_cell.length_a           77.220 
_cell.length_b           77.220 
_cell.length_c           77.220 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I40 
_symmetry.space_group_name_H-M             'I 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                199 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Insulin A chain' 2383.698 1  ? ? ? ? 
2 polymer man 'Insulin B chain' 3403.927 1  ? ? ? ? 
3 water   nat water             18.015   35 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN          GIVEQCCTSICSLYQLENYCN          A ? 
2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTPKA FVNQHLCGSHLVEALYLVCGERGFFYTPKA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  VAL n 
1 4  GLU n 
1 5  GLN n 
1 6  CYS n 
1 7  CYS n 
1 8  THR n 
1 9  SER n 
1 10 ILE n 
1 11 CYS n 
1 12 SER n 
1 13 LEU n 
1 14 TYR n 
1 15 GLN n 
1 16 LEU n 
1 17 GLU n 
1 18 ASN n 
1 19 TYR n 
1 20 CYS n 
1 21 ASN n 
2 1  PHE n 
2 2  VAL n 
2 3  ASN n 
2 4  GLN n 
2 5  HIS n 
2 6  LEU n 
2 7  CYS n 
2 8  GLY n 
2 9  SER n 
2 10 HIS n 
2 11 LEU n 
2 12 VAL n 
2 13 GLU n 
2 14 ALA n 
2 15 LEU n 
2 16 TYR n 
2 17 LEU n 
2 18 VAL n 
2 19 CYS n 
2 20 GLY n 
2 21 GLU n 
2 22 ARG n 
2 23 GLY n 
2 24 PHE n 
2 25 PHE n 
2 26 TYR n 
2 27 THR n 
2 28 PRO n 
2 29 LYS n 
2 30 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
2 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP INS_HUMAN P01308 1 GIVEQCCTSICSLYQLENYCN          90 ? 
2 UNP INS_HUMAN P01308 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I40 A 1 ? 21 ? P01308 90 ? 110 ? 1 21 
2 2 3I40 B 1 ? 30 ? P01308 25 ? 54  ? 1 30 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             3I40 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      30 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01308 
_struct_ref_seq_dif.db_mon_id                    THR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          54 
_struct_ref_seq_dif.details                      'SEE REMARK 999' 
_struct_ref_seq_dif.pdbx_auth_seq_num            30 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I40 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.31 
_exptl_crystal.density_percent_sol   62.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2009-03-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'BRUKER AXS MICROSTAR' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3I40 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             54.636 
_reflns.d_resolution_high            1.850 
_reflns.number_obs                   6677 
_reflns.number_all                   6703 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        24.040 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3I40 
_refine.ls_number_reflns_obs                     6640 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             31.525 
_refine.ls_d_res_high                            1.850 
_refine.ls_percent_reflns_obs                    99.09 
_refine.ls_R_factor_obs                          0.2016 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2003 
_refine.ls_R_factor_R_free                       0.2276 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.76 
_refine.ls_number_reflns_R_free                  316 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               30.297 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.346 
_refine.solvent_model_param_bsol                 47.049 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2G4M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.810 
_refine.pdbx_overall_phase_error                 24.930 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.B_iso_max                                79.46 
_refine.B_iso_min                                13.58 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        403 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               438 
_refine_hist.d_res_high                       1.850 
_refine_hist.d_res_low                        31.525 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 423 'X-RAY DIFFRACTION' ? 
f_angle_d          0.760  ? ? 569 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.205 ? ? 141 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.068  ? ? 62  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.002  ? ? 73  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.8501 2.3309  3105 0.2301 99.00  0.2627 . . 162 . . . . 'X-RAY DIFFRACTION' 
. 2.3309 31.5295 3219 0.1910 100.00 0.2145 . . 154 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I40 
_struct.title                     'Human insulin' 
_struct.pdbx_descriptor           'Insulin A chain, Insulin B chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I40 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            
;insulin, Carbohydrate metabolism, Cleavage on pair of basic residues, Diabetes mellitus, Disease mutation, Disulfide bond, Glucose metabolism, Hormone, Secreted
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 1  ? CYS A 7  ? GLY A 1  CYS A 7  1 ? 7  
HELX_P HELX_P2 2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7  
HELX_P HELX_P3 3 GLY B 8  ? GLY B 20 ? GLY B 8  GLY B 20 1 ? 13 
HELX_P HELX_P4 4 GLU B 21 ? GLY B 23 ? GLU B 21 GLY B 23 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 6  SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6  A CYS 11 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf2 disulf ? ? A CYS 7  SG ? ? ? 1_555 B CYS 7  SG ? ? A CYS 7  B CYS 7  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          3I40 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I40 
_atom_sites.fract_transf_matrix[1][1]   0.012950 
