data_3I5D
# 
_entry.id   3I5D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3I5D         pdb_00003i5d 10.2210/pdb3i5d/pdb 
RCSB  RCSB053984   ?            ?                   
WWPDB D_1000053984 ?            ?                   
# 
_pdbx_database_status.entry_id                        3I5D 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-05 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kawate, T.'   1 
'Michel, J.C.' 2 
'Gouaux, E.'   3 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the ATP-gated P2X(4) ion channel in the closed state.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            460 
_citation.page_first                592 
_citation.page_last                 598 
_citation.year                      2009 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19641588 
_citation.pdbx_database_id_DOI      10.1038/nature08198 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kawate, T.'     1 ? 
primary 'Michel, J.C.'   2 ? 
primary 'Birdsong, W.T.' 3 ? 
primary 'Gouaux, E.'     4 ? 
# 
_cell.length_a           234.910 
_cell.length_b           234.910 
_cell.length_c           138.433 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3I5D 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              27 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.entry_id                         3I5D 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                146 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'P2X purinoceptor'                                                                        40194.805 3  ? H252R 
'UNP residues 28-381' ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2  ? ?     ? 
? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   10 ? ?     ? 
? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVL
TNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADA
ENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCD
LDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAG
LALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVL
TNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADA
ENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCD
LDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAG
LALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDF
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   LYS n 
1 5   LYS n 
1 6   VAL n 
1 7   GLY n 
1 8   THR n 
1 9   LEU n 
1 10  ASN n 
1 11  ARG n 
1 12  PHE n 
1 13  THR n 
1 14  GLN n 
1 15  ALA n 
1 16  LEU n 
1 17  VAL n 
1 18  ILE n 
1 19  ALA n 
1 20  TYR n 
1 21  VAL n 
1 22  ILE n 
1 23  GLY n 
1 24  TYR n 
1 25  VAL n 
1 26  CYS n 
1 27  VAL n 
1 28  TYR n 
1 29  ASN n 
1 30  LYS n 
1 31  GLY n 
1 32  TYR n 
1 33  GLN n 
1 34  ASP n 
1 35  THR n 
1 36  ASP n 
1 37  THR n 
1 38  VAL n 
1 39  LEU n 
1 40  SER n 
1 41  SER n 
1 42  VAL n 
1 43  THR n 
1 44  THR n 
1 45  LYS n 
1 46  VAL n 
1 47  LYS n 
1 48  GLY n 
1 49  ILE n 
1 50  ALA n 
1 51  LEU n 
1 52  THR n 
1 53  ASN n 
1 54  THR n 
1 55  SER n 
1 56  GLU n 
1 57  LEU n 
1 58  GLY n 
1 59  GLU n 
1 60  ARG n 
1 61  ILE n 
1 62  TRP n 
1 63  ASP n 
1 64  VAL n 
1 65  ALA n 
1 66  ASP n 
1 67  TYR n 
1 68  ILE n 
1 69  ILE n 
1 70  PRO n 
1 71  PRO n 
1 72  GLN n 
1 73  GLU n 
1 74  ASP n 
1 75  GLY n 
1 76  SER n 
1 77  PHE n 
1 78  PHE n 
1 79  VAL n 
1 80  LEU n 
1 81  THR n 
1 82  ASN n 
1 83  MET n 
1 84  ILE n 
1 85  ILE n 
1 86  THR n 
1 87  THR n 
1 88  ASN n 
1 89  GLN n 
1 90  THR n 
1 91  GLN n 
1 92  SER n 
1 93  LYS n 
1 94  CYS n 
1 95  ALA n 
1 96  GLU n 
1 97  ASN n 
1 98  PRO n 
1 99  THR n 
1 100 PRO n 
1 101 ALA n 
1 102 SER n 
1 103 THR n 
1 104 CYS n 
1 105 THR n 
1 106 SER n 
1 107 HIS n 
1 108 ARG n 
1 109 ASP n 
1 110 CYS n 
1 111 LYS n 
1 112 ARG n 
1 113 GLY n 
1 114 PHE n 
1 115 ASN n 
1 116 ASP n 
1 117 ALA n 
1 118 ARG n 
1 119 GLY n 
1 120 ASP n 
1 121 GLY n 
1 122 VAL n 
1 123 ARG n 
1 124 THR n 
1 125 GLY n 
1 126 ARG n 
1 127 CYS n 
1 128 VAL n 
1 129 SER n 
1 130 TYR n 
1 131 SER n 
1 132 ALA n 
1 133 SER n 
1 134 VAL n 
1 135 LYS n 
1 136 THR n 
1 137 CYS n 
1 138 GLU n 
1 139 VAL n 
1 140 LEU n 
1 141 SER n 
1 142 TRP n 
1 143 CYS n 
1 144 PRO n 
1 145 LEU n 
1 146 GLU n 
1 147 LYS n 
1 148 ILE n 
1 149 VAL n 
1 150 ASP n 
1 151 PRO n 
1 152 PRO n 
1 153 ASN n 
1 154 PRO n 
1 155 PRO n 
1 156 LEU n 
1 157 LEU n 
1 158 ALA n 
1 159 ASP n 
1 160 ALA n 
1 161 GLU n 
1 162 ASN n 
1 163 PHE n 
1 164 THR n 
1 165 VAL n 
1 166 LEU n 
1 167 ILE n 
1 168 LYS n 
1 169 ASN n 
1 170 ASN n 
1 171 ILE n 
1 172 ARG n 
1 173 TYR n 
1 174 PRO n 
1 175 LYS n 
1 176 PHE n 
1 177 ASN n 
1 178 PHE n 
1 179 ASN n 
1 180 LYS n 
1 181 ARG n 
1 182 ASN n 
1 183 ILE n 
1 184 LEU n 
1 185 PRO n 
1 186 ASN n 
1 187 ILE n 
1 188 ASN n 
1 189 SER n 
1 190 SER n 
1 191 TYR n 
1 192 LEU n 
1 193 THR n 
1 194 HIS n 
1 195 CYS n 
1 196 VAL n 
1 197 PHE n 
1 198 SER n 
1 199 ARG n 
1 200 LYS n 
1 201 THR n 
1 202 ASP n 
1 203 PRO n 
1 204 ASP n 
1 205 CYS n 
1 206 PRO n 
1 207 ILE n 
1 208 PHE n 
1 209 ARG n 
1 210 LEU n 
1 211 GLY n 
1 212 ASP n 
1 213 ILE n 
1 214 VAL n 
1 215 GLY n 
1 216 GLU n 
1 217 ALA n 
1 218 GLU n 
1 219 GLU n 
1 220 ASP n 
1 221 PHE n 
1 222 GLN n 
1 223 ILE n 
1 224 MET n 
1 225 ALA n 
1 226 VAL n 
1 227 ARG n 
1 228 GLY n 
1 229 GLY n 
1 230 VAL n 
1 231 MET n 
1 232 GLY n 
1 233 VAL n 
1 234 GLN n 
1 235 ILE n 
1 236 ARG n 
1 237 TRP n 
1 238 ASP n 
1 239 CYS n 
1 240 ASP n 
1 241 LEU n 
1 242 ASP n 
1 243 MET n 
1 244 PRO n 
1 245 GLN n 
1 246 SER n 
1 247 TRP n 
1 248 CYS n 
1 249 VAL n 
1 250 PRO n 
1 251 ARG n 
1 252 TYR n 
1 253 THR n 
1 254 PHE n 
1 255 ARG n 
1 256 ARG n 
1 257 LEU n 
1 258 ASP n 
1 259 ASN n 
1 260 LYS n 
1 261 ASP n 
1 262 PRO n 
1 263 ASP n 
1 264 ASN n 
1 265 ASN n 
1 266 VAL n 
1 267 ALA n 
1 268 PRO n 
1 269 GLY n 
1 270 TYR n 
1 271 ASN n 
1 272 PHE n 
1 273 ARG n 
1 274 PHE n 
1 275 ALA n 
1 276 LYS n 
1 277 TYR n 
1 278 TYR n 
1 279 LYS n 
1 280 ASN n 
1 281 SER n 
1 282 ASP n 
1 283 GLY n 
1 284 THR n 
1 285 GLU n 
1 286 THR n 
1 287 ARG n 
1 288 THR n 
1 289 LEU n 
1 290 ILE n 
1 291 LYS n 
1 292 GLY n 
1 293 TYR n 
1 294 GLY n 
1 295 ILE n 
1 296 ARG n 
1 297 PHE n 
1 298 ASP n 
1 299 VAL n 
1 300 MET n 
1 301 VAL n 
1 302 PHE n 
1 303 GLY n 
1 304 GLN n 
1 305 ALA n 
1 306 GLY n 
1 307 LYS n 
1 308 PHE n 
1 309 ASN n 
1 310 ILE n 
1 311 ILE n 
1 312 PRO n 
1 313 THR n 
1 314 LEU n 
1 315 LEU n 
1 316 ASN n 
1 317 ILE n 
1 318 GLY n 
1 319 ALA n 
1 320 GLY n 
1 321 LEU n 
1 322 ALA n 
1 323 LEU n 
1 324 LEU n 
1 325 GLY n 
1 326 LEU n 
1 327 VAL n 
1 328 ASN n 
1 329 VAL n 
1 330 ILE n 
1 331 CYS n 
1 332 ASP n 
1 333 TRP n 
1 334 ILE n 
1 335 VAL n 
1 336 LEU n 
1 337 THR n 
1 338 PHE n 
1 339 MET n 
1 340 LYS n 
1 341 ARG n 
1 342 LYS n 
1 343 GLN n 
1 344 HIS n 
1 345 TYR n 
1 346 LYS n 
1 347 GLU n 
1 348 GLN n 
1 349 LYS n 
1 350 TYR n 
1 351 THR n 
1 352 TYR n 
1 353 VAL n 
1 354 ASP n 
1 355 ASP n 
1 356 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'leopard danio,zebra danio,zebra fish' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'p2rx4a, P2X4.1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Danio rerio' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7955 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Sf9 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          bacmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFastBac 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q6NYR1_DANRE 
_struct_ref.pdbx_db_accession          Q6NYR1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTN
MIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAEN
FTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVHGGVMGVQIRWDCDLD
MPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLA
LLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDF
;
_struct_ref.pdbx_align_begin           28 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I5D A 3 ? 356 ? Q6NYR1 28 ? 381 ? 28 381 
2 1 3I5D B 3 ? 356 ? Q6NYR1 28 ? 381 ? 28 381 
3 1 3I5D C 3 ? 356 ? Q6NYR1 28 ? 381 ? 28 381 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I5D GLY A 1   ? UNP Q6NYR1 ?   ?   'expression tag'      26  1 
1 3I5D SER A 2   ? UNP Q6NYR1 ?   ?   'expression tag'      27  2 
1 3I5D ARG A 227 ? UNP Q6NYR1 HIS 252 'engineered mutation' 252 3 
2 3I5D GLY B 1   ? UNP Q6NYR1 ?   ?   'expression tag'      26  4 
2 3I5D SER B 2   ? UNP Q6NYR1 ?   ?   'expression tag'      27  5 
2 3I5D ARG B 227 ? UNP Q6NYR1 HIS 252 'engineered mutation' 252 6 
3 3I5D GLY C 1   ? UNP Q6NYR1 ?   ?   'expression tag'      26  7 
3 3I5D SER C 2   ? UNP Q6NYR1 ?   ?   'expression tag'      27  8 
3 3I5D ARG C 227 ? UNP Q6NYR1 HIS 252 'engineered mutation' 252 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3I5D 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      6.10 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   79.82 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              4.4 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.pdbx_details    
'12 % PEG 4,000, 100 mM sodium acetate, 100 mM ammonium sulfate, 1 mM GdCl3, pH 4.4, vapor diffusion, temperature 277K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2008-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
# 
_reflns.entry_id                     3I5D 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            3.46 
_reflns.d_resolution_low             50 
_reflns.number_all                   ? 
_reflns.number_obs                   43062 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.053 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.46 
_reflns_shell.d_res_low              3.52 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           0.791 
_reflns_shell.meanI_over_sigI_obs    1.4 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        5.0 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3I5D 
_refine.ls_d_res_high                            3.460 
_refine.ls_d_res_low                             47.740 
_refine.pdbx_ls_sigma_F                          0.11 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    87.840 
_refine.ls_number_reflns_obs                     32647 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.277 
_refine.ls_R_factor_R_work                       0.276 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.289 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.810 
_refine.ls_number_reflns_R_free                  1571 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               125.900 
_refine.solvent_model_param_bsol                 39.925 
_refine.solvent_model_param_ksol                 0.224 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            10.414 
_refine.aniso_B[2][2]                            10.414 
_refine.aniso_B[3][3]                            -20.828 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            -0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.530 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             0.800 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.755 
_refine.B_iso_max                                248.25 
_refine.B_iso_min                                20.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7101 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         196 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7297 
_refine_hist.d_res_high                       3.460 
_refine_hist.d_res_low                        47.740 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           7487  0.007  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          10243 1.272  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     1217  0.084  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      1327  0.005  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 4502  21.600 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
'X-RAY DIFFRACTION' 1  1 POSITIONAL A 179  0.024 ? 1  ? ? ? 
'X-RAY DIFFRACTION' 1  2 POSITIONAL B 179  0.024 ? 2  ? ? ? 
'X-RAY DIFFRACTION' 1  3 POSITIONAL C 182  0.015 ? 3  ? ? ? 
'X-RAY DIFFRACTION' 2  1 POSITIONAL B 194  0.010 ? 4  ? ? ? 
'X-RAY DIFFRACTION' 2  2 POSITIONAL C 194  0.010 ? 5  ? ? ? 
'X-RAY DIFFRACTION' 3  1 POSITIONAL A 368  0.026 ? 6  ? ? ? 
'X-RAY DIFFRACTION' 3  2 POSITIONAL B 368  0.026 ? 7  ? ? ? 
'X-RAY DIFFRACTION' 3  3 POSITIONAL C 362  0.025 ? 8  ? ? ? 
'X-RAY DIFFRACTION' 4  1 POSITIONAL B 379  0.018 ? 9  ? ? ? 
'X-RAY DIFFRACTION' 4  2 POSITIONAL C 379  0.018 ? 10 ? ? ? 
'X-RAY DIFFRACTION' 5  1 POSITIONAL A 305  0.023 ? 11 ? ? ? 
'X-RAY DIFFRACTION' 5  2 POSITIONAL B 305  0.023 ? 12 ? ? ? 
'X-RAY DIFFRACTION' 5  3 POSITIONAL C 303  0.024 ? 13 ? ? ? 
'X-RAY DIFFRACTION' 6  1 POSITIONAL B 313  0.014 ? 14 ? ? ? 
'X-RAY DIFFRACTION' 6  2 POSITIONAL C 313  0.014 ? 15 ? ? ? 
'X-RAY DIFFRACTION' 7  1 POSITIONAL A 1153 0.024 ? 16 ? ? ? 
'X-RAY DIFFRACTION' 7  2 POSITIONAL B 1153 0.024 ? 17 ? ? ? 
'X-RAY DIFFRACTION' 7  3 POSITIONAL C 1170 0.024 ? 18 ? ? ? 
'X-RAY DIFFRACTION' 8  1 POSITIONAL B 1147 0.017 ? 19 ? ? ? 
'X-RAY DIFFRACTION' 8  2 POSITIONAL C 1147 0.017 ? 20 ? ? ? 
'X-RAY DIFFRACTION' 9  1 POSITIONAL A 153  0.017 ? 21 ? ? ? 
'X-RAY DIFFRACTION' 9  2 POSITIONAL B 153  0.017 ? 22 ? ? ? 
'X-RAY DIFFRACTION' 9  3 POSITIONAL C 156  0.052 ? 23 ? ? ? 
'X-RAY DIFFRACTION' 10 1 POSITIONAL B 140  0.011 ? 24 ? ? ? 
'X-RAY DIFFRACTION' 10 2 POSITIONAL C 140  0.011 ? 25 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.460 3.572  11 76.000 2485 . 0.346 0.348 . 125 . 2610 . . 'X-RAY DIFFRACTION' 
3.572 3.699  11 78.000 2492 . 0.335 0.361 . 134 . 2626 . . 'X-RAY DIFFRACTION' 
3.699 3.847  11 80.000 2566 . 0.322 0.364 . 132 . 2698 . . 'X-RAY DIFFRACTION' 
3.847 4.022  11 78.000 2503 . 0.291 0.347 . 123 . 2626 . . 'X-RAY DIFFRACTION' 
4.022 4.234  11 84.000 2696 . 0.285 0.339 . 137 . 2833 . . 'X-RAY DIFFRACTION' 
4.234 4.499  11 89.000 2880 . 0.245 0.283 . 141 . 3021 . . 'X-RAY DIFFRACTION' 
4.499 4.846  11 91.000 2928 . 0.225 0.244 . 148 . 3076 . . 'X-RAY DIFFRACTION' 
4.846 5.334  11 95.000 3097 . 0.222 0.265 . 145 . 3242 . . 'X-RAY DIFFRACTION' 
5.334 6.104  11 97.000 3081 . 0.243 0.262 . 159 . 3240 . . 'X-RAY DIFFRACTION' 
6.104 7.685  11 98.000 3163 . 0.258 0.301 . 164 . 3327 . . 'X-RAY DIFFRACTION' 
7.685 47.744 11 99.000 3185 . 0.287 0.247 . 163 . 3348 . . 'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1  1 A 
1  2 B 
1  3 C 
2  1 B 
2  2 C 
3  1 A 
3  2 B 
3  3 C 
4  1 B 
4  2 C 
5  1 A 
5  2 B 
5  3 C 
6  1 B 
6  2 C 
7  1 A 
7  2 B 
7  3 C 
8  1 B 
8  2 C 
9  1 A 
9  2 B 
9  3 C 
10 1 B 
10 2 C 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1  1 1 ? A 36  A 64  'chain A and (resseq 36:64 )'   ? ? ? ? ? ? ? ? 
1  2 1 ? B 36  B 64  'chain B and (resseq 36:64 )'   ? ? ? ? ? ? ? ? 
1  3 1 ? C 36  C 64  'chain C and (resseq 36:64 )'   ? ? ? ? ? ? ? ? 
2  1 1 ? B 36  B 64  'chain B and (resseq 36:64 )'   ? ? ? ? ? ? ? ? 
2  2 1 ? C 36  C 64  'chain C and (resseq 36:64 )'   ? ? ? ? ? ? ? ? 
3  1 1 ? A 65  A 118 'chain A and (resseq 65:118 )'  ? ? ? ? ? ? ? ? 
3  2 1 ? B 65  B 118 'chain B and (resseq 65:118 )'  ? ? ? ? ? ? ? ? 
3  3 1 ? C 65  C 118 'chain C and (resseq 65:118 )'  ? ? ? ? ? ? ? ? 
4  1 1 ? B 65  B 118 'chain B and (resseq 65:118 )'  ? ? ? ? ? ? ? ? 
4  2 1 ? C 65  C 118 'chain C and (resseq 65:118 )'  ? ? ? ? ? ? ? ? 
5  1 1 ? A 119 A 169 'chain A and (resseq 119:169 )' ? ? ? ? ? ? ? ? 
5  2 1 ? B 119 B 169 'chain B and (resseq 119:169 )' ? ? ? ? ? ? ? ? 
5  3 1 ? C 119 C 169 'chain C and (resseq 119:169 )' ? ? ? ? ? ? ? ? 
6  1 1 ? B 119 B 169 'chain B and (resseq 119:169 )' ? ? ? ? ? ? ? ? 
6  2 1 ? C 119 C 169 'chain C and (resseq 119:169 )' ? ? ? ? ? ? ? ? 
7  1 1 ? A 170 A 325 'chain A and (resseq 170:325 )' ? ? ? ? ? ? ? ? 
7  2 1 ? B 170 B 325 'chain B and (resseq 170:325 )' ? ? ? ? ? ? ? ? 
7  3 1 ? C 170 C 325 'chain C and (resseq 170:325 )' ? ? ? ? ? ? ? ? 
8  1 1 ? B 170 B 325 'chain B and (resseq 170:325 )' ? ? ? ? ? ? ? ? 
8  2 1 ? C 170 C 325 'chain C and (resseq 170:325 )' ? ? ? ? ? ? ? ? 
9  1 1 ? A 326 A 352 'chain A and (resseq 326:352 )' ? ? ? ? ? ? ? ? 
9  2 1 ? B 326 B 352 'chain B and (resseq 326:352 )' ? ? ? ? ? ? ? ? 
9  3 1 ? C 326 C 352 'chain C and (resseq 326:352 )' ? ? ? ? ? ? ? ? 
10 1 1 ? B 326 B 352 'chain B and (resseq 326:352 )' ? ? ? ? ? ? ? ? 
10 2 1 ? C 326 C 352 'chain C and (resseq 326:352 )' ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
# 
_struct.entry_id                  3I5D 
_struct.title                     
'Crystal structure of the ATP-gated P2X4 ion channel in the closed, apo state at 3.5 Angstroms (R3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I5D 
_struct_keywords.text            
;P2X, Purinergic receptor, ion channel, closed state, apo state, Ion transport, Ionic channel, Receptor, Transmembrane, Transport, TRANSPORT PROTEIN
;
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 13  ? ILE A 22  ? THR A 38  ILE A 47  1 ? 10 
HELX_P HELX_P2  2  LEU A 157 ? ASN A 162 ? LEU A 182 ASN A 187 5 ? 6  
HELX_P HELX_P3  3  LEU A 210 ? ALA A 217 ? LEU A 235 ALA A 242 1 ? 8  
HELX_P HELX_P4  4  ASP A 220 ? GLY A 228 ? ASP A 245 GLY A 253 1 ? 9  
HELX_P HELX_P5  5  PRO A 244 ? CYS A 248 ? PRO A 269 CYS A 273 5 ? 5  
HELX_P HELX_P6  6  ASN A 309 ? ILE A 334 ? ASN A 334 ILE A 359 1 ? 26 
HELX_P HELX_P7  7  LEU B 9   ? ILE B 22  ? LEU B 34  ILE B 47  1 ? 14 
HELX_P HELX_P8  8  LEU B 157 ? ASN B 162 ? LEU B 182 ASN B 187 5 ? 6  
HELX_P HELX_P9  9  LEU B 210 ? ALA B 217 ? LEU B 235 ALA B 242 1 ? 8  
HELX_P HELX_P10 10 ASP B 220 ? GLY B 228 ? ASP B 245 GLY B 253 1 ? 9  
HELX_P HELX_P11 11 PRO B 244 ? CYS B 248 ? PRO B 269 CYS B 273 5 ? 5  
HELX_P HELX_P12 12 ASN B 309 ? LEU B 336 ? ASN B 334 LEU B 361 1 ? 28 
HELX_P HELX_P13 13 LEU C 9   ? ILE C 22  ? LEU C 34  ILE C 47  1 ? 14 
HELX_P HELX_P14 14 LEU C 157 ? ASN C 162 ? LEU C 182 ASN C 187 5 ? 6  
HELX_P HELX_P15 15 LEU C 210 ? ALA C 217 ? LEU C 235 ALA C 242 1 ? 8  
HELX_P HELX_P16 16 ASP C 220 ? GLY C 228 ? ASP C 245 GLY C 253 1 ? 9  
HELX_P HELX_P17 17 PRO C 244 ? CYS C 248 ? PRO C 269 CYS C 273 5 ? 5  
HELX_P HELX_P18 18 ASN C 309 ? TRP C 333 ? ASN C 334 TRP C 358 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 94  SG  ? ? ? 1_555 A CYS 143 SG ? ? A CYS 119 A CYS 168 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf2  disulf ?    ? A CYS 104 SG  ? ? ? 1_555 A CYS 127 SG ? ? A CYS 129 A CYS 152 1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf3  disulf ?    ? A CYS 110 SG  ? ? ? 1_555 A CYS 137 SG ? ? A CYS 135 A CYS 162 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf4  disulf ?    ? A CYS 195 SG  ? ? ? 1_555 A CYS 205 SG ? ? A CYS 220 A CYS 230 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf5  disulf ?    ? A CYS 239 SG  ? ? ? 1_555 A CYS 248 SG ? ? A CYS 264 A CYS 273 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf6  disulf ?    ? B CYS 94  SG  ? ? ? 1_555 B CYS 143 SG ? ? B CYS 119 B CYS 168 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf7  disulf ?    ? B CYS 104 SG  ? ? ? 1_555 B CYS 127 SG ? ? B CYS 129 B CYS 152 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf8  disulf ?    ? B CYS 110 SG  ? ? ? 1_555 B CYS 137 SG ? ? B CYS 135 B CYS 162 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf9  disulf ?    ? B CYS 195 SG  ? ? ? 1_555 B CYS 205 SG ? ? B CYS 220 B CYS 230 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf10 disulf ?    ? B CYS 239 SG  ? ? ? 1_555 B CYS 248 SG ? ? B CYS 264 B CYS 273 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf11 disulf ?    ? C CYS 94  SG  ? ? ? 1_555 C CYS 143 SG ? ? C CYS 119 C CYS 168 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf12 disulf ?    ? C CYS 104 SG  ? ? ? 1_555 C CYS 127 SG ? ? C CYS 129 C CYS 152 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf13 disulf ?    ? C CYS 110 SG  ? ? ? 1_555 C CYS 137 SG ? ? C CYS 135 C CYS 162 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf14 disulf ?    ? C CYS 195 SG  ? ? ? 1_555 C CYS 205 SG ? ? C CYS 220 C CYS 230 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf15 disulf ?    ? C CYS 239 SG  ? ? ? 1_555 C CYS 248 SG ? ? C CYS 264 C CYS 273 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
covale1  covale one  ? A ASN 53  ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 78  A NAG 401 1_555 ? ? ? ? ? ? ? 1.455 ? N-Glycosylation 
covale2  covale one  ? A ASN 88  ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 113 A NAG 402 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale3  covale one  ? A ASN 162 ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 187 A NAG 403 1_555 ? ? ? ? ? ? ? 1.493 ? N-Glycosylation 
covale4  covale one  ? A ASN 188 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 213 D NAG 1   1_555 ? ? ? ? ? ? ? 1.435 ? N-Glycosylation 
covale5  covale one  ? B ASN 53  ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 78  B NAG 401 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale6  covale one  ? B ASN 88  ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 113 B NAG 402 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale7  covale one  ? B ASN 162 ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 187 B NAG 403 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale8  covale one  ? B ASN 188 ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 213 B NAG 404 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale9  covale one  ? C ASN 53  ND2 ? ? ? 1_555 M NAG .   C1 ? ? C ASN 78  C NAG 401 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale10 covale one  ? C ASN 88  ND2 ? ? ? 1_555 N NAG .   C1 ? ? C ASN 113 C NAG 402 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale11 covale one  ? C ASN 162 ND2 ? ? ? 1_555 O NAG .   C1 ? ? C ASN 187 C NAG 403 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale12 covale one  ? C ASN 188 ND2 ? ? ? 1_555 E NAG .   C1 ? ? C ASN 213 E NAG 1   1_555 ? ? ? ? ? ? ? 1.470 ? N-Glycosylation 
covale13 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.457 ? ?               
covale14 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.477 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 70  A . ? PRO 95  A PRO 71  A ? PRO 96  A 1 -16.16 
2 CYS 143 A . ? CYS 168 A PRO 144 A ? PRO 169 A 1 6.89   
3 ASN 153 A . ? ASN 178 A PRO 154 A ? PRO 179 A 1 1.64   
4 PRO 70  B . ? PRO 95  B PRO 71  B ? PRO 96  B 1 -16.77 
5 CYS 143 B . ? CYS 168 B PRO 144 B ? PRO 169 B 1 6.83   
6 ASN 153 B . ? ASN 178 B PRO 154 B ? PRO 179 B 1 1.75   
7 PRO 70  C . ? PRO 95  C PRO 71  C ? PRO 96  C 1 -16.47 
8 CYS 143 C . ? CYS 168 C PRO 144 C ? PRO 169 C 1 6.86   
9 ASN 153 C . ? ASN 178 C PRO 154 C ? PRO 179 C 1 0.60   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 3 ? 
D ? 3 ? 
E ? 2 ? 
F ? 4 ? 
G ? 5 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
K ? 4 ? 
L ? 5 ? 
M ? 3 ? 
N ? 3 ? 
O ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? parallel      
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
O 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 36  ? THR A 37  ? ASP A 61  THR A 62  
A 2 GLU A 285 ? ALA A 305 ? GLU A 310 ALA A 330 
A 3 GLY A 229 ? CYS A 239 ? GLY A 254 CYS A 264 
A 4 PRO A 250 ? ARG A 256 ? PRO A 275 ARG A 281 
B 1 VAL A 122 ? SER A 129 ? VAL A 147 SER A 154 
B 2 LYS A 135 ? CYS A 143 ? LYS A 160 CYS A 168 
B 3 PHE A 77  ? ALA A 95  ? PHE A 102 ALA A 120 
B 4 GLU A 285 ? ALA A 305 ? GLU A 310 ALA A 330 
B 5 ASN A 271 ? LYS A 279 ? ASN A 296 LYS A 304 
C 1 LEU A 39  ? LYS A 47  ? LEU A 64  LYS A 72  
C 2 THR A 164 ? TYR A 173 ? THR A 189 TYR A 198 
C 3 PHE A 178 ? ARG A 181 ? PHE A 203 ARG A 206 
D 1 LEU A 39  ? LYS A 47  ? LEU A 64  LYS A 72  
D 2 THR A 164 ? TYR A 173 ? THR A 189 TYR A 198 
D 3 ILE A 207 ? ARG A 209 ? ILE A 232 ARG A 234 
E 1 ALA A 50  ? THR A 54  ? ALA A 75  THR A 79  
E 2 GLY A 58  ? TRP A 62  ? GLY A 83  TRP A 87  
F 1 ASP B 36  ? THR B 37  ? ASP B 61  THR B 62  
F 2 GLU B 285 ? ALA B 305 ? GLU B 310 ALA B 330 
F 3 GLY B 229 ? CYS B 239 ? GLY B 254 CYS B 264 
F 4 PRO B 250 ? ARG B 256 ? PRO B 275 ARG B 281 
G 1 VAL B 122 ? VAL B 128 ? VAL B 147 VAL B 153 
G 2 THR B 136 ? CYS B 143 ? THR B 161 CYS B 168 
G 3 PHE B 77  ? ALA B 95  ? PHE B 102 ALA B 120 
G 4 GLU B 285 ? ALA B 305 ? GLU B 310 ALA B 330 
G 5 ASN B 271 ? LYS B 279 ? ASN B 296 LYS B 304 
H 1 LEU B 39  ? LYS B 47  ? LEU B 64  LYS B 72  
H 2 THR B 164 ? TYR B 173 ? THR B 189 TYR B 198 
H 3 PHE B 178 ? ARG B 181 ? PHE B 203 ARG B 206 
I 1 LEU B 39  ? LYS B 47  ? LEU B 64  LYS B 72  
I 2 THR B 164 ? TYR B 173 ? THR B 189 TYR B 198 
I 3 ILE B 207 ? ARG B 209 ? ILE B 232 ARG B 234 
J 1 ALA B 50  ? LEU B 51  ? ALA B 75  LEU B 76  
J 2 ILE B 61  ? TRP B 62  ? ILE B 86  TRP B 87  
K 1 ASP C 36  ? THR C 37  ? ASP C 61  THR C 62  
K 2 GLU C 285 ? ALA C 305 ? GLU C 310 ALA C 330 
K 3 GLY C 229 ? CYS C 239 ? GLY C 254 CYS C 264 
K 4 PRO C 250 ? ARG C 256 ? PRO C 275 ARG C 281 
L 1 VAL C 122 ? VAL C 128 ? VAL C 147 VAL C 153 
L 2 THR C 136 ? CYS C 143 ? THR C 161 CYS C 168 
L 3 PHE C 77  ? ALA C 95  ? PHE C 102 ALA C 120 
L 4 GLU C 285 ? ALA C 305 ? GLU C 310 ALA C 330 
L 5 ASN C 271 ? LYS C 279 ? ASN C 296 LYS C 304 
M 1 LEU C 39  ? LYS C 47  ? LEU C 64  LYS C 72  
M 2 THR C 164 ? TYR C 173 ? THR C 189 TYR C 198 
M 3 PHE C 178 ? ARG C 181 ? PHE C 203 ARG C 206 
N 1 LEU C 39  ? LYS C 47  ? LEU C 64  LYS C 72  
N 2 THR C 164 ? TYR C 173 ? THR C 189 TYR C 198 
N 3 ILE C 207 ? ARG C 209 ? ILE C 232 ARG C 234 
O 1 ALA C 50  ? THR C 54  ? ALA C 75  THR C 79  
O 2 GLY C 58  ? TRP C 62  ? GLY C 83  TRP C 87  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 36  ? N ASP A 61  O ALA A 305 ? O ALA A 330 
A 2 3 O ASP A 298 ? O ASP A 323 N MET A 231 ? N MET A 256 
A 3 4 N GLY A 232 ? N GLY A 257 O ARG A 255 ? O ARG A 280 
B 1 2 N VAL A 122 ? N VAL A 147 O LEU A 140 ? O LEU A 165 
B 2 3 O VAL A 139 ? O VAL A 164 N CYS A 94  ? N CYS A 119 
B 3 4 N THR A 86  ? N THR A 111 O LEU A 289 ? O LEU A 314 
B 4 5 O THR A 286 ? O THR A 311 N TYR A 278 ? N TYR A 303 
C 1 2 N LYS A 47  ? N LYS A 72  O THR A 164 ? O THR A 189 
C 2 3 N TYR A 173 ? N TYR A 198 O PHE A 178 ? O PHE A 203 
D 1 2 N LYS A 47  ? N LYS A 72  O THR A 164 ? O THR A 189 
D 2 3 N VAL A 165 ? N VAL A 190 O PHE A 208 ? O PHE A 233 
E 1 2 N ALA A 50  ? N ALA A 75  O TRP A 62  ? O TRP A 87  
F 1 2 N ASP B 36  ? N ASP B 61  O ALA B 305 ? O ALA B 330 
F 2 3 O ASP B 298 ? O ASP B 323 N MET B 231 ? N MET B 256 
F 3 4 N ARG B 236 ? N ARG B 261 O ARG B 251 ? O ARG B 276 
G 1 2 N VAL B 122 ? N VAL B 147 O LEU B 140 ? O LEU B 165 
G 2 3 O VAL B 139 ? O VAL B 164 N CYS B 94  ? N CYS B 119 
G 3 4 N PHE B 77  ? N PHE B 102 O PHE B 297 ? O PHE B 322 
G 4 5 O THR B 286 ? O THR B 311 N TYR B 278 ? N TYR B 303 
H 1 2 N LYS B 47  ? N LYS B 72  O THR B 164 ? O THR B 189 
H 2 3 N TYR B 173 ? N TYR B 198 O PHE B 178 ? O PHE B 203 
I 1 2 N LYS B 47  ? N LYS B 72  O THR B 164 ? O THR B 189 
I 2 3 N VAL B 165 ? N VAL B 190 O PHE B 208 ? O PHE B 233 
J 1 2 N ALA B 50  ? N ALA B 75  O TRP B 62  ? O TRP B 87  
K 1 2 N ASP C 36  ? N ASP C 61  O ALA C 305 ? O ALA C 330 
K 2 3 O ASP C 298 ? O ASP C 323 N MET C 231 ? N MET C 256 
K 3 4 N GLY C 232 ? N GLY C 257 O ARG C 255 ? O ARG C 280 
L 1 2 N VAL C 122 ? N VAL C 147 O LEU C 140 ? O LEU C 165 
L 2 3 O VAL C 139 ? O VAL C 164 N CYS C 94  ? N CYS C 119 
L 3 4 N PHE C 77  ? N PHE C 102 O PHE C 297 ? O PHE C 322 
L 4 5 O THR C 286 ? O THR C 311 N TYR C 278 ? N TYR C 303 
M 1 2 N LYS C 47  ? N LYS C 72  O THR C 164 ? O THR C 189 
M 2 3 N TYR C 173 ? N TYR C 198 O PHE C 178 ? O PHE C 203 
N 1 2 N LYS C 47  ? N LYS C 72  O THR C 164 ? O THR C 189 
N 2 3 N VAL C 165 ? N VAL C 190 O PHE C 208 ? O PHE C 233 
O 1 2 N ALA C 50  ? N ALA C 75  O TRP C 62  ? O TRP C 87  
# 
_atom_sites.entry_id                    3I5D 
_atom_sites.fract_transf_matrix[1][1]   0.004257 
_atom_sites.fract_transf_matrix[1][2]   0.002458 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004916 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007224 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 11  ? -18.462  -46.735 29.184  1.00 213.85 ? 36  ARG A N   1 
ATOM   2    C CA  . ARG A 1 11  ? -17.696  -45.554 28.803  1.00 214.04 ? 36  ARG A CA  1 
ATOM   3    C C   . ARG A 1 11  ? -18.292  -44.917 27.555  1.00 219.57 ? 36  ARG A C   1 
ATOM   4    O O   . ARG A 1 11  ? -18.025  -43.752 27.251  1.00 216.32 ? 36  ARG A O   1 
ATOM   5    C CB  . ARG A 1 11  ? -16.235  -45.918 28.571  1.00 197.80 ? 36  ARG A CB  1 
ATOM   6    N N   . PHE A 1 12  ? -19.099  -45.700 26.841  1.00 211.65 ? 37  PHE A N   1 
ATOM   7    C CA  . PHE A 1 12  ? -19.768  -45.252 25.619  1.00 221.94 ? 37  PHE A CA  1 
ATOM   8    C C   . PHE A 1 12  ? -21.046  -44.443 25.885  1.00 235.93 ? 37  PHE A C   1 
ATOM   9    O O   . PHE A 1 12  ? -21.305  -43.443 25.212  1.00 227.72 ? 37  PHE A O   1 
ATOM   10   C CB  . PHE A 1 12  ? -20.070  -46.445 24.712  1.00 198.63 ? 37  PHE A CB  1 
ATOM   11   N N   . THR A 1 13  ? -21.848  -44.881 26.854  1.00 230.33 ? 38  THR A N   1 
ATOM   12   C CA  . THR A 1 13  ? -23.057  -44.155 27.240  1.00 209.74 ? 38  THR A CA  1 
ATOM   13   C C   . THR A 1 13  ? -22.705  -42.871 27.991  1.00 211.62 ? 38  THR A C   1 
ATOM   14   O O   . THR A 1 13  ? -23.403  -41.863 27.875  1.00 212.48 ? 38  THR A O   1 
ATOM   15   C CB  . THR A 1 13  ? -23.989  -45.018 28.117  1.00 195.39 ? 38  THR A CB  1 
ATOM   16   O OG1 . THR A 1 13  ? -23.380  -45.248 29.394  1.00 196.71 ? 38  THR A OG1 1 
ATOM   17   C CG2 . THR A 1 13  ? -24.271  -46.352 27.446  1.00 172.70 ? 38  THR A CG2 1 
ATOM   18   N N   . GLN A 1 14  ? -21.618  -42.918 28.758  1.00 218.84 ? 39  GLN A N   1 
ATOM   19   C CA  . GLN A 1 14  ? -21.136  -41.755 29.503  1.00 218.83 ? 39  GLN A CA  1 
ATOM   20   C C   . GLN A 1 14  ? -20.661  -40.636 28.571  1.00 238.11 ? 39  GLN A C   1 
ATOM   21   O O   . GLN A 1 14  ? -20.742  -39.455 28.918  1.00 231.50 ? 39  GLN A O   1 
ATOM   22   C CB  . GLN A 1 14  ? -20.024  -42.162 30.466  1.00 201.04 ? 39  GLN A CB  1 
ATOM   23   N N   . ALA A 1 15  ? -20.158  -41.011 27.395  1.00 243.58 ? 40  ALA A N   1 
ATOM   24   C CA  . ALA A 1 15  ? -19.779  -40.036 26.374  1.00 229.89 ? 40  ALA A CA  1 
ATOM   25   C C   . ALA A 1 15  ? -21.002  -39.576 25.575  1.00 221.53 ? 40  ALA A C   1 
ATOM   26   O O   . ALA A 1 15  ? -20.954  -38.562 24.875  1.00 207.94 ? 40  ALA A O   1 
ATOM   27   C CB  . ALA A 1 15  ? -18.707  -40.609 25.449  1.00 199.29 ? 40  ALA A CB  1 
ATOM   28   N N   . LEU A 1 16  ? -22.092  -40.335 25.686  1.00 213.32 ? 41  LEU A N   1 
ATOM   29   C CA  . LEU A 1 16  ? -23.353  -40.007 25.018  1.00 204.90 ? 41  LEU A CA  1 
ATOM   30   C C   . LEU A 1 16  ? -24.175  -38.975 25.793  1.00 199.21 ? 41  LEU A C   1 
ATOM   31   O O   . LEU A 1 16  ? -24.705  -38.027 25.213  1.00 186.55 ? 41  LEU A O   1 
ATOM   32   C CB  . LEU A 1 16  ? -24.192  -41.270 24.802  1.00 196.30 ? 41  LEU A CB  1 
ATOM   33   C CG  . LEU A 1 16  ? -25.524  -41.040 24.085  1.00 183.57 ? 41  LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 16  ? -25.273  -40.619 22.640  1.00 148.23 ? 41  LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 16  ? -26.417  -42.276 24.155  1.00 130.47 ? 41  LEU A CD2 1 
ATOM   36   N N   . VAL A 1 17  ? -24.291  -39.174 27.102  1.00 197.25 ? 42  VAL A N   1 
ATOM   37   C CA  . VAL A 1 17  ? -25.020  -38.244 27.953  1.00 178.73 ? 42  VAL A CA  1 
ATOM   38   C C   . VAL A 1 17  ? -24.283  -36.909 28.109  1.00 190.56 ? 42  VAL A C   1 
ATOM   39   O O   . VAL A 1 17  ? -24.922  -35.866 28.227  1.00 191.15 ? 42  VAL A O   1 
ATOM   40   C CB  . VAL A 1 17  ? -25.312  -38.845 29.343  1.00 175.18 ? 42  VAL A CB  1 
ATOM   41   C CG1 . VAL A 1 17  ? -26.166  -40.094 29.212  1.00 136.89 ? 42  VAL A CG1 1 
ATOM   42   C CG2 . VAL A 1 17  ? -24.018  -39.149 30.079  1.00 192.58 ? 42  VAL A CG2 1 
ATOM   43   N N   . ILE A 1 18  ? -22.948  -36.939 28.115  1.00 202.12 ? 43  ILE A N   1 
ATOM   44   C CA  . ILE A 1 18  ? -22.158  -35.701 28.150  1.00 211.39 ? 43  ILE A CA  1 
ATOM   45   C C   . ILE A 1 18  ? -22.367  -34.898 26.860  1.00 213.10 ? 43  ILE A C   1 
ATOM   46   O O   . ILE A 1 18  ? -22.412  -33.667 26.888  1.00 211.78 ? 43  ILE A O   1 
ATOM   47   C CB  . ILE A 1 18  ? -20.629  -35.949 28.414  1.00 211.47 ? 43  ILE A CB  1 
ATOM   48   C CG1 . ILE A 1 18  ? -19.888  -34.628 28.685  1.00 207.40 ? 43  ILE A CG1 1 
ATOM   49   C CG2 . ILE A 1 18  ? -19.983  -36.689 27.255  1.00 215.53 ? 43  ILE A CG2 1 
ATOM   50   C CD1 . ILE A 1 18  ? -18.368  -34.760 28.793  1.00 143.06 ? 43  ILE A CD1 1 
ATOM   51   N N   . ALA A 1 19  ? -22.507  -35.598 25.735  1.00 206.52 ? 44  ALA A N   1 
ATOM   52   C CA  . ALA A 1 19  ? -22.782  -34.949 24.455  1.00 201.10 ? 44  ALA A CA  1 
ATOM   53   C C   . ALA A 1 19  ? -24.273  -34.649 24.308  1.00 194.32 ? 44  ALA A C   1 
ATOM   54   O O   . ALA A 1 19  ? -24.692  -33.919 23.406  1.00 188.32 ? 44  ALA A O   1 
ATOM   55   C CB  . ALA A 1 19  ? -22.292  -35.814 23.304  1.00 186.99 ? 44  ALA A CB  1 
ATOM   56   N N   . TYR A 1 20  ? -25.066  -35.231 25.201  1.00 191.05 ? 45  TYR A N   1 
ATOM   57   C CA  . TYR A 1 20  ? -26.507  -35.026 25.215  1.00 186.76 ? 45  TYR A CA  1 
ATOM   58   C C   . TYR A 1 20  ? -26.897  -33.781 26.004  1.00 180.70 ? 45  TYR A C   1 
ATOM   59   O O   . TYR A 1 20  ? -27.779  -33.030 25.596  1.00 171.71 ? 45  TYR A O   1 
ATOM   60   C CB  . TYR A 1 20  ? -27.200  -36.252 25.799  1.00 180.64 ? 45  TYR A CB  1 
ATOM   61   C CG  . TYR A 1 20  ? -28.617  -35.995 26.235  1.00 171.55 ? 45  TYR A CG  1 
ATOM   62   C CD1 . TYR A 1 20  ? -29.685  -36.312 25.407  1.00 156.88 ? 45  TYR A CD1 1 
ATOM   63   C CD2 . TYR A 1 20  ? -28.888  -35.437 27.478  1.00 152.30 ? 45  TYR A CD2 1 
ATOM   64   C CE1 . TYR A 1 20  ? -30.984  -36.083 25.804  1.00 163.70 ? 45  TYR A CE1 1 
ATOM   65   C CE2 . TYR A 1 20  ? -30.183  -35.203 27.884  1.00 167.27 ? 45  TYR A CE2 1 
ATOM   66   C CZ  . TYR A 1 20  ? -31.228  -35.528 27.046  1.00 177.78 ? 45  TYR A CZ  1 
ATOM   67   O OH  . TYR A 1 20  ? -32.520  -35.294 27.457  1.00 152.03 ? 45  TYR A OH  1 
ATOM   68   N N   . VAL A 1 21  ? -26.249  -33.572 27.145  1.00 178.51 ? 46  VAL A N   1 
ATOM   69   C CA  . VAL A 1 21  ? -26.522  -32.393 27.956  1.00 174.23 ? 46  VAL A CA  1 
ATOM   70   C C   . VAL A 1 21  ? -25.783  -31.157 27.440  1.00 178.53 ? 46  VAL A C   1 
ATOM   71   O O   . VAL A 1 21  ? -26.409  -30.166 27.078  1.00 196.38 ? 46  VAL A O   1 
ATOM   72   C CB  . VAL A 1 21  ? -26.209  -32.628 29.450  1.00 168.13 ? 46  VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 21  ? -27.160  -33.661 30.031  1.00 134.17 ? 46  VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 21  ? -24.761  -33.054 29.642  1.00 181.04 ? 46  VAL A CG2 1 
ATOM   75   N N   . ILE A 1 22  ? -24.457  -31.213 27.395  1.00 173.33 ? 47  ILE A N   1 
ATOM   76   C CA  . ILE A 1 22  ? -23.677  -30.073 26.918  1.00 190.05 ? 47  ILE A CA  1 
ATOM   77   C C   . ILE A 1 22  ? -23.959  -29.789 25.441  1.00 202.99 ? 47  ILE A C   1 
ATOM   78   O O   . ILE A 1 22  ? -24.089  -28.631 25.037  1.00 202.96 ? 47  ILE A O   1 
ATOM   79   C CB  . ILE A 1 22  ? -22.154  -30.279 27.130  1.00 200.10 ? 47  ILE A CB  1 
ATOM   80   C CG1 . ILE A 1 22  ? -21.858  -30.620 28.592  1.00 181.65 ? 47  ILE A CG1 1 
ATOM   81   C CG2 . ILE A 1 22  ? -21.372  -29.040 26.694  1.00 192.28 ? 47  ILE A CG2 1 
ATOM   82   C CD1 . ILE A 1 22  ? -20.375  -30.741 28.910  1.00 175.10 ? 47  ILE A CD1 1 
ATOM   83   N N   . GLY A 1 23  ? -24.068  -30.850 24.645  1.00 203.06 ? 48  GLY A N   1 
ATOM   84   C CA  . GLY A 1 23  ? -24.227  -30.718 23.206  1.00 196.15 ? 48  GLY A CA  1 
ATOM   85   C C   . GLY A 1 23  ? -25.641  -30.427 22.739  1.00 194.22 ? 48  GLY A C   1 
ATOM   86   O O   . GLY A 1 23  ? -25.852  -29.608 21.842  1.00 194.67 ? 48  GLY A O   1 
ATOM   87   N N   . TYR A 1 24  ? -26.610  -31.106 23.345  1.00 194.46 ? 49  TYR A N   1 
ATOM   88   C CA  . TYR A 1 24  ? -28.005  -30.985 22.936  1.00 194.22 ? 49  TYR A CA  1 
ATOM   89   C C   . TYR A 1 24  ? -28.793  -29.944 23.728  1.00 185.22 ? 49  TYR A C   1 
ATOM   90   O O   . TYR A 1 24  ? -29.278  -28.957 23.173  1.00 185.38 ? 49  TYR A O   1 
ATOM   91   C CB  . TYR A 1 24  ? -28.711  -32.337 23.052  1.00 187.92 ? 49  TYR A CB  1 
ATOM   92   C CG  . TYR A 1 24  ? -30.196  -32.242 22.815  1.00 183.95 ? 49  TYR A CG  1 
ATOM   93   C CD1 . TYR A 1 24  ? -30.706  -32.219 21.522  1.00 180.83 ? 49  TYR A CD1 1 
ATOM   94   C CD2 . TYR A 1 24  ? -31.088  -32.160 23.880  1.00 154.24 ? 49  TYR A CD2 1 
ATOM   95   C CE1 . TYR A 1 24  ? -32.057  -32.125 21.291  1.00 166.29 ? 49  TYR A CE1 1 
ATOM   96   C CE2 . TYR A 1 24  ? -32.443  -32.065 23.658  1.00 155.93 ? 49  TYR A CE2 1 
ATOM   97   C CZ  . TYR A 1 24  ? -32.922  -32.048 22.358  1.00 166.41 ? 49  TYR A CZ  1 
ATOM   98   O OH  . TYR A 1 24  ? -34.271  -31.955 22.110  1.00 149.62 ? 49  TYR A OH  1 
ATOM   99   N N   . VAL A 1 25  ? -28.932  -30.185 25.026  1.00 179.46 ? 50  VAL A N   1 
ATOM   100  C CA  . VAL A 1 25  ? -29.794  -29.363 25.865  1.00 170.52 ? 50  VAL A CA  1 
ATOM   101  C C   . VAL A 1 25  ? -29.156  -28.037 26.280  1.00 167.64 ? 50  VAL A C   1 
ATOM   102  O O   . VAL A 1 25  ? -29.790  -27.235 26.961  1.00 169.05 ? 50  VAL A O   1 
ATOM   103  C CB  . VAL A 1 25  ? -30.241  -30.125 27.135  1.00 147.24 ? 50  VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 25  ? -29.170  -30.045 28.208  1.00 158.19 ? 50  VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 25  ? -31.557  -29.579 27.650  1.00 154.09 ? 50  VAL A CG2 1 
ATOM   106  N N   . CYS A 1 26  ? -27.907  -27.804 25.890  1.00 166.14 ? 51  CYS A N   1 
ATOM   107  C CA  . CYS A 1 26  ? -27.233  -26.577 26.309  1.00 161.59 ? 51  CYS A CA  1 
ATOM   108  C C   . CYS A 1 26  ? -26.781  -25.681 25.164  1.00 160.83 ? 51  CYS A C   1 
ATOM   109  O O   . CYS A 1 26  ? -26.100  -24.682 25.378  1.00 169.40 ? 51  CYS A O   1 
ATOM   110  C CB  . CYS A 1 26  ? -26.090  -26.880 27.276  1.00 179.45 ? 51  CYS A CB  1 
ATOM   111  S SG  . CYS A 1 26  ? -26.697  -27.457 28.878  1.00 146.22 ? 51  CYS A SG  1 
ATOM   112  N N   . VAL A 1 27  ? -27.166  -26.038 23.948  1.00 168.66 ? 52  VAL A N   1 
ATOM   113  C CA  . VAL A 1 27  ? -26.945  -25.153 22.813  1.00 192.63 ? 52  VAL A CA  1 
ATOM   114  C C   . VAL A 1 27  ? -28.207  -25.106 21.951  1.00 189.81 ? 52  VAL A C   1 
ATOM   115  O O   . VAL A 1 27  ? -28.629  -24.036 21.510  1.00 185.54 ? 52  VAL A O   1 
ATOM   116  C CB  . VAL A 1 27  ? -25.697  -25.560 21.982  1.00 191.06 ? 52  VAL A CB  1 
ATOM   117  C CG1 . VAL A 1 27  ? -24.535  -25.920 22.905  1.00 141.65 ? 52  VAL A CG1 1 
ATOM   118  C CG2 . VAL A 1 27  ? -26.013  -26.715 21.044  1.00 190.16 ? 52  VAL A CG2 1 
ATOM   119  N N   . TYR A 1 28  ? -28.752  -26.287 21.647  1.00 183.70 ? 53  TYR A N   1 
ATOM   120  C CA  . TYR A 1 28  ? -30.065  -26.436 21.001  1.00 178.87 ? 53  TYR A CA  1 
ATOM   121  C C   . TYR A 1 28  ? -31.280  -26.023 21.851  1.00 181.60 ? 53  TYR A C   1 
ATOM   122  O O   . TYR A 1 28  ? -32.183  -25.341 21.365  1.00 181.60 ? 53  TYR A O   1 
ATOM   123  C CB  . TYR A 1 28  ? -30.249  -27.872 20.502  1.00 173.37 ? 53  TYR A CB  1 
ATOM   124  C CG  . TYR A 1 28  ? -31.577  -28.117 19.821  1.00 194.92 ? 53  TYR A CG  1 
ATOM   125  C CD1 . TYR A 1 28  ? -31.724  -27.925 18.454  1.00 178.64 ? 53  TYR A CD1 1 
ATOM   126  C CD2 . TYR A 1 28  ? -32.683  -28.540 20.546  1.00 202.73 ? 53  TYR A CD2 1 
ATOM   127  C CE1 . TYR A 1 28  ? -32.935  -28.147 17.827  1.00 194.50 ? 53  TYR A CE1 1 
ATOM   128  C CE2 . TYR A 1 28  ? -33.898  -28.765 19.928  1.00 212.53 ? 53  TYR A CE2 1 
ATOM   129  C CZ  . TYR A 1 28  ? -34.019  -28.567 18.569  1.00 211.73 ? 53  TYR A CZ  1 
ATOM   130  O OH  . TYR A 1 28  ? -35.227  -28.789 17.949  1.00 187.83 ? 53  TYR A OH  1 
ATOM   131  N N   . ASN A 1 29  ? -31.286  -26.434 23.118  1.00 167.52 ? 54  ASN A N   1 
ATOM   132  C CA  . ASN A 1 29  ? -32.294  -26.020 24.087  1.00 164.56 ? 54  ASN A CA  1 
ATOM   133  C C   . ASN A 1 29  ? -31.805  -24.865 24.964  1.00 166.85 ? 54  ASN A C   1 
ATOM   134  O O   . ASN A 1 29  ? -32.602  -24.185 25.604  1.00 165.70 ? 54  ASN A O   1 
ATOM   135  C CB  . ASN A 1 29  ? -32.740  -27.200 24.937  1.00 135.29 ? 54  ASN A CB  1 
ATOM   136  N N   . LYS A 1 30  ? -30.493  -24.651 24.990  1.00 172.35 ? 55  LYS A N   1 
ATOM   137  C CA  . LYS A 1 30  ? -29.905  -23.544 25.741  1.00 169.74 ? 55  LYS A CA  1 
ATOM   138  C C   . LYS A 1 30  ? -30.431  -23.467 27.181  1.00 173.65 ? 55  LYS A C   1 
ATOM   139  O O   . LYS A 1 30  ? -30.786  -22.388 27.660  1.00 180.78 ? 55  LYS A O   1 
ATOM   140  C CB  . LYS A 1 30  ? -30.140  -22.224 25.006  1.00 133.59 ? 55  LYS A CB  1 
ATOM   141  N N   . GLY A 1 31  ? -30.472  -24.612 27.864  1.00 164.40 ? 56  GLY A N   1 
ATOM   142  C CA  . GLY A 1 31  ? -31.064  -24.713 29.191  1.00 151.96 ? 56  GLY A CA  1 
ATOM   143  C C   . GLY A 1 31  ? -30.271  -24.132 30.352  1.00 166.77 ? 56  GLY A C   1 
ATOM   144  O O   . GLY A 1 31  ? -30.717  -24.199 31.499  1.00 161.58 ? 56  GLY A O   1 
ATOM   145  N N   . TYR A 1 32  ? -29.099  -23.567 30.063  1.00 169.89 ? 57  TYR A N   1 
ATOM   146  C CA  . TYR A 1 32  ? -28.234  -22.975 31.090  1.00 160.25 ? 57  TYR A CA  1 
ATOM   147  C C   . TYR A 1 32  ? -28.570  -21.512 31.376  1.00 177.22 ? 57  TYR A C   1 
ATOM   148  O O   . TYR A 1 32  ? -27.911  -20.868 32.201  1.00 167.10 ? 57  TYR A O   1 
ATOM   149  C CB  . TYR A 1 32  ? -26.768  -23.072 30.672  1.00 150.87 ? 57  TYR A CB  1 
ATOM   150  C CG  . TYR A 1 32  ? -26.463  -22.369 29.368  1.00 154.71 ? 57  TYR A CG  1 
ATOM   151  C CD1 . TYR A 1 32  ? -25.881  -21.108 29.354  1.00 159.91 ? 57  TYR A CD1 1 
ATOM   152  C CD2 . TYR A 1 32  ? -26.763  -22.968 28.150  1.00 141.01 ? 57  TYR A CD2 1 
ATOM   153  C CE1 . TYR A 1 32  ? -25.601  -20.465 28.162  1.00 155.32 ? 57  TYR A CE1 1 
ATOM   154  C CE2 . TYR A 1 32  ? -26.489  -22.333 26.957  1.00 142.32 ? 57  TYR A CE2 1 
ATOM   155  C CZ  . TYR A 1 32  ? -25.907  -21.084 26.968  1.00 142.44 ? 57  TYR A CZ  1 
ATOM   156  O OH  . TYR A 1 32  ? -25.634  -20.451 25.781  1.00 122.90 ? 57  TYR A OH  1 
ATOM   157  N N   . GLN A 1 33  ? -29.576  -20.996 30.674  1.00 181.43 ? 58  GLN A N   1 
ATOM   158  C CA  . GLN A 1 33  ? -30.018  -19.613 30.826  1.00 164.30 ? 58  GLN A CA  1 
ATOM   159  C C   . GLN A 1 33  ? -31.245  -19.508 31.748  1.00 161.83 ? 58  GLN A C   1 
ATOM   160  O O   . GLN A 1 33  ? -32.020  -20.461 31.846  1.00 129.28 ? 58  GLN A O   1 
ATOM   161  C CB  . GLN A 1 33  ? -30.322  -19.018 29.452  1.00 119.50 ? 58  GLN A CB  1 
ATOM   162  N N   . ASP A 1 34  ? -31.407  -18.369 32.434  1.00 152.83 ? 59  ASP A N   1 
ATOM   163  C CA  . ASP A 1 34  ? -32.653  -18.057 33.153  1.00 138.27 ? 59  ASP A CA  1 
ATOM   164  C C   . ASP A 1 34  ? -33.573  -17.244 32.233  1.00 154.10 ? 59  ASP A C   1 
ATOM   165  O O   . ASP A 1 34  ? -33.102  -16.348 31.539  1.00 152.70 ? 59  ASP A O   1 
ATOM   166  C CB  . ASP A 1 34  ? -32.364  -17.285 34.448  1.00 89.95  ? 59  ASP A CB  1 
ATOM   167  N N   . THR A 1 35  ? -34.871  -17.546 32.219  1.00 151.30 ? 60  THR A N   1 
ATOM   168  C CA  . THR A 1 35  ? -35.806  -16.874 31.304  1.00 137.67 ? 60  THR A CA  1 
ATOM   169  C C   . THR A 1 35  ? -36.397  -15.557 31.855  1.00 153.46 ? 60  THR A C   1 
ATOM   170  O O   . THR A 1 35  ? -36.432  -15.345 33.073  1.00 149.20 ? 60  THR A O   1 
ATOM   171  C CB  . THR A 1 35  ? -36.920  -17.837 30.891  1.00 97.88  ? 60  THR A CB  1 
ATOM   172  N N   . ASP A 1 36  ? -36.854  -14.678 30.958  1.00 134.75 ? 61  ASP A N   1 
ATOM   173  C CA  . ASP A 1 36  ? -37.548  -13.441 31.352  1.00 134.01 ? 61  ASP A CA  1 
ATOM   174  C C   . ASP A 1 36  ? -38.407  -12.885 30.210  1.00 132.34 ? 61  ASP A C   1 
ATOM   175  O O   . ASP A 1 36  ? -37.922  -12.673 29.097  1.00 119.86 ? 61  ASP A O   1 
ATOM   176  C CB  . ASP A 1 36  ? -36.555  -12.369 31.841  1.00 134.88 ? 61  ASP A CB  1 
ATOM   177  C CG  . ASP A 1 36  ? -37.248  -11.134 32.445  1.00 131.28 ? 61  ASP A CG  1 
ATOM   178  O OD1 . ASP A 1 36  ? -38.448  -11.201 32.790  1.00 128.68 ? 61  ASP A OD1 1 
ATOM   179  O OD2 . ASP A 1 36  ? -36.583  -10.084 32.584  1.00 115.15 ? 61  ASP A OD2 1 
ATOM   180  N N   . THR A 1 37  ? -39.684  -12.645 30.502  1.00 128.07 ? 62  THR A N   1 
ATOM   181  C CA  . THR A 1 37  ? -40.629  -12.111 29.523  1.00 124.21 ? 62  THR A CA  1 
ATOM   182  C C   . THR A 1 37  ? -40.495  -10.603 29.364  1.00 114.51 ? 62  THR A C   1 
ATOM   183  O O   . THR A 1 37  ? -39.995  -9.919  30.248  1.00 125.89 ? 62  THR A O   1 
ATOM   184  C CB  . THR A 1 37  ? -42.070  -12.426 29.924  1.00 128.35 ? 62  THR A CB  1 
ATOM   185  O OG1 . THR A 1 37  ? -42.360  -11.798 31.180  1.00 133.24 ? 62  THR A OG1 1 
ATOM   186  C CG2 . THR A 1 37  ? -42.263  -13.934 30.052  1.00 117.43 ? 62  THR A CG2 1 
ATOM   187  N N   . VAL A 1 38  ? -40.957  -10.089 28.234  1.00 106.91 ? 63  VAL A N   1 
ATOM   188  C CA  . VAL A 1 38  ? -40.749  -8.688  27.900  1.00 105.17 ? 63  VAL A CA  1 
ATOM   189  C C   . VAL A 1 38  ? -41.784  -7.758  28.516  1.00 105.03 ? 63  VAL A C   1 
ATOM   190  O O   . VAL A 1 38  ? -42.970  -8.078  28.550  1.00 99.64  ? 63  VAL A O   1 
ATOM   191  C CB  . VAL A 1 38  ? -40.760  -8.480  26.374  1.00 101.69 ? 63  VAL A CB  1 
ATOM   192  C CG1 . VAL A 1 38  ? -40.403  -7.039  26.027  1.00 99.97  ? 63  VAL A CG1 1 
ATOM   193  C CG2 . VAL A 1 38  ? -39.798  -9.439  25.711  1.00 121.12 ? 63  VAL A CG2 1 
ATOM   194  N N   . LEU A 1 39  ? -41.321  -6.616  29.020  1.00 117.27 ? 64  LEU A N   1 
ATOM   195  C CA  . LEU A 1 39  ? -42.204  -5.488  29.309  1.00 115.24 ? 64  LEU A CA  1 
ATOM   196  C C   . LEU A 1 39  ? -42.149  -4.567  28.089  1.00 114.49 ? 64  LEU A C   1 
ATOM   197  O O   . LEU A 1 39  ? -41.082  -4.083  27.722  1.00 93.45  ? 64  LEU A O   1 
ATOM   198  C CB  . LEU A 1 39  ? -41.763  -4.741  30.589  1.00 61.30  ? 64  LEU A CB  1 
ATOM   199  N N   . SER A 1 40  ? -43.278  -4.340  27.434  1.00 113.77 ? 65  SER A N   1 
ATOM   200  C CA  . SER A 1 40  ? -43.288  -3.579  26.183  1.00 107.66 ? 65  SER A CA  1 
ATOM   201  C C   . SER A 1 40  ? -44.017  -2.243  26.262  1.00 95.23  ? 65  SER A C   1 
ATOM   202  O O   . SER A 1 40  ? -44.843  -2.011  27.143  1.00 100.84 ? 65  SER A O   1 
ATOM   203  C CB  . SER A 1 40  ? -43.897  -4.424  25.058  1.00 108.83 ? 65  SER A CB  1 
ATOM   204  O OG  . SER A 1 40  ? -43.736  -3.808  23.788  1.00 90.20  ? 65  SER A OG  1 
ATOM   205  N N   . SER A 1 41  ? -43.707  -1.376  25.308  1.00 82.09  ? 66  SER A N   1 
ATOM   206  C CA  . SER A 1 41  ? -44.406  -0.115  25.145  1.00 88.43  ? 66  SER A CA  1 
ATOM   207  C C   . SER A 1 41  ? -44.234  0.326   23.702  1.00 96.91  ? 66  SER A C   1 
ATOM   208  O O   . SER A 1 41  ? -43.115  0.359   23.205  1.00 106.67 ? 66  SER A O   1 
ATOM   209  C CB  . SER A 1 41  ? -43.820  0.937   26.084  1.00 95.09  ? 66  SER A CB  1 
ATOM   210  O OG  . SER A 1 41  ? -44.419  2.204   25.876  1.00 94.79  ? 66  SER A OG  1 
ATOM   211  N N   . VAL A 1 42  ? -45.334  0.661   23.031  1.00 93.61  ? 67  VAL A N   1 
ATOM   212  C CA  . VAL A 1 42  ? -45.278  1.039   21.616  1.00 93.82  ? 67  VAL A CA  1 
ATOM   213  C C   . VAL A 1 42  ? -45.873  2.413   21.362  1.00 98.57  ? 67  VAL A C   1 
ATOM   214  O O   . VAL A 1 42  ? -46.522  2.997   22.228  1.00 105.71 ? 67  VAL A O   1 
ATOM   215  C CB  . VAL A 1 42  ? -46.017  0.042   20.695  1.00 74.92  ? 67  VAL A CB  1 
ATOM   216  C CG1 . VAL A 1 42  ? -45.372  -1.325  20.752  1.00 96.51  ? 67  VAL A CG1 1 
ATOM   217  C CG2 . VAL A 1 42  ? -47.463  -0.045  21.087  1.00 105.47 ? 67  VAL A CG2 1 
ATOM   218  N N   . THR A 1 43  ? -45.646  2.913   20.153  1.00 92.54  ? 68  THR A N   1 
ATOM   219  C CA  . THR A 1 43  ? -46.083  4.240   19.752  1.00 91.71  ? 68  THR A CA  1 
ATOM   220  C C   . THR A 1 43  ? -46.195  4.230   18.244  1.00 102.63 ? 68  THR A C   1 
ATOM   221  O O   . THR A 1 43  ? -45.240  3.891   17.544  1.00 102.12 ? 68  THR A O   1 
ATOM   222  C CB  . THR A 1 43  ? -45.044  5.306   20.121  1.00 109.23 ? 68  THR A CB  1 
ATOM   223  O OG1 . THR A 1 43  ? -45.000  5.466   21.547  1.00 131.88 ? 68  THR A OG1 1 
ATOM   224  C CG2 . THR A 1 43  ? -45.374  6.639   19.442  1.00 82.16  ? 68  THR A CG2 1 
ATOM   225  N N   . THR A 1 44  ? -47.362  4.597   17.738  1.00 115.10 ? 69  THR A N   1 
ATOM   226  C CA  . THR A 1 44  ? -47.586  4.626   16.301  1.00 91.57  ? 69  THR A CA  1 
ATOM   227  C C   . THR A 1 44  ? -47.849  6.057   15.832  1.00 87.90  ? 69  THR A C   1 
ATOM   228  O O   . THR A 1 44  ? -48.353  6.876   16.598  1.00 97.47  ? 69  THR A O   1 
ATOM   229  C CB  . THR A 1 44  ? -48.789  3.735   15.933  1.00 99.66  ? 69  THR A CB  1 
ATOM   230  O OG1 . THR A 1 44  ? -49.959  4.192   16.632  1.00 114.76 ? 69  THR A OG1 1 
ATOM   231  C CG2 . THR A 1 44  ? -48.499  2.272   16.308  1.00 84.51  ? 69  THR A CG2 1 
ATOM   232  N N   . LYS A 1 45  ? -47.484  6.370   14.593  1.00 79.30  ? 70  LYS A N   1 
ATOM   233  C CA  . LYS A 1 45  ? -47.980  7.588   13.948  1.00 94.01  ? 70  LYS A CA  1 
ATOM   234  C C   . LYS A 1 45  ? -48.182  7.330   12.460  1.00 92.77  ? 70  LYS A C   1 
ATOM   235  O O   . LYS A 1 45  ? -47.226  7.085   11.716  1.00 93.51  ? 70  LYS A O   1 
ATOM   236  C CB  . LYS A 1 45  ? -47.056  8.779   14.177  1.00 58.15  ? 70  LYS A CB  1 
ATOM   237  N N   . VAL A 1 46  ? -49.442  7.374   12.039  1.00 93.45  ? 71  VAL A N   1 
ATOM   238  C CA  . VAL A 1 46  ? -49.802  7.126   10.650  1.00 84.90  ? 71  VAL A CA  1 
ATOM   239  C C   . VAL A 1 46  ? -49.743  8.419   9.839   1.00 95.47  ? 71  VAL A C   1 
ATOM   240  O O   . VAL A 1 46  ? -50.264  9.465   10.257  1.00 86.83  ? 71  VAL A O   1 
ATOM   241  C CB  . VAL A 1 46  ? -51.209  6.503   10.545  1.00 70.49  ? 71  VAL A CB  1 
ATOM   242  C CG1 . VAL A 1 46  ? -51.684  6.484   9.110   1.00 88.26  ? 71  VAL A CG1 1 
ATOM   243  C CG2 . VAL A 1 46  ? -51.217  5.101   11.153  1.00 65.68  ? 71  VAL A CG2 1 
ATOM   244  N N   . LYS A 1 47  ? -49.114  8.339   8.672   1.00 93.59  ? 72  LYS A N   1 
ATOM   245  C CA  . LYS A 1 47  ? -49.048  9.479   7.768   1.00 100.51 ? 72  LYS A CA  1 
ATOM   246  C C   . LYS A 1 47  ? -49.619  9.136   6.395   1.00 98.08  ? 72  LYS A C   1 
ATOM   247  O O   . LYS A 1 47  ? -49.331  8.068   5.826   1.00 89.77  ? 72  LYS A O   1 
ATOM   248  C CB  . LYS A 1 47  ? -47.616  9.974   7.643   1.00 73.87  ? 72  LYS A CB  1 
ATOM   249  N N   . GLY A 1 48  ? -50.437  10.052  5.879   1.00 83.92  ? 73  GLY A N   1 
ATOM   250  C CA  . GLY A 1 48  ? -51.015  9.918   4.553   1.00 79.52  ? 73  GLY A CA  1 
ATOM   251  C C   . GLY A 1 48  ? -52.202  10.850  4.377   1.00 94.64  ? 73  GLY A C   1 
ATOM   252  O O   . GLY A 1 48  ? -52.647  11.464  5.353   1.00 100.27 ? 73  GLY A O   1 
ATOM   253  N N   . ILE A 1 49  ? -52.694  10.986  3.145   1.00 76.59  ? 74  ILE A N   1 
ATOM   254  C CA  . ILE A 1 49  ? -54.002  11.603  2.907   1.00 101.91 ? 74  ILE A CA  1 
ATOM   255  C C   . ILE A 1 49  ? -54.705  10.879  1.785   1.00 105.48 ? 74  ILE A C   1 
ATOM   256  O O   . ILE A 1 49  ? -54.072  10.200  0.974   1.00 93.69  ? 74  ILE A O   1 
ATOM   257  C CB  . ILE A 1 49  ? -53.933  13.076  2.488   1.00 85.07  ? 74  ILE A CB  1 
ATOM   258  C CG1 . ILE A 1 49  ? -53.043  13.220  1.260   1.00 111.29 ? 74  ILE A CG1 1 
ATOM   259  C CG2 . ILE A 1 49  ? -53.474  13.947  3.638   1.00 104.28 ? 74  ILE A CG2 1 
ATOM   260  C CD1 . ILE A 1 49  ? -53.051  14.597  0.681   1.00 129.92 ? 74  ILE A CD1 1 
ATOM   261  N N   . ALA A 1 50  ? -56.018  11.048  1.728   1.00 93.44  ? 75  ALA A N   1 
ATOM   262  C CA  . ALA A 1 50  ? -56.825  10.316  0.772   1.00 82.83  ? 75  ALA A CA  1 
ATOM   263  C C   . ALA A 1 50  ? -57.933  11.206  0.218   1.00 101.37 ? 75  ALA A C   1 
ATOM   264  O O   . ALA A 1 50  ? -58.528  11.998  0.958   1.00 98.95  ? 75  ALA A O   1 
ATOM   265  C CB  . ALA A 1 50  ? -57.403  9.088   1.427   1.00 96.49  ? 75  ALA A CB  1 
ATOM   266  N N   . LEU A 1 51  ? -58.176  11.086  -1.093  1.00 111.34 ? 76  LEU A N   1 
ATOM   267  C CA  . LEU A 1 51  ? -59.212  11.847  -1.805  1.00 112.28 ? 76  LEU A CA  1 
ATOM   268  C C   . LEU A 1 51  ? -60.426  10.978  -2.125  1.00 103.72 ? 76  LEU A C   1 
ATOM   269  O O   . LEU A 1 51  ? -60.280  9.793   -2.415  1.00 104.61 ? 76  LEU A O   1 
ATOM   270  C CB  . LEU A 1 51  ? -58.644  12.465  -3.108  1.00 71.15  ? 76  LEU A CB  1 
ATOM   271  N N   . THR A 1 52  ? -61.621  11.563  -2.082  1.00 88.18  ? 77  THR A N   1 
ATOM   272  C CA  . THR A 1 52  ? -62.829  10.836  -2.471  1.00 103.85 ? 77  THR A CA  1 
ATOM   273  C C   . THR A 1 52  ? -63.757  11.692  -3.316  1.00 119.39 ? 77  THR A C   1 
ATOM   274  O O   . THR A 1 52  ? -64.219  12.752  -2.874  1.00 119.67 ? 77  THR A O   1 
ATOM   275  C CB  . THR A 1 52  ? -63.656  10.306  -1.255  1.00 110.49 ? 77  THR A CB  1 
ATOM   276  O OG1 . THR A 1 52  ? -64.236  11.402  -0.527  1.00 83.60  ? 77  THR A OG1 1 
ATOM   277  C CG2 . THR A 1 52  ? -62.806  9.438   -0.337  1.00 91.73  ? 77  THR A CG2 1 
ATOM   278  N N   . ASN A 1 53  ? -64.024  11.229  -4.536  1.00 124.10 ? 78  ASN A N   1 
ATOM   279  C CA  . ASN A 1 53  ? -65.106  11.779  -5.345  1.00 135.34 ? 78  ASN A CA  1 
ATOM   280  C C   . ASN A 1 53  ? -66.397  11.053  -5.007  1.00 149.62 ? 78  ASN A C   1 
ATOM   281  O O   . ASN A 1 53  ? -66.791  10.119  -5.701  1.00 142.37 ? 78  ASN A O   1 
ATOM   282  C CB  . ASN A 1 53  ? -64.800  11.648  -6.837  1.00 139.38 ? 78  ASN A CB  1 
ATOM   283  C CG  . ASN A 1 53  ? -63.668  12.548  -7.270  1.00 156.40 ? 78  ASN A CG  1 
ATOM   284  O OD1 . ASN A 1 53  ? -62.950  13.100  -6.433  1.00 151.14 ? 78  ASN A OD1 1 
ATOM   285  N ND2 . ASN A 1 53  ? -63.478  12.682  -8.580  1.00 176.87 ? 78  ASN A ND2 1 
ATOM   286  N N   . THR A 1 54  ? -67.042  11.466  -3.922  1.00 163.62 ? 79  THR A N   1 
ATOM   287  C CA  . THR A 1 54  ? -68.320  10.884  -3.546  1.00 149.81 ? 79  THR A CA  1 
ATOM   288  C C   . THR A 1 54  ? -69.295  11.101  -4.688  1.00 153.66 ? 79  THR A C   1 
ATOM   289  O O   . THR A 1 54  ? -69.018  11.858  -5.616  1.00 152.11 ? 79  THR A O   1 
ATOM   290  C CB  . THR A 1 54  ? -68.880  11.522  -2.263  1.00 173.00 ? 79  THR A CB  1 
ATOM   291  O OG1 . THR A 1 54  ? -68.662  12.934  -2.312  1.00 183.67 ? 79  THR A OG1 1 
ATOM   292  C CG2 . THR A 1 54  ? -68.177  10.955  -1.032  1.00 157.73 ? 79  THR A CG2 1 
ATOM   293  N N   . SER A 1 55  ? -70.435  10.427  -4.627  1.00 179.78 ? 80  SER A N   1 
ATOM   294  C CA  . SER A 1 55  ? -71.434  10.561  -5.677  1.00 180.13 ? 80  SER A CA  1 
ATOM   295  C C   . SER A 1 55  ? -71.821  12.026  -5.860  1.00 176.24 ? 80  SER A C   1 
ATOM   296  O O   . SER A 1 55  ? -71.536  12.626  -6.895  1.00 149.94 ? 80  SER A O   1 
ATOM   297  C CB  . SER A 1 55  ? -72.666  9.710   -5.363  1.00 161.80 ? 80  SER A CB  1 
ATOM   298  O OG  . SER A 1 55  ? -73.112  9.918   -4.033  1.00 158.88 ? 80  SER A OG  1 
ATOM   299  N N   . GLU A 1 56  ? -72.461  12.603  -4.850  1.00 187.26 ? 81  GLU A N   1 
ATOM   300  C CA  . GLU A 1 56  ? -72.931  13.982  -4.940  1.00 184.05 ? 81  GLU A CA  1 
ATOM   301  C C   . GLU A 1 56  ? -71.955  14.979  -4.307  1.00 182.41 ? 81  GLU A C   1 
ATOM   302  O O   . GLU A 1 56  ? -71.732  16.069  -4.850  1.00 156.18 ? 81  GLU A O   1 
ATOM   303  C CB  . GLU A 1 56  ? -74.320  14.110  -4.303  1.00 207.37 ? 81  GLU A CB  1 
ATOM   304  C CG  . GLU A 1 56  ? -75.406  13.271  -4.990  1.00 217.13 ? 81  GLU A CG  1 
ATOM   305  C CD  . GLU A 1 56  ? -76.659  13.104  -4.136  1.00 222.53 ? 81  GLU A CD  1 
ATOM   306  O OE1 . GLU A 1 56  ? -76.744  13.747  -3.067  1.00 228.31 ? 81  GLU A OE1 1 
ATOM   307  O OE2 . GLU A 1 56  ? -77.557  12.327  -4.530  1.00 194.90 ? 81  GLU A OE2 1 
ATOM   308  N N   . LEU A 1 57  ? -71.371  14.587  -3.171  1.00 185.84 ? 82  LEU A N   1 
ATOM   309  C CA  . LEU A 1 57  ? -70.543  15.479  -2.350  1.00 187.90 ? 82  LEU A CA  1 
ATOM   310  C C   . LEU A 1 57  ? -69.292  15.999  -3.060  1.00 183.90 ? 82  LEU A C   1 
ATOM   311  O O   . LEU A 1 57  ? -68.667  16.962  -2.604  1.00 167.05 ? 82  LEU A O   1 
ATOM   312  C CB  . LEU A 1 57  ? -70.125  14.794  -1.045  1.00 157.41 ? 82  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 57  ? -71.181  14.186  -0.129  1.00 141.89 ? 82  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 57  ? -71.921  13.034  -0.804  1.00 131.12 ? 82  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 57  ? -70.500  13.727  1.145   1.00 126.76 ? 82  LEU A CD2 1 
ATOM   316  N N   . GLY A 1 58  ? -68.923  15.354  -4.163  1.00 188.56 ? 83  GLY A N   1 
ATOM   317  C CA  . GLY A 1 58  ? -67.765  15.767  -4.937  1.00 171.65 ? 83  GLY A CA  1 
ATOM   318  C C   . GLY A 1 58  ? -66.442  15.553  -4.221  1.00 147.89 ? 83  GLY A C   1 
ATOM   319  O O   . GLY A 1 58  ? -66.409  15.098  -3.078  1.00 137.29 ? 83  GLY A O   1 
ATOM   320  N N   . GLU A 1 59  ? -65.349  15.868  -4.912  1.00 161.15 ? 84  GLU A N   1 
ATOM   321  C CA  . GLU A 1 59  ? -63.998  15.749  -4.361  1.00 142.07 ? 84  GLU A CA  1 
ATOM   322  C C   . GLU A 1 59  ? -63.954  16.147  -2.893  1.00 109.93 ? 84  GLU A C   1 
ATOM   323  O O   . GLU A 1 59  ? -64.536  17.161  -2.510  1.00 100.59 ? 84  GLU A O   1 
ATOM   324  C CB  . GLU A 1 59  ? -63.021  16.604  -5.179  1.00 129.94 ? 84  GLU A CB  1 
ATOM   325  N N   . ARG A 1 60  ? -63.257  15.343  -2.088  1.00 127.48 ? 85  ARG A N   1 
ATOM   326  C CA  . ARG A 1 60  ? -63.147  15.551  -0.640  1.00 122.60 ? 85  ARG A CA  1 
ATOM   327  C C   . ARG A 1 60  ? -61.892  14.881  -0.077  1.00 107.27 ? 85  ARG A C   1 
ATOM   328  O O   . ARG A 1 60  ? -61.515  13.789  -0.508  1.00 107.09 ? 85  ARG A O   1 
ATOM   329  C CB  . ARG A 1 60  ? -64.381  15.004  0.078   1.00 97.33  ? 85  ARG A CB  1 
ATOM   330  C CG  . ARG A 1 60  ? -64.508  15.502  1.484   1.00 90.42  ? 85  ARG A CG  1 
ATOM   331  C CD  . ARG A 1 60  ? -65.685  14.887  2.223   1.00 118.46 ? 85  ARG A CD  1 
ATOM   332  N NE  . ARG A 1 60  ? -65.888  15.564  3.505   1.00 148.81 ? 85  ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 60  ? -65.161  15.349  4.605   1.00 128.66 ? 85  ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 60  ? -64.176  14.452  4.609   1.00 80.80  ? 85  ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 60  ? -65.419  16.035  5.713   1.00 125.07 ? 85  ARG A NH2 1 
ATOM   336  N N   . ILE A 1 61  ? -61.239  15.542  0.874   1.00 101.08 ? 86  ILE A N   1 
ATOM   337  C CA  . ILE A 1 61  ? -60.010  15.013  1.457   1.00 104.89 ? 86  ILE A CA  1 
ATOM   338  C C   . ILE A 1 61  ? -60.191  14.521  2.884   1.00 104.13 ? 86  ILE A C   1 
ATOM   339  O O   . ILE A 1 61  ? -60.941  15.105  3.667   1.00 109.04 ? 86  ILE A O   1 
ATOM   340  C CB  . ILE A 1 61  ? -58.898  16.056  1.467   1.00 105.77 ? 86  ILE A CB  1 
ATOM   341  C CG1 . ILE A 1 61  ? -57.922  15.801  0.333   1.00 108.43 ? 86  ILE A CG1 1 
ATOM   342  C CG2 . ILE A 1 61  ? -58.102  15.965  2.744   1.00 106.98 ? 86  ILE A CG2 1 
ATOM   343  C CD1 . ILE A 1 61  ? -56.535  16.337  0.644   1.00 117.46 ? 86  ILE A CD1 1 
ATOM   344  N N   . TRP A 1 62  ? -59.467  13.460  3.217   1.00 100.33 ? 87  TRP A N   1 
ATOM   345  C CA  . TRP A 1 62  ? -59.545  12.845  4.529   1.00 105.80 ? 87  TRP A CA  1 
ATOM   346  C C   . TRP A 1 62  ? -58.137  12.718  5.039   1.00 106.51 ? 87  TRP A C   1 
ATOM   347  O O   . TRP A 1 62  ? -57.406  11.835  4.592   1.00 107.05 ? 87  TRP A O   1 
ATOM   348  C CB  . TRP A 1 62  ? -60.118  11.434  4.405   1.00 99.47  ? 87  TRP A CB  1 
ATOM   349  C CG  . TRP A 1 62  ? -61.512  11.390  3.901   1.00 97.23  ? 87  TRP A CG  1 
ATOM   350  C CD1 . TRP A 1 62  ? -61.923  11.544  2.617   1.00 111.09 ? 87  TRP A CD1 1 
ATOM   351  C CD2 . TRP A 1 62  ? -62.686  11.187  4.678   1.00 92.66  ? 87  TRP A CD2 1 
ATOM   352  N NE1 . TRP A 1 62  ? -63.286  11.450  2.542   1.00 110.03 ? 87  TRP A NE1 1 
ATOM   353  C CE2 . TRP A 1 62  ? -63.779  11.231  3.799   1.00 96.60  ? 87  TRP A CE2 1 
ATOM   354  C CE3 . TRP A 1 62  ? -62.918  10.975  6.037   1.00 103.92 ? 87  TRP A CE3 1 
ATOM   355  C CZ2 . TRP A 1 62  ? -65.084  11.069  4.231   1.00 99.86  ? 87  TRP A CZ2 1 
ATOM   356  C CZ3 . TRP A 1 62  ? -64.212  10.812  6.466   1.00 104.84 ? 87  TRP A CZ3 1 
ATOM   357  C CH2 . TRP A 1 62  ? -65.283  10.863  5.566   1.00 112.02 ? 87  TRP A CH2 1 
ATOM   358  N N   . ASP A 1 63  ? -57.727  13.578  5.965   1.00 107.88 ? 88  ASP A N   1 
ATOM   359  C CA  . ASP A 1 63  ? -56.336  13.491  6.396   1.00 125.43 ? 88  ASP A CA  1 
ATOM   360  C C   . ASP A 1 63  ? -56.155  12.433  7.451   1.00 124.66 ? 88  ASP A C   1 
ATOM   361  O O   . ASP A 1 63  ? -56.365  12.698  8.640   1.00 90.92  ? 88  ASP A O   1 
ATOM   362  C CB  . ASP A 1 63  ? -55.750  14.831  6.836   1.00 101.36 ? 88  ASP A CB  1 
ATOM   363  C CG  . ASP A 1 63  ? -56.579  15.515  7.865   1.00 114.38 ? 88  ASP A CG  1 
ATOM   364  O OD1 . ASP A 1 63  ? -57.651  14.974  8.223   1.00 132.67 ? 88  ASP A OD1 1 
ATOM   365  O OD2 . ASP A 1 63  ? -56.150  16.603  8.305   1.00 98.33  ? 88  ASP A OD2 1 
ATOM   366  N N   . VAL A 1 64  ? -55.753  11.246  6.980   1.00 136.01 ? 89  VAL A N   1 
ATOM   367  C CA  . VAL A 1 64  ? -55.551  10.064  7.810   1.00 121.34 ? 89  VAL A CA  1 
ATOM   368  C C   . VAL A 1 64  ? -55.067  10.420  9.208   1.00 145.51 ? 89  VAL A C   1 
ATOM   369  O O   . VAL A 1 64  ? -55.402  9.735   10.182  1.00 145.39 ? 89  VAL A O   1 
ATOM   370  C CB  . VAL A 1 64  ? -54.643  8.996   7.125   1.00 77.76  ? 89  VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 64  ? -53.218  9.355   7.275   1.00 91.13  ? 89  VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 64  ? -54.863  7.631   7.720   1.00 70.25  ? 89  VAL A CG2 1 
ATOM   373  N N   . ALA A 1 65  ? -54.314  11.509  9.322   1.00 120.63 ? 90  ALA A N   1 
ATOM   374  C CA  . ALA A 1 65  ? -53.951  11.994  10.632  1.00 69.84  ? 90  ALA A CA  1 
ATOM   375  C C   . ALA A 1 65  ? -55.240  12.196  11.434  1.00 104.79 ? 90  ALA A C   1 
ATOM   376  O O   . ALA A 1 65  ? -55.564  11.408  12.330  1.00 103.94 ? 90  ALA A O   1 
ATOM   377  C CB  . ALA A 1 65  ? -53.173  13.282  10.509  1.00 86.19  ? 90  ALA A CB  1 
ATOM   378  N N   . ASP A 1 66  ? -55.996  13.231  11.085  1.00 98.28  ? 91  ASP A N   1 
ATOM   379  C CA  . ASP A 1 66  ? -57.097  13.673  11.939  1.00 96.98  ? 91  ASP A CA  1 
ATOM   380  C C   . ASP A 1 66  ? -58.440  13.075  11.593  1.00 98.47  ? 91  ASP A C   1 
ATOM   381  O O   . ASP A 1 66  ? -59.216  12.728  12.488  1.00 112.06 ? 91  ASP A O   1 
ATOM   382  C CB  . ASP A 1 66  ? -57.207  15.185  11.938  1.00 92.63  ? 91  ASP A CB  1 
ATOM   383  N N   . TYR A 1 67  ? -58.726  12.986  10.301  1.00 97.16  ? 92  TYR A N   1 
ATOM   384  C CA  . TYR A 1 67  ? -60.048  12.595  9.873   1.00 116.39 ? 92  TYR A CA  1 
ATOM   385  C C   . TYR A 1 67  ? -60.170  11.070  9.752   1.00 102.58 ? 92  TYR A C   1 
ATOM   386  O O   . TYR A 1 67  ? -61.262  10.514  9.853   1.00 96.24  ? 92  TYR A O   1 
ATOM   387  C CB  . TYR A 1 67  ? -60.425  13.317  8.577   1.00 111.05 ? 92  TYR A CB  1 
ATOM   388  C CG  . TYR A 1 67  ? -61.901  13.613  8.513   1.00 146.99 ? 92  TYR A CG  1 
ATOM   389  C CD1 . TYR A 1 67  ? -62.818  12.771  9.149   1.00 157.02 ? 92  TYR A CD1 1 
ATOM   390  C CD2 . TYR A 1 67  ? -62.387  14.720  7.832   1.00 142.09 ? 92  TYR A CD2 1 
ATOM   391  C CE1 . TYR A 1 67  ? -64.179  13.017  9.112   1.00 151.14 ? 92  TYR A CE1 1 
ATOM   392  C CE2 . TYR A 1 67  ? -63.758  14.977  7.788   1.00 166.94 ? 92  TYR A CE2 1 
ATOM   393  C CZ  . TYR A 1 67  ? -64.649  14.117  8.431   1.00 167.51 ? 92  TYR A CZ  1 
ATOM   394  O OH  . TYR A 1 67  ? -66.013  14.346  8.396   1.00 133.75 ? 92  TYR A OH  1 
ATOM   395  N N   . ILE A 1 68  ? -59.041  10.393  9.587   1.00 92.13  ? 93  ILE A N   1 
ATOM   396  C CA  . ILE A 1 68  ? -59.053  8.971   9.261   1.00 80.74  ? 93  ILE A CA  1 
ATOM   397  C C   . ILE A 1 68  ? -58.920  8.010   10.421  1.00 80.63  ? 93  ILE A C   1 
ATOM   398  O O   . ILE A 1 68  ? -59.170  6.814   10.260  1.00 82.03  ? 93  ILE A O   1 
ATOM   399  C CB  . ILE A 1 68  ? -57.910  8.626   8.320   1.00 84.33  ? 93  ILE A CB  1 
ATOM   400  C CG1 . ILE A 1 68  ? -58.258  9.035   6.887   1.00 111.20 ? 93  ILE A CG1 1 
ATOM   401  C CG2 . ILE A 1 68  ? -57.543  7.145   8.434   1.00 84.67  ? 93  ILE A CG2 1 
ATOM   402  C CD1 . ILE A 1 68  ? -57.245  8.635   5.845   1.00 100.67 ? 93  ILE A CD1 1 
ATOM   403  N N   . ILE A 1 69  ? -58.479  8.498   11.574  1.00 87.32  ? 94  ILE A N   1 
ATOM   404  C CA  . ILE A 1 69  ? -58.183  7.581   12.665  1.00 83.53  ? 94  ILE A CA  1 
ATOM   405  C C   . ILE A 1 69  ? -59.007  7.807   13.938  1.00 92.06  ? 94  ILE A C   1 
ATOM   406  O O   . ILE A 1 69  ? -58.608  8.572   14.812  1.00 103.30 ? 94  ILE A O   1 
ATOM   407  C CB  . ILE A 1 69  ? -56.691  7.566   12.958  1.00 56.93  ? 94  ILE A CB  1 
ATOM   408  C CG1 . ILE A 1 69  ? -55.946  7.216   11.674  1.00 71.66  ? 94  ILE A CG1 1 
ATOM   409  C CG2 . ILE A 1 69  ? -56.388  6.562   14.033  1.00 78.95  ? 94  ILE A CG2 1 
ATOM   410  C CD1 . ILE A 1 69  ? -54.498  6.879   11.877  1.00 91.92  ? 94  ILE A CD1 1 
ATOM   411  N N   . PRO A 1 70  ? -60.186  7.163   14.017  1.00 88.54  ? 95  PRO A N   1 
ATOM   412  C CA  . PRO A 1 70  ? -61.019  7.142   15.220  1.00 87.90  ? 95  PRO A CA  1 
ATOM   413  C C   . PRO A 1 70  ? -60.718  5.953   16.116  1.00 93.42  ? 95  PRO A C   1 
ATOM   414  O O   . PRO A 1 70  ? -60.859  4.812   15.676  1.00 86.50  ? 95  PRO A O   1 
ATOM   415  C CB  . PRO A 1 70  ? -62.448  6.990   14.660  1.00 77.14  ? 95  PRO A CB  1 
ATOM   416  C CG  . PRO A 1 70  ? -62.345  7.231   13.170  1.00 80.78  ? 95  PRO A CG  1 
ATOM   417  C CD  . PRO A 1 70  ? -60.962  6.764   12.832  1.00 107.03 ? 95  PRO A CD  1 
ATOM   418  N N   . PRO A 1 71  ? -60.283  6.214   17.354  1.00 94.00  ? 96  PRO A N   1 
ATOM   419  C CA  . PRO A 1 71  ? -59.770  7.512   17.758  1.00 83.32  ? 96  PRO A CA  1 
ATOM   420  C C   . PRO A 1 71  ? -58.276  7.278   17.728  1.00 112.35 ? 96  PRO A C   1 
ATOM   421  O O   . PRO A 1 71  ? -57.845  6.438   16.941  1.00 121.29 ? 96  PRO A O   1 
ATOM   422  C CB  . PRO A 1 71  ? -60.278  7.653   19.201  1.00 82.21  ? 96  PRO A CB  1 
ATOM   423  C CG  . PRO A 1 71  ? -60.911  6.298   19.556  1.00 83.46  ? 96  PRO A CG  1 
ATOM   424  C CD  . PRO A 1 71  ? -60.417  5.337   18.520  1.00 96.96  ? 96  PRO A CD  1 
ATOM   425  N N   . GLN A 1 72  ? -57.503  7.958   18.567  1.00 119.12 ? 97  GLN A N   1 
ATOM   426  C CA  . GLN A 1 72  ? -56.050  7.796   18.557  1.00 117.52 ? 97  GLN A CA  1 
ATOM   427  C C   . GLN A 1 72  ? -55.574  6.967   19.749  1.00 133.65 ? 97  GLN A C   1 
ATOM   428  O O   . GLN A 1 72  ? -55.114  7.507   20.756  1.00 111.56 ? 97  GLN A O   1 
ATOM   429  C CB  . GLN A 1 72  ? -55.359  9.157   18.531  1.00 85.29  ? 97  GLN A CB  1 
ATOM   430  C CG  . GLN A 1 72  ? -55.854  10.063  17.417  1.00 94.52  ? 97  GLN A CG  1 
ATOM   431  C CD  . GLN A 1 72  ? -57.360  10.319  17.475  1.00 87.14  ? 97  GLN A CD  1 
ATOM   432  O OE1 . GLN A 1 72  ? -57.998  10.047  18.473  1.00 67.02  ? 97  GLN A OE1 1 
ATOM   433  N NE2 . GLN A 1 72  ? -57.923  10.845  16.397  1.00 115.40 ? 97  GLN A NE2 1 
ATOM   434  N N   . GLU A 1 73  ? -55.679  5.648   19.608  1.00 163.51 ? 98  GLU A N   1 
ATOM   435  C CA  . GLU A 1 73  ? -55.372  4.698   20.679  1.00 145.30 ? 98  GLU A CA  1 
ATOM   436  C C   . GLU A 1 73  ? -53.881  4.579   21.011  1.00 151.27 ? 98  GLU A C   1 
ATOM   437  O O   . GLU A 1 73  ? -53.017  5.127   20.313  1.00 143.46 ? 98  GLU A O   1 
ATOM   438  C CB  . GLU A 1 73  ? -55.945  3.319   20.341  1.00 128.63 ? 98  GLU A CB  1 
ATOM   439  N N   . ASP A 1 74  ? -53.603  3.835   22.082  1.00 156.10 ? 99  ASP A N   1 
ATOM   440  C CA  . ASP A 1 74  ? -52.249  3.647   22.614  1.00 157.61 ? 99  ASP A CA  1 
ATOM   441  C C   . ASP A 1 74  ? -51.332  2.814   21.710  1.00 155.30 ? 99  ASP A C   1 
ATOM   442  O O   . ASP A 1 74  ? -50.633  3.360   20.838  1.00 121.63 ? 99  ASP A O   1 
ATOM   443  C CB  . ASP A 1 74  ? -52.315  3.013   24.013  1.00 153.23 ? 99  ASP A CB  1 
ATOM   444  C CG  . ASP A 1 74  ? -53.073  1.686   24.027  1.00 156.36 ? 99  ASP A CG  1 
ATOM   445  O OD1 . ASP A 1 74  ? -52.867  0.902   24.979  1.00 159.23 ? 99  ASP A OD1 1 
ATOM   446  O OD2 . ASP A 1 74  ? -53.867  1.425   23.087  1.00 133.74 ? 99  ASP A OD2 1 
ATOM   447  N N   . GLY A 1 75  ? -51.331  1.499   21.943  1.00 150.79 ? 100 GLY A N   1 
ATOM   448  C CA  . GLY A 1 75  ? -50.638  0.548   21.093  1.00 120.32 ? 100 GLY A CA  1 
ATOM   449  C C   . GLY A 1 75  ? -51.283  0.453   19.723  1.00 130.60 ? 100 GLY A C   1 
ATOM   450  O O   . GLY A 1 75  ? -50.817  1.073   18.764  1.00 134.48 ? 100 GLY A O   1 
ATOM   451  N N   . SER A 1 76  ? -52.372  -0.306  19.636  1.00 120.56 ? 101 SER A N   1 
ATOM   452  C CA  . SER A 1 76  ? -53.101  -0.504  18.378  1.00 106.87 ? 101 SER A CA  1 
ATOM   453  C C   . SER A 1 76  ? -53.706  0.784   17.791  1.00 100.54 ? 101 SER A C   1 
ATOM   454  O O   . SER A 1 76  ? -53.820  1.795   18.482  1.00 119.88 ? 101 SER A O   1 
ATOM   455  C CB  . SER A 1 76  ? -54.190  -1.560  18.581  1.00 106.81 ? 101 SER A CB  1 
ATOM   456  O OG  . SER A 1 76  ? -53.711  -2.613  19.402  1.00 124.33 ? 101 SER A OG  1 
ATOM   457  N N   . PHE A 1 77  ? -54.090  0.736   16.514  1.00 91.72  ? 102 PHE A N   1 
ATOM   458  C CA  . PHE A 1 77  ? -54.702  1.885   15.830  1.00 90.73  ? 102 PHE A CA  1 
ATOM   459  C C   . PHE A 1 77  ? -55.605  1.463   14.678  1.00 90.34  ? 102 PHE A C   1 
ATOM   460  O O   . PHE A 1 77  ? -55.437  0.387   14.104  1.00 93.33  ? 102 PHE A O   1 
ATOM   461  C CB  . PHE A 1 77  ? -53.635  2.818   15.266  1.00 92.05  ? 102 PHE A CB  1 
ATOM   462  C CG  . PHE A 1 77  ? -52.773  2.175   14.217  1.00 98.89  ? 102 PHE A CG  1 
ATOM   463  C CD1 . PHE A 1 77  ? -52.996  2.400   12.863  1.00 94.23  ? 102 PHE A CD1 1 
ATOM   464  C CD2 . PHE A 1 77  ? -51.748  1.318   14.589  1.00 85.55  ? 102 PHE A CD2 1 
ATOM   465  C CE1 . PHE A 1 77  ? -52.199  1.790   11.912  1.00 82.50  ? 102 PHE A CE1 1 
ATOM   466  C CE2 . PHE A 1 77  ? -50.958  0.714   13.650  1.00 70.40  ? 102 PHE A CE2 1 
ATOM   467  C CZ  . PHE A 1 77  ? -51.182  0.947   12.307  1.00 82.80  ? 102 PHE A CZ  1 
ATOM   468  N N   . PHE A 1 78  ? -56.531  2.339   14.304  1.00 74.10  ? 103 PHE A N   1 
ATOM   469  C CA  . PHE A 1 78  ? -57.568  1.962   13.357  1.00 71.37  ? 103 PHE A CA  1 
ATOM   470  C C   . PHE A 1 78  ? -57.729  2.948   12.220  1.00 85.02  ? 103 PHE A C   1 
ATOM   471  O O   . PHE A 1 78  ? -58.054  4.119   12.429  1.00 87.48  ? 103 PHE A O   1 
ATOM   472  C CB  . PHE A 1 78  ? -58.889  1.806   14.086  1.00 91.49  ? 103 PHE A CB  1 
ATOM   473  C CG  . PHE A 1 78  ? -60.077  1.787   13.186  1.00 82.72  ? 103 PHE A CG  1 
ATOM   474  C CD1 . PHE A 1 78  ? -60.500  0.606   12.616  1.00 73.36  ? 103 PHE A CD1 1 
ATOM   475  C CD2 . PHE A 1 78  ? -60.793  2.946   12.939  1.00 72.14  ? 103 PHE A CD2 1 
ATOM   476  C CE1 . PHE A 1 78  ? -61.594  0.590   11.806  1.00 84.06  ? 103 PHE A CE1 1 
ATOM   477  C CE2 . PHE A 1 78  ? -61.893  2.934   12.128  1.00 62.48  ? 103 PHE A CE2 1 
ATOM   478  C CZ  . PHE A 1 78  ? -62.295  1.764   11.559  1.00 78.98  ? 103 PHE A CZ  1 
ATOM   479  N N   . VAL A 1 79  ? -57.517  2.438   11.011  1.00 87.23  ? 104 VAL A N   1 
ATOM   480  C CA  . VAL A 1 79  ? -57.526  3.233   9.798   1.00 75.84  ? 104 VAL A CA  1 
ATOM   481  C C   . VAL A 1 79  ? -58.848  3.081   9.057   1.00 77.99  ? 104 VAL A C   1 
ATOM   482  O O   . VAL A 1 79  ? -59.200  1.991   8.593   1.00 77.55  ? 104 VAL A O   1 
ATOM   483  C CB  . VAL A 1 79  ? -56.384  2.785   8.879   1.00 84.99  ? 104 VAL A CB  1 
ATOM   484  C CG1 . VAL A 1 79  ? -56.326  3.650   7.633   1.00 92.79  ? 104 VAL A CG1 1 
ATOM   485  C CG2 . VAL A 1 79  ? -55.063  2.828   9.625   1.00 77.08  ? 104 VAL A CG2 1 
ATOM   486  N N   . LEU A 1 80  ? -59.579  4.182   8.953   1.00 66.12  ? 105 LEU A N   1 
ATOM   487  C CA  . LEU A 1 80  ? -60.840  4.201   8.237   1.00 71.69  ? 105 LEU A CA  1 
ATOM   488  C C   . LEU A 1 80  ? -60.584  3.977   6.755   1.00 79.73  ? 105 LEU A C   1 
ATOM   489  O O   . LEU A 1 80  ? -59.763  4.660   6.159   1.00 79.65  ? 105 LEU A O   1 
ATOM   490  C CB  . LEU A 1 80  ? -61.516  5.552   8.451   1.00 74.95  ? 105 LEU A CB  1 
ATOM   491  C CG  . LEU A 1 80  ? -62.939  5.686   7.935   1.00 80.75  ? 105 LEU A CG  1 
ATOM   492  C CD1 . LEU A 1 80  ? -63.787  4.551   8.463   1.00 92.92  ? 105 LEU A CD1 1 
ATOM   493  C CD2 . LEU A 1 80  ? -63.495  7.015   8.367   1.00 79.28  ? 105 LEU A CD2 1 
ATOM   494  N N   . THR A 1 81  ? -61.299  3.033   6.153   1.00 86.55  ? 106 THR A N   1 
ATOM   495  C CA  . THR A 1 81  ? -61.085  2.695   4.744   1.00 76.92  ? 106 THR A CA  1 
ATOM   496  C C   . THR A 1 81  ? -62.361  2.781   3.905   1.00 87.32  ? 106 THR A C   1 
ATOM   497  O O   . THR A 1 81  ? -62.291  3.073   2.710   1.00 98.24  ? 106 THR A O   1 
ATOM   498  C CB  . THR A 1 81  ? -60.477  1.290   4.569   1.00 71.07  ? 106 THR A CB  1 
ATOM   499  O OG1 . THR A 1 81  ? -61.160  0.371   5.415   1.00 76.11  ? 106 THR A OG1 1 
ATOM   500  C CG2 . THR A 1 81  ? -59.008  1.282   4.943   1.00 76.20  ? 106 THR A CG2 1 
ATOM   501  N N   . ASN A 1 82  ? -63.513  2.550   4.537   1.00 88.66  ? 107 ASN A N   1 
ATOM   502  C CA  . ASN A 1 82  ? -64.818  2.565   3.872   1.00 84.49  ? 107 ASN A CA  1 
ATOM   503  C C   . ASN A 1 82  ? -65.895  3.046   4.846   1.00 84.85  ? 107 ASN A C   1 
ATOM   504  O O   . ASN A 1 82  ? -65.676  3.052   6.058   1.00 83.39  ? 107 ASN A O   1 
ATOM   505  C CB  . ASN A 1 82  ? -65.157  1.167   3.360   1.00 85.35  ? 107 ASN A CB  1 
ATOM   506  C CG  . ASN A 1 82  ? -65.844  1.190   2.019   1.00 88.75  ? 107 ASN A CG  1 
ATOM   507  O OD1 . ASN A 1 82  ? -65.985  2.239   1.401   1.00 103.40 ? 107 ASN A OD1 1 
ATOM   508  N ND2 . ASN A 1 82  ? -66.270  0.024   1.555   1.00 83.28  ? 107 ASN A ND2 1 
ATOM   509  N N   . MET A 1 83  ? -67.060  3.433   4.331   1.00 91.32  ? 108 MET A N   1 
ATOM   510  C CA  . MET A 1 83  ? -68.079  4.065   5.176   1.00 84.26  ? 108 MET A CA  1 
ATOM   511  C C   . MET A 1 83  ? -69.466  4.197   4.549   1.00 93.62  ? 108 MET A C   1 
ATOM   512  O O   . MET A 1 83  ? -69.623  4.200   3.320   1.00 101.14 ? 108 MET A O   1 
ATOM   513  C CB  . MET A 1 83  ? -67.604  5.459   5.550   1.00 87.89  ? 108 MET A CB  1 
ATOM   514  C CG  . MET A 1 83  ? -67.095  6.205   4.343   1.00 95.72  ? 108 MET A CG  1 
ATOM   515  S SD  . MET A 1 83  ? -66.713  7.926   4.716   1.00 106.94 ? 108 MET A SD  1 
ATOM   516  C CE  . MET A 1 83  ? -65.389  7.682   5.883   1.00 97.25  ? 108 MET A CE  1 
ATOM   517  N N   . ILE A 1 84  ? -70.465  4.350   5.415   1.00 90.36  ? 109 ILE A N   1 
ATOM   518  C CA  . ILE A 1 84  ? -71.832  4.639   4.998   1.00 94.49  ? 109 ILE A CA  1 
ATOM   519  C C   . ILE A 1 84  ? -72.353  5.744   5.894   1.00 94.77  ? 109 ILE A C   1 
ATOM   520  O O   . ILE A 1 84  ? -72.652  5.522   7.064   1.00 86.90  ? 109 ILE A O   1 
ATOM   521  C CB  . ILE A 1 84  ? -72.752  3.417   5.136   1.00 84.98  ? 109 ILE A CB  1 
ATOM   522  C CG1 . ILE A 1 84  ? -72.138  2.208   4.435   1.00 85.49  ? 109 ILE A CG1 1 
ATOM   523  C CG2 . ILE A 1 84  ? -74.122  3.720   4.575   1.00 85.72  ? 109 ILE A CG2 1 
ATOM   524  C CD1 . ILE A 1 84  ? -72.955  0.959   4.580   1.00 84.43  ? 109 ILE A CD1 1 
ATOM   525  N N   . ILE A 1 85  ? -72.456  6.940   5.332   1.00 90.08  ? 110 ILE A N   1 
ATOM   526  C CA  . ILE A 1 85  ? -72.717  8.143   6.105   1.00 89.10  ? 110 ILE A CA  1 
ATOM   527  C C   . ILE A 1 85  ? -74.193  8.534   6.115   1.00 89.38  ? 110 ILE A C   1 
ATOM   528  O O   . ILE A 1 85  ? -74.771  8.823   5.070   1.00 111.69 ? 110 ILE A O   1 
ATOM   529  C CB  . ILE A 1 85  ? -71.879  9.304   5.551   1.00 93.59  ? 110 ILE A CB  1 
ATOM   530  C CG1 . ILE A 1 85  ? -70.388  8.942   5.600   1.00 85.90  ? 110 ILE A CG1 1 
ATOM   531  C CG2 . ILE A 1 85  ? -72.163  10.585  6.313   1.00 90.46  ? 110 ILE A CG2 1 
ATOM   532  C CD1 . ILE A 1 85  ? -69.481  10.015  5.025   1.00 104.59 ? 110 ILE A CD1 1 
ATOM   533  N N   . THR A 1 86  ? -74.796  8.536   7.301   1.00 85.99  ? 111 THR A N   1 
ATOM   534  C CA  . THR A 1 86  ? -76.171  8.990   7.483   1.00 85.75  ? 111 THR A CA  1 
ATOM   535  C C   . THR A 1 86  ? -76.161  10.380  8.102   1.00 87.56  ? 111 THR A C   1 
ATOM   536  O O   . THR A 1 86  ? -75.565  10.583  9.155   1.00 111.63 ? 111 THR A O   1 
ATOM   537  C CB  . THR A 1 86  ? -76.949  8.048   8.404   1.00 95.61  ? 111 THR A CB  1 
ATOM   538  O OG1 . THR A 1 86  ? -76.691  6.687   8.032   1.00 94.46  ? 111 THR A OG1 1 
ATOM   539  C CG2 . THR A 1 86  ? -78.434  8.342   8.319   1.00 95.37  ? 111 THR A CG2 1 
ATOM   540  N N   . THR A 1 87  ? -76.789  11.349  7.445   1.00 94.96  ? 112 THR A N   1 
ATOM   541  C CA  . THR A 1 87  ? -76.695  12.745  7.894   1.00 117.93 ? 112 THR A CA  1 
ATOM   542  C C   . THR A 1 87  ? -77.992  13.358  8.432   1.00 113.66 ? 112 THR A C   1 
ATOM   543  O O   . THR A 1 87  ? -79.064  12.776  8.301   1.00 124.20 ? 112 THR A O   1 
ATOM   544  C CB  . THR A 1 87  ? -76.169  13.645  6.766   1.00 99.32  ? 112 THR A CB  1 
ATOM   545  O OG1 . THR A 1 87  ? -76.941  13.413  5.582   1.00 103.61 ? 112 THR A OG1 1 
ATOM   546  C CG2 . THR A 1 87  ? -74.717  13.331  6.485   1.00 76.56  ? 112 THR A CG2 1 
ATOM   547  N N   . ASN A 1 88  ? -77.884  14.550  9.014   1.00 93.57  ? 113 ASN A N   1 
ATOM   548  C CA  . ASN A 1 88  ? -79.058  15.289  9.452   1.00 106.92 ? 113 ASN A CA  1 
ATOM   549  C C   . ASN A 1 88  ? -79.929  14.449  10.370  1.00 117.95 ? 113 ASN A C   1 
ATOM   550  O O   . ASN A 1 88  ? -81.157  14.535  10.310  1.00 117.78 ? 113 ASN A O   1 
ATOM   551  C CB  . ASN A 1 88  ? -79.878  15.772  8.253   1.00 113.74 ? 113 ASN A CB  1 
ATOM   552  C CG  . ASN A 1 88  ? -80.895  16.829  8.624   1.00 133.31 ? 113 ASN A CG  1 
ATOM   553  O OD1 . ASN A 1 88  ? -80.599  17.801  9.335   1.00 120.16 ? 113 ASN A OD1 1 
ATOM   554  N ND2 . ASN A 1 88  ? -82.115  16.647  8.129   1.00 150.95 ? 113 ASN A ND2 1 
ATOM   555  N N   . GLN A 1 89  ? -79.305  13.621  11.206  1.00 109.62 ? 114 GLN A N   1 
ATOM   556  C CA  . GLN A 1 89  ? -80.065  12.862  12.195  1.00 99.87  ? 114 GLN A CA  1 
ATOM   557  C C   . GLN A 1 89  ? -80.495  13.762  13.345  1.00 112.89 ? 114 GLN A C   1 
ATOM   558  O O   . GLN A 1 89  ? -79.746  14.638  13.773  1.00 107.69 ? 114 GLN A O   1 
ATOM   559  C CB  . GLN A 1 89  ? -79.279  11.655  12.715  1.00 91.69  ? 114 GLN A CB  1 
ATOM   560  C CG  . GLN A 1 89  ? -79.302  10.461  11.780  1.00 93.73  ? 114 GLN A CG  1 
ATOM   561  C CD  . GLN A 1 89  ? -78.825  9.187   12.444  1.00 94.98  ? 114 GLN A CD  1 
ATOM   562  O OE1 . GLN A 1 89  ? -78.111  9.225   13.443  1.00 87.94  ? 114 GLN A OE1 1 
ATOM   563  N NE2 . GLN A 1 89  ? -79.219  8.050   11.892  1.00 89.95  ? 114 GLN A NE2 1 
ATOM   564  N N   . THR A 1 90  ? -81.713  13.539  13.831  1.00 119.84 ? 115 THR A N   1 
ATOM   565  C CA  . THR A 1 90  ? -82.275  14.311  14.930  1.00 107.89 ? 115 THR A CA  1 
ATOM   566  C C   . THR A 1 90  ? -83.185  13.407  15.739  1.00 108.21 ? 115 THR A C   1 
ATOM   567  O O   . THR A 1 90  ? -83.731  12.440  15.210  1.00 105.78 ? 115 THR A O   1 
ATOM   568  C CB  . THR A 1 90  ? -83.117  15.484  14.418  1.00 108.23 ? 115 THR A CB  1 
ATOM   569  O OG1 . THR A 1 90  ? -84.211  14.983  13.638  1.00 104.06 ? 115 THR A OG1 1 
ATOM   570  C CG2 . THR A 1 90  ? -82.267  16.425  13.577  1.00 105.14 ? 115 THR A CG2 1 
ATOM   571  N N   . GLN A 1 91  ? -83.346  13.715  17.020  1.00 108.86 ? 116 GLN A N   1 
ATOM   572  C CA  . GLN A 1 91  ? -84.276  12.971  17.858  1.00 116.57 ? 116 GLN A CA  1 
ATOM   573  C C   . GLN A 1 91  ? -85.701  13.175  17.347  1.00 121.08 ? 116 GLN A C   1 
ATOM   574  O O   . GLN A 1 91  ? -86.217  14.293  17.366  1.00 121.55 ? 116 GLN A O   1 
ATOM   575  C CB  . GLN A 1 91  ? -84.154  13.418  19.319  1.00 99.89  ? 116 GLN A CB  1 
ATOM   576  C CG  . GLN A 1 91  ? -82.861  13.000  20.001  1.00 90.28  ? 116 GLN A CG  1 
ATOM   577  C CD  . GLN A 1 91  ? -82.835  11.530  20.349  1.00 108.07 ? 116 GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 91  ? -83.849  10.834  20.251  1.00 115.67 ? 116 GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 91  ? -81.673  11.046  20.762  1.00 109.66 ? 116 GLN A NE2 1 
ATOM   580  N N   . SER A 1 92  ? -86.329  12.092  16.897  1.00 106.40 ? 117 SER A N   1 
ATOM   581  C CA  . SER A 1 92  ? -87.652  12.165  16.288  1.00 99.17  ? 117 SER A CA  1 
ATOM   582  C C   . SER A 1 92  ? -88.265  10.776  16.121  1.00 102.02 ? 117 SER A C   1 
ATOM   583  O O   . SER A 1 92  ? -87.624  9.777   16.422  1.00 109.68 ? 117 SER A O   1 
ATOM   584  C CB  . SER A 1 92  ? -87.548  12.856  14.934  1.00 101.16 ? 117 SER A CB  1 
ATOM   585  O OG  . SER A 1 92  ? -88.823  12.997  14.344  1.00 132.67 ? 117 SER A OG  1 
ATOM   586  N N   . LYS A 1 93  ? -89.507  10.715  15.651  1.00 91.67  ? 118 LYS A N   1 
ATOM   587  C CA  . LYS A 1 93  ? -90.150  9.446   15.322  1.00 98.71  ? 118 LYS A CA  1 
ATOM   588  C C   . LYS A 1 93  ? -90.126  9.194   13.803  1.00 112.02 ? 118 LYS A C   1 
ATOM   589  O O   . LYS A 1 93  ? -89.899  10.122  13.023  1.00 108.03 ? 118 LYS A O   1 
ATOM   590  C CB  . LYS A 1 93  ? -91.576  9.425   15.863  1.00 86.72  ? 118 LYS A CB  1 
ATOM   591  N N   . CYS A 1 94  ? -90.364  7.945   13.396  1.00 104.28 ? 119 CYS A N   1 
ATOM   592  C CA  . CYS A 1 94  ? -90.343  7.569   11.980  1.00 104.19 ? 119 CYS A CA  1 
ATOM   593  C C   . CYS A 1 94  ? -90.517  6.067   11.770  1.00 112.13 ? 119 CYS A C   1 
ATOM   594  O O   . CYS A 1 94  ? -90.513  5.297   12.724  1.00 120.12 ? 119 CYS A O   1 
ATOM   595  C CB  . CYS A 1 94  ? -89.037  8.004   11.343  1.00 105.46 ? 119 CYS A CB  1 
ATOM   596  S SG  . CYS A 1 94  ? -87.626  7.199   12.060  1.00 117.57 ? 119 CYS A SG  1 
ATOM   597  N N   . ALA A 1 95  ? -90.663  5.655   10.514  1.00 98.49  ? 120 ALA A N   1 
ATOM   598  C CA  . ALA A 1 95  ? -90.935  4.256   10.200  1.00 109.96 ? 120 ALA A CA  1 
ATOM   599  C C   . ALA A 1 95  ? -89.701  3.386   10.357  1.00 117.34 ? 120 ALA A C   1 
ATOM   600  O O   . ALA A 1 95  ? -88.602  3.786   9.994   1.00 131.83 ? 120 ALA A O   1 
ATOM   601  C CB  . ALA A 1 95  ? -91.490  4.122   8.792   1.00 101.91 ? 120 ALA A CB  1 
ATOM   602  N N   . GLU A 1 96  ? -89.881  2.191   10.901  1.00 111.47 ? 121 GLU A N   1 
ATOM   603  C CA  . GLU A 1 96  ? -88.797  1.221   10.940  1.00 110.13 ? 121 GLU A CA  1 
ATOM   604  C C   . GLU A 1 96  ? -88.472  0.782   9.528   1.00 127.29 ? 121 GLU A C   1 
ATOM   605  O O   . GLU A 1 96  ? -89.116  1.209   8.575   1.00 122.08 ? 121 GLU A O   1 
ATOM   606  C CB  . GLU A 1 96  ? -89.184  -0.002  11.770  1.00 114.07 ? 121 GLU A CB  1 
ATOM   607  C CG  . GLU A 1 96  ? -88.921  0.139   13.245  1.00 122.76 ? 121 GLU A CG  1 
ATOM   608  C CD  . GLU A 1 96  ? -89.089  -1.169  13.980  1.00 135.77 ? 121 GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 96  ? -88.458  -1.353  15.046  1.00 132.90 ? 121 GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 96  ? -89.852  -2.016  13.479  1.00 144.15 ? 121 GLU A OE2 1 
ATOM   611  N N   . ASN A 1 97  ? -87.465  -0.071  9.394   1.00 132.71 ? 122 ASN A N   1 
ATOM   612  C CA  . ASN A 1 97  ? -87.142  -0.649  8.100   1.00 137.65 ? 122 ASN A CA  1 
ATOM   613  C C   . ASN A 1 97  ? -88.016  -1.868  7.851   1.00 140.93 ? 122 ASN A C   1 
ATOM   614  O O   . ASN A 1 97  ? -88.328  -2.603  8.781   1.00 142.49 ? 122 ASN A O   1 
ATOM   615  C CB  . ASN A 1 97  ? -85.660  -1.020  8.026   1.00 145.40 ? 122 ASN A CB  1 
ATOM   616  C CG  . ASN A 1 97  ? -84.759  0.195   7.916   1.00 148.25 ? 122 ASN A CG  1 
ATOM   617  O OD1 . ASN A 1 97  ? -85.098  1.174   7.249   1.00 128.98 ? 122 ASN A OD1 1 
ATOM   618  N ND2 . ASN A 1 97  ? -83.604  0.138   8.572   1.00 143.63 ? 122 ASN A ND2 1 
ATOM   619  N N   . PRO A 1 98  ? -88.428  -2.080  6.594   1.00 141.51 ? 123 PRO A N   1 
ATOM   620  C CA  . PRO A 1 98  ? -89.270  -3.227  6.244   1.00 125.93 ? 123 PRO A CA  1 
ATOM   621  C C   . PRO A 1 98  ? -88.644  -4.550  6.671   1.00 127.95 ? 123 PRO A C   1 
ATOM   622  O O   . PRO A 1 98  ? -87.514  -4.847  6.293   1.00 130.11 ? 123 PRO A O   1 
ATOM   623  C CB  . PRO A 1 98  ? -89.348  -3.143  4.720   1.00 140.35 ? 123 PRO A CB  1 
ATOM   624  C CG  . PRO A 1 98  ? -89.168  -1.696  4.422   1.00 136.51 ? 123 PRO A CG  1 
ATOM   625  C CD  . PRO A 1 98  ? -88.193  -1.194  5.441   1.00 140.94 ? 123 PRO A CD  1 
ATOM   626  N N   . THR A 1 99  ? -89.389  -5.332  7.448   1.00 128.66 ? 124 THR A N   1 
ATOM   627  C CA  . THR A 1 99  ? -88.907  -6.599  7.993   1.00 134.89 ? 124 THR A CA  1 
ATOM   628  C C   . THR A 1 99  ? -90.077  -7.401  8.533   1.00 142.15 ? 124 THR A C   1 
ATOM   629  O O   . THR A 1 99  ? -90.970  -6.834  9.149   1.00 151.05 ? 124 THR A O   1 
ATOM   630  C CB  . THR A 1 99  ? -87.917  -6.369  9.151   1.00 132.85 ? 124 THR A CB  1 
ATOM   631  O OG1 . THR A 1 99  ? -86.643  -5.983  8.622   1.00 146.14 ? 124 THR A OG1 1 
ATOM   632  C CG2 . THR A 1 99  ? -87.750  -7.633  9.983   1.00 124.09 ? 124 THR A CG2 1 
ATOM   633  N N   . PRO A 1 100 ? -90.073  -8.725  8.312   1.00 143.38 ? 125 PRO A N   1 
ATOM   634  C CA  . PRO A 1 100 ? -91.144  -9.604  8.799   1.00 140.27 ? 125 PRO A CA  1 
ATOM   635  C C   . PRO A 1 100 ? -91.520  -9.302  10.251  1.00 155.70 ? 125 PRO A C   1 
ATOM   636  O O   . PRO A 1 100 ? -92.698  -9.353  10.598  1.00 155.99 ? 125 PRO A O   1 
ATOM   637  C CB  . PRO A 1 100 ? -90.522  -10.996 8.695   1.00 130.33 ? 125 PRO A CB  1 
ATOM   638  C CG  . PRO A 1 100 ? -89.556  -10.882 7.570   1.00 153.25 ? 125 PRO A CG  1 
ATOM   639  C CD  . PRO A 1 100 ? -89.043  -9.465  7.563   1.00 140.30 ? 125 PRO A CD  1 
ATOM   640  N N   . ALA A 1 101 ? -90.531  -8.983  11.080  1.00 159.44 ? 126 ALA A N   1 
ATOM   641  C CA  . ALA A 1 101 ? -90.776  -8.697  12.487  1.00 145.68 ? 126 ALA A CA  1 
ATOM   642  C C   . ALA A 1 101 ? -91.300  -7.281  12.701  1.00 131.20 ? 126 ALA A C   1 
ATOM   643  O O   . ALA A 1 101 ? -92.049  -7.025  13.636  1.00 108.14 ? 126 ALA A O   1 
ATOM   644  C CB  . ALA A 1 101 ? -89.512  -8.934  13.297  1.00 127.45 ? 126 ALA A CB  1 
ATOM   645  N N   . SER A 1 102 ? -90.912  -6.373  11.815  1.00 136.98 ? 127 SER A N   1 
ATOM   646  C CA  . SER A 1 102 ? -91.256  -4.956  11.933  1.00 142.27 ? 127 SER A CA  1 
ATOM   647  C C   . SER A 1 102 ? -92.554  -4.568  11.218  1.00 153.32 ? 127 SER A C   1 
ATOM   648  O O   . SER A 1 102 ? -93.227  -3.615  11.613  1.00 146.74 ? 127 SER A O   1 
ATOM   649  C CB  . SER A 1 102 ? -90.117  -4.104  11.374  1.00 149.99 ? 127 SER A CB  1 
ATOM   650  O OG  . SER A 1 102 ? -90.026  -4.256  9.967   1.00 153.06 ? 127 SER A OG  1 
ATOM   651  N N   . THR A 1 103 ? -92.889  -5.292  10.155  1.00 160.58 ? 128 THR A N   1 
ATOM   652  C CA  . THR A 1 103 ? -94.070  -4.989  9.355   1.00 140.01 ? 128 THR A CA  1 
ATOM   653  C C   . THR A 1 103 ? -95.335  -5.073  10.188  1.00 136.85 ? 128 THR A C   1 
ATOM   654  O O   . THR A 1 103 ? -95.451  -5.905  11.087  1.00 124.09 ? 128 THR A O   1 
ATOM   655  C CB  . THR A 1 103 ? -94.223  -5.971  8.180   1.00 141.13 ? 128 THR A CB  1 
ATOM   656  O OG1 . THR A 1 103 ? -93.014  -6.007  7.419   1.00 143.00 ? 128 THR A OG1 1 
ATOM   657  C CG2 . THR A 1 103 ? -95.361  -5.549  7.276   1.00 139.01 ? 128 THR A CG2 1 
ATOM   658  N N   . CYS A 1 104 ? -96.300  -4.227  9.857   1.00 136.69 ? 129 CYS A N   1 
ATOM   659  C CA  . CYS A 1 104 ? -97.545  -4.170  10.599  1.00 134.96 ? 129 CYS A CA  1 
ATOM   660  C C   . CYS A 1 104 ? -98.727  -3.916  9.675   1.00 160.58 ? 129 CYS A C   1 
ATOM   661  O O   . CYS A 1 104 ? -98.594  -3.254  8.645   1.00 162.55 ? 129 CYS A O   1 
ATOM   662  C CB  . CYS A 1 104 ? -97.481  -3.040  11.613  1.00 139.28 ? 129 CYS A CB  1 
ATOM   663  S SG  . CYS A 1 104 ? -97.654  -1.415  10.862  1.00 139.86 ? 129 CYS A SG  1 
ATOM   664  N N   . THR A 1 105 ? -99.885  -4.442  10.062  1.00 166.32 ? 130 THR A N   1 
ATOM   665  C CA  . THR A 1 105 ? -101.130 -4.223  9.337   1.00 149.51 ? 130 THR A CA  1 
ATOM   666  C C   . THR A 1 105 ? -101.876 -3.007  9.878   1.00 149.54 ? 130 THR A C   1 
ATOM   667  O O   . THR A 1 105 ? -102.618 -2.354  9.149   1.00 125.71 ? 130 THR A O   1 
ATOM   668  C CB  . THR A 1 105 ? -102.050 -5.448  9.437   1.00 138.59 ? 130 THR A CB  1 
ATOM   669  O OG1 . THR A 1 105 ? -102.361 -5.692  10.814  1.00 162.56 ? 130 THR A OG1 1 
ATOM   670  C CG2 . THR A 1 105 ? -101.365 -6.673  8.863   1.00 118.59 ? 130 THR A CG2 1 
ATOM   671  N N   . SER A 1 106 ? -101.674 -2.710  11.160  1.00 167.41 ? 131 SER A N   1 
ATOM   672  C CA  . SER A 1 106 ? -102.385 -1.614  11.819  1.00 169.92 ? 131 SER A CA  1 
ATOM   673  C C   . SER A 1 106 ? -101.864 -1.327  13.225  1.00 169.77 ? 131 SER A C   1 
ATOM   674  O O   . SER A 1 106 ? -100.920 -1.962  13.699  1.00 162.18 ? 131 SER A O   1 
ATOM   675  C CB  . SER A 1 106 ? -103.873 -1.934  11.913  1.00 177.74 ? 131 SER A CB  1 
ATOM   676  O OG  . SER A 1 106 ? -104.084 -3.036  12.776  1.00 180.63 ? 131 SER A OG  1 
ATOM   677  N N   . HIS A 1 107 ? -102.516 -0.378  13.890  1.00 175.53 ? 132 HIS A N   1 
ATOM   678  C CA  . HIS A 1 107 ? -102.137 0.059   15.233  1.00 171.42 ? 132 HIS A CA  1 
ATOM   679  C C   . HIS A 1 107 ? -102.021 -1.093  16.231  1.00 151.71 ? 132 HIS A C   1 
ATOM   680  O O   . HIS A 1 107 ? -101.369 -0.966  17.264  1.00 149.57 ? 132 HIS A O   1 
ATOM   681  C CB  . HIS A 1 107 ? -103.146 1.098   15.741  1.00 168.18 ? 132 HIS A CB  1 
ATOM   682  C CG  . HIS A 1 107 ? -103.371 2.242   14.789  1.00 194.12 ? 132 HIS A CG  1 
ATOM   683  N ND1 . HIS A 1 107 ? -104.151 2.134   13.657  1.00 154.02 ? 132 HIS A ND1 1 
ATOM   684  C CD2 . HIS A 1 107 ? -102.909 3.517   14.807  1.00 193.27 ? 132 HIS A CD2 1 
ATOM   685  C CE1 . HIS A 1 107 ? -104.163 3.294   13.018  1.00 131.85 ? 132 HIS A CE1 1 
ATOM   686  N NE2 . HIS A 1 107 ? -103.417 4.147   13.694  1.00 169.78 ? 132 HIS A NE2 1 
ATOM   687  N N   . ARG A 1 108 ? -102.652 -2.216  15.909  1.00 159.12 ? 133 ARG A N   1 
ATOM   688  C CA  . ARG A 1 108 ? -102.689 -3.360  16.812  1.00 151.35 ? 133 ARG A CA  1 
ATOM   689  C C   . ARG A 1 108 ? -101.355 -4.100  16.896  1.00 146.03 ? 133 ARG A C   1 
ATOM   690  O O   . ARG A 1 108 ? -100.998 -4.615  17.951  1.00 146.72 ? 133 ARG A O   1 
ATOM   691  C CB  . ARG A 1 108 ? -103.815 -4.321  16.422  1.00 144.56 ? 133 ARG A CB  1 
ATOM   692  N N   . ASP A 1 109 ? -100.615 -4.150  15.793  1.00 150.26 ? 134 ASP A N   1 
ATOM   693  C CA  . ASP A 1 109 ? -99.356  -4.898  15.750  1.00 156.11 ? 134 ASP A CA  1 
ATOM   694  C C   . ASP A 1 109 ? -98.221  -4.185  16.490  1.00 145.68 ? 134 ASP A C   1 
ATOM   695  O O   . ASP A 1 109 ? -97.361  -4.823  17.097  1.00 123.76 ? 134 ASP A O   1 
ATOM   696  C CB  . ASP A 1 109 ? -98.939  -5.173  14.300  1.00 160.35 ? 134 ASP A CB  1 
ATOM   697  C CG  . ASP A 1 109 ? -100.002 -5.916  13.510  1.00 150.40 ? 134 ASP A CG  1 
ATOM   698  O OD1 . ASP A 1 109 ? -101.205 -5.714  13.773  1.00 151.19 ? 134 ASP A OD1 1 
ATOM   699  O OD2 . ASP A 1 109 ? -99.627  -6.695  12.611  1.00 150.62 ? 134 ASP A OD2 1 
ATOM   700  N N   . CYS A 1 110 ? -98.223  -2.859  16.426  1.00 143.06 ? 135 CYS A N   1 
ATOM   701  C CA  . CYS A 1 110 ? -97.206  -2.047  17.094  1.00 135.20 ? 135 CYS A CA  1 
ATOM   702  C C   . CYS A 1 110 ? -97.460  -1.925  18.596  1.00 144.59 ? 135 CYS A C   1 
ATOM   703  O O   . CYS A 1 110 ? -98.415  -1.273  19.026  1.00 143.17 ? 135 CYS A O   1 
ATOM   704  C CB  . CYS A 1 110 ? -97.149  -0.646  16.483  1.00 144.25 ? 135 CYS A CB  1 
ATOM   705  S SG  . CYS A 1 110 ? -96.552  -0.565  14.787  1.00 160.17 ? 135 CYS A SG  1 
ATOM   706  N N   . LYS A 1 111 ? -96.587  -2.552  19.380  1.00 132.66 ? 136 LYS A N   1 
ATOM   707  C CA  . LYS A 1 111 ? -96.639  -2.529  20.843  1.00 117.74 ? 136 LYS A CA  1 
ATOM   708  C C   . LYS A 1 111 ? -95.614  -1.540  21.392  1.00 109.29 ? 136 LYS A C   1 
ATOM   709  O O   . LYS A 1 111 ? -94.437  -1.636  21.061  1.00 149.79 ? 136 LYS A O   1 
ATOM   710  C CB  . LYS A 1 111 ? -96.331  -3.930  21.373  1.00 120.26 ? 136 LYS A CB  1 
ATOM   711  C CG  . LYS A 1 111 ? -95.260  -4.641  20.544  1.00 146.51 ? 136 LYS A CG  1 
ATOM   712  C CD  . LYS A 1 111 ? -95.474  -6.154  20.463  1.00 137.72 ? 136 LYS A CD  1 
ATOM   713  C CE  . LYS A 1 111 ? -94.615  -6.785  19.362  1.00 134.92 ? 136 LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 111 ? -95.013  -8.194  19.057  1.00 86.39  ? 136 LYS A NZ  1 
ATOM   715  N N   . ARG A 1 112 ? -96.051  -0.610  22.241  1.00 94.08  ? 137 ARG A N   1 
ATOM   716  C CA  . ARG A 1 112 ? -95.188  0.494   22.705  1.00 117.01 ? 137 ARG A CA  1 
ATOM   717  C C   . ARG A 1 112 ? -94.013  0.098   23.616  1.00 110.12 ? 137 ARG A C   1 
ATOM   718  O O   . ARG A 1 112 ? -94.219  -0.455  24.689  1.00 108.88 ? 137 ARG A O   1 
ATOM   719  C CB  . ARG A 1 112 ? -96.016  1.600   23.363  1.00 63.46  ? 137 ARG A CB  1 
ATOM   720  C CG  . ARG A 1 112 ? -95.245  2.880   23.588  1.00 71.49  ? 137 ARG A CG  1 
ATOM   721  C CD  . ARG A 1 112 ? -96.179  4.016   23.949  1.00 94.15  ? 137 ARG A CD  1 
ATOM   722  N NE  . ARG A 1 112 ? -95.708  5.294   23.421  1.00 128.39 ? 137 ARG A NE  1 
ATOM   723  C CZ  . ARG A 1 112 ? -96.052  6.488   23.901  1.00 136.25 ? 137 ARG A CZ  1 
ATOM   724  N NH1 . ARG A 1 112 ? -96.872  6.580   24.942  1.00 146.29 ? 137 ARG A NH1 1 
ATOM   725  N NH2 . ARG A 1 112 ? -95.565  7.595   23.345  1.00 117.11 ? 137 ARG A NH2 1 
ATOM   726  N N   . GLY A 1 113 ? -92.786  0.413   23.195  1.00 125.68 ? 138 GLY A N   1 
ATOM   727  C CA  . GLY A 1 113 ? -91.590  0.005   23.917  1.00 88.36  ? 138 GLY A CA  1 
ATOM   728  C C   . GLY A 1 113 ? -90.962  -1.310  23.460  1.00 119.49 ? 138 GLY A C   1 
ATOM   729  O O   . GLY A 1 113 ? -89.751  -1.399  23.276  1.00 115.33 ? 138 GLY A O   1 
ATOM   730  N N   . PHE A 1 114 ? -91.783  -2.336  23.274  1.00 141.87 ? 139 PHE A N   1 
ATOM   731  C CA  . PHE A 1 114 ? -91.278  -3.691  23.061  1.00 158.16 ? 139 PHE A CA  1 
ATOM   732  C C   . PHE A 1 114 ? -90.752  -3.925  21.663  1.00 121.90 ? 139 PHE A C   1 
ATOM   733  O O   . PHE A 1 114 ? -89.657  -4.436  21.464  1.00 115.63 ? 139 PHE A O   1 
ATOM   734  C CB  . PHE A 1 114 ? -92.368  -4.720  23.393  1.00 168.16 ? 139 PHE A CB  1 
ATOM   735  N N   . ASN A 1 115 ? -91.564  -3.558  20.693  1.00 144.49 ? 140 ASN A N   1 
ATOM   736  C CA  . ASN A 1 115 ? -91.172  -3.652  19.302  1.00 177.91 ? 140 ASN A CA  1 
ATOM   737  C C   . ASN A 1 115 ? -90.022  -2.666  19.021  1.00 197.10 ? 140 ASN A C   1 
ATOM   738  O O   . ASN A 1 115 ? -89.456  -2.619  17.910  1.00 183.05 ? 140 ASN A O   1 
ATOM   739  C CB  . ASN A 1 115 ? -92.368  -3.380  18.438  1.00 133.61 ? 140 ASN A CB  1 
ATOM   740  N N   . ASP A 1 116 ? -89.674  -1.904  20.059  1.00 193.77 ? 141 ASP A N   1 
ATOM   741  C CA  . ASP A 1 116 ? -88.586  -0.931  20.018  1.00 181.12 ? 141 ASP A CA  1 
ATOM   742  C C   . ASP A 1 116 ? -87.198  -1.583  19.915  1.00 175.85 ? 141 ASP A C   1 
ATOM   743  O O   . ASP A 1 116 ? -86.493  -1.422  18.911  1.00 144.18 ? 141 ASP A O   1 
ATOM   744  C CB  . ASP A 1 116 ? -88.660  -0.045  21.239  1.00 127.88 ? 141 ASP A CB  1 
ATOM   745  N N   . ALA A 1 117 ? -86.812  -2.319  20.954  1.00 158.74 ? 142 ALA A N   1 
ATOM   746  C CA  . ALA A 1 117 ? -85.500  -2.959  21.003  1.00 162.03 ? 142 ALA A CA  1 
ATOM   747  C C   . ALA A 1 117 ? -84.941  -3.469  19.642  1.00 160.72 ? 142 ALA A C   1 
ATOM   748  O O   . ALA A 1 117 ? -83.756  -3.284  19.341  1.00 102.06 ? 142 ALA A O   1 
ATOM   749  C CB  . ALA A 1 117 ? -85.514  -4.072  22.047  1.00 124.85 ? 142 ALA A CB  1 
ATOM   750  N N   . ARG A 1 118 ? -85.788  -4.079  18.813  1.00 172.10 ? 143 ARG A N   1 
ATOM   751  C CA  . ARG A 1 118 ? -85.319  -4.775  17.598  1.00 191.31 ? 143 ARG A CA  1 
ATOM   752  C C   . ARG A 1 118 ? -84.673  -3.906  16.489  1.00 182.62 ? 143 ARG A C   1 
ATOM   753  O O   . ARG A 1 118 ? -83.501  -4.095  16.120  1.00 123.87 ? 143 ARG A O   1 
ATOM   754  C CB  . ARG A 1 118 ? -86.453  -5.642  17.007  1.00 140.69 ? 143 ARG A CB  1 
ATOM   755  N N   . GLY A 1 119 ? -85.443  -2.969  15.945  1.00 174.08 ? 144 GLY A N   1 
ATOM   756  C CA  . GLY A 1 119 ? -85.003  -2.215  14.782  1.00 137.69 ? 144 GLY A CA  1 
ATOM   757  C C   . GLY A 1 119 ? -84.228  -0.927  15.029  1.00 118.96 ? 144 GLY A C   1 
ATOM   758  O O   . GLY A 1 119 ? -84.334  0.010   14.256  1.00 106.95 ? 144 GLY A O   1 
ATOM   759  N N   . ASP A 1 120 ? -83.454  -0.864  16.105  1.00 135.04 ? 145 ASP A N   1 
ATOM   760  C CA  . ASP A 1 120 ? -82.635  0.322   16.395  1.00 124.29 ? 145 ASP A CA  1 
ATOM   761  C C   . ASP A 1 120 ? -83.430  1.628   16.520  1.00 105.96 ? 145 ASP A C   1 
ATOM   762  O O   . ASP A 1 120 ? -83.086  2.636   15.909  1.00 65.83  ? 145 ASP A O   1 
ATOM   763  C CB  . ASP A 1 120 ? -81.517  0.474   15.383  1.00 97.47  ? 145 ASP A CB  1 
ATOM   764  N N   . GLY A 1 121 ? -84.477  1.590   17.340  1.00 114.10 ? 146 GLY A N   1 
ATOM   765  C CA  . GLY A 1 121 ? -85.316  2.736   17.647  1.00 104.10 ? 146 GLY A CA  1 
ATOM   766  C C   . GLY A 1 121 ? -86.440  2.231   18.541  1.00 111.61 ? 146 GLY A C   1 
ATOM   767  O O   . GLY A 1 121 ? -86.796  1.064   18.462  1.00 121.69 ? 146 GLY A O   1 
ATOM   768  N N   . VAL A 1 122 ? -86.994  3.075   19.407  1.00 122.62 ? 147 VAL A N   1 
ATOM   769  C CA  . VAL A 1 122 ? -88.097  2.633   20.276  1.00 108.50 ? 147 VAL A CA  1 
ATOM   770  C C   . VAL A 1 122 ? -89.474  2.822   19.658  1.00 111.72 ? 147 VAL A C   1 
ATOM   771  O O   . VAL A 1 122 ? -89.787  3.885   19.109  1.00 100.72 ? 147 VAL A O   1 
ATOM   772  C CB  . VAL A 1 122 ? -88.072  3.275   21.688  1.00 115.16 ? 147 VAL A CB  1 
ATOM   773  C CG1 . VAL A 1 122 ? -89.429  3.163   22.348  1.00 110.46 ? 147 VAL A CG1 1 
ATOM   774  C CG2 . VAL A 1 122 ? -87.027  2.611   22.546  1.00 82.81  ? 147 VAL A CG2 1 
ATOM   775  N N   . ARG A 1 123 ? -90.302  1.787   19.778  1.00 86.94  ? 148 ARG A N   1 
ATOM   776  C CA  . ARG A 1 123 ? -91.588  1.772   19.100  1.00 91.86  ? 148 ARG A CA  1 
ATOM   777  C C   . ARG A 1 123 ? -92.650  2.488   19.863  1.00 89.45  ? 148 ARG A C   1 
ATOM   778  O O   . ARG A 1 123 ? -92.946  2.147   20.996  1.00 109.37 ? 148 ARG A O   1 
ATOM   779  C CB  . ARG A 1 123 ? -92.066  0.354   18.819  1.00 70.54  ? 148 ARG A CB  1 
ATOM   780  C CG  . ARG A 1 123 ? -91.356  -0.248  17.647  1.00 120.45 ? 148 ARG A CG  1 
ATOM   781  C CD  . ARG A 1 123 ? -92.226  -1.169  16.835  1.00 124.01 ? 148 ARG A CD  1 
ATOM   782  N NE  . ARG A 1 123 ? -91.415  -2.202  16.192  1.00 128.64 ? 148 ARG A NE  1 
ATOM   783  C CZ  . ARG A 1 123 ? -91.874  -3.369  15.753  1.00 132.07 ? 148 ARG A CZ  1 
ATOM   784  N NH1 . ARG A 1 123 ? -93.154  -3.684  15.886  1.00 150.83 ? 148 ARG A NH1 1 
ATOM   785  N NH2 . ARG A 1 123 ? -91.040  -4.230  15.197  1.00 132.57 ? 148 ARG A NH2 1 
ATOM   786  N N   . THR A 1 124 ? -93.240  3.486   19.232  1.00 113.35 ? 149 THR A N   1 
ATOM   787  C CA  . THR A 1 124 ? -94.462  4.034   19.766  1.00 106.50 ? 149 THR A CA  1 
ATOM   788  C C   . THR A 1 124 ? -95.584  3.173   19.197  1.00 136.23 ? 149 THR A C   1 
ATOM   789  O O   . THR A 1 124 ? -95.457  2.633   18.099  1.00 149.26 ? 149 THR A O   1 
ATOM   790  C CB  . THR A 1 124 ? -94.609  5.513   19.403  1.00 106.12 ? 149 THR A CB  1 
ATOM   791  O OG1 . THR A 1 124 ? -95.965  5.923   19.594  1.00 145.17 ? 149 THR A OG1 1 
ATOM   792  C CG2 . THR A 1 124 ? -94.197  5.754   17.970  1.00 94.78  ? 149 THR A CG2 1 
ATOM   793  N N   . GLY A 1 125 ? -96.661  3.010   19.956  1.00 140.55 ? 150 GLY A N   1 
ATOM   794  C CA  . GLY A 1 125 ? -97.755  2.142   19.551  1.00 150.89 ? 150 GLY A CA  1 
ATOM   795  C C   . GLY A 1 125 ? -98.259  2.394   18.139  1.00 159.68 ? 150 GLY A C   1 
ATOM   796  O O   . GLY A 1 125 ? -98.793  1.486   17.502  1.00 156.98 ? 150 GLY A O   1 
ATOM   797  N N   . ARG A 1 126 ? -98.083  3.622   17.652  1.00 162.81 ? 151 ARG A N   1 
ATOM   798  C CA  . ARG A 1 126 ? -98.549  4.020   16.322  1.00 136.63 ? 151 ARG A CA  1 
ATOM   799  C C   . ARG A 1 126 ? -97.965  3.157   15.195  1.00 145.07 ? 151 ARG A C   1 
ATOM   800  O O   . ARG A 1 126 ? -96.803  2.749   15.255  1.00 123.90 ? 151 ARG A O   1 
ATOM   801  C CB  . ARG A 1 126 ? -98.247  5.507   16.081  1.00 76.19  ? 151 ARG A CB  1 
ATOM   802  N N   . CYS A 1 127 ? -98.785  2.873   14.182  1.00 159.27 ? 152 CYS A N   1 
ATOM   803  C CA  . CYS A 1 127 ? -98.325  2.211   12.958  1.00 145.76 ? 152 CYS A CA  1 
ATOM   804  C C   . CYS A 1 127 ? -98.356  3.168   11.768  1.00 136.78 ? 152 CYS A C   1 
ATOM   805  O O   . CYS A 1 127 ? -99.380  3.792   11.485  1.00 122.18 ? 152 CYS A O   1 
ATOM   806  C CB  . CYS A 1 127 ? -99.176  0.982   12.648  1.00 142.87 ? 152 CYS A CB  1 
ATOM   807  S SG  . CYS A 1 127 ? -98.837  0.222   11.058  1.00 123.43 ? 152 CYS A SG  1 
ATOM   808  N N   . VAL A 1 128 ? -97.234  3.268   11.066  1.00 131.87 ? 153 VAL A N   1 
ATOM   809  C CA  . VAL A 1 128 ? -97.126  4.187   9.946   1.00 133.67 ? 153 VAL A CA  1 
ATOM   810  C C   . VAL A 1 128 ? -96.590  3.508   8.700   1.00 136.91 ? 153 VAL A C   1 
ATOM   811  O O   . VAL A 1 128 ? -96.048  2.407   8.748   1.00 132.67 ? 153 VAL A O   1 
ATOM   812  C CB  . VAL A 1 128 ? -96.208  5.379   10.266  1.00 117.92 ? 153 VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 128 ? -96.855  6.295   11.280  1.00 113.29 ? 153 VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 128 ? -94.864  4.892   10.757  1.00 123.83 ? 153 VAL A CG2 1 
ATOM   815  N N   . SER A 1 129 ? -96.746  4.194   7.578   1.00 128.05 ? 154 SER A N   1 
ATOM   816  C CA  . SER A 1 129 ? -96.296  3.693   6.300   1.00 132.95 ? 154 SER A CA  1 
ATOM   817  C C   . SER A 1 129 ? -94.826  4.002   6.087   1.00 133.27 ? 154 SER A C   1 
ATOM   818  O O   . SER A 1 129 ? -94.401  5.150   6.213   1.00 104.27 ? 154 SER A O   1 
ATOM   819  C CB  . SER A 1 129 ? -97.111  4.356   5.200   1.00 152.67 ? 154 SER A CB  1 
ATOM   820  O OG  . SER A 1 129 ? -97.090  5.765   5.362   1.00 146.50 ? 154 SER A OG  1 
ATOM   821  N N   . TYR A 1 130 ? -94.057  2.970   5.759   1.00 137.23 ? 155 TYR A N   1 
ATOM   822  C CA  . TYR A 1 130 ? -92.652  3.122   5.413   1.00 135.95 ? 155 TYR A CA  1 
ATOM   823  C C   . TYR A 1 130 ? -92.568  3.709   4.020   1.00 135.14 ? 155 TYR A C   1 
ATOM   824  O O   . TYR A 1 130 ? -91.570  4.317   3.641   1.00 121.83 ? 155 TYR A O   1 
ATOM   825  C CB  . TYR A 1 130 ? -91.958  1.764   5.451   1.00 144.37 ? 155 TYR A CB  1 
ATOM   826  C CG  . TYR A 1 130 ? -90.590  1.749   4.822   1.00 142.19 ? 155 TYR A CG  1 
ATOM   827  C CD1 . TYR A 1 130 ? -90.408  1.258   3.541   1.00 148.99 ? 155 TYR A CD1 1 
ATOM   828  C CD2 . TYR A 1 130 ? -89.480  2.222   5.510   1.00 149.97 ? 155 TYR A CD2 1 
ATOM   829  C CE1 . TYR A 1 130 ? -89.161  1.238   2.956   1.00 158.66 ? 155 TYR A CE1 1 
ATOM   830  C CE2 . TYR A 1 130 ? -88.228  2.207   4.935   1.00 154.55 ? 155 TYR A CE2 1 
ATOM   831  C CZ  . TYR A 1 130 ? -88.074  1.714   3.657   1.00 157.32 ? 155 TYR A CZ  1 
ATOM   832  O OH  . TYR A 1 130 ? -86.830  1.696   3.073   1.00 144.71 ? 155 TYR A OH  1 
ATOM   833  N N   . SER A 1 131 ? -93.646  3.521   3.269   1.00 151.69 ? 156 SER A N   1 
ATOM   834  C CA  . SER A 1 131 ? -93.784  4.034   1.914   1.00 152.06 ? 156 SER A CA  1 
ATOM   835  C C   . SER A 1 131 ? -95.246  3.877   1.529   1.00 163.03 ? 156 SER A C   1 
ATOM   836  O O   . SER A 1 131 ? -96.063  3.481   2.355   1.00 167.19 ? 156 SER A O   1 
ATOM   837  C CB  . SER A 1 131 ? -92.909  3.245   0.944   1.00 146.43 ? 156 SER A CB  1 
ATOM   838  O OG  . SER A 1 131 ? -93.383  1.917   0.806   1.00 128.96 ? 156 SER A OG  1 
ATOM   839  N N   . ALA A 1 132 ? -95.580  4.170   0.278   1.00 167.23 ? 157 ALA A N   1 
ATOM   840  C CA  . ALA A 1 132 ? -96.957  4.030   -0.184  1.00 159.11 ? 157 ALA A CA  1 
ATOM   841  C C   . ALA A 1 132 ? -97.432  2.571   -0.185  1.00 154.87 ? 157 ALA A C   1 
ATOM   842  O O   . ALA A 1 132 ? -98.538  2.270   0.256   1.00 120.59 ? 157 ALA A O   1 
ATOM   843  C CB  . ALA A 1 132 ? -97.110  4.648   -1.566  1.00 140.27 ? 157 ALA A CB  1 
ATOM   844  N N   . SER A 1 133 ? -96.585  1.672   -0.677  1.00 157.27 ? 158 SER A N   1 
ATOM   845  C CA  . SER A 1 133 ? -96.958  0.267   -0.847  1.00 151.14 ? 158 SER A CA  1 
ATOM   846  C C   . SER A 1 133 ? -96.924  -0.556  0.438   1.00 163.34 ? 158 SER A C   1 
ATOM   847  O O   . SER A 1 133 ? -97.639  -1.553  0.555   1.00 145.41 ? 158 SER A O   1 
ATOM   848  C CB  . SER A 1 133 ? -96.070  -0.407  -1.900  1.00 151.93 ? 158 SER A CB  1 
ATOM   849  O OG  . SER A 1 133 ? -96.250  0.166   -3.185  1.00 153.80 ? 158 SER A OG  1 
ATOM   850  N N   . VAL A 1 134 ? -96.088  -0.152  1.392   1.00 171.76 ? 159 VAL A N   1 
ATOM   851  C CA  . VAL A 1 134 ? -95.908  -0.920  2.627   1.00 157.90 ? 159 VAL A CA  1 
ATOM   852  C C   . VAL A 1 134 ? -95.979  -0.045  3.870   1.00 144.44 ? 159 VAL A C   1 
ATOM   853  O O   . VAL A 1 134 ? -95.798  1.172   3.800   1.00 130.47 ? 159 VAL A O   1 
ATOM   854  C CB  . VAL A 1 134 ? -94.560  -1.682  2.657   1.00 147.15 ? 159 VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 134 ? -94.557  -2.823  1.651   1.00 141.12 ? 159 VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 134 ? -93.402  -0.729  2.404   1.00 149.65 ? 159 VAL A CG2 1 
ATOM   857  N N   . LYS A 1 135 ? -96.235  -0.682  5.010   1.00 151.09 ? 160 LYS A N   1 
ATOM   858  C CA  . LYS A 1 135 ? -96.371  0.020   6.281   1.00 145.90 ? 160 LYS A CA  1 
ATOM   859  C C   . LYS A 1 135 ? -95.751  -0.795  7.406   1.00 151.82 ? 160 LYS A C   1 
ATOM   860  O O   . LYS A 1 135 ? -95.852  -2.025  7.431   1.00 138.13 ? 160 LYS A O   1 
ATOM   861  C CB  . LYS A 1 135 ? -97.831  0.314   6.584   1.00 116.53 ? 160 LYS A CB  1 
ATOM   862  N N   . THR A 1 136 ? -95.118  -0.094  8.343   1.00 152.93 ? 161 THR A N   1 
ATOM   863  C CA  . THR A 1 136 ? -94.364  -0.729  9.416   1.00 140.56 ? 161 THR A CA  1 
ATOM   864  C C   . THR A 1 136 ? -94.361  0.154   10.659  1.00 143.37 ? 161 THR A C   1 
ATOM   865  O O   . THR A 1 136 ? -94.646  1.348   10.580  1.00 130.54 ? 161 THR A O   1 
ATOM   866  C CB  . THR A 1 136 ? -92.912  -0.990  8.990   1.00 140.23 ? 161 THR A CB  1 
ATOM   867  O OG1 . THR A 1 136 ? -92.298  -1.894  9.915   1.00 146.49 ? 161 THR A OG1 1 
ATOM   868  C CG2 . THR A 1 136 ? -92.120  0.319   8.932   1.00 115.47 ? 161 THR A CG2 1 
ATOM   869  N N   . CYS A 1 137 ? -94.024  -0.441  11.801  1.00 151.59 ? 162 CYS A N   1 
ATOM   870  C CA  . CYS A 1 137 ? -94.103  0.228   13.098  1.00 129.40 ? 162 CYS A CA  1 
ATOM   871  C C   . CYS A 1 137 ? -93.275  1.497   13.236  1.00 124.69 ? 162 CYS A C   1 
ATOM   872  O O   . CYS A 1 137 ? -92.086  1.509   12.932  1.00 117.29 ? 162 CYS A O   1 
ATOM   873  C CB  . CYS A 1 137 ? -93.716  -0.743  14.205  1.00 116.61 ? 162 CYS A CB  1 
ATOM   874  S SG  . CYS A 1 137 ? -95.023  -1.892  14.670  1.00 172.35 ? 162 CYS A SG  1 
ATOM   875  N N   . GLU A 1 138 ? -93.918  2.555   13.720  1.00 129.35 ? 163 GLU A N   1 
ATOM   876  C CA  . GLU A 1 138 ? -93.240  3.811   13.994  1.00 110.19 ? 163 GLU A CA  1 
ATOM   877  C C   . GLU A 1 138 ? -92.362  3.693   15.218  1.00 116.76 ? 163 GLU A C   1 
ATOM   878  O O   . GLU A 1 138 ? -92.756  3.104   16.224  1.00 100.55 ? 163 GLU A O   1 
ATOM   879  C CB  . GLU A 1 138 ? -94.244  4.937   14.215  1.00 111.17 ? 163 GLU A CB  1 
ATOM   880  C CG  . GLU A 1 138 ? -93.592  6.255   14.604  1.00 109.47 ? 163 GLU A CG  1 
ATOM   881  C CD  . GLU A 1 138 ? -94.599  7.329   14.969  1.00 119.35 ? 163 GLU A CD  1 
ATOM   882  O OE1 . GLU A 1 138 ? -94.403  8.489   14.553  1.00 114.33 ? 163 GLU A OE1 1 
ATOM   883  O OE2 . GLU A 1 138 ? -95.584  7.014   15.668  1.00 123.65 ? 163 GLU A OE2 1 
ATOM   884  N N   . VAL A 1 139 ? -91.174  4.273   15.128  1.00 117.35 ? 164 VAL A N   1 
ATOM   885  C CA  . VAL A 1 139 ? -90.227  4.238   16.223  1.00 107.65 ? 164 VAL A CA  1 
ATOM   886  C C   . VAL A 1 139 ? -89.616  5.606   16.399  1.00 103.66 ? 164 VAL A C   1 
ATOM   887  O O   . VAL A 1 139 ? -89.337  6.293   15.422  1.00 103.79 ? 164 VAL A O   1 
ATOM   888  C CB  . VAL A 1 139 ? -89.092  3.241   15.962  1.00 97.41  ? 164 VAL A CB  1 
ATOM   889  C CG1 . VAL A 1 139 ? -89.645  1.846   15.837  1.00 107.91 ? 164 VAL A CG1 1 
ATOM   890  C CG2 . VAL A 1 139 ? -88.327  3.618   14.721  1.00 101.05 ? 164 VAL A CG2 1 
ATOM   891  N N   . LEU A 1 140 ? -89.447  6.021   17.649  1.00 93.88  ? 165 LEU A N   1 
ATOM   892  C CA  . LEU A 1 140 ? -88.681  7.223   17.921  1.00 104.07 ? 165 LEU A CA  1 
ATOM   893  C C   . LEU A 1 140 ? -87.239  6.768   18.017  1.00 100.99 ? 165 LEU A C   1 
ATOM   894  O O   . LEU A 1 140 ? -86.979  5.646   18.420  1.00 79.79  ? 165 LEU A O   1 
ATOM   895  C CB  . LEU A 1 140 ? -89.185  7.962   19.170  1.00 91.22  ? 165 LEU A CB  1 
ATOM   896  C CG  . LEU A 1 140 ? -89.330  7.201   20.481  1.00 97.97  ? 165 LEU A CG  1 
ATOM   897  C CD1 . LEU A 1 140 ? -87.981  7.139   21.158  1.00 144.77 ? 165 LEU A CD1 1 
ATOM   898  C CD2 . LEU A 1 140 ? -90.334  7.878   21.389  1.00 92.17  ? 165 LEU A CD2 1 
ATOM   899  N N   . SER A 1 141 ? -86.310  7.624   17.611  1.00 99.51  ? 166 SER A N   1 
ATOM   900  C CA  . SER A 1 141 ? -84.935  7.209   17.371  1.00 91.46  ? 166 SER A CA  1 
ATOM   901  C C   . SER A 1 141 ? -84.193  8.367   16.743  1.00 98.44  ? 166 SER A C   1 
ATOM   902  O O   . SER A 1 141 ? -84.729  9.468   16.657  1.00 108.45 ? 166 SER A O   1 
ATOM   903  C CB  . SER A 1 141 ? -84.921  6.007   16.422  1.00 95.63  ? 166 SER A CB  1 
ATOM   904  O OG  . SER A 1 141 ? -83.631  5.729   15.906  1.00 85.15  ? 166 SER A OG  1 
ATOM   905  N N   . TRP A 1 142 ? -82.955  8.127   16.325  1.00 100.33 ? 167 TRP A N   1 
ATOM   906  C CA  . TRP A 1 142 ? -82.225  9.090   15.520  1.00 97.50  ? 167 TRP A CA  1 
ATOM   907  C C   . TRP A 1 142 ? -82.708  8.936   14.084  1.00 102.98 ? 167 TRP A C   1 
ATOM   908  O O   . TRP A 1 142 ? -82.502  7.890   13.467  1.00 101.66 ? 167 TRP A O   1 
ATOM   909  C CB  . TRP A 1 142 ? -80.718  8.840   15.603  1.00 98.03  ? 167 TRP A CB  1 
ATOM   910  C CG  . TRP A 1 142 ? -80.033  9.374   16.861  1.00 100.18 ? 167 TRP A CG  1 
ATOM   911  C CD1 . TRP A 1 142 ? -79.538  8.640   17.895  1.00 110.11 ? 167 TRP A CD1 1 
ATOM   912  C CD2 . TRP A 1 142 ? -79.759  10.741  17.187  1.00 90.07  ? 167 TRP A CD2 1 
ATOM   913  N NE1 . TRP A 1 142 ? -78.979  9.456   18.843  1.00 98.91  ? 167 TRP A NE1 1 
ATOM   914  C CE2 . TRP A 1 142 ? -79.107  10.755  18.429  1.00 84.29  ? 167 TRP A CE2 1 
ATOM   915  C CE3 . TRP A 1 142 ? -80.008  11.957  16.549  1.00 107.98 ? 167 TRP A CE3 1 
ATOM   916  C CZ2 . TRP A 1 142 ? -78.699  11.921  19.044  1.00 100.93 ? 167 TRP A CZ2 1 
ATOM   917  C CZ3 . TRP A 1 142 ? -79.598  13.120  17.168  1.00 103.88 ? 167 TRP A CZ3 1 
ATOM   918  C CH2 . TRP A 1 142 ? -78.954  13.091  18.400  1.00 96.52  ? 167 TRP A CH2 1 
ATOM   919  N N   . CYS A 1 143 ? -83.348  9.981   13.561  1.00 106.14 ? 168 CYS A N   1 
ATOM   920  C CA  . CYS A 1 143 ? -84.041  9.917   12.271  1.00 108.68 ? 168 CYS A CA  1 
ATOM   921  C C   . CYS A 1 143 ? -83.556  10.989  11.292  1.00 108.71 ? 168 CYS A C   1 
ATOM   922  O O   . CYS A 1 143 ? -83.281  12.118  11.694  1.00 110.32 ? 168 CYS A O   1 
ATOM   923  C CB  . CYS A 1 143 ? -85.549  10.071  12.478  1.00 101.86 ? 168 CYS A CB  1 
ATOM   924  S SG  . CYS A 1 143 ? -86.405  8.559   12.960  1.00 122.56 ? 168 CYS A SG  1 
ATOM   925  N N   . PRO A 1 144 ? -83.483  10.648  9.996   1.00 96.48  ? 169 PRO A N   1 
ATOM   926  C CA  . PRO A 1 144 ? -83.956  9.395   9.411   1.00 91.71  ? 169 PRO A CA  1 
ATOM   927  C C   . PRO A 1 144 ? -83.039  8.235   9.726   1.00 92.89  ? 169 PRO A C   1 
ATOM   928  O O   . PRO A 1 144 ? -81.866  8.401   10.035  1.00 88.46  ? 169 PRO A O   1 
ATOM   929  C CB  . PRO A 1 144 ? -83.898  9.665   7.906   1.00 108.10 ? 169 PRO A CB  1 
ATOM   930  C CG  . PRO A 1 144 ? -83.599  11.121  7.753   1.00 107.98 ? 169 PRO A CG  1 
ATOM   931  C CD  . PRO A 1 144 ? -82.865  11.509  8.981   1.00 102.80 ? 169 PRO A CD  1 
ATOM   932  N N   . LEU A 1 145 ? -83.587  7.045   9.613   1.00 97.60  ? 170 LEU A N   1 
ATOM   933  C CA  . LEU A 1 145 ? -82.833  5.838   9.866   1.00 101.52 ? 170 LEU A CA  1 
ATOM   934  C C   . LEU A 1 145 ? -81.632  5.712   8.947   1.00 98.11  ? 170 LEU A C   1 
ATOM   935  O O   . LEU A 1 145 ? -81.509  6.422   7.962   1.00 103.73 ? 170 LEU A O   1 
ATOM   936  C CB  . LEU A 1 145 ? -83.732  4.621   9.686   1.00 106.42 ? 170 LEU A CB  1 
ATOM   937  C CG  . LEU A 1 145 ? -84.324  4.003   10.950  1.00 94.06  ? 170 LEU A CG  1 
ATOM   938  C CD1 . LEU A 1 145 ? -83.203  3.532   11.850  1.00 103.83 ? 170 LEU A CD1 1 
ATOM   939  C CD2 . LEU A 1 145 ? -85.203  4.985   11.671  1.00 95.58  ? 170 LEU A CD2 1 
ATOM   940  N N   . GLU A 1 146 ? -80.733  4.801   9.281   1.00 92.00  ? 171 GLU A N   1 
ATOM   941  C CA  . GLU A 1 146 ? -79.616  4.523   8.407   1.00 98.94  ? 171 GLU A CA  1 
ATOM   942  C C   . GLU A 1 146 ? -80.157  3.611   7.347   1.00 105.67 ? 171 GLU A C   1 
ATOM   943  O O   . GLU A 1 146 ? -80.721  2.567   7.676   1.00 98.48  ? 171 GLU A O   1 
ATOM   944  C CB  . GLU A 1 146 ? -78.496  3.820   9.167   1.00 117.27 ? 171 GLU A CB  1 
ATOM   945  C CG  . GLU A 1 146 ? -77.337  3.425   8.278   1.00 119.92 ? 171 GLU A CG  1 
ATOM   946  C CD  . GLU A 1 146 ? -76.235  2.735   9.041   1.00 113.79 ? 171 GLU A CD  1 
ATOM   947  O OE1 . GLU A 1 146 ? -76.078  3.032   10.243  1.00 116.24 ? 171 GLU A OE1 1 
ATOM   948  O OE2 . GLU A 1 146 ? -75.530  1.897   8.438   1.00 104.33 ? 171 GLU A OE2 1 
ATOM   949  N N   . LYS A 1 147 ? -80.004  4.002   6.083   1.00 105.05 ? 172 LYS A N   1 
ATOM   950  C CA  . LYS A 1 147 ? -80.485  3.164   4.992   1.00 107.44 ? 172 LYS A CA  1 
ATOM   951  C C   . LYS A 1 147 ? -79.763  1.819   5.055   1.00 101.61 ? 172 LYS A C   1 
ATOM   952  O O   . LYS A 1 147 ? -78.607  1.753   5.479   1.00 99.96  ? 172 LYS A O   1 
ATOM   953  C CB  . LYS A 1 147 ? -80.280  3.845   3.645   1.00 58.85  ? 172 LYS A CB  1 
ATOM   954  N N   . ILE A 1 148 ? -80.448  0.742   4.684   1.00 106.44 ? 173 ILE A N   1 
ATOM   955  C CA  . ILE A 1 148 ? -79.804  -0.567  4.644   1.00 110.99 ? 173 ILE A CA  1 
ATOM   956  C C   . ILE A 1 148 ? -79.192  -0.809  3.263   1.00 104.85 ? 173 ILE A C   1 
ATOM   957  O O   . ILE A 1 148 ? -79.888  -1.138  2.308   1.00 89.64  ? 173 ILE A O   1 
ATOM   958  C CB  . ILE A 1 148 ? -80.780  -1.701  4.983   1.00 109.33 ? 173 ILE A CB  1 
ATOM   959  C CG1 . ILE A 1 148 ? -81.156  -1.643  6.466   1.00 139.51 ? 173 ILE A CG1 1 
ATOM   960  C CG2 . ILE A 1 148 ? -80.161  -3.047  4.649   1.00 92.58  ? 173 ILE A CG2 1 
ATOM   961  C CD1 . ILE A 1 148 ? -82.103  -2.764  6.914   1.00 158.52 ? 173 ILE A CD1 1 
ATOM   962  N N   . VAL A 1 149 ? -77.880  -0.641  3.165   1.00 101.20 ? 174 VAL A N   1 
ATOM   963  C CA  . VAL A 1 149 ? -77.195  -0.737  1.890   1.00 83.03  ? 174 VAL A CA  1 
ATOM   964  C C   . VAL A 1 149 ? -75.800  -1.313  2.092   1.00 86.08  ? 174 VAL A C   1 
ATOM   965  O O   . VAL A 1 149 ? -75.268  -1.293  3.196   1.00 91.54  ? 174 VAL A O   1 
ATOM   966  C CB  . VAL A 1 149 ? -77.094  0.638   1.192   1.00 85.90  ? 174 VAL A CB  1 
ATOM   967  C CG1 . VAL A 1 149 ? -78.447  1.339   1.179   1.00 87.51  ? 174 VAL A CG1 1 
ATOM   968  C CG2 . VAL A 1 149 ? -76.048  1.513   1.854   1.00 84.24  ? 174 VAL A CG2 1 
ATOM   969  N N   . ASP A 1 150 ? -75.215  -1.850  1.027   1.00 103.77 ? 175 ASP A N   1 
ATOM   970  C CA  . ASP A 1 150 ? -73.874  -2.416  1.114   1.00 117.10 ? 175 ASP A CA  1 
ATOM   971  C C   . ASP A 1 150 ? -72.821  -1.303  1.049   1.00 94.94  ? 175 ASP A C   1 
ATOM   972  O O   . ASP A 1 150 ? -73.094  -0.217  0.557   1.00 83.53  ? 175 ASP A O   1 
ATOM   973  C CB  . ASP A 1 150 ? -73.664  -3.495  0.039   1.00 122.19 ? 175 ASP A CB  1 
ATOM   974  C CG  . ASP A 1 150 ? -74.536  -4.727  0.269   1.00 132.72 ? 175 ASP A CG  1 