_atom_sites.fract_transf_matrix[1][2]   -0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012950 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012950 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 1  ? -27.279 6.238   -12.314 1.00 45.01 ? 1  GLY A N   1 
ATOM   2   C CA  . GLY A 1 1  ? -26.249 6.028   -11.313 1.00 43.47 ? 1  GLY A CA  1 
ATOM   3   C C   . GLY A 1 1  ? -25.582 4.677   -11.471 1.00 34.37 ? 1  GLY A C   1 
ATOM   4   O O   . GLY A 1 1  ? -25.731 4.023   -12.501 1.00 30.09 ? 1  GLY A O   1 
ATOM   5   N N   . ILE A 1 2  ? -24.853 4.248   -10.446 1.00 32.71 ? 2  ILE A N   1 
ATOM   6   C CA  . ILE A 1 2  ? -24.070 3.023   -10.550 1.00 22.60 ? 2  ILE A CA  1 
ATOM   7   C C   . ILE A 1 2  ? -24.915 1.786   -10.840 1.00 23.32 ? 2  ILE A C   1 
ATOM   8   O O   . ILE A 1 2  ? -24.469 0.865   -11.529 1.00 26.36 ? 2  ILE A O   1 
ATOM   9   C CB  . ILE A 1 2  ? -23.208 2.791   -9.302  1.00 28.24 ? 2  ILE A CB  1 
ATOM   10  C CG1 . ILE A 1 2  ? -22.249 1.620   -9.538  1.00 25.03 ? 2  ILE A CG1 1 
ATOM   11  C CG2 . ILE A 1 2  ? -24.090 2.579   -8.068  1.00 32.70 ? 2  ILE A CG2 1 
ATOM   12  C CD1 . ILE A 1 2  ? -21.209 1.479   -8.457  1.00 30.60 ? 2  ILE A CD1 1 
ATOM   13  N N   . VAL A 1 3  ? -26.137 1.755   -10.324 1.00 27.13 ? 3  VAL A N   1 
ATOM   14  C CA  . VAL A 1 3  ? -26.993 0.599   -10.563 1.00 30.10 ? 3  VAL A CA  1 
ATOM   15  C C   . VAL A 1 3  ? -27.324 0.471   -12.049 1.00 32.71 ? 3  VAL A C   1 
ATOM   16  O O   . VAL A 1 3  ? -27.258 -0.617  -12.621 1.00 28.83 ? 3  VAL A O   1 
ATOM   17  C CB  . VAL A 1 3  ? -28.284 0.657   -9.740  1.00 30.51 ? 3  VAL A CB  1 
ATOM   18  C CG1 . VAL A 1 3  ? -29.194 -0.497  -10.127 1.00 35.07 ? 3  VAL A CG1 1 
ATOM   19  C CG2 . VAL A 1 3  ? -27.956 0.613   -8.242  1.00 27.53 ? 3  VAL A CG2 1 
ATOM   20  N N   . GLU A 1 4  ? -27.669 1.596   -12.667 1.00 34.97 ? 4  GLU A N   1 
ATOM   21  C CA  . GLU A 1 4  ? -28.001 1.627   -14.086 1.00 31.24 ? 4  GLU A CA  1 
ATOM   22  C C   . GLU A 1 4  ? -26.797 1.224   -14.927 1.00 32.52 ? 4  GLU A C   1 
ATOM   23  O O   . GLU A 1 4  ? -26.933 0.517   -15.924 1.00 31.47 ? 4  GLU A O   1 
ATOM   24  C CB  . GLU A 1 4  ? -28.474 3.027   -14.485 1.00 38.19 ? 4  GLU A CB  1 
ATOM   25  C CG  . GLU A 1 4  ? -29.829 3.420   -13.908 1.00 61.51 ? 4  GLU A CG  1 
ATOM   26  C CD  . GLU A 1 4  ? -29.832 3.535   -12.387 1.00 66.16 ? 4  GLU A CD  1 
ATOM   27  O OE1 . GLU A 1 4  ? -28.868 4.094   -11.814 1.00 42.60 ? 4  GLU A OE1 1 
ATOM   28  O OE2 . GLU A 1 4  ? -30.812 3.071   -11.762 1.00 67.86 ? 4  GLU A OE2 1 
ATOM   29  N N   . GLN A 1 5  ? -25.615 1.664   -14.508 1.00 28.29 ? 5  GLN A N   1 
ATOM   30  C CA  . GLN A 1 5  ? -24.393 1.410   -15.266 1.00 31.01 ? 5  GLN A CA  1 
ATOM   31  C C   . GLN A 1 5  ? -23.776 0.028   -15.056 1.00 39.69 ? 5  GLN A C   1 
ATOM   32  O O   . GLN A 1 5  ? -23.149 -0.511  -15.967 1.00 26.39 ? 5  GLN A O   1 
ATOM   33  C CB  . GLN A 1 5  ? -23.349 2.492   -14.974 1.00 25.23 ? 5  GLN A CB  1 
ATOM   34  C CG  . GLN A 1 5  ? -23.818 3.887   -15.346 1.00 38.13 ? 5  GLN A CG  1 
ATOM   35  C CD  . GLN A 1 5  ? -24.535 3.921   -16.693 1.00 53.62 ? 5  GLN A CD  1 
ATOM   36  O OE1 . GLN A 1 5  ? -24.074 3.334   -17.674 1.00 38.85 ? 5  GLN A OE1 1 
ATOM   37  N NE2 . GLN A 1 5  ? -25.671 4.609   -16.741 1.00 42.57 ? 5  GLN A NE2 1 
ATOM   38  N N   . CYS A 1 6  ? -23.940 -0.551  -13.868 1.00 22.46 ? 6  CYS A N   1 
ATOM   39  C CA  . CYS A 1 6  ? -23.214 -1.776  -13.549 1.00 20.37 ? 6  CYS A CA  1 
ATOM   40  C C   . CYS A 1 6  ? -24.114 -2.963  -13.225 1.00 18.21 ? 6  CYS A C   1 
ATOM   41  O O   . CYS A 1 6  ? -23.677 -4.107  -13.293 1.00 21.83 ? 6  CYS A O   1 
ATOM   42  C CB  . CYS A 1 6  ? -22.235 -1.524  -12.396 1.00 22.32 ? 6  CYS A CB  1 
ATOM   43  S SG  . CYS A 1 6  ? -20.756 -0.602  -12.893 1.00 27.82 ? 6  CYS A SG  1 
ATOM   44  N N   . CYS A 1 7  ? -25.359 -2.685  -12.860 1.00 22.16 ? 7  CYS A N   1 
ATOM   45  C CA  . CYS A 1 7  ? -26.307 -3.744  -12.520 1.00 21.25 ? 7  CYS A CA  1 
ATOM   46  C C   . CYS A 1 7  ? -27.245 -4.032  -13.690 1.00 31.44 ? 7  CYS A C   1 
ATOM   47  O O   . CYS A 1 7  ? -27.307 -5.155  -14.190 1.00 24.09 ? 7  CYS A O   1 
ATOM   48  C CB  . CYS A 1 7  ? -27.119 -3.351  -11.286 1.00 22.97 ? 7  CYS A CB  1 
ATOM   49  S SG  . CYS A 1 7  ? -28.355 -4.584  -10.791 1.00 28.27 ? 7  CYS A SG  1 
ATOM   50  N N   . THR A 1 8  ? -27.967 -3.001  -14.122 1.00 29.15 ? 8  THR A N   1 
ATOM   51  C CA  . THR A 1 8  ? -28.901 -3.121  -15.236 1.00 29.59 ? 8  THR A CA  1 
ATOM   52  C C   . THR A 1 8  ? -28.147 -3.334  -16.542 1.00 34.52 ? 8  THR A C   1 
ATOM   53  O O   . THR A 1 8  ? -28.647 -3.986  -17.454 1.00 38.61 ? 8  THR A O   1 
ATOM   54  C CB  . THR A 1 8  ? -29.780 -1.868  -15.371 1.00 31.24 ? 8  THR A CB  1 
ATOM   55  O OG1 . THR A 1 8  ? -30.023 -1.303  -14.080 1.00 41.12 ? 8  THR A OG1 1 
ATOM   56  C CG2 . THR A 1 8  ? -31.100 -2.218  -16.029 1.00 51.07 ? 8  THR A CG2 1 
ATOM   57  N N   . SER A 1 9  ? -26.948 -2.769  -16.630 1.00 26.15 ? 9  SER A N   1 
ATOM   58  C CA  . SER A 1 9  ? -26.064 -3.019  -17.765 1.00 21.41 ? 9  SER A CA  1 
ATOM   59  C C   . SER A 1 9  ? -24.699 -3.529  -17.309 1.00 32.36 ? 9  SER A C   1 
ATOM   60  O O   . SER A 1 9  ? -24.419 -3.594  -16.111 1.00 29.40 ? 9  SER A O   1 
ATOM   61  C CB  . SER A 1 9  ? -25.910 -1.765  -18.626 1.00 32.53 ? 9  SER A CB  1 
ATOM   62  O OG  . SER A 1 9  ? -25.465 -0.670  -17.851 1.00 47.07 ? 9  SER A OG  1 
ATOM   63  N N   . ILE A 1 10 ? -23.849 -3.891  -18.261 1.00 24.43 ? 10 ILE A N   1 
ATOM   64  C CA  . ILE A 1 10 ? -22.562 -4.492  -17.924 1.00 24.22 ? 10 ILE A CA  1 
ATOM   65  C C   . ILE A 1 10 ? -21.591 -3.454  -17.367 1.00 30.49 ? 10 ILE A C   1 
ATOM   66  O O   . ILE A 1 10 ? -21.420 -2.380  -17.934 1.00 26.28 ? 10 ILE A O   1 
ATOM   67  C CB  . ILE A 1 10 ? -21.942 -5.216  -19.128 1.00 26.99 ? 10 ILE A CB  1 
ATOM   68  C CG1 . ILE A 1 10 ? -22.880 -6.328  -19.595 1.00 26.49 ? 10 ILE A CG1 1 
ATOM   69  C CG2 . ILE A 1 10 ? -20.577 -5.790  -18.770 1.00 25.10 ? 10 ILE A CG2 1 
ATOM   70  C CD1 . ILE A 1 10 ? -22.302 -7.179  -20.689 1.00 44.31 ? 10 ILE A CD1 1 
ATOM   71  N N   . CYS A 1 11 ? -20.972 -3.790  -16.240 1.00 28.14 ? 11 CYS A N   1 
ATOM   72  C CA  . CYS A 1 11 ? -20.088 -2.876  -15.534 1.00 25.92 ? 11 CYS A CA  1 
ATOM   73  C C   . CYS A 1 11 ? -18.752 -2.779  -16.258 1.00 36.06 ? 11 CYS A C   1 
ATOM   74  O O   . CYS A 1 11 ? -18.491 -3.524  -17.204 1.00 27.25 ? 11 CYS A O   1 
ATOM   75  C CB  . CYS A 1 11 ? -19.867 -3.387  -14.106 1.00 23.76 ? 11 CYS A CB  1 
ATOM   76  S SG  . CYS A 1 11 ? -19.406 -2.114  -12.908 1.00 28.09 ? 11 CYS A SG  1 
ATOM   77  N N   . SER A 1 12 ? -17.902 -1.865  -15.807 1.00 25.78 ? 12 SER A N   1 
ATOM   78  C CA  . SER A 1 12 ? -16.554 -1.767  -16.349 1.00 22.91 ? 12 SER A CA  1 
ATOM   79  C C   . SER A 1 12 ? -15.634 -1.220  -15.281 1.00 19.20 ? 12 SER A C   1 
ATOM   80  O O   . SER A 1 12 ? -16.076 -0.508  -14.375 1.00 18.62 ? 12 SER A O   1 
ATOM   81  C CB  . SER A 1 12 ? -16.530 -0.845  -17.559 1.00 24.50 ? 12 SER A CB  1 
ATOM   82  O OG  . SER A 1 12 ? -16.681 0.502   -17.157 1.00 24.75 ? 12 SER A OG  1 
ATOM   83  N N   . LEU A 1 13 ? -14.346 -1.528  -15.392 1.00 22.17 ? 13 LEU A N   1 
ATOM   84  C CA  . LEU A 1 13 ? -13.378 -1.013  -14.426 1.00 19.72 ? 13 LEU A CA  1 
ATOM   85  C C   . LEU A 1 13 ? -13.412 0.508   -14.438 1.00 22.22 ? 13 LEU A C   1 
ATOM   86  O O   . LEU A 1 13 ? -13.329 1.158   -13.393 1.00 17.29 ? 13 LEU A O   1 
ATOM   87  C CB  . LEU A 1 13 ? -11.971 -1.517  -14.751 1.00 19.22 ? 13 LEU A CB  1 
ATOM   88  C CG  . LEU A 1 13 ? -10.860 -0.998  -13.840 1.00 17.99 ? 13 LEU A CG  1 
ATOM   89  C CD1 . LEU A 1 13 ? -11.104 -1.386  -12.388 1.00 18.06 ? 13 LEU A CD1 1 
ATOM   90  C CD2 . LEU A 1 13 ? -9.522  -1.530  -14.308 1.00 15.25 ? 13 LEU A CD2 1 
ATOM   91  N N   . TYR A 1 14 ? -13.550 1.075   -15.632 1.00 19.94 ? 14 TYR A N   1 
ATOM   92  C CA  . TYR A 1 14 ? -13.559 2.521   -15.774 1.00 22.72 ? 14 TYR A CA  1 
ATOM   93  C C   . TYR A 1 14 ? -14.638 3.140   -14.893 1.00 22.64 ? 14 TYR A C   1 
ATOM   94  O O   . TYR A 1 14 ? -14.391 4.094   -14.152 1.00 25.33 ? 14 TYR A O   1 
ATOM   95  C CB  A TYR A 1 14 ? -13.771 2.911   -17.239 0.50 27.81 ? 14 TYR A CB  1 
ATOM   96  C CB  B TYR A 1 14 ? -13.786 2.928   -17.233 0.50 27.85 ? 14 TYR A CB  1 
ATOM   97  C CG  A TYR A 1 14 ? -13.608 4.388   -17.494 0.50 28.31 ? 14 TYR A CG  1 
ATOM   98  C CG  B TYR A 1 14 ? -13.829 4.427   -17.427 0.50 28.20 ? 14 TYR A CG  1 
ATOM   99  C CD1 A TYR A 1 14 ? -12.442 4.893   -18.059 0.50 23.25 ? 14 TYR A CD1 1 
ATOM   100 C CD1 B TYR A 1 14 ? -12.714 5.121   -17.879 0.50 25.75 ? 14 TYR A CD1 1 
ATOM   101 C CD2 A TYR A 1 14 ? -14.614 5.282   -17.153 0.50 28.36 ? 14 TYR A CD2 1 
ATOM   102 C CD2 B TYR A 1 14 ? -14.980 5.152   -17.138 0.50 27.68 ? 14 TYR A CD2 1 
ATOM   103 C CE1 A TYR A 1 14 ? -12.289 6.252   -18.283 0.50 27.32 ? 14 TYR A CE1 1 
ATOM   104 C CE1 B TYR A 1 14 ? -12.746 6.496   -18.047 0.50 27.49 ? 14 TYR A CE1 1 
ATOM   105 C CE2 A TYR A 1 14 ? -14.472 6.636   -17.372 0.50 29.32 ? 14 TYR A CE2 1 
ATOM   106 C CE2 B TYR A 1 14 ? -15.021 6.527   -17.300 0.50 28.26 ? 14 TYR A CE2 1 
ATOM   107 C CZ  A TYR A 1 14 ? -13.311 7.117   -17.938 0.50 29.06 ? 14 TYR A CZ  1 
ATOM   108 C CZ  B TYR A 1 14 ? -13.902 7.193   -17.757 0.50 29.57 ? 14 TYR A CZ  1 
ATOM   109 O OH  A TYR A 1 14 ? -13.179 8.469   -18.153 0.50 33.01 ? 14 TYR A OH  1 
ATOM   110 O OH  B TYR A 1 14 ? -13.938 8.561   -17.922 0.50 32.79 ? 14 TYR A OH  1 
ATOM   111 N N   . GLN A 1 15 ? -15.837 2.584   -14.969 1.00 21.27 ? 15 GLN A N   1 
ATOM   112 C CA  . GLN A 1 15 ? -16.962 3.129   -14.222 1.00 21.51 ? 15 GLN A CA  1 
ATOM   113 C C   . GLN A 1 15 ? -16.837 2.882   -12.722 1.00 17.30 ? 15 GLN A C   1 
ATOM   114 O O   . GLN A 1 15 ? -17.121 3.764   -11.917 1.00 20.82 ? 15 GLN A O   1 
ATOM   115 C CB  . GLN A 1 15 ? -18.275 2.561   -14.758 1.00 25.25 ? 15 GLN A CB  1 
ATOM   116 C CG  . GLN A 1 15 ? -18.527 2.905   -16.214 1.00 32.75 ? 15 GLN A CG  1 
ATOM   117 C CD  . GLN A 1 15 ? -19.997 3.039   -16.527 1.00 55.05 ? 15 GLN A CD  1 
ATOM   118 O OE1 . GLN A 1 15 ? -20.680 3.914   -15.987 1.00 53.01 ? 15 GLN A OE1 1 
ATOM   119 N NE2 . GLN A 1 15 ? -20.497 2.177   -17.410 1.00 50.66 ? 15 GLN A NE2 1 
ATOM   120 N N   . LEU A 1 16 ? -16.399 1.687   -12.346 1.00 15.37 ? 16 LEU A N   1 
ATOM   121 C CA  . LEU A 1 16 ? -16.236 1.380   -10.930 1.00 17.02 ? 16 LEU A CA  1 
ATOM   122 C C   . LEU A 1 16 ? -15.301 2.382   -10.273 1.00 16.55 ? 16 LEU A C   1 
ATOM   123 O O   . LEU A 1 16 ? -15.565 2.868   -9.172  1.00 19.70 ? 16 LEU A O   1 
ATOM   124 C CB  . LEU A 1 16 ? -15.703 -0.037  -10.742 1.00 24.64 ? 16 LEU A CB  1 
ATOM   125 C CG  . LEU A 1 16 ? -16.709 -1.151  -11.013 1.00 24.23 ? 16 LEU A CG  1 
ATOM   126 C CD1 . LEU A 1 16 ? -16.007 -2.496  -11.058 1.00 21.90 ? 16 LEU A CD1 1 
ATOM   127 C CD2 . LEU A 1 16 ? -17.786 -1.124  -9.936  1.00 18.48 ? 16 LEU A CD2 1 
ATOM   128 N N   . GLU A 1 17 ? -14.199 2.703   -10.950 1.00 17.86 ? 17 GLU A N   1 
ATOM   129 C CA  . GLU A 1 17 ? -13.219 3.608   -10.365 1.00 19.38 ? 17 GLU A CA  1 
ATOM   130 C C   . GLU A 1 17 ? -13.763 5.026   -10.180 1.00 18.73 ? 17 GLU A C   1 
ATOM   131 O O   . GLU A 1 17 ? -13.259 5.782   -9.351  1.00 22.43 ? 17 GLU A O   1 
ATOM   132 C CB  . GLU A 1 17 ? -11.910 3.598   -11.155 1.00 20.40 ? 17 GLU A CB  1 
ATOM   133 C CG  . GLU A 1 17 ? -11.090 2.343   -10.898 1.00 20.17 ? 17 GLU A CG  1 
ATOM   134 C CD  . GLU A 1 17 ? -9.623  2.514   -11.240 1.00 22.14 ? 17 GLU A CD  1 
ATOM   135 O OE1 . GLU A 1 17 ? -9.301  3.347   -12.110 1.00 22.42 ? 17 GLU A OE1 1 
ATOM   136 O OE2 . GLU A 1 17 ? -8.792  1.805   -10.640 1.00 27.73 ? 17 GLU A OE2 1 