ATOM   975  O OD1 . ASP A 1 150 ? -74.718  -5.523  -0.675  1.00 134.35 ? 175 ASP A OD1 1 
ATOM   976  O OD2 . ASP A 1 150 ? -75.048  -4.905  1.396   1.00 136.89 ? 175 ASP A OD2 1 
ATOM   977  N N   . PRO A 1 151 ? -71.621  -1.558  1.582   1.00 85.75  ? 176 PRO A N   1 
ATOM   978  C CA  . PRO A 1 151 ? -70.575  -0.535  1.589   1.00 75.75  ? 176 PRO A CA  1 
ATOM   979  C C   . PRO A 1 151 ? -70.036  -0.346  0.197   1.00 90.66  ? 176 PRO A C   1 
ATOM   980  O O   . PRO A 1 151 ? -70.045  -1.294  -0.575  1.00 99.44  ? 176 PRO A O   1 
ATOM   981  C CB  . PRO A 1 151 ? -69.476  -1.159  2.445   1.00 96.90  ? 176 PRO A CB  1 
ATOM   982  C CG  . PRO A 1 151 ? -70.076  -2.382  3.077   1.00 118.58 ? 176 PRO A CG  1 
ATOM   983  C CD  . PRO A 1 151 ? -71.165  -2.823  2.171   1.00 112.60 ? 176 PRO A CD  1 
ATOM   984  N N   . PRO A 1 152 ? -69.550  0.854   -0.118  1.00 90.82  ? 177 PRO A N   1 
ATOM   985  C CA  . PRO A 1 152 ? -69.044  1.161   -1.458  1.00 96.46  ? 177 PRO A CA  1 
ATOM   986  C C   . PRO A 1 152 ? -67.896  0.261   -1.868  1.00 96.96  ? 177 PRO A C   1 
ATOM   987  O O   . PRO A 1 152 ? -67.154  -0.211  -1.006  1.00 91.79  ? 177 PRO A O   1 
ATOM   988  C CB  . PRO A 1 152 ? -68.543  2.589   -1.315  1.00 84.89  ? 177 PRO A CB  1 
ATOM   989  C CG  . PRO A 1 152 ? -69.360  3.156   -0.197  1.00 98.22  ? 177 PRO A CG  1 
ATOM   990  C CD  . PRO A 1 152 ? -69.563  2.033   0.758   1.00 86.57  ? 177 PRO A CD  1 
ATOM   991  N N   . ASN A 1 153 ? -67.765  0.035   -3.173  1.00 100.61 ? 178 ASN A N   1 
ATOM   992  C CA  . ASN A 1 153 ? -66.667  -0.744  -3.727  1.00 96.14  ? 178 ASN A CA  1 
ATOM   993  C C   . ASN A 1 153 ? -66.301  -0.230  -5.109  1.00 104.29 ? 178 ASN A C   1 
ATOM   994  O O   . ASN A 1 153 ? -67.152  -0.168  -5.993  1.00 106.34 ? 178 ASN A O   1 
ATOM   995  C CB  . ASN A 1 153 ? -67.027  -2.223  -3.811  1.00 77.21  ? 178 ASN A CB  1 
ATOM   996  C CG  . ASN A 1 153 ? -65.816  -3.094  -4.011  1.00 86.09  ? 178 ASN A CG  1 
ATOM   997  O OD1 . ASN A 1 153 ? -64.832  -2.668  -4.607  1.00 110.14 ? 178 ASN A OD1 1 
ATOM   998  N ND2 . ASN A 1 153 ? -65.872  -4.319  -3.505  1.00 83.94  ? 178 ASN A ND2 1 
ATOM   999  N N   . PRO A 1 154 ? -65.029  0.144   -5.304  1.00 102.94 ? 179 PRO A N   1 
ATOM   1000 C CA  . PRO A 1 154 ? -63.939  0.076   -4.322  1.00 103.56 ? 179 PRO A CA  1 
ATOM   1001 C C   . PRO A 1 154 ? -64.172  0.961   -3.094  1.00 101.16 ? 179 PRO A C   1 
ATOM   1002 O O   . PRO A 1 154 ? -65.102  1.763   -3.102  1.00 105.94 ? 179 PRO A O   1 
ATOM   1003 C CB  . PRO A 1 154 ? -62.734  0.578   -5.121  1.00 106.70 ? 179 PRO A CB  1 
ATOM   1004 C CG  . PRO A 1 154 ? -63.096  0.332   -6.551  1.00 93.87  ? 179 PRO A CG  1 
ATOM   1005 C CD  . PRO A 1 154 ? -64.554  0.614   -6.615  1.00 98.35  ? 179 PRO A CD  1 
ATOM   1006 N N   . PRO A 1 155 ? -63.340  0.814   -2.049  1.00 89.00  ? 180 PRO A N   1 
ATOM   1007 C CA  . PRO A 1 155 ? -63.487  1.592   -0.814  1.00 84.93  ? 180 PRO A CA  1 
ATOM   1008 C C   . PRO A 1 155 ? -63.229  3.062   -1.076  1.00 94.26  ? 180 PRO A C   1 
ATOM   1009 O O   . PRO A 1 155 ? -62.422  3.367   -1.947  1.00 101.70 ? 180 PRO A O   1 
ATOM   1010 C CB  . PRO A 1 155 ? -62.372  1.050   0.074   1.00 79.52  ? 180 PRO A CB  1 
ATOM   1011 C CG  . PRO A 1 155 ? -61.969  -0.245  -0.533  1.00 90.39  ? 180 PRO A CG  1 
ATOM   1012 C CD  . PRO A 1 155 ? -62.196  -0.107  -1.989  1.00 88.02  ? 180 PRO A CD  1 
ATOM   1013 N N   . LEU A 1 156 ? -63.882  3.954   -0.338  1.00 89.44  ? 181 LEU A N   1 
ATOM   1014 C CA  . LEU A 1 156 ? -63.681  5.381   -0.552  1.00 92.62  ? 181 LEU A CA  1 
ATOM   1015 C C   . LEU A 1 156 ? -62.275  5.783   -0.188  1.00 91.30  ? 181 LEU A C   1 
ATOM   1016 O O   . LEU A 1 156 ? -61.594  6.474   -0.945  1.00 100.10 ? 181 LEU A O   1 
ATOM   1017 C CB  . LEU A 1 156 ? -64.647  6.211   0.280   1.00 78.22  ? 181 LEU A CB  1 
ATOM   1018 C CG  . LEU A 1 156 ? -66.061  6.292   -0.265  1.00 63.11  ? 181 LEU A CG  1 
ATOM   1019 C CD1 . LEU A 1 156 ? -66.556  4.899   -0.453  1.00 91.29  ? 181 LEU A CD1 1 
ATOM   1020 C CD2 . LEU A 1 156 ? -66.963  7.049   0.680   1.00 81.08  ? 181 LEU A CD2 1 
ATOM   1021 N N   . LEU A 1 157 ? -61.847  5.362   0.992   1.00 75.14  ? 182 LEU A N   1 
ATOM   1022 C CA  . LEU A 1 157 ? -60.501  5.654   1.443   1.00 94.57  ? 182 LEU A CA  1 
ATOM   1023 C C   . LEU A 1 157 ? -59.561  4.580   0.909   1.00 96.82  ? 182 LEU A C   1 
ATOM   1024 O O   . LEU A 1 157 ? -58.765  4.021   1.660   1.00 85.82  ? 182 LEU A O   1 
ATOM   1025 C CB  . LEU A 1 157 ? -60.434  5.745   2.974   1.00 92.00  ? 182 LEU A CB  1 
ATOM   1026 C CG  . LEU A 1 157 ? -61.016  6.981   3.690   1.00 83.58  ? 182 LEU A CG  1 
ATOM   1027 C CD1 . LEU A 1 157 ? -60.384  8.275   3.208   1.00 71.97  ? 182 LEU A CD1 1 
ATOM   1028 C CD2 . LEU A 1 157 ? -62.545  7.082   3.616   1.00 90.28  ? 182 LEU A CD2 1 
ATOM   1029 N N   . ALA A 1 158 ? -59.667  4.295   -0.390  1.00 94.45  ? 183 ALA A N   1 
ATOM   1030 C CA  . ALA A 1 158 ? -58.824  3.290   -1.030  1.00 79.87  ? 183 ALA A CA  1 
ATOM   1031 C C   . ALA A 1 158 ? -57.380  3.748   -1.102  1.00 82.40  ? 183 ALA A C   1 
ATOM   1032 O O   . ALA A 1 158 ? -56.475  2.927   -1.251  1.00 70.75  ? 183 ALA A O   1 
ATOM   1033 C CB  . ALA A 1 158 ? -59.338  2.952   -2.413  1.00 86.51  ? 183 ALA A CB  1 
ATOM   1034 N N   . ASP A 1 159 ? -57.173  5.060   -1.000  1.00 85.73  ? 184 ASP A N   1 
ATOM   1035 C CA  . ASP A 1 159 ? -55.827  5.642   -0.968  1.00 99.11  ? 184 ASP A CA  1 
ATOM   1036 C C   . ASP A 1 159 ? -55.048  5.196   0.277   1.00 103.69 ? 184 ASP A C   1 
ATOM   1037 O O   . ASP A 1 159 ? -53.847  5.476   0.430   1.00 81.94  ? 184 ASP A O   1 
ATOM   1038 C CB  . ASP A 1 159 ? -55.912  7.171   -1.001  1.00 99.95  ? 184 ASP A CB  1 
ATOM   1039 C CG  . ASP A 1 159 ? -56.238  7.717   -2.386  1.00 120.43 ? 184 ASP A CG  1 
ATOM   1040 O OD1 . ASP A 1 159 ? -55.773  7.121   -3.386  1.00 122.60 ? 184 ASP A OD1 1 
ATOM   1041 O OD2 . ASP A 1 159 ? -56.942  8.753   -2.473  1.00 104.33 ? 184 ASP A OD2 1 
ATOM   1042 N N   . ALA A 1 160 ? -55.761  4.504   1.161   1.00 102.94 ? 185 ALA A N   1 
ATOM   1043 C CA  . ALA A 1 160 ? -55.223  4.018   2.422   1.00 82.79  ? 185 ALA A CA  1 
ATOM   1044 C C   . ALA A 1 160 ? -54.054  3.061   2.240   1.00 86.26  ? 185 ALA A C   1 
ATOM   1045 O O   . ALA A 1 160 ? -53.184  2.982   3.104   1.00 90.45  ? 185 ALA A O   1 
ATOM   1046 C CB  . ALA A 1 160 ? -56.320  3.340   3.218   1.00 75.68  ? 185 ALA A CB  1 
ATOM   1047 N N   . GLU A 1 161 ? -54.045  2.326   1.128   1.00 101.56 ? 186 GLU A N   1 
ATOM   1048 C CA  . GLU A 1 161 ? -53.040  1.294   0.905   1.00 94.58  ? 186 GLU A CA  1 
ATOM   1049 C C   . GLU A 1 161 ? -51.675  1.921   1.053   1.00 108.56 ? 186 GLU A C   1 
ATOM   1050 O O   . GLU A 1 161 ? -50.780  1.362   1.705   1.00 95.74  ? 186 GLU A O   1 
ATOM   1051 C CB  . GLU A 1 161 ? -53.198  0.683   -0.478  1.00 71.61  ? 186 GLU A CB  1 
ATOM   1052 N N   . ASN A 1 162 ? -51.570  3.122   0.478   1.00 103.28 ? 187 ASN A N   1 
ATOM   1053 C CA  . ASN A 1 162 ? -50.324  3.872   0.328   1.00 92.26  ? 187 ASN A CA  1 
ATOM   1054 C C   . ASN A 1 162 ? -49.937  4.672   1.573   1.00 102.70 ? 187 ASN A C   1 
ATOM   1055 O O   . ASN A 1 162 ? -48.937  5.385   1.560   1.00 112.30 ? 187 ASN A O   1 
ATOM   1056 C CB  . ASN A 1 162 ? -50.375  4.769   -0.926  1.00 94.87  ? 187 ASN A CB  1 
ATOM   1057 C CG  . ASN A 1 162 ? -49.970  4.025   -2.199  1.00 109.11 ? 187 ASN A CG  1 
ATOM   1058 O OD1 . ASN A 1 162 ? -49.366  2.943   -2.136  1.00 106.39 ? 187 ASN A OD1 1 
ATOM   1059 N ND2 . ASN A 1 162 ? -50.281  4.622   -3.371  1.00 105.59 ? 187 ASN A ND2 1 
ATOM   1060 N N   . PHE A 1 163 ? -50.714  4.546   2.650   1.00 109.60 ? 188 PHE A N   1 
ATOM   1061 C CA  . PHE A 1 163 ? -50.340  5.194   3.904   1.00 99.84  ? 188 PHE A CA  1 
ATOM   1062 C C   . PHE A 1 163 ? -49.155  4.509   4.526   1.00 92.94  ? 188 PHE A C   1 
ATOM   1063 O O   . PHE A 1 163 ? -48.771  3.406   4.130   1.00 94.36  ? 188 PHE A O   1 
ATOM   1064 C CB  . PHE A 1 163 ? -51.472  5.176   4.920   1.00 89.54  ? 188 PHE A CB  1 
ATOM   1065 C CG  . PHE A 1 163 ? -52.632  6.017   4.536   1.00 87.26  ? 188 PHE A CG  1 
ATOM   1066 C CD1 . PHE A 1 163 ? -53.913  5.625   4.838   1.00 81.01  ? 188 PHE A CD1 1 
ATOM   1067 C CD2 . PHE A 1 163 ? -52.445  7.197   3.855   1.00 99.83  ? 188 PHE A CD2 1 
ATOM   1068 C CE1 . PHE A 1 163 ? -54.979  6.406   4.476   1.00 87.60  ? 188 PHE A CE1 1 
ATOM   1069 C CE2 . PHE A 1 163 ? -53.515  7.975   3.491   1.00 101.26 ? 188 PHE A CE2 1 
ATOM   1070 C CZ  . PHE A 1 163 ? -54.782  7.578   3.801   1.00 90.43  ? 188 PHE A CZ  1 
ATOM   1071 N N   . THR A 1 164 ? -48.603  5.147   5.541   1.00 82.18  ? 189 THR A N   1 
ATOM   1072 C CA  . THR A 1 164 ? -47.459  4.571   6.193   1.00 94.28  ? 189 THR A CA  1 
ATOM   1073 C C   . THR A 1 164 ? -47.495  4.858   7.693   1.00 103.77 ? 189 THR A C   1 
ATOM   1074 O O   . THR A 1 164 ? -47.844  5.968   8.141   1.00 89.75  ? 189 THR A O   1 
ATOM   1075 C CB  . THR A 1 164 ? -46.181  5.098   5.556   1.00 86.19  ? 189 THR A CB  1 
ATOM   1076 O OG1 . THR A 1 164 ? -45.051  4.559   6.245   1.00 104.62 ? 189 THR A OG1 1 
ATOM   1077 C CG2 . THR A 1 164 ? -46.156  6.624   5.587   1.00 70.63  ? 189 THR A CG2 1 
ATOM   1078 N N   . VAL A 1 165 ? -47.166  3.832   8.468   1.00 85.75  ? 190 VAL A N   1 
ATOM   1079 C CA  . VAL A 1 165 ? -47.180  3.956   9.912   1.00 88.49  ? 190 VAL A CA  1 
ATOM   1080 C C   . VAL A 1 165 ? -45.796  3.789   10.525  1.00 97.05  ? 190 VAL A C   1 
ATOM   1081 O O   . VAL A 1 165 ? -45.132  2.758   10.346  1.00 90.97  ? 190 VAL A O   1 
ATOM   1082 C CB  . VAL A 1 165 ? -48.124  2.930   10.554  1.00 89.12  ? 190 VAL A CB  1 
ATOM   1083 C CG1 . VAL A 1 165 ? -47.645  1.508   10.292  1.00 92.02  ? 190 VAL A CG1 1 
ATOM   1084 C CG2 . VAL A 1 165 ? -48.222  3.185   12.035  1.00 95.33  ? 190 VAL A CG2 1 
ATOM   1085 N N   . LEU A 1 166 ? -45.372  4.814   11.257  1.00 93.87  ? 191 LEU A N   1 
ATOM   1086 C CA  . LEU A 1 166 ? -44.174  4.723   12.070  1.00 100.94 ? 191 LEU A CA  1 
ATOM   1087 C C   . LEU A 1 166 ? -44.477  4.013   13.379  1.00 91.55  ? 191 LEU A C   1 
ATOM   1088 O O   . LEU A 1 166 ? -45.383  4.408   14.120  1.00 74.35  ? 191 LEU A O   1 
ATOM   1089 C CB  . LEU A 1 166 ? -43.602  6.106   12.361  1.00 93.75  ? 191 LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 166 ? -42.483  6.025   13.397  1.00 96.56  ? 191 LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 166 ? -41.282  5.305   12.790  1.00 98.59  ? 191 LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 166 ? -42.107  7.408   13.908  1.00 93.13  ? 191 LEU A CD2 1 
ATOM   1093 N N   . ILE A 1 167 ? -43.696  2.981   13.670  1.00 77.68  ? 192 ILE A N   1 
ATOM   1094 C CA  . ILE A 1 167 ? -43.926  2.173   14.851  1.00 83.03  ? 192 ILE A CA  1 
ATOM   1095 C C   . ILE A 1 167 ? -42.683  2.179   15.722  1.00 92.06  ? 192 ILE A C   1 
ATOM   1096 O O   . ILE A 1 167 ? -41.684  1.545   15.392  1.00 106.41 ? 192 ILE A O   1 
ATOM   1097 C CB  . ILE A 1 167 ? -44.238  0.726   14.454  1.00 83.40  ? 192 ILE A CB  1 
ATOM   1098 C CG1 . ILE A 1 167 ? -45.442  0.699   13.512  1.00 87.42  ? 192 ILE A CG1 1 
ATOM   1099 C CG2 . ILE A 1 167 ? -44.454  -0.156  15.696  1.00 67.82  ? 192 ILE A CG2 1 
ATOM   1100 C CD1 . ILE A 1 167 ? -45.926  -0.692  13.219  1.00 97.88  ? 192 ILE A CD1 1 
ATOM   1101 N N   . LYS A 1 168 ? -42.743  2.911   16.828  1.00 91.40  ? 193 LYS A N   1 
ATOM   1102 C CA  . LYS A 1 168 ? -41.646  2.939   17.777  1.00 88.20  ? 193 LYS A CA  1 
ATOM   1103 C C   . LYS A 1 168 ? -41.938  1.884   18.852  1.00 88.52  ? 193 LYS A C   1 
ATOM   1104 O O   . LYS A 1 168 ? -43.088  1.693   19.241  1.00 96.68  ? 193 LYS A O   1 
ATOM   1105 C CB  . LYS A 1 168 ? -41.473  4.362   18.333  1.00 97.35  ? 193 LYS A CB  1 
ATOM   1106 C CG  . LYS A 1 168 ? -41.278  5.427   17.222  1.00 92.37  ? 193 LYS A CG  1 
ATOM   1107 C CD  . LYS A 1 168 ? -40.852  6.803   17.752  1.00 105.50 ? 193 LYS A CD  1 
ATOM   1108 C CE  . LYS A 1 168 ? -39.508  6.742   18.488  1.00 112.93 ? 193 LYS A CE  1 
ATOM   1109 N NZ  . LYS A 1 168 ? -39.125  8.031   19.148  1.00 127.97 ? 193 LYS A NZ  1 
ATOM   1110 N N   . ASN A 1 169 ? -40.914  1.160   19.286  1.00 83.98  ? 194 ASN A N   1 
ATOM   1111 C CA  . ASN A 1 169 ? -41.099  0.139   20.308  1.00 85.22  ? 194 ASN A CA  1 
ATOM   1112 C C   . ASN A 1 169 ? -39.924  0.057   21.286  1.00 105.81 ? 194 ASN A C   1 
ATOM   1113 O O   . ASN A 1 169 ? -38.868  -0.486  20.963  1.00 115.63 ? 194 ASN A O   1 
ATOM   1114 C CB  . ASN A 1 169 ? -41.357  -1.235  19.675  1.00 89.86  ? 194 ASN A CB  1 
ATOM   1115 C CG  . ASN A 1 169 ? -41.605  -2.330  20.724  1.00 101.50 ? 194 ASN A CG  1 
ATOM   1116 O OD1 . ASN A 1 169 ? -41.479  -3.520  20.440  1.00 94.41  ? 194 ASN A OD1 1 
ATOM   1117 N ND2 . ASN A 1 169 ? -41.971  -1.923  21.937  1.00 96.57  ? 194 ASN A ND2 1 
ATOM   1118 N N   . ASN A 1 170 ? -40.120  0.600   22.483  1.00 112.43 ? 195 ASN A N   1 
ATOM   1119 C CA  . ASN A 1 170 ? -39.156  0.469   23.557  1.00 111.35 ? 195 ASN A CA  1 
ATOM   1120 C C   . ASN A 1 170 ? -39.503  -0.751  24.413  1.00 110.08 ? 195 ASN A C   1 
ATOM   1121 O O   . ASN A 1 170 ? -40.645  -0.905  24.843  1.00 101.87 ? 195 ASN A O   1 
ATOM   1122 C CB  . ASN A 1 170 ? -39.156  1.756   24.390  1.00 130.95 ? 195 ASN A CB  1 
ATOM   1123 C CG  . ASN A 1 170 ? -38.315  1.646   25.664  1.00 157.85 ? 195 ASN A CG  1 
ATOM   1124 O OD1 . ASN A 1 170 ? -37.586  0.670   25.863  1.00 168.88 ? 195 ASN A OD1 1 
ATOM   1125 N ND2 . ASN A 1 170 ? -38.412  2.657   26.533  1.00 141.79 ? 195 ASN A ND2 1 
ATOM   1126 N N   . ILE A 1 171 ? -38.523  -1.615  24.661  1.00 106.14 ? 196 ILE A N   1 
ATOM   1127 C CA  . ILE A 1 171 ? -38.754  -2.779  25.517  1.00 120.67 ? 196 ILE A CA  1 
ATOM   1128 C C   . ILE A 1 171 ? -37.691  -2.921  26.600  1.00 121.58 ? 196 ILE A C   1 
ATOM   1129 O O   . ILE A 1 171 ? -36.585  -2.395  26.469  1.00 108.86 ? 196 ILE A O   1 
ATOM   1130 C CB  . ILE A 1 171 ? -38.849  -4.093  24.702  1.00 110.30 ? 196 ILE A CB  1 
ATOM   1131 C CG1 . ILE A 1 171 ? -37.599  -4.297  23.841  1.00 110.33 ? 196 ILE A CG1 1 
ATOM   1132 C CG2 . ILE A 1 171 ? -40.093  -4.090  23.829  1.00 108.18 ? 196 ILE A CG2 1 
ATOM   1133 C CD1 . ILE A 1 171 ? -36.439  -4.918  24.577  1.00 103.41 ? 196 ILE A CD1 1 
ATOM   1134 N N   . ARG A 1 172 ? -38.042  -3.625  27.674  1.00 121.09 ? 197 ARG A N   1 
ATOM   1135 C CA  . ARG A 1 172 ? -37.119  -3.841  28.787  1.00 129.58 ? 197 ARG A CA  1 
ATOM   1136 C C   . ARG A 1 172 ? -37.327  -5.219  29.421  1.00 129.37 ? 197 ARG A C   1 
ATOM   1137 O O   . ARG A 1 172 ? -38.451  -5.705  29.502  1.00 128.10 ? 197 ARG A O   1 
ATOM   1138 C CB  . ARG A 1 172 ? -37.271  -2.734  29.842  1.00 95.76  ? 197 ARG A CB  1 
ATOM   1139 N N   . TYR A 1 173 ? -36.233  -5.852  29.842  1.00 136.74 ? 198 TYR A N   1 
ATOM   1140 C CA  . TYR A 1 173 ? -36.295  -7.071  30.645  1.00 135.02 ? 198 TYR A CA  1 
ATOM   1141 C C   . TYR A 1 173 ? -35.979  -6.739  32.092  1.00 129.29 ? 198 TYR A C   1 
ATOM   1142 O O   . TYR A 1 173 ? -34.827  -6.491  32.441  1.00 123.44 ? 198 TYR A O   1 
ATOM   1143 C CB  . TYR A 1 173 ? -35.301  -8.114  30.149  1.00 125.87 ? 198 TYR A CB  1 
ATOM   1144 C CG  . TYR A 1 173 ? -35.593  -8.615  28.765  1.00 126.07 ? 198 TYR A CG  1 
ATOM   1145 C CD1 . TYR A 1 173 ? -34.952  -8.066  27.665  1.00 127.83 ? 198 TYR A CD1 1 
ATOM   1146 C CD2 . TYR A 1 173 ? -36.511  -9.636  28.555  1.00 120.60 ? 198 TYR A CD2 1 
ATOM   1147 C CE1 . TYR A 1 173 ? -35.210  -8.523  26.391  1.00 135.52 ? 198 TYR A CE1 1 
ATOM   1148 C CE2 . TYR A 1 173 ? -36.779  -10.102 27.287  1.00 124.77 ? 198 TYR A CE2 1 
ATOM   1149 C CZ  . TYR A 1 173 ? -36.125  -9.541  26.204  1.00 128.24 ? 198 TYR A CZ  1 
ATOM   1150 O OH  . TYR A 1 173 ? -36.387  -9.993  24.930  1.00 114.77 ? 198 TYR A OH  1 
ATOM   1151 N N   . PRO A 1 174 ? -37.002  -6.758  32.944  1.00 121.93 ? 199 PRO A N   1 
ATOM   1152 C CA  . PRO A 1 174 ? -36.875  -6.374  34.349  1.00 124.98 ? 199 PRO A CA  1 
ATOM   1153 C C   . PRO A 1 174 ? -35.763  -7.145  35.047  1.00 134.27 ? 199 PRO A C   1 
ATOM   1154 O O   . PRO A 1 174 ? -34.890  -6.530  35.661  1.00 122.27 ? 199 PRO A O   1 
ATOM   1155 C CB  . PRO A 1 174 ? -38.229  -6.774  34.934  1.00 148.83 ? 199 PRO A CB  1 
ATOM   1156 C CG  . PRO A 1 174 ? -39.159  -6.791  33.762  1.00 143.92 ? 199 PRO A CG  1 
ATOM   1157 C CD  . PRO A 1 174 ? -38.339  -7.283  32.629  1.00 123.39 ? 199 PRO A CD  1 
ATOM   1158 N N   . LYS A 1 175 ? -35.792  -8.473  34.946  1.00 148.08 ? 200 LYS A N   1 
ATOM   1159 C CA  . LYS A 1 175 ? -34.825  -9.321  35.646  1.00 136.10 ? 200 LYS A CA  1 
ATOM   1160 C C   . LYS A 1 175 ? -33.378  -8.941  35.337  1.00 125.22 ? 200 LYS A C   1 
ATOM   1161 O O   . LYS A 1 175 ? -32.572  -8.767  36.245  1.00 140.08 ? 200 LYS A O   1 
ATOM   1162 C CB  . LYS A 1 175 ? -35.066  -10.805 35.342  1.00 91.22  ? 200 LYS A CB  1 
ATOM   1163 N N   . PHE A 1 176 ? -33.056  -8.802  34.055  1.00 118.63 ? 201 PHE A N   1 
ATOM   1164 C CA  . PHE A 1 176 ? -31.695  -8.488  33.629  1.00 128.15 ? 201 PHE A CA  1 
ATOM   1165 C C   . PHE A 1 176 ? -31.389  -6.997  33.526  1.00 142.49 ? 201 PHE A C   1 
ATOM   1166 O O   . PHE A 1 176 ? -30.391  -6.611  32.909  1.00 117.47 ? 201 PHE A O   1 
ATOM   1167 C CB  . PHE A 1 176 ? -31.410  -9.148  32.286  1.00 120.26 ? 201 PHE A CB  1 
ATOM   1168 C CG  . PHE A 1 176 ? -31.763  -10.594 32.252  1.00 125.23 ? 201 PHE A CG  1 
ATOM   1169 C CD1 . PHE A 1 176 ? -31.307  -11.452 33.239  1.00 133.65 ? 201 PHE A CD1 1 
ATOM   1170 C CD2 . PHE A 1 176 ? -32.551  -11.103 31.239  1.00 131.85 ? 201 PHE A CD2 1 
ATOM   1171 C CE1 . PHE A 1 176 ? -31.631  -12.797 33.214  1.00 143.04 ? 201 PHE A CE1 1 
ATOM   1172 C CE2 . PHE A 1 176 ? -32.878  -12.447 31.209  1.00 137.00 ? 201 PHE A CE2 1 
ATOM   1173 C CZ  . PHE A 1 176 ? -32.415  -13.295 32.201  1.00 142.61 ? 201 PHE A CZ  1 
ATOM   1174 N N   . ASN A 1 177 ? -32.241  -6.166  34.120  1.00 143.59 ? 202 ASN A N   1 
ATOM   1175 C CA  . ASN A 1 177 ? -32.062  -4.722  34.047  1.00 137.26 ? 202 ASN A CA  1 
ATOM   1176 C C   . ASN A 1 177 ? -31.480  -4.310  32.701  1.00 132.47 ? 202 ASN A C   1 
ATOM   1177 O O   . ASN A 1 177 ? -30.481  -3.595  32.625  1.00 120.41 ? 202 ASN A O   1 
ATOM   1178 C CB  . ASN A 1 177 ? -31.183  -4.215  35.190  1.00 131.60 ? 202 ASN A CB  1 
ATOM   1179 C CG  . ASN A 1 177 ? -31.113  -2.699  35.237  1.00 148.05 ? 202 ASN A CG  1 
ATOM   1180 O OD1 . ASN A 1 177 ? -31.759  -2.009  34.440  1.00 128.78 ? 202 ASN A OD1 1 
ATOM   1181 N ND2 . ASN A 1 177 ? -30.328  -2.171  36.171  1.00 148.84 ? 202 ASN A ND2 1 
ATOM   1182 N N   . PHE A 1 178 ? -32.115  -4.782  31.637  1.00 137.07 ? 203 PHE A N   1 
ATOM   1183 C CA  . PHE A 1 178 ? -31.642  -4.529  30.290  1.00 125.89 ? 203 PHE A CA  1 
ATOM   1184 C C   . PHE A 1 178 ? -32.782  -4.044  29.408  1.00 117.96 ? 203 PHE A C   1 
ATOM   1185 O O   . PHE A 1 178 ? -33.890  -4.565  29.487  1.00 122.86 ? 203 PHE A O   1 
ATOM   1186 C CB  . PHE A 1 178 ? -31.065  -5.809  29.692  1.00 132.09 ? 203 PHE A CB  1 
ATOM   1187 C CG  . PHE A 1 178 ? -30.967  -5.773  28.194  1.00 139.30 ? 203 PHE A CG  1 
ATOM   1188 C CD1 . PHE A 1 178 ? -29.944  -5.067  27.569  1.00 149.76 ? 203 PHE A CD1 1 
ATOM   1189 C CD2 . PHE A 1 178 ? -31.904  -6.423  27.408  1.00 119.48 ? 203 PHE A CD2 1 
ATOM   1190 C CE1 . PHE A 1 178 ? -29.850  -5.021  26.189  1.00 134.14 ? 203 PHE A CE1 1 
ATOM   1191 C CE2 . PHE A 1 178 ? -31.813  -6.378  26.026  1.00 119.13 ? 203 PHE A CE2 1 
ATOM   1192 C CZ  . PHE A 1 178 ? -30.790  -5.678  25.416  1.00 120.98 ? 203 PHE A CZ  1 
ATOM   1193 N N   . ASN A 1 179 ? -32.506  -3.061  28.558  1.00 110.61 ? 204 ASN A N   1 
ATOM   1194 C CA  . ASN A 1 179 ? -33.528  -2.552  27.648  1.00 128.47 ? 204 ASN A CA  1 
ATOM   1195 C C   . ASN A 1 179 ? -32.979  -2.065  26.297  1.00 123.60 ? 204 ASN A C   1 
ATOM   1196 O O   . ASN A 1 179 ? -31.832  -1.631  26.211  1.00 110.75 ? 204 ASN A O   1 
ATOM   1197 C CB  . ASN A 1 179 ? -34.392  -1.487  28.339  1.00 124.72 ? 204 ASN A CB  1 
ATOM   1198 C CG  . ASN A 1 179 ? -33.603  -0.627  29.297  1.00 120.98 ? 204 ASN A CG  1 
ATOM   1199 O OD1 . ASN A 1 179 ? -34.030  -0.389  30.430  1.00 110.27 ? 204 ASN A OD1 1 
ATOM   1200 N ND2 . ASN A 1 179 ? -32.443  -0.156  28.852  1.00 129.15 ? 204 ASN A ND2 1 
ATOM   1201 N N   . LYS A 1 180 ? -33.804  -2.183  25.249  1.00 143.12 ? 205 LYS A N   1 
ATOM   1202 C CA  . LYS A 1 180 ? -33.446  -1.817  23.868  1.00 136.06 ? 205 LYS A CA  1 
ATOM   1203 C C   . LYS A 1 180 ? -34.650  -1.230  23.101  1.00 119.36 ? 205 LYS A C   1 
ATOM   1204 O O   . LYS A 1 180 ? -35.805  -1.467  23.461  1.00 118.42 ? 205 LYS A O   1 
ATOM   1205 C CB  . LYS A 1 180 ? -32.880  -3.030  23.119  1.00 88.54  ? 205 LYS A CB  1 
ATOM   1206 N N   . ARG A 1 181 ? -34.377  -0.471  22.042  1.00 104.13 ? 206 ARG A N   1 
ATOM   1207 C CA  . ARG A 1 181 ? -35.438  0.129   21.223  1.00 120.22 ? 206 ARG A CA  1 
ATOM   1208 C C   . ARG A 1 181 ? -35.326  -0.326  19.760  1.00 117.64 ? 206 ARG A C   1 
ATOM   1209 O O   . ARG A 1 181 ? -34.227  -0.540  19.252  1.00 123.29 ? 206 ARG A O   1 
ATOM   1210 C CB  . ARG A 1 181 ? -35.402  1.663   21.314  1.00 113.85 ? 206 ARG A CB  1 
ATOM   1211 C CG  . ARG A 1 181 ? -35.061  2.179   22.693  1.00 120.65 ? 206 ARG A CG  1 
ATOM   1212 C CD  . ARG A 1 181 ? -35.095  3.701   22.791  1.00 141.14 ? 206 ARG A CD  1 
ATOM   1213 N NE  . ARG A 1 181 ? -34.633  4.138   24.116  1.00 183.64 ? 206 ARG A NE  1 
ATOM   1214 C CZ  . ARG A 1 181 ? -34.922  5.315   24.674  1.00 164.80 ? 206 ARG A CZ  1 
ATOM   1215 N NH1 . ARG A 1 181 ? -35.680  6.187   24.023  1.00 158.49 ? 206 ARG A NH1 1 
ATOM   1216 N NH2 . ARG A 1 181 ? -34.462  5.622   25.888  1.00 103.55 ? 206 ARG A NH2 1 
ATOM   1217 N N   . ASN A 1 182 ? -36.465  -0.476  19.089  1.00 116.15 ? 207 ASN A N   1 
ATOM   1218 C CA  . ASN A 1 182 ? -36.506  -1.001  17.719  1.00 117.94 ? 207 ASN A CA  1 
ATOM   1219 C C   . ASN A 1 182 ? -35.818  -0.093  16.697  1.00 120.06 ? 207 ASN A C   1 
ATOM   1220 O O   . ASN A 1 182 ? -35.695  -0.446  15.518  1.00 108.99 ? 207 ASN A O   1 
ATOM   1221 C CB  . ASN A 1 182 ? -37.951  -1.243  17.288  1.00 109.21 ? 207 ASN A CB  1 
ATOM   1222 C CG  . ASN A 1 182 ? -38.737  0.046   17.171  1.00 111.46 ? 207 ASN A CG  1 
ATOM   1223 O OD1 . ASN A 1 182 ? -38.645  0.926   18.034  1.00 110.42 ? 207 ASN A OD1 1 
ATOM   1224 N ND2 . ASN A 1 182 ? -39.498  0.177   16.094  1.00 94.62  ? 207 ASN A ND2 1 
ATOM   1225 N N   . ILE A 1 183 ? -35.404  1.089   17.142  1.00 114.93 ? 208 ILE A N   1 
ATOM   1226 C CA  . ILE A 1 183 ? -34.568  1.944   16.314  1.00 126.03 ? 208 ILE A CA  1 
ATOM   1227 C C   . ILE A 1 183 ? -33.114  1.765   16.718  1.00 141.78 ? 208 ILE A C   1 
ATOM   1228 O O   . ILE A 1 183 ? -32.654  2.368   17.696  1.00 127.32 ? 208 ILE A O   1 
ATOM   1229 C CB  . ILE A 1 183 ? -34.919  3.413   16.489  1.00 119.02 ? 208 ILE A CB  1 
ATOM   1230 C CG1 . ILE A 1 183 ? -36.427  3.620   16.366  1.00 92.52  ? 208 ILE A CG1 1 
ATOM   1231 C CG2 . ILE A 1 183 ? -34.180  4.259   15.460  1.00 128.47 ? 208 ILE A CG2 1 
ATOM   1232 C CD1 . ILE A 1 183 ? -36.855  5.021   16.725  1.00 113.77 ? 208 ILE A CD1 1 
ATOM   1233 N N   . LEU A 1 184 ? -32.393  0.943   15.962  1.00 137.71 ? 209 LEU A N   1 
ATOM   1234 C CA  . LEU A 1 184 ? -31.004  0.628   16.280  1.00 146.46 ? 209 LEU A CA  1 
ATOM   1235 C C   . LEU A 1 184 ? -30.111  1.872   16.205  1.00 156.35 ? 209 LEU A C   1 
ATOM   1236 O O   . LEU A 1 184 ? -30.377  2.787   15.419  1.00 156.29 ? 209 LEU A O   1 
ATOM   1237 C CB  . LEU A 1 184 ? -30.491  -0.483  15.359  1.00 159.55 ? 209 LEU A CB  1 
ATOM   1238 C CG  . LEU A 1 184 ? -31.084  -1.883  15.572  1.00 141.01 ? 209 LEU A CG  1 
ATOM   1239 C CD1 . LEU A 1 184 ? -32.601  -1.913  15.387  1.00 133.15 ? 209 LEU A CD1 1 
ATOM   1240 C CD2 . LEU A 1 184 ? -30.414  -2.879  14.636  1.00 156.66 ? 209 LEU A CD2 1 
ATOM   1241 N N   . PRO A 1 185 ? -29.049  1.907   17.033  1.00 157.93 ? 210 PRO A N   1 
ATOM   1242 C CA  . PRO A 1 185 ? -28.179  3.083   17.189  1.00 163.20 ? 210 PRO A CA  1 
ATOM   1243 C C   . PRO A 1 185 ? -27.388  3.410   15.928  1.00 146.91 ? 210 PRO A C   1 
ATOM   1244 O O   . PRO A 1 185 ? -26.968  4.556   15.729  1.00 128.69 ? 210 PRO A O   1 
ATOM   1245 C CB  . PRO A 1 185 ? -27.216  2.666   18.311  1.00 163.30 ? 210 PRO A CB  1 
ATOM   1246 C CG  . PRO A 1 185 ? -27.890  1.513   19.002  1.00 147.73 ? 210 PRO A CG  1 
ATOM   1247 C CD  . PRO A 1 185 ? -28.645  0.805   17.922  1.00 131.61 ? 210 PRO A CD  1 
ATOM   1248 N N   . ASN A 1 186 ? -27.182  2.399   15.093  1.00 144.35 ? 211 ASN A N   1 
ATOM   1249 C CA  . ASN A 1 186 ? -26.463  2.572   13.844  1.00 162.06 ? 211 ASN A CA  1 
ATOM   1250 C C   . ASN A 1 186 ? -27.378  3.107   12.748  1.00 157.27 ? 211 ASN A C   1 
ATOM   1251 O O   . ASN A 1 186 ? -27.374  2.590   11.629  1.00 170.06 ? 211 ASN A O   1 
ATOM   1252 C CB  . ASN A 1 186 ? -25.840  1.251   13.420  1.00 164.88 ? 211 ASN A CB  1 
ATOM   1253 N N   . ILE A 1 187 ? -28.158  4.140   13.057  1.00 139.77 ? 212 ILE A N   1 
ATOM   1254 C CA  . ILE A 1 187 ? -29.105  4.654   12.067  1.00 141.49 ? 212 ILE A CA  1 
ATOM   1255 C C   . ILE A 1 187 ? -29.199  6.185   11.993  1.00 135.67 ? 212 ILE A C   1 
ATOM   1256 O O   . ILE A 1 187 ? -29.458  6.867   12.988  1.00 118.12 ? 212 ILE A O   1 
ATOM   1257 C CB  . ILE A 1 187 ? -30.516  4.029   12.243  1.00 135.71 ? 212 ILE A CB  1 
ATOM   1258 C CG1 . ILE A 1 187 ? -30.466  2.518   11.992  1.00 138.89 ? 212 ILE A CG1 1 
ATOM   1259 C CG2 . ILE A 1 187 ? -31.523  4.677   11.304  1.00 115.12 ? 212 ILE A CG2 1 
ATOM   1260 C CD1 . ILE A 1 187 ? -31.822  1.828   12.073  1.00 150.77 ? 212 ILE A CD1 1 
ATOM   1261 N N   . ASN A 1 188 ? -28.986  6.702   10.786  1.00 136.89 ? 213 ASN A N   1 
ATOM   1262 C CA  . ASN A 1 188 ? -29.129  8.123   10.477  1.00 119.20 ? 213 ASN A CA  1 
ATOM   1263 C C   . ASN A 1 188 ? -30.553  8.602   10.715  1.00 116.13 ? 213 ASN A C   1 
ATOM   1264 O O   . ASN A 1 188 ? -31.496  7.833   10.563  1.00 118.90 ? 213 ASN A O   1 
ATOM   1265 C CB  . ASN A 1 188 ? -28.770  8.360   9.007   1.00 110.73 ? 213 ASN A CB  1 
ATOM   1266 C CG  . ASN A 1 188 ? -27.690  7.423   8.513   1.00 136.48 ? 213 ASN A CG  1 
ATOM   1267 O OD1 . ASN A 1 188 ? -26.689  7.163   9.202   1.00 138.87 ? 213 ASN A OD1 1 
ATOM   1268 N ND2 . ASN A 1 188 ? -27.881  6.909   7.302   1.00 138.04 ? 213 ASN A ND2 1 
ATOM   1269 N N   . SER A 1 189 ? -30.713  9.869   11.083  1.00 125.56 ? 214 SER A N   1 
ATOM   1270 C CA  . SER A 1 189 ? -32.045  10.447  11.241  1.00 120.83 ? 214 SER A CA  1 
ATOM   1271 C C   . SER A 1 189 ? -32.639  10.817  9.886   1.00 120.20 ? 214 SER A C   1 
ATOM   1272 O O   . SER A 1 189 ? -33.850  10.677  9.660   1.00 123.97 ? 214 SER A O   1 
ATOM   1273 C CB  . SER A 1 189 ? -32.002  11.681  12.135  1.00 126.68 ? 214 SER A CB  1 
ATOM   1274 O OG  . SER A 1 189 ? -31.262  11.410  13.306  1.00 151.48 ? 214 SER A OG  1 
ATOM   1275 N N   . SER A 1 190 ? -31.788  11.303  8.987   1.00 120.53 ? 215 SER A N   1 
ATOM   1276 C CA  . SER A 1 190 ? -32.216  11.548  7.619   1.00 123.62 ? 215 SER A CA  1 
ATOM   1277 C C   . SER A 1 190 ? -32.653  10.243  6.964   1.00 123.45 ? 215 SER A C   1 
ATOM   1278 O O   . SER A 1 190 ? -33.449  10.253  6.024   1.00 122.46 ? 215 SER A O   1 
ATOM   1279 C CB  . SER A 1 190 ? -31.103  12.197  6.800   1.00 104.69 ? 215 SER A CB  1 
ATOM   1280 O OG  . SER A 1 190 ? -31.155  13.607  6.896   1.00 120.29 ? 215 SER A OG  1 
ATOM   1281 N N   . TYR A 1 191 ? -32.129  9.119   7.448   1.00 118.99 ? 216 TYR A N   1 
ATOM   1282 C CA  . TYR A 1 191 ? -32.514  7.831   6.887   1.00 114.67 ? 216 TYR A CA  1 
ATOM   1283 C C   . TYR A 1 191 ? -33.996  7.577   7.137   1.00 125.38 ? 216 TYR A C   1 
ATOM   1284 O O   . TYR A 1 191 ? -34.750  7.225   6.214   1.00 128.97 ? 216 TYR A O   1 
ATOM   1285 C CB  . TYR A 1 191 ? -31.681  6.698   7.479   1.00 112.41 ? 216 TYR A CB  1 
ATOM   1286 C CG  . TYR A 1 191 ? -32.153  5.326   7.046   1.00 111.97 ? 216 TYR A CG  1 
ATOM   1287 C CD1 . TYR A 1 191 ? -32.534  4.374   7.984   1.00 115.53 ? 216 TYR A CD1 1 
ATOM   1288 C CD2 . TYR A 1 191 ? -32.244  4.990   5.697   1.00 115.94 ? 216 TYR A CD2 1 
ATOM   1289 C CE1 . TYR A 1 191 ? -32.977  3.115   7.593   1.00 125.38 ? 216 TYR A CE1 1 
ATOM   1290 C CE2 . TYR A 1 191 ? -32.689  3.730   5.294   1.00 125.94 ? 216 TYR A CE2 1 
ATOM   1291 C CZ  . TYR A 1 191 ? -33.052  2.796   6.247   1.00 123.99 ? 216 TYR A CZ  1 
ATOM   1292 O OH  . TYR A 1 191 ? -33.497  1.542   5.864   1.00 104.11 ? 216 TYR A OH  1 
ATOM   1293 N N   . LEU A 1 192 ? -34.407  7.778   8.386   1.00 112.24 ? 217 LEU A N   1 
ATOM   1294 C CA  . LEU A 1 192 ? -35.788  7.570   8.782   1.00 114.46 ? 217 LEU A CA  1 
ATOM   1295 C C   . LEU A 1 192 ? -36.700  8.676   8.236   1.00 125.24 ? 217 LEU A C   1 
ATOM   1296 O O   . LEU A 1 192 ? -37.921  8.609   8.369   1.00 115.69 ? 217 LEU A O   1 
ATOM   1297 C CB  . LEU A 1 192 ? -35.866  7.477   10.302  1.00 95.59  ? 217 LEU A CB  1 
ATOM   1298 C CG  . LEU A 1 192 ? -34.787  6.552   10.887  1.00 112.43 ? 217 LEU A CG  1 
ATOM   1299 C CD1 . LEU A 1 192 ? -34.803  6.494   12.425  1.00 78.07  ? 217 LEU A CD1 1 
ATOM   1300 C CD2 . LEU A 1 192 ? -34.895  5.148   10.275  1.00 127.76 ? 217 LEU A CD2 1 
ATOM   1301 N N   . THR A 1 193 ? -36.099  9.680   7.605   1.00 136.82 ? 218 THR A N   1 
ATOM   1302 C CA  . THR A 1 193 ? -36.853  10.754  6.969   1.00 142.03 ? 218 THR A CA  1 
ATOM   1303 C C   . THR A 1 193 ? -37.664  10.271  5.759   1.00 151.62 ? 218 THR A C   1 
ATOM   1304 O O   . THR A 1 193 ? -38.693  10.866  5.423   1.00 152.17 ? 218 THR A O   1 
ATOM   1305 C CB  . THR A 1 193 ? -35.921  11.887  6.496   1.00 151.17 ? 218 THR A CB  1 
ATOM   1306 O OG1 . THR A 1 193 ? -36.497  13.154  6.829   1.00 160.36 ? 218 THR A OG1 1 
ATOM   1307 C CG2 . THR A 1 193 ? -35.693  11.814  4.970   1.00 137.09 ? 218 THR A CG2 1 
ATOM   1308 N N   . HIS A 1 194 ? -37.204  9.209   5.098   1.00 132.23 ? 219 HIS A N   1 
ATOM   1309 C CA  . HIS A 1 194 ? -37.876  8.757   3.885   1.00 156.64 ? 219 HIS A CA  1 
ATOM   1310 C C   . HIS A 1 194 ? -37.735  7.256   3.635   1.00 152.66 ? 219 HIS A C   1 
ATOM   1311 O O   . HIS A 1 194 ? -38.235  6.736   2.629   1.00 161.13 ? 219 HIS A O   1 
ATOM   1312 C CB  . HIS A 1 194 ? -37.397  9.559   2.667   1.00 176.30 ? 219 HIS A CB  1 
ATOM   1313 C CG  . HIS A 1 194 ? -38.155  9.266   1.407   1.00 206.81 ? 219 HIS A CG  1 
ATOM   1314 N ND1 . HIS A 1 194 ? -39.358  9.867   1.099   1.00 199.25 ? 219 HIS A ND1 1 
ATOM   1315 C CD2 . HIS A 1 194 ? -37.874  8.441   0.367   1.00 201.37 ? 219 HIS A CD2 1 
ATOM   1316 C CE1 . HIS A 1 194 ? -39.787  9.423   -0.069  1.00 182.31 ? 219 HIS A CE1 1 
ATOM   1317 N NE2 . HIS A 1 194 ? -38.903  8.556   -0.534  1.00 189.06 ? 219 HIS A NE2 1 
ATOM   1318 N N   . CYS A 1 195 ? -37.066  6.550   4.541   1.00 121.34 ? 220 CYS A N   1 
ATOM   1319 C CA  . CYS A 1 195 ? -37.007  5.098   4.409   1.00 126.20 ? 220 CYS A CA  1 
ATOM   1320 C C   . CYS A 1 195 ? -38.412  4.497   4.515   1.00 122.05 ? 220 CYS A C   1 
ATOM   1321 O O   . CYS A 1 195 ? -39.337  5.148   5.009   1.00 117.18 ? 220 CYS A O   1 
ATOM   1322 C CB  . CYS A 1 195 ? -36.092  4.481   5.467   1.00 130.18 ? 220 CYS A CB  1 
ATOM   1323 S SG  . CYS A 1 195 ? -36.815  4.295   7.142   1.00 129.24 ? 220 CYS A SG  1 
ATOM   1324 N N   . VAL A 1 196 ? -38.556  3.259   4.043   1.00 113.98 ? 221 VAL A N   1 
ATOM   1325 C CA  . VAL A 1 196 ? -39.786  2.493   4.186   1.00 92.83  ? 221 VAL A CA  1 
ATOM   1326 C C   . VAL A 1 196 ? -39.432  1.020   4.217   1.00 92.00  ? 221 VAL A C   1 
ATOM   1327 O O   . VAL A 1 196 ? -38.791  0.501   3.308   1.00 100.72 ? 221 VAL A O   1 
ATOM   1328 C CB  . VAL A 1 196 ? -40.762  2.699   3.017   1.00 78.56  ? 221 VAL A CB  1 
ATOM   1329 C CG1 . VAL A 1 196 ? -41.958  1.777   3.178   1.00 72.95  ? 221 VAL A CG1 1 
ATOM   1330 C CG2 . VAL A 1 196 ? -41.205  4.142   2.917   1.00 90.25  ? 221 VAL A CG2 1 
ATOM   1331 N N   . PHE A 1 197 ? -39.889  0.346   5.258   1.00 100.80 ? 222 PHE A N   1 
ATOM   1332 C CA  . PHE A 1 197 ? -39.576  -1.051  5.480   1.00 96.51  ? 222 PHE A CA  1 
ATOM   1333 C C   . PHE A 1 197 ? -39.776  -1.953  4.269   1.00 110.62 ? 222 PHE A C   1 
ATOM   1334 O O   . PHE A 1 197 ? -40.720  -1.786  3.490   1.00 122.59 ? 222 PHE A O   1 
ATOM   1335 C CB  . PHE A 1 197 ? -40.420  -1.584  6.626   1.00 98.97  ? 222 PHE A CB  1 
ATOM   1336 C CG  . PHE A 1 197 ? -40.188  -3.025  6.906   1.00 103.05 ? 222 PHE A CG  1 
ATOM   1337 C CD1 . PHE A 1 197 ? -39.191  -3.409  7.784   1.00 96.53  ? 222 PHE A CD1 1 
ATOM   1338 C CD2 . PHE A 1 197 ? -40.957  -4.001  6.283   1.00 102.46 ? 222 PHE A CD2 1 
ATOM   1339 C CE1 . PHE A 1 197 ? -38.968  -4.746  8.053   1.00 100.82 ? 222 PHE A CE1 1 
ATOM   1340 C CE2 . PHE A 1 197 ? -40.740  -5.344  6.542   1.00 108.81 ? 222 PHE A CE2 1 
ATOM   1341 C CZ  . PHE A 1 197 ? -39.743  -5.717  7.430   1.00 118.63 ? 222 PHE A CZ  1 
ATOM   1342 N N   . SER A 1 198 ? -38.875  -2.922  4.146   1.00 120.70 ? 223 SER A N   1 
ATOM   1343 C CA  . SER A 1 198 ? -38.961  -3.986  3.153   1.00 127.75 ? 223 SER A CA  1 
ATOM   1344 C C   . SER A 1 198 ? -37.966  -5.052  3.582   1.00 118.40 ? 223 SER A C   1 
ATOM   1345 O O   . SER A 1 198 ? -36.821  -4.739  3.916   1.00 102.31 ? 223 SER A O   1 
ATOM   1346 C CB  . SER A 1 198 ? -38.609  -3.472  1.758   1.00 114.32 ? 223 SER A CB  1 
ATOM   1347 O OG  . SER A 1 198 ? -37.252  -3.076  1.714   1.00 119.23 ? 223 SER A OG  1 
ATOM   1348 N N   . ARG A 1 199 ? -38.405  -6.306  3.594   1.00 129.43 ? 224 ARG A N   1 
ATOM   1349 C CA  . ARG A 1 199 ? -37.576  -7.392  4.110   1.00 139.18 ? 224 ARG A CA  1 
ATOM   1350 C C   . ARG A 1 199 ? -36.195  -7.385  3.453   1.00 146.40 ? 224 ARG A C   1 
ATOM   1351 O O   . ARG A 1 199 ? -35.166  -7.544  4.126   1.00 116.45 ? 224 ARG A O   1 
ATOM   1352 C CB  . ARG A 1 199 ? -38.260  -8.744  3.886   1.00 136.52 ? 224 ARG A CB  1 
ATOM   1353 C CG  . ARG A 1 199 ? -37.654  -9.882  4.688   1.00 129.56 ? 224 ARG A CG  1 
ATOM   1354 C CD  . ARG A 1 199 ? -38.056  -9.775  6.146   1.00 139.28 ? 224 ARG A CD  1 
ATOM   1355 N NE  . ARG A 1 199 ? -39.501  -9.640  6.288   1.00 150.58 ? 224 ARG A NE  1 
ATOM   1356 C CZ  . ARG A 1 199 ? -40.148  -9.645  7.452   1.00 139.56 ? 224 ARG A CZ  1 
ATOM   1357 N NH1 . ARG A 1 199 ? -39.481  -9.779  8.596   1.00 97.13  ? 224 ARG A NH1 1 
ATOM   1358 N NH2 . ARG A 1 199 ? -41.471  -9.519  7.473   1.00 135.84 ? 224 ARG A NH2 1 
ATOM   1359 N N   . LYS A 1 200 ? -36.195  -7.188  2.135   1.00 154.18 ? 225 LYS A N   1 
ATOM   1360 C CA  . LYS A 1 200 ? -34.983  -7.198  1.318   1.00 136.11 ? 225 LYS A CA  1 
ATOM   1361 C C   . LYS A 1 200 ? -34.054  -6.014  1.604   1.00 135.76 ? 225 LYS A C   1 
ATOM   1362 O O   . LYS A 1 200 ? -33.089  -6.132  2.366   1.00 106.49 ? 225 LYS A O   1 
ATOM   1363 C CB  . LYS A 1 200 ? -35.360  -7.224  -0.164  1.00 98.29  ? 225 LYS A CB  1 
ATOM   1364 N N   . THR A 1 201 ? -34.356  -4.876  0.984   1.00 123.30 ? 226 THR A N   1 
ATOM   1365 C CA  . THR A 1 201 ? -33.487  -3.701  1.042   1.00 103.73 ? 226 THR A CA  1 
ATOM   1366 C C   . THR A 1 201 ? -33.343  -3.082  2.443   1.00 115.16 ? 226 THR A C   1 
ATOM   1367 O O   . THR A 1 201 ? -32.259  -3.123  3.014   1.00 109.73 ? 226 THR A O   1 
ATOM   1368 C CB  . THR A 1 201 ? -33.910  -2.625  0.006   1.00 105.04 ? 226 THR A CB  1 
ATOM   1369 O OG1 . THR A 1 201 ? -35.086  -1.940  0.452   1.00 127.60 ? 226 THR A OG1 1 
ATOM   1370 C CG2 . THR A 1 201 ? -34.198  -3.271  -1.340  1.00 106.57 ? 226 THR A CG2 1 
ATOM   1371 N N   . ASP A 1 202 ? -34.423  -2.516  2.987   1.00 115.26 ? 227 ASP A N   1 
ATOM   1372 C CA  . ASP A 1 202 ? -34.379  -1.824  4.281   1.00 100.23 ? 227 ASP A CA  1 
ATOM   1373 C C   . ASP A 1 202 ? -35.110  -2.587  5.379   1.00 112.12 ? 227 ASP A C   1 
ATOM   1374 O O   . ASP A 1 202 ? -36.301  -2.364  5.598   1.00 122.00 ? 227 ASP A O   1 
ATOM   1375 C CB  . ASP A 1 202 ? -35.008  -0.434  4.166   1.00 108.71 ? 227 ASP A CB  1 
ATOM   1376 C CG  . ASP A 1 202 ? -34.755  0.215   2.820   1.00 116.79 ? 227 ASP A CG  1 
ATOM   1377 O OD1 . ASP A 1 202 ? -33.572  0.405   2.466   1.00 127.52 ? 227 ASP A OD1 1 
ATOM   1378 O OD2 . ASP A 1 202 ? -35.739  0.548   2.118   1.00 122.72 ? 227 ASP A OD2 1 
ATOM   1379 N N   . PRO A 1 203 ? -34.400  -3.475  6.088   1.00 110.11 ? 228 PRO A N   1 
ATOM   1380 C CA  . PRO A 1 203 ? -34.993  -4.313  7.141   1.00 124.07 ? 228 PRO A CA  1 
ATOM   1381 C C   . PRO A 1 203 ? -35.073  -3.608  8.498   1.00 123.64 ? 228 PRO A C   1 
ATOM   1382 O O   . PRO A 1 203 ? -35.781  -4.071  9.401   1.00 99.91  ? 228 PRO A O   1 
ATOM   1383 C CB  . PRO A 1 203 ? -34.020  -5.501  7.232   1.00 123.92 ? 228 PRO A CB  1 
ATOM   1384 C CG  . PRO A 1 203 ? -33.106  -5.369  6.031   1.00 122.70 ? 228 PRO A CG  1 
ATOM   1385 C CD  . PRO A 1 203 ? -33.030  -3.899  5.780   1.00 108.69 ? 228 PRO A CD  1 
ATOM   1386 N N   . ASP A 1 204 ? -34.339  -2.506  8.633   1.00 136.40 ? 229 ASP A N   1 
ATOM   1387 C CA  . ASP A 1 204 ? -34.253  -1.774  9.893   1.00 134.05 ? 229 ASP A CA  1 
ATOM   1388 C C   . ASP A 1 204 ? -35.077  -0.499  9.864   1.00 127.53 ? 229 ASP A C   1 
ATOM   1389 O O   . ASP A 1 204 ? -34.950  0.351   10.747  1.00 123.87 ? 229 ASP A O   1 
ATOM   1390 C CB  . ASP A 1 204 ? -32.799  -1.426  10.206  1.00 142.17 ? 229 ASP A CB  1 
ATOM   1391 C CG  . ASP A 1 204 ? -31.943  -2.651  10.393  1.00 145.19 ? 229 ASP A CG  1 
ATOM   1392 O OD1 . ASP A 1 204 ? -32.405  -3.589  11.080  1.00 143.11 ? 229 ASP A OD1 1 
ATOM   1393 O OD2 . ASP A 1 204 ? -30.816  -2.672  9.854   1.00 157.09 ? 229 ASP A OD2 1 
ATOM   1394 N N   . CYS A 1 205 ? -35.906  -0.359  8.837   1.00 122.20 ? 230 CYS A N   1 
ATOM   1395 C CA  . CYS A 1 205 ? -36.770  0.804   8.713   1.00 116.49 ? 230 CYS A CA  1 
ATOM   1396 C C   . CYS A 1 205 ? -38.119  0.574   9.402   1.00 118.27 ? 230 CYS A C   1 
ATOM   1397 O O   . CYS A 1 205 ? -38.947  -0.194  8.904   1.00 113.80 ? 230 CYS A O   1 
ATOM   1398 C CB  . CYS A 1 205 ? -36.986  1.133   7.241   1.00 106.56 ? 230 CYS A CB  1 
ATOM   1399 S SG  . CYS A 1 205 ? -37.955  2.614   7.003   1.00 127.91 ? 230 CYS A SG  1 
ATOM   1400 N N   . PRO A 1 206 ? -38.348  1.257   10.541  1.00 116.78 ? 231 PRO A N   1 
ATOM   1401 C CA  . PRO A 1 206 ? -39.532  1.062   11.390  1.00 114.59 ? 231 PRO A CA  1 
ATOM   1402 C C   . PRO A 1 206 ? -40.784  1.729   10.823  1.00 111.97 ? 231 PRO A C   1 
ATOM   1403 O O   . PRO A 1 206 ? -41.838  1.695   11.472  1.00 109.25 ? 231 PRO A O   1 
ATOM   1404 C CB  . PRO A 1 206 ? -39.151  1.756   12.709  1.00 104.36 ? 231 PRO A CB  1 
ATOM   1405 C CG  . PRO A 1 206 ? -37.755  2.277   12.527  1.00 125.38 ? 231 PRO A CG  1 
ATOM   1406 C CD  . PRO A 1 206 ? -37.487  2.331   11.055  1.00 121.25 ? 231 PRO A CD  1 
ATOM   1407 N N   . ILE A 1 207 ? -40.666  2.353   9.655   1.00 97.75  ? 232 ILE A N   1 
ATOM   1408 C CA  . ILE A 1 207 ? -41.820  2.957   9.010   1.00 96.21  ? 232 ILE A CA  1 
ATOM   1409 C C   . ILE A 1 207 ? -42.377  1.974   7.994   1.00 98.23  ? 232 ILE A C   1 
ATOM   1410 O O   . ILE A 1 207 ? -41.789  1.796   6.935   1.00 104.27 ? 232 ILE A O   1 
ATOM   1411 C CB  . ILE A 1 207 ? -41.421  4.253   8.296   1.00 91.71  ? 232 ILE A CB  1 
ATOM   1412 C CG1 . ILE A 1 207 ? -40.549  5.110   9.211   1.00 91.32  ? 232 ILE A CG1 1 
ATOM   1413 C CG2 . ILE A 1 207 ? -42.640  5.032   7.854   1.00 90.34  ? 232 ILE A CG2 1 
ATOM   1414 C CD1 . ILE A 1 207 ? -40.175  6.423   8.587   1.00 111.35 ? 232 ILE A CD1 1 
ATOM   1415 N N   . PHE A 1 208 ? -43.496  1.329   8.308   1.00 91.87  ? 233 PHE A N   1 
ATOM   1416 C CA  . PHE A 1 208 ? -44.078  0.364   7.384   1.00 83.32  ? 233 PHE A CA  1 
ATOM   1417 C C   . PHE A 1 208 ? -45.207  0.974   6.555   1.00 94.80  ? 233 PHE A C   1 
ATOM   1418 O O   . PHE A 1 208 ? -46.029  1.735   7.069   1.00 84.24  ? 233 PHE A O   1 
ATOM   1419 C CB  . PHE A 1 208 ? -44.606  -0.840  8.143   1.00 63.64  ? 233 PHE A CB  1 
ATOM   1420 C CG  . PHE A 1 208 ? -43.609  -1.463  9.072   1.00 90.11  ? 233 PHE A CG  1 
ATOM   1421 C CD1 . PHE A 1 208 ? -42.907  -2.593  8.698   1.00 96.06  ? 233 PHE A CD1 1 
ATOM   1422 C CD2 . PHE A 1 208 ? -43.390  -0.934  10.340  1.00 106.20 ? 233 PHE A CD2 1 
ATOM   1423 C CE1 . PHE A 1 208 ? -41.996  -3.185  9.571   1.00 105.12 ? 233 PHE A CE1 1 
ATOM   1424 C CE2 . PHE A 1 208 ? -42.477  -1.524  11.217  1.00 96.85  ? 233 PHE A CE2 1 
ATOM   1425 C CZ  . PHE A 1 208 ? -41.782  -2.651  10.825  1.00 99.64  ? 233 PHE A CZ  1 
ATOM   1426 N N   . ARG A 1 209 ? -45.246  0.648   5.267   1.00 108.83 ? 234 ARG A N   1 
ATOM   1427 C CA  . ARG A 1 209 ? -46.405  1.003   4.454   1.00 96.68  ? 234 ARG A CA  1 
ATOM   1428 C C   . ARG A 1 209 ? -47.536  0.058   4.819   1.00 105.73 ? 234 ARG A C   1 
ATOM   1429 O O   . ARG A 1 209 ? -47.314  -1.119  5.127   1.00 93.45  ? 234 ARG A O   1 
ATOM   1430 C CB  . ARG A 1 209 ? -46.104  0.902   2.971   1.00 82.85  ? 234 ARG A CB  1 
ATOM   1431 N N   . LEU A 1 210 ? -48.756  0.570   4.784   1.00 107.37 ? 235 LEU A N   1 
ATOM   1432 C CA  . LEU A 1 210 ? -49.899  -0.239  5.177   1.00 105.37 ? 235 LEU A CA  1 
ATOM   1433 C C   . LEU A 1 210 ? -50.087  -1.425  4.222   1.00 105.66 ? 235 LEU A C   1 
ATOM   1434 O O   . LEU A 1 210 ? -50.119  -2.582  4.662   1.00 87.77  ? 235 LEU A O   1 
ATOM   1435 C CB  . LEU A 1 210 ? -51.162  0.622   5.278   1.00 103.01 ? 235 LEU A CB  1 
ATOM   1436 C CG  . LEU A 1 210 ? -51.195  1.589   6.462   1.00 80.83  ? 235 LEU A CG  1 
ATOM   1437 C CD1 . LEU A 1 210 ? -52.568  2.225   6.612   1.00 56.80  ? 235 LEU A CD1 1 
ATOM   1438 C CD2 . LEU A 1 210 ? -50.769  0.865   7.735   1.00 75.05  ? 235 LEU A CD2 1 
ATOM   1439 N N   . GLY A 1 211 ? -50.191  -1.138  2.923   1.00 102.93 ? 236 GLY A N   1 
ATOM   1440 C CA  . GLY A 1 211 ? -50.293  -2.183  1.918   1.00 100.37 ? 236 GLY A CA  1 
ATOM   1441 C C   . GLY A 1 211 ? -49.269  -3.294  2.100   1.00 109.03 ? 236 GLY A C   1 
ATOM   1442 O O   . GLY A 1 211 ? -49.618  -4.479  2.071   1.00 93.46  ? 236 GLY A O   1 
ATOM   1443 N N   . ASP A 1 212 ? -48.003  -2.918  2.292   1.00 123.56 ? 237 ASP A N   1 
ATOM   1444 C CA  . ASP A 1 212 ? -46.938  -3.903  2.495   1.00 113.93 ? 237 ASP A CA  1 
ATOM   1445 C C   . ASP A 1 212 ? -47.240  -4.767  3.700   1.00 98.43  ? 237 ASP A C   1 
ATOM   1446 O O   . ASP A 1 212 ? -46.952  -5.964  3.698   1.00 109.68 ? 237 ASP A O   1 
ATOM   1447 C CB  . ASP A 1 212 ? -45.567  -3.244  2.675   1.00 110.54 ? 237 ASP A CB  1 
ATOM   1448 C CG  . ASP A 1 212 ? -45.196  -2.325  1.517   1.00 133.82 ? 237 ASP A CG  1 
ATOM   1449 O OD1 . ASP A 1 212 ? -46.072  -2.008  0.667   1.00 119.78 ? 237 ASP A OD1 1 
ATOM   1450 O OD2 . ASP A 1 212 ? -44.015  -1.912  1.466   1.00 128.08 ? 237 ASP A OD2 1 
ATOM   1451 N N   . ILE A 1 213 ? -47.818  -4.157  4.730   1.00 101.94 ? 238 ILE A N   1 
ATOM   1452 C CA  . ILE A 1 213 ? -48.159  -4.897  5.936   1.00 104.66 ? 238 ILE A CA  1 
ATOM   1453 C C   . ILE A 1 213 ? -49.185  -5.973  5.604   1.00 100.00 ? 238 ILE A C   1 
ATOM   1454 O O   . ILE A 1 213 ? -48.989  -7.148  5.939   1.00 87.65  ? 238 ILE A O   1 
ATOM   1455 C CB  . ILE A 1 213 ? -48.707  -3.977  7.033   1.00 85.70  ? 238 ILE A CB  1 
ATOM   1456 C CG1 . ILE A 1 213 ? -47.564  -3.253  7.731   1.00 75.79  ? 238 ILE A CG1 1 
ATOM   1457 C CG2 . ILE A 1 213 ? -49.489  -4.770  8.048   1.00 77.01  ? 238 ILE A CG2 1 
ATOM   1458 C CD1 . ILE A 1 213 ? -48.007  -2.475  8.919   1.00 89.51  ? 238 ILE A CD1 1 
ATOM   1459 N N   . VAL A 1 214 ? -50.265  -5.567  4.934   1.00 86.63  ? 239 VAL A N   1 
ATOM   1460 C CA  . VAL A 1 214 ? -51.330  -6.483  4.559   1.00 81.26  ? 239 VAL A CA  1 
ATOM   1461 C C   . VAL A 1 214 ? -50.822  -7.510  3.563   1.00 106.58 ? 239 VAL A C   1 
ATOM   1462 O O   . VAL A 1 214 ? -51.125  -8.705  3.674   1.00 96.24  ? 239 VAL A O   1 
ATOM   1463 C CB  . VAL A 1 214 ? -52.480  -5.751  3.896   1.00 79.53  ? 239 VAL A CB  1 
ATOM   1464 C CG1 . VAL A 1 214 ? -53.419  -6.757  3.258   1.00 93.95  ? 239 VAL A CG1 1 
ATOM   1465 C CG2 . VAL A 1 214 ? -53.198  -4.880  4.894   1.00 90.29  ? 239 VAL A CG2 1 
ATOM   1466 N N   . GLY A 1 215 ? -50.055  -7.031  2.585   1.00 109.21 ? 240 GLY A N   1 
ATOM   1467 C CA  . GLY A 1 215 ? -49.485  -7.899  1.576   1.00 98.46  ? 240 GLY A CA  1 
ATOM   1468 C C   . GLY A 1 215 ? -48.693  -9.013  2.230   1.00 100.75 ? 240 GLY A C   1 
ATOM   1469 O O   . GLY A 1 215 ? -49.070  -10.186 2.147   1.00 92.06  ? 240 GLY A O   1 
ATOM   1470 N N   . GLU A 1 216 ? -47.611  -8.632  2.906   1.00 95.32  ? 241 GLU A N   1 
ATOM   1471 C CA  . GLU A 1 216 ? -46.721  -9.574  3.576   1.00 102.07 ? 241 GLU A CA  1 
ATOM   1472 C C   . GLU A 1 216 ? -47.493  -10.684 4.281   1.00 99.75  ? 241 GLU A C   1 
ATOM   1473 O O   . GLU A 1 216 ? -47.003  -11.811 4.410   1.00 95.41  ? 241 GLU A O   1 
ATOM   1474 C CB  . GLU A 1 216 ? -45.855  -8.830  4.598   1.00 123.12 ? 241 GLU A CB  1 
ATOM   1475 C CG  . GLU A 1 216 ? -44.765  -9.678  5.260   1.00 130.43 ? 241 GLU A CG  1 
ATOM   1476 C CD  . GLU A 1 216 ? -43.434  -9.573  4.543   1.00 142.39 ? 241 GLU A CD  1 
ATOM   1477 O OE1 . GLU A 1 216 ? -43.407  -9.024  3.418   1.00 154.06 ? 241 GLU A OE1 1 
ATOM   1478 O OE2 . GLU A 1 216 ? -42.425  -10.036 5.111   1.00 127.35 ? 241 GLU A OE2 1 
ATOM   1479 N N   . ALA A 1 217 ? -48.695  -10.349 4.742   1.00 99.45  ? 242 ALA A N   1 
ATOM   1480 C CA  . ALA A 1 217 ? -49.526  -11.273 5.498   1.00 95.48  ? 242 ALA A CA  1 
ATOM   1481 C C   . ALA A 1 217 ? -50.318  -12.183 4.586   1.00 105.36 ? 242 ALA A C   1 
ATOM   1482 O O   . ALA A 1 217 ? -51.192  -12.922 5.048   1.00 103.61 ? 242 ALA A O   1 
ATOM   1483 C CB  . ALA A 1 217 ? -50.456  -10.513 6.403   1.00 97.46  ? 242 ALA A CB  1 
ATOM   1484 N N   . GLU A 1 218 ? -50.010  -12.119 3.294   1.00 102.88 ? 243 GLU A N   1 
ATOM   1485 C CA  . GLU A 1 218 ? -50.682  -12.938 2.295   1.00 105.01 ? 243 GLU A CA  1 
ATOM   1486 C C   . GLU A 1 218 ? -52.146  -12.542 2.156   1.00 106.34 ? 243 GLU A C   1 
ATOM   1487 O O   . GLU A 1 218 ? -53.026  -13.399 2.153   1.00 121.79 ? 243 GLU A O   1 
ATOM   1488 C CB  . GLU A 1 218 ? -50.577  -14.433 2.638   1.00 122.78 ? 243 GLU A CB  1 
ATOM   1489 C CG  . GLU A 1 218 ? -49.162  -14.991 2.662   1.00 125.08 ? 243 GLU A CG  1 
ATOM   1490 C CD  . GLU A 1 218 ? -48.511  -15.028 1.288   1.00 150.43 ? 243 GLU A CD  1 
ATOM   1491 O OE1 . GLU A 1 218 ? -49.241  -15.057 0.268   1.00 135.18 ? 243 GLU A OE1 1 
ATOM   1492 O OE2 . GLU A 1 218 ? -47.263  -15.034 1.236   1.00 150.72 ? 243 GLU A OE2 1 
ATOM   1493 N N   . GLU A 1 219 ? -52.406  -11.245 2.048   1.00 94.06  ? 244 GLU A N   1 
ATOM   1494 C CA  . GLU A 1 219 ? -53.772  -10.755 1.920   1.00 86.27  ? 244 GLU A CA  1 
ATOM   1495 C C   . GLU A 1 219 ? -53.783  -9.626  0.937   1.00 98.09  ? 244 GLU A C   1 
ATOM   1496 O O   . GLU A 1 219 ? -52.743  -9.268  0.396   1.00 119.23 ? 244 GLU A O   1 
ATOM   1497 C CB  . GLU A 1 219 ? -54.278  -10.222 3.246   1.00 81.68  ? 244 GLU A CB  1 
ATOM   1498 C CG  . GLU A 1 219 ? -54.403  -11.264 4.320   1.00 94.24  ? 244 GLU A CG  1 
ATOM   1499 C CD  . GLU A 1 219 ? -55.666  -12.090 4.192   1.00 103.46 ? 244 GLU A CD  1 
ATOM   1500 O OE1 . GLU A 1 219 ? -56.610  -11.616 3.530   1.00 99.22  ? 244 GLU A OE1 1 
ATOM   1501 O OE2 . GLU A 1 219 ? -55.716  -13.204 4.762   1.00 109.10 ? 244 GLU A OE2 1 
ATOM   1502 N N   . ASP A 1 220 ? -54.950  -9.036  0.720   1.00 81.13  ? 245 ASP A N   1 
ATOM   1503 C CA  . ASP A 1 220 ? -55.023  -7.944  -0.235  1.00 105.11 ? 245 ASP A CA  1 
ATOM   1504 C C   . ASP A 1 220 ? -55.726  -6.708  0.300   1.00 103.55 ? 245 ASP A C   1 
ATOM   1505 O O   . ASP A 1 220 ? -56.920  -6.738  0.594   1.00 86.06  ? 245 ASP A O   1 
ATOM   1506 C CB  . ASP A 1 220 ? -55.682  -8.389  -1.535  1.00 106.09 ? 245 ASP A CB  1 
ATOM   1507 C CG  . ASP A 1 220 ? -55.825  -7.249  -2.510  1.00 117.32 ? 245 ASP A CG  1 
ATOM   1508 O OD1 . ASP A 1 220 ? -54.953  -6.350  -2.481  1.00 127.41 ? 245 ASP A OD1 1 
ATOM   1509 O OD2 . ASP A 1 220 ? -56.808  -7.238  -3.282  1.00 108.06 ? 245 ASP A OD2 1 
ATOM   1510 N N   . PHE A 1 221 ? -54.979  -5.613  0.391   1.00 99.74  ? 246 PHE A N   1 
ATOM   1511 C CA  . PHE A 1 221 ? -55.490  -4.402  1.018   1.00 99.55  ? 246 PHE A CA  1 
ATOM   1512 C C   . PHE A 1 221 ? -56.803  -3.934  0.413   1.00 92.07  ? 246 PHE A C   1 
ATOM   1513 O O   . PHE A 1 221 ? -57.695  -3.503  1.126   1.00 107.57 ? 246 PHE A O   1 
ATOM   1514 C CB  . PHE A 1 221 ? -54.456  -3.273  0.990   1.00 112.65 ? 246 PHE A CB  1 
ATOM   1515 C CG  . PHE A 1 221 ? -54.788  -2.120  1.908   1.00 100.82 ? 246 PHE A CG  1 
ATOM   1516 C CD1 . PHE A 1 221 ? -54.145  -1.974  3.119   1.00 86.00  ? 246 PHE A CD1 1 
ATOM   1517 C CD2 . PHE A 1 221 ? -55.752  -1.187  1.553   1.00 93.73  ? 246 PHE A CD2 1 
ATOM   1518 C CE1 . PHE A 1 221 ? -54.456  -0.920  3.939   1.00 95.09  ? 246 PHE A CE1 1 
ATOM   1519 C CE2 . PHE A 1 221 ? -56.064  -0.131  2.378   1.00 70.84  ? 246 PHE A CE2 1 
ATOM   1520 C CZ  . PHE A 1 221 ? -55.424  0.007   3.561   1.00 75.53  ? 246 PHE A CZ  1 
ATOM   1521 N N   . GLN A 1 222 ? -56.937  -4.026  -0.896  1.00 78.89  ? 247 GLN A N   1 
ATOM   1522 C CA  . GLN A 1 222 ? -58.135  -3.514  -1.544  1.00 86.93  ? 247 GLN A CA  1 
ATOM   1523 C C   . GLN A 1 222 ? -59.388  -4.375  -1.335  1.00 101.04 ? 247 GLN A C   1 
ATOM   1524 O O   . GLN A 1 222 ? -60.502  -3.851  -1.277  1.00 96.53  ? 247 GLN A O   1 
ATOM   1525 C CB  . GLN A 1 222 ? -57.860  -3.271  -3.022  1.00 105.04 ? 247 GLN A CB  1 
ATOM   1526 C CG  . GLN A 1 222 ? -56.814  -2.207  -3.217  1.00 115.19 ? 247 GLN A CG  1 
ATOM   1527 C CD  . GLN A 1 222 ? -57.288  -0.877  -2.698  1.00 98.17  ? 247 GLN A CD  1 
ATOM   1528 O OE1 . GLN A 1 222 ? -58.474  -0.555  -2.795  1.00 78.45  ? 247 GLN A OE1 1 
ATOM   1529 N NE2 . GLN A 1 222 ? -56.371  -0.093  -2.142  1.00 100.37 ? 247 GLN A NE2 1 
ATOM   1530 N N   . ILE A 1 223 ? -59.217  -5.687  -1.211  1.00 99.56  ? 248 ILE A N   1 
ATOM   1531 C CA  . ILE A 1 223 ? -60.365  -6.541  -0.944  1.00 93.41  ? 248 ILE A CA  1 
ATOM   1532 C C   . ILE A 1 223 ? -60.745  -6.440  0.531   1.00 98.91  ? 248 ILE A C   1 
ATOM   1533 O O   . ILE A 1 223 ? -61.929  -6.426  0.876   1.00 93.72  ? 248 ILE A O   1 
ATOM   1534 C CB  . ILE A 1 223 ? -60.128  -8.021  -1.356  1.00 97.70  ? 248 ILE A CB  1 
ATOM   1535 C CG1 . ILE A 1 223 ? -58.981  -8.648  -0.548  1.00 141.86 ? 248 ILE A CG1 1 
ATOM   1536 C CG2 . ILE A 1 223 ? -59.849  -8.113  -2.848  1.00 94.80  ? 248 ILE A CG2 1 
ATOM   1537 C CD1 . ILE A 1 223 ? -58.856  -10.172 -0.705  1.00 125.56 ? 248 ILE A CD1 1 
ATOM   1538 N N   . MET A 1 224 ? -59.736  -6.346  1.397   1.00 104.33 ? 249 MET A N   1 
ATOM   1539 C CA  . MET A 1 224 ? -59.962  -6.219  2.835   1.00 96.61  ? 249 MET A CA  1 
ATOM   1540 C C   . MET A 1 224 ? -60.666  -4.906  3.151   1.00 91.41  ? 249 MET A C   1 
ATOM   1541 O O   . MET A 1 224 ? -61.762  -4.888  3.696   1.00 89.39  ? 249 MET A O   1 
ATOM   1542 C CB  . MET A 1 224 ? -58.632  -6.297  3.598   1.00 77.99  ? 249 MET A CB  1 
ATOM   1543 C CG  . MET A 1 224 ? -58.791  -6.686  5.072   1.00 95.41  ? 249 MET A CG  1 
ATOM   1544 S SD  . MET A 1 224 ? -57.292  -6.693  6.107   1.00 92.31  ? 249 MET A SD  1 
ATOM   1545 C CE  . MET A 1 224 ? -56.253  -7.847  5.245   1.00 97.75  ? 249 MET A CE  1 
ATOM   1546 N N   . ALA A 1 225 ? -60.024  -3.810  2.770   1.00 91.68  ? 250 ALA A N   1 
ATOM   1547 C CA  . ALA A 1 225 ? -60.449  -2.457  3.123   1.00 91.55  ? 250 ALA A CA  1 
ATOM   1548 C C   . ALA A 1 225 ? -61.891  -2.123  2.765   1.00 95.17  ? 250 ALA A C   1 
ATOM   1549 O O   . ALA A 1 225 ? -62.355  -1.013  3.037   1.00 88.63  ? 250 ALA A O   1 
ATOM   1550 C CB  . ALA A 1 225 ? -59.523  -1.440  2.468   1.00 93.53  ? 250 ALA A CB  1 
ATOM   1551 N N   . VAL A 1 226 ? -62.599  -3.053  2.139   1.00 95.65  ? 251 VAL A N   1 
ATOM   1552 C CA  . VAL A 1 226 ? -63.963  -2.755  1.743   1.00 100.59 ? 251 VAL A CA  1 
ATOM   1553 C C   . VAL A 1 226 ? -64.898  -3.031  2.911   1.00 92.85  ? 251 VAL A C   1 
ATOM   1554 O O   . VAL A 1 226 ? -65.760  -2.220  3.245   1.00 92.79  ? 251 VAL A O   1 
ATOM   1555 C CB  . VAL A 1 226 ? -64.384  -3.526  0.483   1.00 77.95  ? 251 VAL A CB  1 
ATOM   1556 C CG1 . VAL A 1 226 ? -64.178  -5.005  0.687   1.00 87.10  ? 251 VAL A CG1 1 
ATOM   1557 C CG2 . VAL A 1 226 ? -65.833  -3.217  0.141   1.00 57.09  ? 251 VAL A CG2 1 
ATOM   1558 N N   . ARG A 1 227 ? -64.696  -4.165  3.558   1.00 83.51  ? 252 ARG A N   1 
ATOM   1559 C CA  . ARG A 1 227 ? -65.546  -4.542  4.669   1.00 90.94  ? 252 ARG A CA  1 
ATOM   1560 C C   . ARG A 1 227 ? -64.804  -4.542  6.025   1.00 96.48  ? 252 ARG A C   1 
ATOM   1561 O O   . ARG A 1 227 ? -65.412  -4.721  7.093   1.00 76.79  ? 252 ARG A O   1 
ATOM   1562 C CB  . ARG A 1 227 ? -66.179  -5.895  4.361   1.00 100.57 ? 252 ARG A CB  1 
ATOM   1563 C CG  . ARG A 1 227 ? -67.358  -6.243  5.238   1.00 142.41 ? 252 ARG A CG  1 
ATOM   1564 C CD  . ARG A 1 227 ? -68.359  -7.095  4.480   1.00 120.50 ? 252 ARG A CD  1 
ATOM   1565 N NE  . ARG A 1 227 ? -69.169  -6.279  3.582   1.00 123.61 ? 252 ARG A NE  1 
ATOM   1566 C CZ  . ARG A 1 227 ? -70.017  -6.783  2.693   1.00 130.29 ? 252 ARG A CZ  1 
ATOM   1567 N NH1 . ARG A 1 227 ? -70.143  -8.103  2.583   1.00 117.13 ? 252 ARG A NH1 1 
ATOM   1568 N NH2 . ARG A 1 227 ? -70.734  -5.978  1.912   1.00 104.42 ? 252 ARG A NH2 1 
ATOM   1569 N N   . GLY A 1 228 ? -63.489  -4.335  5.969   1.00 96.42  ? 253 GLY A N   1 
ATOM   1570 C CA  . GLY A 1 228 ? -62.667  -4.216  7.158   1.00 77.70  ? 253 GLY A CA  1 
ATOM   1571 C C   . GLY A 1 228 ? -62.058  -5.514  7.641   1.00 88.42  ? 253 GLY A C   1 
ATOM   1572 O O   . GLY A 1 228 ? -62.434  -6.598  7.200   1.00 95.20  ? 253 GLY A O   1 
ATOM   1573 N N   . GLY A 1 229 ? -61.105  -5.393  8.559   1.00 92.82  ? 254 GLY A N   1 
ATOM   1574 C CA  . GLY A 1 229 ? -60.457  -6.545  9.168   1.00 95.59  ? 254 GLY A CA  1 
ATOM   1575 C C   . GLY A 1 229 ? -59.467  -6.089  10.223  1.00 89.56  ? 254 GLY A C   1 
ATOM   1576 O O   . GLY A 1 229 ? -59.359  -4.884  10.478  1.00 93.06  ? 254 GLY A O   1 
ATOM   1577 N N   . VAL A 1 230 ? -58.751  -7.032  10.838  1.00 80.57  ? 255 VAL A N   1 
ATOM   1578 C CA  . VAL A 1 230 ? -57.723  -6.678  11.825  1.00 88.67  ? 255 VAL A CA  1 
ATOM   1579 C C   . VAL A 1 230 ? -56.399  -7.373  11.555  1.00 89.16  ? 255 VAL A C   1 
ATOM   1580 O O   . VAL A 1 230 ? -56.317  -8.604  11.454  1.00 81.45  ? 255 VAL A O   1 
ATOM   1581 C CB  . VAL A 1 230 ? -58.145  -6.965  13.274  1.00 59.48  ? 255 VAL A CB  1 
ATOM   1582 C CG1 . VAL A 1 230 ? -59.384  -6.185  13.617  1.00 77.34  ? 255 VAL A CG1 1 
ATOM   1583 C CG2 . VAL A 1 230 ? -58.363  -8.447  13.477  1.00 86.01  ? 255 VAL A CG2 1 
ATOM   1584 N N   . MET A 1 231 ? -55.362  -6.554  11.436  1.00 94.10  ? 256 MET A N   1 
ATOM   1585 C CA  . MET A 1 231 ? -54.022  -7.024  11.132  1.00 97.85  ? 256 MET A CA  1 
ATOM   1586 C C   . MET A 1 231 ? -53.174  -7.102  12.389  1.00 91.49  ? 256 MET A C   1 
ATOM   1587 O O   . MET A 1 231 ? -53.089  -6.129  13.133  1.00 92.72  ? 256 MET A O   1 
ATOM   1588 C CB  . MET A 1 231 ? -53.360  -6.082  10.119  1.00 98.00  ? 256 MET A CB  1 
ATOM   1589 C CG  . MET A 1 231 ? -53.852  -6.276  8.704   1.00 87.56  ? 256 MET A CG  1 
ATOM   1590 S SD  . MET A 1 231 ? -53.569  -7.998  8.239   1.00 103.73 ? 256 MET A SD  1 
ATOM   1591 C CE  . MET A 1 231 ? -51.845  -8.129  8.679   1.00 85.07  ? 256 MET A CE  1 
ATOM   1592 N N   . GLY A 1 232 ? -52.549  -8.253  12.621  1.00 93.62  ? 257 GLY A N   1 
ATOM   1593 C CA  . GLY A 1 232 ? -51.628  -8.404  13.733  1.00 95.20  ? 257 GLY A CA  1 
ATOM   1594 C C   . GLY A 1 232 ? -50.193  -8.113  13.323  1.00 110.12 ? 257 GLY A C   1 
ATOM   1595 O O   . GLY A 1 232 ? -49.617  -8.818  12.496  1.00 120.38 ? 257 GLY A O   1 
ATOM   1596 N N   . VAL A 1 233 ? -49.615  -7.056  13.877  1.00 99.06  ? 258 VAL A N   1 
ATOM   1597 C CA  . VAL A 1 233 ? -48.215  -6.750  13.644  1.00 88.56  ? 258 VAL A CA  1 
ATOM   1598 C C   . VAL A 1 233 ? -47.431  -7.298  14.823  1.00 91.81  ? 258 VAL A C   1 
ATOM   1599 O O   . VAL A 1 233 ? -47.320  -6.641  15.852  1.00 103.17 ? 258 VAL A O   1 
ATOM   1600 C CB  . VAL A 1 233 ? -48.006  -5.233  13.542  1.00 82.62  ? 258 VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 233 ? -46.553  -4.898  13.297  1.00 82.58  ? 258 VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 233 ? -48.875  -4.668  12.446  1.00 81.51  ? 258 VAL A CG2 1 
ATOM   1603 N N   . GLN A 1 234 ? -46.902  -8.508  14.690  1.00 91.93  ? 259 GLN A N   1 
ATOM   1604 C CA  . GLN A 1 234 ? -46.177  -9.129  15.794  1.00 94.97  ? 259 GLN A CA  1 
ATOM   1605 C C   . GLN A 1 234 ? -44.706  -8.738  15.809  1.00 95.79  ? 259 GLN A C   1 
ATOM   1606 O O   . GLN A 1 234 ? -43.996  -8.902  14.826  1.00 112.46 ? 259 GLN A O   1 
ATOM   1607 C CB  . GLN A 1 234 ? -46.297  -10.646 15.739  1.00 108.59 ? 259 GLN A CB  1 
ATOM   1608 C CG  . GLN A 1 234 ? -47.716  -11.150 15.839  1.00 119.84 ? 259 GLN A CG  1 
ATOM   1609 C CD  . GLN A 1 234 ? -47.844  -12.578 15.362  1.00 143.04 ? 259 GLN A CD  1 
ATOM   1610 O OE1 . GLN A 1 234 ? -48.952  -13.089 15.169  1.00 143.86 ? 259 GLN A OE1 1 
ATOM   1611 N NE2 . GLN A 1 234 ? -46.701  -13.234 15.160  1.00 143.32 ? 259 GLN A NE2 1 
ATOM   1612 N N   . ILE A 1 235 ? -44.256  -8.214  16.937  1.00 94.56  ? 260 ILE A N   1 
ATOM   1613 C CA  . ILE A 1 235 ? -42.846  -7.944  17.153  1.00 92.64  ? 260 ILE A CA  1 
ATOM   1614 C C   . ILE A 1 235 ? -42.299  -8.933  18.170  1.00 100.27 ? 260 ILE A C   1 
ATOM   1615 O O   . ILE A 1 235 ? -42.806  -9.020  19.290  1.00 101.54 ? 260 ILE A O   1 
ATOM   1616 C CB  . ILE A 1 235 ? -42.621  -6.504  17.633  1.00 94.13  ? 260 ILE A CB  1 
ATOM   1617 C CG1 . ILE A 1 235 ? -43.153  -5.518  16.587  1.00 98.76  ? 260 ILE A CG1 1 