ATOM   137 N N   . ASN A 1 18 ? -14.799 5.374   -10.932 1.00 20.29 ? 18 ASN A N   1 
ATOM   138 C CA  . ASN A 1 18 ? -15.480 6.657   -10.735 1.00 20.00 ? 18 ASN A CA  1 
ATOM   139 C C   . ASN A 1 18 ? -16.080 6.766   -9.334  1.00 26.36 ? 18 ASN A C   1 
ATOM   140 O O   . ASN A 1 18 ? -16.469 7.849   -8.890  1.00 28.46 ? 18 ASN A O   1 
ATOM   141 C CB  . ASN A 1 18 ? -16.587 6.839   -11.774 1.00 21.66 ? 18 ASN A CB  1 
ATOM   142 C CG  . ASN A 1 18 ? -16.061 7.344   -13.113 1.00 25.89 ? 18 ASN A CG  1 
ATOM   143 O OD1 . ASN A 1 18 ? -15.007 7.974   -13.180 1.00 32.32 ? 18 ASN A OD1 1 
ATOM   144 N ND2 . ASN A 1 18 ? -16.802 7.070   -14.180 1.00 38.57 ? 18 ASN A ND2 1 
ATOM   145 N N   . TYR A 1 19 ? -16.163 5.640   -8.638  1.00 20.84 ? 19 TYR A N   1 
ATOM   146 C CA  . TYR A 1 19 ? -16.803 5.618   -7.327  1.00 18.56 ? 19 TYR A CA  1 
ATOM   147 C C   . TYR A 1 19 ? -15.822 5.394   -6.180  1.00 23.20 ? 19 TYR A C   1 
ATOM   148 O O   . TYR A 1 19 ? -16.223 5.337   -5.018  1.00 27.54 ? 19 TYR A O   1 
ATOM   149 C CB  . TYR A 1 19 ? -17.945 4.599   -7.298  1.00 20.89 ? 19 TYR A CB  1 
ATOM   150 C CG  . TYR A 1 19 ? -19.068 4.966   -8.236  1.00 21.62 ? 19 TYR A CG  1 
ATOM   151 C CD1 . TYR A 1 19 ? -19.115 4.453   -9.521  1.00 23.43 ? 19 TYR A CD1 1 
ATOM   152 C CD2 . TYR A 1 19 ? -20.066 5.848   -7.844  1.00 26.68 ? 19 TYR A CD2 1 
ATOM   153 C CE1 . TYR A 1 19 ? -20.126 4.796   -10.385 1.00 24.39 ? 19 TYR A CE1 1 
ATOM   154 C CE2 . TYR A 1 19 ? -21.082 6.200   -8.708  1.00 31.02 ? 19 TYR A CE2 1 
ATOM   155 C CZ  . TYR A 1 19 ? -21.104 5.672   -9.979  1.00 28.36 ? 19 TYR A CZ  1 
ATOM   156 O OH  . TYR A 1 19 ? -22.114 6.009   -10.853 1.00 42.08 ? 19 TYR A OH  1 
ATOM   157 N N   . CYS A 1 20 ? -14.534 5.281   -6.499  1.00 21.90 ? 20 CYS A N   1 
ATOM   158 C CA  . CYS A 1 20 ? -13.510 5.251   -5.459  1.00 19.66 ? 20 CYS A CA  1 
ATOM   159 C C   . CYS A 1 20 ? -13.334 6.645   -4.882  1.00 28.69 ? 20 CYS A C   1 
ATOM   160 O O   . CYS A 1 20 ? -13.526 7.639   -5.585  1.00 30.53 ? 20 CYS A O   1 
ATOM   161 C CB  . CYS A 1 20 ? -12.169 4.783   -6.021  1.00 22.84 ? 20 CYS A CB  1 
ATOM   162 S SG  . CYS A 1 20 ? -12.209 3.187   -6.829  1.00 22.45 ? 20 CYS A SG  1 
ATOM   163 N N   . ASN A 1 21 ? -12.955 6.716   -3.609  1.00 26.51 ? 21 ASN A N   1 
ATOM   164 C CA  . ASN A 1 21 ? -12.630 7.993   -2.976  1.00 36.60 ? 21 ASN A CA  1 
ATOM   165 C C   . ASN A 1 21 ? -11.279 8.511   -3.448  1.00 35.58 ? 21 ASN A C   1 
ATOM   166 O O   . ASN A 1 21 ? -10.515 7.790   -4.091  1.00 36.84 ? 21 ASN A O   1 
ATOM   167 C CB  . ASN A 1 21 ? -12.615 7.863   -1.450  1.00 34.89 ? 21 ASN A CB  1 
ATOM   168 C CG  . ASN A 1 21 ? -13.978 7.548   -0.878  1.00 33.46 ? 21 ASN A CG  1 
ATOM   169 O OD1 . ASN A 1 21 ? -14.107 6.726   0.029   1.00 48.60 ? 21 ASN A OD1 1 
ATOM   170 N ND2 . ASN A 1 21 ? -15.008 8.198   -1.408  1.00 39.53 ? 21 ASN A ND2 1 
ATOM   171 O OXT . ASN A 1 21 ? -10.922 9.659   -3.189  1.00 58.00 ? 21 ASN A OXT 1 
ATOM   172 N N   . PHE B 2 1  ? -13.174 -9.740  -13.251 1.00 44.56 ? 1  PHE B N   1 
ATOM   173 C CA  . PHE B 2 1  ? -14.387 -9.892  -12.452 1.00 53.84 ? 1  PHE B CA  1 
ATOM   174 C C   . PHE B 2 1  ? -15.310 -8.684  -12.590 1.00 44.51 ? 1  PHE B C   1 
ATOM   175 O O   . PHE B 2 1  ? -16.451 -8.715  -12.133 1.00 40.17 ? 1  PHE B O   1 
ATOM   176 C CB  . PHE B 2 1  ? -14.042 -10.126 -10.973 1.00 47.36 ? 1  PHE B CB  1 
ATOM   177 C CG  . PHE B 2 1  ? -13.222 -9.024  -10.356 1.00 43.05 ? 1  PHE B CG  1 
ATOM   178 C CD1 . PHE B 2 1  ? -13.816 -8.050  -9.571  1.00 39.13 ? 1  PHE B CD1 1 
ATOM   179 C CD2 . PHE B 2 1  ? -11.854 -8.964  -10.565 1.00 48.11 ? 1  PHE B CD2 1 
ATOM   180 C CE1 . PHE B 2 1  ? -13.059 -7.037  -9.008  1.00 29.34 ? 1  PHE B CE1 1 
ATOM   181 C CE2 . PHE B 2 1  ? -11.093 -7.959  -10.002 1.00 34.97 ? 1  PHE B CE2 1 
ATOM   182 C CZ  . PHE B 2 1  ? -11.696 -6.993  -9.224  1.00 36.24 ? 1  PHE B CZ  1 
ATOM   183 N N   . VAL B 2 2  ? -14.819 -7.623  -13.228 1.00 27.44 ? 2  VAL B N   1 
ATOM   184 C CA  . VAL B 2 2  ? -15.568 -6.367  -13.273 1.00 25.65 ? 2  VAL B CA  1 
ATOM   185 C C   . VAL B 2 2  ? -16.402 -6.197  -14.541 1.00 30.55 ? 2  VAL B C   1 
ATOM   186 O O   . VAL B 2 2  ? -17.249 -5.306  -14.628 1.00 30.98 ? 2  VAL B O   1 
ATOM   187 C CB  . VAL B 2 2  ? -14.633 -5.163  -13.114 1.00 32.50 ? 2  VAL B CB  1 
ATOM   188 C CG1 . VAL B 2 2  ? -14.056 -5.139  -11.705 1.00 29.74 ? 2  VAL B CG1 1 
ATOM   189 C CG2 . VAL B 2 2  ? -13.519 -5.227  -14.141 1.00 45.24 ? 2  VAL B CG2 1 
ATOM   190 N N   . ASN B 2 3  ? -16.158 -7.045  -15.528 1.00 28.57 ? 3  ASN B N   1 
ATOM   191 C CA  . ASN B 2 3  ? -16.844 -6.904  -16.806 1.00 31.00 ? 3  ASN B CA  1 
ATOM   192 C C   . ASN B 2 3  ? -18.072 -7.800  -16.928 1.00 29.49 ? 3  ASN B C   1 
ATOM   193 O O   . ASN B 2 3  ? -18.115 -8.720  -17.743 1.00 28.57 ? 3  ASN B O   1 
ATOM   194 C CB  . ASN B 2 3  ? -15.854 -7.122  -17.946 1.00 31.67 ? 3  ASN B CB  1 
ATOM   195 C CG  . ASN B 2 3  ? -14.703 -6.139  -17.888 1.00 35.45 ? 3  ASN B CG  1 
ATOM   196 O OD1 . ASN B 2 3  ? -13.561 -6.507  -17.600 1.00 38.37 ? 3  ASN B OD1 1 
ATOM   197 N ND2 . ASN B 2 3  ? -15.009 -4.871  -18.113 1.00 23.34 ? 3  ASN B ND2 1 
ATOM   198 N N   . GLN B 2 4  ? -19.073 -7.514  -16.099 1.00 31.90 ? 4  GLN B N   1 
ATOM   199 C CA  . GLN B 2 4  ? -20.313 -8.287  -16.082 1.00 28.96 ? 4  GLN B CA  1 
ATOM   200 C C   . GLN B 2 4  ? -21.397 -7.521  -15.328 1.00 23.12 ? 4  GLN B C   1 
ATOM   201 O O   . GLN B 2 4  ? -21.154 -6.432  -14.812 1.00 26.67 ? 4  GLN B O   1 
ATOM   202 C CB  . GLN B 2 4  ? -20.079 -9.648  -15.425 1.00 33.50 ? 4  GLN B CB  1 
ATOM   203 C CG  . GLN B 2 4  ? -19.608 -9.556  -13.987 1.00 31.03 ? 4  GLN B CG  1 
ATOM   204 C CD  . GLN B 2 4  ? -19.344 -10.918 -13.379 1.00 54.72 ? 4  GLN B CD  1 
ATOM   205 O OE1 . GLN B 2 4  ? -20.210 -11.794 -13.390 1.00 51.79 ? 4  GLN B OE1 1 
ATOM   206 N NE2 . GLN B 2 4  ? -18.144 -11.105 -12.840 1.00 41.70 ? 4  GLN B NE2 1 
ATOM   207 N N   . HIS B 2 5  ? -22.599 -8.080  -15.281 1.00 25.17 ? 5  HIS B N   1 
ATOM   208 C CA  . HIS B 2 5  ? -23.666 -7.471  -14.503 1.00 26.87 ? 5  HIS B CA  1 
ATOM   209 C C   . HIS B 2 5  ? -23.358 -7.685  -13.035 1.00 26.33 ? 5  HIS B C   1 
ATOM   210 O O   . HIS B 2 5  ? -23.193 -8.822  -12.595 1.00 25.34 ? 5  HIS B O   1 
ATOM   211 C CB  . HIS B 2 5  ? -25.013 -8.109  -14.834 1.00 24.65 ? 5  HIS B CB  1 
ATOM   212 C CG  . HIS B 2 5  ? -25.462 -7.871  -16.239 1.00 27.43 ? 5  HIS B CG  1 
ATOM   213 N ND1 . HIS B 2 5  ? -26.235 -6.787  -16.598 1.00 29.87 ? 5  HIS B ND1 1 
ATOM   214 C CD2 . HIS B 2 5  ? -25.241 -8.570  -17.377 1.00 27.84 ? 5  HIS B CD2 1 
ATOM   215 C CE1 . HIS B 2 5  ? -26.478 -6.833  -17.896 1.00 24.52 ? 5  HIS B CE1 1 
ATOM   216 N NE2 . HIS B 2 5  ? -25.885 -7.905  -18.393 1.00 35.03 ? 5  HIS B NE2 1 
ATOM   217 N N   . LEU B 2 6  ? -23.267 -6.592  -12.287 1.00 22.69 ? 6  LEU B N   1 
ATOM   218 C CA  . LEU B 2 6  ? -22.974 -6.660  -10.862 1.00 21.06 ? 6  LEU B CA  1 
ATOM   219 C C   . LEU B 2 6  ? -24.052 -5.932  -10.079 1.00 21.50 ? 6  LEU B C   1 
ATOM   220 O O   . LEU B 2 6  ? -24.197 -4.715  -10.194 1.00 22.66 ? 6  LEU B O   1 
ATOM   221 C CB  . LEU B 2 6  ? -21.612 -6.034  -10.568 1.00 20.56 ? 6  LEU B CB  1 
ATOM   222 C CG  . LEU B 2 6  ? -20.418 -6.665  -11.281 1.00 20.16 ? 6  LEU B CG  1 
ATOM   223 C CD1 . LEU B 2 6  ? -19.190 -5.786  -11.103 1.00 20.54 ? 6  LEU B CD1 1 
ATOM   224 C CD2 . LEU B 2 6  ? -20.155 -8.064  -10.763 1.00 25.22 ? 6  LEU B CD2 1 
ATOM   225 N N   . CYS B 2 7  ? -24.800 -6.679  -9.273  1.00 20.58 ? 7  CYS B N   1 
ATOM   226 C CA  . CYS B 2 7  ? -25.899 -6.104  -8.513  1.00 22.46 ? 7  CYS B CA  1 
ATOM   227 C C   . CYS B 2 7  ? -25.754 -6.421  -7.034  1.00 22.72 ? 7  CYS B C   1 
ATOM   228 O O   . CYS B 2 7  ? -25.231 -7.471  -6.665  1.00 21.90 ? 7  CYS B O   1 
ATOM   229 C CB  . CYS B 2 7  ? -27.236 -6.664  -9.009  1.00 28.16 ? 7  CYS B CB  1 
ATOM   230 S SG  . CYS B 2 7  ? -27.554 -6.459  -10.788 1.00 29.45 ? 7  CYS B SG  1 
ATOM   231 N N   . GLY B 2 8  ? -26.229 -5.514  -6.191  1.00 21.36 ? 8  GLY B N   1 
ATOM   232 C CA  . GLY B 2 8  ? -26.233 -5.745  -4.759  1.00 22.98 ? 8  GLY B CA  1 
ATOM   233 C C   . GLY B 2 8  ? -24.859 -6.051  -4.209  1.00 20.91 ? 8  GLY B C   1 
ATOM   234 O O   . GLY B 2 8  ? -23.911 -5.316  -4.465  1.00 23.25 ? 8  GLY B O   1 
ATOM   235 N N   . SER B 2 9  ? -24.741 -7.136  -3.447  1.00 18.12 ? 9  SER B N   1 
ATOM   236 C CA  . SER B 2 9  ? -23.484 -7.444  -2.778  1.00 15.90 ? 9  SER B CA  1 
ATOM   237 C C   . SER B 2 9  ? -22.360 -7.702  -3.780  1.00 18.45 ? 9  SER B C   1 
ATOM   238 O O   . SER B 2 9  ? -21.183 -7.509  -3.473  1.00 17.21 ? 9  SER B O   1 
ATOM   239 C CB  . SER B 2 9  ? -23.648 -8.663  -1.863  1.00 19.34 ? 9  SER B CB  1 
ATOM   240 O OG  . SER B 2 9  ? -23.919 -9.813  -2.638  1.00 20.35 ? 9  SER B OG  1 
ATOM   241 N N   . HIS B 2 10 ? -22.730 -8.151  -4.972  1.00 14.91 ? 10 HIS B N   1 
ATOM   242 C CA  . HIS B 2 10 ? -21.764 -8.403  -6.039  1.00 17.86 ? 10 HIS B CA  1 
ATOM   243 C C   . HIS B 2 10 ? -21.093 -7.097  -6.470  1.00 18.59 ? 10 HIS B C   1 
ATOM   244 O O   . HIS B 2 10 ? -19.891 -7.055  -6.725  1.00 17.96 ? 10 HIS B O   1 
ATOM   245 C CB  . HIS B 2 10 ? -22.471 -9.047  -7.236  1.00 18.56 ? 10 HIS B CB  1 
ATOM   246 C CG  . HIS B 2 10 ? -23.081 -10.384 -6.933  1.00 23.08 ? 10 HIS B CG  1 
ATOM   247 N ND1 . HIS B 2 10 ? -23.461 -11.269 -7.919  1.00 27.72 ? 10 HIS B ND1 1 
ATOM   248 C CD2 . HIS B 2 10 ? -23.366 -10.990 -5.755  1.00 23.69 ? 10 HIS B CD2 1 
ATOM   249 C CE1 . HIS B 2 10 ? -23.951 -12.364 -7.363  1.00 29.56 ? 10 HIS B CE1 1 
ATOM   250 N NE2 . HIS B 2 10 ? -23.906 -12.220 -6.050  1.00 22.03 ? 10 HIS B NE2 1 
ATOM   251 N N   . LEU B 2 11 ? -21.886 -6.037  -6.550  1.00 16.34 ? 11 LEU B N   1 
ATOM   252 C CA  . LEU B 2 11 ? -21.398 -4.713  -6.938  1.00 16.50 ? 11 LEU B CA  1 
ATOM   253 C C   . LEU B 2 11 ? -20.523 -4.120  -5.847  1.00 19.44 ? 11 LEU B C   1 
ATOM   254 O O   . LEU B 2 11 ? -19.446 -3.585  -6.105  1.00 17.25 ? 11 LEU B O   1 
ATOM   255 C CB  . LEU B 2 11 ? -22.588 -3.788  -7.211  1.00 16.97 ? 11 LEU B CB  1 
ATOM   256 C CG  . LEU B 2 11 ? -22.268 -2.390  -7.735  1.00 22.79 ? 11 LEU B CG  1 
ATOM   257 C CD1 . LEU B 2 11 ? -21.211 -2.486  -8.812  1.00 17.51 ? 11 LEU B CD1 1 
ATOM   258 C CD2 . LEU B 2 11 ? -23.529 -1.754  -8.277  1.00 22.41 ? 11 LEU B CD2 1 
ATOM   259 N N   . VAL B 2 12 ? -20.990 -4.218  -4.610  1.00 15.40 ? 12 VAL B N   1 
ATOM   260 C CA  . VAL B 2 12 ? -20.242 -3.690  -3.490  1.00 13.81 ? 12 VAL B CA  1 
ATOM   261 C C   . VAL B 2 12 ? -18.902 -4.422  -3.332  1.00 15.23 ? 12 VAL B C   1 
ATOM   262 O O   . VAL B 2 12 ? -17.879 -3.825  -2.988  1.00 14.98 ? 12 VAL B O   1 
ATOM   263 C CB  . VAL B 2 12 ? -21.096 -3.776  -2.212  1.00 24.43 ? 12 VAL B CB  1 
ATOM   264 C CG1 . VAL B 2 12 ? -20.252 -3.609  -1.029  1.00 30.29 ? 12 VAL B CG1 1 
ATOM   265 C CG2 . VAL B 2 12 ? -22.169 -2.694  -2.241  1.00 21.29 ? 12 VAL B CG2 1 
ATOM   266 N N   . GLU B 2 13 ? -18.912 -5.721  -3.589  1.00 14.50 ? 13 GLU B N   1 
ATOM   267 C CA  . GLU B 2 13 ? -17.695 -6.515  -3.515  1.00 14.19 ? 13 GLU B CA  1 
ATOM   268 C C   . GLU B 2 13 ? -16.682 -6.056  -4.574  1.00 15.30 ? 13 GLU B C   1 
ATOM   269 O O   . GLU B 2 13 ? -15.481 -5.936  -4.304  1.00 16.00 ? 13 GLU B O   1 
ATOM   270 C CB  . GLU B 2 13 ? -18.046 -7.986  -3.712  1.00 22.91 ? 13 GLU B CB  1 
ATOM   271 C CG  . GLU B 2 13 ? -16.884 -8.875  -4.073  1.00 31.68 ? 13 GLU B CG  1 
ATOM   272 C CD  . GLU B 2 13 ? -17.296 -10.336 -4.139  1.00 35.29 ? 13 GLU B CD  1 
ATOM   273 O OE1 . GLU B 2 13 ? -17.726 -10.873 -3.092  1.00 24.65 ? 13 GLU B OE1 1 