ATOM   1618 C CG2 . ILE A 1 235 ? -41.153  -6.271  17.901  1.00 101.47 ? 260 ILE A CG2 1 
ATOM   1619 C CD1 . ILE A 1 235 ? -43.159  -4.068  17.046  1.00 86.32  ? 260 ILE A CD1 1 
ATOM   1620 N N   . ARG A 1 236 ? -41.284  -9.693  17.769  1.00 99.99  ? 261 ARG A N   1 
ATOM   1621 C CA  . ARG A 1 236 ? -40.676  -10.694 18.653  1.00 114.61 ? 261 ARG A CA  1 
ATOM   1622 C C   . ARG A 1 236 ? -39.244  -10.329 19.108  1.00 115.24 ? 261 ARG A C   1 
ATOM   1623 O O   . ARG A 1 236 ? -38.330  -10.205 18.278  1.00 105.64 ? 261 ARG A O   1 
ATOM   1624 C CB  . ARG A 1 236 ? -40.712  -12.091 18.008  1.00 124.20 ? 261 ARG A CB  1 
ATOM   1625 C CG  . ARG A 1 236 ? -40.777  -13.248 19.011  1.00 122.19 ? 261 ARG A CG  1 
ATOM   1626 C CD  . ARG A 1 236 ? -40.818  -14.628 18.340  1.00 110.39 ? 261 ARG A CD  1 
ATOM   1627 N NE  . ARG A 1 236 ? -39.482  -15.094 17.963  1.00 160.87 ? 261 ARG A NE  1 
ATOM   1628 C CZ  . ARG A 1 236 ? -38.944  -14.937 16.750  1.00 179.53 ? 261 ARG A CZ  1 
ATOM   1629 N NH1 . ARG A 1 236 ? -39.632  -14.327 15.785  1.00 173.84 ? 261 ARG A NH1 1 
ATOM   1630 N NH2 . ARG A 1 236 ? -37.716  -15.387 16.492  1.00 152.06 ? 261 ARG A NH2 1 
ATOM   1631 N N   . TRP A 1 237 ? -39.064  -10.150 20.414  1.00 105.56 ? 262 TRP A N   1 
ATOM   1632 C CA  . TRP A 1 237 ? -37.742  -9.899  20.990  1.00 106.71 ? 262 TRP A CA  1 
ATOM   1633 C C   . TRP A 1 237 ? -37.183  -11.153 21.646  1.00 111.04 ? 262 TRP A C   1 
ATOM   1634 O O   . TRP A 1 237 ? -37.419  -11.398 22.831  1.00 107.42 ? 262 TRP A O   1 
ATOM   1635 C CB  . TRP A 1 237 ? -37.797  -8.773  22.022  1.00 102.41 ? 262 TRP A CB  1 
ATOM   1636 C CG  . TRP A 1 237 ? -38.216  -7.470  21.456  1.00 105.22 ? 262 TRP A CG  1 
ATOM   1637 C CD1 . TRP A 1 237 ? -39.490  -7.054  21.227  1.00 111.68 ? 262 TRP A CD1 1 
ATOM   1638 C CD2 . TRP A 1 237 ? -37.362  -6.394  21.049  1.00 105.83 ? 262 TRP A CD2 1 
ATOM   1639 N NE1 . TRP A 1 237 ? -39.487  -5.784  20.701  1.00 108.28 ? 262 TRP A NE1 1 
ATOM   1640 C CE2 . TRP A 1 237 ? -38.190  -5.356  20.581  1.00 108.05 ? 262 TRP A CE2 1 
ATOM   1641 C CE3 . TRP A 1 237 ? -35.979  -6.207  21.032  1.00 118.65 ? 262 TRP A CE3 1 
ATOM   1642 C CZ2 . TRP A 1 237 ? -37.680  -4.143  20.101  1.00 103.97 ? 262 TRP A CZ2 1 
ATOM   1643 C CZ3 . TRP A 1 237 ? -35.474  -4.999  20.553  1.00 116.69 ? 262 TRP A CZ3 1 
ATOM   1644 C CH2 . TRP A 1 237 ? -36.324  -3.985  20.099  1.00 97.21  ? 262 TRP A CH2 1 
ATOM   1645 N N   . ASP A 1 238 ? -36.442  -11.942 20.874  1.00 120.47 ? 263 ASP A N   1 
ATOM   1646 C CA  . ASP A 1 238 ? -35.777  -13.123 21.402  1.00 122.69 ? 263 ASP A CA  1 
ATOM   1647 C C   . ASP A 1 238 ? -34.271  -12.918 21.444  1.00 117.57 ? 263 ASP A C   1 
ATOM   1648 O O   . ASP A 1 238 ? -33.573  -13.132 20.455  1.00 144.92 ? 263 ASP A O   1 
ATOM   1649 C CB  . ASP A 1 238 ? -36.129  -14.346 20.566  1.00 125.59 ? 263 ASP A CB  1 
ATOM   1650 C CG  . ASP A 1 238 ? -37.528  -14.843 20.840  1.00 130.87 ? 263 ASP A CG  1 
ATOM   1651 O OD1 . ASP A 1 238 ? -38.157  -14.333 21.788  1.00 130.33 ? 263 ASP A OD1 1 
ATOM   1652 O OD2 . ASP A 1 238 ? -38.000  -15.743 20.118  1.00 137.78 ? 263 ASP A OD2 1 
ATOM   1653 N N   . CYS A 1 239 ? -33.776  -12.496 22.598  1.00 112.82 ? 264 CYS A N   1 
ATOM   1654 C CA  . CYS A 1 239 ? -32.374  -12.149 22.737  1.00 132.89 ? 264 CYS A CA  1 
ATOM   1655 C C   . CYS A 1 239 ? -31.622  -13.156 23.595  1.00 146.62 ? 264 CYS A C   1 
ATOM   1656 O O   . CYS A 1 239 ? -32.193  -13.778 24.488  1.00 142.81 ? 264 CYS A O   1 
ATOM   1657 C CB  . CYS A 1 239 ? -32.242  -10.742 23.321  1.00 126.21 ? 264 CYS A CB  1 
ATOM   1658 S SG  . CYS A 1 239 ? -32.821  -9.444  22.217  1.00 125.65 ? 264 CYS A SG  1 
ATOM   1659 N N   . ASP A 1 240 ? -30.338  -13.325 23.302  1.00 145.87 ? 265 ASP A N   1 
ATOM   1660 C CA  . ASP A 1 240 ? -29.445  -14.059 24.182  1.00 142.03 ? 265 ASP A CA  1 
ATOM   1661 C C   . ASP A 1 240 ? -28.621  -13.026 24.952  1.00 139.10 ? 265 ASP A C   1 
ATOM   1662 O O   . ASP A 1 240 ? -27.723  -12.404 24.383  1.00 147.95 ? 265 ASP A O   1 
ATOM   1663 C CB  . ASP A 1 240 ? -28.540  -14.987 23.365  1.00 146.54 ? 265 ASP A CB  1 
ATOM   1664 C CG  . ASP A 1 240 ? -27.998  -16.147 24.183  1.00 157.23 ? 265 ASP A CG  1 
ATOM   1665 O OD1 . ASP A 1 240 ? -28.351  -16.249 25.379  1.00 164.14 ? 265 ASP A OD1 1 
ATOM   1666 O OD2 . ASP A 1 240 ? -27.222  -16.957 23.633  1.00 135.18 ? 265 ASP A OD2 1 
ATOM   1667 N N   . LEU A 1 241 ? -28.929  -12.829 26.234  1.00 131.92 ? 266 LEU A N   1 
ATOM   1668 C CA  . LEU A 1 241 ? -28.303  -11.750 27.011  1.00 163.86 ? 266 LEU A CA  1 
ATOM   1669 C C   . LEU A 1 241 ? -26.805  -11.922 27.282  1.00 173.40 ? 266 LEU A C   1 
ATOM   1670 O O   . LEU A 1 241 ? -26.088  -10.934 27.485  1.00 157.29 ? 266 LEU A O   1 
ATOM   1671 C CB  . LEU A 1 241 ? -29.052  -11.495 28.323  1.00 166.49 ? 266 LEU A CB  1 
ATOM   1672 C CG  . LEU A 1 241 ? -29.994  -10.289 28.304  1.00 147.70 ? 266 LEU A CG  1 
ATOM   1673 C CD1 . LEU A 1 241 ? -29.211  -8.982  28.259  1.00 147.97 ? 266 LEU A CD1 1 
ATOM   1674 C CD2 . LEU A 1 241 ? -30.932  -10.383 27.119  1.00 142.26 ? 266 LEU A CD2 1 
ATOM   1675 N N   . ASP A 1 242 ? -26.335  -13.167 27.295  1.00 168.83 ? 267 ASP A N   1 
ATOM   1676 C CA  . ASP A 1 242 ? -24.906  -13.431 27.440  1.00 159.72 ? 267 ASP A CA  1 
ATOM   1677 C C   . ASP A 1 242 ? -24.126  -13.013 26.178  1.00 168.63 ? 267 ASP A C   1 
ATOM   1678 O O   . ASP A 1 242 ? -22.932  -12.708 26.251  1.00 186.20 ? 267 ASP A O   1 
ATOM   1679 C CB  . ASP A 1 242 ? -24.645  -14.892 27.850  1.00 148.74 ? 267 ASP A CB  1 
ATOM   1680 C CG  . ASP A 1 242 ? -25.500  -15.890 27.076  1.00 152.34 ? 267 ASP A CG  1 
ATOM   1681 O OD1 . ASP A 1 242 ? -25.997  -16.861 27.690  1.00 125.37 ? 267 ASP A OD1 1 
ATOM   1682 O OD2 . ASP A 1 242 ? -25.666  -15.709 25.851  1.00 158.35 ? 267 ASP A OD2 1 
ATOM   1683 N N   . MET A 1 243 ? -24.817  -12.991 25.036  1.00 148.84 ? 268 MET A N   1 
ATOM   1684 C CA  . MET A 1 243 ? -24.306  -12.411 23.790  1.00 132.89 ? 268 MET A CA  1 
ATOM   1685 C C   . MET A 1 243 ? -24.240  -10.895 23.887  1.00 153.81 ? 268 MET A C   1 
ATOM   1686 O O   . MET A 1 243 ? -24.849  -10.305 24.777  1.00 163.70 ? 268 MET A O   1 
ATOM   1687 C CB  . MET A 1 243 ? -25.240  -12.751 22.635  1.00 138.40 ? 268 MET A CB  1 
ATOM   1688 C CG  . MET A 1 243 ? -25.441  -14.223 22.421  1.00 148.04 ? 268 MET A CG  1 
ATOM   1689 S SD  . MET A 1 243 ? -23.965  -14.961 21.737  1.00 164.08 ? 268 MET A SD  1 
ATOM   1690 C CE  . MET A 1 243 ? -23.654  -13.859 20.350  1.00 126.10 ? 268 MET A CE  1 
ATOM   1691 N N   . PRO A 1 244 ? -23.522  -10.251 22.954  1.00 152.02 ? 269 PRO A N   1 
ATOM   1692 C CA  . PRO A 1 244 ? -23.444  -8.786  22.976  1.00 164.89 ? 269 PRO A CA  1 
ATOM   1693 C C   . PRO A 1 244 ? -24.823  -8.153  22.828  1.00 158.36 ? 269 PRO A C   1 
ATOM   1694 O O   . PRO A 1 244 ? -25.668  -8.652  22.078  1.00 133.22 ? 269 PRO A O   1 
ATOM   1695 C CB  . PRO A 1 244 ? -22.573  -8.461  21.759  1.00 152.29 ? 269 PRO A CB  1 
ATOM   1696 C CG  . PRO A 1 244 ? -21.782  -9.705  21.524  1.00 148.23 ? 269 PRO A CG  1 
ATOM   1697 C CD  . PRO A 1 244 ? -22.710  -10.829 21.872  1.00 134.67 ? 269 PRO A CD  1 
ATOM   1698 N N   . GLN A 1 245 ? -25.044  -7.063  23.556  1.00 162.20 ? 270 GLN A N   1 
ATOM   1699 C CA  . GLN A 1 245 ? -26.324  -6.369  23.523  1.00 149.31 ? 270 GLN A CA  1 
ATOM   1700 C C   . GLN A 1 245 ? -26.632  -5.895  22.107  1.00 138.29 ? 270 GLN A C   1 
ATOM   1701 O O   . GLN A 1 245 ? -27.752  -5.483  21.811  1.00 136.87 ? 270 GLN A O   1 
ATOM   1702 C CB  . GLN A 1 245 ? -26.330  -5.191  24.507  1.00 118.79 ? 270 GLN A CB  1 
ATOM   1703 N N   . SER A 1 246 ? -25.630  -5.959  21.236  1.00 135.46 ? 271 SER A N   1 
ATOM   1704 C CA  . SER A 1 246 ? -25.791  -5.535  19.851  1.00 140.93 ? 271 SER A CA  1 
ATOM   1705 C C   . SER A 1 246 ? -26.557  -6.566  19.001  1.00 145.58 ? 271 SER A C   1 
ATOM   1706 O O   . SER A 1 246 ? -27.145  -6.219  17.973  1.00 119.76 ? 271 SER A O   1 
ATOM   1707 C CB  . SER A 1 246 ? -24.423  -5.232  19.236  1.00 135.77 ? 271 SER A CB  1 
ATOM   1708 O OG  . SER A 1 246 ? -24.555  -4.730  17.919  1.00 134.65 ? 271 SER A OG  1 
ATOM   1709 N N   . TRP A 1 247 ? -26.556  -7.824  19.439  1.00 154.24 ? 272 TRP A N   1 
ATOM   1710 C CA  . TRP A 1 247 ? -27.214  -8.908  18.702  1.00 148.50 ? 272 TRP A CA  1 
ATOM   1711 C C   . TRP A 1 247 ? -28.721  -8.968  18.961  1.00 141.39 ? 272 TRP A C   1 
ATOM   1712 O O   . TRP A 1 247 ? -29.441  -9.749  18.326  1.00 124.82 ? 272 TRP A O   1 
ATOM   1713 C CB  . TRP A 1 247 ? -26.588  -10.258 19.059  1.00 165.35 ? 272 TRP A CB  1 
ATOM   1714 C CG  . TRP A 1 247 ? -25.147  -10.401 18.657  1.00 176.71 ? 272 TRP A CG  1 
ATOM   1715 C CD1 . TRP A 1 247 ? -24.068  -9.831  19.266  1.00 172.52 ? 272 TRP A CD1 1 
ATOM   1716 C CD2 . TRP A 1 247 ? -24.628  -11.177 17.566  1.00 173.71 ? 272 TRP A CD2 1 
ATOM   1717 N NE1 . TRP A 1 247 ? -22.910  -10.196 18.620  1.00 160.99 ? 272 TRP A NE1 1 
ATOM   1718 C CE2 . TRP A 1 247 ? -23.227  -11.020 17.575  1.00 164.81 ? 272 TRP A CE2 1 
ATOM   1719 C CE3 . TRP A 1 247 ? -25.213  -11.981 16.582  1.00 166.51 ? 272 TRP A CE3 1 
ATOM   1720 C CZ2 . TRP A 1 247 ? -22.403  -11.641 16.639  1.00 176.28 ? 272 TRP A CZ2 1 
ATOM   1721 C CZ3 . TRP A 1 247 ? -24.395  -12.596 15.656  1.00 148.15 ? 272 TRP A CZ3 1 
ATOM   1722 C CH2 . TRP A 1 247 ? -23.004  -12.422 15.690  1.00 174.17 ? 272 TRP A CH2 1 
ATOM   1723 N N   . CYS A 1 248 ? -29.176  -8.158  19.915  1.00 149.05 ? 273 CYS A N   1 
ATOM   1724 C CA  . CYS A 1 248 ? -30.583  -8.087  20.304  1.00 123.91 ? 273 CYS A CA  1 
ATOM   1725 C C   . CYS A 1 248 ? -31.381  -7.258  19.314  1.00 126.21 ? 273 CYS A C   1 
ATOM   1726 O O   . CYS A 1 248 ? -31.163  -6.050  19.189  1.00 122.41 ? 273 CYS A O   1 
ATOM   1727 C CB  . CYS A 1 248 ? -30.700  -7.446  21.680  1.00 119.61 ? 273 CYS A CB  1 
ATOM   1728 S SG  . CYS A 1 248 ? -32.352  -7.467  22.366  1.00 157.73 ? 273 CYS A SG  1 
ATOM   1729 N N   . VAL A 1 249 ? -32.325  -7.902  18.635  1.00 129.41 ? 274 VAL A N   1 
ATOM   1730 C CA  . VAL A 1 249 ? -33.028  -7.268  17.526  1.00 122.64 ? 274 VAL A CA  1 
ATOM   1731 C C   . VAL A 1 249 ? -34.465  -7.793  17.432  1.00 126.89 ? 274 VAL A C   1 
ATOM   1732 O O   . VAL A 1 249 ? -34.726  -8.948  17.783  1.00 123.35 ? 274 VAL A O   1 
ATOM   1733 C CB  . VAL A 1 249 ? -32.269  -7.511  16.193  1.00 117.12 ? 274 VAL A CB  1 
ATOM   1734 C CG1 . VAL A 1 249 ? -32.995  -6.876  15.008  1.00 121.73 ? 274 VAL A CG1 1 
ATOM   1735 C CG2 . VAL A 1 249 ? -30.838  -6.985  16.289  1.00 110.25 ? 274 VAL A CG2 1 
ATOM   1736 N N   . PRO A 1 250 ? -35.405  -6.930  16.988  1.00 126.73 ? 275 PRO A N   1 
ATOM   1737 C CA  . PRO A 1 250 ? -36.826  -7.263  16.793  1.00 119.38 ? 275 PRO A CA  1 
ATOM   1738 C C   . PRO A 1 250 ? -37.103  -8.072  15.520  1.00 126.44 ? 275 PRO A C   1 
ATOM   1739 O O   . PRO A 1 250 ? -36.599  -7.704  14.454  1.00 123.57 ? 275 PRO A O   1 
ATOM   1740 C CB  . PRO A 1 250 ? -37.496  -5.884  16.642  1.00 114.79 ? 275 PRO A CB  1 
ATOM   1741 C CG  . PRO A 1 250 ? -36.489  -4.876  17.069  1.00 114.27 ? 275 PRO A CG  1 
ATOM   1742 C CD  . PRO A 1 250 ? -35.154  -5.487  16.810  1.00 117.87 ? 275 PRO A CD  1 
ATOM   1743 N N   . ARG A 1 251 ? -37.905  -9.134  15.619  1.00 118.67 ? 276 ARG A N   1 
ATOM   1744 C CA  . ARG A 1 251 ? -38.364  -9.857  14.428  1.00 126.75 ? 276 ARG A CA  1 
ATOM   1745 C C   . ARG A 1 251 ? -39.844  -9.582  14.091  1.00 120.21 ? 276 ARG A C   1 
ATOM   1746 O O   . ARG A 1 251 ? -40.751  -10.030 14.799  1.00 102.39 ? 276 ARG A O   1 
ATOM   1747 C CB  . ARG A 1 251 ? -38.095  -11.361 14.565  1.00 99.24  ? 276 ARG A CB  1 
ATOM   1748 N N   . TYR A 1 252 ? -40.075  -8.850  13.001  1.00 104.89 ? 277 TYR A N   1 
ATOM   1749 C CA  . TYR A 1 252 ? -41.426  -8.474  12.578  1.00 107.44 ? 277 TYR A CA  1 
ATOM   1750 C C   . TYR A 1 252 ? -42.168  -9.556  11.765  1.00 115.03 ? 277 TYR A C   1 
ATOM   1751 O O   . TYR A 1 252 ? -41.648  -10.082 10.773  1.00 114.70 ? 277 TYR A O   1 
ATOM   1752 C CB  . TYR A 1 252 ? -41.383  -7.168  11.772  1.00 93.04  ? 277 TYR A CB  1 
ATOM   1753 C CG  . TYR A 1 252 ? -40.652  -6.041  12.456  1.00 101.43 ? 277 TYR A CG  1 
ATOM   1754 C CD1 . TYR A 1 252 ? -39.307  -5.826  12.228  1.00 121.96 ? 277 TYR A CD1 1 
ATOM   1755 C CD2 . TYR A 1 252 ? -41.309  -5.189  13.329  1.00 106.58 ? 277 TYR A CD2 1 
ATOM   1756 C CE1 . TYR A 1 252 ? -38.631  -4.791  12.854  1.00 140.61 ? 277 TYR A CE1 1 
ATOM   1757 C CE2 . TYR A 1 252 ? -40.643  -4.151  13.959  1.00 95.47  ? 277 TYR A CE2 1 
ATOM   1758 C CZ  . TYR A 1 252 ? -39.303  -3.955  13.720  1.00 119.74 ? 277 TYR A CZ  1 
ATOM   1759 O OH  . TYR A 1 252 ? -38.626  -2.926  14.343  1.00 109.15 ? 277 TYR A OH  1 
ATOM   1760 N N   . THR A 1 253 ? -43.412  -9.824  12.156  1.00 107.34 ? 278 THR A N   1 
ATOM   1761 C CA  . THR A 1 253 ? -44.266  -10.790 11.473  1.00 95.21  ? 278 THR A CA  1 
ATOM   1762 C C   . THR A 1 253 ? -45.590  -10.095 11.162  1.00 102.50 ? 278 THR A C   1 
ATOM   1763 O O   . THR A 1 253 ? -45.866  -9.010  11.678  1.00 98.06  ? 278 THR A O   1 
ATOM   1764 C CB  . THR A 1 253 ? -44.561  -12.012 12.357  1.00 99.49  ? 278 THR A CB  1 
ATOM   1765 O OG1 . THR A 1 253 ? -43.451  -12.265 13.229  1.00 102.69 ? 278 THR A OG1 1 
ATOM   1766 C CG2 . THR A 1 253 ? -44.846  -13.239 11.508  1.00 92.27  ? 278 THR A CG2 1 
ATOM   1767 N N   . PHE A 1 254 ? -46.402  -10.696 10.302  1.00 109.44 ? 279 PHE A N   1 
ATOM   1768 C CA  . PHE A 1 254 ? -47.685  -10.098 9.933   1.00 105.69 ? 279 PHE A CA  1 
ATOM   1769 C C   . PHE A 1 254 ? -48.732  -11.164 9.693   1.00 109.21 ? 279 PHE A C   1 
ATOM   1770 O O   . PHE A 1 254 ? -48.543  -12.063 8.870   1.00 119.81 ? 279 PHE A O   1 
ATOM   1771 C CB  . PHE A 1 254 ? -47.558  -9.232  8.679   1.00 96.17  ? 279 PHE A CB  1 
ATOM   1772 C CG  . PHE A 1 254 ? -46.583  -8.110  8.816   1.00 105.70 ? 279 PHE A CG  1 
ATOM   1773 C CD1 . PHE A 1 254 ? -45.229  -8.330  8.658   1.00 118.69 ? 279 PHE A CD1 1 
ATOM   1774 C CD2 . PHE A 1 254 ? -47.016  -6.830  9.095   1.00 109.41 ? 279 PHE A CD2 1 
ATOM   1775 C CE1 . PHE A 1 254 ? -44.328  -7.292  8.785   1.00 117.41 ? 279 PHE A CE1 1 
ATOM   1776 C CE2 . PHE A 1 254 ? -46.115  -5.786  9.216   1.00 103.27 ? 279 PHE A CE2 1 
ATOM   1777 C CZ  . PHE A 1 254 ? -44.773  -6.017  9.065   1.00 103.11 ? 279 PHE A CZ  1 
ATOM   1778 N N   . ARG A 1 255 ? -49.842  -11.047 10.415  1.00 106.25 ? 280 ARG A N   1 
ATOM   1779 C CA  . ARG A 1 255 ? -50.957  -11.974 10.285  1.00 104.81 ? 280 ARG A CA  1 
ATOM   1780 C C   . ARG A 1 255 ? -52.251  -11.192 10.125  1.00 109.51 ? 280 ARG A C   1 
ATOM   1781 O O   . ARG A 1 255 ? -52.405  -10.116 10.696  1.00 108.35 ? 280 ARG A O   1 
ATOM   1782 C CB  . ARG A 1 255 ? -51.091  -12.836 11.542  1.00 99.21  ? 280 ARG A CB  1 
ATOM   1783 C CG  . ARG A 1 255 ? -50.251  -14.098 11.581  1.00 106.62 ? 280 ARG A CG  1 
ATOM   1784 C CD  . ARG A 1 255 ? -50.763  -15.061 12.675  1.00 147.14 ? 280 ARG A CD  1 
ATOM   1785 N NE  . ARG A 1 255 ? -51.226  -14.382 13.896  1.00 160.23 ? 280 ARG A NE  1 
ATOM   1786 C CZ  . ARG A 1 255 ? -51.979  -14.959 14.836  1.00 152.09 ? 280 ARG A CZ  1 
ATOM   1787 N NH1 . ARG A 1 255 ? -52.351  -16.226 14.695  1.00 152.35 ? 280 ARG A NH1 1 
ATOM   1788 N NH2 . ARG A 1 255 ? -52.368  -14.281 15.917  1.00 115.57 ? 280 ARG A NH2 1 
ATOM   1789 N N   . ARG A 1 256 ? -53.177  -11.722 9.337   1.00 97.22  ? 281 ARG A N   1 
ATOM   1790 C CA  . ARG A 1 256 ? -54.557  -11.288 9.423   1.00 89.81  ? 281 ARG A CA  1 
ATOM   1791 C C   . ARG A 1 256 ? -55.145  -12.047 10.606  1.00 102.87 ? 281 ARG A C   1 
ATOM   1792 O O   . ARG A 1 256 ? -54.916  -13.248 10.752  1.00 98.49  ? 281 ARG A O   1 
ATOM   1793 C CB  . ARG A 1 256 ? -55.312  -11.633 8.140   1.00 88.91  ? 281 ARG A CB  1 
ATOM   1794 C CG  . ARG A 1 256 ? -56.820  -11.657 8.290   1.00 93.60  ? 281 ARG A CG  1 
ATOM   1795 C CD  . ARG A 1 256 ? -57.424  -10.281 8.062   1.00 94.45  ? 281 ARG A CD  1 
ATOM   1796 N NE  . ARG A 1 256 ? -57.907  -10.107 6.691   1.00 98.97  ? 281 ARG A NE  1 
ATOM   1797 C CZ  . ARG A 1 256 ? -59.187  -10.182 6.324   1.00 98.18  ? 281 ARG A CZ  1 
ATOM   1798 N NH1 . ARG A 1 256 ? -60.138  -10.418 7.220   1.00 89.30  ? 281 ARG A NH1 1 
ATOM   1799 N NH2 . ARG A 1 256 ? -59.522  -10.014 5.055   1.00 103.79 ? 281 ARG A NH2 1 
ATOM   1800 N N   . LEU A 1 257 ? -55.891  -11.361 11.462  1.00 92.91  ? 282 LEU A N   1 
ATOM   1801 C CA  . LEU A 1 257 ? -56.407  -12.014 12.656  1.00 81.77  ? 282 LEU A CA  1 
ATOM   1802 C C   . LEU A 1 257 ? -57.866  -12.480 12.575  1.00 98.60  ? 282 LEU A C   1 
ATOM   1803 O O   . LEU A 1 257 ? -58.204  -13.530 13.117  1.00 116.67 ? 282 LEU A O   1 
ATOM   1804 C CB  . LEU A 1 257 ? -56.171  -11.129 13.879  1.00 101.05 ? 282 LEU A CB  1 
ATOM   1805 C CG  . LEU A 1 257 ? -54.689  -10.844 14.149  1.00 103.45 ? 282 LEU A CG  1 
ATOM   1806 C CD1 . LEU A 1 257 ? -54.481  -9.754  15.200  1.00 106.34 ? 282 LEU A CD1 1 
ATOM   1807 C CD2 . LEU A 1 257 ? -53.965  -12.121 14.556  1.00 106.28 ? 282 LEU A CD2 1 
ATOM   1808 N N   . ASP A 1 258 ? -58.731  -11.709 11.917  1.00 87.80  ? 283 ASP A N   1 
ATOM   1809 C CA  . ASP A 1 258 ? -60.144  -12.092 11.796  1.00 89.90  ? 283 ASP A CA  1 
ATOM   1810 C C   . ASP A 1 258 ? -60.402  -13.111 10.695  1.00 116.72 ? 283 ASP A C   1 
ATOM   1811 O O   . ASP A 1 258 ? -59.567  -13.311 9.812   1.00 122.91 ? 283 ASP A O   1 
ATOM   1812 C CB  . ASP A 1 258 ? -61.034  -10.875 11.569  1.00 90.52  ? 283 ASP A CB  1 
ATOM   1813 C CG  . ASP A 1 258 ? -60.633  -10.087 10.357  1.00 90.77  ? 283 ASP A CG  1 
ATOM   1814 O OD1 . ASP A 1 258 ? -59.435  -9.770  10.235  1.00 81.52  ? 283 ASP A OD1 1 
ATOM   1815 O OD2 . ASP A 1 258 ? -61.521  -9.773  9.541   1.00 105.17 ? 283 ASP A OD2 1 
ATOM   1816 N N   . ASN A 1 259 ? -61.568  -13.747 10.748  1.00 120.90 ? 284 ASN A N   1 
ATOM   1817 C CA  . ASN A 1 259 ? -61.941  -14.740 9.749   1.00 125.00 ? 284 ASN A CA  1 
ATOM   1818 C C   . ASN A 1 259 ? -62.608  -14.109 8.533   1.00 139.74 ? 284 ASN A C   1 
ATOM   1819 O O   . ASN A 1 259 ? -63.541  -13.314 8.678   1.00 141.53 ? 284 ASN A O   1 
ATOM   1820 C CB  . ASN A 1 259 ? -62.869  -15.789 10.361  1.00 119.57 ? 284 ASN A CB  1 
ATOM   1821 C CG  . ASN A 1 259 ? -63.064  -16.986 9.457   1.00 142.18 ? 284 ASN A CG  1 
ATOM   1822 O OD1 . ASN A 1 259 ? -62.311  -17.184 8.502   1.00 148.50 ? 284 ASN A OD1 1 
ATOM   1823 N ND2 . ASN A 1 259 ? -64.078  -17.793 9.750   1.00 139.65 ? 284 ASN A ND2 1 
ATOM   1824 N N   . LYS A 1 260 ? -62.123  -14.465 7.343   1.00 142.36 ? 285 LYS A N   1 
ATOM   1825 C CA  . LYS A 1 260 ? -62.695  -13.985 6.088   1.00 132.08 ? 285 LYS A CA  1 
ATOM   1826 C C   . LYS A 1 260 ? -63.903  -14.823 5.651   1.00 134.15 ? 285 LYS A C   1 
ATOM   1827 O O   . LYS A 1 260 ? -64.747  -14.355 4.891   1.00 135.27 ? 285 LYS A O   1 
ATOM   1828 C CB  . LYS A 1 260 ? -61.632  -13.956 4.997   1.00 106.50 ? 285 LYS A CB  1 
ATOM   1829 N N   . ASP A 1 261 ? -63.984  -16.056 6.144   1.00 130.59 ? 286 ASP A N   1 
ATOM   1830 C CA  . ASP A 1 261 ? -65.088  -16.967 5.828   1.00 133.52 ? 286 ASP A CA  1 
ATOM   1831 C C   . ASP A 1 261 ? -66.436  -16.456 6.345   1.00 141.71 ? 286 ASP A C   1 
ATOM   1832 O O   . ASP A 1 261 ? -66.638  -16.367 7.551   1.00 147.09 ? 286 ASP A O   1 
ATOM   1833 C CB  . ASP A 1 261 ? -64.795  -18.351 6.423   1.00 135.23 ? 286 ASP A CB  1 
ATOM   1834 C CG  . ASP A 1 261 ? -65.955  -19.319 6.268   1.00 149.48 ? 286 ASP A CG  1 
ATOM   1835 O OD1 . ASP A 1 261 ? -66.786  -19.125 5.358   1.00 151.07 ? 286 ASP A OD1 1 
ATOM   1836 O OD2 . ASP A 1 261 ? -66.032  -20.283 7.059   1.00 154.71 ? 286 ASP A OD2 1 
ATOM   1837 N N   . PRO A 1 262 ? -67.370  -16.132 5.433   1.00 145.16 ? 287 PRO A N   1 
ATOM   1838 C CA  . PRO A 1 262 ? -68.689  -15.610 5.821   1.00 135.31 ? 287 PRO A CA  1 
ATOM   1839 C C   . PRO A 1 262 ? -69.460  -16.550 6.751   1.00 141.63 ? 287 PRO A C   1 
ATOM   1840 O O   . PRO A 1 262 ? -70.158  -16.081 7.653   1.00 141.95 ? 287 PRO A O   1 
ATOM   1841 C CB  . PRO A 1 262 ? -69.423  -15.479 4.482   1.00 150.91 ? 287 PRO A CB  1 
ATOM   1842 C CG  . PRO A 1 262 ? -68.347  -15.350 3.467   1.00 153.15 ? 287 PRO A CG  1 
ATOM   1843 C CD  . PRO A 1 262 ? -67.207  -16.186 3.970   1.00 156.99 ? 287 PRO A CD  1 
ATOM   1844 N N   . ASP A 1 263 ? -69.343  -17.857 6.520   1.00 146.84 ? 288 ASP A N   1 
ATOM   1845 C CA  . ASP A 1 263 ? -69.979  -18.855 7.378   1.00 156.67 ? 288 ASP A CA  1 
ATOM   1846 C C   . ASP A 1 263 ? -69.133  -19.099 8.611   1.00 149.30 ? 288 ASP A C   1 
ATOM   1847 O O   . ASP A 1 263 ? -67.954  -18.745 8.639   1.00 154.61 ? 288 ASP A O   1 
ATOM   1848 C CB  . ASP A 1 263 ? -70.157  -20.180 6.638   1.00 163.16 ? 288 ASP A CB  1 
ATOM   1849 C CG  . ASP A 1 263 ? -71.172  -20.095 5.523   1.00 174.99 ? 288 ASP A CG  1 
ATOM   1850 O OD1 . ASP A 1 263 ? -72.242  -19.477 5.734   1.00 177.34 ? 288 ASP A OD1 1 
ATOM   1851 O OD2 . ASP A 1 263 ? -70.897  -20.658 4.439   1.00 161.91 ? 288 ASP A OD2 1 
ATOM   1852 N N   . ASN A 1 264 ? -69.729  -19.716 9.626   1.00 139.51 ? 289 ASN A N   1 
ATOM   1853 C CA  . ASN A 1 264 ? -68.991  -20.073 10.832  1.00 146.09 ? 289 ASN A CA  1 
ATOM   1854 C C   . ASN A 1 264 ? -68.504  -18.853 11.614  1.00 143.46 ? 289 ASN A C   1 
ATOM   1855 O O   . ASN A 1 264 ? -67.473  -18.904 12.292  1.00 144.04 ? 289 ASN A O   1 
ATOM   1856 C CB  . ASN A 1 264 ? -67.810  -20.987 10.486  1.00 155.77 ? 289 ASN A CB  1 
ATOM   1857 C CG  . ASN A 1 264 ? -67.076  -21.478 11.715  1.00 146.12 ? 289 ASN A CG  1 
ATOM   1858 O OD1 . ASN A 1 264 ? -67.681  -21.679 12.767  1.00 139.72 ? 289 ASN A OD1 1 
ATOM   1859 N ND2 . ASN A 1 264 ? -65.766  -21.669 11.590  1.00 140.18 ? 289 ASN A ND2 1 
ATOM   1860 N N   . ASN A 1 265 ? -69.241  -17.752 11.502  1.00 132.15 ? 290 ASN A N   1 
ATOM   1861 C CA  . ASN A 1 265 ? -68.962  -16.558 12.298  1.00 132.27 ? 290 ASN A CA  1 
ATOM   1862 C C   . ASN A 1 265 ? -69.987  -15.451 12.066  1.00 128.46 ? 290 ASN A C   1 
ATOM   1863 O O   . ASN A 1 265 ? -70.942  -15.624 11.306  1.00 121.84 ? 290 ASN A O   1 
ATOM   1864 C CB  . ASN A 1 265 ? -67.534  -16.038 12.059  1.00 125.74 ? 290 ASN A CB  1 
ATOM   1865 C CG  . ASN A 1 265 ? -67.432  -15.117 10.852  1.00 128.02 ? 290 ASN A CG  1 
ATOM   1866 O OD1 . ASN A 1 265 ? -68.307  -15.102 9.985   1.00 133.10 ? 290 ASN A OD1 1 
ATOM   1867 N ND2 . ASN A 1 265 ? -66.354  -14.343 10.793  1.00 114.14 ? 290 ASN A ND2 1 
ATOM   1868 N N   . VAL A 1 266 ? -69.776  -14.321 12.736  1.00 120.55 ? 291 VAL A N   1 
ATOM   1869 C CA  . VAL A 1 266 ? -70.636  -13.150 12.599  1.00 120.84 ? 291 VAL A CA  1 
ATOM   1870 C C   . VAL A 1 266 ? -69.802  -11.888 12.687  1.00 127.45 ? 291 VAL A C   1 
ATOM   1871 O O   . VAL A 1 266 ? -68.633  -11.935 13.068  1.00 128.44 ? 291 VAL A O   1 
ATOM   1872 C CB  . VAL A 1 266 ? -71.690  -13.082 13.703  1.00 104.14 ? 291 VAL A CB  1 
ATOM   1873 C CG1 . VAL A 1 266 ? -72.929  -13.881 13.315  1.00 116.88 ? 291 VAL A CG1 1 
ATOM   1874 C CG2 . VAL A 1 266 ? -71.102  -13.561 15.014  1.00 78.78  ? 291 VAL A CG2 1 
ATOM   1875 N N   . ALA A 1 267 ? -70.410  -10.759 12.343  1.00 121.21 ? 292 ALA A N   1 
ATOM   1876 C CA  . ALA A 1 267 ? -69.690  -9.493  12.307  1.00 135.99 ? 292 ALA A CA  1 
ATOM   1877 C C   . ALA A 1 267 ? -68.442  -9.630  11.446  1.00 137.90 ? 292 ALA A C   1 
ATOM   1878 O O   . ALA A 1 267 ? -67.332  -9.362  11.910  1.00 147.33 ? 292 ALA A O   1 
ATOM   1879 C CB  . ALA A 1 267 ? -69.311  -9.048  13.727  1.00 134.81 ? 292 ALA A CB  1 
ATOM   1880 N N   . PRO A 1 268 ? -68.615  -10.055 10.188  1.00 117.38 ? 293 PRO A N   1 
ATOM   1881 C CA  . PRO A 1 268 ? -67.462  -10.296 9.319   1.00 96.84  ? 293 PRO A CA  1 
ATOM   1882 C C   . PRO A 1 268 ? -66.693  -9.005  9.144   1.00 103.87 ? 293 PRO A C   1 
ATOM   1883 O O   . PRO A 1 268 ? -67.286  -7.932  9.209   1.00 110.35 ? 293 PRO A O   1 
ATOM   1884 C CB  . PRO A 1 268 ? -68.102  -10.716 7.998   1.00 103.19 ? 293 PRO A CB  1 
ATOM   1885 C CG  . PRO A 1 268 ? -69.495  -11.143 8.360   1.00 125.05 ? 293 PRO A CG  1 
ATOM   1886 C CD  . PRO A 1 268 ? -69.889  -10.261 9.487   1.00 111.27 ? 293 PRO A CD  1 
ATOM   1887 N N   . GLY A 1 269 ? -65.387  -9.103  8.949   1.00 113.77 ? 294 GLY A N   1 
ATOM   1888 C CA  . GLY A 1 269 ? -64.570  -7.916  8.798   1.00 121.19 ? 294 GLY A CA  1 
ATOM   1889 C C   . GLY A 1 269 ? -64.479  -7.116  10.084  1.00 114.72 ? 294 GLY A C   1 
ATOM   1890 O O   . GLY A 1 269 ? -64.426  -7.697  11.167  1.00 115.54 ? 294 GLY A O   1 
ATOM   1891 N N   . TYR A 1 270 ? -64.458  -5.789  9.976   1.00 99.81  ? 295 TYR A N   1 
ATOM   1892 C CA  . TYR A 1 270 ? -64.332  -4.936  11.155  1.00 90.97  ? 295 TYR A CA  1 
ATOM   1893 C C   . TYR A 1 270 ? -64.873  -3.534  10.897  1.00 90.91  ? 295 TYR A C   1 
ATOM   1894 O O   . TYR A 1 270 ? -64.495  -2.882  9.938   1.00 90.90  ? 295 TYR A O   1 
ATOM   1895 C CB  . TYR A 1 270 ? -62.871  -4.869  11.601  1.00 79.79  ? 295 TYR A CB  1 
ATOM   1896 C CG  . TYR A 1 270 ? -62.642  -4.147  12.918  1.00 106.01 ? 295 TYR A CG  1 
ATOM   1897 C CD1 . TYR A 1 270 ? -62.576  -4.839  14.128  1.00 103.54 ? 295 TYR A CD1 1 
ATOM   1898 C CD2 . TYR A 1 270 ? -62.478  -2.771  12.950  1.00 113.86 ? 295 TYR A CD2 1 
ATOM   1899 C CE1 . TYR A 1 270 ? -62.356  -4.169  15.327  1.00 102.47 ? 295 TYR A CE1 1 
ATOM   1900 C CE2 . TYR A 1 270 ? -62.263  -2.096  14.142  1.00 100.27 ? 295 TYR A CE2 1 
ATOM   1901 C CZ  . TYR A 1 270 ? -62.199  -2.794  15.325  1.00 94.76  ? 295 TYR A CZ  1 
ATOM   1902 O OH  . TYR A 1 270 ? -61.978  -2.105  16.500  1.00 99.88  ? 295 TYR A OH  1 
ATOM   1903 N N   . ASN A 1 271 ? -65.757  -3.071  11.771  1.00 102.71 ? 296 ASN A N   1 
ATOM   1904 C CA  . ASN A 1 271 ? -66.382  -1.764  11.611  1.00 93.44  ? 296 ASN A CA  1 
ATOM   1905 C C   . ASN A 1 271 ? -67.108  -1.332  12.871  1.00 85.98  ? 296 ASN A C   1 
ATOM   1906 O O   . ASN A 1 271 ? -67.433  -2.154  13.724  1.00 95.67  ? 296 ASN A O   1 
ATOM   1907 C CB  . ASN A 1 271 ? -67.416  -1.825  10.503  1.00 92.81  ? 296 ASN A CB  1 
ATOM   1908 C CG  . ASN A 1 271 ? -68.763  -2.298  11.003  1.00 92.58  ? 296 ASN A CG  1 
ATOM   1909 O OD1 . ASN A 1 271 ? -69.766  -1.625  10.820  1.00 83.75  ? 296 ASN A OD1 1 
ATOM   1910 N ND2 . ASN A 1 271 ? -68.788  -3.449  11.655  1.00 96.36  ? 296 ASN A ND2 1 
ATOM   1911 N N   . PHE A 1 272 ? -67.392  -0.043  12.969  1.00 58.69  ? 297 PHE A N   1 
ATOM   1912 C CA  . PHE A 1 272 ? -68.144  0.466   14.094  1.00 60.16  ? 297 PHE A CA  1 
ATOM   1913 C C   . PHE A 1 272 ? -68.842  1.743   13.739  1.00 69.49  ? 297 PHE A C   1 
ATOM   1914 O O   . PHE A 1 272 ? -68.585  2.312   12.696  1.00 93.75  ? 297 PHE A O   1 
ATOM   1915 C CB  . PHE A 1 272 ? -67.249  0.668   15.307  1.00 80.84  ? 297 PHE A CB  1 
ATOM   1916 C CG  . PHE A 1 272 ? -66.130  1.639   15.105  1.00 65.58  ? 297 PHE A CG  1 
ATOM   1917 C CD1 . PHE A 1 272 ? -64.826  1.194   15.016  1.00 73.32  ? 297 PHE A CD1 1 
ATOM   1918 C CD2 . PHE A 1 272 ? -66.372  2.988   15.073  1.00 60.94  ? 297 PHE A CD2 1 
ATOM   1919 C CE1 . PHE A 1 272 ? -63.789  2.076   14.863  1.00 82.71  ? 297 PHE A CE1 1 
ATOM   1920 C CE2 . PHE A 1 272 ? -65.347  3.871   14.924  1.00 71.11  ? 297 PHE A CE2 1 
ATOM   1921 C CZ  . PHE A 1 272 ? -64.050  3.425   14.815  1.00 80.96  ? 297 PHE A CZ  1 
ATOM   1922 N N   . ARG A 1 273 ? -69.752  2.182   14.594  1.00 79.45  ? 298 ARG A N   1 
ATOM   1923 C CA  . ARG A 1 273 ? -70.457  3.429   14.343  1.00 88.66  ? 298 ARG A CA  1 
ATOM   1924 C C   . ARG A 1 273 ? -69.887  4.532   15.220  1.00 98.79  ? 298 ARG A C   1 
ATOM   1925 O O   . ARG A 1 273 ? -69.367  4.283   16.317  1.00 89.95  ? 298 ARG A O   1 
ATOM   1926 C CB  . ARG A 1 273 ? -71.968  3.266   14.560  1.00 75.14  ? 298 ARG A CB  1 
ATOM   1927 C CG  . ARG A 1 273 ? -72.498  1.950   14.023  1.00 89.39  ? 298 ARG A CG  1 
ATOM   1928 C CD  . ARG A 1 273 ? -73.977  2.003   13.715  1.00 94.16  ? 298 ARG A CD  1 
ATOM   1929 N NE  . ARG A 1 273 ? -74.355  0.931   12.801  1.00 89.98  ? 298 ARG A NE  1 
ATOM   1930 C CZ  . ARG A 1 273 ? -75.562  0.805   12.259  1.00 124.51 ? 298 ARG A CZ  1 
ATOM   1931 N NH1 . ARG A 1 273 ? -76.525  1.687   12.539  1.00 131.16 ? 298 ARG A NH1 1 
ATOM   1932 N NH2 . ARG A 1 273 ? -75.809  -0.206  11.434  1.00 127.48 ? 298 ARG A NH2 1 
ATOM   1933 N N   . PHE A 1 274 ? -69.956  5.753   14.716  1.00 93.37  ? 299 PHE A N   1 
ATOM   1934 C CA  . PHE A 1 274 ? -69.619  6.907   15.521  1.00 85.73  ? 299 PHE A CA  1 
ATOM   1935 C C   . PHE A 1 274 ? -70.303  8.108   14.931  1.00 86.96  ? 299 PHE A C   1 
ATOM   1936 O O   . PHE A 1 274 ? -70.866  8.033   13.839  1.00 92.67  ? 299 PHE A O   1 
ATOM   1937 C CB  . PHE A 1 274 ? -68.111  7.124   15.580  1.00 76.62  ? 299 PHE A CB  1 
ATOM   1938 C CG  . PHE A 1 274 ? -67.469  7.357   14.246  1.00 75.70  ? 299 PHE A CG  1 
ATOM   1939 C CD1 . PHE A 1 274 ? -66.611  6.417   13.714  1.00 81.79  ? 299 PHE A CD1 1 
ATOM   1940 C CD2 . PHE A 1 274 ? -67.703  8.514   13.536  1.00 83.00  ? 299 PHE A CD2 1 
ATOM   1941 C CE1 . PHE A 1 274 ? -65.997  6.620   12.499  1.00 85.68  ? 299 PHE A CE1 1 
ATOM   1942 C CE2 . PHE A 1 274 ? -67.099  8.717   12.319  1.00 85.39  ? 299 PHE A CE2 1 
ATOM   1943 C CZ  . PHE A 1 274 ? -66.241  7.763   11.799  1.00 85.93  ? 299 PHE A CZ  1 
ATOM   1944 N N   . ALA A 1 275 ? -70.261  9.222   15.647  1.00 79.22  ? 300 ALA A N   1 
ATOM   1945 C CA  . ALA A 1 275 ? -71.049  10.368  15.230  1.00 88.26  ? 300 ALA A CA  1 
ATOM   1946 C C   . ALA A 1 275 ? -70.395  11.709  15.465  1.00 91.82  ? 300 ALA A C   1 
ATOM   1947 O O   . ALA A 1 275 ? -69.449  11.843  16.243  1.00 92.25  ? 300 ALA A O   1 
ATOM   1948 C CB  . ALA A 1 275 ? -72.405  10.338  15.886  1.00 99.30  ? 300 ALA A CB  1 
ATOM   1949 N N   . LYS A 1 276 ? -70.944  12.699  14.774  1.00 85.96  ? 301 LYS A N   1 
ATOM   1950 C CA  . LYS A 1 276 ? -70.485  14.066  14.855  1.00 95.51  ? 301 LYS A CA  1 
ATOM   1951 C C   . LYS A 1 276 ? -71.699  14.862  15.269  1.00 99.33  ? 301 LYS A C   1 
ATOM   1952 O O   . LYS A 1 276 ? -72.736  14.806  14.612  1.00 101.81 ? 301 LYS A O   1 
ATOM   1953 C CB  . LYS A 1 276 ? -70.000  14.548  13.486  1.00 101.53 ? 301 LYS A CB  1 
ATOM   1954 C CG  . LYS A 1 276 ? -69.229  13.512  12.686  1.00 102.77 ? 301 LYS A CG  1 
ATOM   1955 C CD  . LYS A 1 276 ? -67.787  13.378  13.149  1.00 91.79  ? 301 LYS A CD  1 
ATOM   1956 C CE  . LYS A 1 276 ? -66.894  14.389  12.436  1.00 117.34 ? 301 LYS A CE  1 
ATOM   1957 N NZ  . LYS A 1 276 ? -66.968  14.301  10.952  1.00 111.82 ? 301 LYS A NZ  1 
ATOM   1958 N N   . TYR A 1 277 ? -71.588  15.585  16.372  1.00 90.75  ? 302 TYR A N   1 
ATOM   1959 C CA  . TYR A 1 277 ? -72.738  16.297  16.891  1.00 92.08  ? 302 TYR A CA  1 
ATOM   1960 C C   . TYR A 1 277 ? -72.652  17.783  16.572  1.00 97.97  ? 302 TYR A C   1 
ATOM   1961 O O   . TYR A 1 277 ? -71.569  18.370  16.597  1.00 100.98 ? 302 TYR A O   1 
ATOM   1962 C CB  . TYR A 1 277 ? -72.887  16.010  18.390  1.00 106.46 ? 302 TYR A CB  1 
ATOM   1963 C CG  . TYR A 1 277 ? -73.022  14.526  18.691  1.00 102.91 ? 302 TYR A CG  1 
ATOM   1964 C CD1 . TYR A 1 277 ? -71.908  13.745  18.979  1.00 95.46  ? 302 TYR A CD1 1 
ATOM   1965 C CD2 . TYR A 1 277 ? -74.265  13.905  18.667  1.00 105.07 ? 302 TYR A CD2 1 
ATOM   1966 C CE1 . TYR A 1 277 ? -72.032  12.395  19.248  1.00 97.53  ? 302 TYR A CE1 1 
ATOM   1967 C CE2 . TYR A 1 277 ? -74.399  12.555  18.930  1.00 99.11  ? 302 TYR A CE2 1 
ATOM   1968 C CZ  . TYR A 1 277 ? -73.281  11.804  19.217  1.00 107.11 ? 302 TYR A CZ  1 
ATOM   1969 O OH  . TYR A 1 277 ? -73.424  10.458  19.478  1.00 110.84 ? 302 TYR A OH  1 
ATOM   1970 N N   . TYR A 1 278 ? -73.794  18.381  16.247  1.00 87.06  ? 303 TYR A N   1 
ATOM   1971 C CA  . TYR A 1 278 ? -73.827  19.782  15.854  1.00 106.99 ? 303 TYR A CA  1 
ATOM   1972 C C   . TYR A 1 278 ? -75.018  20.489  16.465  1.00 125.37 ? 303 TYR A C   1 
ATOM   1973 O O   . TYR A 1 278 ? -76.162  20.136  16.191  1.00 123.94 ? 303 TYR A O   1 
ATOM   1974 C CB  . TYR A 1 278 ? -73.941  19.918  14.333  1.00 121.83 ? 303 TYR A CB  1 
ATOM   1975 C CG  . TYR A 1 278 ? -72.932  19.129  13.524  1.00 142.84 ? 303 TYR A CG  1 
ATOM   1976 C CD1 . TYR A 1 278 ? -71.561  19.277  13.730  1.00 160.77 ? 303 TYR A CD1 1 
ATOM   1977 C CD2 . TYR A 1 278 ? -73.350  18.258  12.527  1.00 124.75 ? 303 TYR A CD2 1 
ATOM   1978 C CE1 . TYR A 1 278 ? -70.635  18.557  12.969  1.00 139.30 ? 303 TYR A CE1 1 
ATOM   1979 C CE2 . TYR A 1 278 ? -72.434  17.537  11.768  1.00 128.72 ? 303 TYR A CE2 1 
ATOM   1980 C CZ  . TYR A 1 278 ? -71.081  17.689  11.993  1.00 117.68 ? 303 TYR A CZ  1 
ATOM   1981 O OH  . TYR A 1 278 ? -70.175  16.968  11.248  1.00 105.42 ? 303 TYR A OH  1 
ATOM   1982 N N   . LYS A 1 279 ? -74.752  21.499  17.286  1.00 154.30 ? 304 LYS A N   1 
ATOM   1983 C CA  . LYS A 1 279 ? -75.825  22.331  17.810  1.00 151.85 ? 304 LYS A CA  1 
ATOM   1984 C C   . LYS A 1 279 ? -76.342  23.216  16.691  1.00 149.57 ? 304 LYS A C   1 
ATOM   1985 O O   . LYS A 1 279 ? -75.725  24.219  16.337  1.00 150.96 ? 304 LYS A O   1 
ATOM   1986 C CB  . LYS A 1 279 ? -75.349  23.174  18.979  1.00 143.95 ? 304 LYS A CB  1 
ATOM   1987 N N   . ASN A 1 280 ? -77.472  22.818  16.124  1.00 152.07 ? 305 ASN A N   1 
ATOM   1988 C CA  . ASN A 1 280 ? -78.170  23.612  15.127  1.00 160.00 ? 305 ASN A CA  1 
ATOM   1989 C C   . ASN A 1 280 ? -78.447  25.018  15.669  1.00 192.00 ? 305 ASN A C   1 
ATOM   1990 O O   . ASN A 1 280 ? -78.562  25.209  16.885  1.00 199.52 ? 305 ASN A O   1 
ATOM   1991 C CB  . ASN A 1 280 ? -79.474  22.906  14.754  1.00 152.13 ? 305 ASN A CB  1 
ATOM   1992 C CG  . ASN A 1 280 ? -80.275  23.654  13.715  1.00 161.70 ? 305 ASN A CG  1 
ATOM   1993 O OD1 . ASN A 1 280 ? -79.742  24.464  12.958  1.00 168.17 ? 305 ASN A OD1 1 
ATOM   1994 N ND2 . ASN A 1 280 ? -81.569  23.375  13.666  1.00 167.38 ? 305 ASN A ND2 1 
ATOM   1995 N N   . SER A 1 281 ? -78.541  25.998  14.771  1.00 195.73 ? 306 SER A N   1 
ATOM   1996 C CA  . SER A 1 281 ? -78.783  27.390  15.160  1.00 190.08 ? 306 SER A CA  1 
ATOM   1997 C C   . SER A 1 281 ? -80.113  27.561  15.896  1.00 183.20 ? 306 SER A C   1 
ATOM   1998 O O   . SER A 1 281 ? -80.303  28.529  16.638  1.00 173.57 ? 306 SER A O   1 
ATOM   1999 C CB  . SER A 1 281 ? -78.731  28.314  13.938  1.00 168.97 ? 306 SER A CB  1 
ATOM   2000 O OG  . SER A 1 281 ? -77.420  28.383  13.406  1.00 158.28 ? 306 SER A OG  1 
ATOM   2001 N N   . ASP A 1 282 ? -81.026  26.615  15.682  1.00 179.75 ? 307 ASP A N   1 
ATOM   2002 C CA  . ASP A 1 282 ? -82.325  26.607  16.351  1.00 166.55 ? 307 ASP A CA  1 
ATOM   2003 C C   . ASP A 1 282 ? -82.199  26.111  17.783  1.00 162.11 ? 307 ASP A C   1 
ATOM   2004 O O   . ASP A 1 282 ? -83.185  26.056  18.515  1.00 160.59 ? 307 ASP A O   1 
ATOM   2005 C CB  . ASP A 1 282 ? -83.310  25.705  15.606  1.00 153.94 ? 307 ASP A CB  1 
ATOM   2006 C CG  . ASP A 1 282 ? -83.449  26.070  14.145  1.00 171.39 ? 307 ASP A CG  1 
ATOM   2007 O OD1 . ASP A 1 282 ? -82.611  26.844  13.631  1.00 174.61 ? 307 ASP A OD1 1 
ATOM   2008 O OD2 . ASP A 1 282 ? -84.401  25.569  13.513  1.00 164.69 ? 307 ASP A OD2 1 
ATOM   2009 N N   . GLY A 1 283 ? -80.984  25.741  18.174  1.00 158.14 ? 308 GLY A N   1 
ATOM   2010 C CA  . GLY A 1 283 ? -80.740  25.193  19.496  1.00 163.20 ? 308 GLY A CA  1 
ATOM   2011 C C   . GLY A 1 283 ? -80.976  23.696  19.581  1.00 156.13 ? 308 GLY A C   1 
ATOM   2012 O O   . GLY A 1 283 ? -80.583  23.057  20.554  1.00 140.44 ? 308 GLY A O   1 
ATOM   2013 N N   . THR A 1 284 ? -81.621  23.137  18.562  1.00 163.15 ? 309 THR A N   1 
ATOM   2014 C CA  . THR A 1 284 ? -81.881  21.698  18.500  1.00 153.91 ? 309 THR A CA  1 
ATOM   2015 C C   . THR A 1 284 ? -80.649  20.912  18.032  1.00 142.75 ? 309 THR A C   1 
ATOM   2016 O O   . THR A 1 284 ? -79.839  21.420  17.261  1.00 148.66 ? 309 THR A O   1 
ATOM   2017 C CB  . THR A 1 284 ? -83.075  21.389  17.574  1.00 151.18 ? 309 THR A CB  1 
ATOM   2018 O OG1 . THR A 1 284 ? -82.814  21.910  16.265  1.00 151.50 ? 309 THR A OG1 1 
ATOM   2019 C CG2 . THR A 1 284 ? -84.352  22.019  18.123  1.00 139.39 ? 309 THR A CG2 1 
ATOM   2020 N N   . GLU A 1 285 ? -80.515  19.674  18.504  1.00 136.94 ? 310 GLU A N   1 
ATOM   2021 C CA  . GLU A 1 285 ? -79.362  18.831  18.179  1.00 112.84 ? 310 GLU A CA  1 
ATOM   2022 C C   . GLU A 1 285 ? -79.531  18.011  16.907  1.00 110.98 ? 310 GLU A C   1 
ATOM   2023 O O   . GLU A 1 285 ? -80.597  17.458  16.647  1.00 118.85 ? 310 GLU A O   1 
ATOM   2024 C CB  . GLU A 1 285 ? -79.046  17.878  19.336  1.00 110.91 ? 310 GLU A CB  1 
ATOM   2025 C CG  . GLU A 1 285 ? -77.678  18.076  19.980  1.00 125.19 ? 310 GLU A CG  1 
ATOM   2026 C CD  . GLU A 1 285 ? -77.127  16.788  20.584  1.00 141.90 ? 310 GLU A CD  1 
ATOM   2027 O OE1 . GLU A 1 285 ? -77.899  15.812  20.704  1.00 145.12 ? 310 GLU A OE1 1 
ATOM   2028 O OE2 . GLU A 1 285 ? -75.927  16.747  20.935  1.00 127.27 ? 310 GLU A OE2 1 
ATOM   2029 N N   . THR A 1 286 ? -78.455  17.916  16.134  1.00 108.94 ? 311 THR A N   1 
ATOM   2030 C CA  . THR A 1 286 ? -78.409  17.042  14.970  1.00 109.31 ? 311 THR A CA  1 
ATOM   2031 C C   . THR A 1 286 ? -77.069  16.333  14.960  1.00 103.62 ? 311 THR A C   1 
ATOM   2032 O O   . THR A 1 286 ? -76.070  16.868  15.449  1.00 103.83 ? 311 THR A O   1 
ATOM   2033 C CB  . THR A 1 286 ? -78.552  17.817  13.642  1.00 102.43 ? 311 THR A CB  1 
ATOM   2034 O OG1 . THR A 1 286 ? -77.403  18.653  13.447  1.00 112.31 ? 311 THR A OG1 1 
ATOM   2035 C CG2 . THR A 1 286 ? -79.804  18.670  13.642  1.00 98.61  ? 311 THR A CG2 1 
ATOM   2036 N N   . ARG A 1 287 ? -77.039  15.132  14.399  1.00 94.32  ? 312 ARG A N   1 
ATOM   2037 C CA  . ARG A 1 287 ? -75.793  14.383  14.340  1.00 100.68 ? 312 ARG A CA  1 
ATOM   2038 C C   . ARG A 1 287 ? -75.614  13.660  13.013  1.00 112.62 ? 312 ARG A C   1 
ATOM   2039 O O   . ARG A 1 287 ? -76.585  13.351  12.319  1.00 114.91 ? 312 ARG A O   1 
ATOM   2040 C CB  . ARG A 1 287 ? -75.765  13.344  15.439  1.00 100.60 ? 312 ARG A CB  1 
ATOM   2041 C CG  . ARG A 1 287 ? -76.517  12.104  15.065  1.00 84.54  ? 312 ARG A CG  1 
ATOM   2042 C CD  . ARG A 1 287 ? -76.257  11.002  16.049  1.00 97.99  ? 312 ARG A CD  1 
ATOM   2043 N NE  . ARG A 1 287 ? -76.720  9.729   15.528  1.00 93.21  ? 312 ARG A NE  1 
ATOM   2044 C CZ  . ARG A 1 287 ? -76.665  8.587   16.199  1.00 98.59  ? 312 ARG A CZ  1 
ATOM   2045 N NH1 . ARG A 1 287 ? -76.169  8.557   17.432  1.00 104.44 ? 312 ARG A NH1 1 
ATOM   2046 N NH2 . ARG A 1 287 ? -77.108  7.475   15.635  1.00 83.34  ? 312 ARG A NH2 1 
ATOM   2047 N N   . THR A 1 288 ? -74.360  13.396  12.665  1.00 101.54 ? 313 THR A N   1 
ATOM   2048 C CA  . THR A 1 288 ? -74.041  12.661  11.453  1.00 88.93  ? 313 THR A CA  1 
ATOM   2049 C C   . THR A 1 288 ? -73.544  11.274  11.813  1.00 89.77  ? 313 THR A C   1 
ATOM   2050 O O   . THR A 1 288 ? -72.472  11.127  12.382  1.00 91.32  ? 313 THR A O   1 
ATOM   2051 C CB  . THR A 1 288 ? -72.952  13.366  10.646  1.00 97.71  ? 313 THR A CB  1 
ATOM   2052 O OG1 . THR A 1 288 ? -73.477  14.570  10.074  1.00 93.43  ? 313 THR A OG1 1 
ATOM   2053 C CG2 . THR A 1 288 ? -72.452  12.458  9.540   1.00 90.95  ? 313 THR A CG2 1 
ATOM   2054 N N   . LEU A 1 289 ? -74.327  10.256  11.485  1.00 94.03  ? 314 LEU A N   1 
ATOM   2055 C CA  . LEU A 1 289 ? -73.965  8.889   11.826  1.00 85.11  ? 314 LEU A CA  1 
ATOM   2056 C C   . LEU A 1 289 ? -73.096  8.254   10.755  1.00 80.89  ? 314 LEU A C   1 
ATOM   2057 O O   . LEU A 1 289 ? -73.405  8.301   9.568   1.00 93.24  ? 314 LEU A O   1 
ATOM   2058 C CB  . LEU A 1 289 ? -75.213  8.045   12.093  1.00 68.34  ? 314 LEU A CB  1 
ATOM   2059 C CG  . LEU A 1 289 ? -74.997  6.588   12.489  1.00 77.17  ? 314 LEU A CG  1 
ATOM   2060 C CD1 . LEU A 1 289 ? -73.933  6.456   13.548  1.00 80.18  ? 314 LEU A CD1 1 
ATOM   2061 C CD2 . LEU A 1 289 ? -76.296  6.013   12.978  1.00 94.53  ? 314 LEU A CD2 1 
ATOM   2062 N N   . ILE A 1 290 ? -72.018  7.627   11.194  1.00 79.55  ? 315 ILE A N   1 
ATOM   2063 C CA  . ILE A 1 290 ? -71.028  7.092   10.281  1.00 80.28  ? 315 ILE A CA  1 
ATOM   2064 C C   . ILE A 1 290 ? -70.719  5.643   10.602  1.00 88.55  ? 315 ILE A C   1 
ATOM   2065 O O   . ILE A 1 290 ? -70.212  5.338   11.676  1.00 81.47  ? 315 ILE A O   1 
ATOM   2066 C CB  . ILE A 1 290 ? -69.726  7.882   10.403  1.00 80.57  ? 315 ILE A CB  1 
ATOM   2067 C CG1 . ILE A 1 290 ? -69.976  9.356   10.103  1.00 82.27  ? 315 ILE A CG1 1 
ATOM   2068 C CG2 . ILE A 1 290 ? -68.653  7.305   9.499   1.00 81.54  ? 315 ILE A CG2 1 
ATOM   2069 C CD1 . ILE A 1 290 ? -68.711  10.132  9.820   1.00 91.70  ? 315 ILE A CD1 1 
ATOM   2070 N N   . LYS A 1 291 ? -71.046  4.749   9.675   1.00 83.58  ? 316 LYS A N   1 
ATOM   2071 C CA  . LYS A 1 291 ? -70.692  3.346   9.821   1.00 69.17  ? 316 LYS A CA  1 
ATOM   2072 C C   . LYS A 1 291 ? -69.375  3.125   9.134   1.00 71.99  ? 316 LYS A C   1 
ATOM   2073 O O   . LYS A 1 291 ? -69.319  2.846   7.946   1.00 94.43  ? 316 LYS A O   1 
ATOM   2074 C CB  . LYS A 1 291 ? -71.762  2.434   9.232   1.00 90.78  ? 316 LYS A CB  1 
ATOM   2075 C CG  . LYS A 1 291 ? -71.559  0.966   9.543   1.00 84.15  ? 316 LYS A CG  1 
ATOM   2076 C CD  . LYS A 1 291 ? -72.694  0.125   8.971   1.00 94.48  ? 316 LYS A CD  1 
ATOM   2077 C CE  . LYS A 1 291 ? -72.496  -1.356  9.255   1.00 111.49 ? 316 LYS A CE  1 
ATOM   2078 N NZ  . LYS A 1 291 ? -73.742  -2.141  9.021   1.00 149.78 ? 316 LYS A NZ  1 
ATOM   2079 N N   . GLY A 1 292 ? -68.309  3.274   9.898   1.00 75.30  ? 317 GLY A N   1 
ATOM   2080 C CA  . GLY A 1 292 ? -66.968  3.183   9.367   1.00 79.29  ? 317 GLY A CA  1 
ATOM   2081 C C   . GLY A 1 292 ? -66.440  1.765   9.325   1.00 87.78  ? 317 GLY A C   1 
ATOM   2082 O O   . GLY A 1 292 ? -66.436  1.052   10.331  1.00 73.22  ? 317 GLY A O   1 
ATOM   2083 N N   . TYR A 1 293 ? -66.008  1.350   8.141   1.00 87.15  ? 318 TYR A N   1 
ATOM   2084 C CA  . TYR A 1 293 ? -65.290  0.104   7.986   1.00 74.90  ? 318 TYR A CA  1 
ATOM   2085 C C   . TYR A 1 293 ? -63.827  0.473   7.892   1.00 78.74  ? 318 TYR A C   1 
ATOM   2086 O O   . TYR A 1 293 ? -63.497  1.549   7.426   1.00 89.95  ? 318 TYR A O   1 
ATOM   2087 C CB  . TYR A 1 293 ? -65.735  -0.607  6.709   1.00 74.87  ? 318 TYR A CB  1 
ATOM   2088 C CG  . TYR A 1 293 ? -67.212  -0.896  6.645   1.00 83.03  ? 318 TYR A CG  1 
ATOM   2089 C CD1 . TYR A 1 293 ? -68.110  0.086   6.258   1.00 86.07  ? 318 TYR A CD1 1 
ATOM   2090 C CD2 . TYR A 1 293 ? -67.710  -2.151  6.967   1.00 82.77  ? 318 TYR A CD2 1 
ATOM   2091 C CE1 . TYR A 1 293 ? -69.468  -0.172  6.194   1.00 93.45  ? 318 TYR A CE1 1 
ATOM   2092 C CE2 . TYR A 1 293 ? -69.061  -2.420  6.910   1.00 83.85  ? 318 TYR A CE2 1 
ATOM   2093 C CZ  . TYR A 1 293 ? -69.937  -1.426  6.521   1.00 97.33  ? 318 TYR A CZ  1 
ATOM   2094 O OH  . TYR A 1 293 ? -71.284  -1.688  6.457   1.00 92.99  ? 318 TYR A OH  1 
ATOM   2095 N N   . GLY A 1 294 ? -62.948  -0.411  8.335   1.00 67.11  ? 319 GLY A N   1 
ATOM   2096 C CA  . GLY A 1 294 ? -61.524  -0.168  8.230   1.00 68.46  ? 319 GLY A CA  1 
ATOM   2097 C C   . GLY A 1 294 ? -60.696  -1.338  8.708   1.00 84.36  ? 319 GLY A C   1 
ATOM   2098 O O   . GLY A 1 294 ? -61.227  -2.362  9.124   1.00 98.74  ? 319 GLY A O   1 
ATOM   2099 N N   . ILE A 1 295 ? -59.382  -1.191  8.644   1.00 79.64  ? 320 ILE A N   1 
ATOM   2100 C CA  . ILE A 1 295 ? -58.500  -2.205  9.188   1.00 80.17  ? 320 ILE A CA  1 
ATOM   2101 C C   . ILE A 1 295 ? -57.921  -1.728  10.515  1.00 89.30  ? 320 ILE A C   1 
ATOM   2102 O O   . ILE A 1 295 ? -57.336  -0.641  10.598  1.00 89.50  ? 320 ILE A O   1 
ATOM   2103 C CB  . ILE A 1 295 ? -57.358  -2.484  8.222   1.00 88.27  ? 320 ILE A CB  1 
ATOM   2104 C CG1 . ILE A 1 295 ? -57.884  -2.501  6.784   1.00 85.41  ? 320 ILE A CG1 1 
ATOM   2105 C CG2 . ILE A 1 295 ? -56.653  -3.781  8.578   1.00 87.24  ? 320 ILE A CG2 1 
ATOM   2106 C CD1 . ILE A 1 295 ? -56.801  -2.669  5.745   1.00 80.35  ? 320 ILE A CD1 1 
ATOM   2107 N N   . ARG A 1 296 ? -58.093  -2.526  11.561  1.00 84.84  ? 321 ARG A N   1 
ATOM   2108 C CA  . ARG A 1 296 ? -57.485  -2.201  12.839  1.00 82.45  ? 321 ARG A CA  1 
ATOM   2109 C C   . ARG A 1 296 ? -56.145  -2.904  12.959  1.00 81.76  ? 321 ARG A C   1 
ATOM   2110 O O   . ARG A 1 296 ? -56.064  -4.121  12.790  1.00 79.72  ? 321 ARG A O   1 
ATOM   2111 C CB  . ARG A 1 296 ? -58.387  -2.642  13.986  1.00 85.63  ? 321 ARG A CB  1 
ATOM   2112 C CG  . ARG A 1 296 ? -58.076  -1.938  15.288  1.00 89.58  ? 321 ARG A CG  1 
ATOM   2113 C CD  . ARG A 1 296 ? -57.819  -2.917  16.415  1.00 79.41  ? 321 ARG A CD  1 
ATOM   2114 N NE  . ARG A 1 296 ? -59.041  -3.585  16.847  1.00 101.38 ? 321 ARG A NE  1 
ATOM   2115 C CZ  . ARG A 1 296 ? -59.071  -4.573  17.736  1.00 118.15 ? 321 ARG A CZ  1 
ATOM   2116 N NH1 . ARG A 1 296 ? -57.943  -5.012  18.281  1.00 101.19 ? 321 ARG A NH1 1 
ATOM   2117 N NH2 . ARG A 1 296 ? -60.223  -5.129  18.082  1.00 122.26 ? 321 ARG A NH2 1 
ATOM   2118 N N   . PHE A 1 297 ? -55.095  -2.149  13.258  1.00 78.62  ? 322 PHE A N   1 
ATOM   2119 C CA  . PHE A 1 297 ? -53.780  -2.750  13.441  1.00 81.63  ? 322 PHE A CA  1 
ATOM   2120 C C   . PHE A 1 297 ? -53.410  -2.993  14.911  1.00 86.42  ? 322 PHE A C   1 
ATOM   2121 O O   . PHE A 1 297 ? -53.252  -2.049  15.690  1.00 96.72  ? 322 PHE A O   1 
ATOM   2122 C CB  . PHE A 1 297 ? -52.715  -1.900  12.759  1.00 78.46  ? 322 PHE A CB  1 
ATOM   2123 C CG  . PHE A 1 297 ? -52.879  -1.818  11.272  1.00 89.69  ? 322 PHE A CG  1 
ATOM   2124 C CD1 . PHE A 1 297 ? -53.785  -0.943  10.713  1.00 92.60  ? 322 PHE A CD1 1 
ATOM   2125 C CD2 . PHE A 1 297 ? -52.140  -2.636  10.428  1.00 89.84  ? 322 PHE A CD2 1 
ATOM   2126 C CE1 . PHE A 1 297 ? -53.951  -0.877  9.331   1.00 92.73  ? 322 PHE A CE1 1 
ATOM   2127 C CE2 . PHE A 1 297 ? -52.302  -2.575  9.051   1.00 86.68  ? 322 PHE A CE2 1 
ATOM   2128 C CZ  . PHE A 1 297 ? -53.210  -1.692  8.504   1.00 77.32  ? 322 PHE A CZ  1 
ATOM   2129 N N   . ASP A 1 298 ? -53.273  -4.264  15.285  1.00 77.58  ? 323 ASP A N   1 
ATOM   2130 C CA  . ASP A 1 298 ? -52.887  -4.633  16.647  1.00 86.97  ? 323 ASP A CA  1 
ATOM   2131 C C   . ASP A 1 298 ? -51.399  -4.902  16.725  1.00 93.00  ? 323 ASP A C   1 
ATOM   2132 O O   . ASP A 1 298 ? -50.922  -5.910  16.198  1.00 93.08  ? 323 ASP A O   1 
ATOM   2133 C CB  . ASP A 1 298 ? -53.642  -5.882  17.118  1.00 96.86  ? 323 ASP A CB  1 
ATOM   2134 C CG  . ASP A 1 298 ? -55.063  -5.581  17.543  1.00 114.74 ? 323 ASP A CG  1 
ATOM   2135 O OD1 . ASP A 1 298 ? -55.552  -4.470  17.245  1.00 112.23 ? 323 ASP A OD1 1 
ATOM   2136 O OD2 . ASP A 1 298 ? -55.691  -6.458  18.173  1.00 110.59 ? 323 ASP A OD2 1 
ATOM   2137 N N   . VAL A 1 299 ? -50.668  -4.011  17.387  1.00 93.50  ? 324 VAL A N   1 
ATOM   2138 C CA  . VAL A 1 299 ? -49.246  -4.242  17.620  1.00 97.09  ? 324 VAL A CA  1 
ATOM   2139 C C   . VAL A 1 299 ? -49.025  -5.169  18.813  1.00 93.39  ? 324 VAL A C   1 
ATOM   2140 O O   . VAL A 1 299 ? -49.157  -4.769  19.972  1.00 95.94  ? 324 VAL A O   1 
ATOM   2141 C CB  . VAL A 1 299 ? -48.467  -2.940  17.829  1.00 99.35  ? 324 VAL A CB  1 
ATOM   2142 C CG1 . VAL A 1 299 ? -47.016  -3.249  18.166  1.00 91.01  ? 324 VAL A CG1 1 
ATOM   2143 C CG2 . VAL A 1 299 ? -48.557  -2.063  16.590  1.00 84.33  ? 324 VAL A CG2 1 
ATOM   2144 N N   . MET A 1 300 ? -48.695  -6.416  18.517  1.00 74.68  ? 325 MET A N   1 
ATOM   2145 C CA  . MET A 1 300 ? -48.546  -7.420  19.546  1.00 82.51  ? 325 MET A CA  1 
ATOM   2146 C C   . MET A 1 300 ? -47.080  -7.689  19.810  1.00 101.34 ? 325 MET A C   1 
ATOM   2147 O O   . MET A 1 300 ? -46.399  -8.296  18.992  1.00 111.68 ? 325 MET A O   1 
ATOM   2148 C CB  . MET A 1 300 ? -49.262  -8.694  19.116  1.00 85.62  ? 325 MET A CB  1 
ATOM   2149 C CG  . MET A 1 300 ? -50.742  -8.497  18.892  1.00 84.45  ? 325 MET A CG  1 
ATOM   2150 S SD  . MET A 1 300 ? -51.538  -9.949  18.220  1.00 115.22 ? 325 MET A SD  1 
ATOM   2151 C CE  . MET A 1 300 ? -50.892  -9.921  16.556  1.00 109.22 ? 325 MET A CE  1 
ATOM   2152 N N   . VAL A 1 301 ? -46.594  -7.239  20.960  1.00 102.55 ? 326 VAL A N   1 
ATOM   2153 C CA  . VAL A 1 301 ? -45.187  -7.430  21.293  1.00 91.59  ? 326 VAL A CA  1 
ATOM   2154 C C   . VAL A 1 301 ? -44.978  -8.479  22.370  1.00 92.25  ? 326 VAL A C   1 
ATOM   2155 O O   . VAL A 1 301 ? -45.656  -8.482  23.401  1.00 99.99  ? 326 VAL A O   1 
ATOM   2156 C CB  . VAL A 1 301 ? -44.524  -6.126  21.744  1.00 90.90  ? 326 VAL A CB  1 
ATOM   2157 C CG1 . VAL A 1 301 ? -43.089  -6.375  22.103  1.00 94.00  ? 326 VAL A CG1 1 
ATOM   2158 C CG2 . VAL A 1 301 ? -44.628  -5.084  20.648  1.00 94.66  ? 326 VAL A CG2 1 
ATOM   2159 N N   . PHE A 1 302 ? -44.020  -9.362  22.131  1.00 99.96  ? 327 PHE A N   1 
ATOM   2160 C CA  . PHE A 1 302 ? -43.701  -10.404 23.094  1.00 124.40 ? 327 PHE A CA  1 
ATOM   2161 C C   . PHE A 1 302 ? -42.280  -10.919 22.885  1.00 125.52 ? 327 PHE A C   1 
ATOM   2162 O O   . PHE A 1 302 ? -41.650  -10.632 21.860  1.00 121.20 ? 327 PHE A O   1 
ATOM   2163 C CB  . PHE A 1 302 ? -44.695  -11.555 22.975  1.00 110.26 ? 327 PHE A CB  1 
ATOM   2164 C CG  . PHE A 1 302 ? -44.515  -12.380 21.739  1.00 110.28 ? 327 PHE A CG  1 
ATOM   2165 C CD1 . PHE A 1 302 ? -45.103  -12.000 20.542  1.00 121.56 ? 327 PHE A CD1 1 
ATOM   2166 C CD2 . PHE A 1 302 ? -43.759  -13.540 21.773  1.00 121.74 ? 327 PHE A CD2 1 
ATOM   2167 C CE1 . PHE A 1 302 ? -44.945  -12.764 19.397  1.00 127.14 ? 327 PHE A CE1 1 
ATOM   2168 C CE2 . PHE A 1 302 ? -43.593  -14.309 20.632  1.00 134.38 ? 327 PHE A CE2 1 
ATOM   2169 C CZ  . PHE A 1 302 ? -44.188  -13.923 19.442  1.00 138.14 ? 327 PHE A CZ  1 
ATOM   2170 N N   . GLY A 1 303 ? -41.777  -11.679 23.854  1.00 108.98 ? 328 GLY A N   1 
ATOM   2171 C CA  . GLY A 1 303 ? -40.446  -12.236 23.735  1.00 118.91 ? 328 GLY A CA  1 
ATOM   2172 C C   . GLY A 1 303 ? -39.875  -12.807 25.013  1.00 129.54 ? 328 GLY A C   1 
ATOM   2173 O O   . GLY A 1 303 ? -40.495  -12.740 26.077  1.00 129.36 ? 328 GLY A O   1 
ATOM   2174 N N   . GLN A 1 304 ? -38.676  -13.366 24.896  1.00 118.52 ? 329 GLN A N   1 
ATOM   2175 C CA  . GLN A 1 304 ? -37.999  -13.999 26.014  1.00 124.15 ? 329 GLN A CA  1 
ATOM   2176 C C   . GLN A 1 304 ? -36.497  -13.861 25.816  1.00 136.88 ? 329 GLN A C   1 
ATOM   2177 O O   . GLN A 1 304 ? -36.032  -13.682 24.688  1.00 135.30 ? 329 GLN A O   1 
ATOM   2178 C CB  . GLN A 1 304 ? -38.397  -15.472 26.115  1.00 97.34  ? 329 GLN A CB  1 
ATOM   2179 N N   . ALA A 1 305 ? -35.744  -13.947 26.911  1.00 137.35 ? 330 ALA A N   1 
ATOM   2180 C CA  . ALA A 1 305 ? -34.290  -13.839 26.866  1.00 119.00 ? 330 ALA A CA  1 
ATOM   2181 C C   . ALA A 1 305 ? -33.660  -14.528 28.074  1.00 139.58 ? 330 ALA A C   1 
ATOM   2182 O O   . ALA A 1 305 ? -34.356  -14.877 29.029  1.00 133.79 ? 330 ALA A O   1 
ATOM   2183 C CB  . ALA A 1 305 ? -33.871  -12.381 26.802  1.00 105.60 ? 330 ALA A CB  1 
ATOM   2184 N N   . GLY A 1 306 ? -32.346  -14.733 28.025  1.00 149.08 ? 331 GLY A N   1 
ATOM   2185 C CA  . GLY A 1 306 ? -31.635  -15.350 29.133  1.00 161.41 ? 331 GLY A CA  1 
ATOM   2186 C C   . GLY A 1 306 ? -30.120  -15.439 29.000  1.00 165.11 ? 331 GLY A C   1 
ATOM   2187 O O   . GLY A 1 306 ? -29.602  -15.858 27.960  1.00 153.58 ? 331 GLY A O   1 
ATOM   2188 N N   . LYS A 1 307 ? -29.415  -15.039 30.061  1.00 169.40 ? 332 LYS A N   1 
ATOM   2189 C CA  . LYS A 1 307 ? -27.963  -15.195 30.158  1.00 168.35 ? 332 LYS A CA  1 
ATOM   2190 C C   . LYS A 1 307 ? -27.630  -16.502 30.876  1.00 172.70 ? 332 LYS A C   1 
ATOM   2191 O O   . LYS A 1 307 ? -28.528  -17.246 31.261  1.00 163.47 ? 332 LYS A O   1 
ATOM   2192 C CB  . LYS A 1 307 ? -27.342  -14.007 30.891  1.00 129.80 ? 332 LYS A CB  1 
ATOM   2193 N N   . PHE A 1 308 ? -26.342  -16.777 31.058  1.00 176.28 ? 333 PHE A N   1 
ATOM   2194 C CA  . PHE A 1 308 ? -25.912  -17.972 31.781  1.00 179.34 ? 333 PHE A CA  1 
ATOM   2195 C C   . PHE A 1 308 ? -26.261  -17.899 33.268  1.00 173.73 ? 333 PHE A C   1 
ATOM   2196 O O   . PHE A 1 308 ? -26.367  -16.813 33.837  1.00 165.70 ? 333 PHE A O   1 
ATOM   2197 C CB  . PHE A 1 308 ? -24.404  -18.187 31.615  1.00 189.37 ? 333 PHE A CB  1 
ATOM   2198 C CG  . PHE A 1 308 ? -23.816  -19.141 32.615  1.00 188.30 ? 333 PHE A CG  1 
ATOM   2199 C CD1 . PHE A 1 308 ? -23.219  -18.669 33.776  1.00 180.52 ? 333 PHE A CD1 1 
ATOM   2200 C CD2 . PHE A 1 308 ? -23.873  -20.509 32.401  1.00 171.01 ? 333 PHE A CD2 1 
ATOM   2201 C CE1 . PHE A 1 308 ? -22.684  -19.541 34.702  1.00 177.21 ? 333 PHE A CE1 1 
ATOM   2202 C CE2 . PHE A 1 308 ? -23.340  -21.388 33.320  1.00 182.54 ? 333 PHE A CE2 1 
ATOM   2203 C CZ  . PHE A 1 308 ? -22.744  -20.903 34.473  1.00 191.13 ? 333 PHE A CZ  1 
ATOM   2204 N N   . ASN A 1 309 ? -26.426  -19.060 33.895  1.00 171.74 ? 334 ASN A N   1 
ATOM   2205 C CA  . ASN A 1 309 ? -26.675  -19.123 35.332  1.00 176.98 ? 334 ASN A CA  1 
ATOM   2206 C C   . ASN A 1 309 ? -26.298  -20.492 35.894  1.00 177.50 ? 334 ASN A C   1 
ATOM   2207 O O   . ASN A 1 309 ? -26.601  -21.526 35.292  1.00 162.71 ? 334 ASN A O   1 
ATOM   2208 C CB  . ASN A 1 309 ? -28.142  -18.801 35.639  1.00 177.17 ? 334 ASN A CB  1 
ATOM   2209 C CG  . ASN A 1 309 ? -28.377  -18.436 37.103  1.00 172.64 ? 334 ASN A CG  1 
ATOM   2210 O OD1 . ASN A 1 309 ? -27.435  -18.276 37.881  1.00 158.33 ? 334 ASN A OD1 1 
ATOM   2211 N ND2 . ASN A 1 309 ? -29.645  -18.295 37.477  1.00 166.49 ? 334 ASN A ND2 1 
ATOM   2212 N N   . ILE A 1 310 ? -25.626  -20.494 37.043  1.00 173.83 ? 335 ILE A N   1 
ATOM   2213 C CA  . ILE A 1 310 ? -25.168  -21.737 37.655  1.00 162.93 ? 335 ILE A CA  1 
ATOM   2214 C C   . ILE A 1 310 ? -26.323  -22.547 38.226  1.00 159.40 ? 335 ILE A C   1 
ATOM   2215 O O   . ILE A 1 310 ? -26.285  -23.775 38.219  1.00 161.72 ? 335 ILE A O   1 
ATOM   2216 C CB  . ILE A 1 310 ? -24.122  -21.458 38.733  1.00 116.58 ? 335 ILE A CB  1 
ATOM   2217 N N   . ILE A 1 311 ? -27.350  -21.861 38.716  1.00 155.14 ? 336 ILE A N   1 
ATOM   2218 C CA  . ILE A 1 311 ? -28.478  -22.545 39.345  1.00 149.64 ? 336 ILE A CA  1 
ATOM   2219 C C   . ILE A 1 311 ? -29.132  -23.577 38.416  1.00 163.99 ? 336 ILE A C   1 
ATOM   2220 O O   . ILE A 1 311 ? -29.290  -24.740 38.793  1.00 171.66 ? 336 ILE A O   1 
ATOM   2221 C CB  . ILE A 1 311 ? -29.507  -21.534 39.879  1.00 95.99  ? 336 ILE A CB  1 
ATOM   2222 N N   . PRO A 1 312 ? -29.501  -23.157 37.192  1.00 165.04 ? 337 PRO A N   1 
ATOM   2223 C CA  . PRO A 1 312 ? -30.160  -24.033 36.212  1.00 162.17 ? 337 PRO A CA  1 
ATOM   2224 C C   . PRO A 1 312 ? -29.205  -25.041 35.583  1.00 170.04 ? 337 PRO A C   1 
ATOM   2225 O O   . PRO A 1 312 ? -29.612  -26.158 35.266  1.00 159.86 ? 337 PRO A O   1 
ATOM   2226 C CB  . PRO A 1 312 ? -30.621  -23.044 35.139  1.00 158.80 ? 337 PRO A CB  1 
ATOM   2227 C CG  . PRO A 1 312 ? -29.624  -21.933 35.242  1.00 163.87 ? 337 PRO A CG  1 
ATOM   2228 C CD  . PRO A 1 312 ? -29.472  -21.764 36.716  1.00 158.99 ? 337 PRO A CD  1 
ATOM   2229 N N   . THR A 1 313 ? -27.953  -24.638 35.392  1.00 174.54 ? 338 THR A N   1 
ATOM   2230 C CA  . THR A 1 313 ? -26.953  -25.509 34.790  1.00 164.70 ? 338 THR A CA  1 
ATOM   2231 C C   . THR A 1 313 ? -26.656  -26.715 35.682  1.00 169.37 ? 338 THR A C   1 
ATOM   2232 O O   . THR A 1 313 ? -26.719  -27.857 35.232  1.00 171.90 ? 338 THR A O   1 
ATOM   2233 C CB  . THR A 1 313 ? -25.648  -24.744 34.495  1.00 158.74 ? 338 THR A CB  1 
ATOM   2234 O OG1 . THR A 1 313 ? -25.944  -23.553 33.753  1.00 149.95 ? 338 THR A OG1 1 
ATOM   2235 C CG2 . THR A 1 313 ? -24.684  -25.615 33.696  1.00 165.08 ? 338 THR A CG2 1 
ATOM   2236 N N   . LEU A 1 314 ? -26.342  -26.457 36.948  1.00 163.44 ? 339 LEU A N   1 
ATOM   2237 C CA  . LEU A 1 314 ? -26.060  -27.530 37.898  1.00 160.98 ? 339 LEU A CA  1 
ATOM   2238 C C   . LEU A 1 314 ? -27.273  -28.434 38.069  1.00 169.15 ? 339 LEU A C   1 
ATOM   2239 O O   . LEU A 1 314 ? -27.145  -29.652 38.204  1.00 173.00 ? 339 LEU A O   1 
ATOM   2240 C CB  . LEU A 1 314 ? -25.648  -26.955 39.255  1.00 156.97 ? 339 LEU A CB  1 
ATOM   2241 C CG  . LEU A 1 314 ? -24.396  -26.080 39.253  1.00 157.08 ? 339 LEU A CG  1 
ATOM   2242 C CD1 . LEU A 1 314 ? -23.989  -25.718 40.671  1.00 143.01 ? 339 LEU A CD1 1 
ATOM   2243 C CD2 . LEU A 1 314 ? -23.260  -26.786 38.533  1.00 119.85 ? 339 LEU A CD2 1 
ATOM   2244 N N   . LEU A 1 315 ? -28.453  -27.824 38.063  1.00 174.96 ? 340 LEU A N   1 
ATOM   2245 C CA  . LEU A 1 315 ? -29.700  -28.560 38.227  1.00 182.53 ? 340 LEU A CA  1 
ATOM   2246 C C   . LEU A 1 315 ? -29.836  -29.600 37.121  1.00 179.56 ? 340 LEU A C   1 
ATOM   2247 O O   . LEU A 1 315 ? -30.053  -30.791 37.378  1.00 179.24 ? 340 LEU A O   1 
ATOM   2248 C CB  . LEU A 1 315 ? -30.886  -27.591 38.188  1.00 167.08 ? 340 LEU A CB  1 
ATOM   2249 C CG  . LEU A 1 315 ? -32.250  -28.052 38.715  1.00 156.93 ? 340 LEU A CG  1 
ATOM   2250 C CD1 . LEU A 1 315 ? -32.872  -29.115 37.818  1.00 130.18 ? 340 LEU A CD1 1 
ATOM   2251 C CD2 . LEU A 1 315 ? -32.151  -28.542 40.157  1.00 157.74 ? 340 LEU A CD2 1 
ATOM   2252 N N   . ASN A 1 316 ? -29.693  -29.139 35.885  1.00 172.91 ? 341 ASN A N   1 
ATOM   2253 C CA  . ASN A 1 316 ? -29.842  -30.007 34.730  1.00 179.81 ? 341 ASN A CA  1 
ATOM   2254 C C   . ASN A 1 316 ? -28.733  -31.058 34.652  1.00 188.89 ? 341 ASN A C   1 
ATOM   2255 O O   . ASN A 1 316 ? -28.988  -32.214 34.308  1.00 185.70 ? 341 ASN A O   1 
ATOM   2256 C CB  . ASN A 1 316 ? -29.896  -29.174 33.449  1.00 173.71 ? 341 ASN A CB  1 
ATOM   2257 C CG  . ASN A 1 316 ? -30.443  -29.953 32.270  1.00 186.54 ? 341 ASN A CG  1 
ATOM   2258 O OD1 . ASN A 1 316 ? -30.918  -31.080 32.423  1.00 191.20 ? 341 ASN A OD1 1 
ATOM   2259 N ND2 . ASN A 1 316 ? -30.382  -29.356 31.084  1.00 181.87 ? 341 ASN A ND2 1 
ATOM   2260 N N   . ILE A 1 317 ? -27.506  -30.654 34.975  1.00 187.13 ? 342 ILE A N   1 