ATOM   274 O OE2 . GLU B 2 13 ? -17.204 -10.932 -5.236  1.00 35.79 ? 13 GLU B OE2 1 
ATOM   275 N N   . ALA B 2 14 ? -17.166 -5.811  -5.782  1.00 16.94 ? 14 ALA B N   1 
ATOM   276 C CA  . ALA B 2 14 ? -16.298 -5.308  -6.856  1.00 19.02 ? 14 ALA B CA  1 
ATOM   277 C C   . ALA B 2 14 ? -15.701 -3.941  -6.523  1.00 17.95 ? 14 ALA B C   1 
ATOM   278 O O   . ALA B 2 14 ? -14.507 -3.704  -6.731  1.00 16.40 ? 14 ALA B O   1 
ATOM   279 C CB  . ALA B 2 14 ? -17.065 -5.240  -8.157  1.00 19.13 ? 14 ALA B CB  1 
ATOM   280 N N   . LEU B 2 15 ? -16.536 -3.036  -6.021  1.00 15.53 ? 15 LEU B N   1 
ATOM   281 C CA  . LEU B 2 15 ? -16.066 -1.724  -5.592  1.00 13.58 ? 15 LEU B CA  1 
ATOM   282 C C   . LEU B 2 15 ? -14.977 -1.846  -4.540  1.00 20.33 ? 15 LEU B C   1 
ATOM   283 O O   . LEU B 2 15 ? -13.957 -1.159  -4.594  1.00 17.96 ? 15 LEU B O   1 
ATOM   284 C CB  . LEU B 2 15 ? -17.228 -0.890  -5.054  1.00 17.56 ? 15 LEU B CB  1 
ATOM   285 C CG  . LEU B 2 15 ? -18.132 -0.253  -6.108  1.00 19.95 ? 15 LEU B CG  1 
ATOM   286 C CD1 . LEU B 2 15 ? -19.434 0.217   -5.476  1.00 19.70 ? 15 LEU B CD1 1 
ATOM   287 C CD2 . LEU B 2 15 ? -17.420 0.908   -6.806  1.00 19.43 ? 15 LEU B CD2 1 
ATOM   288 N N   . TYR B 2 16 ? -15.196 -2.733  -3.580  1.00 16.41 ? 16 TYR B N   1 
ATOM   289 C CA  . TYR B 2 16 ? -14.214 -2.982  -2.528  1.00 14.22 ? 16 TYR B CA  1 
ATOM   290 C C   . TYR B 2 16 ? -12.884 -3.467  -3.093  1.00 18.76 ? 16 TYR B C   1 
ATOM   291 O O   . TYR B 2 16 ? -11.823 -2.978  -2.708  1.00 14.92 ? 16 TYR B O   1 
ATOM   292 C CB  . TYR B 2 16 ? -14.766 -4.015  -1.551  1.00 13.58 ? 16 TYR B CB  1 
ATOM   293 C CG  . TYR B 2 16 ? -13.748 -4.582  -0.595  1.00 15.85 ? 16 TYR B CG  1 
ATOM   294 C CD1 . TYR B 2 16 ? -13.213 -3.811  0.431   1.00 19.91 ? 16 TYR B CD1 1 
ATOM   295 C CD2 . TYR B 2 16 ? -13.338 -5.909  -0.707  1.00 14.31 ? 16 TYR B CD2 1 
ATOM   296 C CE1 . TYR B 2 16 ? -12.290 -4.347  1.318   1.00 18.93 ? 16 TYR B CE1 1 
ATOM   297 C CE2 . TYR B 2 16 ? -12.419 -6.445  0.163   1.00 16.89 ? 16 TYR B CE2 1 
ATOM   298 C CZ  . TYR B 2 16 ? -11.899 -5.665  1.173   1.00 19.03 ? 16 TYR B CZ  1 
ATOM   299 O OH  . TYR B 2 16 ? -10.991 -6.225  2.037   1.00 19.26 ? 16 TYR B OH  1 
ATOM   300 N N   . LEU B 2 17 ? -12.941 -4.437  -4.002  1.00 17.26 ? 17 LEU B N   1 
ATOM   301 C CA  . LEU B 2 17 ? -11.725 -4.998  -4.583  1.00 17.15 ? 17 LEU B CA  1 
ATOM   302 C C   . LEU B 2 17 ? -10.983 -3.979  -5.439  1.00 20.48 ? 17 LEU B C   1 
ATOM   303 O O   . LEU B 2 17 ? -9.751  -3.889  -5.407  1.00 20.37 ? 17 LEU B O   1 
ATOM   304 C CB  . LEU B 2 17 ? -12.060 -6.221  -5.428  1.00 16.44 ? 17 LEU B CB  1 
ATOM   305 C CG  . LEU B 2 17 ? -12.491 -7.468  -4.651  1.00 17.44 ? 17 LEU B CG  1 
ATOM   306 C CD1 . LEU B 2 17 ? -12.867 -8.590  -5.593  1.00 22.58 ? 17 LEU B CD1 1 
ATOM   307 C CD2 . LEU B 2 17 ? -11.383 -7.898  -3.717  1.00 22.13 ? 17 LEU B CD2 1 
ATOM   308 N N   . VAL B 2 18 ? -11.738 -3.226  -6.224  1.00 18.15 ? 18 VAL B N   1 
ATOM   309 C CA  . VAL B 2 18 ? -11.150 -2.270  -7.151  1.00 18.50 ? 18 VAL B CA  1 
ATOM   310 C C   . VAL B 2 18 ? -10.557 -1.063  -6.431  1.00 22.53 ? 18 VAL B C   1 
ATOM   311 O O   . VAL B 2 18 ? -9.454  -0.628  -6.747  1.00 21.63 ? 18 VAL B O   1 
ATOM   312 C CB  . VAL B 2 18 ? -12.188 -1.824  -8.207  1.00 19.51 ? 18 VAL B CB  1 
ATOM   313 C CG1 . VAL B 2 18 ? -11.714 -0.594  -8.955  1.00 28.07 ? 18 VAL B CG1 1 
ATOM   314 C CG2 . VAL B 2 18 ? -12.468 -2.973  -9.165  1.00 23.98 ? 18 VAL B CG2 1 
ATOM   315 N N   . CYS B 2 19 ? -11.268 -0.548  -5.433  1.00 19.45 ? 19 CYS B N   1 
ATOM   316 C CA  . CYS B 2 19 ? -10.874 0.709   -4.803  1.00 21.28 ? 19 CYS B CA  1 
ATOM   317 C C   . CYS B 2 19 ? -9.819  0.588   -3.702  1.00 26.60 ? 19 CYS B C   1 
ATOM   318 O O   . CYS B 2 19 ? -9.167  1.576   -3.355  1.00 25.82 ? 19 CYS B O   1 
ATOM   319 C CB  . CYS B 2 19 ? -12.102 1.455   -4.285  1.00 20.90 ? 19 CYS B CB  1 
ATOM   320 S SG  . CYS B 2 19 ? -13.231 1.932   -5.593  1.00 21.21 ? 19 CYS B SG  1 
ATOM   321 N N   . GLY B 2 20 ? -9.653  -0.608  -3.150  1.00 25.20 ? 20 GLY B N   1 
ATOM   322 C CA  . GLY B 2 20 ? -8.606  -0.825  -2.167  1.00 33.63 ? 20 GLY B CA  1 
ATOM   323 C C   . GLY B 2 20 ? -8.661  0.162   -1.014  1.00 39.29 ? 20 GLY B C   1 
ATOM   324 O O   . GLY B 2 20 ? -9.737  0.464   -0.501  1.00 27.87 ? 20 GLY B O   1 
ATOM   325 N N   . GLU B 2 21 ? -7.507  0.678   -0.599  1.00 30.38 ? 21 GLU B N   1 
ATOM   326 C CA  . GLU B 2 21 ? -7.474  1.534   0.591   1.00 34.13 ? 21 GLU B CA  1 
ATOM   327 C C   . GLU B 2 21 ? -8.014  2.944   0.351   1.00 23.63 ? 21 GLU B C   1 
ATOM   328 O O   . GLU B 2 21 ? -8.123  3.737   1.283   1.00 35.45 ? 21 GLU B O   1 
ATOM   329 C CB  . GLU B 2 21 ? -6.075  1.569   1.220   1.00 45.91 ? 21 GLU B CB  1 
ATOM   330 C CG  . GLU B 2 21 ? -5.015  2.280   0.401   1.00 57.50 ? 21 GLU B CG  1 
ATOM   331 C CD  . GLU B 2 21 ? -3.631  2.179   1.034   1.00 75.22 ? 21 GLU B CD  1 
ATOM   332 O OE1 . GLU B 2 21 ? -2.707  2.876   0.563   1.00 79.46 ? 21 GLU B OE1 1 
ATOM   333 O OE2 . GLU B 2 21 ? -3.470  1.401   2.002   1.00 57.31 ? 21 GLU B OE2 1 
ATOM   334 N N   . ARG B 2 22 ? -8.356  3.251   -0.897  1.00 27.41 ? 22 ARG B N   1 
ATOM   335 C CA  . ARG B 2 22 ? -9.040  4.498   -1.213  1.00 28.81 ? 22 ARG B CA  1 
ATOM   336 C C   . ARG B 2 22 ? -10.456 4.461   -0.645  1.00 33.76 ? 22 ARG B C   1 
ATOM   337 O O   . ARG B 2 22 ? -11.008 5.480   -0.235  1.00 31.35 ? 22 ARG B O   1 
ATOM   338 C CB  . ARG B 2 22 ? -9.130  4.700   -2.726  1.00 30.48 ? 22 ARG B CB  1 
ATOM   339 C CG  . ARG B 2 22 ? -7.876  5.228   -3.400  1.00 38.41 ? 22 ARG B CG  1 
ATOM   340 C CD  . ARG B 2 22 ? -8.072  5.288   -4.922  1.00 44.34 ? 22 ARG B CD  1 
ATOM   341 N NE  . ARG B 2 22 ? -8.003  3.963   -5.546  1.00 61.53 ? 22 ARG B NE  1 
ATOM   342 C CZ  . ARG B 2 22 ? -8.246  3.711   -6.833  1.00 56.00 ? 22 ARG B CZ  1 
ATOM   343 N NH1 . ARG B 2 22 ? -8.151  2.467   -7.288  1.00 37.21 ? 22 ARG B NH1 1 
ATOM   344 N NH2 . ARG B 2 22 ? -8.588  4.690   -7.664  1.00 33.73 ? 22 ARG B NH2 1 
ATOM   345 N N   . GLY B 2 23 ? -11.048 3.276   -0.627  1.00 23.72 ? 23 GLY B N   1 
ATOM   346 C CA  . GLY B 2 23 ? -12.442 3.151   -0.243  1.00 25.22 ? 23 GLY B CA  1 
ATOM   347 C C   . GLY B 2 23 ? -13.323 3.633   -1.376  1.00 26.84 ? 23 GLY B C   1 
ATOM   348 O O   . GLY B 2 23 ? -12.832 3.954   -2.460  1.00 20.71 ? 23 GLY B O   1 
ATOM   349 N N   . PHE B 2 24 ? -14.625 3.700   -1.132  1.00 18.98 ? 24 PHE B N   1 
ATOM   350 C CA  . PHE B 2 24 ? -15.558 4.055   -2.188  1.00 17.55 ? 24 PHE B CA  1 
ATOM   351 C C   . PHE B 2 24 ? -16.875 4.561   -1.614  1.00 23.50 ? 24 PHE B C   1 
ATOM   352 O O   . PHE B 2 24 ? -17.092 4.530   -0.402  1.00 24.02 ? 24 PHE B O   1 
ATOM   353 C CB  . PHE B 2 24 ? -15.811 2.837   -3.086  1.00 17.36 ? 24 PHE B CB  1 
ATOM   354 C CG  . PHE B 2 24 ? -16.428 1.661   -2.361  1.00 19.89 ? 24 PHE B CG  1 
ATOM   355 C CD1 . PHE B 2 24 ? -15.628 0.691   -1.776  1.00 18.48 ? 24 PHE B CD1 1 
ATOM   356 C CD2 . PHE B 2 24 ? -17.811 1.527   -2.269  1.00 22.89 ? 24 PHE B CD2 1 
ATOM   357 C CE1 . PHE B 2 24 ? -16.189 -0.390  -1.107  1.00 21.90 ? 24 PHE B CE1 1 
ATOM   358 C CE2 . PHE B 2 24 ? -18.378 0.446   -1.597  1.00 19.48 ? 24 PHE B CE2 1 
ATOM   359 C CZ  . PHE B 2 24 ? -17.562 -0.513  -1.015  1.00 19.73 ? 24 PHE B CZ  1 
ATOM   360 N N   . PHE B 2 25 ? -17.742 5.048   -2.487  1.00 23.02 ? 25 PHE B N   1 
ATOM   361 C CA  . PHE B 2 25 ? -19.108 5.343   -2.088  1.00 26.05 ? 25 PHE B CA  1 
ATOM   362 C C   . PHE B 2 25 ? -20.081 4.558   -2.948  1.00 29.87 ? 25 PHE B C   1 
ATOM   363 O O   . PHE B 2 25 ? -19.912 4.448   -4.158  1.00 25.71 ? 25 PHE B O   1 
ATOM   364 C CB  . PHE B 2 25 ? -19.410 6.848   -2.118  1.00 30.50 ? 25 PHE B CB  1 
ATOM   365 C CG  . PHE B 2 25 ? -19.035 7.523   -3.399  1.00 36.46 ? 25 PHE B CG  1 
ATOM   366 C CD1 . PHE B 2 25 ? -17.729 7.929   -3.625  1.00 41.85 ? 25 PHE B CD1 1 
ATOM   367 C CD2 . PHE B 2 25 ? -19.989 7.772   -4.374  1.00 47.50 ? 25 PHE B CD2 1 
ATOM   368 C CE1 . PHE B 2 25 ? -17.376 8.562   -4.808  1.00 51.84 ? 25 PHE B CE1 1 
ATOM   369 C CE2 . PHE B 2 25 ? -19.645 8.407   -5.560  1.00 37.96 ? 25 PHE B CE2 1 
ATOM   370 C CZ  . PHE B 2 25 ? -18.336 8.802   -5.778  1.00 47.77 ? 25 PHE B CZ  1 
ATOM   371 N N   . TYR B 2 26 ? -21.090 3.991   -2.301  1.00 26.11 ? 26 TYR B N   1 
ATOM   372 C CA  . TYR B 2 26 ? -22.087 3.184   -2.976  1.00 19.37 ? 26 TYR B CA  1 
ATOM   373 C C   . TYR B 2 26 ? -23.429 3.866   -2.826  1.00 26.37 ? 26 TYR B C   1 
ATOM   374 O O   . TYR B 2 26 ? -23.966 3.954   -1.726  1.00 25.08 ? 26 TYR B O   1 
ATOM   375 C CB  . TYR B 2 26 ? -22.136 1.795   -2.350  1.00 18.99 ? 26 TYR B CB  1 
ATOM   376 C CG  . TYR B 2 26 ? -23.255 0.930   -2.876  1.00 21.56 ? 26 TYR B CG  1 
ATOM   377 C CD1 . TYR B 2 26 ? -24.280 0.506   -2.042  1.00 24.62 ? 26 TYR B CD1 1 
ATOM   378 C CD2 . TYR B 2 26 ? -23.285 0.533   -4.203  1.00 23.44 ? 26 TYR B CD2 1 
ATOM   379 C CE1 . TYR B 2 26 ? -25.304 -0.295  -2.516  1.00 26.30 ? 26 TYR B CE1 1 
ATOM   380 C CE2 . TYR B 2 26 ? -24.304 -0.265  -4.690  1.00 25.09 ? 26 TYR B CE2 1 
ATOM   381 C CZ  . TYR B 2 26 ? -25.313 -0.675  -3.842  1.00 27.86 ? 26 TYR B CZ  1 
ATOM   382 O OH  . TYR B 2 26 ? -26.328 -1.469  -4.320  1.00 29.25 ? 26 TYR B OH  1 
ATOM   383 N N   . THR B 2 27 ? -23.960 4.365   -3.936  1.00 28.14 ? 27 THR B N   1 
ATOM   384 C CA  . THR B 2 27 ? -25.185 5.147   -3.909  1.00 37.14 ? 27 THR B CA  1 
ATOM   385 C C   . THR B 2 27 ? -26.169 4.594   -4.936  1.00 32.53 ? 27 THR B C   1 
ATOM   386 O O   . THR B 2 27 ? -26.193 5.035   -6.082  1.00 36.20 ? 27 THR B O   1 
ATOM   387 C CB  . THR B 2 27 ? -24.889 6.637   -4.188  1.00 36.89 ? 27 THR B CB  1 
ATOM   388 O OG1 . THR B 2 27 ? -24.271 6.772   -5.473  1.00 57.47 ? 27 THR B OG1 1 
ATOM   389 C CG2 . THR B 2 27 ? -23.936 7.182   -3.151  1.00 33.01 ? 27 THR B CG2 1 
ATOM   390 N N   . PRO B 2 28 ? -26.989 3.620   -4.517  1.00 29.25 ? 28 PRO B N   1 
ATOM   391 C CA  . PRO B 2 28 ? -27.893 2.887   -5.411  1.00 32.94 ? 28 PRO B CA  1 
ATOM   392 C C   . PRO B 2 28 ? -29.081 3.726   -5.872  1.00 32.76 ? 28 PRO B C   1 
ATOM   393 O O   . PRO B 2 28 ? -29.671 3.417   -6.908  1.00 36.05 ? 28 PRO B O   1 
ATOM   394 C CB  . PRO B 2 28 ? -28.401 1.730   -4.542  1.00 31.48 ? 28 PRO B CB  1 
ATOM   395 C CG  . PRO B 2 28 ? -27.658 1.813   -3.247  1.00 28.54 ? 28 PRO B CG  1 
ATOM   396 C CD  . PRO B 2 28 ? -27.128 3.190   -3.118  1.00 34.39 ? 28 PRO B CD  1 
ATOM   397 N N   . LYS B 2 29 ? -29.436 4.751   -5.105  1.00 34.79 ? 29 LYS B N   1 
ATOM   398 C CA  . LYS B 2 29 ? -30.532 5.642   -5.483  1.00 49.07 ? 29 LYS B CA  1 
ATOM   399 C C   . LYS B 2 29 ? -30.051 6.834   -6.309  1.00 63.70 ? 29 LYS B C   1 
ATOM   400 O O   . LYS B 2 29 ? -30.669 7.191   -7.315  1.00 73.47 ? 29 LYS B O   1 
ATOM   401 C CB  . LYS B 2 29 ? -31.305 6.122   -4.251  1.00 62.86 ? 29 LYS B CB  1 
ATOM   402 C CG  . LYS B 2 29 ? -32.706 5.526   -4.105  1.00 74.15 ? 29 LYS B CG  1 
ATOM   403 C CD  . LYS B 2 29 ? -32.690 4.118   -3.525  1.00 72.32 ? 29 LYS B CD  1 
ATOM   404 C CE  . LYS B 2 29 ? -32.356 3.061   -4.572  1.00 68.55 ? 29 LYS B CE  1 
ATOM   405 N NZ  . LYS B 2 29 ? -33.458 2.854   -5.553  1.00 59.40 ? 29 LYS B NZ  1 
ATOM   406 N N   . ALA B 2 30 ? -28.950 7.446   -5.884  1.00 72.05 ? 30 ALA B N   1 
ATOM   407 C CA  . ALA B 2 30 ? -28.366 8.568   -6.616  1.00 74.07 ? 30 ALA B CA  1 
ATOM   408 C C   . ALA B 2 30 ? -27.782 8.115   -7.955  1.00 73.01 ? 30 ALA B C   1 
ATOM   409 O O   . ALA B 2 30 ? -27.485 8.928   -8.831  1.00 64.47 ? 30 ALA B O   1 