ATOM   2261 C CA  . ILE A 1 317 ? -26.376  -31.578 35.001  1.00 179.72 ? 342 ILE A CA  1 
ATOM   2262 C C   . ILE A 1 317 ? -26.590  -32.653 36.068  1.00 178.74 ? 342 ILE A C   1 
ATOM   2263 O O   . ILE A 1 317 ? -26.263  -33.821 35.858  1.00 177.37 ? 342 ILE A O   1 
ATOM   2264 C CB  . ILE A 1 317 ? -25.041  -30.839 35.252  1.00 167.67 ? 342 ILE A CB  1 
ATOM   2265 C CG1 . ILE A 1 317 ? -24.737  -29.866 34.108  1.00 161.73 ? 342 ILE A CG1 1 
ATOM   2266 C CG2 . ILE A 1 317 ? -23.903  -31.831 35.414  1.00 162.87 ? 342 ILE A CG2 1 
ATOM   2267 C CD1 . ILE A 1 317 ? -23.435  -29.104 34.275  1.00 158.53 ? 342 ILE A CD1 1 
ATOM   2268 N N   . GLY A 1 318 ? -27.152  -32.252 37.206  1.00 171.29 ? 343 GLY A N   1 
ATOM   2269 C CA  . GLY A 1 318 ? -27.432  -33.177 38.288  1.00 164.36 ? 343 GLY A CA  1 
ATOM   2270 C C   . GLY A 1 318 ? -28.342  -34.309 37.854  1.00 172.41 ? 343 GLY A C   1 
ATOM   2271 O O   . GLY A 1 318 ? -28.086  -35.473 38.156  1.00 185.47 ? 343 GLY A O   1 
ATOM   2272 N N   . ALA A 1 319 ? -29.406  -33.967 37.137  1.00 162.74 ? 344 ALA A N   1 
ATOM   2273 C CA  . ALA A 1 319 ? -30.349  -34.962 36.640  1.00 166.98 ? 344 ALA A CA  1 
ATOM   2274 C C   . ALA A 1 319 ? -29.735  -35.812 35.531  1.00 188.93 ? 344 ALA A C   1 
ATOM   2275 O O   . ALA A 1 319 ? -30.152  -36.949 35.309  1.00 184.41 ? 344 ALA A O   1 
ATOM   2276 C CB  . ALA A 1 319 ? -31.617  -34.292 36.152  1.00 163.30 ? 344 ALA A CB  1 
ATOM   2277 N N   . GLY A 1 320 ? -28.744  -35.255 34.838  1.00 193.62 ? 345 GLY A N   1 
ATOM   2278 C CA  . GLY A 1 320 ? -28.050  -35.970 33.781  1.00 184.43 ? 345 GLY A CA  1 
ATOM   2279 C C   . GLY A 1 320 ? -27.236  -37.124 34.332  1.00 186.47 ? 345 GLY A C   1 
ATOM   2280 O O   . GLY A 1 320 ? -27.053  -38.145 33.668  1.00 185.44 ? 345 GLY A O   1 
ATOM   2281 N N   . LEU A 1 321 ? -26.743  -36.952 35.554  1.00 175.68 ? 346 LEU A N   1 
ATOM   2282 C CA  . LEU A 1 321 ? -26.019  -38.009 36.247  1.00 177.33 ? 346 LEU A CA  1 
ATOM   2283 C C   . LEU A 1 321 ? -26.965  -39.116 36.703  1.00 172.33 ? 346 LEU A C   1 
ATOM   2284 O O   . LEU A 1 321 ? -26.706  -40.296 36.477  1.00 187.31 ? 346 LEU A O   1 
ATOM   2285 C CB  . LEU A 1 321 ? -25.250  -37.442 37.441  1.00 175.64 ? 346 LEU A CB  1 
ATOM   2286 C CG  . LEU A 1 321 ? -23.861  -36.873 37.149  1.00 179.20 ? 346 LEU A CG  1 
ATOM   2287 C CD1 . LEU A 1 321 ? -23.890  -35.891 35.978  1.00 127.86 ? 346 LEU A CD1 1 
ATOM   2288 C CD2 . LEU A 1 321 ? -23.281  -36.227 38.405  1.00 176.21 ? 346 LEU A CD2 1 
ATOM   2289 N N   . ALA A 1 322 ? -28.063  -38.737 37.344  1.00 165.76 ? 347 ALA A N   1 
ATOM   2290 C CA  . ALA A 1 322 ? -29.040  -39.724 37.776  1.00 177.39 ? 347 ALA A CA  1 
ATOM   2291 C C   . ALA A 1 322 ? -29.601  -40.444 36.558  1.00 178.23 ? 347 ALA A C   1 
ATOM   2292 O O   . ALA A 1 322 ? -29.926  -41.630 36.615  1.00 168.62 ? 347 ALA A O   1 
ATOM   2293 C CB  . ALA A 1 322 ? -30.149  -39.064 38.576  1.00 179.39 ? 347 ALA A CB  1 
ATOM   2294 N N   . LEU A 1 323 ? -29.693  -39.718 35.449  1.00 186.10 ? 348 LEU A N   1 
ATOM   2295 C CA  . LEU A 1 323 ? -30.199  -40.276 34.201  1.00 189.04 ? 348 LEU A CA  1 
ATOM   2296 C C   . LEU A 1 323 ? -29.251  -41.307 33.581  1.00 200.18 ? 348 LEU A C   1 
ATOM   2297 O O   . LEU A 1 323 ? -29.698  -42.204 32.865  1.00 202.97 ? 348 LEU A O   1 
ATOM   2298 C CB  . LEU A 1 323 ? -30.519  -39.164 33.202  1.00 149.18 ? 348 LEU A CB  1 
ATOM   2299 N N   . LEU A 1 324 ? -27.950  -41.184 33.844  1.00 202.82 ? 349 LEU A N   1 
ATOM   2300 C CA  . LEU A 1 324 ? -26.991  -42.180 33.350  1.00 206.04 ? 349 LEU A CA  1 
ATOM   2301 C C   . LEU A 1 324 ? -27.006  -43.440 34.210  1.00 199.59 ? 349 LEU A C   1 
ATOM   2302 O O   . LEU A 1 324 ? -26.508  -44.490 33.798  1.00 198.59 ? 349 LEU A O   1 
ATOM   2303 C CB  . LEU A 1 324 ? -25.559  -41.623 33.207  1.00 206.84 ? 349 LEU A CB  1 
ATOM   2304 C CG  . LEU A 1 324 ? -24.603  -41.368 34.391  1.00 196.55 ? 349 LEU A CG  1 
ATOM   2305 C CD1 . LEU A 1 324 ? -24.557  -42.406 35.523  1.00 166.52 ? 349 LEU A CD1 1 
ATOM   2306 C CD2 . LEU A 1 324 ? -23.204  -40.902 33.968  1.00 172.33 ? 349 LEU A CD2 1 
ATOM   2307 N N   . GLY A 1 325 ? -27.566  -43.323 35.409  1.00 181.77 ? 350 GLY A N   1 
ATOM   2308 C CA  . GLY A 1 325 ? -27.734  -44.466 36.285  1.00 178.15 ? 350 GLY A CA  1 
ATOM   2309 C C   . GLY A 1 325 ? -28.828  -45.379 35.771  1.00 189.06 ? 350 GLY A C   1 
ATOM   2310 O O   . GLY A 1 325 ? -28.679  -46.601 35.756  1.00 194.53 ? 350 GLY A O   1 
ATOM   2311 N N   . LEU A 1 326 ? -29.936  -44.783 35.344  1.00 187.49 ? 351 LEU A N   1 
ATOM   2312 C CA  . LEU A 1 326 ? -31.030  -45.552 34.765  1.00 183.68 ? 351 LEU A CA  1 
ATOM   2313 C C   . LEU A 1 326 ? -30.708  -46.019 33.341  1.00 199.97 ? 351 LEU A C   1 
ATOM   2314 O O   . LEU A 1 326 ? -31.194  -47.061 32.903  1.00 197.80 ? 351 LEU A O   1 
ATOM   2315 C CB  . LEU A 1 326 ? -32.327  -44.749 34.794  1.00 153.61 ? 351 LEU A CB  1 
ATOM   2316 N N   . VAL A 1 327 ? -29.886  -45.252 32.627  1.00 208.64 ? 352 VAL A N   1 
ATOM   2317 C CA  . VAL A 1 327 ? -29.495  -45.591 31.255  1.00 202.24 ? 352 VAL A CA  1 
ATOM   2318 C C   . VAL A 1 327 ? -28.610  -46.830 31.188  1.00 214.59 ? 352 VAL A C   1 
ATOM   2319 O O   . VAL A 1 327 ? -28.748  -47.656 30.286  1.00 210.87 ? 352 VAL A O   1 
ATOM   2320 C CB  . VAL A 1 327 ? -28.784  -44.414 30.593  1.00 183.45 ? 352 VAL A CB  1 
ATOM   2321 N N   . ASN A 1 328 ? -27.678  -46.930 32.130  1.00 213.28 ? 353 ASN A N   1 
ATOM   2322 C CA  . ASN A 1 328 ? -26.712  -48.021 32.151  1.00 204.42 ? 353 ASN A CA  1 
ATOM   2323 C C   . ASN A 1 328 ? -27.251  -49.252 32.882  1.00 214.71 ? 353 ASN A C   1 
ATOM   2324 O O   . ASN A 1 328 ? -26.816  -50.376 32.622  1.00 214.74 ? 353 ASN A O   1 
ATOM   2325 C CB  . ASN A 1 328 ? -25.405  -47.552 32.776  1.00 178.00 ? 353 ASN A CB  1 
ATOM   2326 N N   . VAL A 1 329 ? -28.192  -49.035 33.797  1.00 213.01 ? 354 VAL A N   1 
ATOM   2327 C CA  . VAL A 1 329 ? -28.786  -50.132 34.556  1.00 209.87 ? 354 VAL A CA  1 
ATOM   2328 C C   . VAL A 1 329 ? -29.965  -50.784 33.827  1.00 217.50 ? 354 VAL A C   1 
ATOM   2329 O O   . VAL A 1 329 ? -30.185  -51.992 33.945  1.00 210.12 ? 354 VAL A O   1 
ATOM   2330 C CB  . VAL A 1 329 ? -29.206  -49.655 35.943  1.00 177.69 ? 354 VAL A CB  1 
ATOM   2331 N N   . ILE A 1 330 ? -30.719  -49.982 33.077  1.00 223.33 ? 355 ILE A N   1 
ATOM   2332 C CA  . ILE A 1 330 ? -31.897  -50.475 32.360  1.00 214.89 ? 355 ILE A CA  1 
ATOM   2333 C C   . ILE A 1 330 ? -31.558  -51.094 31.002  1.00 218.50 ? 355 ILE A C   1 
ATOM   2334 O O   . ILE A 1 330 ? -32.213  -52.044 30.571  1.00 207.77 ? 355 ILE A O   1 
ATOM   2335 C CB  . ILE A 1 330 ? -32.933  -49.365 32.198  1.00 204.57 ? 355 ILE A CB  1 
ATOM   2336 N N   . CYS A 1 331 ? -30.544  -50.550 30.328  1.00 228.77 ? 356 CYS A N   1 
ATOM   2337 C CA  . CYS A 1 331 ? -30.111  -51.079 29.030  1.00 237.86 ? 356 CYS A CA  1 
ATOM   2338 C C   . CYS A 1 331 ? -29.243  -52.339 29.182  1.00 245.33 ? 356 CYS A C   1 
ATOM   2339 O O   . CYS A 1 331 ? -29.143  -53.152 28.255  1.00 228.20 ? 356 CYS A O   1 
ATOM   2340 C CB  . CYS A 1 331 ? -29.405  -50.003 28.183  1.00 227.16 ? 356 CYS A CB  1 
ATOM   2341 S SG  . CYS A 1 331 ? -27.662  -49.664 28.574  1.00 237.37 ? 356 CYS A SG  1 
ATOM   2342 N N   . ASP A 1 332 ? -28.626  -52.495 30.353  1.00 248.25 ? 357 ASP A N   1 
ATOM   2343 C CA  . ASP A 1 332 ? -27.902  -53.716 30.696  1.00 216.33 ? 357 ASP A CA  1 
ATOM   2344 C C   . ASP A 1 332 ? -28.897  -54.835 31.005  1.00 216.21 ? 357 ASP A C   1 
ATOM   2345 O O   . ASP A 1 332 ? -28.614  -56.013 30.781  1.00 193.46 ? 357 ASP A O   1 
ATOM   2346 C CB  . ASP A 1 332 ? -26.976  -53.473 31.882  1.00 165.04 ? 357 ASP A CB  1 
ATOM   2347 N N   . TRP A 1 333 ? -30.063  -54.447 31.520  1.00 226.55 ? 358 TRP A N   1 
ATOM   2348 C CA  . TRP A 1 333 ? -31.162  -55.373 31.778  1.00 204.80 ? 358 TRP A CA  1 
ATOM   2349 C C   . TRP A 1 333 ? -31.901  -55.777 30.496  1.00 211.92 ? 358 TRP A C   1 
ATOM   2350 O O   . TRP A 1 333 ? -32.574  -56.808 30.464  1.00 202.81 ? 358 TRP A O   1 
ATOM   2351 C CB  . TRP A 1 333 ? -32.138  -54.771 32.793  1.00 151.07 ? 358 TRP A CB  1 
ATOM   2352 N N   . ILE A 1 334 ? -31.784  -54.960 29.449  1.00 215.89 ? 359 ILE A N   1 
ATOM   2353 C CA  . ILE A 1 334 ? -32.421  -55.253 28.163  1.00 192.29 ? 359 ILE A CA  1 
ATOM   2354 C C   . ILE A 1 334 ? -31.605  -56.245 27.340  1.00 179.94 ? 359 ILE A C   1 
ATOM   2355 O O   . ILE A 1 334 ? -31.352  -56.023 26.155  1.00 123.09 ? 359 ILE A O   1 
ATOM   2356 C CB  . ILE A 1 334 ? -32.650  -53.973 27.369  1.00 168.73 ? 359 ILE A CB  1 
ATOM   2357 N N   . LEU B 1 9   ? -38.240  -53.008 53.264  1.00 181.67 ? 34  LEU B N   1 
ATOM   2358 C CA  . LEU B 1 9   ? -39.174  -51.931 52.952  1.00 208.48 ? 34  LEU B CA  1 
ATOM   2359 C C   . LEU B 1 9   ? -38.578  -50.941 51.951  1.00 225.78 ? 34  LEU B C   1 
ATOM   2360 O O   . LEU B 1 9   ? -39.215  -49.944 51.600  1.00 232.17 ? 34  LEU B O   1 
ATOM   2361 C CB  . LEU B 1 9   ? -39.613  -51.212 54.225  1.00 179.31 ? 34  LEU B CB  1 
ATOM   2362 N N   . ASN B 1 10  ? -37.356  -51.220 51.501  1.00 209.53 ? 35  ASN B N   1 
ATOM   2363 C CA  . ASN B 1 10  ? -36.699  -50.401 50.484  1.00 211.69 ? 35  ASN B CA  1 
ATOM   2364 C C   . ASN B 1 10  ? -37.315  -50.618 49.097  1.00 228.49 ? 35  ASN B C   1 
ATOM   2365 O O   . ASN B 1 10  ? -37.432  -49.679 48.306  1.00 220.47 ? 35  ASN B O   1 
ATOM   2366 C CB  . ASN B 1 10  ? -35.202  -50.679 50.461  1.00 177.38 ? 35  ASN B CB  1 
ATOM   2367 N N   . ARG B 1 11  ? -37.701  -51.859 48.806  1.00 223.01 ? 36  ARG B N   1 
ATOM   2368 C CA  . ARG B 1 11  ? -38.446  -52.165 47.587  1.00 215.94 ? 36  ARG B CA  1 
ATOM   2369 C C   . ARG B 1 11  ? -39.830  -51.518 47.643  1.00 222.12 ? 36  ARG B C   1 
ATOM   2370 O O   . ARG B 1 11  ? -40.497  -51.358 46.621  1.00 216.29 ? 36  ARG B O   1 
ATOM   2371 C CB  . ARG B 1 11  ? -38.566  -53.672 47.395  1.00 194.89 ? 36  ARG B CB  1 
ATOM   2372 N N   . PHE B 1 12  ? -40.250  -51.149 48.849  1.00 231.25 ? 37  PHE B N   1 
ATOM   2373 C CA  . PHE B 1 12  ? -41.543  -50.505 49.065  1.00 223.18 ? 37  PHE B CA  1 
ATOM   2374 C C   . PHE B 1 12  ? -41.504  -49.003 48.782  1.00 220.61 ? 37  PHE B C   1 
ATOM   2375 O O   . PHE B 1 12  ? -42.407  -48.461 48.143  1.00 216.46 ? 37  PHE B O   1 
ATOM   2376 C CB  . PHE B 1 12  ? -42.031  -50.763 50.492  1.00 208.09 ? 37  PHE B CB  1 
ATOM   2377 C CG  . PHE B 1 12  ? -43.235  -49.956 50.876  1.00 212.03 ? 37  PHE B CG  1 
ATOM   2378 C CD1 . PHE B 1 12  ? -44.509  -50.388 50.543  1.00 201.14 ? 37  PHE B CD1 1 
ATOM   2379 C CD2 . PHE B 1 12  ? -43.092  -48.769 51.575  1.00 208.96 ? 37  PHE B CD2 1 
ATOM   2380 C CE1 . PHE B 1 12  ? -45.622  -49.650 50.896  1.00 203.85 ? 37  PHE B CE1 1 
ATOM   2381 C CE2 . PHE B 1 12  ? -44.199  -48.025 51.932  1.00 214.30 ? 37  PHE B CE2 1 
ATOM   2382 C CZ  . PHE B 1 12  ? -45.467  -48.466 51.591  1.00 216.95 ? 37  PHE B CZ  1 
ATOM   2383 N N   . THR B 1 13  ? -40.463  -48.330 49.264  1.00 221.74 ? 38  THR B N   1 
ATOM   2384 C CA  . THR B 1 13  ? -40.305  -46.905 49.005  1.00 210.90 ? 38  THR B CA  1 
ATOM   2385 C C   . THR B 1 13  ? -40.036  -46.658 47.523  1.00 211.87 ? 38  THR B C   1 
ATOM   2386 O O   . THR B 1 13  ? -40.477  -45.652 46.964  1.00 211.33 ? 38  THR B O   1 
ATOM   2387 C CB  . THR B 1 13  ? -39.170  -46.284 49.847  1.00 203.12 ? 38  THR B CB  1 
ATOM   2388 O OG1 . THR B 1 13  ? -37.904  -46.781 49.397  1.00 205.80 ? 38  THR B OG1 1 
ATOM   2389 C CG2 . THR B 1 13  ? -39.352  -46.617 51.320  1.00 177.81 ? 38  THR B CG2 1 
ATOM   2390 N N   . GLN B 1 14  ? -39.315  -47.584 46.895  1.00 214.16 ? 39  GLN B N   1 
ATOM   2391 C CA  . GLN B 1 14  ? -39.008  -47.497 45.469  1.00 216.88 ? 39  GLN B CA  1 
ATOM   2392 C C   . GLN B 1 14  ? -40.271  -47.614 44.610  1.00 236.92 ? 39  GLN B C   1 
ATOM   2393 O O   . GLN B 1 14  ? -40.342  -47.043 43.518  1.00 232.18 ? 39  GLN B O   1 
ATOM   2394 C CB  . GLN B 1 14  ? -37.991  -48.560 45.076  1.00 200.14 ? 39  GLN B CB  1 
ATOM   2395 N N   . ALA B 1 15  ? -41.259  -48.358 45.103  1.00 240.22 ? 40  ALA B N   1 
ATOM   2396 C CA  . ALA B 1 15  ? -42.555  -48.453 44.434  1.00 229.49 ? 40  ALA B CA  1 
ATOM   2397 C C   . ALA B 1 15  ? -43.441  -47.251 44.776  1.00 221.54 ? 40  ALA B C   1 
ATOM   2398 O O   . ALA B 1 15  ? -44.436  -46.985 44.095  1.00 208.27 ? 40  ALA B O   1 
ATOM   2399 C CB  . ALA B 1 15  ? -43.254  -49.760 44.796  1.00 199.95 ? 40  ALA B CB  1 
ATOM   2400 N N   . LEU B 1 16  ? -43.068  -46.532 45.834  1.00 213.31 ? 41  LEU B N   1 
ATOM   2401 C CA  . LEU B 1 16  ? -43.784  -45.332 46.261  1.00 201.06 ? 41  LEU B CA  1 
ATOM   2402 C C   . LEU B 1 16  ? -43.386  -44.096 45.454  1.00 200.21 ? 41  LEU B C   1 
ATOM   2403 O O   . LEU B 1 16  ? -44.244  -43.323 45.025  1.00 196.21 ? 41  LEU B O   1 
ATOM   2404 C CB  . LEU B 1 16  ? -43.546  -45.068 47.749  1.00 186.98 ? 41  LEU B CB  1 
ATOM   2405 C CG  . LEU B 1 16  ? -44.279  -43.841 48.294  1.00 175.07 ? 41  LEU B CG  1 
ATOM   2406 C CD1 . LEU B 1 16  ? -45.778  -44.092 48.290  1.00 145.61 ? 41  LEU B CD1 1 
ATOM   2407 C CD2 . LEU B 1 16  ? -43.793  -43.476 49.688  1.00 128.88 ? 41  LEU B CD2 1 
ATOM   2408 N N   . VAL B 1 17  ? -42.083  -43.905 45.262  1.00 197.18 ? 42  VAL B N   1 
ATOM   2409 C CA  . VAL B 1 17  ? -41.583  -42.773 44.488  1.00 183.66 ? 42  VAL B CA  1 
ATOM   2410 C C   . VAL B 1 17  ? -41.902  -42.921 43.004  1.00 190.71 ? 42  VAL B C   1 
ATOM   2411 O O   . VAL B 1 17  ? -42.125  -41.930 42.307  1.00 192.16 ? 42  VAL B O   1 
ATOM   2412 C CB  . VAL B 1 17  ? -40.065  -42.576 44.672  1.00 177.53 ? 42  VAL B CB  1 
ATOM   2413 C CG1 . VAL B 1 17  ? -39.743  -42.292 46.131  1.00 142.29 ? 42  VAL B CG1 1 
ATOM   2414 C CG2 . VAL B 1 17  ? -39.307  -43.794 44.177  1.00 191.08 ? 42  VAL B CG2 1 
ATOM   2415 N N   . ILE B 1 18  ? -41.926  -44.161 42.528  1.00 195.58 ? 43  ILE B N   1 
ATOM   2416 C CA  . ILE B 1 18  ? -42.314  -44.438 41.153  1.00 187.83 ? 43  ILE B CA  1 
ATOM   2417 C C   . ILE B 1 18  ? -43.766  -44.026 40.937  1.00 204.35 ? 43  ILE B C   1 
ATOM   2418 O O   . ILE B 1 18  ? -44.107  -43.424 39.918  1.00 203.22 ? 43  ILE B O   1 
ATOM   2419 C CB  . ILE B 1 18  ? -42.123  -45.909 40.836  1.00 156.19 ? 43  ILE B CB  1 
ATOM   2420 N N   . ALA B 1 19  ? -44.615  -44.348 41.909  1.00 205.38 ? 44  ALA B N   1 
ATOM   2421 C CA  . ALA B 1 19  ? -46.030  -43.995 41.851  1.00 200.45 ? 44  ALA B CA  1 
ATOM   2422 C C   . ALA B 1 19  ? -46.241  -42.533 42.232  1.00 194.14 ? 44  ALA B C   1 
ATOM   2423 O O   . ALA B 1 19  ? -47.327  -41.982 42.054  1.00 193.40 ? 44  ALA B O   1 
ATOM   2424 C CB  . ALA B 1 19  ? -46.837  -44.905 42.760  1.00 181.46 ? 44  ALA B CB  1 
ATOM   2425 N N   . TYR B 1 20  ? -45.191  -41.921 42.769  1.00 187.66 ? 45  TYR B N   1 
ATOM   2426 C CA  . TYR B 1 20  ? -45.220  -40.520 43.162  1.00 183.32 ? 45  TYR B CA  1 
ATOM   2427 C C   . TYR B 1 20  ? -44.889  -39.596 41.991  1.00 187.17 ? 45  TYR B C   1 
ATOM   2428 O O   . TYR B 1 20  ? -45.516  -38.549 41.819  1.00 186.24 ? 45  TYR B O   1 
ATOM   2429 C CB  . TYR B 1 20  ? -44.246  -40.280 44.312  1.00 174.56 ? 45  TYR B CB  1 
ATOM   2430 C CG  . TYR B 1 20  ? -43.904  -38.828 44.514  1.00 170.07 ? 45  TYR B CG  1 
ATOM   2431 C CD1 . TYR B 1 20  ? -44.559  -38.070 45.475  1.00 155.21 ? 45  TYR B CD1 1 
ATOM   2432 C CD2 . TYR B 1 20  ? -42.925  -38.212 43.740  1.00 154.91 ? 45  TYR B CD2 1 
ATOM   2433 C CE1 . TYR B 1 20  ? -44.248  -36.742 45.664  1.00 159.83 ? 45  TYR B CE1 1 
ATOM   2434 C CE2 . TYR B 1 20  ? -42.609  -36.883 43.919  1.00 165.16 ? 45  TYR B CE2 1 
ATOM   2435 C CZ  . TYR B 1 20  ? -43.274  -36.154 44.881  1.00 173.13 ? 45  TYR B CZ  1 
ATOM   2436 O OH  . TYR B 1 20  ? -42.960  -34.829 45.055  1.00 147.59 ? 45  TYR B OH  1 
ATOM   2437 N N   . VAL B 1 21  ? -43.893  -39.975 41.194  1.00 184.81 ? 46  VAL B N   1 
ATOM   2438 C CA  . VAL B 1 21  ? -43.521  -39.179 40.029  1.00 182.31 ? 46  VAL B CA  1 
ATOM   2439 C C   . VAL B 1 21  ? -44.437  -39.447 38.832  1.00 183.64 ? 46  VAL B C   1 
ATOM   2440 O O   . VAL B 1 21  ? -45.105  -38.537 38.343  1.00 197.21 ? 46  VAL B O   1 
ATOM   2441 C CB  . VAL B 1 21  ? -42.039  -39.372 39.632  1.00 166.04 ? 46  VAL B CB  1 
ATOM   2442 C CG1 . VAL B 1 21  ? -41.122  -38.828 40.717  1.00 131.87 ? 46  VAL B CG1 1 
ATOM   2443 C CG2 . VAL B 1 21  ? -41.743  -40.833 39.358  1.00 181.48 ? 46  VAL B CG2 1 
ATOM   2444 N N   . ILE B 1 22  ? -44.482  -40.692 38.368  1.00 172.19 ? 47  ILE B N   1 
ATOM   2445 C CA  . ILE B 1 22  ? -45.327  -41.031 37.229  1.00 188.74 ? 47  ILE B CA  1 
ATOM   2446 C C   . ILE B 1 22  ? -46.807  -40.837 37.563  1.00 201.29 ? 47  ILE B C   1 
ATOM   2447 O O   . ILE B 1 22  ? -47.574  -40.322 36.745  1.00 202.83 ? 47  ILE B O   1 
ATOM   2448 C CB  . ILE B 1 22  ? -45.084  -42.475 36.739  1.00 193.49 ? 47  ILE B CB  1 
ATOM   2449 C CG1 . ILE B 1 22  ? -43.596  -42.701 36.457  1.00 176.46 ? 47  ILE B CG1 1 
ATOM   2450 C CG2 . ILE B 1 22  ? -45.916  -42.770 35.494  1.00 193.67 ? 47  ILE B CG2 1 
ATOM   2451 C CD1 . ILE B 1 22  ? -43.282  -44.063 35.860  1.00 174.61 ? 47  ILE B CD1 1 
ATOM   2452 N N   . GLY B 1 23  ? -47.197  -41.232 38.772  1.00 195.64 ? 48  GLY B N   1 
ATOM   2453 C CA  . GLY B 1 23  ? -48.593  -41.207 39.171  1.00 194.01 ? 48  GLY B CA  1 
ATOM   2454 C C   . GLY B 1 23  ? -49.110  -39.858 39.632  1.00 191.62 ? 48  GLY B C   1 
ATOM   2455 O O   . GLY B 1 23  ? -50.227  -39.466 39.294  1.00 195.87 ? 48  GLY B O   1 
ATOM   2456 N N   . TYR B 1 24  ? -48.298  -39.151 40.412  1.00 190.52 ? 49  TYR B N   1 
ATOM   2457 C CA  . TYR B 1 24  ? -48.705  -37.877 40.994  1.00 188.80 ? 49  TYR B CA  1 
ATOM   2458 C C   . TYR B 1 24  ? -48.289  -36.665 40.165  1.00 184.22 ? 49  TYR B C   1 
ATOM   2459 O O   . TYR B 1 24  ? -49.134  -35.909 39.680  1.00 188.80 ? 49  TYR B O   1 
ATOM   2460 C CB  . TYR B 1 24  ? -48.134  -37.731 42.402  1.00 179.61 ? 49  TYR B CB  1 
ATOM   2461 C CG  . TYR B 1 24  ? -48.364  -36.363 42.985  1.00 172.26 ? 49  TYR B CG  1 
ATOM   2462 C CD1 . TYR B 1 24  ? -49.574  -36.046 43.586  1.00 167.11 ? 49  TYR B CD1 1 
ATOM   2463 C CD2 . TYR B 1 24  ? -47.381  -35.383 42.923  1.00 154.04 ? 49  TYR B CD2 1 
ATOM   2464 C CE1 . TYR B 1 24  ? -49.802  -34.798 44.118  1.00 156.00 ? 49  TYR B CE1 1 
ATOM   2465 C CE2 . TYR B 1 24  ? -47.599  -34.127 43.453  1.00 156.41 ? 49  TYR B CE2 1 
ATOM   2466 C CZ  . TYR B 1 24  ? -48.815  -33.842 44.051  1.00 160.44 ? 49  TYR B CZ  1 
ATOM   2467 O OH  . TYR B 1 24  ? -49.062  -32.599 44.587  1.00 132.56 ? 49  TYR B OH  1 
ATOM   2468 N N   . VAL B 1 25  ? -46.982  -36.478 40.019  1.00 173.91 ? 50  VAL B N   1 
ATOM   2469 C CA  . VAL B 1 25  ? -46.452  -35.279 39.382  1.00 169.83 ? 50  VAL B CA  1 
ATOM   2470 C C   . VAL B 1 25  ? -46.517  -35.305 37.850  1.00 170.46 ? 50  VAL B C   1 
ATOM   2471 O O   . VAL B 1 25  ? -46.149  -34.332 37.195  1.00 168.41 ? 50  VAL B O   1 
ATOM   2472 C CB  . VAL B 1 25  ? -44.999  -35.012 39.819  1.00 148.05 ? 50  VAL B CB  1 
ATOM   2473 C CG1 . VAL B 1 25  ? -44.042  -35.840 38.989  1.00 158.04 ? 50  VAL B CG1 1 
ATOM   2474 C CG2 . VAL B 1 25  ? -44.672  -33.532 39.703  1.00 162.80 ? 50  VAL B CG2 1 
ATOM   2475 N N   . CYS B 1 26  ? -46.975  -36.411 37.273  1.00 173.44 ? 51  CYS B N   1 
ATOM   2476 C CA  . CYS B 1 26  ? -47.011  -36.507 35.816  1.00 166.29 ? 51  CYS B CA  1 
ATOM   2477 C C   . CYS B 1 26  ? -48.398  -36.722 35.227  1.00 164.48 ? 51  CYS B C   1 
ATOM   2478 O O   . CYS B 1 26  ? -48.539  -36.958 34.031  1.00 171.19 ? 51  CYS B O   1 
ATOM   2479 C CB  . CYS B 1 26  ? -46.026  -37.560 35.317  1.00 175.68 ? 51  CYS B CB  1 
ATOM   2480 S SG  . CYS B 1 26  ? -44.308  -37.038 35.537  1.00 139.03 ? 51  CYS B SG  1 
ATOM   2481 N N   . VAL B 1 27  ? -49.419  -36.644 36.070  1.00 168.36 ? 52  VAL B N   1 
ATOM   2482 C CA  . VAL B 1 27  ? -50.790  -36.649 35.583  1.00 189.47 ? 52  VAL B CA  1 
ATOM   2483 C C   . VAL B 1 27  ? -51.595  -35.575 36.316  1.00 186.82 ? 52  VAL B C   1 
ATOM   2484 O O   . VAL B 1 27  ? -52.364  -34.832 35.699  1.00 186.21 ? 52  VAL B O   1 
ATOM   2485 C CB  . VAL B 1 27  ? -51.450  -38.049 35.703  1.00 184.26 ? 52  VAL B CB  1 
ATOM   2486 C CG1 . VAL B 1 27  ? -50.475  -39.134 35.268  1.00 129.06 ? 52  VAL B CG1 1 
ATOM   2487 C CG2 . VAL B 1 27  ? -51.940  -38.312 37.116  1.00 182.48 ? 52  VAL B CG2 1 
ATOM   2488 N N   . TYR B 1 28  ? -51.472  -35.562 37.646  1.00 174.06 ? 53  TYR B N   1 
ATOM   2489 C CA  . TYR B 1 28  ? -52.007  -34.494 38.504  1.00 174.67 ? 53  TYR B CA  1 
ATOM   2490 C C   . TYR B 1 28  ? -51.327  -33.121 38.359  1.00 180.11 ? 53  TYR B C   1 
ATOM   2491 O O   . TYR B 1 28  ? -51.999  -32.092 38.290  1.00 180.11 ? 53  TYR B O   1 
ATOM   2492 C CB  . TYR B 1 28  ? -51.930  -34.933 39.966  1.00 167.38 ? 53  TYR B CB  1 
ATOM   2493 C CG  . TYR B 1 28  ? -52.672  -34.023 40.920  1.00 189.66 ? 53  TYR B CG  1 
ATOM   2494 C CD1 . TYR B 1 28  ? -54.015  -34.235 41.210  1.00 174.54 ? 53  TYR B CD1 1 
ATOM   2495 C CD2 . TYR B 1 28  ? -52.029  -32.955 41.529  1.00 201.99 ? 53  TYR B CD2 1 
ATOM   2496 C CE1 . TYR B 1 28  ? -54.695  -33.406 42.080  1.00 197.17 ? 53  TYR B CE1 1 
ATOM   2497 C CE2 . TYR B 1 28  ? -52.703  -32.119 42.403  1.00 210.70 ? 53  TYR B CE2 1 
ATOM   2498 C CZ  . TYR B 1 28  ? -54.035  -32.350 42.674  1.00 212.86 ? 53  TYR B CZ  1 
ATOM   2499 O OH  . TYR B 1 28  ? -54.711  -31.522 43.540  1.00 187.37 ? 53  TYR B OH  1 
ATOM   2500 N N   . ASN B 1 29  ? -49.996  -33.121 38.306  1.00 162.71 ? 54  ASN B N   1 
ATOM   2501 C CA  . ASN B 1 29  ? -49.214  -31.922 38.051  1.00 160.80 ? 54  ASN B CA  1 
ATOM   2502 C C   . ASN B 1 29  ? -48.779  -31.834 36.586  1.00 168.18 ? 54  ASN B C   1 
ATOM   2503 O O   . ASN B 1 29  ? -48.392  -30.765 36.115  1.00 173.83 ? 54  ASN B O   1 
ATOM   2504 C CB  . ASN B 1 29  ? -48.020  -31.852 38.981  1.00 133.09 ? 54  ASN B CB  1 
ATOM   2505 N N   . LYS B 1 30  ? -48.847  -32.955 35.872  1.00 167.33 ? 55  LYS B N   1 
ATOM   2506 C CA  . LYS B 1 30  ? -48.519  -32.983 34.445  1.00 166.27 ? 55  LYS B CA  1 
ATOM   2507 C C   . LYS B 1 30  ? -47.186  -32.299 34.134  1.00 166.81 ? 55  LYS B C   1 
ATOM   2508 O O   . LYS B 1 30  ? -47.097  -31.502 33.202  1.00 170.25 ? 55  LYS B O   1 
ATOM   2509 C CB  . LYS B 1 30  ? -49.649  -32.354 33.622  1.00 134.47 ? 55  LYS B CB  1 
ATOM   2510 N N   . GLY B 1 31  ? -46.160  -32.618 34.919  1.00 158.55 ? 56  GLY B N   1 
ATOM   2511 C CA  . GLY B 1 31  ? -44.870  -31.951 34.828  1.00 152.88 ? 56  GLY B CA  1 
ATOM   2512 C C   . GLY B 1 31  ? -43.990  -32.314 33.643  1.00 165.63 ? 56  GLY B C   1 
ATOM   2513 O O   . GLY B 1 31  ? -42.881  -31.795 33.513  1.00 166.27 ? 56  GLY B O   1 
ATOM   2514 N N   . TYR B 1 32  ? -44.475  -33.204 32.781  1.00 161.71 ? 57  TYR B N   1 
ATOM   2515 C CA  . TYR B 1 32  ? -43.724  -33.636 31.602  1.00 154.51 ? 57  TYR B CA  1 
ATOM   2516 C C   . TYR B 1 32  ? -43.934  -32.740 30.372  1.00 173.40 ? 57  TYR B C   1 
ATOM   2517 O O   . TYR B 1 32  ? -43.388  -33.012 29.301  1.00 166.86 ? 57  TYR B O   1 
ATOM   2518 C CB  . TYR B 1 32  ? -44.097  -35.071 31.245  1.00 148.33 ? 57  TYR B CB  1 
ATOM   2519 C CG  . TYR B 1 32  ? -45.562  -35.244 30.926  1.00 151.99 ? 57  TYR B CG  1 
ATOM   2520 C CD1 . TYR B 1 32  ? -46.010  -35.304 29.608  1.00 153.25 ? 57  TYR B CD1 1 
ATOM   2521 C CD2 . TYR B 1 32  ? -46.501  -35.341 31.942  1.00 142.16 ? 57  TYR B CD2 1 
ATOM   2522 C CE1 . TYR B 1 32  ? -47.353  -35.463 29.316  1.00 152.44 ? 57  TYR B CE1 1 
ATOM   2523 C CE2 . TYR B 1 32  ? -47.847  -35.499 31.660  1.00 148.31 ? 57  TYR B CE2 1 
ATOM   2524 C CZ  . TYR B 1 32  ? -48.269  -35.560 30.347  1.00 144.13 ? 57  TYR B CZ  1 
ATOM   2525 O OH  . TYR B 1 32  ? -49.607  -35.718 30.063  1.00 114.43 ? 57  TYR B OH  1 
ATOM   2526 N N   . GLN B 1 33  ? -44.741  -31.691 30.522  1.00 170.97 ? 58  GLN B N   1 
ATOM   2527 C CA  . GLN B 1 33  ? -45.018  -30.748 29.434  1.00 145.17 ? 58  GLN B CA  1 
ATOM   2528 C C   . GLN B 1 33  ? -44.184  -29.472 29.558  1.00 140.90 ? 58  GLN B C   1 
ATOM   2529 O O   . GLN B 1 33  ? -43.798  -29.087 30.655  1.00 151.52 ? 58  GLN B O   1 
ATOM   2530 C CB  . GLN B 1 33  ? -46.509  -30.374 29.421  1.00 152.34 ? 58  GLN B CB  1 
ATOM   2531 C CG  . GLN B 1 33  ? -47.471  -31.556 29.267  1.00 173.15 ? 58  GLN B CG  1 
ATOM   2532 C CD  . GLN B 1 33  ? -48.927  -31.202 29.582  1.00 167.02 ? 58  GLN B CD  1 
ATOM   2533 O OE1 . GLN B 1 33  ? -49.241  -30.074 29.963  1.00 158.38 ? 58  GLN B OE1 1 
ATOM   2534 N NE2 . GLN B 1 33  ? -49.818  -32.177 29.424  1.00 157.00 ? 58  GLN B NE2 1 
ATOM   2535 N N   . ASP B 1 34  ? -43.908  -28.816 28.436  1.00 142.69 ? 59  ASP B N   1 
ATOM   2536 C CA  . ASP B 1 34  ? -43.328  -27.472 28.460  1.00 135.80 ? 59  ASP B CA  1 
ATOM   2537 C C   . ASP B 1 34  ? -44.466  -26.437 28.428  1.00 152.04 ? 59  ASP B C   1 
ATOM   2538 O O   . ASP B 1 34  ? -45.437  -26.622 27.700  1.00 155.43 ? 59  ASP B O   1 
ATOM   2539 C CB  . ASP B 1 34  ? -42.380  -27.276 27.277  1.00 92.44  ? 59  ASP B CB  1 
ATOM   2540 N N   . THR B 1 35  ? -44.360  -25.361 29.210  1.00 148.63 ? 60  THR B N   1 
ATOM   2541 C CA  . THR B 1 35  ? -45.438  -24.360 29.297  1.00 135.56 ? 60  THR B CA  1 
ATOM   2542 C C   . THR B 1 35  ? -45.355  -23.265 28.216  1.00 150.33 ? 60  THR B C   1 
ATOM   2543 O O   . THR B 1 35  ? -44.285  -23.018 27.661  1.00 148.58 ? 60  THR B O   1 
ATOM   2544 C CB  . THR B 1 35  ? -45.473  -23.738 30.701  1.00 96.18  ? 60  THR B CB  1 
ATOM   2545 N N   . ASP B 1 36  ? -46.488  -22.622 27.919  1.00 137.76 ? 61  ASP B N   1 
ATOM   2546 C CA  . ASP B 1 36  ? -46.518  -21.466 27.010  1.00 134.51 ? 61  ASP B CA  1 
ATOM   2547 C C   . ASP B 1 36  ? -47.760  -20.602 27.238  1.00 128.67 ? 61  ASP B C   1 
ATOM   2548 O O   . ASP B 1 36  ? -48.887  -21.108 27.246  1.00 110.58 ? 61  ASP B O   1 
ATOM   2549 C CB  . ASP B 1 36  ? -46.439  -21.909 25.541  1.00 129.48 ? 61  ASP B CB  1 
ATOM   2550 C CG  . ASP B 1 36  ? -46.256  -20.734 24.570  1.00 131.21 ? 61  ASP B CG  1 
ATOM   2551 O OD1 . ASP B 1 36  ? -45.922  -19.614 25.017  1.00 129.89 ? 61  ASP B OD1 1 
ATOM   2552 O OD2 . ASP B 1 36  ? -46.445  -20.936 23.348  1.00 120.97 ? 61  ASP B OD2 1 
ATOM   2553 N N   . THR B 1 37  ? -47.540  -19.300 27.427  1.00 121.81 ? 62  THR B N   1 
ATOM   2554 C CA  . THR B 1 37  ? -48.620  -18.345 27.665  1.00 128.63 ? 62  THR B CA  1 
ATOM   2555 C C   . THR B 1 37  ? -49.286  -17.917 26.361  1.00 125.40 ? 62  THR B C   1 
ATOM   2556 O O   . THR B 1 37  ? -48.681  -18.001 25.296  1.00 124.68 ? 62  THR B O   1 
ATOM   2557 C CB  . THR B 1 37  ? -48.107  -17.092 28.386  1.00 126.98 ? 62  THR B CB  1 
ATOM   2558 O OG1 . THR B 1 37  ? -47.124  -16.440 27.571  1.00 127.39 ? 62  THR B OG1 1 
ATOM   2559 C CG2 . THR B 1 37  ? -47.497  -17.460 29.732  1.00 112.43 ? 62  THR B CG2 1 
ATOM   2560 N N   . VAL B 1 38  ? -50.525  -17.444 26.455  1.00 119.54 ? 63  VAL B N   1 
ATOM   2561 C CA  . VAL B 1 38  ? -51.317  -17.128 25.277  1.00 102.87 ? 63  VAL B CA  1 
ATOM   2562 C C   . VAL B 1 38  ? -51.039  -15.747 24.693  1.00 100.36 ? 63  VAL B C   1 
ATOM   2563 O O   . VAL B 1 38  ? -50.906  -14.773 25.424  1.00 88.41  ? 63  VAL B O   1 
ATOM   2564 C CB  . VAL B 1 38  ? -52.808  -17.218 25.596  1.00 96.74  ? 63  VAL B CB  1 
ATOM   2565 C CG1 . VAL B 1 38  ? -53.618  -17.013 24.340  1.00 105.07 ? 63  VAL B CG1 1 
ATOM   2566 C CG2 . VAL B 1 38  ? -53.129  -18.555 26.231  1.00 114.10 ? 63  VAL B CG2 1 
ATOM   2567 N N   . LEU B 1 39  ? -50.934  -15.681 23.367  1.00 118.41 ? 64  LEU B N   1 
ATOM   2568 C CA  . LEU B 1 39  ? -50.987  -14.403 22.661  1.00 116.08 ? 64  LEU B CA  1 
ATOM   2569 C C   . LEU B 1 39  ? -52.434  -14.130 22.290  1.00 116.47 ? 64  LEU B C   1 
ATOM   2570 O O   . LEU B 1 39  ? -53.073  -14.945 21.606  1.00 92.12  ? 64  LEU B O   1 
ATOM   2571 C CB  . LEU B 1 39  ? -50.084  -14.391 21.413  1.00 51.92  ? 64  LEU B CB  1 
ATOM   2572 N N   . SER B 1 40  ? -52.936  -12.981 22.757  1.00 119.49 ? 65  SER B N   1 
ATOM   2573 C CA  . SER B 1 40  ? -54.346  -12.653 22.606  1.00 104.98 ? 65  SER B CA  1 
ATOM   2574 C C   . SER B 1 40  ? -54.670  -11.417 21.779  1.00 97.66  ? 65  SER B C   1 
ATOM   2575 O O   . SER B 1 40  ? -53.870  -10.491 21.647  1.00 98.29  ? 65  SER B O   1 
ATOM   2576 C CB  . SER B 1 40  ? -55.007  -12.522 23.975  1.00 105.72 ? 65  SER B CB  1 
ATOM   2577 O OG  . SER B 1 40  ? -56.414  -12.539 23.846  1.00 95.55  ? 65  SER B OG  1 
ATOM   2578 N N   . SER B 1 41  ? -55.885  -11.426 21.247  1.00 90.82  ? 66  SER B N   1 
ATOM   2579 C CA  . SER B 1 41  ? -56.447  -10.297 20.532  1.00 95.60  ? 66  SER B CA  1 
ATOM   2580 C C   . SER B 1 41  ? -57.970  -10.418 20.617  1.00 96.89  ? 66  SER B C   1 
ATOM   2581 O O   . SER B 1 41  ? -58.521  -11.483 20.338  1.00 102.75 ? 66  SER B O   1 
ATOM   2582 C CB  . SER B 1 41  ? -55.975  -10.306 19.074  1.00 95.16  ? 66  SER B CB  1 
ATOM   2583 O OG  . SER B 1 41  ? -56.546  -9.246  18.328  1.00 92.93  ? 66  SER B OG  1 
ATOM   2584 N N   . VAL B 1 42  ? -58.646  -9.340  21.016  1.00 88.12  ? 67  VAL B N   1 
ATOM   2585 C CA  . VAL B 1 42  ? -60.102  -9.365  21.159  1.00 85.72  ? 67  VAL B CA  1 
ATOM   2586 C C   . VAL B 1 42  ? -60.788  -8.284  20.342  1.00 97.82  ? 67  VAL B C   1 
ATOM   2587 O O   . VAL B 1 42  ? -60.148  -7.356  19.845  1.00 106.21 ? 67  VAL B O   1 
ATOM   2588 C CB  . VAL B 1 42  ? -60.556  -9.182  22.616  1.00 72.41  ? 67  VAL B CB  1 
ATOM   2589 C CG1 . VAL B 1 42  ? -60.061  -10.314 23.481  1.00 98.98  ? 67  VAL B CG1 1 
ATOM   2590 C CG2 . VAL B 1 42  ? -60.084  -7.849  23.138  1.00 106.36 ? 67  VAL B CG2 1 
ATOM   2591 N N   . THR B 1 43  ? -62.104  -8.426  20.222  1.00 88.32  ? 68  THR B N   1 
ATOM   2592 C CA  . THR B 1 43  ? -62.935  -7.528  19.446  1.00 86.36  ? 68  THR B CA  1 
ATOM   2593 C C   . THR B 1 43  ? -64.329  -7.560  20.030  1.00 93.75  ? 68  THR B C   1 
ATOM   2594 O O   . THR B 1 43  ? -64.918  -8.624  20.180  1.00 89.93  ? 68  THR B O   1 
ATOM   2595 C CB  . THR B 1 43  ? -63.031  -8.002  17.996  1.00 102.98 ? 68  THR B CB  1 
ATOM   2596 O OG1 . THR B 1 43  ? -61.762  -7.833  17.354  1.00 128.77 ? 68  THR B OG1 1 
ATOM   2597 C CG2 . THR B 1 43  ? -64.085  -7.208  17.236  1.00 90.40  ? 68  THR B CG2 1 
ATOM   2598 N N   . THR B 1 44  ? -64.847  -6.393  20.382  1.00 103.16 ? 69  THR B N   1 
ATOM   2599 C CA  . THR B 1 44  ? -66.171  -6.307  20.969  1.00 81.41  ? 69  THR B CA  1 
ATOM   2600 C C   . THR B 1 44  ? -67.104  -5.540  20.041  1.00 86.27  ? 69  THR B C   1 
ATOM   2601 O O   . THR B 1 44  ? -66.645  -4.686  19.273  1.00 99.97  ? 69  THR B O   1 
ATOM   2602 C CB  . THR B 1 44  ? -66.117  -5.593  22.327  1.00 91.85  ? 69  THR B CB  1 
ATOM   2603 O OG1 . THR B 1 44  ? -65.544  -4.290  22.169  1.00 92.67  ? 69  THR B OG1 1 
ATOM   2604 C CG2 . THR B 1 44  ? -65.266  -6.375  23.309  1.00 87.22  ? 69  THR B CG2 1 
ATOM   2605 N N   . LYS B 1 45  ? -68.399  -5.855  20.082  1.00 77.73  ? 70  LYS B N   1 
ATOM   2606 C CA  . LYS B 1 45  ? -69.405  -4.979  19.472  1.00 94.90  ? 70  LYS B CA  1 
ATOM   2607 C C   . LYS B 1 45  ? -70.678  -5.018  20.288  1.00 81.81  ? 70  LYS B C   1 
ATOM   2608 O O   . LYS B 1 45  ? -71.342  -6.048  20.359  1.00 78.04  ? 70  LYS B O   1 
ATOM   2609 C CB  . LYS B 1 45  ? -69.678  -5.325  17.981  1.00 59.45  ? 70  LYS B CB  1 
ATOM   2610 N N   . VAL B 1 46  ? -70.994  -3.892  20.920  1.00 77.14  ? 71  VAL B N   1 
ATOM   2611 C CA  . VAL B 1 46  ? -72.179  -3.788  21.751  1.00 77.79  ? 71  VAL B CA  1 
ATOM   2612 C C   . VAL B 1 46  ? -73.408  -3.398  20.934  1.00 89.10  ? 71  VAL B C   1 
ATOM   2613 O O   . VAL B 1 46  ? -73.350  -2.465  20.139  1.00 88.43  ? 71  VAL B O   1 
ATOM   2614 C CB  . VAL B 1 46  ? -71.969  -2.759  22.863  1.00 66.09  ? 71  VAL B CB  1 
ATOM   2615 C CG1 . VAL B 1 46  ? -73.269  -2.491  23.590  1.00 90.80  ? 71  VAL B CG1 1 
ATOM   2616 C CG2 . VAL B 1 46  ? -70.938  -3.249  23.822  1.00 75.55  ? 71  VAL B CG2 1 
ATOM   2617 N N   . LYS B 1 47  ? -74.518  -4.108  21.142  1.00 91.36  ? 72  LYS B N   1 
ATOM   2618 C CA  . LYS B 1 47  ? -75.779  -3.793  20.475  1.00 94.66  ? 72  LYS B CA  1 
ATOM   2619 C C   . LYS B 1 47  ? -76.891  -3.551  21.476  1.00 85.29  ? 72  LYS B C   1 
ATOM   2620 O O   . LYS B 1 47  ? -77.071  -4.306  22.404  1.00 90.55  ? 72  LYS B O   1 
ATOM   2621 C CB  . LYS B 1 47  ? -76.174  -4.900  19.509  1.00 67.89  ? 72  LYS B CB  1 
ATOM   2622 N N   . GLY B 1 48  ? -77.636  -2.480  21.255  1.00 79.77  ? 73  GLY B N   1 
ATOM   2623 C CA  . GLY B 1 48  ? -78.789  -2.127  22.062  1.00 72.60  ? 73  GLY B CA  1 
ATOM   2624 C C   . GLY B 1 48  ? -79.212  -0.689  21.832  1.00 82.25  ? 73  GLY B C   1 
ATOM   2625 O O   . GLY B 1 48  ? -78.498  0.060   21.193  1.00 92.43  ? 73  GLY B O   1 
ATOM   2626 N N   . ILE B 1 49  ? -80.390  -0.313  22.315  1.00 66.92  ? 74  ILE B N   1 
ATOM   2627 C CA  . ILE B 1 49  ? -80.748  1.096   22.415  1.00 92.49  ? 74  ILE B CA  1 
ATOM   2628 C C   . ILE B 1 49  ? -81.492  1.341   23.706  1.00 103.65 ? 74  ILE B C   1 
ATOM   2629 O O   . ILE B 1 49  ? -82.083  0.423   24.272  1.00 92.02  ? 74  ILE B O   1 
ATOM   2630 C CB  . ILE B 1 49  ? -81.661  1.588   21.297  1.00 79.02  ? 74  ILE B CB  1 
ATOM   2631 C CG1 . ILE B 1 49  ? -82.917  0.733   21.238  1.00 114.17 ? 74  ILE B CG1 1 
ATOM   2632 C CG2 . ILE B 1 49  ? -80.933  1.632   19.982  1.00 99.25  ? 74  ILE B CG2 1 
ATOM   2633 C CD1 . ILE B 1 49  ? -83.958  1.267   20.291  1.00 124.54 ? 74  ILE B CD1 1 
ATOM   2634 N N   . ALA B 1 50  ? -81.485  2.593   24.149  1.00 90.05  ? 75  ALA B N   1 
ATOM   2635 C CA  . ALA B 1 50  ? -82.068  2.934   25.426  1.00 79.79  ? 75  ALA B CA  1 
ATOM   2636 C C   . ALA B 1 50  ? -82.812  4.248   25.340  1.00 97.23  ? 75  ALA B C   1 
ATOM   2637 O O   . ALA B 1 50  ? -82.373  5.174   24.663  1.00 99.50  ? 75  ALA B O   1 
ATOM   2638 C CB  . ALA B 1 50  ? -80.995  3.016   26.462  1.00 91.16  ? 75  ALA B CB  1 
ATOM   2639 N N   . LEU B 1 51  ? -83.940  4.306   26.039  1.00 93.69  ? 76  LEU B N   1 
ATOM   2640 C CA  . LEU B 1 51  ? -84.790  5.486   26.074  1.00 103.13 ? 76  LEU B CA  1 
ATOM   2641 C C   . LEU B 1 51  ? -84.581  6.262   27.361  1.00 84.63  ? 76  LEU B C   1 
ATOM   2642 O O   . LEU B 1 51  ? -84.163  5.692   28.354  1.00 104.47 ? 76  LEU B O   1 
ATOM   2643 C CB  . LEU B 1 51  ? -86.250  5.061   25.984  1.00 107.01 ? 76  LEU B CB  1 
ATOM   2644 C CG  . LEU B 1 51  ? -87.279  6.169   26.173  1.00 97.13  ? 76  LEU B CG  1 
ATOM   2645 C CD1 . LEU B 1 51  ? -87.189  7.171   25.035  1.00 102.48 ? 76  LEU B CD1 1 
ATOM   2646 C CD2 . LEU B 1 51  ? -88.663  5.574   26.260  1.00 99.47  ? 76  LEU B CD2 1 
ATOM   2647 N N   . THR B 1 52  ? -84.883  7.555   27.356  1.00 80.24  ? 77  THR B N   1 
ATOM   2648 C CA  . THR B 1 52  ? -84.924  8.317   28.596  1.00 94.90  ? 77  THR B CA  1 
ATOM   2649 C C   . THR B 1 52  ? -85.969  9.414   28.547  1.00 111.39 ? 77  THR B C   1 
ATOM   2650 O O   . THR B 1 52  ? -85.907  10.292  27.696  1.00 118.49 ? 77  THR B O   1 
ATOM   2651 C CB  . THR B 1 52  ? -83.561  8.968   28.956  1.00 100.91 ? 77  THR B CB  1 
ATOM   2652 O OG1 . THR B 1 52  ? -83.233  9.994   28.015  1.00 84.18  ? 77  THR B OG1 1 
ATOM   2653 C CG2 . THR B 1 52  ? -82.458  7.950   28.982  1.00 89.89  ? 77  THR B CG2 1 
ATOM   2654 N N   . ASN B 1 53  ? -86.935  9.353   29.457  1.00 119.74 ? 78  ASN B N   1 
ATOM   2655 C CA  . ASN B 1 53  ? -87.811  10.489  29.729  1.00 132.89 ? 78  ASN B CA  1 
ATOM   2656 C C   . ASN B 1 53  ? -87.154  11.403  30.758  1.00 145.80 ? 78  ASN B C   1 
ATOM   2657 O O   . ASN B 1 53  ? -87.439  11.327  31.949  1.00 132.54 ? 78  ASN B O   1 
ATOM   2658 C CB  . ASN B 1 53  ? -89.171  10.009  30.238  1.00 135.26 ? 78  ASN B CB  1 
ATOM   2659 C CG  . ASN B 1 53  ? -89.953  9.296   29.179  1.00 146.57 ? 78  ASN B CG  1 
ATOM   2660 O OD1 . ASN B 1 53  ? -89.412  8.963   28.126  1.00 140.38 ? 78  ASN B OD1 1 
ATOM   2661 N ND2 . ASN B 1 53  ? -91.228  9.039   29.447  1.00 173.17 ? 78  ASN B ND2 1 
ATOM   2662 N N   . THR B 1 54  ? -86.246  12.251  30.296  1.00 162.39 ? 79  THR B N   1 
ATOM   2663 C CA  . THR B 1 54  ? -85.609  13.207  31.183  1.00 148.09 ? 79  THR B CA  1 
ATOM   2664 C C   . THR B 1 54  ? -86.691  14.074  31.802  1.00 158.44 ? 79  THR B C   1 
ATOM   2665 O O   . THR B 1 54  ? -87.846  14.037  31.379  1.00 158.94 ? 79  THR B O   1 
ATOM   2666 C CB  . THR B 1 54  ? -84.608  14.103  30.435  1.00 174.00 ? 79  THR B CB  1 
ATOM   2667 O OG1 . THR B 1 54  ? -85.168  14.475  29.171  1.00 185.31 ? 79  THR B OG1 1 
ATOM   2668 C CG2 . THR B 1 54  ? -83.302  13.352  30.194  1.00 163.62 ? 79  THR B CG2 1 
ATOM   2669 N N   . SER B 1 55  ? -86.326  14.844  32.818  1.00 183.42 ? 80  SER B N   1 
ATOM   2670 C CA  . SER B 1 55  ? -87.293  15.709  33.479  1.00 182.39 ? 80  SER B CA  1 
ATOM   2671 C C   . SER B 1 55  ? -87.933  16.639  32.458  1.00 173.12 ? 80  SER B C   1 
ATOM   2672 O O   . SER B 1 55  ? -89.130  16.540  32.178  1.00 135.64 ? 80  SER B O   1 
ATOM   2673 C CB  . SER B 1 55  ? -86.618  16.515  34.593  1.00 164.58 ? 80  SER B CB  1 
ATOM   2674 O OG  . SER B 1 55  ? -85.428  17.136  34.133  1.00 163.23 ? 80  SER B OG  1 
ATOM   2675 N N   . GLU B 1 56  ? -87.116  17.523  31.890  1.00 168.71 ? 81  GLU B N   1 
ATOM   2676 C CA  . GLU B 1 56  ? -87.602  18.569  30.994  1.00 171.20 ? 81  GLU B CA  1 
ATOM   2677 C C   . GLU B 1 56  ? -87.418  18.244  29.514  1.00 184.14 ? 81  GLU B C   1 
ATOM   2678 O O   . GLU B 1 56  ? -88.212  18.677  28.674  1.00 204.63 ? 81  GLU B O   1 
ATOM   2679 C CB  . GLU B 1 56  ? -86.931  19.896  31.325  1.00 164.46 ? 81  GLU B CB  1 
ATOM   2680 N N   . LEU B 1 57  ? -86.365  17.492  29.203  1.00 185.62 ? 82  LEU B N   1 
ATOM   2681 C CA  . LEU B 1 57  ? -85.983  17.200  27.817  1.00 191.93 ? 82  LEU B CA  1 
ATOM   2682 C C   . LEU B 1 57  ? -86.915  16.212  27.105  1.00 183.30 ? 82  LEU B C   1 
ATOM   2683 O O   . LEU B 1 57  ? -86.873  16.072  25.879  1.00 158.96 ? 82  LEU B O   1 
ATOM   2684 C CB  . LEU B 1 57  ? -84.552  16.665  27.756  1.00 161.40 ? 82  LEU B CB  1 
ATOM   2685 C CG  . LEU B 1 57  ? -83.421  17.472  28.388  1.00 144.44 ? 82  LEU B CG  1 
ATOM   2686 C CD1 . LEU B 1 57  ? -83.592  17.611  29.896  1.00 131.64 ? 82  LEU B CD1 1 
ATOM   2687 C CD2 . LEU B 1 57  ? -82.110  16.797  28.049  1.00 126.48 ? 82  LEU B CD2 1 
ATOM   2688 N N   . GLY B 1 58  ? -87.741  15.517  27.879  1.00 188.87 ? 83  GLY B N   1 
ATOM   2689 C CA  . GLY B 1 58  ? -88.694  14.576  27.321  1.00 166.82 ? 83  GLY B CA  1 
ATOM   2690 C C   . GLY B 1 58  ? -88.031  13.375  26.682  1.00 146.43 ? 83  GLY B C   1 
ATOM   2691 O O   . GLY B 1 58  ? -86.807  13.255  26.699  1.00 138.87 ? 83  GLY B O   1 
ATOM   2692 N N   . GLU B 1 59  ? -88.845  12.492  26.106  1.00 155.74 ? 84  GLU B N   1 
ATOM   2693 C CA  . GLU B 1 59  ? -88.340  11.252  25.520  1.00 131.68 ? 84  GLU B CA  1 
ATOM   2694 C C   . GLU B 1 59  ? -87.100  11.486  24.675  1.00 105.32 ? 84  GLU B C   1 
ATOM   2695 O O   . GLU B 1 59  ? -87.007  12.469  23.952  1.00 99.82  ? 84  GLU B O   1 
ATOM   2696 C CB  . GLU B 1 59  ? -89.423  10.499  24.730  1.00 117.42 ? 84  GLU B CB  1 
ATOM   2697 C CG  . GLU B 1 59  ? -90.460  11.369  24.029  1.00 144.64 ? 84  GLU B CG  1 
ATOM   2698 C CD  . GLU B 1 59  ? -91.711  10.589  23.611  1.00 152.52 ? 84  GLU B CD  1 
ATOM   2699 O OE1 . GLU B 1 59  ? -91.904  9.459   24.117  1.00 139.26 ? 84  GLU B OE1 1 
ATOM   2700 O OE2 . GLU B 1 59  ? -92.506  11.112  22.788  1.00 133.77 ? 84  GLU B OE2 1 
ATOM   2701 N N   . ARG B 1 60  ? -86.143  10.574  24.795  1.00 118.75 ? 85  ARG B N   1 
ATOM   2702 C CA  . ARG B 1 60  ? -84.871  10.682  24.093  1.00 112.63 ? 85  ARG B CA  1 
ATOM   2703 C C   . ARG B 1 60  ? -84.199  9.323   23.960  1.00 97.26  ? 85  ARG B C   1 
ATOM   2704 O O   . ARG B 1 60  ? -84.246  8.512   24.876  1.00 102.83 ? 85  ARG B O   1 
ATOM   2705 C CB  . ARG B 1 60  ? -83.945  11.646  24.821  1.00 88.78  ? 85  ARG B CB  1 
ATOM   2706 C CG  . ARG B 1 60  ? -82.795  12.088  23.976  1.00 85.55  ? 85  ARG B CG  1 
ATOM   2707 C CD  . ARG B 1 60  ? -81.826  12.986  24.715  1.00 112.39 ? 85  ARG B CD  1 
ATOM   2708 N NE  . ARG B 1 60  ? -80.871  13.578  23.780  1.00 148.15 ? 85  ARG B NE  1 
ATOM   2709 C CZ  . ARG B 1 60  ? -79.818  12.936  23.272  1.00 135.41 ? 85  ARG B CZ  1 
ATOM   2710 N NH1 . ARG B 1 60  ? -79.565  11.675  23.620  1.00 96.24  ? 85  ARG B NH1 1 
ATOM   2711 N NH2 . ARG B 1 60  ? -79.011  13.553  22.414  1.00 124.29 ? 85  ARG B NH2 1 
ATOM   2712 N N   . ILE B 1 61  ? -83.590  9.075   22.807  1.00 94.48  ? 86  ILE B N   1 
ATOM   2713 C CA  . ILE B 1 61  ? -82.943  7.800   22.540  1.00 94.93  ? 86  ILE B CA  1 
ATOM   2714 C C   . ILE B 1 61  ? -81.424  7.900   22.525  1.00 102.49 ? 86  ILE B C   1 
ATOM   2715 O O   . ILE B 1 61  ? -80.861  8.895   22.078  1.00 105.55 ? 86  ILE B O   1 
ATOM   2716 C CB  . ILE B 1 61  ? -83.383  7.221   21.207  1.00 96.39  ? 86  ILE B CB  1 
ATOM   2717 C CG1 . ILE B 1 61  ? -84.409  6.127   21.425  1.00 96.19  ? 86  ILE B CG1 1 
ATOM   2718 C CG2 . ILE B 1 61  ? -82.216  6.589   20.504  1.00 103.89 ? 86  ILE B CG2 1 
ATOM   2719 C CD1 . ILE B 1 61  ? -84.411  5.125   20.297  1.00 113.11 ? 86  ILE B CD1 1 
ATOM   2720 N N   . TRP B 1 62  ? -80.773  6.845   23.002  1.00 103.20 ? 87  TRP B N   1 
ATOM   2721 C CA  . TRP B 1 62  ? -79.328  6.794   23.094  1.00 101.82 ? 87  TRP B CA  1 
ATOM   2722 C C   . TRP B 1 62  ? -78.905  5.516   22.441  1.00 97.44  ? 87  TRP B C   1 
ATOM   2723 O O   . TRP B 1 62  ? -79.068  4.459   23.028  1.00 97.24  ? 87  TRP B O   1 
ATOM   2724 C CB  . TRP B 1 62  ? -78.906  6.729   24.563  1.00 93.00  ? 87  TRP B CB  1 
ATOM   2725 C CG  . TRP B 1 62  ? -79.274  7.927   25.342  1.00 86.83  ? 87  TRP B CG  1 
ATOM   2726 C CD1 . TRP B 1 62  ? -80.503  8.245   25.822  1.00 104.52 ? 87  TRP B CD1 1 
ATOM   2727 C CD2 . TRP B 1 62  ? -78.407  8.984   25.719  1.00 84.38  ? 87  TRP B CD2 1 
ATOM   2728 N NE1 . TRP B 1 62  ? -80.458  9.447   26.474  1.00 109.99 ? 87  TRP B NE1 1 
ATOM   2729 C CE2 . TRP B 1 62  ? -79.171  9.925   26.422  1.00 94.38  ? 87  TRP B CE2 1 
ATOM   2730 C CE3 . TRP B 1 62  ? -77.048  9.234   25.529  1.00 93.78  ? 87  TRP B CE3 1 
ATOM   2731 C CZ2 . TRP B 1 62  ? -78.634  11.088  26.937  1.00 96.63  ? 87  TRP B CZ2 1 
ATOM   2732 C CZ3 . TRP B 1 62  ? -76.513  10.389  26.036  1.00 96.61  ? 87  TRP B CZ3 1 
ATOM   2733 C CH2 . TRP B 1 62  ? -77.302  11.304  26.733  1.00 101.42 ? 87  TRP B CH2 1 
ATOM   2734 N N   . ASP B 1 63  ? -78.374  5.578   21.229  1.00 101.80 ? 88  ASP B N   1 
ATOM   2735 C CA  . ASP B 1 63  ? -78.030  4.320   20.577  1.00 123.68 ? 88  ASP B CA  1 
ATOM   2736 C C   . ASP B 1 63  ? -76.676  3.831   21.022  1.00 123.21 ? 88  ASP B C   1 
ATOM   2737 O O   . ASP B 1 63  ? -75.646  4.232   20.465  1.00 85.49  ? 88  ASP B O   1 
ATOM   2738 C CB  . ASP B 1 63  ? -78.143  4.366   19.050  1.00 99.73  ? 88  ASP B CB  1 
ATOM   2739 C CG  . ASP B 1 63  ? -77.385  5.502   18.445  1.00 115.74 ? 88  ASP B CG  1 
ATOM   2740 O OD1 . ASP B 1 63  ? -76.779  6.296   19.210  1.00 138.46 ? 88  ASP B OD1 1 
ATOM   2741 O OD2 . ASP B 1 63  ? -77.414  5.596   17.198  1.00 88.02  ? 88  ASP B OD2 1 
ATOM   2742 N N   . VAL B 1 64  ? -76.716  2.948   22.026  1.00 137.78 ? 89  VAL B N   1 
ATOM   2743 C CA  . VAL B 1 64  ? -75.533  2.357   22.640  1.00 117.54 ? 89  VAL B CA  1 
ATOM   2744 C C   . VAL B 1 64  ? -74.391  2.195   21.650  1.00 150.32 ? 89  VAL B C   1 
ATOM   2745 O O   . VAL B 1 64  ? -73.221  2.324   22.027  1.00 153.20 ? 89  VAL B O   1 
ATOM   2746 C CB  . VAL B 1 64  ? -75.838  1.034   23.414  1.00 69.40  ? 89  VAL B CB  1 
ATOM   2747 C CG1 . VAL B 1 64  ? -75.964  -0.110  22.477  1.00 83.82  ? 89  VAL B CG1 1 
ATOM   2748 C CG2 . VAL B 1 64  ? -74.759  0.747   24.394  1.00 61.25  ? 89  VAL B CG2 1 
ATOM   2749 N N   . ALA B 1 65  ? -74.721  1.955   20.384  1.00 118.06 ? 90  ALA B N   1 
ATOM   2750 C CA  . ALA B 1 65  ? -73.704  1.939   19.371  1.00 58.30  ? 90  ALA B CA  1 
ATOM   2751 C C   . ALA B 1 65  ? -72.950  3.271   19.439  1.00 97.96  ? 90  ALA B C   1 
ATOM   2752 O O   . ALA B 1 65  ? -71.810  3.324   19.899  1.00 106.86 ? 90  ALA B O   1 
ATOM   2753 C CB  . ALA B 1 65  ? -74.331  1.729   18.033  1.00 90.05  ? 90  ALA B CB  1 
ATOM   2754 N N   . ASP B 1 66  ? -73.593  4.350   19.019  1.00 88.29  ? 91  ASP B N   1 
ATOM   2755 C CA  . ASP B 1 66  ? -72.875  5.600   18.799  1.00 90.20  ? 91  ASP B CA  1 
ATOM   2756 C C   . ASP B 1 66  ? -72.895  6.540   19.969  1.00 95.83  ? 91  ASP B C   1 
ATOM   2757 O O   . ASP B 1 66  ? -71.900  7.190   20.262  1.00 108.25 ? 91  ASP B O   1 
ATOM   2758 C CB  . ASP B 1 66  ? -73.420  6.317   17.589  1.00 84.11  ? 91  ASP B CB  1 
ATOM   2759 N N   . TYR B 1 67  ? -74.047  6.648   20.608  1.00 103.25 ? 92  TYR B N   1 
ATOM   2760 C CA  . TYR B 1 67  ? -74.226  7.653   21.635  1.00 118.79 ? 92  TYR B CA  1 
ATOM   2761 C C   . TYR B 1 67  ? -73.791  7.144   23.026  1.00 103.58 ? 92  TYR B C   1 
ATOM   2762 O O   . TYR B 1 67  ? -73.458  7.921   23.919  1.00 81.48  ? 92  TYR B O   1 
ATOM   2763 C CB  . TYR B 1 67  ? -75.670  8.174   21.623  1.00 112.08 ? 92  TYR B CB  1 
ATOM   2764 C CG  . TYR B 1 67  ? -75.746  9.627   22.007  1.00 151.63 ? 92  TYR B CG  1 
ATOM   2765 C CD1 . TYR B 1 67  ? -74.805  10.174  22.884  1.00 161.91 ? 92  TYR B CD1 1 
ATOM   2766 C CD2 . TYR B 1 67  ? -76.745  10.455  21.512  1.00 141.90 ? 92  TYR B CD2 1 
ATOM   2767 C CE1 . TYR B 1 67  ? -74.845  11.507  23.259  1.00 153.53 ? 92  TYR B CE1 1 
ATOM   2768 C CE2 . TYR B 1 67  ? -76.799  11.797  21.887  1.00 164.07 ? 92  TYR B CE2 1 
ATOM   2769 C CZ  . TYR B 1 67  ? -75.842  12.315  22.763  1.00 165.88 ? 92  TYR B CZ  1 
ATOM   2770 O OH  . TYR B 1 67  ? -75.869  13.641  23.146  1.00 134.87 ? 92  TYR B OH  1 
ATOM   2771 N N   . ILE B 1 68  ? -73.756  5.827   23.183  1.00 103.44 ? 93  ILE B N   1 
ATOM   2772 C CA  . ILE B 1 68  ? -73.562  5.213   24.494  1.00 85.60  ? 93  ILE B CA  1 
ATOM   2773 C C   . ILE B 1 68  ? -72.147  4.827   24.842  1.00 75.69  ? 93  ILE B C   1 
ATOM   2774 O O   . ILE B 1 68  ? -71.848  4.566   25.989  1.00 75.52  ? 93  ILE B O   1 
ATOM   2775 C CB  . ILE B 1 68  ? -74.385  3.935   24.617  1.00 76.60  ? 93  ILE B CB  1 
ATOM   2776 C CG1 . ILE B 1 68  ? -75.842  4.285   24.926  1.00 106.35 ? 93  ILE B CG1 1 
ATOM   2777 C CG2 . ILE B 1 68  ? -73.784  3.036   25.652  1.00 80.11  ? 93  ILE B CG2 1 
ATOM   2778 C CD1 . ILE B 1 68  ? -76.723  3.116   25.215  1.00 99.06  ? 93  ILE B CD1 1 
ATOM   2779 N N   . ILE B 1 69  ? -71.272  4.749   23.857  1.00 84.16  ? 94  ILE B N   1 
ATOM   2780 C CA  . ILE B 1 69  ? -69.958  4.191   24.126  1.00 79.73  ? 94  ILE B CA  1 
ATOM   2781 C C   . ILE B 1 69  ? -68.814  5.143   23.819  1.00 88.05  ? 94  ILE B C   1 
ATOM   2782 O O   . ILE B 1 69  ? -68.311  5.164   22.703  1.00 98.84  ? 94  ILE B O   1 
ATOM   2783 C CB  . ILE B 1 69  ? -69.771  2.853   23.400  1.00 57.35  ? 94  ILE B CB  1 
ATOM   2784 C CG1 . ILE B 1 69  ? -70.885  1.902   23.827  1.00 69.10  ? 94  ILE B CG1 1 
ATOM   2785 C CG2 . ILE B 1 69  ? -68.439  2.258   23.746  1.00 80.80  ? 94  ILE B CG2 1 
ATOM   2786 C CD1 . ILE B 1 69  ? -70.657  0.477   23.448  1.00 86.65  ? 94  ILE B CD1 1 
ATOM   2787 N N   . PRO B 1 70  ? -68.434  5.969   24.815  1.00 90.18  ? 95  PRO B N   1 
ATOM   2788 C CA  . PRO B 1 70  ? -67.249  6.830   24.757  1.00 91.93  ? 95  PRO B CA  1 
ATOM   2789 C C   . PRO B 1 70  ? -66.009  6.152   25.317  1.00 92.51  ? 95  PRO B C   1 
ATOM   2790 O O   . PRO B 1 70  ? -66.008  5.758   26.481  1.00 84.89  ? 95  PRO B O   1 
ATOM   2791 C CB  . PRO B 1 70  ? -67.625  8.020   25.660  1.00 69.57  ? 95  PRO B CB  1 
ATOM   2792 C CG  . PRO B 1 70  ? -69.091  7.883   25.930  1.00 79.02  ? 95  PRO B CG  1 
ATOM   2793 C CD  . PRO B 1 70  ? -69.346  6.403   25.882  1.00 105.38 ? 95  PRO B CD  1 
ATOM   2794 N N   . PRO B 1 71  ? -64.973  5.989   24.483  1.00 90.92  ? 96  PRO B N   1 
ATOM   2795 C CA  . PRO B 1 71  ? -65.088  6.090   23.041  1.00 80.16  ? 96  PRO B CA  1 
ATOM   2796 C C   . PRO B 1 71  ? -65.122  4.633   22.627  1.00 112.27 ? 96  PRO B C   1 
ATOM   2797 O O   . PRO B 1 71  ? -65.576  3.826   23.446  1.00 126.05 ? 96  PRO B O   1 
ATOM   2798 C CB  . PRO B 1 71  ? -63.763  6.750   22.634  1.00 78.01  ? 96  PRO B CB  1 
ATOM   2799 C CG  . PRO B 1 71  ? -62.914  6.811   23.887  1.00 81.45  ? 96  PRO B CG  1 
ATOM   2800 C CD  . PRO B 1 71  ? -63.563  5.868   24.861  1.00 105.09 ? 96  PRO B CD  1 
ATOM   2801 N N   . GLN B 1 72  ? -64.639  4.284   21.438  1.00 114.52 ? 97  GLN B N   1 
ATOM   2802 C CA  . GLN B 1 72  ? -64.676  2.897   20.983  1.00 113.05 ? 97  GLN B CA  1 
ATOM   2803 C C   . GLN B 1 72  ? -63.302  2.242   21.076  1.00 135.87 ? 97  GLN B C   1 
ATOM   2804 O O   . GLN B 1 72  ? -62.582  2.154   20.085  1.00 120.70 ? 97  GLN B O   1 
ATOM   2805 C CB  . GLN B 1 72  ? -65.219  2.828   19.561  1.00 81.61  ? 97  GLN B CB  1 
ATOM   2806 C CG  . GLN B 1 72  ? -66.556  3.538   19.399  1.00 99.37  ? 97  GLN B CG  1 
ATOM   2807 C CD  . GLN B 1 72  ? -66.501  5.013   19.779  1.00 96.08  ? 97  GLN B CD  1 
ATOM   2808 O OE1 . GLN B 1 72  ? -65.428  5.584   19.901  1.00 67.59  ? 97  GLN B OE1 1 
ATOM   2809 N NE2 . GLN B 1 72  ? -67.661  5.635   19.952  1.00 113.38 ? 97  GLN B NE2 1 
ATOM   2810 N N   . GLU B 1 73  ? -62.964  1.768   22.275  1.00 164.44 ? 98  GLU B N   1 
ATOM   2811 C CA  . GLU B 1 73  ? -61.647  1.211   22.585  1.00 141.98 ? 98  GLU B CA  1 
ATOM   2812 C C   . GLU B 1 73  ? -61.387  -0.164  21.955  1.00 148.79 ? 98  GLU B C   1 
ATOM   2813 O O   . GLU B 1 73  ? -62.293  -0.796  21.395  1.00 142.79 ? 98  GLU B O   1 
ATOM   2814 C CB  . GLU B 1 73  ? -61.448  1.145   24.108  1.00 123.64 ? 98  GLU B CB  1 
ATOM   2815 N N   . ASP B 1 74  ? -60.137  -0.616  22.075  1.00 159.70 ? 99  ASP B N   1 
ATOM   2816 C CA  . ASP B 1 74  ? -59.660  -1.878  21.492  1.00 158.35 ? 99  ASP B CA  1 
ATOM   2817 C C   . ASP B 1 74  ? -60.266  -3.135  22.133  1.00 154.13 ? 99  ASP B C   1 
ATOM   2818 O O   . ASP B 1 74  ? -61.316  -3.631  21.697  1.00 112.41 ? 99  ASP B O   1 
ATOM   2819 C CB  . ASP B 1 74  ? -58.123  -1.939  21.562  1.00 146.22 ? 99  ASP B CB  1 
ATOM   2820 C CG  . ASP B 1 74  ? -57.583  -1.788  22.990  1.00 150.93 ? 99  ASP B CG  1 
ATOM   2821 O OD1 . ASP B 1 74  ? -56.432  -2.207  23.233  1.00 154.42 ? 99  ASP B OD1 1 
ATOM   2822 O OD2 . ASP B 1 74  ? -58.298  -1.258  23.872  1.00 129.86 ? 99  ASP B OD2 1 
ATOM   2823 N N   . GLY B 1 75  ? -59.580  -3.649  23.153  1.00 156.70 ? 100 GLY B N   1 
ATOM   2824 C CA  . GLY B 1 75  ? -60.084  -4.742  23.961  1.00 122.48 ? 100 GLY B CA  1 
ATOM   2825 C C   . GLY B 1 75  ? -61.282  -4.319  24.789  1.00 128.71 ? 100 GLY B C   1 
ATOM   2826 O O   . GLY B 1 75  ? -62.425  -4.579  24.411  1.00 132.60 ? 100 GLY B O   1 
ATOM   2827 N N   . SER B 1 76  ? -61.021  -3.652  25.910  1.00 115.52 ? 101 SER B N   1 
ATOM   2828 C CA  . SER B 1 76  ? -62.075  -3.186  26.816  1.00 101.98 ? 101 SER B CA  1 
ATOM   2829 C C   . SER B 1 76  ? -63.033  -2.151  26.195  1.00 101.68 ? 101 SER B C   1 
ATOM   2830 O O   . SER B 1 76  ? -62.731  -1.566  25.153  1.00 120.22 ? 101 SER B O   1 
ATOM   2831 C CB  . SER B 1 76  ? -61.441  -2.613  28.084  1.00 109.41 ? 101 SER B CB  1 
ATOM   2832 O OG  . SER B 1 76  ? -60.337  -3.403  28.494  1.00 127.53 ? 101 SER B OG  1 
ATOM   2833 N N   . PHE B 1 77  ? -64.185  -1.939  26.840  1.00 95.01  ? 102 PHE B N   1 
ATOM   2834 C CA  . PHE B 1 77  ? -65.201  -0.987  26.365  1.00 87.26  ? 102 PHE B CA  1 
ATOM   2835 C C   . PHE B 1 77  ? -66.061  -0.451  27.496  1.00 90.90  ? 102 PHE B C   1 
ATOM   2836 O O   . PHE B 1 77  ? -66.220  -1.091  28.536  1.00 89.75  ? 102 PHE B O   1 
ATOM   2837 C CB  . PHE B 1 77  ? -66.130  -1.632  25.343  1.00 90.65  ? 102 PHE B CB  1 
ATOM   2838 C CG  . PHE B 1 77  ? -66.926  -2.777  25.892  1.00 89.44  ? 102 PHE B CG  1 
ATOM   2839 C CD1 . PHE B 1 77  ? -68.243  -2.612  26.264  1.00 87.23  ? 102 PHE B CD1 1 
ATOM   2840 C CD2 . PHE B 1 77  ? -66.350  -4.021  26.034  1.00 79.80  ? 102 PHE B CD2 1 
ATOM   2841 C CE1 . PHE B 1 77  ? -68.962  -3.670  26.766  1.00 82.65  ? 102 PHE B CE1 1 
ATOM   2842 C CE2 . PHE B 1 77  ? -67.064  -5.075  26.528  1.00 70.19  ? 102 PHE B CE2 1 
ATOM   2843 C CZ  . PHE B 1 77  ? -68.369  -4.903  26.898  1.00 74.06  ? 102 PHE B CZ  1 
ATOM   2844 N N   . PHE B 1 78  ? -66.658  0.710   27.268  1.00 80.24  ? 103 PHE B N   1 
ATOM   2845 C CA  . PHE B 1 78  ? -67.345  1.412   28.337  1.00 74.96  ? 103 PHE B CA  1 
ATOM   2846 C C   . PHE B 1 78  ? -68.753  1.855   27.974  1.00 85.80  ? 103 PHE B C   1 
ATOM   2847 O O   . PHE B 1 78  ? -68.960  2.651   27.064  1.00 85.92  ? 103 PHE B O   1 
ATOM   2848 C CB  . PHE B 1 78  ? -66.527  2.618   28.753  1.00 84.63  ? 103 PHE B CB  1 
ATOM   2849 C CG  . PHE B 1 78  ? -67.286  3.602   29.577  1.00 83.76  ? 103 PHE B CG  1 
ATOM   2850 C CD1 . PHE B 1 78  ? -67.385  3.446   30.944  1.00 79.70  ? 103 PHE B CD1 1 
ATOM   2851 C CD2 . PHE B 1 78  ? -67.888  4.692   28.983  1.00 76.13  ? 103 PHE B CD2 1 
ATOM   2852 C CE1 . PHE B 1 78  ? -68.075  4.354   31.695  1.00 90.56  ? 103 PHE B CE1 1 
ATOM   2853 C CE2 . PHE B 1 78  ? -68.582  5.610   29.734  1.00 70.82  ? 103 PHE B CE2 1 
ATOM   2854 C CZ  . PHE B 1 78  ? -68.678  5.443   31.087  1.00 87.83  ? 103 PHE B CZ  1 
ATOM   2855 N N   . VAL B 1 79  ? -69.708  1.337   28.733  1.00 89.07  ? 104 VAL B N   1 
ATOM   2856 C CA  . VAL B 1 79  ? -71.121  1.553   28.503  1.00 78.90  ? 104 VAL B CA  1 
ATOM   2857 C C   . VAL B 1 79  ? -71.671  2.620   29.433  1.00 80.76  ? 104 VAL B C   1 
ATOM   2858 O O   . VAL B 1 79  ? -71.680  2.459   30.645  1.00 80.79  ? 104 VAL B O   1 
ATOM   2859 C CB  . VAL B 1 79  ? -71.889  0.242   28.736  1.00 80.93  ? 104 VAL B CB  1 
ATOM   2860 C CG1 . VAL B 1 79  ? -73.359  0.423   28.441  1.00 85.75  ? 104 VAL B CG1 1 
ATOM   2861 C CG2 . VAL B 1 79  ? -71.293  -0.867  27.893  1.00 70.34  ? 104 VAL B CG2 1 
ATOM   2862 N N   . LEU B 1 80  ? -72.122  3.718   28.850  1.00 76.11  ? 105 LEU B N   1 
ATOM   2863 C CA  . LEU B 1 80  ? -72.721  4.805   29.604  1.00 76.15  ? 105 LEU B CA  1 
ATOM   2864 C C   . LEU B 1 80  ? -74.043  4.342   30.204  1.00 84.17  ? 105 LEU B C   1 
ATOM   2865 O O   . LEU B 1 80  ? -74.889  3.811   29.479  1.00 81.18  ? 105 LEU B O   1 
ATOM   2866 C CB  . LEU B 1 80  ? -72.940  5.995   28.670  1.00 75.62  ? 105 LEU B CB  1 
ATOM   2867 C CG  . LEU B 1 80  ? -73.383  7.292   29.328  1.00 84.63  ? 105 LEU B CG  1 
ATOM   2868 C CD1 . LEU B 1 80  ? -72.426  7.641   30.450  1.00 93.09  ? 105 LEU B CD1 1 
ATOM   2869 C CD2 . LEU B 1 80  ? -73.412  8.381   28.292  1.00 82.87  ? 105 LEU B CD2 1 
ATOM   2870 N N   . THR B 1 81  ? -74.224  4.551   31.512  1.00 89.88  ? 106 THR B N   1 
ATOM   2871 C CA  . THR B 1 81  ? -75.423  4.085   32.204  1.00 72.26  ? 106 THR B CA  1 
ATOM   2872 C C   . THR B 1 81  ? -76.145  5.199   32.949  1.00 78.24  ? 106 THR B C   1 
ATOM   2873 O O   . THR B 1 81  ? -77.355  5.156   33.093  1.00 89.02  ? 106 THR B O   1 
ATOM   2874 C CB  . THR B 1 81  ? -75.117  2.954   33.180  1.00 62.79  ? 106 THR B CB  1 
ATOM   2875 O OG1 . THR B 1 81  ? -73.949  3.282   33.915  1.00 66.98  ? 106 THR B OG1 1 
ATOM   2876 C CG2 . THR B 1 81  ? -74.859  1.662   32.450  1.00 69.31  ? 106 THR B CG2 1 
ATOM   2877 N N   . ASN B 1 82  ? -75.404  6.210   33.383  1.00 80.76  ? 107 ASN B N   1 
ATOM   2878 C CA  . ASN B 1 82  ? -75.955  7.335   34.137  1.00 85.28  ? 107 ASN B CA  1 
ATOM   2879 C C   . ASN B 1 82  ? -75.153  8.612   33.836  1.00 87.26  ? 107 ASN B C   1 
ATOM   2880 O O   . ASN B 1 82  ? -74.048  8.532   33.305  1.00 84.48  ? 107 ASN B O   1 
ATOM   2881 C CB  . ASN B 1 82  ? -75.915  7.017   35.632  1.00 85.98  ? 107 ASN B CB  1 
ATOM   2882 C CG  . ASN B 1 82  ? -77.125  7.536   36.377  1.00 93.05  ? 107 ASN B CG  1 
ATOM   2883 O OD1 . ASN B 1 82  ? -78.065  8.041   35.778  1.00 113.08 ? 107 ASN B OD1 1 
ATOM   2884 N ND2 . ASN B 1 82  ? -77.106  7.408   37.692  1.00 86.14  ? 107 ASN B ND2 1 
ATOM   2885 N N   . MET B 1 83  ? -75.694  9.782   34.178  1.00 90.35  ? 108 MET B N   1 
ATOM   2886 C CA  . MET B 1 83  ? -75.076  11.046  33.778  1.00 85.73  ? 108 MET B CA  1 
ATOM   2887 C C   . MET B 1 83  ? -75.628  12.308  34.446  1.00 91.05  ? 108 MET B C   1 
ATOM   2888 O O   . MET B 1 83  ? -76.753  12.343  34.930  1.00 92.94  ? 108 MET B O   1 
ATOM   2889 C CB  . MET B 1 83  ? -75.263  11.204  32.282  1.00 93.67  ? 108 MET B CB  1 
ATOM   2890 C CG  . MET B 1 83  ? -76.689  10.928  31.868  1.00 91.74  ? 108 MET B CG  1 
ATOM   2891 S SD  . MET B 1 83  ? -76.996  11.277  30.152  1.00 114.20 ? 108 MET B SD  1 
ATOM   2892 C CE  . MET B 1 83  ? -75.889  10.110  29.376  1.00 84.51  ? 108 MET B CE  1 
ATOM   2893 N N   . ILE B 1 84  ? -74.816  13.356  34.435  1.00 88.77  ? 109 ILE B N   1 
ATOM   2894 C CA  . ILE B 1 84  ? -75.221  14.676  34.901  1.00 90.29  ? 109 ILE B CA  1 
ATOM   2895 C C   . ILE B 1 84  ? -74.737  15.689  33.875  1.00 96.27  ? 109 ILE B C   1 
ATOM   2896 O O   . ILE B 1 84  ? -73.548  15.986  33.778  1.00 88.46  ? 109 ILE B O   1 
ATOM   2897 C CB  . ILE B 1 84  ? -74.591  15.022  36.251  1.00 91.31  ? 109 ILE B CB  1 
ATOM   2898 C CG1 . ILE B 1 84  ? -74.867  13.920  37.269  1.00 88.99  ? 109 ILE B CG1 1 
ATOM   2899 C CG2 . ILE B 1 84  ? -75.116  16.340  36.762  1.00 93.53  ? 109 ILE B CG2 1 
ATOM   2900 C CD1 . ILE B 1 84  ? -74.212  14.166  38.605  1.00 89.90  ? 109 ILE B CD1 1 
ATOM   2901 N N   . ILE B 1 85  ? -75.680  16.218  33.111  1.00 92.86  ? 110 ILE B N   1 
ATOM   2902 C CA  . ILE B 1 85  ? -75.374  17.011  31.928  1.00 96.80  ? 110 ILE B CA  1 
ATOM   2903 C C   . ILE B 1 85  ? -75.403  18.511  32.210  1.00 96.25  ? 110 ILE B C   1 
ATOM   2904 O O   . ILE B 1 85  ? -76.442  19.061  32.573  1.00 115.40 ? 110 ILE B O   1 