ATOM   410 C CB  . ALA B 2 30 ? -27.302 9.269   -5.772  1.00 56.14 ? 30 ALA B CB  1 
ATOM   411 O OXT . ALA B 2 30 ? -27.594 6.921   -8.197  1.00 73.19 ? 30 ALA B OXT 1 
HETATM 412 O O   . HOH C 3 .  ? -29.500 -7.696  -14.149 1.00 50.68 ? 22 HOH A O   1 
HETATM 413 O O   . HOH C 3 .  ? -11.374 10.214  -16.391 1.00 40.62 ? 23 HOH A O   1 
HETATM 414 O O   . HOH C 3 .  ? -11.187 9.560   -19.007 1.00 44.09 ? 24 HOH A O   1 
HETATM 415 O O   . HOH C 3 .  ? -22.708 -0.422  -18.245 1.00 25.03 ? 25 HOH A O   1 
HETATM 416 O O   . HOH C 3 .  ? -17.282 8.923   0.122   1.00 44.14 ? 26 HOH A O   1 
HETATM 417 O O   . HOH C 3 .  ? -27.802 -5.289  -20.151 1.00 41.02 ? 27 HOH A O   1 
HETATM 418 O O   . HOH C 3 .  ? -13.732 9.674   -11.684 1.00 48.35 ? 28 HOH A O   1 
HETATM 419 O O   . HOH C 3 .  ? -26.166 6.685   -14.912 1.00 50.84 ? 29 HOH A O   1 
HETATM 420 O O   . HOH C 3 .  ? -30.826 -5.812  -17.868 1.00 54.11 ? 30 HOH A O   1 
HETATM 421 O O   . HOH C 3 .  ? -14.803 9.989   -8.715  1.00 62.79 ? 31 HOH A O   1 
HETATM 422 O O   . HOH C 3 .  ? -19.609 9.964   -9.626  1.00 46.30 ? 32 HOH A O   1 
HETATM 423 O O   . HOH C 3 .  ? -13.690 11.749  -14.300 1.00 49.90 ? 33 HOH A O   1 
HETATM 424 O O   . HOH D 3 .  ? -24.729 10.263  -12.014 1.00 61.01 ? 31 HOH B O   1 
HETATM 425 O O   . HOH D 3 .  ? -20.724 -10.273 -19.319 1.00 52.72 ? 32 HOH B O   1 
HETATM 426 O O   . HOH D 3 .  ? -17.700 -13.422 -2.674  1.00 25.54 ? 33 HOH B O   1 
HETATM 427 O O   . HOH D 3 .  ? -28.494 10.301  -14.536 1.00 56.88 ? 34 HOH B O   1 
HETATM 428 O O   . HOH D 3 .  ? -24.545 6.027   -8.162  1.00 32.84 ? 35 HOH B O   1 
HETATM 429 O O   . HOH D 3 .  ? -27.182 -2.924  -7.024  1.00 27.65 ? 36 HOH B O   1 
HETATM 430 O O   . HOH D 3 .  ? -24.782 -9.599  -9.935  1.00 26.60 ? 37 HOH B O   1 
HETATM 431 O O   . HOH D 3 .  ? -14.505 -9.421  -15.869 1.00 44.83 ? 38 HOH B O   1 
HETATM 432 O O   . HOH D 3 .  ? -28.442 -1.829  -2.831  1.00 43.18 ? 39 HOH B O   1 
HETATM 433 O O   . HOH D 3 .  ? -12.046 -0.492  -0.930  1.00 25.29 ? 40 HOH B O   1 
HETATM 434 O O   . HOH D 3 .  ? -18.702 -9.557  -7.601  1.00 29.84 ? 41 HOH B O   1 
HETATM 435 O O   . HOH D 3 .  ? -8.200  -0.632  -9.134  1.00 32.65 ? 42 HOH B O   1 
HETATM 436 O O   . HOH D 3 .  ? -15.277 -10.853 -7.465  1.00 43.14 ? 43 HOH B O   1 
HETATM 437 O O   . HOH D 3 .  ? -22.107 4.402   -6.065  1.00 31.09 ? 44 HOH B O   1 
HETATM 438 O O   . HOH D 3 .  ? -5.206  0.010   -2.235  1.00 43.01 ? 45 HOH B O   1 
HETATM 439 O O   . HOH D 3 .  ? -26.729 -9.715  -6.146  1.00 30.80 ? 46 HOH B O   1 
HETATM 440 O O   . HOH D 3 .  ? -27.875 3.972   -9.042  1.00 40.15 ? 47 HOH B O   1 
HETATM 441 O O   . HOH D 3 .  ? -20.453 -7.642  -0.550  1.00 34.77 ? 48 HOH B O   1 
HETATM 442 O O   . HOH D 3 .  ? -17.760 -10.041 -0.552  1.00 37.12 ? 49 HOH B O   1 
HETATM 443 O O   . HOH D 3 .  ? -22.932 -10.505 -16.556 1.00 47.78 ? 50 HOH B O   1 
HETATM 444 O O   . HOH D 3 .  ? -28.195 5.830   -2.571  1.00 53.39 ? 51 HOH B O   1 
HETATM 445 O O   . HOH D 3 .  ? -17.118 -11.123 -18.586 1.00 52.94 ? 52 HOH B O   1 
HETATM 446 O O   . HOH D 3 .  ? -27.581 8.994   -11.659 1.00 53.89 ? 53 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
B 2 1  PHE 1  1  1  PHE PHE B . n 
B 2 2  VAL 2  2  2  VAL VAL B . n 
B 2 3  ASN 3  3  3  ASN ASN B . n 
B 2 4  GLN 4  4  4  GLN GLN B . n 
B 2 5  HIS 5  5  5  HIS HIS B . n 
B 2 6  LEU 6  6  6  LEU LEU B . n 
B 2 7  CYS 7  7  7  CYS CYS B . n 
B 2 8  GLY 8  8  8  GLY GLY B . n 
B 2 9  SER 9  9  9  SER SER B . n 
B 2 10 HIS 10 10 10 HIS HIS B . n 
B 2 11 LEU 11 11 11 LEU LEU B . n 
B 2 12 VAL 12 12 12 VAL VAL B . n 
B 2 13 GLU 13 13 13 GLU GLU B . n 
B 2 14 ALA 14 14 14 ALA ALA B . n 
B 2 15 LEU 15 15 15 LEU LEU B . n 
B 2 16 TYR 16 16 16 TYR TYR B . n 
B 2 17 LEU 17 17 17 LEU LEU B . n 
B 2 18 VAL 18 18 18 VAL VAL B . n 
B 2 19 CYS 19 19 19 CYS CYS B . n 
B 2 20 GLY 20 20 20 GLY GLY B . n 
B 2 21 GLU 21 21 21 GLU GLU B . n 
B 2 22 ARG 22 22 22 ARG ARG B . n 
B 2 23 GLY 23 23 23 GLY GLY B . n 
B 2 24 PHE 24 24 24 PHE PHE B . n 
B 2 25 PHE 25 25 25 PHE PHE B . n 
B 2 26 TYR 26 26 26 TYR TYR B . n 
B 2 27 THR 27 27 27 THR THR B . n 
B 2 28 PRO 28 28 28 PRO PRO B . n 
B 2 29 LYS 29 29 29 LYS LYS B . n 
B 2 30 ALA 30 30 30 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  22 22 HOH HOH A . 
C 3 HOH 2  23 23 HOH HOH A . 
C 3 HOH 3  24 24 HOH HOH A . 
C 3 HOH 4  25 8  HOH HOH A . 
C 3 HOH 5  26 9  HOH HOH A . 
C 3 HOH 6  27 16 HOH HOH A . 
C 3 HOH 7  28 28 HOH HOH A . 
C 3 HOH 8  29 18 HOH HOH A . 
C 3 HOH 9  30 30 HOH HOH A . 
C 3 HOH 10 31 21 HOH HOH A . 
C 3 HOH 11 32 1  HOH HOH A . 
C 3 HOH 12 33 33 HOH HOH A . 
D 3 HOH 1  31 31 HOH HOH B . 
D 3 HOH 2  32 32 HOH HOH B . 
D 3 HOH 3  33 1  HOH HOH B . 
D 3 HOH 4  34 34 HOH HOH B . 
D 3 HOH 5  35 2  HOH HOH B . 
D 3 HOH 6  36 3  HOH HOH B . 
D 3 HOH 7  37 4  HOH HOH B . 
D 3 HOH 8  38 5  HOH HOH B . 
D 3 HOH 9  39 6  HOH HOH B . 
D 3 HOH 10 40 7  HOH HOH B . 
D 3 HOH 11 41 10 HOH HOH B . 
D 3 HOH 12 42 11 HOH HOH B . 
D 3 HOH 13 43 12 HOH HOH B . 
D 3 HOH 14 44 13 HOH HOH B . 
D 3 HOH 15 45 14 HOH HOH B . 
D 3 HOH 16 46 15 HOH HOH B . 
D 3 HOH 17 47 17 HOH HOH B . 
D 3 HOH 18 48 19 HOH HOH B . 
D 3 HOH 19 49 20 HOH HOH B . 
D 3 HOH 20 50 25 HOH HOH B . 
D 3 HOH 21 51 26 HOH HOH B . 
D 3 HOH 22 52 27 HOH HOH B . 
D 3 HOH 23 53 29 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1520 ? 
1 MORE         -14  ? 
1 'SSA (A^2)'  3380 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-01-05 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2014-04-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(phenix.refine)' ? 1 
DENZO  'data reduction' .                 ? 2 
# 
_pdbx_entry_details.entry_id             3I40 
_pdbx_entry_details.sequence_details     'THE CONFLICT OF THE SEQUENCE MAY DUE TO ARTIFACT.' 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#