ATOM   2905 C CB  . ILE B 1 85  ? -76.357  16.666  30.779  1.00 98.20  ? 110 ILE B CB  1 
ATOM   2906 C CG1 . ILE B 1 85  ? -76.282  15.169  30.457  1.00 89.70  ? 110 ILE B CG1 1 
ATOM   2907 C CG2 . ILE B 1 85  ? -76.073  17.517  29.552  1.00 85.98  ? 110 ILE B CG2 1 
ATOM   2908 C CD1 . ILE B 1 85  ? -77.265  14.725  29.411  1.00 104.70 ? 110 ILE B CD1 1 
ATOM   2909 N N   . THR B 1 86  ? -74.252  19.159  32.048  1.00 99.14  ? 111 THR B N   1 
ATOM   2910 C CA  . THR B 1 86  ? -74.152  20.612  32.147  1.00 97.56  ? 111 THR B CA  1 
ATOM   2911 C C   . THR B 1 86  ? -74.066  21.226  30.746  1.00 96.25  ? 111 THR B C   1 
ATOM   2912 O O   . THR B 1 86  ? -73.176  20.889  29.970  1.00 109.32 ? 111 THR B O   1 
ATOM   2913 C CB  . THR B 1 86  ? -72.900  21.025  32.953  1.00 104.81 ? 111 THR B CB  1 
ATOM   2914 O OG1 . THR B 1 86  ? -72.795  20.210  34.128  1.00 103.11 ? 111 THR B OG1 1 
ATOM   2915 C CG2 . THR B 1 86  ? -72.987  22.491  33.345  1.00 101.01 ? 111 THR B CG2 1 
ATOM   2916 N N   . THR B 1 87  ? -74.989  22.132  30.418  1.00 102.70 ? 112 THR B N   1 
ATOM   2917 C CA  . THR B 1 87  ? -75.093  22.658  29.049  1.00 115.87 ? 112 THR B CA  1 
ATOM   2918 C C   . THR B 1 87  ? -74.719  24.126  28.887  1.00 111.47 ? 112 THR B C   1 
ATOM   2919 O O   . THR B 1 87  ? -74.526  24.841  29.868  1.00 126.57 ? 112 THR B O   1 
ATOM   2920 C CB  . THR B 1 87  ? -76.500  22.433  28.473  1.00 103.60 ? 112 THR B CB  1 
ATOM   2921 O OG1 . THR B 1 87  ? -77.478  22.934  29.391  1.00 111.25 ? 112 THR B OG1 1 
ATOM   2922 C CG2 . THR B 1 87  ? -76.748  20.962  28.243  1.00 87.03  ? 112 THR B CG2 1 
ATOM   2923 N N   . ASN B 1 88  ? -74.621  24.570  27.637  1.00 92.13  ? 113 ASN B N   1 
ATOM   2924 C CA  . ASN B 1 88  ? -74.391  25.989  27.359  1.00 113.08 ? 113 ASN B CA  1 
ATOM   2925 C C   . ASN B 1 88  ? -73.176  26.533  28.100  1.00 116.95 ? 113 ASN B C   1 
ATOM   2926 O O   . ASN B 1 88  ? -73.173  27.679  28.550  1.00 111.11 ? 113 ASN B O   1 
ATOM   2927 C CB  . ASN B 1 88  ? -75.630  26.830  27.710  1.00 124.25 ? 113 ASN B CB  1 
ATOM   2928 C CG  . ASN B 1 88  ? -75.594  28.229  27.098  1.00 148.05 ? 113 ASN B CG  1 
ATOM   2929 O OD1 . ASN B 1 88  ? -75.275  28.401  25.916  1.00 137.29 ? 113 ASN B OD1 1 
ATOM   2930 N ND2 . ASN B 1 88  ? -75.953  29.237  27.904  1.00 160.17 ? 113 ASN B ND2 1 
ATOM   2931 N N   . GLN B 1 89  ? -72.152  25.706  28.254  1.00 108.68 ? 114 GLN B N   1 
ATOM   2932 C CA  . GLN B 1 89  ? -70.914  26.180  28.850  1.00 104.70 ? 114 GLN B CA  1 
ATOM   2933 C C   . GLN B 1 89  ? -70.128  27.040  27.862  1.00 117.78 ? 114 GLN B C   1 
ATOM   2934 O O   . GLN B 1 89  ? -70.069  26.749  26.670  1.00 106.55 ? 114 GLN B O   1 
ATOM   2935 C CB  . GLN B 1 89  ? -70.057  25.015  29.355  1.00 97.46  ? 114 GLN B CB  1 
ATOM   2936 C CG  . GLN B 1 89  ? -70.494  24.455  30.693  1.00 95.77  ? 114 GLN B CG  1 
ATOM   2937 C CD  . GLN B 1 89  ? -69.437  23.571  31.337  1.00 100.67 ? 114 GLN B CD  1 
ATOM   2938 O OE1 . GLN B 1 89  ? -68.553  23.040  30.665  1.00 88.93  ? 114 GLN B OE1 1 
ATOM   2939 N NE2 . GLN B 1 89  ? -69.526  23.411  32.653  1.00 99.22  ? 114 GLN B NE2 1 
ATOM   2940 N N   . THR B 1 90  ? -69.522  28.100  28.379  1.00 126.99 ? 115 THR B N   1 
ATOM   2941 C CA  . THR B 1 90  ? -68.737  29.031  27.579  1.00 111.28 ? 115 THR B CA  1 
ATOM   2942 C C   . THR B 1 90  ? -67.605  29.573  28.436  1.00 118.22 ? 115 THR B C   1 
ATOM   2943 O O   . THR B 1 90  ? -67.726  29.631  29.665  1.00 116.46 ? 115 THR B O   1 
ATOM   2944 C CB  . THR B 1 90  ? -69.580  30.234  27.121  1.00 111.09 ? 115 THR B CB  1 
ATOM   2945 O OG1 . THR B 1 90  ? -70.071  30.942  28.268  1.00 108.61 ? 115 THR B OG1 1 
ATOM   2946 C CG2 . THR B 1 90  ? -70.753  29.777  26.281  1.00 113.92 ? 115 THR B CG2 1 
ATOM   2947 N N   . GLN B 1 91  ? -66.508  29.965  27.794  1.00 117.39 ? 116 GLN B N   1 
ATOM   2948 C CA  . GLN B 1 91  ? -65.401  30.582  28.511  1.00 115.72 ? 116 GLN B CA  1 
ATOM   2949 C C   . GLN B 1 91  ? -65.854  31.914  29.100  1.00 125.59 ? 116 GLN B C   1 
ATOM   2950 O O   . GLN B 1 91  ? -66.207  32.838  28.370  1.00 124.95 ? 116 GLN B O   1 
ATOM   2951 C CB  . GLN B 1 91  ? -64.210  30.787  27.582  1.00 97.62  ? 116 GLN B CB  1 
ATOM   2952 C CG  . GLN B 1 91  ? -63.509  29.508  27.170  1.00 96.91  ? 116 GLN B CG  1 
ATOM   2953 C CD  . GLN B 1 91  ? -62.667  28.912  28.282  1.00 112.44 ? 116 GLN B CD  1 
ATOM   2954 O OE1 . GLN B 1 91  ? -62.458  29.536  29.324  1.00 116.76 ? 116 GLN B OE1 1 
ATOM   2955 N NE2 . GLN B 1 91  ? -62.171  27.697  28.062  1.00 109.99 ? 116 GLN B NE2 1 
ATOM   2956 N N   . SER B 1 92  ? -65.837  32.004  30.425  1.00 118.25 ? 117 SER B N   1 
ATOM   2957 C CA  . SER B 1 92  ? -66.364  33.171  31.113  1.00 109.49 ? 117 SER B CA  1 
ATOM   2958 C C   . SER B 1 92  ? -65.957  33.198  32.581  1.00 113.67 ? 117 SER B C   1 
ATOM   2959 O O   . SER B 1 92  ? -65.388  32.234  33.103  1.00 111.20 ? 117 SER B O   1 
ATOM   2960 C CB  . SER B 1 92  ? -67.887  33.221  30.977  1.00 102.40 ? 117 SER B CB  1 
ATOM   2961 O OG  . SER B 1 92  ? -68.412  34.379  31.598  1.00 133.91 ? 117 SER B OG  1 
ATOM   2962 N N   . LYS B 1 93  ? -66.207  34.347  33.204  1.00 116.45 ? 118 LYS B N   1 
ATOM   2963 C CA  . LYS B 1 93  ? -66.016  34.542  34.632  1.00 116.35 ? 118 LYS B CA  1 
ATOM   2964 C C   . LYS B 1 93  ? -67.341  34.255  35.343  1.00 119.50 ? 118 LYS B C   1 
ATOM   2965 O O   . LYS B 1 93  ? -68.419  34.484  34.784  1.00 119.37 ? 118 LYS B O   1 
ATOM   2966 C CB  . LYS B 1 93  ? -65.544  35.980  34.913  1.00 116.53 ? 118 LYS B CB  1 
ATOM   2967 C CG  . LYS B 1 93  ? -64.153  36.353  34.341  1.00 113.07 ? 118 LYS B CG  1 
ATOM   2968 C CD  . LYS B 1 93  ? -63.631  37.682  34.926  1.00 133.04 ? 118 LYS B CD  1 
ATOM   2969 C CE  . LYS B 1 93  ? -62.148  37.959  34.601  1.00 129.52 ? 118 LYS B CE  1 
ATOM   2970 N NZ  . LYS B 1 93  ? -61.917  38.970  33.516  1.00 85.12  ? 118 LYS B NZ  1 
ATOM   2971 N N   . CYS B 1 94  ? -67.256  33.742  36.567  1.00 109.50 ? 119 CYS B N   1 
ATOM   2972 C CA  . CYS B 1 94  ? -68.448  33.435  37.354  1.00 110.31 ? 119 CYS B CA  1 
ATOM   2973 C C   . CYS B 1 94  ? -68.093  32.986  38.769  1.00 120.70 ? 119 CYS B C   1 
ATOM   2974 O O   . CYS B 1 94  ? -66.926  32.768  39.092  1.00 119.75 ? 119 CYS B O   1 
ATOM   2975 C CB  . CYS B 1 94  ? -69.266  32.345  36.668  1.00 120.58 ? 119 CYS B CB  1 
ATOM   2976 S SG  . CYS B 1 94  ? -68.374  30.773  36.499  1.00 148.98 ? 119 CYS B SG  1 
ATOM   2977 N N   . ALA B 1 95  ? -69.110  32.845  39.612  1.00 119.87 ? 120 ALA B N   1 
ATOM   2978 C CA  . ALA B 1 95  ? -68.895  32.493  41.013  1.00 123.97 ? 120 ALA B CA  1 
ATOM   2979 C C   . ALA B 1 95  ? -68.517  31.027  41.199  1.00 126.19 ? 120 ALA B C   1 
ATOM   2980 O O   . ALA B 1 95  ? -69.084  30.143  40.554  1.00 135.17 ? 120 ALA B O   1 
ATOM   2981 C CB  . ALA B 1 95  ? -70.133  32.829  41.837  1.00 110.05 ? 120 ALA B CB  1 
ATOM   2982 N N   . GLU B 1 96  ? -67.552  30.770  42.075  1.00 112.02 ? 121 GLU B N   1 
ATOM   2983 C CA  . GLU B 1 96  ? -67.240  29.400  42.451  1.00 112.65 ? 121 GLU B CA  1 
ATOM   2984 C C   . GLU B 1 96  ? -68.424  28.787  43.182  1.00 132.85 ? 121 GLU B C   1 
ATOM   2985 O O   . GLU B 1 96  ? -69.439  29.452  43.406  1.00 134.09 ? 121 GLU B O   1 
ATOM   2986 C CB  . GLU B 1 96  ? -66.010  29.347  43.347  1.00 109.25 ? 121 GLU B CB  1 
ATOM   2987 C CG  . GLU B 1 96  ? -64.698  29.276  42.600  1.00 119.71 ? 121 GLU B CG  1 
ATOM   2988 C CD  . GLU B 1 96  ? -63.530  28.972  43.515  1.00 139.13 ? 121 GLU B CD  1 
ATOM   2989 O OE1 . GLU B 1 96  ? -62.516  28.400  43.051  1.00 120.60 ? 121 GLU B OE1 1 
ATOM   2990 O OE2 . GLU B 1 96  ? -63.633  29.297  44.713  1.00 159.01 ? 121 GLU B OE2 1 
ATOM   2991 N N   . ASN B 1 97  ? -68.304  27.514  43.539  1.00 134.72 ? 122 ASN B N   1 
ATOM   2992 C CA  . ASN B 1 97  ? -69.327  26.876  44.354  1.00 144.03 ? 122 ASN B CA  1 
ATOM   2993 C C   . ASN B 1 97  ? -69.074  27.166  45.829  1.00 152.34 ? 122 ASN B C   1 
ATOM   2994 O O   . ASN B 1 97  ? -67.922  27.241  46.253  1.00 154.79 ? 122 ASN B O   1 
ATOM   2995 C CB  . ASN B 1 97  ? -69.364  25.373  44.096  1.00 145.34 ? 122 ASN B CB  1 
ATOM   2996 C CG  . ASN B 1 97  ? -69.959  25.030  42.742  1.00 152.45 ? 122 ASN B CG  1 
ATOM   2997 O OD1 . ASN B 1 97  ? -70.901  25.677  42.277  1.00 136.60 ? 122 ASN B OD1 1 
ATOM   2998 N ND2 . ASN B 1 97  ? -69.413  24.002  42.103  1.00 152.67 ? 122 ASN B ND2 1 
ATOM   2999 N N   . PRO B 1 98  ? -70.149  27.347  46.613  1.00 154.14 ? 123 PRO B N   1 
ATOM   3000 C CA  . PRO B 1 98  ? -70.012  27.622  48.048  1.00 137.51 ? 123 PRO B CA  1 
ATOM   3001 C C   . PRO B 1 98  ? -69.181  26.561  48.774  1.00 130.75 ? 123 PRO B C   1 
ATOM   3002 O O   . PRO B 1 98  ? -69.495  25.377  48.716  1.00 126.69 ? 123 PRO B O   1 
ATOM   3003 C CB  . PRO B 1 98  ? -71.459  27.600  48.542  1.00 145.11 ? 123 PRO B CB  1 
ATOM   3004 C CG  . PRO B 1 98  ? -72.266  27.990  47.347  1.00 139.80 ? 123 PRO B CG  1 
ATOM   3005 C CD  . PRO B 1 98  ? -71.554  27.384  46.171  1.00 145.17 ? 123 PRO B CD  1 
ATOM   3006 N N   . THR B 1 99  ? -68.135  27.003  49.461  1.00 131.13 ? 124 THR B N   1 
ATOM   3007 C CA  . THR B 1 99  ? -67.203  26.113  50.145  1.00 135.38 ? 124 THR B CA  1 
ATOM   3008 C C   . THR B 1 99  ? -66.343  26.922  51.106  1.00 148.26 ? 124 THR B C   1 
ATOM   3009 O O   . THR B 1 99  ? -65.925  28.028  50.781  1.00 152.93 ? 124 THR B O   1 
ATOM   3010 C CB  . THR B 1 99  ? -66.272  25.408  49.146  1.00 131.97 ? 124 THR B CB  1 
ATOM   3011 O OG1 . THR B 1 99  ? -66.984  24.355  48.488  1.00 144.14 ? 124 THR B OG1 1 
ATOM   3012 C CG2 . THR B 1 99  ? -65.053  24.827  49.858  1.00 126.91 ? 124 THR B CG2 1 
ATOM   3013 N N   . PRO B 1 100 ? -66.071  26.370  52.296  1.00 152.70 ? 125 PRO B N   1 
ATOM   3014 C CA  . PRO B 1 100 ? -65.227  27.039  53.294  1.00 148.90 ? 125 PRO B CA  1 
ATOM   3015 C C   . PRO B 1 100 ? -63.960  27.637  52.691  1.00 154.59 ? 125 PRO B C   1 
ATOM   3016 O O   . PRO B 1 100 ? -63.548  28.723  53.091  1.00 145.84 ? 125 PRO B O   1 
ATOM   3017 C CB  . PRO B 1 100 ? -64.855  25.901  54.241  1.00 145.72 ? 125 PRO B CB  1 
ATOM   3018 C CG  . PRO B 1 100 ? -66.023  24.963  54.159  1.00 152.89 ? 125 PRO B CG  1 
ATOM   3019 C CD  . PRO B 1 100 ? -66.571  25.066  52.768  1.00 140.86 ? 125 PRO B CD  1 
ATOM   3020 N N   . ALA B 1 101 ? -63.358  26.930  51.739  1.00 164.17 ? 126 ALA B N   1 
ATOM   3021 C CA  . ALA B 1 101 ? -62.135  27.393  51.086  1.00 156.50 ? 126 ALA B CA  1 
ATOM   3022 C C   . ALA B 1 101 ? -62.400  28.450  50.013  1.00 143.23 ? 126 ALA B C   1 
ATOM   3023 O O   . ALA B 1 101 ? -61.557  29.308  49.754  1.00 117.36 ? 126 ALA B O   1 
ATOM   3024 C CB  . ALA B 1 101 ? -61.371  26.216  50.496  1.00 132.61 ? 126 ALA B CB  1 
ATOM   3025 N N   . SER B 1 102 ? -63.581  28.382  49.403  1.00 148.89 ? 127 SER B N   1 
ATOM   3026 C CA  . SER B 1 102 ? -63.960  29.271  48.303  1.00 148.72 ? 127 SER B CA  1 
ATOM   3027 C C   . SER B 1 102 ? -64.685  30.545  48.749  1.00 156.26 ? 127 SER B C   1 
ATOM   3028 O O   . SER B 1 102 ? -64.622  31.568  48.068  1.00 146.09 ? 127 SER B O   1 
ATOM   3029 C CB  . SER B 1 102 ? -64.854  28.522  47.316  1.00 152.64 ? 127 SER B CB  1 
ATOM   3030 O OG  . SER B 1 102 ? -66.128  28.271  47.890  1.00 163.01 ? 127 SER B OG  1 
ATOM   3031 N N   . THR B 1 103 ? -65.385  30.470  49.879  1.00 161.05 ? 128 THR B N   1 
ATOM   3032 C CA  . THR B 1 103 ? -66.168  31.591  50.383  1.00 144.53 ? 128 THR B CA  1 
ATOM   3033 C C   . THR B 1 103 ? -65.286  32.791  50.668  1.00 138.39 ? 128 THR B C   1 
ATOM   3034 O O   . THR B 1 103 ? -64.143  32.649  51.092  1.00 125.15 ? 128 THR B O   1 
ATOM   3035 C CB  . THR B 1 103 ? -66.903  31.231  51.683  1.00 149.42 ? 128 THR B CB  1 
ATOM   3036 O OG1 . THR B 1 103 ? -67.676  30.039  51.490  1.00 149.99 ? 128 THR B OG1 1 
ATOM   3037 C CG2 . THR B 1 103 ? -67.822  32.370  52.105  1.00 147.18 ? 128 THR B CG2 1 
ATOM   3038 N N   . CYS B 1 104 ? -65.838  33.977  50.458  1.00 139.52 ? 129 CYS B N   1 
ATOM   3039 C CA  . CYS B 1 104 ? -65.088  35.208  50.643  1.00 144.20 ? 129 CYS B CA  1 
ATOM   3040 C C   . CYS B 1 104 ? -65.967  36.309  51.229  1.00 167.61 ? 129 CYS B C   1 
ATOM   3041 O O   . CYS B 1 104 ? -67.180  36.357  50.986  1.00 162.99 ? 129 CYS B O   1 
ATOM   3042 C CB  . CYS B 1 104 ? -64.547  35.689  49.302  1.00 145.35 ? 129 CYS B CB  1 
ATOM   3043 S SG  . CYS B 1 104 ? -65.826  36.417  48.245  1.00 163.75 ? 129 CYS B SG  1 
ATOM   3044 N N   . THR B 1 105 ? -65.340  37.192  52.000  1.00 170.50 ? 130 THR B N   1 
ATOM   3045 C CA  . THR B 1 105 ? -66.014  38.349  52.574  1.00 160.55 ? 130 THR B CA  1 
ATOM   3046 C C   . THR B 1 105 ? -65.902  39.568  51.660  1.00 156.87 ? 130 THR B C   1 
ATOM   3047 O O   . THR B 1 105 ? -66.780  40.437  51.662  1.00 129.72 ? 130 THR B O   1 
ATOM   3048 C CB  . THR B 1 105 ? -65.412  38.709  53.939  1.00 154.54 ? 130 THR B CB  1 
ATOM   3049 O OG1 . THR B 1 105 ? -64.022  39.023  53.776  1.00 159.54 ? 130 THR B OG1 1 
ATOM   3050 C CG2 . THR B 1 105 ? -65.555  37.544  54.909  1.00 127.18 ? 130 THR B CG2 1 
ATOM   3051 N N   . SER B 1 106 ? -64.818  39.624  50.884  1.00 170.21 ? 131 SER B N   1 
ATOM   3052 C CA  . SER B 1 106 ? -64.552  40.764  50.008  1.00 176.44 ? 131 SER B CA  1 
ATOM   3053 C C   . SER B 1 106 ? -63.381  40.524  49.056  1.00 173.42 ? 131 SER B C   1 
ATOM   3054 O O   . SER B 1 106 ? -62.778  39.448  49.040  1.00 160.82 ? 131 SER B O   1 
ATOM   3055 C CB  . SER B 1 106 ? -64.259  42.009  50.843  1.00 181.81 ? 131 SER B CB  1 
ATOM   3056 O OG  . SER B 1 106 ? -63.049  41.842  51.564  1.00 183.60 ? 131 SER B OG  1 
ATOM   3057 N N   . HIS B 1 107 ? -63.057  41.558  48.284  1.00 176.54 ? 132 HIS B N   1 
ATOM   3058 C CA  . HIS B 1 107 ? -61.988  41.509  47.291  1.00 172.81 ? 132 HIS B CA  1 
ATOM   3059 C C   . HIS B 1 107 ? -60.658  41.031  47.874  1.00 155.17 ? 132 HIS B C   1 
ATOM   3060 O O   . HIS B 1 107 ? -59.782  40.567  47.148  1.00 152.05 ? 132 HIS B O   1 
ATOM   3061 C CB  . HIS B 1 107 ? -61.822  42.891  46.648  1.00 164.16 ? 132 HIS B CB  1 
ATOM   3062 C CG  . HIS B 1 107 ? -63.098  43.458  46.097  1.00 189.24 ? 132 HIS B CG  1 
ATOM   3063 N ND1 . HIS B 1 107 ? -64.069  44.024  46.894  1.00 156.74 ? 132 HIS B ND1 1 
ATOM   3064 C CD2 . HIS B 1 107 ? -63.562  43.537  44.824  1.00 189.58 ? 132 HIS B CD2 1 
ATOM   3065 C CE1 . HIS B 1 107 ? -65.078  44.430  46.139  1.00 144.09 ? 132 HIS B CE1 1 
ATOM   3066 N NE2 . HIS B 1 107 ? -64.794  44.146  44.882  1.00 178.01 ? 132 HIS B NE2 1 
ATOM   3067 N N   . ARG B 1 108 ? -60.515  41.138  49.188  1.00 159.90 ? 133 ARG B N   1 
ATOM   3068 C CA  . ARG B 1 108 ? -59.258  40.800  49.847  1.00 157.94 ? 133 ARG B CA  1 
ATOM   3069 C C   . ARG B 1 108 ? -58.992  39.289  49.898  1.00 150.36 ? 133 ARG B C   1 
ATOM   3070 O O   . ARG B 1 108 ? -57.843  38.852  49.806  1.00 139.57 ? 133 ARG B O   1 
ATOM   3071 C CB  . ARG B 1 108 ? -59.215  41.412  51.253  1.00 152.89 ? 133 ARG B CB  1 
ATOM   3072 N N   . ASP B 1 109 ? -60.051  38.497  50.040  1.00 158.10 ? 134 ASP B N   1 
ATOM   3073 C CA  . ASP B 1 109 ? -59.910  37.046  50.186  1.00 166.07 ? 134 ASP B CA  1 
ATOM   3074 C C   . ASP B 1 109 ? -59.545  36.365  48.865  1.00 158.84 ? 134 ASP B C   1 
ATOM   3075 O O   . ASP B 1 109 ? -58.801  35.384  48.843  1.00 141.93 ? 134 ASP B O   1 
ATOM   3076 C CB  . ASP B 1 109 ? -61.192  36.424  50.756  1.00 167.86 ? 134 ASP B CB  1 
ATOM   3077 C CG  . ASP B 1 109 ? -61.601  37.030  52.087  1.00 157.75 ? 134 ASP B CG  1 
ATOM   3078 O OD1 . ASP B 1 109 ? -61.354  38.234  52.305  1.00 154.02 ? 134 ASP B OD1 1 
ATOM   3079 O OD2 . ASP B 1 109 ? -62.188  36.298  52.911  1.00 156.79 ? 134 ASP B OD2 1 
ATOM   3080 N N   . CYS B 1 110 ? -60.081  36.887  47.767  1.00 154.22 ? 135 CYS B N   1 
ATOM   3081 C CA  . CYS B 1 110 ? -59.822  36.330  46.442  1.00 143.05 ? 135 CYS B CA  1 
ATOM   3082 C C   . CYS B 1 110 ? -58.447  36.739  45.904  1.00 150.93 ? 135 CYS B C   1 
ATOM   3083 O O   . CYS B 1 110 ? -58.212  37.919  45.614  1.00 152.80 ? 135 CYS B O   1 
ATOM   3084 C CB  . CYS B 1 110 ? -60.906  36.778  45.454  1.00 153.02 ? 135 CYS B CB  1 
ATOM   3085 S SG  . CYS B 1 110 ? -62.560  36.104  45.748  1.00 171.78 ? 135 CYS B SG  1 
ATOM   3086 N N   . LYS B 1 111 ? -57.552  35.762  45.758  1.00 147.55 ? 136 LYS B N   1 
ATOM   3087 C CA  . LYS B 1 111 ? -56.255  35.985  45.110  1.00 149.18 ? 136 LYS B CA  1 
ATOM   3088 C C   . LYS B 1 111 ? -56.252  35.519  43.647  1.00 153.24 ? 136 LYS B C   1 
ATOM   3089 O O   . LYS B 1 111 ? -56.634  34.384  43.354  1.00 169.38 ? 136 LYS B O   1 
ATOM   3090 C CB  . LYS B 1 111 ? -55.145  35.289  45.892  1.00 115.67 ? 136 LYS B CB  1 
ATOM   3091 N N   . ARG B 1 112 ? -55.809  36.383  42.733  1.00 141.76 ? 137 ARG B N   1 
ATOM   3092 C CA  . ARG B 1 112 ? -55.783  36.039  41.308  1.00 154.93 ? 137 ARG B CA  1 
ATOM   3093 C C   . ARG B 1 112 ? -54.789  34.910  40.980  1.00 164.47 ? 137 ARG B C   1 
ATOM   3094 O O   . ARG B 1 112 ? -53.589  35.039  41.235  1.00 129.50 ? 137 ARG B O   1 
ATOM   3095 C CB  . ARG B 1 112 ? -55.511  37.283  40.448  1.00 93.14  ? 137 ARG B CB  1 
ATOM   3096 N N   . GLY B 1 113 ? -55.307  33.816  40.410  1.00 145.80 ? 138 GLY B N   1 
ATOM   3097 C CA  . GLY B 1 113 ? -54.515  32.645  40.051  1.00 104.23 ? 138 GLY B CA  1 
ATOM   3098 C C   . GLY B 1 113 ? -54.511  31.499  41.059  1.00 132.09 ? 138 GLY B C   1 
ATOM   3099 O O   . GLY B 1 113 ? -54.712  30.338  40.696  1.00 119.75 ? 138 GLY B O   1 
ATOM   3100 N N   . PHE B 1 114 ? -54.278  31.820  42.329  1.00 156.08 ? 139 PHE B N   1 
ATOM   3101 C CA  . PHE B 1 114 ? -54.040  30.802  43.362  1.00 165.68 ? 139 PHE B CA  1 
ATOM   3102 C C   . PHE B 1 114 ? -55.311  30.104  43.850  1.00 147.15 ? 139 PHE B C   1 
ATOM   3103 O O   . PHE B 1 114 ? -55.366  28.870  43.939  1.00 136.31 ? 139 PHE B O   1 
ATOM   3104 C CB  . PHE B 1 114 ? -53.285  31.417  44.548  1.00 163.65 ? 139 PHE B CB  1 
ATOM   3105 N N   . ASN B 1 115 ? -56.318  30.905  44.188  1.00 160.29 ? 140 ASN B N   1 
ATOM   3106 C CA  . ASN B 1 115 ? -57.621  30.383  44.581  1.00 173.70 ? 140 ASN B CA  1 
ATOM   3107 C C   . ASN B 1 115 ? -58.273  29.694  43.383  1.00 200.46 ? 140 ASN B C   1 
ATOM   3108 O O   . ASN B 1 115 ? -59.353  29.097  43.504  1.00 189.89 ? 140 ASN B O   1 
ATOM   3109 C CB  . ASN B 1 115 ? -58.511  31.501  45.101  1.00 127.49 ? 140 ASN B CB  1 
ATOM   3110 N N   . ASP B 1 116 ? -57.595  29.780  42.235  1.00 201.78 ? 141 ASP B N   1 
ATOM   3111 C CA  . ASP B 1 116 ? -58.030  29.159  40.985  1.00 183.19 ? 141 ASP B CA  1 
ATOM   3112 C C   . ASP B 1 116 ? -57.980  27.621  41.012  1.00 176.39 ? 141 ASP B C   1 
ATOM   3113 O O   . ASP B 1 116 ? -59.014  26.951  40.942  1.00 153.05 ? 141 ASP B O   1 
ATOM   3114 C CB  . ASP B 1 116 ? -57.198  29.693  39.839  1.00 129.02 ? 141 ASP B CB  1 
ATOM   3115 N N   . ALA B 1 117 ? -56.775  27.071  41.121  1.00 159.31 ? 142 ALA B N   1 
ATOM   3116 C CA  . ALA B 1 117 ? -56.582  25.622  41.128  1.00 162.56 ? 142 ALA B CA  1 
ATOM   3117 C C   . ALA B 1 117 ? -57.701  24.789  41.818  1.00 166.31 ? 142 ALA B C   1 
ATOM   3118 O O   . ALA B 1 117 ? -58.120  23.748  41.302  1.00 125.40 ? 142 ALA B O   1 
ATOM   3119 C CB  . ALA B 1 117 ? -55.207  25.297  41.717  1.00 124.48 ? 142 ALA B CB  1 
ATOM   3120 N N   . ARG B 1 118 ? -58.204  25.250  42.960  1.00 173.22 ? 143 ARG B N   1 
ATOM   3121 C CA  . ARG B 1 118 ? -59.119  24.430  43.777  1.00 189.51 ? 143 ARG B CA  1 
ATOM   3122 C C   . ARG B 1 118 ? -60.494  24.090  43.159  1.00 179.02 ? 143 ARG B C   1 
ATOM   3123 O O   . ARG B 1 118 ? -60.825  22.912  42.944  1.00 117.13 ? 143 ARG B O   1 
ATOM   3124 C CB  . ARG B 1 118 ? -59.298  25.054  45.175  1.00 141.74 ? 143 ARG B CB  1 
ATOM   3125 N N   . GLY B 1 119 ? -61.294  25.117  42.888  1.00 172.15 ? 144 GLY B N   1 
ATOM   3126 C CA  . GLY B 1 119 ? -62.674  24.913  42.477  1.00 140.51 ? 144 GLY B CA  1 
ATOM   3127 C C   . GLY B 1 119 ? -62.958  24.736  40.990  1.00 128.04 ? 144 GLY B C   1 
ATOM   3128 O O   . GLY B 1 119 ? -64.028  25.123  40.515  1.00 113.62 ? 144 GLY B O   1 
ATOM   3129 N N   . ASP B 1 120 ? -62.017  24.154  40.249  1.00 138.77 ? 145 ASP B N   1 
ATOM   3130 C CA  . ASP B 1 120 ? -62.217  23.893  38.813  1.00 132.61 ? 145 ASP B CA  1 
ATOM   3131 C C   . ASP B 1 120 ? -62.528  25.154  37.989  1.00 120.11 ? 145 ASP B C   1 
ATOM   3132 O O   . ASP B 1 120 ? -63.517  25.200  37.254  1.00 95.14  ? 145 ASP B O   1 
ATOM   3133 C CB  . ASP B 1 120 ? -63.290  22.820  38.593  1.00 104.85 ? 145 ASP B CB  1 
ATOM   3134 N N   . GLY B 1 121 ? -61.672  26.165  38.134  1.00 120.42 ? 146 GLY B N   1 
ATOM   3135 C CA  . GLY B 1 121 ? -61.758  27.420  37.402  1.00 110.04 ? 146 GLY B CA  1 
ATOM   3136 C C   . GLY B 1 121 ? -60.681  28.334  37.960  1.00 120.95 ? 146 GLY B C   1 
ATOM   3137 O O   . GLY B 1 121 ? -60.331  28.203  39.127  1.00 126.62 ? 146 GLY B O   1 
ATOM   3138 N N   . VAL B 1 122 ? -60.132  29.239  37.152  1.00 125.62 ? 147 VAL B N   1 
ATOM   3139 C CA  . VAL B 1 122 ? -59.113  30.156  37.670  1.00 117.53 ? 147 VAL B CA  1 
ATOM   3140 C C   . VAL B 1 122 ? -59.710  31.415  38.282  1.00 124.60 ? 147 VAL B C   1 
ATOM   3141 O O   . VAL B 1 122 ? -60.562  32.078  37.686  1.00 108.43 ? 147 VAL B O   1 
ATOM   3142 C CB  . VAL B 1 122 ? -58.014  30.519  36.643  1.00 125.65 ? 147 VAL B CB  1 
ATOM   3143 C CG1 . VAL B 1 122 ? -57.282  31.797  37.062  1.00 119.39 ? 147 VAL B CG1 1 
ATOM   3144 C CG2 . VAL B 1 122 ? -57.036  29.366  36.503  1.00 94.95  ? 147 VAL B CG2 1 
ATOM   3145 N N   . ARG B 1 123 ? -59.260  31.725  39.490  1.00 137.81 ? 148 ARG B N   1 
ATOM   3146 C CA  . ARG B 1 123 ? -59.793  32.846  40.240  1.00 134.30 ? 148 ARG B CA  1 
ATOM   3147 C C   . ARG B 1 123 ? -59.211  34.148  39.728  1.00 138.62 ? 148 ARG B C   1 
ATOM   3148 O O   . ARG B 1 123 ? -57.996  34.288  39.588  1.00 128.04 ? 148 ARG B O   1 
ATOM   3149 C CB  . ARG B 1 123 ? -59.494  32.678  41.730  1.00 105.96 ? 148 ARG B CB  1 
ATOM   3150 N N   . THR B 1 124 ? -60.089  35.090  39.417  1.00 124.00 ? 149 THR B N   1 
ATOM   3151 C CA  . THR B 1 124 ? -59.674  36.464  39.244  1.00 118.55 ? 149 THR B CA  1 
ATOM   3152 C C   . THR B 1 124 ? -59.817  37.106  40.627  1.00 148.07 ? 149 THR B C   1 
ATOM   3153 O O   . THR B 1 124 ? -60.663  36.687  41.422  1.00 153.85 ? 149 THR B O   1 
ATOM   3154 C CB  . THR B 1 124 ? -60.538  37.163  38.182  1.00 115.89 ? 149 THR B CB  1 
ATOM   3155 O OG1 . THR B 1 124 ? -60.410  38.585  38.300  1.00 159.29 ? 149 THR B OG1 1 
ATOM   3156 C CG2 . THR B 1 124 ? -61.993  36.768  38.337  1.00 89.65  ? 149 THR B CG2 1 
ATOM   3157 N N   . GLY B 1 125 ? -58.977  38.090  40.932  1.00 148.54 ? 150 GLY B N   1 
ATOM   3158 C CA  . GLY B 1 125 ? -58.997  38.726  42.238  1.00 153.20 ? 150 GLY B CA  1 
ATOM   3159 C C   . GLY B 1 125 ? -60.371  39.166  42.734  1.00 162.03 ? 150 GLY B C   1 
ATOM   3160 O O   . GLY B 1 125 ? -60.596  39.225  43.941  1.00 158.55 ? 150 GLY B O   1 
ATOM   3161 N N   . ARG B 1 126 ? -61.291  39.478  41.820  1.00 169.71 ? 151 ARG B N   1 
ATOM   3162 C CA  . ARG B 1 126 ? -62.613  40.002  42.190  1.00 161.03 ? 151 ARG B CA  1 
ATOM   3163 C C   . ARG B 1 126 ? -63.489  39.003  42.944  1.00 151.17 ? 151 ARG B C   1 
ATOM   3164 O O   . ARG B 1 126 ? -63.554  37.830  42.592  1.00 147.07 ? 151 ARG B O   1 
ATOM   3165 C CB  . ARG B 1 126 ? -63.372  40.488  40.949  1.00 133.36 ? 151 ARG B CB  1 
ATOM   3166 C CG  . ARG B 1 126 ? -62.728  41.654  40.227  1.00 146.02 ? 151 ARG B CG  1 
ATOM   3167 C CD  . ARG B 1 126 ? -63.416  41.950  38.895  1.00 162.49 ? 151 ARG B CD  1 
ATOM   3168 N NE  . ARG B 1 126 ? -62.771  43.068  38.210  1.00 197.21 ? 151 ARG B NE  1 
ATOM   3169 C CZ  . ARG B 1 126 ? -63.114  43.526  37.008  1.00 183.46 ? 151 ARG B CZ  1 
ATOM   3170 N NH1 . ARG B 1 126 ? -64.111  42.962  36.336  1.00 178.05 ? 151 ARG B NH1 1 
ATOM   3171 N NH2 . ARG B 1 126 ? -62.454  44.552  36.480  1.00 140.43 ? 151 ARG B NH2 1 
ATOM   3172 N N   . CYS B 1 127 ? -64.179  39.488  43.970  1.00 162.32 ? 152 CYS B N   1 
ATOM   3173 C CA  . CYS B 1 127 ? -65.120  38.672  44.732  1.00 157.23 ? 152 CYS B CA  1 
ATOM   3174 C C   . CYS B 1 127 ? -66.568  38.968  44.341  1.00 151.32 ? 152 CYS B C   1 
ATOM   3175 O O   . CYS B 1 127 ? -66.990  40.129  44.320  1.00 133.95 ? 152 CYS B O   1 
ATOM   3176 C CB  . CYS B 1 127 ? -64.932  38.906  46.233  1.00 154.33 ? 152 CYS B CB  1 
ATOM   3177 S SG  . CYS B 1 127 ? -66.212  38.161  47.275  1.00 144.25 ? 152 CYS B SG  1 
ATOM   3178 N N   . VAL B 1 128 ? -67.331  37.915  44.056  1.00 143.44 ? 153 VAL B N   1 
ATOM   3179 C CA  . VAL B 1 128 ? -68.713  38.079  43.634  1.00 143.94 ? 153 VAL B CA  1 
ATOM   3180 C C   . VAL B 1 128 ? -69.665  37.205  44.427  1.00 142.15 ? 153 VAL B C   1 
ATOM   3181 O O   . VAL B 1 128 ? -69.262  36.271  45.119  1.00 134.21 ? 153 VAL B O   1 
ATOM   3182 C CB  . VAL B 1 128 ? -68.895  37.748  42.147  1.00 129.61 ? 153 VAL B CB  1 
ATOM   3183 C CG1 . VAL B 1 128 ? -68.224  38.799  41.290  1.00 123.83 ? 153 VAL B CG1 1 
ATOM   3184 C CG2 . VAL B 1 128 ? -68.342  36.365  41.844  1.00 130.21 ? 153 VAL B CG2 1 
ATOM   3185 N N   . SER B 1 129 ? -70.943  37.530  44.312  1.00 139.29 ? 154 SER B N   1 
ATOM   3186 C CA  . SER B 1 129 ? -71.988  36.803  45.002  1.00 146.39 ? 154 SER B CA  1 
ATOM   3187 C C   . SER B 1 129 ? -72.380  35.559  44.214  1.00 148.25 ? 154 SER B C   1 
ATOM   3188 O O   . SER B 1 129 ? -72.700  35.635  43.021  1.00 123.30 ? 154 SER B O   1 
ATOM   3189 C CB  . SER B 1 129 ? -73.200  37.710  45.164  1.00 154.47 ? 154 SER B CB  1 
ATOM   3190 O OG  . SER B 1 129 ? -73.560  38.251  43.905  1.00 145.43 ? 154 SER B OG  1 
ATOM   3191 N N   . TYR B 1 130 ? -72.343  34.415  44.888  1.00 149.24 ? 155 TYR B N   1 
ATOM   3192 C CA  . TYR B 1 130 ? -72.828  33.166  44.321  1.00 149.67 ? 155 TYR B CA  1 
ATOM   3193 C C   . TYR B 1 130 ? -74.351  33.208  44.267  1.00 142.57 ? 155 TYR B C   1 
ATOM   3194 O O   . TYR B 1 130 ? -74.989  32.518  43.467  1.00 116.50 ? 155 TYR B O   1 
ATOM   3195 C CB  . TYR B 1 130 ? -72.345  31.995  45.179  1.00 150.54 ? 155 TYR B CB  1 
ATOM   3196 C CG  . TYR B 1 130 ? -73.014  30.680  44.865  1.00 148.06 ? 155 TYR B CG  1 
ATOM   3197 C CD1 . TYR B 1 130 ? -74.054  30.208  45.652  1.00 155.58 ? 155 TYR B CD1 1 
ATOM   3198 C CD2 . TYR B 1 130 ? -72.607  29.911  43.782  1.00 147.27 ? 155 TYR B CD2 1 
ATOM   3199 C CE1 . TYR B 1 130 ? -74.672  29.007  45.370  1.00 166.98 ? 155 TYR B CE1 1 
ATOM   3200 C CE2 . TYR B 1 130 ? -73.219  28.709  43.491  1.00 151.11 ? 155 TYR B CE2 1 
ATOM   3201 C CZ  . TYR B 1 130 ? -74.251  28.260  44.289  1.00 162.74 ? 155 TYR B CZ  1 
ATOM   3202 O OH  . TYR B 1 130 ? -74.863  27.062  44.002  1.00 149.36 ? 155 TYR B OH  1 
ATOM   3203 N N   . SER B 1 131 ? -74.912  34.047  45.131  1.00 158.60 ? 156 SER B N   1 
ATOM   3204 C CA  . SER B 1 131 ? -76.346  34.257  45.233  1.00 159.81 ? 156 SER B CA  1 
ATOM   3205 C C   . SER B 1 131 ? -76.556  35.500  46.089  1.00 167.33 ? 156 SER B C   1 
ATOM   3206 O O   . SER B 1 131 ? -75.596  36.173  46.461  1.00 168.39 ? 156 SER B O   1 
ATOM   3207 C CB  . SER B 1 131 ? -77.014  33.051  45.895  1.00 157.23 ? 156 SER B CB  1 
ATOM   3208 O OG  . SER B 1 131 ? -76.647  32.953  47.265  1.00 136.99 ? 156 SER B OG  1 
ATOM   3209 N N   . ALA B 1 132 ? -77.807  35.805  46.410  1.00 168.52 ? 157 ALA B N   1 
ATOM   3210 C CA  . ALA B 1 132 ? -78.104  36.959  47.254  1.00 165.86 ? 157 ALA B CA  1 
ATOM   3211 C C   . ALA B 1 132 ? -77.552  36.810  48.685  1.00 165.73 ? 157 ALA B C   1 
ATOM   3212 O O   . ALA B 1 132 ? -76.946  37.737  49.230  1.00 135.01 ? 157 ALA B O   1 
ATOM   3213 C CB  . ALA B 1 132 ? -79.609  37.224  47.276  1.00 142.84 ? 157 ALA B CB  1 
ATOM   3214 N N   . SER B 1 133 ? -77.751  35.637  49.282  1.00 162.98 ? 158 SER B N   1 
ATOM   3215 C CA  . SER B 1 133 ? -77.387  35.407  50.682  1.00 157.08 ? 158 SER B CA  1 
ATOM   3216 C C   . SER B 1 133 ? -75.896  35.161  50.911  1.00 169.18 ? 158 SER B C   1 
ATOM   3217 O O   . SER B 1 133 ? -75.389  35.416  52.007  1.00 147.16 ? 158 SER B O   1 
ATOM   3218 C CB  . SER B 1 133 ? -78.185  34.235  51.264  1.00 155.06 ? 158 SER B CB  1 
ATOM   3219 O OG  . SER B 1 133 ? -79.573  34.518  51.297  1.00 154.72 ? 158 SER B OG  1 
ATOM   3220 N N   . VAL B 1 134 ? -75.200  34.657  49.891  1.00 177.91 ? 159 VAL B N   1 
ATOM   3221 C CA  . VAL B 1 134 ? -73.789  34.295  50.036  1.00 165.35 ? 159 VAL B CA  1 
ATOM   3222 C C   . VAL B 1 134 ? -72.941  34.825  48.892  1.00 151.51 ? 159 VAL B C   1 
ATOM   3223 O O   . VAL B 1 134 ? -73.455  35.155  47.823  1.00 137.27 ? 159 VAL B O   1 
ATOM   3224 C CB  . VAL B 1 134 ? -73.581  32.761  50.131  1.00 151.50 ? 159 VAL B CB  1 
ATOM   3225 C CG1 . VAL B 1 134 ? -74.120  32.218  51.452  1.00 133.17 ? 159 VAL B CG1 1 
ATOM   3226 C CG2 . VAL B 1 134 ? -74.223  32.059  48.936  1.00 151.01 ? 159 VAL B CG2 1 
ATOM   3227 N N   . LYS B 1 135 ? -71.635  34.896  49.131  1.00 156.43 ? 160 LYS B N   1 
ATOM   3228 C CA  . LYS B 1 135 ? -70.695  35.409  48.141  1.00 154.60 ? 160 LYS B CA  1 
ATOM   3229 C C   . LYS B 1 135 ? -69.395  34.615  48.179  1.00 158.24 ? 160 LYS B C   1 
ATOM   3230 O O   . LYS B 1 135 ? -68.928  34.218  49.251  1.00 141.86 ? 160 LYS B O   1 
ATOM   3231 C CB  . LYS B 1 135 ? -70.424  36.890  48.374  1.00 128.32 ? 160 LYS B CB  1 
ATOM   3232 N N   . THR B 1 136 ? -68.814  34.397  47.001  1.00 159.10 ? 161 THR B N   1 
ATOM   3233 C CA  . THR B 1 136 ? -67.628  33.560  46.860  1.00 152.06 ? 161 THR B CA  1 
ATOM   3234 C C   . THR B 1 136 ? -66.774  34.025  45.681  1.00 142.47 ? 161 THR B C   1 
ATOM   3235 O O   . THR B 1 136 ? -67.244  34.765  44.820  1.00 129.52 ? 161 THR B O   1 
ATOM   3236 C CB  . THR B 1 136 ? -68.016  32.084  46.658  1.00 144.85 ? 161 THR B CB  1 
ATOM   3237 O OG1 . THR B 1 136 ? -66.867  31.245  46.840  1.00 136.97 ? 161 THR B OG1 1 
ATOM   3238 C CG2 . THR B 1 136 ? -68.589  31.881  45.263  1.00 128.31 ? 161 THR B CG2 1 
ATOM   3239 N N   . CYS B 1 137 ? -65.521  33.575  45.648  1.00 147.98 ? 162 CYS B N   1 
ATOM   3240 C CA  . CYS B 1 137 ? -64.539  34.027  44.659  1.00 137.93 ? 162 CYS B CA  1 
ATOM   3241 C C   . CYS B 1 137 ? -64.933  33.795  43.203  1.00 143.20 ? 162 CYS B C   1 
ATOM   3242 O O   . CYS B 1 137 ? -65.312  32.689  42.812  1.00 133.76 ? 162 CYS B O   1 
ATOM   3243 C CB  . CYS B 1 137 ? -63.176  33.379  44.921  1.00 123.23 ? 162 CYS B CB  1 
ATOM   3244 S SG  . CYS B 1 137 ? -62.241  34.161  46.247  1.00 192.56 ? 162 CYS B SG  1 
ATOM   3245 N N   . GLU B 1 138 ? -64.820  34.852  42.403  1.00 148.95 ? 163 GLU B N   1 
ATOM   3246 C CA  . GLU B 1 138 ? -65.051  34.759  40.969  1.00 124.94 ? 163 GLU B CA  1 
ATOM   3247 C C   . GLU B 1 138 ? -63.913  34.016  40.291  1.00 125.56 ? 163 GLU B C   1 
ATOM   3248 O O   . GLU B 1 138 ? -62.736  34.229  40.593  1.00 103.82 ? 163 GLU B O   1 
ATOM   3249 C CB  . GLU B 1 138 ? -65.195  36.147  40.343  1.00 121.11 ? 163 GLU B CB  1 
ATOM   3250 C CG  . GLU B 1 138 ? -65.339  36.109  38.835  1.00 116.71 ? 163 GLU B CG  1 
ATOM   3251 C CD  . GLU B 1 138 ? -65.318  37.479  38.201  1.00 123.17 ? 163 GLU B CD  1 
ATOM   3252 O OE1 . GLU B 1 138 ? -66.157  37.718  37.305  1.00 113.42 ? 163 GLU B OE1 1 
ATOM   3253 O OE2 . GLU B 1 138 ? -64.473  38.309  38.601  1.00 130.21 ? 163 GLU B OE2 1 
ATOM   3254 N N   . VAL B 1 139 ? -64.277  33.147  39.360  1.00 127.07 ? 164 VAL B N   1 
ATOM   3255 C CA  . VAL B 1 139 ? -63.299  32.382  38.613  1.00 115.67 ? 164 VAL B CA  1 
ATOM   3256 C C   . VAL B 1 139 ? -63.672  32.391  37.147  1.00 110.47 ? 164 VAL B C   1 
ATOM   3257 O O   . VAL B 1 139 ? -64.851  32.322  36.793  1.00 106.79 ? 164 VAL B O   1 
ATOM   3258 C CB  . VAL B 1 139 ? -63.248  30.929  39.090  1.00 108.69 ? 164 VAL B CB  1 
ATOM   3259 C CG1 . VAL B 1 139 ? -62.815  30.879  40.543  1.00 119.12 ? 164 VAL B CG1 1 
ATOM   3260 C CG2 . VAL B 1 139 ? -64.607  30.263  38.903  1.00 117.45 ? 164 VAL B CG2 1 
ATOM   3261 N N   . LEU B 1 140 ? -62.670  32.518  36.290  1.00 100.14 ? 165 LEU B N   1 
ATOM   3262 C CA  . LEU B 1 140 ? -62.896  32.308  34.876  1.00 111.67 ? 165 LEU B CA  1 
ATOM   3263 C C   . LEU B 1 140 ? -62.720  30.806  34.645  1.00 116.02 ? 165 LEU B C   1 
ATOM   3264 O O   . LEU B 1 140 ? -61.930  30.154  35.334  1.00 87.80  ? 165 LEU B O   1 
ATOM   3265 C CB  . LEU B 1 140 ? -61.967  33.180  34.020  1.00 98.47  ? 165 LEU B CB  1 
ATOM   3266 C CG  . LEU B 1 140 ? -60.460  33.110  34.272  1.00 105.43 ? 165 LEU B CG  1 
ATOM   3267 C CD1 . LEU B 1 140 ? -59.884  31.914  33.539  1.00 141.91 ? 165 LEU B CD1 1 
ATOM   3268 C CD2 . LEU B 1 140 ? -59.781  34.386  33.812  1.00 108.58 ? 165 LEU B CD2 1 
ATOM   3269 N N   . SER B 1 141 ? -63.480  30.258  33.704  1.00 113.63 ? 166 SER B N   1 
ATOM   3270 C CA  . SER B 1 141 ? -63.621  28.817  33.582  1.00 102.50 ? 166 SER B CA  1 
ATOM   3271 C C   . SER B 1 141 ? -64.673  28.547  32.522  1.00 109.08 ? 166 SER B C   1 
ATOM   3272 O O   . SER B 1 141 ? -65.120  29.463  31.844  1.00 113.73 ? 166 SER B O   1 
ATOM   3273 C CB  . SER B 1 141 ? -64.072  28.240  34.928  1.00 102.03 ? 166 SER B CB  1 
ATOM   3274 O OG  . SER B 1 141 ? -64.545  26.907  34.818  1.00 92.92  ? 166 SER B OG  1 
ATOM   3275 N N   . TRP B 1 142 ? -65.049  27.285  32.361  1.00 112.42 ? 167 TRP B N   1 
ATOM   3276 C CA  . TRP B 1 142 ? -66.201  26.927  31.544  1.00 104.77 ? 167 TRP B CA  1 
ATOM   3277 C C   . TRP B 1 142 ? -67.455  27.187  32.370  1.00 107.72 ? 167 TRP B C   1 
ATOM   3278 O O   . TRP B 1 142 ? -67.680  26.532  33.391  1.00 112.52 ? 167 TRP B O   1 
ATOM   3279 C CB  . TRP B 1 142 ? -66.135  25.453  31.119  1.00 101.27 ? 167 TRP B CB  1 
ATOM   3280 C CG  . TRP B 1 142 ? -65.194  25.153  29.961  1.00 102.75 ? 167 TRP B CG  1 
ATOM   3281 C CD1 . TRP B 1 142 ? -63.993  24.500  30.023  1.00 108.37 ? 167 TRP B CD1 1 
ATOM   3282 C CD2 . TRP B 1 142 ? -65.395  25.483  28.576  1.00 95.65  ? 167 TRP B CD2 1 
ATOM   3283 N NE1 . TRP B 1 142 ? -63.438  24.401  28.769  1.00 100.64 ? 167 TRP B NE1 1 
ATOM   3284 C CE2 . TRP B 1 142 ? -64.275  24.994  27.868  1.00 92.88  ? 167 TRP B CE2 1 
ATOM   3285 C CE3 . TRP B 1 142 ? -66.412  26.137  27.873  1.00 104.25 ? 167 TRP B CE3 1 
ATOM   3286 C CZ2 . TRP B 1 142 ? -64.147  25.144  26.489  1.00 104.06 ? 167 TRP B CZ2 1 
ATOM   3287 C CZ3 . TRP B 1 142 ? -66.279  26.280  26.507  1.00 105.73 ? 167 TRP B CZ3 1 
ATOM   3288 C CH2 . TRP B 1 142 ? -65.153  25.785  25.830  1.00 104.42 ? 167 TRP B CH2 1 
ATOM   3289 N N   . CYS B 1 143 ? -68.272  28.134  31.919  1.00 99.68  ? 168 CYS B N   1 
ATOM   3290 C CA  . CYS B 1 143 ? -69.404  28.614  32.704  1.00 107.97 ? 168 CYS B CA  1 
ATOM   3291 C C   . CYS B 1 143 ? -70.724  28.504  31.952  1.00 107.22 ? 168 CYS B C   1 
ATOM   3292 O O   . CYS B 1 143 ? -70.770  28.746  30.750  1.00 109.62 ? 168 CYS B O   1 
ATOM   3293 C CB  . CYS B 1 143 ? -69.169  30.069  33.117  1.00 110.92 ? 168 CYS B CB  1 
ATOM   3294 S SG  . CYS B 1 143 ? -68.074  30.273  34.546  1.00 135.94 ? 168 CYS B SG  1 
ATOM   3295 N N   . PRO B 1 144 ? -71.817  28.185  32.669  1.00 102.50 ? 169 PRO B N   1 
ATOM   3296 C CA  . PRO B 1 144 ? -71.892  28.068  34.130  1.00 105.09 ? 169 PRO B CA  1 
ATOM   3297 C C   . PRO B 1 144 ? -71.208  26.813  34.665  1.00 105.41 ? 169 PRO B C   1 
ATOM   3298 O O   . PRO B 1 144 ? -71.056  25.833  33.935  1.00 95.64  ? 169 PRO B O   1 
ATOM   3299 C CB  . PRO B 1 144 ? -73.403  27.982  34.401  1.00 111.17 ? 169 PRO B CB  1 
ATOM   3300 C CG  . PRO B 1 144 ? -74.074  28.298  33.104  1.00 106.78 ? 169 PRO B CG  1 
ATOM   3301 C CD  . PRO B 1 144 ? -73.113  27.889  32.044  1.00 101.70 ? 169 PRO B CD  1 
ATOM   3302 N N   . LEU B 1 145 ? -70.830  26.845  35.939  1.00 112.51 ? 170 LEU B N   1 
ATOM   3303 C CA  . LEU B 1 145 ? -70.219  25.697  36.600  1.00 108.21 ? 170 LEU B CA  1 
ATOM   3304 C C   . LEU B 1 145 ? -71.114  24.471  36.559  1.00 109.64 ? 170 LEU B C   1 
ATOM   3305 O O   . LEU B 1 145 ? -72.317  24.565  36.281  1.00 103.61 ? 170 LEU B O   1 
ATOM   3306 C CB  . LEU B 1 145 ? -69.901  26.029  38.058  1.00 107.97 ? 170 LEU B CB  1 
ATOM   3307 C CG  . LEU B 1 145 ? -68.460  26.401  38.396  1.00 106.33 ? 170 LEU B CG  1 
ATOM   3308 C CD1 . LEU B 1 145 ? -67.532  25.260  38.017  1.00 105.68 ? 170 LEU B CD1 1 
ATOM   3309 C CD2 . LEU B 1 145 ? -68.057  27.677  37.692  1.00 104.31 ? 170 LEU B CD2 1 
ATOM   3310 N N   . GLU B 1 146 ? -70.528  23.315  36.842  1.00 101.45 ? 171 GLU B N   1 
ATOM   3311 C CA  . GLU B 1 146 ? -71.326  22.114  36.958  1.00 106.33 ? 171 GLU B CA  1 
ATOM   3312 C C   . GLU B 1 146 ? -71.970  22.135  38.325  1.00 111.25 ? 171 GLU B C   1 
ATOM   3313 O O   . GLU B 1 146 ? -71.274  22.218  39.335  1.00 106.49 ? 171 GLU B O   1 
ATOM   3314 C CB  . GLU B 1 146 ? -70.454  20.876  36.816  1.00 117.66 ? 171 GLU B CB  1 
ATOM   3315 C CG  . GLU B 1 146 ? -71.217  19.585  36.997  1.00 120.62 ? 171 GLU B CG  1 
ATOM   3316 C CD  . GLU B 1 146 ? -70.330  18.374  36.867  1.00 118.75 ? 171 GLU B CD  1 
ATOM   3317 O OE1 . GLU B 1 146 ? -69.329  18.456  36.132  1.00 127.10 ? 171 GLU B OE1 1 
ATOM   3318 O OE2 . GLU B 1 146 ? -70.631  17.341  37.496  1.00 114.07 ? 171 GLU B OE2 1 
ATOM   3319 N N   . LYS B 1 147 ? -73.295  22.077  38.367  1.00 103.40 ? 172 LYS B N   1 
ATOM   3320 C CA  . LYS B 1 147 ? -73.971  22.084  39.652  1.00 102.65 ? 172 LYS B CA  1 
ATOM   3321 C C   . LYS B 1 147 ? -73.479  20.883  40.456  1.00 102.69 ? 172 LYS B C   1 
ATOM   3322 O O   . LYS B 1 147 ? -73.161  19.845  39.881  1.00 109.30 ? 172 LYS B O   1 
ATOM   3323 C CB  . LYS B 1 147 ? -75.477  22.043  39.462  1.00 62.31  ? 172 LYS B CB  1 
ATOM   3324 N N   . ILE B 1 148 ? -73.385  21.026  41.775  1.00 110.77 ? 173 ILE B N   1 
ATOM   3325 C CA  . ILE B 1 148 ? -73.009  19.902  42.627  1.00 115.43 ? 173 ILE B CA  1 
ATOM   3326 C C   . ILE B 1 148 ? -74.246  19.139  43.064  1.00 105.21 ? 173 ILE B C   1 
ATOM   3327 O O   . ILE B 1 148 ? -74.963  19.579  43.958  1.00 99.34  ? 173 ILE B O   1 
ATOM   3328 C CB  . ILE B 1 148 ? -72.214  20.354  43.869  1.00 119.56 ? 173 ILE B CB  1 
ATOM   3329 C CG1 . ILE B 1 148 ? -70.827  20.862  43.457  1.00 143.03 ? 173 ILE B CG1 1 
ATOM   3330 C CG2 . ILE B 1 148 ? -72.079  19.199  44.851  1.00 100.45 ? 173 ILE B CG2 1 
ATOM   3331 C CD1 . ILE B 1 148 ? -69.950  21.308  44.623  1.00 152.02 ? 173 ILE B CD1 1 
ATOM   3332 N N   . VAL B 1 149 ? -74.490  17.998  42.424  1.00 110.84 ? 174 VAL B N   1 
ATOM   3333 C CA  . VAL B 1 149 ? -75.695  17.208  42.674  1.00 96.87  ? 174 VAL B CA  1 
ATOM   3334 C C   . VAL B 1 149 ? -75.396  15.716  42.515  1.00 88.79  ? 174 VAL B C   1 
ATOM   3335 O O   . VAL B 1 149 ? -74.412  15.342  41.874  1.00 95.68  ? 174 VAL B O   1 
ATOM   3336 C CB  . VAL B 1 149 ? -76.855  17.613  41.734  1.00 89.65  ? 174 VAL B CB  1 
ATOM   3337 C CG1 . VAL B 1 149 ? -77.010  19.130  41.690  1.00 91.54  ? 174 VAL B CG1 1 
ATOM   3338 C CG2 . VAL B 1 149 ? -76.628  17.069  40.346  1.00 89.70  ? 174 VAL B CG2 1 
ATOM   3339 N N   . ASP B 1 150 ? -76.214  14.864  43.124  1.00 84.41  ? 175 ASP B N   1 
ATOM   3340 C CA  . ASP B 1 150 ? -75.981  13.424  43.042  1.00 102.36 ? 175 ASP B CA  1 
ATOM   3341 C C   . ASP B 1 150 ? -76.684  12.824  41.815  1.00 97.75  ? 175 ASP B C   1 
ATOM   3342 O O   . ASP B 1 150 ? -77.765  13.273  41.428  1.00 84.28  ? 175 ASP B O   1 
ATOM   3343 C CB  . ASP B 1 150 ? -76.389  12.703  44.371  1.00 57.94  ? 175 ASP B CB  1 
ATOM   3344 N N   . PRO B 1 151 ? -76.075  11.789  41.214  1.00 91.65  ? 176 PRO B N   1 
ATOM   3345 C CA  . PRO B 1 151 ? -76.519  11.234  39.935  1.00 85.53  ? 176 PRO B CA  1 
ATOM   3346 C C   . PRO B 1 151 ? -77.931  10.707  40.048  1.00 96.69  ? 176 PRO B C   1 
ATOM   3347 O O   . PRO B 1 151 ? -78.326  10.276  41.126  1.00 96.90  ? 176 PRO B O   1 
ATOM   3348 C CB  . PRO B 1 151 ? -75.563  10.057  39.704  1.00 97.34  ? 176 PRO B CB  1 
ATOM   3349 C CG  . PRO B 1 151 ? -74.506  10.167  40.736  1.00 123.95 ? 176 PRO B CG  1 
ATOM   3350 C CD  . PRO B 1 151 ? -75.108  10.904  41.878  1.00 117.90 ? 176 PRO B CD  1 
ATOM   3351 N N   . PRO B 1 152 ? -78.681  10.721  38.940  1.00 98.60  ? 177 PRO B N   1 
ATOM   3352 C CA  . PRO B 1 152 ? -80.071  10.266  38.945  1.00 98.90  ? 177 PRO B CA  1 
ATOM   3353 C C   . PRO B 1 152 ? -80.207  8.821   39.372  1.00 98.09  ? 177 PRO B C   1 
ATOM   3354 O O   . PRO B 1 152 ? -79.313  8.015   39.146  1.00 92.88  ? 177 PRO B O   1 
ATOM   3355 C CB  . PRO B 1 152 ? -80.482  10.404  37.487  1.00 80.91  ? 177 PRO B CB  1 
ATOM   3356 C CG  . PRO B 1 152 ? -79.600  11.462  36.951  1.00 99.83  ? 177 PRO B CG  1 
ATOM   3357 C CD  . PRO B 1 152 ? -78.288  11.266  37.634  1.00 92.85  ? 177 PRO B CD  1 
ATOM   3358 N N   . ASN B 1 153 ? -81.341  8.508   39.982  1.00 101.45 ? 178 ASN B N   1 
ATOM   3359 C CA  . ASN B 1 153 ? -81.655  7.145   40.365  1.00 100.90 ? 178 ASN B CA  1 
ATOM   3360 C C   . ASN B 1 153 ? -83.150  6.905   40.268  1.00 102.71 ? 178 ASN B C   1 
ATOM   3361 O O   . ASN B 1 153 ? -83.934  7.626   40.876  1.00 101.28 ? 178 ASN B O   1 
ATOM   3362 C CB  . ASN B 1 153 ? -81.178  6.866   41.786  1.00 82.75  ? 178 ASN B CB  1 
ATOM   3363 C CG  . ASN B 1 153 ? -81.156  5.388   42.117  1.00 86.34  ? 178 ASN B CG  1 
ATOM   3364 O OD1 . ASN B 1 153 ? -81.948  4.605   41.600  1.00 102.89 ? 178 ASN B OD1 1 
ATOM   3365 N ND2 . ASN B 1 153 ? -80.240  5.000   42.984  1.00 85.77  ? 178 ASN B ND2 1 
ATOM   3366 N N   . PRO B 1 154 ? -83.554  5.878   39.509  1.00 97.51  ? 179 PRO B N   1 
ATOM   3367 C CA  . PRO B 1 154 ? -82.689  4.937   38.788  1.00 98.98  ? 179 PRO B CA  1 
ATOM   3368 C C   . PRO B 1 154 ? -81.834  5.621   37.722  1.00 100.02 ? 179 PRO B C   1 
ATOM   3369 O O   . PRO B 1 154 ? -82.044  6.798   37.448  1.00 103.03 ? 179 PRO B O   1 
ATOM   3370 C CB  . PRO B 1 154 ? -83.693  3.965   38.153  1.00 96.52  ? 179 PRO B CB  1 
ATOM   3371 C CG  . PRO B 1 154 ? -84.906  4.076   38.995  1.00 92.87  ? 179 PRO B CG  1 
ATOM   3372 C CD  . PRO B 1 154 ? -84.972  5.513   39.385  1.00 99.15  ? 179 PRO B CD  1 
ATOM   3373 N N   . PRO B 1 155 ? -80.875  4.892   37.135  1.00 86.58  ? 180 PRO B N   1 
ATOM   3374 C CA  . PRO B 1 155 ? -80.002  5.441   36.097  1.00 89.20  ? 180 PRO B CA  1 
ATOM   3375 C C   . PRO B 1 155 ? -80.794  5.781   34.830  1.00 98.84  ? 180 PRO B C   1 
ATOM   3376 O O   . PRO B 1 155 ? -81.771  5.098   34.537  1.00 99.29  ? 180 PRO B O   1 
ATOM   3377 C CB  . PRO B 1 155 ? -79.045  4.286   35.802  1.00 77.75  ? 180 PRO B CB  1 
ATOM   3378 C CG  . PRO B 1 155 ? -79.202  3.339   36.892  1.00 82.48  ? 180 PRO B CG  1 
ATOM   3379 C CD  . PRO B 1 155 ? -80.591  3.475   37.384  1.00 82.24  ? 180 PRO B CD  1 
ATOM   3380 N N   . LEU B 1 156 ? -80.382  6.804   34.084  1.00 89.52  ? 181 LEU B N   1 
ATOM   3381 C CA  . LEU B 1 156 ? -81.106  7.184   32.880  1.00 85.64  ? 181 LEU B CA  1 
ATOM   3382 C C   . LEU B 1 156 ? -81.001  6.090   31.851  1.00 87.50  ? 181 LEU B C   1 
ATOM   3383 O O   . LEU B 1 156 ? -82.001  5.652   31.289  1.00 99.25  ? 181 LEU B O   1 
ATOM   3384 C CB  . LEU B 1 156 ? -80.548  8.468   32.290  1.00 76.83  ? 181 LEU B CB  1 
ATOM   3385 C CG  . LEU B 1 156 ? -81.011  9.729   32.995  1.00 67.14  ? 181 LEU B CG  1 
ATOM   3386 C CD1 . LEU B 1 156 ? -80.651  9.608   34.432  1.00 88.15  ? 181 LEU B CD1 1 
ATOM   3387 C CD2 . LEU B 1 156 ? -80.340  10.932  32.379  1.00 95.31  ? 181 LEU B CD2 1 
ATOM   3388 N N   . LEU B 1 157 ? -79.776  5.657   31.598  1.00 71.69  ? 182 LEU B N   1 
ATOM   3389 C CA  . LEU B 1 157 ? -79.550  4.573   30.662  1.00 92.36  ? 182 LEU B CA  1 
ATOM   3390 C C   . LEU B 1 157 ? -79.732  3.230   31.370  1.00 91.39  ? 182 LEU B C   1 
ATOM   3391 O O   . LEU B 1 157 ? -78.905  2.331   31.264  1.00 78.63  ? 182 LEU B O   1 
ATOM   3392 C CB  . LEU B 1 157 ? -78.168  4.687   30.015  1.00 88.99  ? 182 LEU B CB  1 
ATOM   3393 C CG  . LEU B 1 157 ? -77.880  5.769   28.967  1.00 71.66  ? 182 LEU B CG  1 
ATOM   3394 C CD1 . LEU B 1 157 ? -78.842  5.662   27.810  1.00 72.72  ? 182 LEU B CD1 1 
ATOM   3395 C CD2 . LEU B 1 157 ? -77.869  7.188   29.545  1.00 83.03  ? 182 LEU B CD2 1 
ATOM   3396 N N   . ALA B 1 158 ? -80.832  3.105   32.099  1.00 90.96  ? 183 ALA B N   1 
ATOM   3397 C CA  . ALA B 1 158 ? -81.127  1.878   32.825  1.00 75.33  ? 183 ALA B CA  1 
ATOM   3398 C C   . ALA B 1 158 ? -81.440  0.745   31.883  1.00 79.55  ? 183 ALA B C   1 
ATOM   3399 O O   . ALA B 1 158 ? -81.350  -0.406  32.272  1.00 76.56  ? 183 ALA B O   1 
ATOM   3400 C CB  . ALA B 1 158 ? -82.279  2.086   33.775  1.00 90.36  ? 183 ALA B CB  1 
ATOM   3401 N N   . ASP B 1 159 ? -81.814  1.083   30.648  1.00 91.60  ? 184 ASP B N   1 
ATOM   3402 C CA  . ASP B 1 159 ? -82.110  0.101   29.597  1.00 94.28  ? 184 ASP B CA  1 
ATOM   3403 C C   . ASP B 1 159 ? -80.856  -0.678  29.220  1.00 94.61  ? 184 ASP B C   1 
ATOM   3404 O O   . ASP B 1 159 ? -80.901  -1.638  28.435  1.00 73.80  ? 184 ASP B O   1 
ATOM   3405 C CB  . ASP B 1 159 ? -82.690  0.791   28.354  1.00 91.76  ? 184 ASP B CB  1 
ATOM   3406 C CG  . ASP B 1 159 ? -84.145  1.193   28.524  1.00 118.90 ? 184 ASP B CG  1 
ATOM   3407 O OD1 . ASP B 1 159 ? -84.898  0.457   29.196  1.00 118.79 ? 184 ASP B OD1 1 
ATOM   3408 O OD2 . ASP B 1 159 ? -84.536  2.246   27.970  1.00 113.96 ? 184 ASP B OD2 1 
ATOM   3409 N N   . ALA B 1 160 ? -79.742  -0.248  29.804  1.00 91.12  ? 185 ALA B N   1 
ATOM   3410 C CA  . ALA B 1 160 ? -78.434  -0.819  29.540  1.00 72.30  ? 185 ALA B CA  1 
ATOM   3411 C C   . ALA B 1 160 ? -78.341  -2.271  29.931  1.00 70.39  ? 185 ALA B C   1 
ATOM   3412 O O   . ALA B 1 160 ? -77.546  -3.017  29.405  1.00 76.64  ? 185 ALA B O   1 
ATOM   3413 C CB  . ALA B 1 160 ? -77.376  -0.024  30.264  1.00 68.47  ? 185 ALA B CB  1 
ATOM   3414 N N   . GLU B 1 161 ? -79.157  -2.662  30.888  1.00 90.43  ? 186 GLU B N   1 
ATOM   3415 C CA  . GLU B 1 161 ? -79.073  -3.996  31.452  1.00 97.05  ? 186 GLU B CA  1 
ATOM   3416 C C   . GLU B 1 161 ? -79.293  -5.015  30.355  1.00 95.59  ? 186 GLU B C   1 
ATOM   3417 O O   . GLU B 1 161 ? -78.665  -6.074  30.314  1.00 95.20  ? 186 GLU B O   1 
ATOM   3418 C CB  . GLU B 1 161 ? -80.122  -4.177  32.554  1.00 96.13  ? 186 GLU B CB  1 
ATOM   3419 C CG  . GLU B 1 161 ? -80.151  -5.569  33.161  1.00 132.22 ? 186 GLU B CG  1 
ATOM   3420 C CD  . GLU B 1 161 ? -81.231  -5.726  34.216  1.00 142.63 ? 186 GLU B CD  1 
ATOM   3421 O OE1 . GLU B 1 161 ? -81.173  -6.706  35.002  1.00 138.42 ? 186 GLU B OE1 1 
ATOM   3422 O OE2 . GLU B 1 161 ? -82.136  -4.863  34.248  1.00 122.95 ? 186 GLU B OE2 1 
ATOM   3423 N N   . ASN B 1 162 ? -80.189  -4.654  29.451  1.00 97.94  ? 187 ASN B N   1 
ATOM   3424 C CA  . ASN B 1 162 ? -80.654  -5.522  28.382  1.00 91.14  ? 187 ASN B CA  1 
ATOM   3425 C C   . ASN B 1 162 ? -79.801  -5.458  27.112  1.00 101.87 ? 187 ASN B C   1 
ATOM   3426 O O   . ASN B 1 162 ? -80.107  -6.115  26.120  1.00 102.86 ? 187 ASN B O   1 
ATOM   3427 C CB  . ASN B 1 162 ? -82.128  -5.213  28.087  1.00 94.03  ? 187 ASN B CB  1 
ATOM   3428 C CG  . ASN B 1 162 ? -83.069  -5.971  29.005  1.00 112.65 ? 187 ASN B CG  1 
ATOM   3429 O OD1 . ASN B 1 162 ? -82.668  -6.950  29.648  1.00 108.64 ? 187 ASN B OD1 1 
ATOM   3430 N ND2 . ASN B 1 162 ? -84.325  -5.540  29.064  1.00 115.19 ? 187 ASN B ND2 1 
ATOM   3431 N N   . PHE B 1 163 ? -78.718  -4.688  27.150  1.00 107.91 ? 188 PHE B N   1 
ATOM   3432 C CA  . PHE B 1 163 ? -77.803  -4.656  26.015  1.00 91.28  ? 188 PHE B CA  1 
ATOM   3433 C C   . PHE B 1 163 ? -77.066  -5.962  25.900  1.00 87.30  ? 188 PHE B C   1 
ATOM   3434 O O   . PHE B 1 163 ? -77.110  -6.807  26.788  1.00 92.58  ? 188 PHE B O   1 
ATOM   3435 C CB  . PHE B 1 163 ? -76.765  -3.542  26.124  1.00 76.65  ? 188 PHE B CB  1 
ATOM   3436 C CG  . PHE B 1 163 ? -77.338  -2.176  26.032  1.00 73.06  ? 188 PHE B CG  1 
ATOM   3437 C CD1 . PHE B 1 163 ? -76.814  -1.140  26.754  1.00 67.79  ? 188 PHE B CD1 1 
ATOM   3438 C CD2 . PHE B 1 163 ? -78.417  -1.931  25.232  1.00 100.07 ? 188 PHE B CD2 1 
ATOM   3439 C CE1 . PHE B 1 163 ? -77.354  0.110   26.665  1.00 77.35  ? 188 PHE B CE1 1 
ATOM   3440 C CE2 . PHE B 1 163 ? -78.959  -0.670  25.142  1.00 103.17 ? 188 PHE B CE2 1 
ATOM   3441 C CZ  . PHE B 1 163 ? -78.425  0.348   25.864  1.00 80.95  ? 188 PHE B CZ  1 
ATOM   3442 N N   . THR B 1 164 ? -76.350  -6.109  24.805  1.00 80.54  ? 189 THR B N   1 
ATOM   3443 C CA  . THR B 1 164 ? -75.643  -7.336  24.573  1.00 90.52  ? 189 THR B CA  1 
ATOM   3444 C C   . THR B 1 164 ? -74.352  -7.052  23.832  1.00 96.96  ? 189 THR B C   1 
ATOM   3445 O O   . THR B 1 164 ? -74.310  -6.241  22.905  1.00 86.62  ? 189 THR B O   1 
ATOM   3446 C CB  . THR B 1 164 ? -76.517  -8.333  23.802  1.00 83.55  ? 189 THR B CB  1 
ATOM   3447 O OG1 . THR B 1 164 ? -75.758  -9.509  23.543  1.00 107.86 ? 189 THR B OG1 1 
ATOM   3448 C CG2 . THR B 1 164 ? -76.993  -7.757  22.489  1.00 63.04  ? 189 THR B CG2 1 
ATOM   3449 N N   . VAL B 1 165 ? -73.286  -7.704  24.276  1.00 85.72  ? 190 VAL B N   1 
ATOM   3450 C CA  . VAL B 1 165 ? -71.982  -7.527  23.662  1.00 83.25  ? 190 VAL B CA  1 
ATOM   3451 C C   . VAL B 1 165 ? -71.458  -8.803  23.021  1.00 90.03  ? 190 VAL B C   1 
ATOM   3452 O O   . VAL B 1 165 ? -71.340  -9.848  23.671  1.00 77.45  ? 190 VAL B O   1 
ATOM   3453 C CB  . VAL B 1 165 ? -70.947  -7.024  24.674  1.00 85.40  ? 190 VAL B CB  1 
ATOM   3454 C CG1 . VAL B 1 165 ? -70.729  -8.055  25.763  1.00 95.53  ? 190 VAL B CG1 1 
ATOM   3455 C CG2 . VAL B 1 165 ? -69.654  -6.714  23.974  1.00 86.76  ? 190 VAL B CG2 1 
ATOM   3456 N N   . LEU B 1 166 ? -71.155  -8.707  21.733  1.00 95.63  ? 191 LEU B N   1 
ATOM   3457 C CA  . LEU B 1 166 ? -70.457  -9.771  21.041  1.00 95.39  ? 191 LEU B CA  1 
ATOM   3458 C C   . LEU B 1 166 ? -68.964  -9.645  21.298  1.00 92.06  ? 191 LEU B C   1 
ATOM   3459 O O   . LEU B 1 166 ? -68.368  -8.581  21.086  1.00 81.48  ? 191 LEU B O   1 
ATOM   3460 C CB  . LEU B 1 166 ? -70.706  -9.702  19.540  1.00 87.83  ? 191 LEU B CB  1 
ATOM   3461 C CG  . LEU B 1 166 ? -69.797  -10.664 18.777  1.00 80.00  ? 191 LEU B CG  1 
ATOM   3462 C CD1 . LEU B 1 166 ? -70.203  -12.085 19.091  1.00 88.33  ? 191 LEU B CD1 1 
ATOM   3463 C CD2 . LEU B 1 166 ? -69.837  -10.401 17.289  1.00 78.47  ? 191 LEU B CD2 1 
ATOM   3464 N N   . ILE B 1 167 ? -68.362  -10.746 21.731  1.00 81.93  ? 192 ILE B N   1 
ATOM   3465 C CA  . ILE B 1 167 ? -66.955  -10.764 22.097  1.00 77.27  ? 192 ILE B CA  1 
ATOM   3466 C C   . ILE B 1 167 ? -66.236  -11.821 21.285  1.00 80.66  ? 192 ILE B C   1 
ATOM   3467 O O   . ILE B 1 167 ? -66.400  -13.012 21.509  1.00 86.27  ? 192 ILE B O   1 
ATOM   3468 C CB  . ILE B 1 167 ? -66.783  -11.091 23.583  1.00 79.83  ? 192 ILE B CB  1 
ATOM   3469 C CG1 . ILE B 1 167 ? -67.554  -10.082 24.429  1.00 87.88  ? 192 ILE B CG1 1 
ATOM   3470 C CG2 . ILE B 1 167 ? -65.315  -11.117 23.960  1.00 58.71  ? 192 ILE B CG2 1 
ATOM   3471 C CD1 . ILE B 1 167 ? -67.341  -10.237 25.891  1.00 89.41  ? 192 ILE B CD1 1 
ATOM   3472 N N   . LYS B 1 168 ? -65.446  -11.376 20.324  1.00 96.75  ? 193 LYS B N   1 
ATOM   3473 C CA  . LYS B 1 168 ? -64.712  -12.285 19.468  1.00 78.15  ? 193 LYS B CA  1 
ATOM   3474 C C   . LYS B 1 168 ? -63.249  -12.329 19.926  1.00 89.25  ? 193 LYS B C   1 
ATOM   3475 O O   . LYS B 1 168 ? -62.618  -11.279 20.073  1.00 84.79  ? 193 LYS B O   1 
ATOM   3476 C CB  . LYS B 1 168 ? -64.842  -11.829 18.005  1.00 61.51  ? 193 LYS B CB  1 
ATOM   3477 N N   . ASN B 1 169 ? -62.717  -13.531 20.159  1.00 84.56  ? 194 ASN B N   1 
ATOM   3478 C CA  . ASN B 1 169 ? -61.371  -13.686 20.720  1.00 87.03  ? 194 ASN B CA  1 
ATOM   3479 C C   . ASN B 1 169 ? -60.523  -14.712 19.970  1.00 97.56  ? 194 ASN B C   1 
ATOM   3480 O O   . ASN B 1 169 ? -60.721  -15.917 20.086  1.00 101.06 ? 194 ASN B O   1 
ATOM   3481 C CB  . ASN B 1 169 ? -61.444  -14.065 22.208  1.00 92.25  ? 194 ASN B CB  1 
ATOM   3482 C CG  . ASN B 1 169 ? -60.070  -14.187 22.852  1.00 98.41  ? 194 ASN B CG  1 
ATOM   3483 O OD1 . ASN B 1 169 ? -59.912  -14.814 23.905  1.00 93.84  ? 194 ASN B OD1 1 
ATOM   3484 N ND2 . ASN B 1 169 ? -59.068  -13.585 22.220  1.00 91.30  ? 194 ASN B ND2 1 
ATOM   3485 N N   . ASN B 1 170 ? -59.575  -14.211 19.191  1.00 108.89 ? 195 ASN B N   1 
ATOM   3486 C CA  . ASN B 1 170 ? -58.592  -15.047 18.522  1.00 114.92 ? 195 ASN B CA  1 
ATOM   3487 C C   . ASN B 1 170 ? -57.333  -15.158 19.387  1.00 111.00 ? 195 ASN B C   1 
ATOM   3488 O O   . ASN B 1 170 ? -56.797  -14.143 19.844  1.00 100.36 ? 195 ASN B O   1 
ATOM   3489 C CB  . ASN B 1 170 ? -58.272  -14.458 17.136  1.00 132.90 ? 195 ASN B CB  1 
ATOM   3490 C CG  . ASN B 1 170 ? -57.115  -15.170 16.434  1.00 155.23 ? 195 ASN B CG  1 
ATOM   3491 O OD1 . ASN B 1 170 ? -56.635  -16.213 16.890  1.00 161.35 ? 195 ASN B OD1 1 
ATOM   3492 N ND2 . ASN B 1 170 ? -56.664  -14.605 15.316  1.00 148.83 ? 195 ASN B ND2 1 
ATOM   3493 N N   . ILE B 1 171 ? -56.859  -16.381 19.611  1.00 101.77 ? 196 ILE B N   1 
ATOM   3494 C CA  . ILE B 1 171 ? -55.643  -16.571 20.395  1.00 114.68 ? 196 ILE B CA  1 
ATOM   3495 C C   . ILE B 1 171 ? -54.663  -17.514 19.713  1.00 118.23 ? 196 ILE B C   1 
ATOM   3496 O O   . ILE B 1 171 ? -55.045  -18.300 18.846  1.00 103.84 ? 196 ILE B O   1 
ATOM   3497 C CB  . ILE B 1 171 ? -55.934  -17.079 21.825  1.00 104.64 ? 196 ILE B CB  1 
ATOM   3498 C CG1 . ILE B 1 171 ? -56.753  -18.375 21.801  1.00 104.59 ? 196 ILE B CG1 1 
ATOM   3499 C CG2 . ILE B 1 171 ? -56.640  -16.013 22.640  1.00 101.43 ? 196 ILE B CG2 1 
ATOM   3500 C CD1 . ILE B 1 171 ? -55.940  -19.617 21.574  1.00 97.08  ? 196 ILE B CD1 1 
ATOM   3501 N N   . ARG B 1 172 ? -53.399  -17.431 20.124  1.00 122.05 ? 197 ARG B N   1 
ATOM   3502 C CA  . ARG B 1 172 ? -52.337  -18.251 19.548  1.00 123.24 ? 197 ARG B CA  1 
ATOM   3503 C C   . ARG B 1 172 ? -51.243  -18.551 20.564  1.00 125.24 ? 197 ARG B C   1 
ATOM   3504 O O   . ARG B 1 172 ? -50.918  -17.721 21.413  1.00 108.15 ? 197 ARG B O   1 
ATOM   3505 C CB  . ARG B 1 172 ? -51.715  -17.577 18.315  1.00 109.49 ? 197 ARG B CB  1 
ATOM   3506 C CG  . ARG B 1 172 ? -50.457  -18.285 17.773  1.00 115.32 ? 197 ARG B CG  1 
ATOM   3507 C CD  . ARG B 1 172 ? -50.082  -17.800 16.369  1.00 138.83 ? 197 ARG B CD  1 
ATOM   3508 N NE  . ARG B 1 172 ? -48.979  -18.553 15.767  1.00 124.54 ? 197 ARG B NE  1 
ATOM   3509 C CZ  . ARG B 1 172 ? -47.734  -18.097 15.649  1.00 136.87 ? 197 ARG B CZ  1 
ATOM   3510 N NH1 . ARG B 1 172 ? -47.418  -16.885 16.085  1.00 121.90 ? 197 ARG B NH1 1 
ATOM   3511 N NH2 . ARG B 1 172 ? -46.800  -18.854 15.089  1.00 144.73 ? 197 ARG B NH2 1 
ATOM   3512 N N   . TYR B 1 173 ? -50.685  -19.752 20.466  1.00 135.47 ? 198 TYR B N   1 
ATOM   3513 C CA  . TYR B 1 173 ? -49.496  -20.111 21.218  1.00 128.07 ? 198 TYR B CA  1 
ATOM   3514 C C   . TYR B 1 173 ? -48.285  -20.140 20.301  1.00 127.34 ? 198 TYR B C   1 
ATOM   3515 O O   . TYR B 1 173 ? -48.121  -21.072 19.516  1.00 121.55 ? 198 TYR B O   1 
ATOM   3516 C CB  . TYR B 1 173 ? -49.673  -21.477 21.845  1.00 116.03 ? 198 TYR B CB  1 
ATOM   3517 C CG  . TYR B 1 173 ? -50.766  -21.524 22.870  1.00 119.81 ? 198 TYR B CG  1 
ATOM   3518 C CD1 . TYR B 1 173 ? -52.023  -21.987 22.537  1.00 122.12 ? 198 TYR B CD1 1 
ATOM   3519 C CD2 . TYR B 1 173 ? -50.542  -21.104 24.172  1.00 123.20 ? 198 TYR B CD2 1 
ATOM   3520 C CE1 . TYR B 1 173 ? -53.025  -22.042 23.472  1.00 126.80 ? 198 TYR B CE1 1 
ATOM   3521 C CE2 . TYR B 1 173 ? -51.538  -21.153 25.115  1.00 118.69 ? 198 TYR B CE2 1 
ATOM   3522 C CZ  . TYR B 1 173 ? -52.778  -21.623 24.759  1.00 117.00 ? 198 TYR B CZ  1 
ATOM   3523 O OH  . TYR B 1 173 ? -53.780  -21.675 25.692  1.00 112.23 ? 198 TYR B OH  1 
ATOM   3524 N N   . PRO B 1 174 ? -47.420  -19.127 20.418  1.00 121.43 ? 199 PRO B N   1 
ATOM   3525 C CA  . PRO B 1 174 ? -46.262  -18.957 19.540  1.00 124.06 ? 199 PRO B CA  1 
ATOM   3526 C C   . PRO B 1 174 ? -45.414  -20.221 19.491  1.00 135.59 ? 199 PRO B C   1 
ATOM   3527 O O   . PRO B 1 174 ? -45.117  -20.718 18.401  1.00 122.60 ? 199 PRO B O   1 
ATOM   3528 C CB  . PRO B 1 174 ? -45.482  -17.825 20.213  1.00 145.78 ? 199 PRO B CB  1 
ATOM   3529 C CG  . PRO B 1 174 ? -46.506  -17.084 21.007  1.00 139.07 ? 199 PRO B CG  1 
ATOM   3530 C CD  . PRO B 1 174 ? -47.446  -18.131 21.498  1.00 122.02 ? 199 PRO B CD  1 
ATOM   3531 N N   . LYS B 1 175 ? -45.051  -20.745 20.660  1.00 148.87 ? 200 LYS B N   1 
ATOM   3532 C CA  . LYS B 1 175 ? -44.162  -21.906 20.739  1.00 142.93 ? 200 LYS B CA  1 
ATOM   3533 C C   . LYS B 1 175 ? -44.677  -23.087 19.919  1.00 128.81 ? 200 LYS B C   1 
ATOM   3534 O O   . LYS B 1 175 ? -43.944  -23.657 19.106  1.00 139.26 ? 200 LYS B O   1 
ATOM   3535 C CB  . LYS B 1 175 ? -43.931  -22.323 22.198  1.00 100.38 ? 200 LYS B CB  1 
ATOM   3536 N N   . PHE B 1 176 ? -45.940  -23.441 20.129  1.00 119.20 ? 201 PHE B N   1 
ATOM   3537 C CA  . PHE B 1 176 ? -46.534  -24.598 19.462  1.00 130.88 ? 201 PHE B CA  1 
ATOM   3538 C C   . PHE B 1 176 ? -47.167  -24.292 18.105  1.00 140.82 ? 201 PHE B C   1 
ATOM   3539 O O   . PHE B 1 176 ? -47.924  -25.111 17.569  1.00 118.21 ? 201 PHE B O   1 
ATOM   3540 C CB  . PHE B 1 176 ? -47.566  -25.251 20.373  1.00 123.54 ? 201 PHE B CB  1 
ATOM   3541 C CG  . PHE B 1 176 ? -47.061  -25.511 21.749  1.00 124.03 ? 201 PHE B CG  1 
ATOM   3542 C CD1 . PHE B 1 176 ? -45.876  -26.195 21.941  1.00 130.13 ? 201 PHE B CD1 1 
ATOM   3543 C CD2 . PHE B 1 176 ? -47.765  -25.075 22.853  1.00 133.76 ? 201 PHE B CD2 1 
ATOM   3544 C CE1 . PHE B 1 176 ? -45.401  -26.439 23.206  1.00 143.03 ? 201 PHE B CE1 1 
ATOM   3545 C CE2 . PHE B 1 176 ? -47.294  -25.318 24.125  1.00 140.19 ? 201 PHE B CE2 1 
ATOM   3546 C CZ  . PHE B 1 176 ? -46.109  -26.002 24.301  1.00 145.62 ? 201 PHE B CZ  1 
ATOM   3547 N N   . ASN B 1 177 ? -46.863  -23.120 17.555  1.00 143.40 ? 202 ASN B N   1 
ATOM   3548 C CA  . ASN B 1 177 ? -47.462  -22.696 16.294  1.00 140.29 ? 202 ASN B CA  1 
ATOM   3549 C C   . ASN B 1 177 ? -48.902  -23.180 16.183  1.00 135.34 ? 202 ASN B C   1 
ATOM   3550 O O   . ASN B 1 177 ? -49.282  -23.818 15.204  1.00 124.14 ? 202 ASN B O   1 
ATOM   3551 C CB  . ASN B 1 177 ? -46.642  -23.193 15.105  1.00 135.09 ? 202 ASN B CB  1 
ATOM   3552 C CG  . ASN B 1 177 ? -47.133  -22.631 13.792  1.00 143.57 ? 202 ASN B CG  1 
ATOM   3553 O OD1 . ASN B 1 177 ? -48.065  -21.824 13.760  1.00 127.78 ? 202 ASN B OD1 1 
ATOM   3554 N ND2 . ASN B 1 177 ? -46.510  -23.051 12.698  1.00 145.34 ? 202 ASN B ND2 1 
ATOM   3555 N N   . PHE B 1 178 ? -49.690  -22.883 17.210  1.00 139.46 ? 203 PHE B N   1 
ATOM   3556 C CA  . PHE B 1 178 ? -51.068  -23.331 17.282  1.00 119.95 ? 203 PHE B CA  1 
ATOM   3557 C C   . PHE B 1 178 ? -51.971  -22.171 17.659  1.00 119.13 ? 203 PHE B C   1 
ATOM   3558 O O   . PHE B 1 178 ? -51.630  -21.371 18.529  1.00 122.24 ? 203 PHE B O   1 
ATOM   3559 C CB  . PHE B 1 178 ? -51.210  -24.431 18.327  1.00 121.62 ? 203 PHE B CB  1 
ATOM   3560 C CG  . PHE B 1 178 ? -52.619  -24.636 18.788  1.00 127.50 ? 203 PHE B CG  1 
ATOM   3561 C CD1 . PHE B 1 178 ? -53.516  -25.343 18.009  1.00 140.74 ? 203 PHE B CD1 1 
ATOM   3562 C CD2 . PHE B 1 178 ? -53.054  -24.111 19.990  1.00 115.87 ? 203 PHE B CD2 1 
ATOM   3563 C CE1 . PHE B 1 178 ? -54.817  -25.530 18.424  1.00 133.17 ? 203 PHE B CE1 1 
ATOM   3564 C CE2 . PHE B 1 178 ? -54.356  -24.296 20.409  1.00 113.89 ? 203 PHE B CE2 1 
ATOM   3565 C CZ  . PHE B 1 178 ? -55.237  -25.006 19.627  1.00 117.74 ? 203 PHE B CZ  1 
ATOM   3566 N N   . ASN B 1 179 ? -53.129  -22.089 17.013  1.00 114.03 ? 204 ASN B N   1 
ATOM   3567 C CA  . ASN B 1 179 ? -54.081  -21.028 17.311  1.00 124.78 ? 204 ASN B CA  1 
ATOM   3568 C C   . ASN B 1 179 ? -55.538  -21.423 17.096  1.00 120.20 ? 204 ASN B C   1 
ATOM   3569 O O   . ASN B 1 179 ? -55.842  -22.356 16.354  1.00 111.95 ? 204 ASN B O   1 
ATOM   3570 C CB  . ASN B 1 179 ? -53.737  -19.757 16.531  1.00 120.30 ? 204 ASN B CB  1 
ATOM   3571 C CG  . ASN B 1 179 ? -53.217  -20.048 15.140  1.00 121.34 ? 204 ASN B CG  1 
ATOM   3572 O OD1 . ASN B 1 179 ? -52.222  -19.466 14.701  1.00 99.27  ? 204 ASN B OD1 1 
ATOM   3573 N ND2 . ASN B 1 179 ? -53.887  -20.955 14.438  1.00 134.94 ? 204 ASN B ND2 1 
ATOM   3574 N N   . LYS B 1 180 ? -56.433  -20.692 17.750  1.00 115.99 ? 205 LYS B N   1 
ATOM   3575 C CA  . LYS B 1 180 ? -57.848  -21.022 17.722  1.00 108.69 ? 205 LYS B CA  1 
ATOM   3576 C C   . LYS B 1 180 ? -58.689  -19.812 18.127  1.00 114.04 ? 205 LYS B C   1 
ATOM   3577 O O   . LYS B 1 180 ? -58.156  -18.832 18.661  1.00 111.33 ? 205 LYS B O   1 
ATOM   3578 C CB  . LYS B 1 180 ? -58.123  -22.209 18.647  1.00 99.03  ? 205 LYS B CB  1 
ATOM   3579 C CG  . LYS B 1 180 ? -59.504  -22.767 18.500  1.00 98.65  ? 205 LYS B CG  1 
ATOM   3580 C CD  . LYS B 1 180 ? -59.692  -24.014 19.304  1.00 86.51  ? 205 LYS B CD  1 
ATOM   3581 C CE  . LYS B 1 180 ? -61.126  -24.467 19.179  1.00 99.38  ? 205 LYS B CE  1 
ATOM   3582 N NZ  . LYS B 1 180 ? -61.308  -25.837 19.715  1.00 125.15 ? 205 LYS B NZ  1 
ATOM   3583 N N   . ARG B 1 181 ? -59.998  -19.886 17.868  1.00 107.99 ? 206 ARG B N   1 
ATOM   3584 C CA  . ARG B 1 181 ? -60.913  -18.764 18.100  1.00 112.75 ? 206 ARG B CA  1 
ATOM   3585 C C   . ARG B 1 181 ? -62.121  -19.179 18.949  1.00 108.76 ? 206 ARG B C   1 
ATOM   3586 O O   . ARG B 1 181 ? -62.590  -20.316 18.862  1.00 110.21 ? 206 ARG B O   1 
ATOM   3587 C CB  . ARG B 1 181 ? -61.381  -18.176 16.766  1.00 104.64 ? 206 ARG B CB  1 
ATOM   3588 C CG  . ARG B 1 181 ? -60.300  -18.159 15.707  1.00 117.80 ? 206 ARG B CG  1 
ATOM   3589 C CD  . ARG B 1 181 ? -60.738  -17.491 14.413  1.00 130.99 ? 206 ARG B CD  1 
ATOM   3590 N NE  . ARG B 1 181 ? -59.693  -17.614 13.397  1.00 171.39 ? 206 ARG B NE  1 
ATOM   3591 C CZ  . ARG B 1 181 ? -59.582  -16.829 12.327  1.00 159.16 ? 206 ARG B CZ  1 
ATOM   3592 N NH1 . ARG B 1 181 ? -60.454  -15.851 12.129  1.00 152.21 ? 206 ARG B NH1 1 
ATOM   3593 N NH2 . ARG B 1 181 ? -58.592  -17.013 11.455  1.00 123.37 ? 206 ARG B NH2 1 
ATOM   3594 N N   . ASN B 1 182 ? -62.614  -18.254 19.772  1.00 103.53 ? 207 ASN B N   1 
ATOM   3595 C CA  . ASN B 1 182 ? -63.689  -18.550 20.719  1.00 107.14 ? 207 ASN B CA  1 
ATOM   3596 C C   . ASN B 1 182 ? -65.010  -18.911 20.047  1.00 109.08 ? 207 ASN B C   1 
ATOM   3597 O O   . ASN B 1 182 ? -65.986  -19.271 20.711  1.00 96.29  ? 207 ASN B O   1 
ATOM   3598 C CB  . ASN B 1 182 ? -63.896  -17.376 21.671  1.00 98.04  ? 207 ASN B CB  1 
ATOM   3599 C CG  . ASN B 1 182 ? -64.381  -16.152 20.962  1.00 105.09 ? 207 ASN B CG  1 
ATOM   3600 O OD1 . ASN B 1 182 ? -63.875  -15.807 19.895  1.00 102.87 ? 207 ASN B OD1 1 
ATOM   3601 N ND2 . ASN B 1 182 ? -65.380  -15.490 21.534  1.00 93.85  ? 207 ASN B ND2 1 
ATOM   3602 N N   . ILE B 1 183 ? -65.048  -18.786 18.727  1.00 107.85 ? 208 ILE B N   1 
ATOM   3603 C CA  . ILE B 1 183 ? -66.188  -19.263 17.960  1.00 120.63 ? 208 ILE B CA  1 
ATOM   3604 C C   . ILE B 1 183 ? -65.854  -20.621 17.370  1.00 133.89 ? 208 ILE B C   1 
ATOM   3605 O O   . ILE B 1 183 ? -65.199  -20.710 16.332  1.00 126.08 ? 208 ILE B O   1 
ATOM   3606 C CB  . ILE B 1 183 ? -66.532  -18.323 16.801  1.00 111.20 ? 208 ILE B CB  1 
ATOM   3607 C CG1 . ILE B 1 183 ? -66.631  -16.883 17.292  1.00 74.80  ? 208 ILE B CG1 1 
ATOM   3608 C CG2 . ILE B 1 183 ? -67.830  -18.753 16.144  1.00 119.95 ? 208 ILE B CG2 1 
ATOM   3609 C CD1 . ILE B 1 183 ? -66.723  -15.891 16.166  1.00 106.08 ? 208 ILE B CD1 1 
ATOM   3610 N N   . LEU B 1 184 ? -66.311  -21.677 18.028  1.00 128.20 ? 209 LEU B N   1 
ATOM   3611 C CA  . LEU B 1 184 ? -65.987  -23.035 17.614  1.00 133.17 ? 209 LEU B CA  1 
ATOM   3612 C C   . LEU B 1 184 ? -66.569  -23.355 16.237  1.00 145.83 ? 209 LEU B C   1 
ATOM   3613 O O   . LEU B 1 184 ? -67.609  -22.813 15.865  1.00 155.28 ? 209 LEU B O   1 
ATOM   3614 C CB  . LEU B 1 184 ? -66.492  -24.023 18.663  1.00 155.99 ? 209 LEU B CB  1 
ATOM   3615 C CG  . LEU B 1 184 ? -65.763  -24.035 20.014  1.00 131.72 ? 209 LEU B CG  1 
ATOM   3616 C CD1 . LEU B 1 184 ? -65.828  -22.688 20.722  1.00 125.15 ? 209 LEU B CD1 1 
ATOM   3617 C CD2 . LEU B 1 184 ? -66.324  -25.131 20.909  1.00 152.49 ? 209 LEU B CD2 1 
ATOM   3618 N N   . PRO B 1 185 ? -65.894  -24.237 15.476  1.00 152.32 ? 210 PRO B N   1 
ATOM   3619 C CA  . PRO B 1 185 ? -66.224  -24.537 14.072  1.00 161.24 ? 210 PRO B CA  1 
ATOM   3620 C C   . PRO B 1 185 ? -67.568  -25.237 13.910  1.00 143.21 ? 210 PRO B C   1 
ATOM   3621 O O   . PRO B 1 185 ? -68.183  -25.184 12.840  1.00 117.04 ? 210 PRO B O   1 
ATOM   3622 C CB  . PRO B 1 185 ? -65.097  -25.484 13.639  1.00 161.55 ? 210 PRO B CB  1 
ATOM   3623 C CG  . PRO B 1 185 ? -64.002  -25.278 14.642  1.00 147.37 ? 210 PRO B CG  1 
ATOM   3624 C CD  . PRO B 1 185 ? -64.700  -24.972 15.926  1.00 125.12 ? 210 PRO B CD  1 
ATOM   3625 N N   . ASN B 1 186 ? -68.005  -25.899 14.973  1.00 148.65 ? 211 ASN B N   1 
ATOM   3626 C CA  . ASN B 1 186 ? -69.281  -26.593 14.971  1.00 161.89 ? 211 ASN B CA  1 
ATOM   3627 C C   . ASN B 1 186 ? -70.425  -25.642 15.277  1.00 151.33 ? 211 ASN B C   1 
ATOM   3628 O O   . ASN B 1 186 ? -71.283  -25.958 16.098  1.00 162.31 ? 211 ASN B O   1 
ATOM   3629 C CB  . ASN B 1 186 ? -69.257  -27.731 15.980  1.00 164.88 ? 211 ASN B CB  1 
ATOM   3630 N N   . ILE B 1 187 ? -70.446  -24.481 14.628  1.00 131.18 ? 212 ILE B N   1 
ATOM   3631 C CA  . ILE B 1 187 ? -71.481  -23.494 14.937  1.00 134.06 ? 212 ILE B CA  1 
ATOM   3632 C C   . ILE B 1 187 ? -72.086  -22.782 13.719  1.00 135.64 ? 212 ILE B C   1 
ATOM   3633 O O   . ILE B 1 187 ? -71.368  -22.172 12.919  1.00 112.88 ? 212 ILE B O   1 
ATOM   3634 C CB  . ILE B 1 187 ? -70.991  -22.446 15.974  1.00 122.70 ? 212 ILE B CB  1 
ATOM   3635 C CG1 . ILE B 1 187 ? -70.698  -23.120 17.320  1.00 127.68 ? 212 ILE B CG1 1 
ATOM   3636 C CG2 . ILE B 1 187 ? -72.026  -21.361 16.159  1.00 106.20 ? 212 ILE B CG2 1 
ATOM   3637 C CD1 . ILE B 1 187 ? -70.289  -22.161 18.418  1.00 134.83 ? 212 ILE B CD1 1 
ATOM   3638 N N   . ASN B 1 188 ? -73.415  -22.883 13.608  1.00 142.94 ? 213 ASN B N   1 
ATOM   3639 C CA  . ASN B 1 188 ? -74.211  -22.214 12.587  1.00 105.44 ? 213 ASN B CA  1 
ATOM   3640 C C   . ASN B 1 188 ? -74.058  -20.704 12.696  1.00 109.33 ? 213 ASN B C   1 
ATOM   3641 O O   . ASN B 1 188 ? -73.853  -20.183 13.781  1.00 105.44 ? 213 ASN B O   1 
ATOM   3642 C CB  . ASN B 1 188 ? -75.683  -22.569 12.777  1.00 88.45  ? 213 ASN B CB  1 
ATOM   3643 C CG  . ASN B 1 188 ? -75.891  -23.988 13.259  1.00 110.88 ? 213 ASN B CG  1 
ATOM   3644 O OD1 . ASN B 1 188 ? -75.237  -24.936 12.806  1.00 117.34 ? 213 ASN B OD1 1 
ATOM   3645 N ND2 . ASN B 1 188 ? -76.826  -24.154 14.173  1.00 112.88 ? 213 ASN B ND2 1 
ATOM   3646 N N   . SER B 1 189 ? -74.151  -20.004 11.570  1.00 127.46 ? 214 SER B N   1 
ATOM   3647 C CA  . SER B 1 189 ? -74.117  -18.540 11.560  1.00 110.78 ? 214 SER B CA  1 
ATOM   3648 C C   . SER B 1 189 ? -75.466  -17.964 11.958  1.00 108.83 ? 214 SER B C   1 
ATOM   3649 O O   . SER B 1 189 ? -75.538  -16.947 12.642  1.00 105.35 ? 214 SER B O   1 
ATOM   3650 C CB  . SER B 1 189 ? -73.717  -18.019 10.183  1.00 121.53 ? 214 SER B CB  1 
ATOM   3651 O OG  . SER B 1 189 ? -72.590  -18.727 9.693   1.00 153.61 ? 214 SER B OG  1 
ATOM   3652 N N   . SER B 1 190 ? -76.537  -18.618 11.517  1.00 119.33 ? 215 SER B N   1 
ATOM   3653 C CA  . SER B 1 190 ? -77.876  -18.260 11.961  1.00 117.90 ? 215 SER B CA  1 
ATOM   3654 C C   . SER B 1 190 ? -77.989  -18.444 13.480  1.00 115.97 ? 215 SER B C   1 
ATOM   3655 O O   . SER B 1 190 ? -78.805  -17.795 14.139  1.00 107.06 ? 215 SER B O   1 
ATOM   3656 C CB  . SER B 1 190 ? -78.939  -19.092 11.236  1.00 88.39  ? 215 SER B CB  1 
ATOM   3657 O OG  . SER B 1 190 ? -79.375  -18.434 10.062  1.00 99.55  ? 215 SER B OG  1 
ATOM   3658 N N   . TYR B 1 191 ? -77.166  -19.325 14.043  1.00 110.77 ? 216 TYR B N   1 
ATOM   3659 C CA  . TYR B 1 191 ? -77.206  -19.545 15.479  1.00 103.95 ? 216 TYR B CA  1 
ATOM   3660 C C   . TYR B 1 191 ? -76.781  -18.284 16.207  1.00 112.24 ? 216 TYR B C   1 
ATOM   3661 O O   . TYR B 1 191 ? -77.451  -17.832 17.130  1.00 124.29 ? 216 TYR B O   1 
ATOM   3662 C CB  . TYR B 1 191 ? -76.315  -20.711 15.892  1.00 110.56 ? 216 TYR B CB  1 
ATOM   3663 C CG  . TYR B 1 191 ? -76.201  -20.870 17.397  1.00 106.05 ? 216 TYR B CG  1 
ATOM   3664 C CD1 . TYR B 1 191 ? -74.966  -20.834 18.024  1.00 110.45 ? 216 TYR B CD1 1 
ATOM   3665 C CD2 . TYR B 1 191 ? -77.330  -21.048 18.189  1.00 105.42 ? 216 TYR B CD2 1 
ATOM   3666 C CE1 . TYR B 1 191 ? -74.856  -20.973 19.391  1.00 118.71 ? 216 TYR B CE1 1 
ATOM   3667 C CE2 . TYR B 1 191 ? -77.229  -21.188 19.558  1.00 113.19 ? 216 TYR B CE2 1 
ATOM   3668 C CZ  . TYR B 1 191 ? -75.991  -21.150 20.154  1.00 111.83 ? 216 TYR B CZ  1 
ATOM   3669 O OH  . TYR B 1 191 ? -75.884  -21.292 21.520  1.00 97.65  ? 216 TYR B OH  1 
ATOM   3670 N N   . LEU B 1 192 ? -75.663  -17.715 15.776  1.00 109.79 ? 217 LEU B N   1 
ATOM   3671 C CA  . LEU B 1 192 ? -75.130  -16.507 16.387  1.00 105.68 ? 217 LEU B CA  1 
ATOM   3672 C C   . LEU B 1 192 ? -75.966  -15.279 16.026  1.00 118.87 ? 217 LEU B C   1 
ATOM   3673 O O   . LEU B 1 192 ? -75.739  -14.187 16.544  1.00 98.19  ? 217 LEU B O   1 
ATOM   3674 C CB  . LEU B 1 192 ? -73.667  -16.324 15.983  1.00 84.60  ? 217 LEU B CB  1 
ATOM   3675 C CG  . LEU B 1 192 ? -72.874  -17.637 16.093  1.00 103.67 ? 217 LEU B CG  1 
ATOM   3676 C CD1 . LEU B 1 192 ? -71.437  -17.507 15.620  1.00 73.09  ? 217 LEU B CD1 1 
ATOM   3677 C CD2 . LEU B 1 192 ? -72.923  -18.163 17.518  1.00 126.84 ? 217 LEU B CD2 1 
ATOM   3678 N N   . THR B 1 193 ? -76.946  -15.472 15.148  1.00 137.33 ? 218 THR B N   1 
ATOM   3679 C CA  . THR B 1 193 ? -77.872  -14.408 14.769  1.00 136.51 ? 218 THR B CA  1 
ATOM   3680 C C   . THR B 1 193 ? -78.777  -13.969 15.921  1.00 142.66 ? 218 THR B C   1 
ATOM   3681 O O   . THR B 1 193 ? -79.236  -12.831 15.954  1.00 145.63 ? 218 THR B O   1 
ATOM   3682 C CB  . THR B 1 193 ? -78.779  -14.848 13.605  1.00 148.65 ? 218 THR B CB  1 
ATOM   3683 O OG1 . THR B 1 193 ? -78.880  -13.790 12.649  1.00 162.08 ? 218 THR B OG1 1 
ATOM   3684 C CG2 . THR B 1 193 ? -80.189  -15.217 14.116  1.00 138.08 ? 218 THR B CG2 1 
ATOM   3685 N N   . HIS B 1 194 ? -79.047  -14.872 16.858  1.00 130.93 ? 219 HIS B N   1 
ATOM   3686 C CA  . HIS B 1 194 ? -79.968  -14.556 17.948  1.00 156.15 ? 219 HIS B CA  1 
ATOM   3687 C C   . HIS B 1 194 ? -79.680  -15.312 19.256  1.00 147.88 ? 219 HIS B C   1 
ATOM   3688 O O   . HIS B 1 194 ? -80.395  -15.153 20.250  1.00 152.55 ? 219 HIS B O   1 
ATOM   3689 C CB  . HIS B 1 194 ? -81.424  -14.772 17.505  1.00 179.46 ? 219 HIS B CB  1 
ATOM   3690 C CG  . HIS B 1 194 ? -82.444  -14.315 18.511  1.00 213.39 ? 219 HIS B CG  1 
ATOM   3691 N ND1 . HIS B 1 194 ? -82.861  -13.000 18.607  1.00 205.54 ? 219 HIS B ND1 1 
ATOM   3692 C CD2 . HIS B 1 194 ? -83.132  -14.994 19.455  1.00 203.42 ? 219 HIS B CD2 1 
ATOM   3693 C CE1 . HIS B 1 194 ? -83.759  -12.896 19.570  1.00 174.17 ? 219 HIS B CE1 1 
ATOM   3694 N NE2 . HIS B 1 194 ? -83.943  -14.088 20.105  1.00 180.21 ? 219 HIS B NE2 1 
ATOM   3695 N N   . CYS B 1 195 ? -78.632  -16.125 19.268  1.00 123.29 ? 220 CYS B N   1 
ATOM   3696 C CA  . CYS B 1 195 ? -78.239  -16.779 20.508  1.00 117.42 ? 220 CYS B CA  1 
ATOM   3697 C C   . CYS B 1 195 ? -77.812  -15.732 21.529  1.00 113.43 ? 220 CYS B C   1 
ATOM   3698 O O   . CYS B 1 195 ? -77.514  -14.592 21.177  1.00 100.22 ? 220 CYS B O   1 
ATOM   3699 C CB  . CYS B 1 195 ? -77.108  -17.783 20.275  1.00 122.65 ? 220 CYS B CB  1 
ATOM   3700 S SG  . CYS B 1 195 ? -75.463  -17.045 20.169  1.00 130.33 ? 220 CYS B SG  1 
ATOM   3701 N N   . VAL B 1 196 ? -77.801  -16.137 22.797  1.00 118.27 ? 221 VAL B N   1 
ATOM   3702 C CA  . VAL B 1 196 ? -77.307  -15.322 23.905  1.00 93.91  ? 221 VAL B CA  1 
ATOM   3703 C C   . VAL B 1 196 ? -76.794  -16.230 24.997  1.00 90.67  ? 221 VAL B C   1 
ATOM   3704 O O   . VAL B 1 196 ? -77.512  -17.104 25.475  1.00 90.64  ? 221 VAL B O   1 
ATOM   3705 C CB  . VAL B 1 196 ? -78.391  -14.448 24.546  1.00 77.41  ? 221 VAL B CB  1 
ATOM   3706 C CG1 . VAL B 1 196 ? -77.809  -13.712 25.725  1.00 73.32  ? 221 VAL B CG1 1 
ATOM   3707 C CG2 . VAL B 1 196 ? -78.957  -13.466 23.535  1.00 106.19 ? 221 VAL B CG2 1 
ATOM   3708 N N   . PHE B 1 197 ? -75.553  -15.988 25.397  1.00 99.65  ? 222 PHE B N   1 
ATOM   3709 C CA  . PHE B 1 197 ? -74.863  -16.816 26.365  1.00 91.15  ? 222 PHE B CA  1 
ATOM   3710 C C   . PHE B 1 197 ? -75.657  -17.110 27.625  1.00 101.07 ? 222 PHE B C   1 
ATOM   3711 O O   . PHE B 1 197 ? -76.376  -16.263 28.144  1.00 107.47 ? 222 PHE B O   1 
ATOM   3712 C CB  . PHE B 1 197 ? -73.551  -16.162 26.759  1.00 87.31  ? 222 PHE B CB  1 
ATOM   3713 C CG  . PHE B 1 197 ? -72.776  -16.943 27.763  1.00 98.84  ? 222 PHE B CG  1 
ATOM   3714 C CD1 . PHE B 1 197 ? -71.886  -17.931 27.366  1.00 96.43  ? 222 PHE B CD1 1 
ATOM   3715 C CD2 . PHE B 1 197 ? -72.940  -16.696 29.110  1.00 103.40 ? 222 PHE B CD2 1 
ATOM   3716 C CE1 . PHE B 1 197 ? -71.177  -18.643 28.291  1.00 88.53  ? 222 PHE B CE1 1 
ATOM   3717 C CE2 . PHE B 1 197 ? -72.231  -17.407 30.040  1.00 105.54 ? 222 PHE B CE2 1 
ATOM   3718 C CZ  . PHE B 1 197 ? -71.349  -18.384 29.631  1.00 106.91 ? 222 PHE B CZ  1 
ATOM   3719 N N   . SER B 1 198 ? -75.488  -18.334 28.112  1.00 110.25 ? 223 SER B N   1 
ATOM   3720 C CA  . SER B 1 198 ? -76.031  -18.786 29.384  1.00 118.58 ? 223 SER B CA  1 
ATOM   3721 C C   . SER B 1 198 ? -75.325  -20.088 29.722  1.00 117.13 ? 223 SER B C   1 
ATOM   3722 O O   . SER B 1 198 ? -75.213  -20.965 28.872  1.00 100.50 ? 223 SER B O   1 
ATOM   3723 C CB  . SER B 1 198 ? -77.531  -19.026 29.290  1.00 109.33 ? 223 SER B CB  1 
ATOM   3724 O OG  . SER B 1 198 ? -77.799  -20.133 28.457  1.00 119.63 ? 223 SER B OG  1 
ATOM   3725 N N   . ARG B 1 199 ? -74.845  -20.210 30.955  1.00 131.29 ? 224 ARG B N   1 
ATOM   3726 C CA  . ARG B 1 199 ? -74.026  -21.353 31.343  1.00 129.70 ? 224 ARG B CA  1 
ATOM   3727 C C   . ARG B 1 199 ? -74.736  -22.662 31.017  1.00 135.50 ? 224 ARG B C   1 
ATOM   3728 O O   . ARG B 1 199 ? -74.127  -23.611 30.506  1.00 110.21 ? 224 ARG B O   1 
ATOM   3729 C CB  . ARG B 1 199 ? -73.702  -21.294 32.836  1.00 136.36 ? 224 ARG B CB  1 
ATOM   3730 C CG  . ARG B 1 199 ? -72.585  -22.233 33.266  1.00 136.61 ? 224 ARG B CG  1 
ATOM   3731 C CD  . ARG B 1 199 ? -71.233  -21.698 32.838  1.00 136.57 ? 224 ARG B CD  1 
ATOM   3732 N NE  . ARG B 1 199 ? -71.054  -20.319 33.269  1.00 140.13 ? 224 ARG B NE  1 
ATOM   3733 C CZ  . ARG B 1 199 ? -69.923  -19.635 33.141  1.00 129.66 ? 224 ARG B CZ  1 
ATOM   3734 N NH1 . ARG B 1 199 ? -68.849  -20.198 32.595  1.00 93.37  ? 224 ARG B NH1 1 
ATOM   3735 N NH2 . ARG B 1 199 ? -69.868  -18.380 33.562  1.00 128.46 ? 224 ARG B NH2 1 
ATOM   3736 N N   . LYS B 1 200 ? -76.033  -22.692 31.313  1.00 144.76 ? 225 LYS B N   1 
ATOM   3737 C CA  . LYS B 1 200 ? -76.870  -23.875 31.120  1.00 132.34 ? 225 LYS B CA  1 
ATOM   3738 C C   . LYS B 1 200 ? -77.085  -24.219 29.646  1.00 132.25 ? 225 LYS B C   1 
ATOM   3739 O O   . LYS B 1 200 ? -76.399  -25.084 29.092  1.00 96.20  ? 225 LYS B O   1 
ATOM   3740 C CB  . LYS B 1 200 ? -78.220  -23.679 31.814  1.00 97.15  ? 225 LYS B CB  1 
ATOM   3741 N N   . THR B 1 201 ? -78.041  -23.532 29.023  1.00 121.66 ? 226 THR B N   1 
ATOM   3742 C CA  . THR B 1 201 ? -78.472  -23.843 27.664  1.00 101.90 ? 226 THR B CA  1 
ATOM   3743 C C   . THR B 1 201 ? -77.403  -23.603 26.571  1.00 115.93 ? 226 THR B C   1 
ATOM   3744 O O   . THR B 1 201 ? -76.941  -24.556 25.938  1.00 105.27 ? 226 THR B O   1 
ATOM   3745 C CB  . THR B 1 201 ? -79.794  -23.104 27.312  1.00 108.57 ? 226 THR B CB  1 
ATOM   3746 O OG1 . THR B 1 201 ? -79.530  -21.721 27.059  1.00 129.14 ? 226 THR B OG1 1 
ATOM   3747 C CG2 . THR B 1 201 ? -80.810  -23.221 28.442  1.00 97.96  ? 226 THR B CG2 1 
ATOM   3748 N N   . ASP B 1 202 ? -77.022  -22.345 26.347  1.00 111.15 ? 227 ASP B N   1 
ATOM   3749 C CA  . ASP B 1 202 ? -76.068  -21.995 25.293  1.00 91.01  ? 227 ASP B CA  1 
ATOM   3750 C C   . ASP B 1 202 ? -74.718  -21.544 25.843  1.00 104.62 ? 227 ASP B C   1 
ATOM   3751 O O   . ASP B 1 202 ? -74.505  -20.354 26.062  1.00 110.96 ? 227 ASP B O   1 
ATOM   3752 C CB  . ASP B 1 202 ? -76.632  -20.864 24.440  1.00 103.54 ? 227 ASP B CB  1 
ATOM   3753 C CG  . ASP B 1 202 ? -78.135  -20.953 24.263  1.00 114.31 ? 227 ASP B CG  1 
ATOM   3754 O OD1 . ASP B 1 202 ? -78.623  -21.980 23.737  1.00 128.07 ? 227 ASP B OD1 1 
ATOM   3755 O OD2 . ASP B 1 202 ? -78.827  -19.978 24.628  1.00 106.06 ? 227 ASP B OD2 1 
ATOM   3756 N N   . PRO B 1 203 ? -73.792  -22.485 26.053  1.00 103.93 ? 228 PRO B N   1 
ATOM   3757 C CA  . PRO B 1 203 ? -72.474  -22.192 26.627  1.00 115.36 ? 228 PRO B CA  1 
ATOM   3758 C C   . PRO B 1 203 ? -71.463  -21.710 25.591  1.00 117.88 ? 228 PRO B C   1 
ATOM   3759 O O   . PRO B 1 203 ? -70.425  -21.150 25.949  1.00 97.89  ? 228 PRO B O   1 
ATOM   3760 C CB  . PRO B 1 203 ? -72.030  -23.553 27.192  1.00 123.44 ? 228 PRO B CB  1 
ATOM   3761 C CG  . PRO B 1 203 ? -73.264  -24.443 27.131  1.00 117.38 ? 228 PRO B CG  1 
ATOM   3762 C CD  . PRO B 1 203 ? -74.027  -23.930 25.960  1.00 105.44 ? 228 PRO B CD  1 
ATOM   3763 N N   . ASP B 1 204 ? -71.771  -21.937 24.319  1.00 131.05 ? 229 ASP B N   1 
ATOM   3764 C CA  . ASP B 1 204 ? -70.866  -21.605 23.228  1.00 129.94 ? 229 ASP B CA  1 
ATOM   3765 C C   . ASP B 1 204 ? -71.282  -20.331 22.506  1.00 127.69 ? 229 ASP B C   1 
ATOM   3766 O O   . ASP B 1 204 ? -70.770  -20.024 21.429  1.00 125.82 ? 229 ASP B O   1 
ATOM   3767 C CB  . ASP B 1 204 ? -70.810  -22.759 22.233  1.00 138.76 ? 229 ASP B CB  1 
ATOM   3768 C CG  . ASP B 1 204 ? -70.256  -24.017 22.845  1.00 139.46 ? 229 ASP B CG  1 
ATOM   3769 O OD1 . ASP B 1 204 ? -69.251  -23.918 23.581  1.00 139.89 ? 229 ASP B OD1 1 
ATOM   3770 O OD2 . ASP B 1 204 ? -70.826  -25.098 22.590  1.00 154.19 ? 229 ASP B OD2 1 
ATOM   3771 N N   . CYS B 1 205 ? -72.224  -19.599 23.086  1.00 119.63 ? 230 CYS B N   1 
ATOM   3772 C CA  . CYS B 1 205 ? -72.690  -18.359 22.486  1.00 107.05 ? 230 CYS B CA  1 
ATOM   3773 C C   . CYS B 1 205 ? -71.882  -17.168 22.980  1.00 104.98 ? 230 CYS B C   1 
ATOM   3774 O O   . CYS B 1 205 ? -72.025  -16.760 24.119  1.00 117.77 ? 230 CYS B O   1 
ATOM   3775 C CB  . CYS B 1 205 ? -74.163  -18.153 22.816  1.00 107.16 ? 230 CYS B CB  1 
ATOM   3776 S SG  . CYS B 1 205 ? -74.847  -16.675 22.068  1.00 111.51 ? 230 CYS B SG  1 
ATOM   3777 N N   . PRO B 1 206 ? -71.047  -16.590 22.115  1.00 99.15  ? 231 PRO B N   1 
ATOM   3778 C CA  . PRO B 1 206 ? -70.118  -15.512 22.467  1.00 96.09  ? 231 PRO B CA  1 
ATOM   3779 C C   . PRO B 1 206 ? -70.789  -14.151 22.616  1.00 97.32  ? 231 PRO B C   1 
ATOM   3780 O O   . PRO B 1 206 ? -70.113  -13.154 22.826  1.00 96.96  ? 231 PRO B O   1 
ATOM   3781 C CB  . PRO B 1 206 ? -69.168  -15.457 21.269  1.00 92.80  ? 231 PRO B CB  1 
ATOM   3782 C CG  . PRO B 1 206 ? -69.616  -16.530 20.326  1.00 118.29 ? 231 PRO B CG  1 
ATOM   3783 C CD  . PRO B 1 206 ? -71.007  -16.893 20.683  1.00 115.96 ? 231 PRO B CD  1 
ATOM   3784 N N   . ILE B 1 207 ? -72.103  -14.103 22.470  1.00 93.45  ? 232 ILE B N   1 
ATOM   3785 C CA  . ILE B 1 207 ? -72.835  -12.861 22.648  1.00 89.26  ? 232 ILE B CA  1 
ATOM   3786 C C   . ILE B 1 207 ? -73.409  -12.829 24.049  1.00 87.78  ? 232 ILE B C   1 
ATOM   3787 O O   . ILE B 1 207 ? -74.379  -13.517 24.332  1.00 94.68  ? 232 ILE B O   1 
ATOM   3788 C CB  . ILE B 1 207 ? -73.990  -12.760 21.642  1.00 96.90  ? 232 ILE B CB  1 
ATOM   3789 C CG1 . ILE B 1 207 ? -73.518  -13.121 20.236  1.00 87.66  ? 232 ILE B CG1 1 
ATOM   3790 C CG2 . ILE B 1 207 ? -74.589  -11.377 21.644  1.00 96.30  ? 232 ILE B CG2 1 
ATOM   3791 C CD1 . ILE B 1 207 ? -74.614  -13.020 19.202  1.00 102.83 ? 232 ILE B CD1 1 
ATOM   3792 N N   . PHE B 1 208 ? -72.812  -12.034 24.931  1.00 91.30  ? 233 PHE B N   1 
ATOM   3793 C CA  . PHE B 1 208 ? -73.252  -11.998 26.323  1.00 80.84  ? 233 PHE B CA  1 
ATOM   3794 C C   . PHE B 1 208 ? -74.154  -10.824 26.588  1.00 85.56  ? 233 PHE B C   1 
ATOM   3795 O O   . PHE B 1 208 ? -73.890  -9.713  26.132  1.00 76.98  ? 233 PHE B O   1 
ATOM   3796 C CB  . PHE B 1 208 ? -72.065  -11.919 27.276  1.00 63.70  ? 233 PHE B CB  1 
ATOM   3797 C CG  . PHE B 1 208 ? -71.054  -13.003 27.082  1.00 82.84  ? 233 PHE B CG  1 
ATOM   3798 C CD1 . PHE B 1 208 ? -71.079  -14.146 27.855  1.00 89.98  ? 233 PHE B CD1 1 
ATOM   3799 C CD2 . PHE B 1 208 ? -70.064  -12.868 26.131  1.00 93.49  ? 233 PHE B CD2 1 
ATOM   3800 C CE1 . PHE B 1 208 ? -70.136  -15.140 27.677  1.00 102.46 ? 233 PHE B CE1 1 
ATOM   3801 C CE2 . PHE B 1 208 ? -69.123  -13.852 25.943  1.00 85.42  ? 233 PHE B CE2 1 
ATOM   3802 C CZ  . PHE B 1 208 ? -69.154  -14.995 26.717  1.00 98.59  ? 233 PHE B CZ  1 
ATOM   3803 N N   . ARG B 1 209 ? -75.216  -11.072 27.339  1.00 61.43  ? 234 ARG B N   1 
ATOM   3804 C CA  . ARG B 1 209 ? -76.076  -9.985  27.751  1.00 81.21  ? 234 ARG B CA  1 
ATOM   3805 C C   . ARG B 1 209 ? -75.439  -9.261  28.939  1.00 81.86  ? 234 ARG B C   1 
ATOM   3806 O O   . ARG B 1 209 ? -74.944  -9.910  29.850  1.00 85.82  ? 234 ARG B O   1 
ATOM   3807 C CB  . ARG B 1 209 ? -77.447  -10.524 28.123  1.00 80.46  ? 234 ARG B CB  1 
ATOM   3808 C CG  . ARG B 1 209 ? -78.348  -9.443  28.665  1.00 102.23 ? 234 ARG B CG  1 
ATOM   3809 C CD  . ARG B 1 209 ? -79.630  -9.981  29.243  1.00 99.67  ? 234 ARG B CD  1 
ATOM   3810 N NE  . ARG B 1 209 ? -79.952  -9.253  30.464  1.00 110.73 ? 234 ARG B NE  1 
ATOM   3811 C CZ  . ARG B 1 209 ? -81.002  -9.507  31.235  1.00 124.65 ? 234 ARG B CZ  1 
ATOM   3812 N NH1 . ARG B 1 209 ? -81.857  -10.475 30.905  1.00 127.75 ? 234 ARG B NH1 1 
ATOM   3813 N NH2 . ARG B 1 209 ? -81.199  -8.788  32.335  1.00 111.02 ? 234 ARG B NH2 1 
ATOM   3814 N N   . LEU B 1 210 ? -75.455  -7.928  28.944  1.00 91.62  ? 235 LEU B N   1 
ATOM   3815 C CA  . LEU B 1 210 ? -74.730  -7.170  29.967  1.00 91.54  ? 235 LEU B CA  1 
ATOM   3816 C C   . LEU B 1 210 ? -75.174  -7.537  31.382  1.00 95.00  ? 235 LEU B C   1 
ATOM   3817 O O   . LEU B 1 210 ? -74.364  -7.914  32.219  1.00 91.17  ? 235 LEU B O   1 
ATOM   3818 C CB  . LEU B 1 210 ? -74.845  -5.663  29.719  1.00 94.17  ? 235 LEU B CB  1 
ATOM   3819 C CG  . LEU B 1 210 ? -74.057  -5.131  28.513  1.00 78.34  ? 235 LEU B CG  1 
ATOM   3820 C CD1 . LEU B 1 210 ? -74.024  -3.620  28.501  1.00 63.82  ? 235 LEU B CD1 1 
ATOM   3821 C CD2 . LEU B 1 210 ? -72.654  -5.685  28.497  1.00 69.01  ? 235 LEU B CD2 1 
ATOM   3822 N N   . GLY B 1 211 ? -76.468  -7.440  31.640  1.00 101.77 ? 236 GLY B N   1 
ATOM   3823 C CA  . GLY B 1 211 ? -77.020  -7.857  32.913  1.00 94.73  ? 236 GLY B CA  1 
ATOM   3824 C C   . GLY B 1 211 ? -76.538  -9.221  33.350  1.00 95.89  ? 236 GLY B C   1 
ATOM   3825 O O   . GLY B 1 211 ? -76.112  -9.379  34.484  1.00 99.36  ? 236 GLY B O   1 
ATOM   3826 N N   . ASP B 1 212 ? -76.593  -10.210 32.460  1.00 101.88 ? 237 ASP B N   1 
ATOM   3827 C CA  . ASP B 1 212 ? -76.118  -11.558 32.801  1.00 99.71  ? 237 ASP B CA  1 
ATOM   3828 C C   . ASP B 1 212 ? -74.657  -11.535 33.210  1.00 87.99  ? 237 ASP B C   1 
ATOM   3829 O O   . ASP B 1 212 ? -74.226  -12.296 34.062  1.00 103.53 ? 237 ASP B O   1 
ATOM   3830 C CB  . ASP B 1 212 ? -76.284  -12.542 31.641  1.00 105.75 ? 237 ASP B CB  1 
ATOM   3831 C CG  . ASP B 1 212 ? -77.705  -12.594 31.112  1.00 123.34 ? 237 ASP B CG  1 
ATOM   3832 O OD1 . ASP B 1 212 ? -78.528  -11.731 31.502  1.00 113.30 ? 237 ASP B OD1 1 
ATOM   3833 O OD2 . ASP B 1 212 ? -77.995  -13.496 30.295  1.00 115.35 ? 237 ASP B OD2 1 
ATOM   3834 N N   . ILE B 1 213 ? -73.886  -10.662 32.585  1.00 93.54  ? 238 ILE B N   1 
ATOM   3835 C CA  . ILE B 1 213 ? -72.478  -10.552 32.917  1.00 95.67  ? 238 ILE B CA  1 
ATOM   3836 C C   . ILE B 1 213 ? -72.326  -10.081 34.349  1.00 89.85  ? 238 ILE B C   1 
ATOM   3837 O O   . ILE B 1 213 ? -71.611  -10.691 35.130  1.00 86.79  ? 238 ILE B O   1 
ATOM   3838 C CB  . ILE B 1 213 ? -71.747  -9.579  31.981  1.00 85.99  ? 238 ILE B CB  1 
ATOM   3839 C CG1 . ILE B 1 213 ? -71.437  -10.261 30.658  1.00 76.33  ? 238 ILE B CG1 1 
ATOM   3840 C CG2 . ILE B 1 213 ? -70.466  -9.098  32.614  1.00 79.96  ? 238 ILE B CG2 1 
ATOM   3841 C CD1 . ILE B 1 213 ? -70.560  -9.436  29.778  1.00 85.50  ? 238 ILE B CD1 1 
ATOM   3842 N N   . VAL B 1 214 ? -73.009  -8.994  34.687  1.00 85.35  ? 239 VAL B N   1 
ATOM   3843 C CA  . VAL B 1 214 ? -72.963  -8.437  36.036  1.00 83.43  ? 239 VAL B CA  1 
ATOM   3844 C C   . VAL B 1 214 ? -73.570  -9.397  37.040  1.00 99.78  ? 239 VAL B C   1 
ATOM   3845 O O   . VAL B 1 214 ? -73.027  -9.607  38.119  1.00 93.42  ? 239 VAL B O   1 
ATOM   3846 C CB  . VAL B 1 214 ? -73.763  -7.140  36.128  1.00 83.14  ? 239 VAL B CB  1 
ATOM   3847 C CG1 . VAL B 1 214 ? -73.942  -6.748  37.572  1.00 88.44  ? 239 VAL B CG1 1 
ATOM   3848 C CG2 . VAL B 1 214 ? -73.084  -6.042  35.338  1.00 98.78  ? 239 VAL B CG2 1 
ATOM   3849 N N   . GLY B 1 215 ? -74.708  -9.972  36.676  1.00 98.34  ? 240 GLY B N   1 
ATOM   3850 C CA  . GLY B 1 215 ? -75.376  -10.939 37.522  1.00 86.73  ? 240 GLY B CA  1 
ATOM   3851 C C   . GLY B 1 215 ? -74.420  -12.049 37.904  1.00 92.99  ? 240 GLY B C   1 
ATOM   3852 O O   . GLY B 1 215 ? -74.040  -12.189 39.057  1.00 98.56  ? 240 GLY B O   1 
ATOM   3853 N N   . GLU B 1 216 ? -74.008  -12.823 36.909  1.00 95.04  ? 241 GLU B N   1 
ATOM   3854 C CA  . GLU B 1 216 ? -73.105  -13.953 37.099  1.00 104.98 ? 241 GLU B CA  1 
ATOM   3855 C C   . GLU B 1 216 ? -71.994  -13.635 38.091  1.00 97.75  ? 241 GLU B C   1 
ATOM   3856 O O   . GLU B 1 216 ? -71.490  -14.524 38.775  1.00 94.44  ? 241 GLU B O   1 
ATOM   3857 C CB  . GLU B 1 216 ? -72.483  -14.357 35.756  1.00 123.48 ? 241 GLU B CB  1 
ATOM   3858 C CG  . GLU B 1 216 ? -71.643  -15.634 35.785  1.00 134.22 ? 241 GLU B CG  1 
ATOM   3859 C CD  . GLU B 1 216 ? -72.444  -16.868 35.409  1.00 138.70 ? 241 GLU B CD  1 
ATOM   3860 O OE1 . GLU B 1 216 ? -73.688  -16.770 35.345  1.00 141.37 ? 241 GLU B OE1 1 
ATOM   3861 O OE2 . GLU B 1 216 ? -71.830  -17.930 35.176  1.00 121.69 ? 241 GLU B OE2 1 
ATOM   3862 N N   . ALA B 1 217 ? -71.605  -12.365 38.147  1.00 95.54  ? 242 ALA B N   1 
ATOM   3863 C CA  . ALA B 1 217 ? -70.513  -11.923 39.001  1.00 96.56  ? 242 ALA B CA  1 
ATOM   3864 C C   . ALA B 1 217 ? -70.996  -11.647 40.415  1.00 100.79 ? 242 ALA B C   1 
ATOM   3865 O O   . ALA B 1 217 ? -70.263  -11.112 41.234  1.00 105.63 ? 242 ALA B O   1 
ATOM   3866 C CB  . ALA B 1 217 ? -69.864  -10.693 38.418  1.00 95.27  ? 242 ALA B CB  1 
ATOM   3867 N N   . GLU B 1 218 ? -72.237  -12.018 40.691  1.00 94.35  ? 243 GLU B N   1 
ATOM   3868 C CA  . GLU B 1 218 ? -72.828  -11.823 42.002  1.00 95.54  ? 243 GLU B CA  1 
ATOM   3869 C C   . GLU B 1 218 ? -72.986  -10.348 42.311  1.00 102.98 ? 243 GLU B C   1 
ATOM   3870 O O   . GLU B 1 218 ? -72.610  -9.897  43.387  1.00 120.68 ? 243 GLU B O   1 
ATOM   3871 C CB  . GLU B 1 218 ? -71.978  -12.488 43.090  1.00 118.11 ? 243 GLU B CB  1 
ATOM   3872 C CG  . GLU B 1 218 ? -71.853  -13.999 42.981  1.00 122.39 ? 243 GLU B CG  1 
ATOM   3873 C CD  . GLU B 1 218 ? -73.162  -14.735 43.241  1.00 141.29 ? 243 GLU B CD  1 
ATOM   3874 O OE1 . GLU B 1 218 ? -74.040  -14.176 43.931  1.00 130.70 ? 243 GLU B OE1 1 
ATOM   3875 O OE2 . GLU B 1 218 ? -73.310  -15.878 42.754  1.00 140.85 ? 243 GLU B OE2 1 
ATOM   3876 N N   . GLU B 1 219 ? -73.533  -9.594  41.366  1.00 92.69  ? 244 GLU B N   1 
ATOM   3877 C CA  . GLU B 1 219 ? -73.735  -8.160  41.551  1.00 86.58  ? 244 GLU B CA  1 
ATOM   3878 C C   . GLU B 1 219 ? -75.060  -7.787  40.955  1.00 96.43  ? 244 GLU B C   1 
ATOM   3879 O O   . GLU B 1 219 ? -75.776  -8.645  40.443  1.00 112.57 ? 244 GLU B O   1 
ATOM   3880 C CB  . GLU B 1 219 ? -72.653  -7.350  40.853  1.00 82.69  ? 244 GLU B CB  1 
ATOM   3881 C CG  . GLU B 1 219 ? -71.268  -7.565  41.387  1.00 97.80  ? 244 GLU B CG  1 
ATOM   3882 C CD  . GLU B 1 219 ? -71.002  -6.756  42.627  1.00 107.35 ? 244 GLU B CD  1 
ATOM   3883 O OE1 . GLU B 1 219 ? -71.719  -5.753  42.836  1.00 97.84  ? 244 GLU B OE1 1 
ATOM   3884 O OE2 . GLU B 1 219 ? -70.077  -7.125  43.383  1.00 115.94 ? 244 GLU B OE2 1 
ATOM   3885 N N   . ASP B 1 220 ? -75.393  -6.505  40.999  1.00 84.86  ? 245 ASP B N   1 
ATOM   3886 C CA  . ASP B 1 220 ? -76.670  -6.087  40.448  1.00 101.42 ? 245 ASP B CA  1 
ATOM   3887 C C   . ASP B 1 220 ? -76.562  -4.894  39.515  1.00 111.94 ? 245 ASP B C   1 
ATOM   3888 O O   . ASP B 1 220 ? -76.198  -3.793  39.943  1.00 95.10  ? 245 ASP B O   1 
ATOM   3889 C CB  . ASP B 1 220 ? -77.664  -5.764  41.549  1.00 102.45 ? 245 ASP B CB  1 
ATOM   3890 C CG  . ASP B 1 220 ? -78.956  -5.249  40.996  1.00 118.03 ? 245 ASP B CG  1 
ATOM   3891 O OD1 . ASP B 1 220 ? -79.312  -5.686  39.876  1.00 134.70 ? 245 ASP B OD1 1 
ATOM   3892 O OD2 . ASP B 1 220 ? -79.600  -4.411  41.660  1.00 106.82 ? 245 ASP B OD2 1 
ATOM   3893 N N   . PHE B 1 221 ? -76.912  -5.115  38.247  1.00 109.08 ? 246 PHE B N   1 
ATOM   3894 C CA  . PHE B 1 221 ? -76.718  -4.103  37.218  1.00 96.19  ? 246 PHE B CA  1 
ATOM   3895 C C   . PHE B 1 221 ? -77.351  -2.767  37.573  1.00 89.19  ? 246 PHE B C   1 
ATOM   3896 O O   . PHE B 1 221 ? -76.767  -1.720  37.349  1.00 96.97  ? 246 PHE B O   1 
ATOM   3897 C CB  . PHE B 1 221 ? -77.224  -4.594  35.859  1.00 109.34 ? 246 PHE B CB  1 
ATOM   3898 C CG  . PHE B 1 221 ? -76.753  -3.747  34.694  1.00 104.55 ? 246 PHE B CG  1 
ATOM   3899 C CD1 . PHE B 1 221 ? -75.712  -4.164  33.885  1.00 89.92  ? 246 PHE B CD1 1 
ATOM   3900 C CD2 . PHE B 1 221 ? -77.348  -2.524  34.425  1.00 98.44  ? 246 PHE B CD2 1 
ATOM   3901 C CE1 . PHE B 1 221 ? -75.283  -3.378  32.839  1.00 94.82  ? 246 PHE B CE1 1 
ATOM   3902 C CE2 . PHE B 1 221 ? -76.919  -1.729  33.379  1.00 80.22  ? 246 PHE B CE2 1 
ATOM   3903 C CZ  . PHE B 1 221 ? -75.891  -2.155  32.585  1.00 79.21  ? 246 PHE B CZ  1 
ATOM   3904 N N   . GLN B 1 222 ? -78.537  -2.796  38.148  1.00 77.05  ? 247 GLN B N   1 
ATOM   3905 C CA  . GLN B 1 222 ? -79.232  -1.554  38.450  1.00 84.05  ? 247 GLN B CA  1 
ATOM   3906 C C   . GLN B 1 222 ? -78.644  -0.740  39.617  1.00 104.60 ? 247 GLN B C   1 
ATOM   3907 O O   . GLN B 1 222 ? -78.690  0.494   39.608  1.00 96.53  ? 247 GLN B O   1 
ATOM   3908 C CB  . GLN B 1 222 ? -80.712  -1.844  38.656  1.00 110.54 ? 247 GLN B CB  1 
ATOM   3909 C CG  . GLN B 1 222 ? -81.353  -2.385  37.406  1.00 113.32 ? 247 GLN B CG  1 
ATOM   3910 C CD  . GLN B 1 222 ? -81.343  -1.369  36.308  1.00 92.56  ? 247 GLN B CD  1 
ATOM   3911 O OE1 . GLN B 1 222 ? -81.477  -0.174  36.563  1.00 70.25  ? 247 GLN B OE1 1 
ATOM   3912 N NE2 . GLN B 1 222 ? -81.170  -1.828  35.078  1.00 99.49  ? 247 GLN B NE2 1 
ATOM   3913 N N   . ILE B 1 223 ? -78.085  -1.417  40.617  1.00 113.53 ? 248 ILE B N   1 
ATOM   3914 C CA  . ILE B 1 223 ? -77.435  -0.700  41.711  1.00 103.54 ? 248 ILE B CA  1 
ATOM   3915 C C   . ILE B 1 223 ? -76.068  -0.189  41.259  1.00 101.89 ? 248 ILE B C   1 
ATOM   3916 O O   . ILE B 1 223 ? -75.679  0.924   41.591  1.00 102.03 ? 248 ILE B O   1 
ATOM   3917 C CB  . ILE B 1 223 ? -77.316  -1.546  43.005  1.00 97.20  ? 248 ILE B CB  1 
ATOM   3918 C CG1 . ILE B 1 223 ? -76.421  -2.766  42.776  1.00 140.15 ? 248 ILE B CG1 1 
ATOM   3919 C CG2 . ILE B 1 223 ? -78.693  -1.969  43.489  1.00 89.37  ? 248 ILE B CG2 1 
ATOM   3920 C CD1 . ILE B 1 223 ? -76.026  -3.516  44.068  1.00 127.77 ? 248 ILE B CD1 1 
ATOM   3921 N N   . MET B 1 224 ? -75.356  -0.996  40.478  1.00 99.54  ? 249 MET B N   1 
ATOM   3922 C CA  . MET B 1 224 ? -74.056  -0.602  39.945  1.00 96.22  ? 249 MET B CA  1 
ATOM   3923 C C   . MET B 1 224 ? -74.189  0.596   39.008  1.00 93.03  ? 249 MET B C   1 
ATOM   3924 O O   . MET B 1 224 ? -73.588  1.645   39.226  1.00 91.75  ? 249 MET B O   1 
ATOM   3925 C CB  . MET B 1 224 ? -73.409  -1.774  39.192  1.00 81.30  ? 249 MET B CB  1 
ATOM   3926 C CG  . MET B 1 224 ? -71.895  -1.646  39.046  1.00 85.05  ? 249 MET B CG  1 
ATOM   3927 S SD  . MET B 1 224 ? -71.040  -2.928  38.116  1.00 79.54  ? 249 MET B SD  1 
ATOM   3928 C CE  . MET B 1 224 ? -71.517  -4.437  38.928  1.00 94.66  ? 249 MET B CE  1 
ATOM   3929 N N   . ALA B 1 225 ? -75.006  0.425   37.976  1.00 89.80  ? 250 ALA B N   1 
ATOM   3930 C CA  . ALA B 1 225 ? -75.131  1.384   36.883  1.00 91.02  ? 250 ALA B CA  1 
ATOM   3931 C C   . ALA B 1 225 ? -75.469  2.799   37.313  1.00 92.45  ? 250 ALA B C   1 
ATOM   3932 O O   . ALA B 1 225 ? -75.591  3.693   36.471  1.00 87.73  ? 250 ALA B O   1 
ATOM   3933 C CB  . ALA B 1 225 ? -76.169  0.901   35.890  1.00 92.25  ? 250 ALA B CB  1 
ATOM   3934 N N   . VAL B 1 226 ? -75.657  3.010   38.608  1.00 94.88  ? 251 VAL B N   1 
ATOM   3935 C CA  . VAL B 1 226 ? -76.029  4.340   39.057  1.00 100.32 ? 251 VAL B CA  1 
ATOM   3936 C C   . VAL B 1 226 ? -74.779  5.184   39.252  1.00 88.22  ? 251 VAL B C   1 
ATOM   3937 O O   . VAL B 1 226 ? -74.696  6.315   38.802  1.00 86.80  ? 251 VAL B O   1 
ATOM   3938 C CB  . VAL B 1 226 ? -76.920  4.294   40.307  1.00 65.72  ? 251 VAL B CB  1 
ATOM   3939 C CG1 . VAL B 1 226 ? -76.243  3.530   41.380  1.00 87.94  ? 251 VAL B CG1 1 
ATOM   3940 C CG2 . VAL B 1 226 ? -77.244  5.695   40.765  1.00 56.60  ? 251 VAL B CG2 1 
ATOM   3941 N N   . ARG B 1 227 ? -73.778  4.597   39.875  1.00 82.70  ? 252 ARG B N   1 
ATOM   3942 C CA  . ARG B 1 227 ? -72.553  5.315   40.144  1.00 83.57  ? 252 ARG B CA  1 
ATOM   3943 C C   . ARG B 1 227 ? -71.361  4.752   39.370  1.00 85.86  ? 252 ARG B C   1 
ATOM   3944 O O   . ARG B 1 227 ? -70.270  5.325   39.396  1.00 69.76  ? 252 ARG B O   1 
ATOM   3945 C CB  . ARG B 1 227 ? -72.302  5.308   41.646  1.00 100.37 ? 252 ARG B CB  1 
ATOM   3946 C CG  . ARG B 1 227 ? -71.295  6.334   42.116  1.00 141.16 ? 252 ARG B CG  1 
ATOM   3947 C CD  . ARG B 1 227 ? -71.618  6.836   43.514  1.00 120.34 ? 252 ARG B CD  1 
ATOM   3948 N NE  . ARG B 1 227 ? -72.686  7.825   43.472  1.00 117.50 ? 252 ARG B NE  1 
ATOM   3949 C CZ  . ARG B 1 227 ? -73.294  8.294   44.552  1.00 129.96 ? 252 ARG B CZ  1 
ATOM   3950 N NH1 . ARG B 1 227 ? -72.931  7.853   45.758  1.00 122.82 ? 252 ARG B NH1 1 
ATOM   3951 N NH2 . ARG B 1 227 ? -74.261  9.197   44.429  1.00 102.45 ? 252 ARG B NH2 1 
ATOM   3952 N N   . GLY B 1 228 ? -71.580  3.623   38.696  1.00 92.97  ? 253 GLY B N   1 
ATOM   3953 C CA  . GLY B 1 228 ? -70.581  3.015   37.834  1.00 84.97  ? 253 GLY B CA  1 
ATOM   3954 C C   . GLY B 1 228 ? -69.695  1.986   38.505  1.00 91.76  ? 253 GLY B C   1 
ATOM   3955 O O   . GLY B 1 228 ? -69.689  1.861   39.725  1.00 102.64 ? 253 GLY B O   1 
ATOM   3956 N N   . GLY B 1 229 ? -68.941  1.248   37.694  1.00 87.95  ? 254 GLY B N   1 
ATOM   3957 C CA  . GLY B 1 229 ? -68.010  0.244   38.183  1.00 93.23  ? 254 GLY B CA  1 
ATOM   3958 C C   . GLY B 1 229 ? -67.246  -0.371  37.036  1.00 81.95  ? 254 GLY B C   1 
ATOM   3959 O O   . GLY B 1 229 ? -67.427  0.051   35.904  1.00 98.46  ? 254 GLY B O   1 
ATOM   3960 N N   . VAL B 1 230 ? -66.397  -1.356  37.316  1.00 67.24  ? 255 VAL B N   1 
ATOM   3961 C CA  . VAL B 1 230 ? -65.679  -2.053  36.254  1.00 82.08  ? 255 VAL B CA  1 
ATOM   3962 C C   . VAL B 1 230 ? -65.778  -3.563  36.388  1.00 86.11  ? 255 VAL B C   1 
ATOM   3963 O O   . VAL B 1 230 ? -65.454  -4.138  37.416  1.00 82.15  ? 255 VAL B O   1 
ATOM   3964 C CB  . VAL B 1 230 ? -64.198  -1.662  36.153  1.00 56.20  ? 255 VAL B CB  1 
ATOM   3965 C CG1 . VAL B 1 230 ? -64.053  -0.175  35.896  1.00 78.61  ? 255 VAL B CG1 1 
ATOM   3966 C CG2 . VAL B 1 230 ? -63.466  -2.067  37.391  1.00 91.32  ? 255 VAL B CG2 1 
ATOM   3967 N N   . MET B 1 231 ? -66.245  -4.194  35.319  1.00 96.67  ? 256 MET B N   1 
ATOM   3968 C CA  . MET B 1 231 ? -66.455  -5.629  35.274  1.00 88.24  ? 256 MET B CA  1 
ATOM   3969 C C   . MET B 1 231 ? -65.320  -6.315  34.551  1.00 74.96  ? 256 MET B C   1 
ATOM   3970 O O   . MET B 1 231 ? -64.952  -5.931  33.470  1.00 82.00  ? 256 MET B O   1 
ATOM   3971 C CB  . MET B 1 231 ? -67.778  -5.937  34.572  1.00 91.27  ? 256 MET B CB  1 
ATOM   3972 C CG  . MET B 1 231 ? -68.993  -5.656  35.426  1.00 84.39  ? 256 MET B CG  1 
ATOM   3973 S SD  . MET B 1 231 ? -68.890  -6.647  36.881  1.00 103.34 ? 256 MET B SD  1 
ATOM   3974 C CE  . MET B 1 231 ? -68.507  -8.242  36.159  1.00 79.29  ? 256 MET B CE  1 
ATOM   3975 N N   . GLY B 1 232 ? -64.766  -7.344  35.160  1.00 83.89  ? 257 GLY B N   1 
ATOM   3976 C CA  . GLY B 1 232 ? -63.742  -8.132  34.519  1.00 88.79  ? 257 GLY B CA  1 
ATOM   3977 C C   . GLY B 1 232 ? -64.321  -9.359  33.855  1.00 98.43  ? 257 GLY B C   1 
ATOM   3978 O O   . GLY B 1 232 ? -64.873  -10.243 34.507  1.00 103.95 ? 257 GLY B O   1 
ATOM   3979 N N   . VAL B 1 233 ? -64.205  -9.403  32.537  1.00 94.87  ? 258 VAL B N   1 
ATOM   3980 C CA  . VAL B 1 233 ? -64.613  -10.571 31.775  1.00 96.57  ? 258 VAL B CA  1 
ATOM   3981 C C   . VAL B 1 233 ? -63.375  -11.405 31.500  1.00 86.95  ? 258 VAL B C   1 
ATOM   3982 O O   . VAL B 1 233 ? -62.642  -11.150 30.557  1.00 90.15  ? 258 VAL B O   1 
ATOM   3983 C CB  . VAL B 1 233 ? -65.281  -10.168 30.443  1.00 90.62  ? 258 VAL B CB  1 
ATOM   3984 C CG1 . VAL B 1 233 ? -65.744  -11.384 29.680  1.00 73.87  ? 258 VAL B CG1 1 
ATOM   3985 C CG2 . VAL B 1 233 ? -66.451  -9.231  30.696  1.00 83.56  ? 258 VAL B CG2 1 
ATOM   3986 N N   . GLN B 1 234 ? -63.132  -12.399 32.338  1.00 90.51  ? 259 GLN B N   1 
ATOM   3987 C CA  . GLN B 1 234 ? -61.932  -13.210 32.189  1.00 101.25 ? 259 GLN B CA  1 
ATOM   3988 C C   . GLN B 1 234 ? -62.154  -14.381 31.251  1.00 95.91  ? 259 GLN B C   1 
ATOM   3989 O O   . GLN B 1 234 ? -63.067  -15.190 31.453  1.00 102.94 ? 259 GLN B O   1 
ATOM   3990 C CB  . GLN B 1 234 ? -61.440  -13.719 33.548  1.00 116.09 ? 259 GLN B CB  1 
ATOM   3991 C CG  . GLN B 1 234 ? -61.053  -12.623 34.516  1.00 119.11 ? 259 GLN B CG  1 
ATOM   3992 C CD  . GLN B 1 234 ? -60.987  -13.123 35.931  1.00 140.32 ? 259 GLN B CD  1 
ATOM   3993 O OE1 . GLN B 1 234 ? -60.911  -12.336 36.881  1.00 149.71 ? 259 GLN B OE1 1 
ATOM   3994 N NE2 . GLN B 1 234 ? -61.025  -14.444 36.088  1.00 138.74 ? 259 GLN B NE2 1 
ATOM   3995 N N   . ILE B 1 235 ? -61.313  -14.466 30.225  1.00 89.92  ? 260 ILE B N   1 
ATOM   3996 C CA  . ILE B 1 235 ? -61.301  -15.630 29.353  1.00 95.99  ? 260 ILE B CA  1 
ATOM   3997 C C   . ILE B 1 235 ? -60.035  -16.451 29.601  1.00 101.93 ? 260 ILE B C   1 
ATOM   3998 O O   . ILE B 1 235 ? -58.920  -15.933 29.473  1.00 89.14  ? 260 ILE B O   1 
ATOM   3999 C CB  . ILE B 1 235 ? -61.389  -15.225 27.876  1.00 92.03  ? 260 ILE B CB  1 
ATOM   4000 C CG1 . ILE B 1 235 ? -62.671  -14.437 27.627  1.00 84.54  ? 260 ILE B CG1 1 
ATOM   4001 C CG2 . ILE B 1 235 ? -61.361  -16.453 26.992  1.00 98.59  ? 260 ILE B CG2 1 
ATOM   4002 C CD1 . ILE B 1 235 ? -62.728  -13.810 26.275  1.00 73.30  ? 260 ILE B CD1 1 
ATOM   4003 N N   . ARG B 1 236 ? -60.211  -17.725 29.957  1.00 97.19  ? 261 ARG B N   1 
ATOM   4004 C CA  . ARG B 1 236 ? -59.075  -18.598 30.257  1.00 105.91 ? 261 ARG B CA  1 
ATOM   4005 C C   . ARG B 1 236 ? -58.889  -19.710 29.219  1.00 106.31 ? 261 ARG B C   1 
ATOM   4006 O O   . ARG B 1 236 ? -59.769  -20.559 29.045  1.00 97.30  ? 261 ARG B O   1 
ATOM   4007 C CB  . ARG B 1 236 ? -59.195  -19.188 31.673  1.00 124.03 ? 261 ARG B CB  1 
ATOM   4008 C CG  . ARG B 1 236 ? -57.846  -19.511 32.332  1.00 135.23 ? 261 ARG B CG  1 
ATOM   4009 C CD  . ARG B 1 236 ? -57.987  -20.085 33.755  1.00 120.72 ? 261 ARG B CD  1 
ATOM   4010 N NE  . ARG B 1 236 ? -58.252  -21.524 33.735  1.00 158.93 ? 261 ARG B NE  1 
ATOM   4011 C CZ  . ARG B 1 236 ? -59.467  -22.058 33.810  1.00 169.35 ? 261 ARG B CZ  1 
ATOM   4012 N NH1 . ARG B 1 236 ? -60.528  -21.269 33.922  1.00 164.36 ? 261 ARG B NH1 1 
ATOM   4013 N NH2 . ARG B 1 236 ? -59.625  -23.377 33.778  1.00 144.15 ? 261 ARG B NH2 1 
ATOM   4014 N N   . TRP B 1 237 ? -57.743  -19.693 28.535  1.00 101.04 ? 262 TRP B N   1 
ATOM   4015 C CA  . TRP B 1 237 ? -57.388  -20.747 27.589  1.00 104.71 ? 262 TRP B CA  1 
ATOM   4016 C C   . TRP B 1 237 ? -56.370  -21.710 28.179  1.00 103.81 ? 262 TRP B C   1 
ATOM   4017 O O   . TRP B 1 237 ? -55.166  -21.491 28.081  1.00 99.32  ? 262 TRP B O   1 
ATOM   4018 C CB  . TRP B 1 237 ? -56.826  -20.151 26.293  1.00 114.61 ? 262 TRP B CB  1 
ATOM   4019 C CG  . TRP B 1 237 ? -57.787  -19.288 25.548  1.00 110.48 ? 262 TRP B CG  1 
ATOM   4020 C CD1 . TRP B 1 237 ? -58.060  -17.980 25.790  1.00 111.02 ? 262 TRP B CD1 1 
ATOM   4021 C CD2 . TRP B 1 237 ? -58.603  -19.670 24.437  1.00 99.88  ? 262 TRP B CD2 1 
ATOM   4022 N NE1 . TRP B 1 237 ? -58.996  -17.521 24.902  1.00 98.92  ? 262 TRP B NE1 1 
ATOM   4023 C CE2 . TRP B 1 237 ? -59.347  -18.542 24.062  1.00 97.80  ? 262 TRP B CE2 1 
ATOM   4024 C CE3 . TRP B 1 237 ? -58.777  -20.858 23.727  1.00 111.59 ? 262 TRP B CE3 1 
ATOM   4025 C CZ2 . TRP B 1 237 ? -60.249  -18.566 23.011  1.00 103.43 ? 262 TRP B CZ2 1 
ATOM   4026 C CZ3 . TRP B 1 237 ? -59.673  -20.879 22.687  1.00 105.52 ? 262 TRP B CZ3 1 
ATOM   4027 C CH2 . TRP B 1 237 ? -60.396  -19.742 22.336  1.00 96.80  ? 262 TRP B CH2 1 
ATOM   4028 N N   . ASP B 1 238 ? -56.863  -22.779 28.791  1.00 112.06 ? 263 ASP B N   1 
ATOM   4029 C CA  . ASP B 1 238 ? -55.998  -23.812 29.330  1.00 117.03 ? 263 ASP B CA  1 
ATOM   4030 C C   . ASP B 1 238 ? -56.142  -25.091 28.533  1.00 114.35 ? 263 ASP B C   1 
ATOM   4031 O O   . ASP B 1 238 ? -57.038  -25.897 28.788  1.00 131.52 ? 263 ASP B O   1 
ATOM   4032 C CB  . ASP B 1 238 ? -56.317  -24.058 30.800  1.00 119.83 ? 263 ASP B CB  1 
ATOM   4033 C CG  . ASP B 1 238 ? -55.785  -22.959 31.695  1.00 129.02 ? 263 ASP B CG  1 
ATOM   4034 O OD1 . ASP B 1 238 ? -55.048  -22.091 31.181  1.00 128.27 ? 263 ASP B OD1 1 
ATOM   4035 O OD2 . ASP B 1 238 ? -56.094  -22.961 32.904  1.00 132.79 ? 263 ASP B OD2 1 
ATOM   4036 N N   . CYS B 1 239 ? -55.252  -25.269 27.565  1.00 113.44 ? 264 CYS B N   1 
ATOM   4037 C CA  . CYS B 1 239 ? -55.336  -26.395 26.658  1.00 125.98 ? 264 CYS B CA  1 
ATOM   4038 C C   . CYS B 1 239 ? -54.229  -27.414 26.887  1.00 141.35 ? 264 CYS B C   1 
ATOM   4039 O O   . CYS B 1 239 ? -53.122  -27.062 27.302  1.00 136.72 ? 264 CYS B O   1 
ATOM   4040 C CB  . CYS B 1 239 ? -55.286  -25.888 25.222  1.00 125.49 ? 264 CYS B CB  1 
ATOM   4041 S SG  . CYS B 1 239 ? -56.702  -24.887 24.754  1.00 127.07 ? 264 CYS B SG  1 
ATOM   4042 N N   . ASP B 1 240 ? -54.540  -28.679 26.625  1.00 139.04 ? 265 ASP B N   1 
ATOM   4043 C CA  . ASP B 1 240 ? -53.520  -29.714 26.564  1.00 136.85 ? 265 ASP B CA  1 
ATOM   4044 C C   . ASP B 1 240 ? -53.220  -29.986 25.089  1.00 130.67 ? 265 ASP B C   1 
ATOM   4045 O O   . ASP B 1 240 ? -54.019  -30.614 24.401  1.00 137.24 ? 265 ASP B O   1 
ATOM   4046 C CB  . ASP B 1 240 ? -54.014  -30.983 27.260  1.00 143.03 ? 265 ASP B CB  1 
ATOM   4047 C CG  . ASP B 1 240 ? -52.878  -31.875 27.723  1.00 154.91 ? 265 ASP B CG  1 
ATOM   4048 O OD1 . ASP B 1 240 ? -51.706  -31.492 27.528  1.00 166.07 ? 265 ASP B OD1 1 
ATOM   4049 O OD2 . ASP B 1 240 ? -53.156  -32.957 28.285  1.00 130.27 ? 265 ASP B OD2 1 
ATOM   4050 N N   . LEU B 1 241 ? -52.081  -29.505 24.594  1.00 128.38 ? 266 LEU B N   1 
ATOM   4051 C CA  . LEU B 1 241 ? -51.783  -29.572 23.155  1.00 159.98 ? 266 LEU B CA  1 
ATOM   4052 C C   . LEU B 1 241 ? -51.572  -30.978 22.596  1.00 166.32 ? 266 LEU B C   1 
ATOM   4053 O O   . LEU B 1 241 ? -51.781  -31.210 21.402  1.00 148.43 ? 266 LEU B O   1 
ATOM   4054 C CB  . LEU B 1 241 ? -50.595  -28.674 22.785  1.00 166.68 ? 266 LEU B CB  1 
ATOM   4055 C CG  . LEU B 1 241 ? -50.970  -27.331 22.159  1.00 145.35 ? 266 LEU B CG  1 
ATOM   4056 C CD1 . LEU B 1 241 ? -51.535  -27.520 20.757  1.00 149.58 ? 266 LEU B CD1 1 
ATOM   4057 C CD2 . LEU B 1 241 ? -51.976  -26.621 23.041  1.00 140.63 ? 266 LEU B CD2 1 
ATOM   4058 N N   . ASP B 1 242 ? -51.147  -31.907 23.449  1.00 163.29 ? 267 ASP B N   1 
ATOM   4059 C CA  . ASP B 1 242 ? -51.017  -33.301 23.036  1.00 157.54 ? 267 ASP B CA  1 
ATOM   4060 C C   . ASP B 1 242 ? -52.395  -33.955 22.812  1.00 165.93 ? 267 ASP B C   1 
ATOM   4061 O O   . ASP B 1 242 ? -52.523  -34.912 22.039  1.00 179.52 ? 267 ASP B O   1 
ATOM   4062 C CB  . ASP B 1 242 ? -50.130  -34.095 24.013  1.00 150.99 ? 267 ASP B CB  1 
ATOM   4063 C CG  . ASP B 1 242 ? -50.426  -33.782 25.475  1.00 155.81 ? 267 ASP B CG  1 
ATOM   4064 O OD1 . ASP B 1 242 ? -49.463  -33.658 26.268  1.00 126.13 ? 267 ASP B OD1 1 
ATOM   4065 O OD2 . ASP B 1 242 ? -51.619  -33.667 25.827  1.00 163.49 ? 267 ASP B OD2 1 
ATOM   4066 N N   . MET B 1 243 ? -53.416  -33.415 23.481  1.00 147.57 ? 268 MET B N   1 
ATOM   4067 C CA  . MET B 1 243 ? -54.818  -33.758 23.225  1.00 138.16 ? 268 MET B CA  1 
ATOM   4068 C C   . MET B 1 243 ? -55.275  -33.198 21.881  1.00 158.89 ? 268 MET B C   1 
ATOM   4069 O O   . MET B 1 243 ? -54.615  -32.322 21.320  1.00 167.01 ? 268 MET B O   1 
ATOM   4070 C CB  . MET B 1 243 ? -55.707  -33.144 24.301  1.00 142.80 ? 268 MET B CB  1 
ATOM   4071 C CG  . MET B 1 243 ? -55.376  -33.581 25.695  1.00 151.21 ? 268 MET B CG  1 
ATOM   4072 S SD  . MET B 1 243 ? -55.852  -35.296 25.930  1.00 155.48 ? 268 MET B SD  1 
ATOM   4073 C CE  . MET B 1 243 ? -57.556  -35.249 25.379  1.00 123.80 ? 268 MET B CE  1 
ATOM   4074 N N   . PRO B 1 244 ? -56.423  -33.677 21.370  1.00 157.53 ? 269 PRO B N   1 
ATOM   4075 C CA  . PRO B 1 244 ? -56.932  -33.154 20.096  1.00 163.70 ? 269 PRO B CA  1 
ATOM   4076 C C   . PRO B 1 244 ? -57.198  -31.654 20.170  1.00 155.18 ? 269 PRO B C   1 
ATOM   4077 O O   . PRO B 1 244 ? -57.671  -31.159 21.194  1.00 138.59 ? 269 PRO B O   1 
ATOM   4078 C CB  . PRO B 1 244 ? -58.245  -33.919 19.901  1.00 153.63 ? 269 PRO B CB  1 
ATOM   4079 C CG  . PRO B 1 244 ? -58.078  -35.164 20.710  1.00 142.60 ? 269 PRO B CG  1 
ATOM   4080 C CD  . PRO B 1 244 ? -57.288  -34.739 21.910  1.00 138.35 ? 269 PRO B CD  1 
ATOM   4081 N N   . GLN B 1 245 ? -56.890  -30.943 19.090  1.00 153.23 ? 270 GLN B N   1 
ATOM   4082 C CA  . GLN B 1 245 ? -57.080  -29.500 19.047  1.00 141.07 ? 270 GLN B CA  1 
ATOM   4083 C C   . GLN B 1 245 ? -58.546  -29.142 19.282  1.00 132.55 ? 270 GLN B C   1 
ATOM   4084 O O   . GLN B 1 245 ? -58.885  -27.984 19.509  1.00 126.88 ? 270 GLN B O   1 
ATOM   4085 C CB  . GLN B 1 245 ? -56.595  -28.949 17.716  1.00 116.76 ? 270 GLN B CB  1 
ATOM   4086 N N   . SER B 1 246 ? -59.409  -30.150 19.230  1.00 138.52 ? 271 SER B N   1 
ATOM   4087 C CA  . SER B 1 246 ? -60.842  -29.956 19.426  1.00 138.14 ? 271 SER B CA  1 
ATOM   4088 C C   . SER B 1 246 ? -61.214  -29.748 20.899  1.00 140.91 ? 271 SER B C   1 
ATOM   4089 O O   . SER B 1 246 ? -62.255  -29.167 21.206  1.00 119.79 ? 271 SER B O   1 
ATOM   4090 C CB  . SER B 1 246 ? -61.621  -31.138 18.840  1.00 136.54 ? 271 SER B CB  1 
ATOM   4091 O OG  . SER B 1 246 ? -63.019  -30.938 18.952  1.00 135.31 ? 271 SER B OG  1 
ATOM   4092 N N   . TRP B 1 247 ? -60.362  -30.224 21.805  1.00 152.10 ? 272 TRP B N   1 
ATOM   4093 C CA  . TRP B 1 247 ? -60.614  -30.127 23.247  1.00 149.26 ? 272 TRP B CA  1 
ATOM   4094 C C   . TRP B 1 247 ? -60.244  -28.758 23.819  1.00 133.73 ? 272 TRP B C   1 
ATOM   4095 O O   . TRP B 1 247 ? -60.506  -28.468 24.985  1.00 121.20 ? 272 TRP B O   1 
ATOM   4096 C CB  . TRP B 1 247 ? -59.841  -31.215 24.001  1.00 165.24 ? 272 TRP B CB  1 
ATOM   4097 C CG  . TRP B 1 247 ? -60.263  -32.622 23.675  1.00 172.11 ? 272 TRP B CG  1 
ATOM   4098 C CD1 . TRP B 1 247 ? -59.970  -33.322 22.544  1.00 161.92 ? 272 TRP B CD1 1 
ATOM   4099 C CD2 . TRP B 1 247 ? -61.038  -33.502 24.498  1.00 175.38 ? 272 TRP B CD2 1 
ATOM   4100 N NE1 . TRP B 1 247 ? -60.518  -34.578 22.605  1.00 147.56 ? 272 TRP B NE1 1 
ATOM   4101 C CE2 . TRP B 1 247 ? -61.182  -34.715 23.800  1.00 161.75 ? 272 TRP B CE2 1 
ATOM   4102 C CE3 . TRP B 1 247 ? -61.631  -33.381 25.763  1.00 169.63 ? 272 TRP B CE3 1 
ATOM   4103 C CZ2 . TRP B 1 247 ? -61.890  -35.797 24.314  1.00 175.67 ? 272 TRP B CZ2 1 
ATOM   4104 C CZ3 . TRP B 1 247 ? -62.335  -34.458 26.277  1.00 140.95 ? 272 TRP B CZ3 1 
ATOM   4105 C CH2 . TRP B 1 247 ? -62.459  -35.649 25.553  1.00 167.06 ? 272 TRP B CH2 1 
ATOM   4106 N N   . CYS B 1 248 ? -59.610  -27.936 22.990  1.00 134.23 ? 273 CYS B N   1 
ATOM   4107 C CA  . CYS B 1 248 ? -59.171  -26.600 23.372  1.00 115.32 ? 273 CYS B CA  1 
ATOM   4108 C C   . CYS B 1 248 ? -60.336  -25.623 23.354  1.00 120.51 ? 273 CYS B C   1 
ATOM   4109 O O   . CYS B 1 248 ? -60.897  -25.336 22.300  1.00 125.88 ? 273 CYS B O   1 
ATOM   4110 C CB  . CYS B 1 248 ? -58.095  -26.117 22.401  1.00 117.62 ? 273 CYS B CB  1 
ATOM   4111 S SG  . CYS B 1 248 ? -57.334  -24.553 22.851  1.00 150.92 ? 273 CYS B SG  1 
ATOM   4112 N N   . VAL B 1 249 ? -60.681  -25.085 24.517  1.00 122.47 ? 274 VAL B N   1 
ATOM   4113 C CA  . VAL B 1 249 ? -61.885  -24.275 24.648  1.00 114.05 ? 274 VAL B CA  1 
ATOM   4114 C C   . VAL B 1 249 ? -61.683  -23.190 25.706  1.00 120.55 ? 274 VAL B C   1 
ATOM   4115 O O   . VAL B 1 249 ? -60.928  -23.385 26.658  1.00 126.10 ? 274 VAL B O   1 
ATOM   4116 C CB  . VAL B 1 249 ? -63.086  -25.176 25.027  1.00 111.12 ? 274 VAL B CB  1 
ATOM   4117 C CG1 . VAL B 1 249 ? -64.359  -24.365 25.214  1.00 117.40 ? 274 VAL B CG1 1 
ATOM   4118 C CG2 . VAL B 1 249 ? -63.285  -26.275 23.981  1.00 100.49 ? 274 VAL B CG2 1 
ATOM   4119 N N   . PRO B 1 250 ? -62.338  -22.032 25.524  1.00 111.84 ? 275 PRO B N   1 
ATOM   4120 C CA  . PRO B 1 250 ? -62.292  -20.894 26.451  1.00 115.91 ? 275 PRO B CA  1 
ATOM   4121 C C   . PRO B 1 250 ? -63.191  -21.090 27.670  1.00 122.34 ? 275 PRO B C   1 
ATOM   4122 O O   . PRO B 1 250 ? -64.346  -21.488 27.513  1.00 115.86 ? 275 PRO B O   1 
ATOM   4123 C CB  . PRO B 1 250 ? -62.855  -19.738 25.613  1.00 111.24 ? 275 PRO B CB  1 
ATOM   4124 C CG  . PRO B 1 250 ? -62.894  -20.227 24.221  1.00 109.56 ? 275 PRO B CG  1 
ATOM   4125 C CD  . PRO B 1 250 ? -63.038  -21.693 24.279  1.00 105.29 ? 275 PRO B CD  1 
ATOM   4126 N N   . ARG B 1 251 ? -62.691  -20.813 28.867  1.00 107.76 ? 276 ARG B N   1 
ATOM   4127 C CA  . ARG B 1 251 ? -63.593  -20.746 30.001  1.00 102.16 ? 276 ARG B CA  1 
ATOM   4128 C C   . ARG B 1 251 ? -63.810  -19.301 30.435  1.00 100.12 ? 276 ARG B C   1 
ATOM   4129 O O   . ARG B 1 251 ? -62.854  -18.547 30.647  1.00 81.69  ? 276 ARG B O   1 
ATOM   4130 C CB  . ARG B 1 251 ? -63.123  -21.653 31.132  1.00 133.43 ? 276 ARG B CB  1 
ATOM   4131 C CG  . ARG B 1 251 ? -63.104  -23.126 30.734  1.00 132.21 ? 276 ARG B CG  1 
ATOM   4132 C CD  . ARG B 1 251 ? -62.694  -24.002 31.900  1.00 182.57 ? 276 ARG B CD  1 
ATOM   4133 N NE  . ARG B 1 251 ? -62.353  -25.361 31.488  1.00 194.06 ? 276 ARG B NE  1 
ATOM   4134 C CZ  . ARG B 1 251 ? -61.970  -26.316 32.333  1.00 211.12 ? 276 ARG B CZ  1 
ATOM   4135 N NH1 . ARG B 1 251 ? -61.883  -26.056 33.635  1.00 192.47 ? 276 ARG B NH1 1 
ATOM   4136 N NH2 . ARG B 1 251 ? -61.674  -27.531 31.885  1.00 218.96 ? 276 ARG B NH2 1 
ATOM   4137 N N   . TYR B 1 252 ? -65.084  -18.922 30.512  1.00 98.37  ? 277 TYR B N   1 
ATOM   4138 C CA  . TYR B 1 252 ? -65.487  -17.556 30.851  1.00 104.94 ? 277 TYR B CA  1 
ATOM   4139 C C   . TYR B 1 252 ? -65.809  -17.378 32.339  1.00 110.69 ? 277 TYR B C   1 
ATOM   4140 O O   . TYR B 1 252 ? -66.562  -18.176 32.915  1.00 106.46 ? 277 TYR B O   1 
ATOM   4141 C CB  . TYR B 1 252 ? -66.703  -17.129 30.013  1.00 87.93  ? 277 TYR B CB  1 
ATOM   4142 C CG  . TYR B 1 252 ? -66.518  -17.274 28.519  1.00 105.59 ? 277 TYR B CG  1 
ATOM   4143 C CD1 . TYR B 1 252 ? -66.902  -18.433 27.865  1.00 123.90 ? 277 TYR B CD1 1 
ATOM   4144 C CD2 . TYR B 1 252 ? -65.962  -16.250 27.758  1.00 101.88 ? 277 TYR B CD2 1 
ATOM   4145 C CE1 . TYR B 1 252 ? -66.733  -18.576 26.487  1.00 130.81 ? 277 TYR B CE1 1 
ATOM   4146 C CE2 . TYR B 1 252 ? -65.789  -16.385 26.384  1.00 84.95  ? 277 TYR B CE2 1 
ATOM   4147 C CZ  . TYR B 1 252 ? -66.178  -17.552 25.755  1.00 107.05 ? 277 TYR B CZ  1 
ATOM   4148 O OH  . TYR B 1 252 ? -66.018  -17.708 24.394  1.00 86.97  ? 277 TYR B OH  1 
ATOM   4149 N N   . THR B 1 253 ? -65.260  -16.318 32.937  1.00 103.15 ? 278 THR B N   1 
ATOM   4150 C CA  . THR B 1 253 ? -65.496  -15.991 34.334  1.00 90.58  ? 278 THR B CA  1 
ATOM   4151 C C   . THR B 1 253 ? -65.925  -14.528 34.405  1.00 99.37  ? 278 THR B C   1 
ATOM   4152 O O   . THR B 1 253 ? -65.765  -13.783 33.446  1.00 94.75  ? 278 THR B O   1 
ATOM   4153 C CB  . THR B 1 253 ? -64.211  -16.145 35.157  1.00 102.34 ? 278 THR B CB  1 
ATOM   4154 O OG1 . THR B 1 253 ? -63.389  -17.170 34.587  1.00 103.01 ? 278 THR B OG1 1 
ATOM   4155 C CG2 . THR B 1 253 ? -64.531  -16.478 36.629  1.00 99.40  ? 278 THR B CG2 1 
ATOM   4156 N N   . PHE B 1 254 ? -66.463  -14.107 35.544  1.00 107.09 ? 279 PHE B N   1 
ATOM   4157 C CA  . PHE B 1 254 ? -66.930  -12.730 35.694  1.00 103.37 ? 279 PHE B CA  1 
ATOM   4158 C C   . PHE B 1 254 ? -66.734  -12.235 37.111  1.00 105.27 ? 279 PHE B C   1 
ATOM   4159 O O   . PHE B 1 254 ? -67.182  -12.876 38.062  1.00 112.50 ? 279 PHE B O   1 
ATOM   4160 C CB  . PHE B 1 254 ? -68.417  -12.626 35.359  1.00 107.88 ? 279 PHE B CB  1 
ATOM   4161 C CG  . PHE B 1 254 ? -68.759  -13.042 33.963  1.00 105.23 ? 279 PHE B CG  1 
ATOM   4162 C CD1 . PHE B 1 254 ? -68.936  -14.373 33.653  1.00 115.23 ? 279 PHE B CD1 1 
ATOM   4163 C CD2 . PHE B 1 254 ? -68.923  -12.106 32.969  1.00 99.55  ? 279 PHE B CD2 1 
ATOM   4164 C CE1 . PHE B 1 254 ? -69.254  -14.764 32.379  1.00 107.69 ? 279 PHE B CE1 1 
ATOM   4165 C CE2 . PHE B 1 254 ? -69.243  -12.491 31.694  1.00 102.81 ? 279 PHE B CE2 1 
ATOM   4166 C CZ  . PHE B 1 254 ? -69.408  -13.825 31.397  1.00 102.54 ? 279 PHE B CZ  1 
ATOM   4167 N N   . ARG B 1 255 ? -66.102  -11.077 37.259  1.00 84.72  ? 280 ARG B N   1 
ATOM   4168 C CA  . ARG B 1 255 ? -65.756  -10.592 38.591  1.00 102.56 ? 280 ARG B CA  1 
ATOM   4169 C C   . ARG B 1 255 ? -65.725  -9.076  38.631  1.00 91.00  ? 280 ARG B C   1 
ATOM   4170 O O   . ARG B 1 255 ? -64.952  -8.467  37.903  1.00 79.32  ? 280 ARG B O   1 
ATOM   4171 C CB  . ARG B 1 255 ? -64.382  -11.172 39.047  1.00 62.76  ? 280 ARG B CB  1 
ATOM   4172 N N   . ARG B 1 256 ? -66.543  -8.469  39.492  1.00 90.98  ? 281 ARG B N   1 
ATOM   4173 C CA  . ARG B 1 256 ? -66.491  -7.027  39.684  1.00 84.74  ? 281 ARG B CA  1 
ATOM   4174 C C   . ARG B 1 256 ? -65.081  -6.682  40.142  1.00 96.67  ? 281 ARG B C   1 
ATOM   4175 O O   . ARG B 1 256 ? -64.534  -7.347  41.010  1.00 102.42 ? 281 ARG B O   1 
ATOM   4176 C CB  . ARG B 1 256 ? -67.524  -6.584  40.723  1.00 81.90  ? 281 ARG B CB  1 
ATOM   4177 C CG  . ARG B 1 256 ? -67.260  -5.204  41.308  1.00 96.49  ? 281 ARG B CG  1 
ATOM   4178 C CD  . ARG B 1 256 ? -67.908  -4.107  40.495  1.00 94.53  ? 281 ARG B CD  1 
ATOM   4179 N NE  . ARG B 1 256 ? -69.210  -3.729  41.045  1.00 102.63 ? 281 ARG B NE  1 
ATOM   4180 C CZ  . ARG B 1 256 ? -69.443  -2.607  41.723  1.00 94.62  ? 281 ARG B CZ  1 
ATOM   4181 N NH1 . ARG B 1 256 ? -68.468  -1.736  41.923  1.00 80.33  ? 281 ARG B NH1 1 
ATOM   4182 N NH2 . ARG B 1 256 ? -70.655  -2.347  42.191  1.00 99.35  ? 281 ARG B NH2 1 
ATOM   4183 N N   . LEU B 1 257 ? -64.476  -5.657  39.558  1.00 87.80  ? 282 LEU B N   1 
ATOM   4184 C CA  . LEU B 1 257 ? -63.092  -5.336  39.895  1.00 78.10  ? 282 LEU B CA  1 
ATOM   4185 C C   . LEU B 1 257 ? -62.898  -4.191  40.905  1.00 103.67 ? 282 LEU B C   1 
ATOM   4186 O O   . LEU B 1 257 ? -61.994  -4.256  41.734  1.00 129.49 ? 282 LEU B O   1 
ATOM   4187 C CB  . LEU B 1 257 ? -62.274  -5.092  38.631  1.00 90.44  ? 282 LEU B CB  1 
ATOM   4188 C CG  . LEU B 1 257 ? -62.244  -6.299  37.692  1.00 94.01  ? 282 LEU B CG  1 
ATOM   4189 C CD1 . LEU B 1 257 ? -61.647  -5.950  36.336  1.00 90.23  ? 282 LEU B CD1 1 
ATOM   4190 C CD2 . LEU B 1 257 ? -61.481  -7.432  38.329  1.00 101.73 ? 282 LEU B CD2 1 
ATOM   4191 N N   . ASP B 1 258 ? -63.730  -3.153  40.851  1.00 90.32  ? 283 ASP B N   1 
ATOM   4192 C CA  . ASP B 1 258 ? -63.605  -2.040  41.796  1.00 96.54  ? 283 ASP B CA  1 
ATOM   4193 C C   . ASP B 1 258 ? -64.247  -2.328  43.154  1.00 113.97 ? 283 ASP B C   1 
ATOM   4194 O O   . ASP B 1 258 ? -65.036  -3.262  43.301  1.00 112.23 ? 283 ASP B O   1 
ATOM   4195 C CB  . ASP B 1 258 ? -64.191  -0.758  41.207  1.00 95.25  ? 283 ASP B CB  1 
ATOM   4196 C CG  . ASP B 1 258 ? -65.645  -0.910  40.840  1.00 93.73  ? 283 ASP B CG  1 
ATOM   4197 O OD1 . ASP B 1 258 ? -65.972  -1.908  40.176  1.00 85.53  ? 283 ASP B OD1 1 
ATOM   4198 O OD2 . ASP B 1 258 ? -66.461  -0.040  41.208  1.00 101.74 ? 283 ASP B OD2 1 
ATOM   4199 N N   . ASN B 1 259 ? -63.904  -1.510  44.143  1.00 118.38 ? 284 ASN B N   1 
ATOM   4200 C CA  . ASN B 1 259 ? -64.460  -1.659  45.480  1.00 124.52 ? 284 ASN B CA  1 
ATOM   4201 C C   . ASN B 1 259 ? -65.763  -0.885  45.653  1.00 132.71 ? 284 ASN B C   1 
ATOM   4202 O O   . ASN B 1 259 ? -65.829  0.291   45.307  1.00 132.87 ? 284 ASN B O   1 
ATOM   4203 C CB  . ASN B 1 259 ? -63.444  -1.188  46.520  1.00 128.05 ? 284 ASN B CB  1 
ATOM   4204 C CG  . ASN B 1 259 ? -63.836  -1.570  47.927  1.00 145.00 ? 284 ASN B CG  1 
ATOM   4205 O OD1 . ASN B 1 259 ? -64.702  -2.420  48.131  1.00 149.52 ? 284 ASN B OD1 1 
ATOM   4206 N ND2 . ASN B 1 259 ? -63.199  -0.946  48.909  1.00 148.58 ? 284 ASN B ND2 1 
ATOM   4207 N N   . LYS B 1 260 ? -66.799  -1.532  46.187  1.00 113.41 ? 285 LYS B N   1 
ATOM   4208 C CA  . LYS B 1 260 ? -68.066  -0.836  46.437  1.00 106.61 ? 285 LYS B CA  1 
ATOM   4209 C C   . LYS B 1 260 ? -68.058  -0.135  47.789  1.00 131.60 ? 285 LYS B C   1 
ATOM   4210 O O   . LYS B 1 260 ? -68.824  0.804   48.008  1.00 125.39 ? 285 LYS B O   1 
ATOM   4211 C CB  . LYS B 1 260 ? -69.266  -1.782  46.393  1.00 73.56  ? 285 LYS B CB  1 
ATOM   4212 C CG  . LYS B 1 260 ? -69.005  -3.134  45.777  1.00 75.97  ? 285 LYS B CG  1 
ATOM   4213 C CD  . LYS B 1 260 ? -70.024  -4.137  46.299  1.00 108.09 ? 285 LYS B CD  1 
ATOM   4214 C CE  . LYS B 1 260 ? -69.686  -5.562  45.866  1.00 154.93 ? 285 LYS B CE  1 
ATOM   4215 N NZ  . LYS B 1 260 ? -70.584  -6.586  46.491  1.00 128.92 ? 285 LYS B NZ  1 
ATOM   4216 N N   . ASP B 1 261 ? -67.208  -0.612  48.697  1.00 139.28 ? 286 ASP B N   1 
ATOM   4217 C CA  . ASP B 1 261 ? -67.089  -0.022  50.030  1.00 137.92 ? 286 ASP B CA  1 
ATOM   4218 C C   . ASP B 1 261 ? -66.690  1.459   49.956  1.00 145.29 ? 286 ASP B C   1 
ATOM   4219 O O   . ASP B 1 261 ? -65.588  1.787   49.521  1.00 142.22 ? 286 ASP B O   1 
ATOM   4220 C CB  . ASP B 1 261 ? -66.069  -0.810  50.865  1.00 138.17 ? 286 ASP B CB  1 
ATOM   4221 C CG  . ASP B 1 261 ? -65.789  -0.167  52.211  1.00 151.82 ? 286 ASP B CG  1 
ATOM   4222 O OD1 . ASP B 1 261 ? -66.652  0.587   52.706  1.00 153.68 ? 286 ASP B OD1 1 
ATOM   4223 O OD2 . ASP B 1 261 ? -64.705  -0.420  52.779  1.00 156.96 ? 286 ASP B OD2 1 
ATOM   4224 N N   . PRO B 1 262 ? -67.588  2.361   50.387  1.00 149.80 ? 287 PRO B N   1 
ATOM   4225 C CA  . PRO B 1 262 ? -67.320  3.804   50.350  1.00 134.67 ? 287 PRO B CA  1 
ATOM   4226 C C   . PRO B 1 262 ? -66.069  4.200   51.130  1.00 140.16 ? 287 PRO B C   1 
ATOM   4227 O O   . PRO B 1 262 ? -65.348  5.096   50.701  1.00 144.83 ? 287 PRO B O   1 
ATOM   4228 C CB  . PRO B 1 262 ? -68.563  4.410   51.012  1.00 147.29 ? 287 PRO B CB  1 
ATOM   4229 C CG  . PRO B 1 262 ? -69.635  3.397   50.812  1.00 150.83 ? 287 PRO B CG  1 
ATOM   4230 C CD  . PRO B 1 262 ? -68.946  2.064   50.877  1.00 162.31 ? 287 PRO B CD  1 
ATOM   4231 N N   . ASP B 1 263 ? -65.832  3.550   52.266  1.00 146.12 ? 288 ASP B N   1 
ATOM   4232 C CA  . ASP B 1 263 ? -64.632  3.792   53.065  1.00 161.12 ? 288 ASP B CA  1 
ATOM   4233 C C   . ASP B 1 263 ? -63.453  3.028   52.487  1.00 151.60 ? 288 ASP B C   1 
ATOM   4234 O O   . ASP B 1 263 ? -63.635  2.111   51.694  1.00 158.01 ? 288 ASP B O   1 
ATOM   4235 C CB  . ASP B 1 263 ? -64.838  3.357   54.520  1.00 164.19 ? 288 ASP B CB  1 
ATOM   4236 C CG  . ASP B 1 263 ? -65.839  4.220   55.253  1.00 171.23 ? 288 ASP B CG  1 
ATOM   4237 O OD1 . ASP B 1 263 ? -65.788  5.459   55.090  1.00 174.33 ? 288 ASP B OD1 1 
ATOM   4238 O OD2 . ASP B 1 263 ? -66.668  3.653   56.000  1.00 152.83 ? 288 ASP B OD2 1 
ATOM   4239 N N   . ASN B 1 264 ? -62.245  3.397   52.897  1.00 142.41 ? 289 ASN B N   1 
ATOM   4240 C CA  . ASN B 1 264 ? -61.049  2.690   52.466  1.00 137.78 ? 289 ASN B CA  1 
ATOM   4241 C C   . ASN B 1 264 ? -60.795  2.810   50.968  1.00 136.70 ? 289 ASN B C   1 
ATOM   4242 O O   . ASN B 1 264 ? -60.227  1.911   50.355  1.00 140.17 ? 289 ASN B O   1 
ATOM   4243 C CB  . ASN B 1 264 ? -61.128  1.219   52.870  1.00 145.75 ? 289 ASN B CB  1 
ATOM   4244 C CG  . ASN B 1 264 ? -59.862  0.459   52.540  1.00 143.37 ? 289 ASN B CG  1 
ATOM   4245 O OD1 . ASN B 1 264 ? -58.767  1.012   52.592  1.00 144.02 ? 289 ASN B OD1 1 
ATOM   4246 N ND2 . ASN B 1 264 ? -60.004  -0.815  52.196  1.00 135.06 ? 289 ASN B ND2 1 
ATOM   4247 N N   . ASN B 1 265 ? -61.238  3.915   50.379  1.00 129.90 ? 290 ASN B N   1 
ATOM   4248 C CA  . ASN B 1 265 ? -60.939  4.217   48.981  1.00 130.71 ? 290 ASN B CA  1 
ATOM   4249 C C   . ASN B 1 265 ? -61.475  5.579   48.548  1.00 124.04 ? 290 ASN B C   1 
ATOM   4250 O O   . ASN B 1 265 ? -62.054  6.310   49.351  1.00 116.48 ? 290 ASN B O   1 
ATOM   4251 C CB  . ASN B 1 265 ? -61.438  3.111   48.041  1.00 122.19 ? 290 ASN B CB  1 
ATOM   4252 C CG  . ASN B 1 265 ? -62.895  3.273   47.657  1.00 121.49 ? 290 ASN B CG  1 
ATOM   4253 O OD1 . ASN B 1 265 ? -63.651  3.988   48.312  1.00 136.39 ? 290 ASN B OD1 1 
ATOM   4254 N ND2 . ASN B 1 265 ? -63.298  2.597   46.589  1.00 111.24 ? 290 ASN B ND2 1 
ATOM   4255 N N   . VAL B 1 266 ? -61.267  5.909   47.277  1.00 119.30 ? 291 VAL B N   1 
ATOM   4256 C CA  . VAL B 1 266 ? -61.753  7.153   46.695  1.00 118.76 ? 291 VAL B CA  1 
ATOM   4257 C C   . VAL B 1 266 ? -62.187  6.905   45.259  1.00 133.26 ? 291 VAL B C   1 
ATOM   4258 O O   . VAL B 1 266 ? -61.903  5.844   44.691  1.00 131.95 ? 291 VAL B O   1 
ATOM   4259 C CB  . VAL B 1 266 ? -60.674  8.227   46.670  1.00 97.24  ? 291 VAL B CB  1 
ATOM   4260 C CG1 . VAL B 1 266 ? -60.661  9.002   47.980  1.00 114.67 ? 291 VAL B CG1 1 
ATOM   4261 C CG2 . VAL B 1 266 ? -59.323  7.611   46.362  1.00 67.82  ? 291 VAL B CG2 1 
ATOM   4262 N N   . ALA B 1 267 ? -62.863  7.889   44.670  1.00 130.01 ? 292 ALA B N   1 
ATOM   4263 C CA  . ALA B 1 267 ? -63.400  7.745   43.320  1.00 131.85 ? 292 ALA B CA  1 
ATOM   4264 C C   . ALA B 1 267 ? -64.225  6.474   43.235  1.00 136.78 ? 292 ALA B C   1 
ATOM   4265 O O   . ALA B 1 267 ? -63.960  5.614   42.397  1.00 145.79 ? 292 ALA B O   1 
ATOM   4266 C CB  . ALA B 1 267 ? -62.279  7.717   42.292  1.00 130.44 ? 292 ALA B CB  1 
ATOM   4267 N N   . PRO B 1 268 ? -65.226  6.344   44.116  1.00 121.38 ? 293 PRO B N   1 
ATOM   4268 C CA  . PRO B 1 268 ? -66.036  5.124   44.151  1.00 101.34 ? 293 PRO B CA  1 
ATOM   4269 C C   . PRO B 1 268 ? -66.711  4.931   42.808  1.00 118.15 ? 293 PRO B C   1 
ATOM   4270 O O   . PRO B 1 268 ? -66.997  5.918   42.127  1.00 121.42 ? 293 PRO B O   1 
ATOM   4271 C CB  . PRO B 1 268 ? -67.087  5.429   45.218  1.00 111.47 ? 293 PRO B CB  1 
ATOM   4272 C CG  . PRO B 1 268 ? -66.507  6.565   46.023  1.00 132.44 ? 293 PRO B CG  1 
ATOM   4273 C CD  . PRO B 1 268 ? -65.725  7.371   45.045  1.00 115.09 ? 293 PRO B CD  1 
ATOM   4274 N N   . GLY B 1 269 ? -66.956  3.683   42.427  1.00 129.80 ? 294 GLY B N   1 
ATOM   4275 C CA  . GLY B 1 269 ? -67.566  3.406   41.141  1.00 129.87 ? 294 GLY B CA  1 
ATOM   4276 C C   . GLY B 1 269 ? -66.658  3.771   39.979  1.00 115.55 ? 294 GLY B C   1 
ATOM   4277 O O   . GLY B 1 269 ? -65.444  3.592   40.057  1.00 114.57 ? 294 GLY B O   1 
ATOM   4278 N N   . TYR B 1 270 ? -67.237  4.284   38.898  1.00 100.73 ? 295 TYR B N   1 
ATOM   4279 C CA  . TYR B 1 270 ? -66.451  4.618   37.714  1.00 97.14  ? 295 TYR B CA  1 
ATOM   4280 C C   . TYR B 1 270 ? -67.158  5.653   36.841  1.00 94.65  ? 295 TYR B C   1 
ATOM   4281 O O   . TYR B 1 270 ? -68.317  5.498   36.472  1.00 90.19  ? 295 TYR B O   1 
ATOM   4282 C CB  . TYR B 1 270 ? -66.145  3.352   36.912  1.00 88.18  ? 295 TYR B CB  1 
ATOM   4283 C CG  . TYR B 1 270 ? -65.202  3.549   35.742  1.00 102.31 ? 295 TYR B CG  1 
ATOM   4284 C CD1 . TYR B 1 270 ? -63.842  3.303   35.863  1.00 98.15  ? 295 TYR B CD1 1 
ATOM   4285 C CD2 . TYR B 1 270 ? -65.678  3.964   34.508  1.00 117.41 ? 295 TYR B CD2 1 
ATOM   4286 C CE1 . TYR B 1 270 ? -62.985  3.480   34.789  1.00 105.26 ? 295 TYR B CE1 1 
ATOM   4287 C CE2 . TYR B 1 270 ? -64.825  4.140   33.423  1.00 106.02 ? 295 TYR B CE2 1 
ATOM   4288 C CZ  . TYR B 1 270 ? -63.482  3.897   33.569  1.00 100.14 ? 295 TYR B CZ  1 
ATOM   4289 O OH  . TYR B 1 270 ? -62.645  4.076   32.488  1.00 99.88  ? 295 TYR B OH  1 
ATOM   4290 N N   . ASN B 1 271 ? -66.443  6.715   36.510  1.00 98.87  ? 296 ASN B N   1 
ATOM   4291 C CA  . ASN B 1 271 ? -67.022  7.793   35.731  1.00 97.37  ? 296 ASN B CA  1 
ATOM   4292 C C   . ASN B 1 271 ? -65.948  8.733   35.208  1.00 97.78  ? 296 ASN B C   1 
ATOM   4293 O O   . ASN B 1 271 ? -64.830  8.769   35.731  1.00 107.32 ? 296 ASN B O   1 
ATOM   4294 C CB  . ASN B 1 271 ? -67.973  8.604   36.600  1.00 98.53  ? 296 ASN B CB  1 
ATOM   4295 C CG  . ASN B 1 271 ? -67.252  9.688   37.376  1.00 95.10  ? 296 ASN B CG  1 
ATOM   4296 O OD1 . ASN B 1 271 ? -67.616  10.861  37.312  1.00 81.20  ? 296 ASN B OD1 1 
ATOM   4297 N ND2 . ASN B 1 271 ? -66.198  9.303   38.086  1.00 90.86  ? 296 ASN B ND2 1 
ATOM   4298 N N   . PHE B 1 272 ? -66.296  9.511   34.189  1.00 69.81  ? 297 PHE B N   1 
ATOM   4299 C CA  . PHE B 1 272 ? -65.378  10.512  33.690  1.00 65.61  ? 297 PHE B CA  1 
ATOM   4300 C C   . PHE B 1 272 ? -66.127  11.646  33.020  1.00 74.39  ? 297 PHE B C   1 
ATOM   4301 O O   . PHE B 1 272 ? -67.332  11.556  32.802  1.00 86.98  ? 297 PHE B O   1 
ATOM   4302 C CB  . PHE B 1 272 ? -64.369  9.883   32.737  1.00 75.81  ? 297 PHE B CB  1 
ATOM   4303 C CG  . PHE B 1 272 ? -64.983  9.239   31.531  1.00 77.76  ? 297 PHE B CG  1 
ATOM   4304 C CD1 . PHE B 1 272 ? -65.015  7.855   31.414  1.00 80.51  ? 297 PHE B CD1 1 
ATOM   4305 C CD2 . PHE B 1 272 ? -65.509  10.014  30.499  1.00 79.92  ? 297 PHE B CD2 1 
ATOM   4306 C CE1 . PHE B 1 272 ? -65.571  7.249   30.295  1.00 90.28  ? 297 PHE B CE1 1 
ATOM   4307 C CE2 . PHE B 1 272 ? -66.067  9.416   29.375  1.00 85.28  ? 297 PHE B CE2 1 
ATOM   4308 C CZ  . PHE B 1 272 ? -66.098  8.033   29.275  1.00 92.84  ? 297 PHE B CZ  1 
ATOM   4309 N N   . ARG B 1 273 ? -65.420  12.726  32.722  1.00 80.66  ? 298 ARG B N   1 
ATOM   4310 C CA  . ARG B 1 273 ? -66.044  13.843  32.044  1.00 88.14  ? 298 ARG B CA  1 
ATOM   4311 C C   . ARG B 1 273 ? -65.659  13.842  30.571  1.00 94.68  ? 298 ARG B C   1 
ATOM   4312 O O   . ARG B 1 273 ? -64.594  13.350  30.175  1.00 84.67  ? 298 ARG B O   1 
ATOM   4313 C CB  . ARG B 1 273 ? -65.675  15.168  32.723  1.00 72.89  ? 298 ARG B CB  1 
ATOM   4314 C CG  . ARG B 1 273 ? -65.656  15.080  34.235  1.00 86.57  ? 298 ARG B CG  1 
ATOM   4315 C CD  . ARG B 1 273 ? -65.863  16.429  34.905  1.00 94.82  ? 298 ARG B CD  1 
ATOM   4316 N NE  . ARG B 1 273 ? -66.312  16.265  36.286  1.00 90.96  ? 298 ARG B NE  1 
ATOM   4317 C CZ  . ARG B 1 273 ? -66.699  17.265  37.075  1.00 123.08 ? 298 ARG B CZ  1 
ATOM   4318 N NH1 . ARG B 1 273 ? -66.687  18.519  36.627  1.00 133.23 ? 298 ARG B NH1 1 
ATOM   4319 N NH2 . ARG B 1 273 ? -67.098  17.014  38.316  1.00 129.79 ? 298 ARG B NH2 1 
ATOM   4320 N N   . PHE B 1 274 ? -66.555  14.370  29.757  1.00 92.52  ? 299 PHE B N   1 
ATOM   4321 C CA  . PHE B 1 274 ? -66.250  14.598  28.361  1.00 88.08  ? 299 PHE B CA  1 
ATOM   4322 C C   . PHE B 1 274 ? -67.182  15.659  27.834  1.00 89.21  ? 299 PHE B C   1 
ATOM   4323 O O   . PHE B 1 274 ? -68.124  16.065  28.516  1.00 92.28  ? 299 PHE B O   1 
ATOM   4324 C CB  . PHE B 1 274 ? -66.378  13.316  27.543  1.00 81.93  ? 299 PHE B CB  1 
ATOM   4325 C CG  . PHE B 1 274 ? -67.751  12.707  27.559  1.00 85.53  ? 299 PHE B CG  1 
ATOM   4326 C CD1 . PHE B 1 274 ? -67.973  11.499  28.193  1.00 87.73  ? 299 PHE B CD1 1 
ATOM   4327 C CD2 . PHE B 1 274 ? -68.810  13.322  26.916  1.00 88.73  ? 299 PHE B CD2 1 
ATOM   4328 C CE1 . PHE B 1 274 ? -69.219  10.922  28.196  1.00 89.71  ? 299 PHE B CE1 1 
ATOM   4329 C CE2 . PHE B 1 274 ? -70.065  12.748  26.919  1.00 77.16  ? 299 PHE B CE2 1 
ATOM   4330 C CZ  . PHE B 1 274 ? -70.268  11.546  27.561  1.00 84.52  ? 299 PHE B CZ  1 
ATOM   4331 N N   . ALA B 1 275 ? -66.922  16.114  26.617  1.00 78.59  ? 300 ALA B N   1 
ATOM   4332 C CA  . ALA B 1 275 ? -67.654  17.262  26.114  1.00 89.53  ? 300 ALA B CA  1 
ATOM   4333 C C   . ALA B 1 275 ? -67.966  17.235  24.627  1.00 91.88  ? 300 ALA B C   1 
ATOM   4334 O O   . ALA B 1 275 ? -67.363  16.495  23.842  1.00 87.86  ? 300 ALA B O   1 
ATOM   4335 C CB  . ALA B 1 275 ? -66.929  18.547  26.474  1.00 99.78  ? 300 ALA B CB  1 
ATOM   4336 N N   . LYS B 1 276 ? -68.928  18.071  24.266  1.00 85.57  ? 301 LYS B N   1 
ATOM   4337 C CA  . LYS B 1 276 ? -69.369  18.220  22.902  1.00 94.14  ? 301 LYS B CA  1 
ATOM   4338 C C   . LYS B 1 276 ? -69.179  19.683  22.578  1.00 102.81 ? 301 LYS B C   1 
ATOM   4339 O O   . LYS B 1 276 ? -69.728  20.543  23.263  1.00 101.59 ? 301 LYS B O   1 
ATOM   4340 C CB  . LYS B 1 276 ? -70.850  17.864  22.795  1.00 93.51  ? 301 LYS B CB  1 
ATOM   4341 C CG  . LYS B 1 276 ? -71.260  16.673  23.626  1.00 98.93  ? 301 LYS B CG  1 
ATOM   4342 C CD  . LYS B 1 276 ? -70.897  15.343  22.979  1.00 94.99  ? 301 LYS B CD  1 
ATOM   4343 C CE  . LYS B 1 276 ? -71.988  14.868  22.018  1.00 120.32 ? 301 LYS B CE  1 
ATOM   4344 N NZ  . LYS B 1 276 ? -73.342  14.772  22.650  1.00 110.46 ? 301 LYS B NZ  1 
ATOM   4345 N N   . TYR B 1 277 ? -68.394  19.970  21.548  1.00 97.46  ? 302 TYR B N   1 
ATOM   4346 C CA  . TYR B 1 277 ? -68.086  21.348  21.225  1.00 96.37  ? 302 TYR B CA  1 
ATOM   4347 C C   . TYR B 1 277 ? -68.909  21.844  20.041  1.00 104.71 ? 302 TYR B C   1 
ATOM   4348 O O   . TYR B 1 277 ? -69.135  21.110  19.077  1.00 103.58 ? 302 TYR B O   1 
ATOM   4349 C CB  . TYR B 1 277 ? -66.584  21.497  21.000  1.00 102.89 ? 302 TYR B CB  1 
ATOM   4350 C CG  . TYR B 1 277 ? -65.772  21.049  22.201  1.00 99.54  ? 302 TYR B CG  1 
ATOM   4351 C CD1 . TYR B 1 277 ? -65.309  19.744  22.305  1.00 94.88  ? 302 TYR B CD1 1 
ATOM   4352 C CD2 . TYR B 1 277 ? -65.487  21.926  23.238  1.00 110.19 ? 302 TYR B CD2 1 
ATOM   4353 C CE1 . TYR B 1 277 ? -64.568  19.334  23.400  1.00 95.45  ? 302 TYR B CE1 1 
ATOM   4354 C CE2 . TYR B 1 277 ? -64.754  21.523  24.337  1.00 106.75 ? 302 TYR B CE2 1 
ATOM   4355 C CZ  . TYR B 1 277 ? -64.295  20.228  24.414  1.00 106.89 ? 302 TYR B CZ  1 
ATOM   4356 O OH  . TYR B 1 277 ? -63.568  19.819  25.510  1.00 114.22 ? 302 TYR B OH  1 
ATOM   4357 N N   . TYR B 1 278 ? -69.369  23.089  20.128  1.00 100.99 ? 303 TYR B N   1 
ATOM   4358 C CA  . TYR B 1 278 ? -70.232  23.664  19.102  1.00 117.83 ? 303 TYR B CA  1 
ATOM   4359 C C   . TYR B 1 278 ? -69.823  25.097  18.775  1.00 134.03 ? 303 TYR B C   1 
ATOM   4360 O O   . TYR B 1 278 ? -69.867  25.980  19.638  1.00 129.11 ? 303 TYR B O   1 
ATOM   4361 C CB  . TYR B 1 278 ? -71.694  23.683  19.561  1.00 120.12 ? 303 TYR B CB  1 
ATOM   4362 C CG  . TYR B 1 278 ? -72.231  22.377  20.105  1.00 139.37 ? 303 TYR B CG  1 
ATOM   4363 C CD1 . TYR B 1 278 ? -72.196  21.213  19.348  1.00 150.68 ? 303 TYR B CD1 1 
ATOM   4364 C CD2 . TYR B 1 278 ? -72.813  22.317  21.366  1.00 134.65 ? 303 TYR B CD2 1 
ATOM   4365 C CE1 . TYR B 1 278 ? -72.707  20.017  19.846  1.00 132.27 ? 303 TYR B CE1 1 
ATOM   4366 C CE2 . TYR B 1 278 ? -73.326  21.127  21.866  1.00 135.79 ? 303 TYR B CE2 1 
ATOM   4367 C CZ  . TYR B 1 278 ? -73.270  19.982  21.100  1.00 116.59 ? 303 TYR B CZ  1 
ATOM   4368 O OH  . TYR B 1 278 ? -73.774  18.797  21.586  1.00 106.15 ? 303 TYR B OH  1 
ATOM   4369 N N   . LYS B 1 279 ? -69.439  25.332  17.526  1.00 156.20 ? 304 LYS B N   1 
ATOM   4370 C CA  . LYS B 1 279 ? -69.172  26.689  17.086  1.00 149.96 ? 304 LYS B CA  1 
ATOM   4371 C C   . LYS B 1 279 ? -70.492  27.422  16.942  1.00 151.28 ? 304 LYS B C   1 
ATOM   4372 O O   . LYS B 1 279 ? -71.219  27.236  15.965  1.00 149.94 ? 304 LYS B O   1 
ATOM   4373 C CB  . LYS B 1 279 ? -68.414  26.698  15.780  1.00 140.46 ? 304 LYS B CB  1 
ATOM   4374 N N   . ASN B 1 280 ? -70.796  28.245  17.938  1.00 156.12 ? 305 ASN B N   1 
ATOM   4375 C CA  . ASN B 1 280 ? -71.960  29.115  17.908  1.00 165.94 ? 305 ASN B CA  1 
ATOM   4376 C C   . ASN B 1 280 ? -71.941  29.978  16.643  1.00 190.80 ? 305 ASN B C   1 
ATOM   4377 O O   . ASN B 1 280 ? -70.872  30.268  16.100  1.00 195.58 ? 305 ASN B O   1 
ATOM   4378 C CB  . ASN B 1 280 ? -71.959  29.987  19.165  1.00 155.99 ? 305 ASN B CB  1 
ATOM   4379 C CG  . ASN B 1 280 ? -73.144  30.919  19.235  1.00 168.01 ? 305 ASN B CG  1 
ATOM   4380 O OD1 . ASN B 1 280 ? -74.179  30.684  18.610  1.00 176.14 ? 305 ASN B OD1 1 
ATOM   4381 N ND2 . ASN B 1 280 ? -73.001  31.989  20.009  1.00 170.27 ? 305 ASN B ND2 1 
ATOM   4382 N N   . SER B 1 281 ? -73.121  30.380  16.173  1.00 196.97 ? 306 SER B N   1 
ATOM   4383 C CA  . SER B 1 281 ? -73.239  31.198  14.963  1.00 190.73 ? 306 SER B CA  1 
ATOM   4384 C C   . SER B 1 281 ? -72.523  32.543  15.106  1.00 179.07 ? 306 SER B C   1 
ATOM   4385 O O   . SER B 1 281 ? -72.161  33.175  14.113  1.00 168.88 ? 306 SER B O   1 
ATOM   4386 C CB  . SER B 1 281 ? -74.712  31.419  14.600  1.00 174.42 ? 306 SER B CB  1 
ATOM   4387 O OG  . SER B 1 281 ? -75.341  30.206  14.216  1.00 167.63 ? 306 SER B OG  1 
ATOM   4388 N N   . ASP B 1 282 ? -72.326  32.969  16.349  1.00 175.44 ? 307 ASP B N   1 
ATOM   4389 C CA  . ASP B 1 282 ? -71.611  34.206  16.648  1.00 170.46 ? 307 ASP B CA  1 
ATOM   4390 C C   . ASP B 1 282 ? -70.106  34.018  16.501  1.00 168.65 ? 307 ASP B C   1 
ATOM   4391 O O   . ASP B 1 282 ? -69.335  34.959  16.685  1.00 166.86 ? 307 ASP B O   1 
ATOM   4392 C CB  . ASP B 1 282 ? -71.913  34.665  18.075  1.00 160.40 ? 307 ASP B CB  1 
ATOM   4393 C CG  . ASP B 1 282 ? -73.396  34.813  18.341  1.00 174.15 ? 307 ASP B CG  1 
ATOM   4394 O OD1 . ASP B 1 282 ? -74.207  34.331  17.522  1.00 173.66 ? 307 ASP B OD1 1 
ATOM   4395 O OD2 . ASP B 1 282 ? -73.746  35.413  19.380  1.00 166.06 ? 307 ASP B OD2 1 
ATOM   4396 N N   . GLY B 1 283 ? -69.693  32.796  16.185  1.00 160.33 ? 308 GLY B N   1 
ATOM   4397 C CA  . GLY B 1 283 ? -68.283  32.472  16.084  1.00 159.44 ? 308 GLY B CA  1 
ATOM   4398 C C   . GLY B 1 283 ? -67.655  32.082  17.408  1.00 155.10 ? 308 GLY B C   1 
ATOM   4399 O O   . GLY B 1 283 ? -66.547  31.552  17.439  1.00 136.18 ? 308 GLY B O   1 
ATOM   4400 N N   . THR B 1 284 ? -68.364  32.350  18.503  1.00 168.92 ? 309 THR B N   1 
ATOM   4401 C CA  . THR B 1 284 ? -67.898  32.000  19.847  1.00 159.24 ? 309 THR B CA  1 
ATOM   4402 C C   . THR B 1 284 ? -68.140  30.516  20.172  1.00 147.48 ? 309 THR B C   1 
ATOM   4403 O O   . THR B 1 284 ? -69.105  29.917  19.692  1.00 146.05 ? 309 THR B O   1 
ATOM   4404 C CB  . THR B 1 284 ? -68.570  32.887  20.918  1.00 152.11 ? 309 THR B CB  1 
ATOM   4405 O OG1 . THR B 1 284 ? -69.994  32.749  20.829  1.00 144.56 ? 309 THR B OG1 1 
ATOM   4406 C CG2 . THR B 1 284 ? -68.195  34.352  20.711  1.00 140.27 ? 309 THR B CG2 1 
ATOM   4407 N N   . GLU B 1 285 ? -67.256  29.934  20.983  1.00 143.25 ? 310 GLU B N   1 
ATOM   4408 C CA  . GLU B 1 285 ? -67.336  28.518  21.349  1.00 119.85 ? 310 GLU B CA  1 
ATOM   4409 C C   . GLU B 1 285 ? -68.225  28.235  22.549  1.00 117.89 ? 310 GLU B C   1 
ATOM   4410 O O   . GLU B 1 285 ? -68.198  28.960  23.544  1.00 131.63 ? 310 GLU B O   1 
ATOM   4411 C CB  . GLU B 1 285 ? -65.942  27.948  21.633  1.00 115.63 ? 310 GLU B CB  1 
ATOM   4412 C CG  . GLU B 1 285 ? -65.505  26.835  20.680  1.00 136.64 ? 310 GLU B CG  1 
ATOM   4413 C CD  . GLU B 1 285 ? -64.514  25.875  21.324  1.00 144.38 ? 310 GLU B CD  1 
ATOM   4414 O OE1 . GLU B 1 285 ? -64.011  26.194  22.421  1.00 142.72 ? 310 GLU B OE1 1 
ATOM   4415 O OE2 . GLU B 1 285 ? -64.237  24.802  20.741  1.00 127.85 ? 310 GLU B OE2 1 
ATOM   4416 N N   . THR B 1 286 ? -68.993  27.155  22.455  1.00 109.29 ? 311 THR B N   1 
ATOM   4417 C CA  . THR B 1 286 ? -69.766  26.658  23.588  1.00 114.93 ? 311 THR B CA  1 
ATOM   4418 C C   . THR B 1 286 ? -69.628  25.148  23.642  1.00 112.08 ? 311 THR B C   1 
ATOM   4419 O O   . THR B 1 286 ? -69.432  24.502  22.612  1.00 107.56 ? 311 THR B O   1 
ATOM   4420 C CB  . THR B 1 286 ? -71.263  26.988  23.468  1.00 107.23 ? 311 THR B CB  1 
ATOM   4421 O OG1 . THR B 1 286 ? -71.826  26.251  22.376  1.00 115.26 ? 311 THR B OG1 1 
ATOM   4422 C CG2 . THR B 1 286 ? -71.472  28.471  23.246  1.00 101.03 ? 311 THR B CG2 1 
ATOM   4423 N N   . ARG B 1 287 ? -69.744  24.580  24.836  1.00 105.51 ? 312 ARG B N   1 
ATOM   4424 C CA  . ARG B 1 287 ? -69.589  23.141  24.986  1.00 110.62 ? 312 ARG B CA  1 
ATOM   4425 C C   . ARG B 1 287 ? -70.580  22.574  25.983  1.00 110.42 ? 312 ARG B C   1 
ATOM   4426 O O   . ARG B 1 287 ? -71.044  23.280  26.879  1.00 113.81 ? 312 ARG B O   1 
ATOM   4427 C CB  . ARG B 1 287 ? -68.183  22.803  25.457  1.00 103.37 ? 312 ARG B CB  1 
ATOM   4428 C CG  . ARG B 1 287 ? -68.038  22.923  26.940  1.00 86.63  ? 312 ARG B CG  1 
ATOM   4429 C CD  . ARG B 1 287 ? -66.745  22.333  27.408  1.00 99.04  ? 312 ARG B CD  1 
ATOM   4430 N NE  . ARG B 1 287 ? -66.757  22.192  28.857  1.00 105.77 ? 312 ARG B NE  1 
ATOM   4431 C CZ  . ARG B 1 287 ? -65.729  21.754  29.573  1.00 107.90 ? 312 ARG B CZ  1 
ATOM   4432 N NH1 . ARG B 1 287 ? -64.589  21.409  28.971  1.00 109.97 ? 312 ARG B NH1 1 
ATOM   4433 N NH2 . ARG B 1 287 ? -65.845  21.669  30.893  1.00 86.30  ? 312 ARG B NH2 1 
ATOM   4434 N N   . THR B 1 288 ? -70.905  21.296  25.814  1.00 103.98 ? 313 THR B N   1 
ATOM   4435 C CA  . THR B 1 288 ? -71.783  20.597  26.737  1.00 94.99  ? 313 THR B CA  1 
ATOM   4436 C C   . THR B 1 288 ? -70.984  19.613  27.585  1.00 95.94  ? 313 THR B C   1 
ATOM   4437 O O   . THR B 1 288 ? -70.463  18.617  27.068  1.00 88.25  ? 313 THR B O   1 
ATOM   4438 C CB  . THR B 1 288 ? -72.866  19.822  25.987  1.00 98.54  ? 313 THR B CB  1 
ATOM   4439 O OG1 . THR B 1 288 ? -73.795  20.740  25.402  1.00 99.27  ? 313 THR B OG1 1 
ATOM   4440 C CG2 . THR B 1 288 ? -73.604  18.921  26.950  1.00 92.25  ? 313 THR B CG2 1 
ATOM   4441 N N   . LEU B 1 289 ? -70.880  19.892  28.882  1.00 102.05 ? 314 LEU B N   1 
ATOM   4442 C CA  . LEU B 1 289 ? -70.101  19.039  29.768  1.00 91.43  ? 314 LEU B CA  1 
ATOM   4443 C C   . LEU B 1 289 ? -70.942  17.904  30.323  1.00 86.68  ? 314 LEU B C   1 
ATOM   4444 O O   . LEU B 1 289 ? -72.053  18.111  30.801  1.00 89.06  ? 314 LEU B O   1 
ATOM   4445 C CB  . LEU B 1 289 ? -69.479  19.854  30.896  1.00 74.26  ? 314 LEU B CB  1 
ATOM   4446 C CG  . LEU B 1 289 ? -68.586  19.100  31.879  1.00 86.14  ? 314 LEU B CG  1 
ATOM   4447 C CD1 . LEU B 1 289 ? -67.620  18.168  31.172  1.00 80.16  ? 314 LEU B CD1 1 
ATOM   4448 C CD2 . LEU B 1 289 ? -67.827  20.092  32.732  1.00 101.98 ? 314 LEU B CD2 1 
ATOM   4449 N N   . ILE B 1 290 ? -70.385  16.702  30.265  1.00 89.06  ? 315 ILE B N   1 
ATOM   4450 C CA  . ILE B 1 290 ? -71.107  15.500  30.627  1.00 83.69  ? 315 ILE B CA  1 
ATOM   4451 C C   . ILE B 1 290 ? -70.304  14.666  31.612  1.00 91.79  ? 315 ILE B C   1 
ATOM   4452 O O   . ILE B 1 290 ? -69.249  14.133  31.272  1.00 84.01  ? 315 ILE B O   1 
ATOM   4453 C CB  . ILE B 1 290 ? -71.374  14.649  29.387  1.00 84.80  ? 315 ILE B CB  1 
ATOM   4454 C CG1 . ILE B 1 290 ? -72.169  15.449  28.355  1.00 85.71  ? 315 ILE B CG1 1 
ATOM   4455 C CG2 . ILE B 1 290 ? -72.091  13.374  29.769  1.00 82.02  ? 315 ILE B CG2 1 
ATOM   4456 C CD1 . ILE B 1 290 ? -72.787  14.597  27.265  1.00 93.75  ? 315 ILE B CD1 1 
ATOM   4457 N N   . LYS B 1 291 ? -70.787  14.598  32.849  1.00 96.39  ? 316 LYS B N   1 
ATOM   4458 C CA  . LYS B 1 291 ? -70.219  13.703  33.852  1.00 76.55  ? 316 LYS B CA  1 
ATOM   4459 C C   . LYS B 1 291 ? -70.892  12.354  33.695  1.00 84.72  ? 316 LYS B C   1 
ATOM   4460 O O   . LYS B 1 291 ? -71.957  12.126  34.273  1.00 90.23  ? 316 LYS B O   1 
ATOM   4461 C CB  . LYS B 1 291 ? -70.444  14.244  35.264  1.00 71.84  ? 316 LYS B CB  1 
ATOM   4462 N N   . GLY B 1 292 ? -70.279  11.473  32.901  1.00 85.11  ? 317 GLY B N   1 
ATOM   4463 C CA  . GLY B 1 292 ? -70.844  10.170  32.594  1.00 77.99  ? 317 GLY B CA  1 
ATOM   4464 C C   . GLY B 1 292 ? -70.409  9.092   33.563  1.00 90.35  ? 317 GLY B C   1 
ATOM   4465 O O   . GLY B 1 292 ? -69.210  8.886   33.787  1.00 76.10  ? 317 GLY B O   1 
ATOM   4466 N N   . TYR B 1 293 ? -71.393  8.423   34.158  1.00 92.45  ? 318 TYR B N   1 
ATOM   4467 C CA  . TYR B 1 293 ? -71.143  7.249   34.974  1.00 77.64  ? 318 TYR B CA  1 
ATOM   4468 C C   . TYR B 1 293 ? -71.461  6.061   34.098  1.00 79.38  ? 318 TYR B C   1 
ATOM   4469 O O   . TYR B 1 293 ? -72.312  6.154   33.218  1.00 87.28  ? 318 TYR B O   1 
ATOM   4470 C CB  . TYR B 1 293 ? -72.050  7.247   36.198  1.00 73.68  ? 318 TYR B CB  1 
ATOM   4471 C CG  . TYR B 1 293 ? -71.905  8.472   37.069  1.00 89.99  ? 318 TYR B CG  1 
ATOM   4472 C CD1 . TYR B 1 293 ? -72.566  9.652   36.749  1.00 88.65  ? 318 TYR B CD1 1 
ATOM   4473 C CD2 . TYR B 1 293 ? -71.111  8.452   38.217  1.00 91.83  ? 318 TYR B CD2 1 
ATOM   4474 C CE1 . TYR B 1 293 ? -72.440  10.783  37.543  1.00 98.48  ? 318 TYR B CE1 1 
ATOM   4475 C CE2 . TYR B 1 293 ? -70.981  9.577   39.012  1.00 94.41  ? 318 TYR B CE2 1 
ATOM   4476 C CZ  . TYR B 1 293 ? -71.648  10.740  38.669  1.00 103.00 ? 318 TYR B CZ  1 
ATOM   4477 O OH  . TYR B 1 293 ? -71.529  11.874  39.442  1.00 94.65  ? 318 TYR B OH  1 
ATOM   4478 N N   . GLY B 1 294 ? -70.777  4.948   34.324  1.00 69.17  ? 319 GLY B N   1 
ATOM   4479 C CA  . GLY B 1 294 ? -71.069  3.732   33.591  1.00 76.80  ? 319 GLY B CA  1 
ATOM   4480 C C   . GLY B 1 294 ? -70.260  2.547   34.061  1.00 82.33  ? 319 GLY B C   1 
ATOM   4481 O O   . GLY B 1 294 ? -69.475  2.661   34.990  1.00 88.05  ? 319 GLY B O   1 
ATOM   4482 N N   . ILE B 1 295 ? -70.468  1.401   33.427  1.00 81.24  ? 320 ILE B N   1 
ATOM   4483 C CA  . ILE B 1 295 ? -69.679  0.221   33.723  1.00 77.79  ? 320 ILE B CA  1 
ATOM   4484 C C   . ILE B 1 295 ? -68.650  0.002   32.629  1.00 87.30  ? 320 ILE B C   1 
ATOM   4485 O O   . ILE B 1 295 ? -68.998  -0.101  31.458  1.00 97.31  ? 320 ILE B O   1 
ATOM   4486 C CB  . ILE B 1 295 ? -70.561  -1.009  33.791  1.00 75.52  ? 320 ILE B CB  1 
ATOM   4487 C CG1 . ILE B 1 295 ? -71.849  -0.669  34.541  1.00 81.02  ? 320 ILE B CG1 1 
ATOM   4488 C CG2 . ILE B 1 295 ? -69.817  -2.145  34.434  1.00 82.52  ? 320 ILE B CG2 1 
ATOM   4489 C CD1 . ILE B 1 295 ? -72.835  -1.804  34.610  1.00 78.20  ? 320 ILE B CD1 1 
ATOM   4490 N N   . ARG B 1 296 ? -67.378  -0.056  32.999  1.00 84.50  ? 321 ARG B N   1 
ATOM   4491 C CA  . ARG B 1 296 ? -66.337  -0.364  32.028  1.00 86.18  ? 321 ARG B CA  1 
ATOM   4492 C C   . ARG B 1 296 ? -66.060  -1.858  32.013  1.00 76.83  ? 321 ARG B C   1 
ATOM   4493 O O   . ARG B 1 296 ? -65.798  -2.446  33.046  1.00 72.94  ? 321 ARG B O   1 
ATOM   4494 C CB  . ARG B 1 296 ? -65.048  0.386   32.354  1.00 83.12  ? 321 ARG B CB  1 
ATOM   4495 C CG  . ARG B 1 296 ? -64.124  0.506   31.169  1.00 89.56  ? 321 ARG B CG  1 
ATOM   4496 C CD  . ARG B 1 296 ? -62.743  -0.023  31.475  1.00 83.98  ? 321 ARG B CD  1 
ATOM   4497 N NE  . ARG B 1 296 ? -62.011  0.847   32.386  1.00 100.42 ? 321 ARG B NE  1 
ATOM   4498 C CZ  . ARG B 1 296 ? -60.829  0.541   32.916  1.00 121.08 ? 321 ARG B CZ  1 
ATOM   4499 N NH1 . ARG B 1 296 ? -60.243  -0.618  32.630  1.00 97.90  ? 321 ARG B NH1 1 
ATOM   4500 N NH2 . ARG B 1 296 ? -60.230  1.393   33.737  1.00 134.56 ? 321 ARG B NH2 1 
ATOM   4501 N N   . PHE B 1 297 ? -66.108  -2.474  30.840  1.00 74.82  ? 322 PHE B N   1 
ATOM   4502 C CA  . PHE B 1 297 ? -65.837  -3.905  30.746  1.00 85.04  ? 322 PHE B CA  1 
ATOM   4503 C C   . PHE B 1 297 ? -64.410  -4.202  30.293  1.00 81.13  ? 322 PHE B C   1 
ATOM   4504 O O   . PHE B 1 297 ? -64.032  -3.891  29.176  1.00 94.32  ? 322 PHE B O   1 
ATOM   4505 C CB  . PHE B 1 297 ? -66.861  -4.606  29.847  1.00 77.97  ? 322 PHE B CB  1 
ATOM   4506 C CG  . PHE B 1 297 ? -68.266  -4.550  30.377  1.00 87.26  ? 322 PHE B CG  1 
ATOM   4507 C CD1 . PHE B 1 297 ? -69.027  -3.409  30.229  1.00 90.19  ? 322 PHE B CD1 1 
ATOM   4508 C CD2 . PHE B 1 297 ? -68.820  -5.631  31.037  1.00 81.19  ? 322 PHE B CD2 1 
ATOM   4509 C CE1 . PHE B 1 297 ? -70.315  -3.353  30.727  1.00 89.56  ? 322 PHE B CE1 1 
ATOM   4510 C CE2 . PHE B 1 297 ? -70.108  -5.575  31.532  1.00 80.42  ? 322 PHE B CE2 1 
ATOM   4511 C CZ  . PHE B 1 297 ? -70.852  -4.439  31.379  1.00 74.28  ? 322 PHE B CZ  1 
ATOM   4512 N N   . ASP B 1 298 ? -63.616  -4.796  31.175  1.00 73.67  ? 323 ASP B N   1 
ATOM   4513 C CA  . ASP B 1 298 ? -62.255  -5.199  30.841  1.00 81.29  ? 323 ASP B CA  1 
ATOM   4514 C C   . ASP B 1 298 ? -62.205  -6.662  30.430  1.00 94.63  ? 323 ASP B C   1 
ATOM   4515 O O   . ASP B 1 298 ? -62.403  -7.548  31.260  1.00 90.30  ? 323 ASP B O   1 
ATOM   4516 C CB  . ASP B 1 298 ? -61.313  -4.980  32.031  1.00 95.71  ? 323 ASP B CB  1 
ATOM   4517 C CG  . ASP B 1 298 ? -60.928  -3.523  32.216  1.00 113.79 ? 323 ASP B CG  1 
ATOM   4518 O OD1 . ASP B 1 298 ? -61.574  -2.665  31.583  1.00 114.37 ? 323 ASP B OD1 1 
ATOM   4519 O OD2 . ASP B 1 298 ? -59.988  -3.233  32.989  1.00 102.89 ? 323 ASP B OD2 1 
ATOM   4520 N N   . VAL B 1 299 ? -61.937  -6.915  29.151  1.00 94.68  ? 324 VAL B N   1 
ATOM   4521 C CA  . VAL B 1 299 ? -61.746  -8.282  28.681  1.00 88.90  ? 324 VAL B CA  1 
ATOM   4522 C C   . VAL B 1 299 ? -60.323  -8.748  28.955  1.00 87.94  ? 324 VAL B C   1 
ATOM   4523 O O   . VAL B 1 299 ? -59.374  -8.351  28.288  1.00 88.30  ? 324 VAL B O   1 
ATOM   4524 C CB  . VAL B 1 299 ? -62.047  -8.427  27.195  1.00 92.06  ? 324 VAL B CB  1 
ATOM   4525 C CG1 . VAL B 1 299 ? -61.737  -9.834  26.737  1.00 91.10  ? 324 VAL B CG1 1 
ATOM   4526 C CG2 . VAL B 1 299 ? -63.492  -8.111  26.930  1.00 90.70  ? 324 VAL B CG2 1 
ATOM   4527 N N   . MET B 1 300 ? -60.182  -9.590  29.965  1.00 79.00  ? 325 MET B N   1 
ATOM   4528 C CA  . MET B 1 300 ? -58.873  -10.052 30.395  1.00 86.22  ? 325 MET B CA  1 
ATOM   4529 C C   . MET B 1 300 ? -58.645  -11.471 29.924  1.00 98.35  ? 325 MET B C   1 
ATOM   4530 O O   . MET B 1 300 ? -59.237  -12.414 30.464  1.00 98.43  ? 325 MET B O   1 
ATOM   4531 C CB  . MET B 1 300 ? -58.753  -9.955  31.920  1.00 88.27  ? 325 MET B CB  1 
ATOM   4532 C CG  . MET B 1 300 ? -58.891  -8.533  32.444  1.00 81.93  ? 325 MET B CG  1 
ATOM   4533 S SD  . MET B 1 300 ? -58.952  -8.471  34.213  1.00 113.41 ? 325 MET B SD  1 
ATOM   4534 C CE  . MET B 1 300 ? -60.571  -9.176  34.528  1.00 113.23 ? 325 MET B CE  1 
ATOM   4535 N N   . VAL B 1 301 ? -57.822  -11.613 28.888  1.00 93.26  ? 326 VAL B N   1 
ATOM   4536 C CA  . VAL B 1 301 ? -57.546  -12.931 28.338  1.00 90.44  ? 326 VAL B CA  1 
ATOM   4537 C C   . VAL B 1 301 ? -56.202  -13.463 28.789  1.00 94.32  ? 326 VAL B C   1 
ATOM   4538 O O   . VAL B 1 301 ? -55.201  -12.749 28.766  1.00 94.10  ? 326 VAL B O   1 
ATOM   4539 C CB  . VAL B 1 301 ? -57.585  -12.942 26.815  1.00 87.47  ? 326 VAL B CB  1 
ATOM   4540 C CG1 . VAL B 1 301 ? -57.249  -14.325 26.301  1.00 92.49  ? 326 VAL B CG1 1 
ATOM   4541 C CG2 . VAL B 1 301 ? -58.951  -12.522 26.327  1.00 97.12  ? 326 VAL B CG2 1 
ATOM   4542 N N   . PHE B 1 302 ? -56.186  -14.731 29.183  1.00 103.80 ? 327 PHE B N   1 
ATOM   4543 C CA  . PHE B 1 302 ? -54.963  -15.373 29.635  1.00 116.52 ? 327 PHE B CA  1 
ATOM   4544 C C   . PHE B 1 302 ? -55.069  -16.890 29.525  1.00 118.25 ? 327 PHE B C   1 
ATOM   4545 O O   . PHE B 1 302 ? -56.154  -17.435 29.327  1.00 114.67 ? 327 PHE B O   1 
ATOM   4546 C CB  . PHE B 1 302 ? -54.657  -14.963 31.076  1.00 113.85 ? 327 PHE B CB  1 
ATOM   4547 C CG  . PHE B 1 302 ? -55.566  -15.595 32.096  1.00 111.84 ? 327 PHE B CG  1 
ATOM   4548 C CD1 . PHE B 1 302 ? -56.782  -15.013 32.417  1.00 119.36 ? 327 PHE B CD1 1 
ATOM   4549 C CD2 . PHE B 1 302 ? -55.201  -16.767 32.740  1.00 122.80 ? 327 PHE B CD2 1 
ATOM   4550 C CE1 . PHE B 1 302 ? -57.626  -15.590 33.362  1.00 116.78 ? 327 PHE B CE1 1 
ATOM   4551 C CE2 . PHE B 1 302 ? -56.029  -17.344 33.677  1.00 130.44 ? 327 PHE B CE2 1 
ATOM   4552 C CZ  . PHE B 1 302 ? -57.249  -16.757 33.989  1.00 128.19 ? 327 PHE B CZ  1 
ATOM   4553 N N   . GLY B 1 303 ? -53.935  -17.569 29.648  1.00 111.26 ? 328 GLY B N   1 
ATOM   4554 C CA  . GLY B 1 303 ? -53.937  -19.015 29.588  1.00 118.00 ? 328 GLY B CA  1 
ATOM   4555 C C   . GLY B 1 303 ? -52.569  -19.639 29.421  1.00 128.63 ? 328 GLY B C   1 
ATOM   4556 O O   . GLY B 1 303 ? -51.558  -18.948 29.287  1.00 120.65 ? 328 GLY B O   1 
ATOM   4557 N N   . GLN B 1 304 ? -52.557  -20.967 29.421  1.00 121.62 ? 329 GLN B N   1 
ATOM   4558 C CA  . GLN B 1 304 ? -51.330  -21.739 29.312  1.00 129.77 ? 329 GLN B CA  1 
ATOM   4559 C C   . GLN B 1 304 ? -51.634  -23.062 28.626  1.00 135.34 ? 329 GLN B C   1 
ATOM   4560 O O   . GLN B 1 304 ? -52.776  -23.528 28.643  1.00 127.42 ? 329 GLN B O   1 
ATOM   4561 C CB  . GLN B 1 304 ? -50.728  -21.983 30.699  1.00 111.33 ? 329 GLN B CB  1 
ATOM   4562 N N   . ALA B 1 305 ? -50.609  -23.665 28.028  1.00 134.84 ? 330 ALA B N   1 
ATOM   4563 C CA  . ALA B 1 305 ? -50.767  -24.944 27.349  1.00 116.86 ? 330 ALA B CA  1 
ATOM   4564 C C   . ALA B 1 305 ? -49.430  -25.676 27.272  1.00 139.97 ? 330 ALA B C   1 
ATOM   4565 O O   . ALA B 1 305 ? -48.383  -25.086 27.551  1.00 136.02 ? 330 ALA B O   1 
ATOM   4566 C CB  . ALA B 1 305 ? -51.338  -24.727 25.968  1.00 117.12 ? 330 ALA B CB  1 
ATOM   4567 N N   . GLY B 1 306 ? -49.469  -26.956 26.902  1.00 146.40 ? 331 GLY B N   1 
ATOM   4568 C CA  . GLY B 1 306 ? -48.251  -27.737 26.753  1.00 159.81 ? 331 GLY B CA  1 
ATOM   4569 C C   . GLY B 1 306 ? -48.422  -29.155 26.228  1.00 157.75 ? 331 GLY B C   1 
ATOM   4570 O O   . GLY B 1 306 ? -49.286  -29.901 26.692  1.00 149.30 ? 331 GLY B O   1 
ATOM   4571 N N   . LYS B 1 307 ? -47.590  -29.520 25.254  1.00 159.13 ? 332 LYS B N   1 
ATOM   4572 C CA  . LYS B 1 307 ? -47.525  -30.888 24.738  1.00 161.46 ? 332 LYS B CA  1 
ATOM   4573 C C   . LYS B 1 307 ? -46.440  -31.671 25.482  1.00 170.80 ? 332 LYS B C   1 
ATOM   4574 O O   . LYS B 1 307 ? -45.790  -31.138 26.382  1.00 170.18 ? 332 LYS B O   1 
ATOM   4575 C CB  . LYS B 1 307 ? -47.246  -30.873 23.235  1.00 131.93 ? 332 LYS B CB  1 
ATOM   4576 N N   . PHE B 1 308 ? -46.243  -32.931 25.108  1.00 173.31 ? 333 PHE B N   1 
ATOM   4577 C CA  . PHE B 1 308 ? -45.187  -33.748 25.704  1.00 177.51 ? 333 PHE B CA  1 
ATOM   4578 C C   . PHE B 1 308 ? -43.789  -33.254 25.320  1.00 177.17 ? 333 PHE B C   1 
ATOM   4579 O O   . PHE B 1 308 ? -43.600  -32.648 24.267  1.00 175.14 ? 333 PHE B O   1 
ATOM   4580 C CB  . PHE B 1 308 ? -45.349  -35.215 25.289  1.00 183.46 ? 333 PHE B CB  1 
ATOM   4581 C CG  . PHE B 1 308 ? -44.121  -36.047 25.525  1.00 183.12 ? 333 PHE B CG  1 
ATOM   4582 C CD1 . PHE B 1 308 ? -43.207  -36.271 24.500  1.00 174.15 ? 333 PHE B CD1 1 
ATOM   4583 C CD2 . PHE B 1 308 ? -43.872  -36.591 26.773  1.00 167.92 ? 333 PHE B CD2 1 
ATOM   4584 C CE1 . PHE B 1 308 ? -42.069  -37.029 24.715  1.00 172.37 ? 333 PHE B CE1 1 
ATOM   4585 C CE2 . PHE B 1 308 ? -42.739  -37.349 26.997  1.00 181.83 ? 333 PHE B CE2 1 
ATOM   4586 C CZ  . PHE B 1 308 ? -41.835  -37.570 25.966  1.00 187.85 ? 333 PHE B CZ  1 
ATOM   4587 N N   . ASN B 1 309 ? -42.808  -33.527 26.174  1.00 175.54 ? 334 ASN B N   1 
ATOM   4588 C CA  . ASN B 1 309 ? -41.418  -33.190 25.877  1.00 176.34 ? 334 ASN B CA  1 
ATOM   4589 C C   . ASN B 1 309 ? -40.458  -34.057 26.694  1.00 179.05 ? 334 ASN B C   1 
ATOM   4590 O O   . ASN B 1 309 ? -40.672  -34.282 27.889  1.00 161.62 ? 334 ASN B O   1 
ATOM   4591 C CB  . ASN B 1 309 ? -41.160  -31.700 26.136  1.00 178.10 ? 334 ASN B CB  1 
ATOM   4592 C CG  . ASN B 1 309 ? -39.893  -31.189 25.458  1.00 169.38 ? 334 ASN B CG  1 
ATOM   4593 O OD1 . ASN B 1 309 ? -39.262  -31.896 24.672  1.00 148.53 ? 334 ASN B OD1 1 
ATOM   4594 N ND2 . ASN B 1 309 ? -39.521  -29.948 25.760  1.00 161.47 ? 334 ASN B ND2 1 
ATOM   4595 N N   . ILE B 1 310 ? -39.409  -34.553 26.045  1.00 175.05 ? 335 ILE B N   1 
ATOM   4596 C CA  . ILE B 1 310 ? -38.449  -35.424 26.710  1.00 162.14 ? 335 ILE B CA  1 
ATOM   4597 C C   . ILE B 1 310 ? -37.582  -34.662 27.713  1.00 160.78 ? 335 ILE B C   1 
ATOM   4598 O O   . ILE B 1 310 ? -37.191  -35.209 28.743  1.00 168.10 ? 335 ILE B O   1 
ATOM   4599 C CB  . ILE B 1 310 ? -37.584  -36.142 25.683  1.00 116.80 ? 335 ILE B CB  1 
ATOM   4600 N N   . ILE B 1 311 ? -37.287  -33.400 27.417  1.00 150.02 ? 336 ILE B N   1 
ATOM   4601 C CA  . ILE B 1 311 ? -36.415  -32.614 28.286  1.00 141.40 ? 336 ILE B CA  1 
ATOM   4602 C C   . ILE B 1 311 ? -36.925  -32.544 29.727  1.00 158.94 ? 336 ILE B C   1 
ATOM   4603 O O   . ILE B 1 311 ? -36.180  -32.848 30.656  1.00 172.89 ? 336 ILE B O   1 
ATOM   4604 C CB  . ILE B 1 311 ? -36.187  -31.220 27.715  1.00 96.65  ? 336 ILE B CB  1 
ATOM   4605 N N   . PRO B 1 312 ? -38.196  -32.145 29.918  1.00 160.14 ? 337 PRO B N   1 
ATOM   4606 C CA  . PRO B 1 312 ? -38.810  -32.028 31.248  1.00 162.44 ? 337 PRO B CA  1 
ATOM   4607 C C   . PRO B 1 312 ? -39.129  -33.379 31.887  1.00 171.62 ? 337 PRO B C   1 
ATOM   4608 O O   . PRO B 1 312 ? -39.051  -33.513 33.108  1.00 169.26 ? 337 PRO B O   1 
ATOM   4609 C CB  . PRO B 1 312 ? -40.120  -31.294 30.949  1.00 157.82 ? 337 PRO B CB  1 
ATOM   4610 C CG  . PRO B 1 312 ? -40.431  -31.706 29.556  1.00 167.04 ? 337 PRO B CG  1 
ATOM   4611 C CD  . PRO B 1 312 ? -39.101  -31.627 28.880  1.00 160.93 ? 337 PRO B CD  1 
ATOM   4612 N N   . THR B 1 313 ? -39.498  -34.361 31.070  1.00 169.29 ? 338 THR B N   1 
ATOM   4613 C CA  . THR B 1 313 ? -39.832  -35.686 31.575  1.00 159.71 ? 338 THR B CA  1 
ATOM   4614 C C   . THR B 1 313 ? -38.613  -36.374 32.187  1.00 171.70 ? 338 THR B C   1 
ATOM   4615 O O   . THR B 1 313 ? -38.663  -36.845 33.323  1.00 173.61 ? 338 THR B O   1 
ATOM   4616 C CB  . THR B 1 313 ? -40.415  -36.572 30.464  1.00 155.48 ? 338 THR B CB  1 
ATOM   4617 O OG1 . THR B 1 313 ? -41.485  -35.876 29.815  1.00 160.82 ? 338 THR B OG1 1 
ATOM   4618 C CG2 . THR B 1 313 ? -40.931  -37.888 31.042  1.00 154.90 ? 338 THR B CG2 1 
ATOM   4619 N N   . LEU B 1 314 ? -37.517  -36.423 31.434  1.00 172.15 ? 339 LEU B N   1 
ATOM   4620 C CA  . LEU B 1 314 ? -36.279  -37.028 31.922  1.00 163.46 ? 339 LEU B CA  1 
ATOM   4621 C C   . LEU B 1 314 ? -35.765  -36.297 33.158  1.00 167.78 ? 339 LEU B C   1 
ATOM   4622 O O   . LEU B 1 314 ? -35.261  -36.915 34.098  1.00 170.73 ? 339 LEU B O   1 
ATOM   4623 C CB  . LEU B 1 314 ? -35.207  -37.030 30.826  1.00 151.99 ? 339 LEU B CB  1 
ATOM   4624 C CG  . LEU B 1 314 ? -35.552  -37.792 29.546  1.00 148.47 ? 339 LEU B CG  1 
ATOM   4625 C CD1 . LEU B 1 314 ? -34.345  -37.872 28.630  1.00 131.85 ? 339 LEU B CD1 1 
ATOM   4626 C CD2 . LEU B 1 314 ? -36.068  -39.180 29.884  1.00 112.89 ? 339 LEU B CD2 1 
ATOM   4627 N N   . LEU B 1 315 ? -35.906  -34.977 33.149  1.00 168.92 ? 340 LEU B N   1 
ATOM   4628 C CA  . LEU B 1 315 ? -35.448  -34.150 34.253  1.00 171.55 ? 340 LEU B CA  1 
ATOM   4629 C C   . LEU B 1 315 ? -36.156  -34.574 35.528  1.00 171.32 ? 340 LEU B C   1 
ATOM   4630 O O   . LEU B 1 315 ? -35.521  -34.845 36.543  1.00 181.46 ? 340 LEU B O   1 
ATOM   4631 C CB  . LEU B 1 315 ? -35.740  -32.681 33.949  1.00 158.51 ? 340 LEU B CB  1 
ATOM   4632 C CG  . LEU B 1 315 ? -35.027  -31.590 34.752  1.00 149.87 ? 340 LEU B CG  1 
ATOM   4633 C CD1 . LEU B 1 315 ? -35.497  -31.565 36.203  1.00 130.78 ? 340 LEU B CD1 1 
ATOM   4634 C CD2 . LEU B 1 315 ? -33.515  -31.745 34.659  1.00 148.75 ? 340 LEU B CD2 1 
ATOM   4635 N N   . ASN B 1 316 ? -37.480  -34.639 35.462  1.00 163.72 ? 341 ASN B N   1 
ATOM   4636 C CA  . ASN B 1 316 ? -38.283  -34.974 36.629  1.00 177.84 ? 341 ASN B CA  1 
ATOM   4637 C C   . ASN B 1 316 ? -38.076  -36.422 37.072  1.00 188.57 ? 341 ASN B C   1 
ATOM   4638 O O   . ASN B 1 316 ? -38.026  -36.716 38.270  1.00 184.14 ? 341 ASN B O   1 
ATOM   4639 C CB  . ASN B 1 316 ? -39.762  -34.700 36.351  1.00 170.93 ? 341 ASN B CB  1 
ATOM   4640 C CG  . ASN B 1 316 ? -40.594  -34.651 37.614  1.00 182.15 ? 341 ASN B CG  1 
ATOM   4641 O OD1 . ASN B 1 316 ? -40.064  -34.692 38.725  1.00 192.15 ? 341 ASN B OD1 1 
ATOM   4642 N ND2 . ASN B 1 316 ? -41.908  -34.559 37.450  1.00 167.56 ? 341 ASN B ND2 1 
ATOM   4643 N N   . ILE B 1 317 ? -37.955  -37.323 36.100  1.00 182.90 ? 342 ILE B N   1 
ATOM   4644 C CA  . ILE B 1 317 ? -37.679  -38.727 36.389  1.00 181.25 ? 342 ILE B CA  1 
ATOM   4645 C C   . ILE B 1 317 ? -36.310  -38.881 37.059  1.00 185.94 ? 342 ILE B C   1 
ATOM   4646 O O   . ILE B 1 317 ? -36.147  -39.685 37.980  1.00 187.30 ? 342 ILE B O   1 
ATOM   4647 C CB  . ILE B 1 317 ? -37.747  -39.599 35.112  1.00 164.74 ? 342 ILE B CB  1 
ATOM   4648 C CG1 . ILE B 1 317 ? -39.158  -39.575 34.522  1.00 167.62 ? 342 ILE B CG1 1 
ATOM   4649 C CG2 . ILE B 1 317 ? -37.338  -41.033 35.410  1.00 157.30 ? 342 ILE B CG2 1 
ATOM   4650 C CD1 . ILE B 1 317 ? -39.314  -40.413 33.267  1.00 168.88 ? 342 ILE B CD1 1 
ATOM   4651 N N   . GLY B 1 318 ? -35.334  -38.100 36.599  1.00 176.70 ? 343 GLY B N   1 
ATOM   4652 C CA  . GLY B 1 318 ? -33.995  -38.131 37.166  1.00 163.27 ? 343 GLY B CA  1 
ATOM   4653 C C   . GLY B 1 318 ? -33.993  -37.833 38.653  1.00 174.49 ? 343 GLY B C   1 
ATOM   4654 O O   . GLY B 1 318 ? -33.337  -38.524 39.432  1.00 186.77 ? 343 GLY B O   1 
ATOM   4655 N N   . ALA B 1 319 ? -34.735  -36.803 39.046  1.00 166.99 ? 344 ALA B N   1 
ATOM   4656 C CA  . ALA B 1 319 ? -34.839  -36.418 40.449  1.00 169.50 ? 344 ALA B CA  1 
ATOM   4657 C C   . ALA B 1 319 ? -35.640  -37.436 41.257  1.00 188.61 ? 344 ALA B C   1 
ATOM   4658 O O   . ALA B 1 319 ? -35.460  -37.553 42.471  1.00 178.85 ? 344 ALA B O   1 
ATOM   4659 C CB  . ALA B 1 319 ? -35.458  -35.038 40.574  1.00 166.85 ? 344 ALA B CB  1 
ATOM   4660 N N   . GLY B 1 320 ? -36.528  -38.162 40.580  1.00 193.62 ? 345 GLY B N   1 
ATOM   4661 C CA  . GLY B 1 320 ? -37.324  -39.196 41.219  1.00 186.63 ? 345 GLY B CA  1 
ATOM   4662 C C   . GLY B 1 320 ? -36.459  -40.359 41.667  1.00 189.99 ? 345 GLY B C   1 
ATOM   4663 O O   . GLY B 1 320 ? -36.755  -41.027 42.662  1.00 185.53 ? 345 GLY B O   1 
ATOM   4664 N N   . LEU B 1 321 ? -35.385  -40.595 40.915  1.00 209.16 ? 346 LEU B N   1 
ATOM   4665 C CA  . LEU B 1 321 ? -34.403  -41.624 41.240  1.00 206.21 ? 346 LEU B CA  1 
ATOM   4666 C C   . LEU B 1 321 ? -33.565  -41.225 42.456  1.00 201.78 ? 346 LEU B C   1 
ATOM   4667 O O   . LEU B 1 321 ? -33.386  -42.015 43.388  1.00 189.79 ? 346 LEU B O   1 
ATOM   4668 C CB  . LEU B 1 321 ? -33.505  -41.896 40.034  1.00 152.02 ? 346 LEU B CB  1 
ATOM   4669 N N   . ALA B 1 322 ? -33.048  -39.999 42.440  1.00 171.71 ? 347 ALA B N   1 
ATOM   4670 C CA  . ALA B 1 322 ? -32.272  -39.493 43.564  1.00 178.76 ? 347 ALA B CA  1 
ATOM   4671 C C   . ALA B 1 322 ? -33.158  -39.403 44.801  1.00 187.03 ? 347 ALA B C   1 
ATOM   4672 O O   . ALA B 1 322 ? -32.692  -39.599 45.926  1.00 172.28 ? 347 ALA B O   1 
ATOM   4673 C CB  . ALA B 1 322 ? -31.669  -38.140 43.231  1.00 178.47 ? 347 ALA B CB  1 
ATOM   4674 N N   . LEU B 1 323 ? -34.441  -39.118 44.580  1.00 197.70 ? 348 LEU B N   1 
ATOM   4675 C CA  . LEU B 1 323 ? -35.416  -39.014 45.666  1.00 191.72 ? 348 LEU B CA  1 
ATOM   4676 C C   . LEU B 1 323 ? -35.718  -40.367 46.319  1.00 203.34 ? 348 LEU B C   1 
ATOM   4677 O O   . LEU B 1 323 ? -36.084  -40.422 47.494  1.00 207.57 ? 348 LEU B O   1 
ATOM   4678 C CB  . LEU B 1 323 ? -36.704  -38.350 45.177  1.00 147.80 ? 348 LEU B CB  1 
ATOM   4679 N N   . LEU B 1 324 ? -35.574  -41.449 45.553  1.00 205.81 ? 349 LEU B N   1 
ATOM   4680 C CA  . LEU B 1 324 ? -35.749  -42.801 46.080  1.00 195.00 ? 349 LEU B CA  1 
ATOM   4681 C C   . LEU B 1 324 ? -34.567  -43.200 46.956  1.00 185.40 ? 349 LEU B C   1 
ATOM   4682 O O   . LEU B 1 324 ? -34.696  -44.055 47.830  1.00 178.20 ? 349 LEU B O   1 
ATOM   4683 C CB  . LEU B 1 324 ? -35.929  -43.799 44.946  1.00 180.98 ? 349 LEU B CB  1 
ATOM   4684 N N   . GLY B 1 325 ? -33.418  -42.575 46.709  1.00 182.91 ? 350 GLY B N   1 
ATOM   4685 C CA  . GLY B 1 325 ? -32.222  -42.818 47.493  1.00 180.93 ? 350 GLY B CA  1 
ATOM   4686 C C   . GLY B 1 325 ? -32.347  -42.256 48.896  1.00 192.74 ? 350 GLY B C   1 
ATOM   4687 O O   . GLY B 1 325 ? -31.969  -42.903 49.873  1.00 199.38 ? 350 GLY B O   1 
ATOM   4688 N N   . LEU B 1 326 ? -32.879  -41.043 48.999  1.00 189.33 ? 351 LEU B N   1 
ATOM   4689 C CA  . LEU B 1 326 ? -33.120  -40.439 50.302  1.00 183.56 ? 351 LEU B CA  1 
ATOM   4690 C C   . LEU B 1 326 ? -34.332  -41.066 51.005  1.00 197.03 ? 351 LEU B C   1 
ATOM   4691 O O   . LEU B 1 326 ? -34.382  -41.110 52.234  1.00 194.95 ? 351 LEU B O   1 
ATOM   4692 C CB  . LEU B 1 326 ? -33.278  -38.926 50.173  1.00 151.52 ? 351 LEU B CB  1 
ATOM   4693 N N   . VAL B 1 327 ? -35.297  -41.555 50.224  1.00 200.54 ? 352 VAL B N   1 
ATOM   4694 C CA  . VAL B 1 327 ? -36.496  -42.191 50.777  1.00 195.50 ? 352 VAL B CA  1 
ATOM   4695 C C   . VAL B 1 327 ? -36.154  -43.484 51.518  1.00 213.03 ? 352 VAL B C   1 
ATOM   4696 O O   . VAL B 1 327 ? -36.808  -43.841 52.498  1.00 208.89 ? 352 VAL B O   1 
ATOM   4697 C CB  . VAL B 1 327 ? -37.527  -42.445 49.685  1.00 184.38 ? 352 VAL B CB  1 
ATOM   4698 N N   . ASN B 1 328 ? -35.102  -44.162 51.068  1.00 222.61 ? 353 ASN B N   1 
ATOM   4699 C CA  . ASN B 1 328 ? -34.552  -45.302 51.796  1.00 216.61 ? 353 ASN B CA  1 
ATOM   4700 C C   . ASN B 1 328 ? -34.012  -44.879 53.161  1.00 206.19 ? 353 ASN B C   1 
ATOM   4701 O O   . ASN B 1 328 ? -34.054  -45.647 54.122  1.00 206.42 ? 353 ASN B O   1 
ATOM   4702 C CB  . ASN B 1 328 ? -33.439  -45.979 50.987  1.00 222.11 ? 353 ASN B CB  1 
ATOM   4703 C CG  . ASN B 1 328 ? -33.952  -46.646 49.719  1.00 226.75 ? 353 ASN B CG  1 
ATOM   4704 O OD1 . ASN B 1 328 ? -35.141  -46.584 49.405  1.00 236.21 ? 353 ASN B OD1 1 
ATOM   4705 N ND2 . ASN B 1 328 ? -33.049  -47.288 48.983  1.00 198.80 ? 353 ASN B ND2 1 
ATOM   4706 N N   . VAL B 1 329 ? -33.497  -43.655 53.233  1.00 208.83 ? 354 VAL B N   1 
ATOM   4707 C CA  . VAL B 1 329 ? -32.982  -43.105 54.483  1.00 202.29 ? 354 VAL B CA  1 
ATOM   4708 C C   . VAL B 1 329 ? -34.097  -42.604 55.409  1.00 208.43 ? 354 VAL B C   1 
ATOM   4709 O O   . VAL B 1 329 ? -33.888  -42.461 56.612  1.00 205.87 ? 354 VAL B O   1 
ATOM   4710 C CB  . VAL B 1 329 ? -31.972  -41.994 54.202  1.00 167.52 ? 354 VAL B CB  1 
ATOM   4711 N N   . ILE B 1 330 ? -35.276  -42.342 54.848  1.00 215.19 ? 355 ILE B N   1 
ATOM   4712 C CA  . ILE B 1 330 ? -36.419  -41.868 55.633  1.00 206.35 ? 355 ILE B CA  1 
ATOM   4713 C C   . ILE B 1 330 ? -37.092  -42.983 56.442  1.00 211.12 ? 355 ILE B C   1 
ATOM   4714 O O   . ILE B 1 330 ? -37.556  -42.756 57.561  1.00 186.42 ? 355 ILE B O   1 
ATOM   4715 C CB  . ILE B 1 330 ? -37.435  -41.175 54.731  1.00 184.92 ? 355 ILE B CB  1 
ATOM   4716 N N   . CYS B 1 331 ? -37.151  -44.181 55.865  1.00 228.22 ? 356 CYS B N   1 
ATOM   4717 C CA  . CYS B 1 331 ? -37.697  -45.347 56.560  1.00 225.10 ? 356 CYS B CA  1 
ATOM   4718 C C   . CYS B 1 331 ? -36.669  -45.928 57.524  1.00 217.35 ? 356 CYS B C   1 
ATOM   4719 O O   . CYS B 1 331 ? -37.012  -46.661 58.454  1.00 202.51 ? 356 CYS B O   1 
ATOM   4720 C CB  . CYS B 1 331 ? -38.155  -46.413 55.561  1.00 223.33 ? 356 CYS B CB  1 
ATOM   4721 S SG  . CYS B 1 331 ? -39.559  -45.909 54.533  1.00 189.62 ? 356 CYS B SG  1 
ATOM   4722 N N   . ASP B 1 332 ? -35.403  -45.599 57.289  1.00 221.49 ? 357 ASP B N   1 
ATOM   4723 C CA  . ASP B 1 332 ? -34.336  -45.972 58.205  1.00 219.16 ? 357 ASP B CA  1 
ATOM   4724 C C   . ASP B 1 332 ? -34.504  -45.251 59.545  1.00 223.71 ? 357 ASP B C   1 
ATOM   4725 O O   . ASP B 1 332 ? -34.401  -45.872 60.603  1.00 216.87 ? 357 ASP B O   1 
ATOM   4726 C CB  . ASP B 1 332 ? -32.974  -45.670 57.591  1.00 204.27 ? 357 ASP B CB  1 
ATOM   4727 N N   . TRP B 1 333 ? -34.770  -43.946 59.499  1.00 223.13 ? 358 TRP B N   1 
ATOM   4728 C CA  . TRP B 1 333 ? -34.987  -43.166 60.718  1.00 195.63 ? 358 TRP B CA  1 
ATOM   4729 C C   . TRP B 1 333 ? -36.315  -43.536 61.377  1.00 214.80 ? 358 TRP B C   1 
ATOM   4730 O O   . TRP B 1 333 ? -36.463  -43.426 62.595  1.00 208.27 ? 358 TRP B O   1 
ATOM   4731 C CB  . TRP B 1 333 ? -34.928  -41.671 60.423  1.00 169.50 ? 358 TRP B CB  1 
ATOM   4732 N N   . ILE B 1 334 ? -37.273  -43.973 60.562  1.00 224.78 ? 359 ILE B N   1 
ATOM   4733 C CA  . ILE B 1 334 ? -38.570  -44.433 61.053  1.00 214.62 ? 359 ILE B CA  1 
ATOM   4734 C C   . ILE B 1 334 ? -38.417  -45.765 61.782  1.00 214.47 ? 359 ILE B C   1 
ATOM   4735 O O   . ILE B 1 334 ? -39.208  -46.102 62.670  1.00 186.92 ? 359 ILE B O   1 
ATOM   4736 C CB  . ILE B 1 334 ? -39.553  -44.567 59.899  1.00 180.72 ? 359 ILE B CB  1 
ATOM   4737 N N   . VAL B 1 335 ? -37.394  -46.519 61.388  1.00 220.99 ? 360 VAL B N   1 
ATOM   4738 C CA  . VAL B 1 335 ? -37.056  -47.783 62.029  1.00 214.81 ? 360 VAL B CA  1 
ATOM   4739 C C   . VAL B 1 335 ? -36.375  -47.551 63.378  1.00 223.36 ? 360 VAL B C   1 
ATOM   4740 O O   . VAL B 1 335 ? -36.330  -48.446 64.223  1.00 216.94 ? 360 VAL B O   1 
ATOM   4741 C CB  . VAL B 1 335 ? -36.160  -48.612 61.117  1.00 191.70 ? 360 VAL B CB  1 
ATOM   4742 N N   . LEU B 1 336 ? -35.851  -46.341 63.566  1.00 225.85 ? 361 LEU B N   1 
ATOM   4743 C CA  . LEU B 1 336 ? -35.120  -45.974 64.779  1.00 212.56 ? 361 LEU B CA  1 
ATOM   4744 C C   . LEU B 1 336 ? -33.829  -46.777 64.940  1.00 201.81 ? 361 LEU B C   1 
ATOM   4745 O O   . LEU B 1 336 ? -32.738  -46.209 65.044  1.00 168.74 ? 361 LEU B O   1 
ATOM   4746 C CB  . LEU B 1 336 ? -36.005  -46.122 66.012  1.00 168.10 ? 361 LEU B CB  1 
ATOM   4747 N N   . LEU C 1 9   ? -12.769  -35.763 52.880  1.00 201.30 ? 34  LEU C N   1 
ATOM   4748 C CA  . LEU C 1 9   ? -13.435  -34.617 52.273  1.00 187.98 ? 34  LEU C CA  1 
ATOM   4749 C C   . LEU C 1 9   ? -14.854  -34.962 51.829  1.00 211.43 ? 34  LEU C C   1 
ATOM   4750 O O   . LEU C 1 9   ? -15.647  -34.070 51.533  1.00 220.57 ? 34  LEU C O   1 
ATOM   4751 C CB  . LEU C 1 9   ? -12.621  -34.089 51.099  1.00 146.04 ? 34  LEU C CB  1 
ATOM   4752 N N   . ASN C 1 10  ? -15.164  -36.257 51.790  1.00 223.33 ? 35  ASN C N   1 
ATOM   4753 C CA  . ASN C 1 10  ? -16.481  -36.741 51.371  1.00 229.52 ? 35  ASN C CA  1 
ATOM   4754 C C   . ASN C 1 10  ? -17.595  -36.240 52.290  1.00 235.50 ? 35  ASN C C   1 
ATOM   4755 O O   . ASN C 1 10  ? -18.740  -36.064 51.862  1.00 240.14 ? 35  ASN C O   1 
ATOM   4756 C CB  . ASN C 1 10  ? -16.493  -38.266 51.309  1.00 179.66 ? 35  ASN C CB  1 
ATOM   4757 N N   . ARG C 1 11  ? -17.253  -36.024 53.555  1.00 221.73 ? 36  ARG C N   1 
ATOM   4758 C CA  . ARG C 1 11  ? -18.207  -35.512 54.529  1.00 217.41 ? 36  ARG C CA  1 
ATOM   4759 C C   . ARG C 1 11  ? -18.251  -33.987 54.485  1.00 225.89 ? 36  ARG C C   1 
ATOM   4760 O O   . ARG C 1 11  ? -19.202  -33.369 54.969  1.00 223.89 ? 36  ARG C O   1 
ATOM   4761 C CB  . ARG C 1 11  ? -17.854  -36.001 55.927  1.00 193.13 ? 36  ARG C CB  1 
ATOM   4762 N N   . PHE C 1 12  ? -17.214  -33.390 53.899  1.00 231.52 ? 37  PHE C N   1 
ATOM   4763 C CA  . PHE C 1 12  ? -17.118  -31.937 53.768  1.00 226.67 ? 37  PHE C CA  1 
ATOM   4764 C C   . PHE C 1 12  ? -17.912  -31.393 52.576  1.00 226.76 ? 37  PHE C C   1 
ATOM   4765 O O   . PHE C 1 12  ? -18.612  -30.385 52.692  1.00 224.50 ? 37  PHE C O   1 
ATOM   4766 C CB  . PHE C 1 12  ? -15.653  -31.508 53.667  1.00 209.15 ? 37  PHE C CB  1 
ATOM   4767 C CG  . PHE C 1 12  ? -15.469  -30.062 53.309  1.00 215.46 ? 37  PHE C CG  1 
ATOM   4768 C CD1 . PHE C 1 12  ? -15.512  -29.081 54.290  1.00 203.33 ? 37  PHE C CD1 1 
ATOM   4769 C CD2 . PHE C 1 12  ? -15.251  -29.684 51.992  1.00 206.69 ? 37  PHE C CD2 1 
ATOM   4770 C CE1 . PHE C 1 12  ? -15.343  -27.749 53.965  1.00 203.59 ? 37  PHE C CE1 1 
ATOM   4771 C CE2 . PHE C 1 12  ? -15.081  -28.355 51.659  1.00 207.16 ? 37  PHE C CE2 1 
ATOM   4772 C CZ  . PHE C 1 12  ? -15.126  -27.385 52.646  1.00 213.57 ? 37  PHE C CZ  1 
ATOM   4773 N N   . THR C 1 13  ? -17.793  -32.055 51.429  1.00 223.12 ? 38  THR C N   1 
ATOM   4774 C CA  . THR C 1 13  ? -18.552  -31.656 50.250  1.00 208.24 ? 38  THR C CA  1 
ATOM   4775 C C   . THR C 1 13  ? -20.045  -31.890 50.468  1.00 209.78 ? 38  THR C C   1 
ATOM   4776 O O   . THR C 1 13  ? -20.876  -31.123 49.985  1.00 211.40 ? 38  THR C O   1 
ATOM   4777 C CB  . THR C 1 13  ? -18.089  -32.406 48.984  1.00 200.74 ? 38  THR C CB  1 
ATOM   4778 O OG1 . THR C 1 13  ? -18.453  -33.789 49.075  1.00 205.49 ? 38  THR C OG1 1 
ATOM   4779 C CG2 . THR C 1 13  ? -16.583  -32.286 48.812  1.00 179.18 ? 38  THR C CG2 1 
ATOM   4780 N N   . GLN C 1 14  ? -20.374  -32.952 51.200  1.00 211.54 ? 39  GLN C N   1 
ATOM   4781 C CA  . GLN C 1 14  ? -21.762  -33.276 51.519  1.00 214.81 ? 39  GLN C CA  1 
ATOM   4782 C C   . GLN C 1 14  ? -22.406  -32.213 52.413  1.00 235.91 ? 39  GLN C C   1 
ATOM   4783 O O   . GLN C 1 14  ? -23.616  -31.985 52.345  1.00 232.57 ? 39  GLN C O   1 
ATOM   4784 C CB  . GLN C 1 14  ? -21.851  -34.649 52.169  1.00 199.31 ? 39  GLN C CB  1 
ATOM   4785 N N   . ALA C 1 15  ? -21.596  -31.574 53.254  1.00 240.44 ? 40  ALA C N   1 
ATOM   4786 C CA  . ALA C 1 15  ? -22.065  -30.459 54.074  1.00 231.67 ? 40  ALA C CA  1 
ATOM   4787 C C   . ALA C 1 15  ? -22.084  -29.153 53.269  1.00 223.06 ? 40  ALA C C   1 
ATOM   4788 O O   . ALA C 1 15  ? -22.717  -28.172 53.669  1.00 211.53 ? 40  ALA C O   1 
ATOM   4789 C CB  . ALA C 1 15  ? -21.209  -30.314 55.332  1.00 201.40 ? 40  ALA C CB  1 
ATOM   4790 N N   . LEU C 1 16  ? -21.386  -29.155 52.134  1.00 210.70 ? 41  LEU C N   1 
ATOM   4791 C CA  . LEU C 1 16  ? -21.339  -27.999 51.238  1.00 200.95 ? 41  LEU C CA  1 
ATOM   4792 C C   . LEU C 1 16  ? -22.562  -27.922 50.323  1.00 201.18 ? 41  LEU C C   1 
ATOM   4793 O O   . LEU C 1 16  ? -23.151  -26.855 50.146  1.00 195.57 ? 41  LEU C O   1 
ATOM   4794 C CB  . LEU C 1 16  ? -20.067  -28.027 50.386  1.00 190.38 ? 41  LEU C CB  1 
ATOM   4795 C CG  . LEU C 1 16  ? -19.916  -26.840 49.431  1.00 176.38 ? 41  LEU C CG  1 
ATOM   4796 C CD1 . LEU C 1 16  ? -19.692  -25.557 50.220  1.00 147.21 ? 41  LEU C CD1 1 
ATOM   4797 C CD2 . LEU C 1 16  ? -18.790  -27.062 48.433  1.00 128.13 ? 41  LEU C CD2 1 
ATOM   4798 N N   . VAL C 1 17  ? -22.929  -29.055 49.733  1.00 199.12 ? 42  VAL C N   1 
ATOM   4799 C CA  . VAL C 1 17  ? -24.095  -29.117 48.860  1.00 183.00 ? 42  VAL C CA  1 
ATOM   4800 C C   . VAL C 1 17  ? -25.404  -28.967 49.642  1.00 190.61 ? 42  VAL C C   1 
ATOM   4801 O O   . VAL C 1 17  ? -26.366  -28.400 49.126  1.00 194.40 ? 42  VAL C O   1 
ATOM   4802 C CB  . VAL C 1 17  ? -24.127  -30.419 48.032  1.00 175.28 ? 42  VAL C CB  1 
ATOM   4803 C CG1 . VAL C 1 17  ? -22.895  -30.517 47.138  1.00 139.97 ? 42  VAL C CG1 1 
ATOM   4804 C CG2 . VAL C 1 17  ? -24.234  -31.626 48.946  1.00 188.55 ? 42  VAL C CG2 1 
ATOM   4805 N N   . ILE C 1 18  ? -25.447  -29.476 50.875  1.00 195.68 ? 43  ILE C N   1 
ATOM   4806 C CA  . ILE C 1 18  ? -26.621  -29.289 51.734  1.00 204.10 ? 43  ILE C CA  1 
ATOM   4807 C C   . ILE C 1 18  ? -26.795  -27.806 52.083  1.00 211.40 ? 43  ILE C C   1 
ATOM   4808 O O   . ILE C 1 18  ? -27.922  -27.310 52.166  1.00 210.91 ? 43  ILE C O   1 
ATOM   4809 C CB  . ILE C 1 18  ? -26.582  -30.171 53.031  1.00 205.00 ? 43  ILE C CB  1 
ATOM   4810 C CG1 . ILE C 1 18  ? -27.928  -30.130 53.774  1.00 210.28 ? 43  ILE C CG1 1 
ATOM   4811 C CG2 . ILE C 1 18  ? -25.455  -29.743 53.954  1.00 209.93 ? 43  ILE C CG2 1 
ATOM   4812 C CD1 . ILE C 1 18  ? -27.928  -30.830 55.143  1.00 151.29 ? 43  ILE C CD1 1 
ATOM   4813 N N   . ALA C 1 19  ? -25.678  -27.100 52.270  1.00 206.36 ? 44  ALA C N   1 
ATOM   4814 C CA  . ALA C 1 19  ? -25.710  -25.662 52.542  1.00 201.80 ? 44  ALA C CA  1 
ATOM   4815 C C   . ALA C 1 19  ? -25.844  -24.871 51.244  1.00 193.12 ? 44  ALA C C   1 
ATOM   4816 O O   . ALA C 1 19  ? -26.105  -23.666 51.254  1.00 192.24 ? 44  ALA C O   1 
ATOM   4817 C CB  . ALA C 1 19  ? -24.465  -25.231 53.309  1.00 183.34 ? 44  ALA C CB  1 
ATOM   4818 N N   . TYR C 1 20  ? -25.657  -25.565 50.128  1.00 184.89 ? 45  TYR C N   1 
ATOM   4819 C CA  . TYR C 1 20  ? -25.778  -24.960 48.811  1.00 184.45 ? 45  TYR C CA  1 
ATOM   4820 C C   . TYR C 1 20  ? -27.222  -24.964 48.316  1.00 185.38 ? 45  TYR C C   1 
ATOM   4821 O O   . TYR C 1 20  ? -27.691  -23.988 47.733  1.00 181.13 ? 45  TYR C O   1 
ATOM   4822 C CB  . TYR C 1 20  ? -24.880  -25.694 47.820  1.00 177.01 ? 45  TYR C CB  1 
ATOM   4823 C CG  . TYR C 1 20  ? -25.229  -25.429 46.381  1.00 167.85 ? 45  TYR C CG  1 
ATOM   4824 C CD1 . TYR C 1 20  ? -24.537  -24.475 45.646  1.00 152.41 ? 45  TYR C CD1 1 
ATOM   4825 C CD2 . TYR C 1 20  ? -26.253  -26.131 45.755  1.00 151.21 ? 45  TYR C CD2 1 
ATOM   4826 C CE1 . TYR C 1 20  ? -24.850  -24.228 44.328  1.00 160.10 ? 45  TYR C CE1 1 
ATOM   4827 C CE2 . TYR C 1 20  ? -26.576  -25.892 44.440  1.00 166.29 ? 45  TYR C CE2 1 
ATOM   4828 C CZ  . TYR C 1 20  ? -25.871  -24.939 43.728  1.00 174.76 ? 45  TYR C CZ  1 
ATOM   4829 O OH  . TYR C 1 20  ? -26.186  -24.692 42.410  1.00 145.53 ? 45  TYR C OH  1 
ATOM   4830 N N   . VAL C 1 21  ? -27.923  -26.070 48.538  1.00 185.81 ? 46  VAL C N   1 
ATOM   4831 C CA  . VAL C 1 21  ? -29.320  -26.166 48.133  1.00 182.84 ? 46  VAL C CA  1 
ATOM   4832 C C   . VAL C 1 21  ? -30.255  -25.497 49.143  1.00 184.83 ? 46  VAL C C   1 
ATOM   4833 O O   . VAL C 1 21  ? -30.967  -24.554 48.799  1.00 199.12 ? 46  VAL C O   1 
ATOM   4834 C CB  . VAL C 1 21  ? -29.757  -27.626 47.867  1.00 169.58 ? 46  VAL C CB  1 
ATOM   4835 C CG1 . VAL C 1 21  ? -29.019  -28.192 46.661  1.00 132.26 ? 46  VAL C CG1 1 
ATOM   4836 C CG2 . VAL C 1 21  ? -29.532  -28.488 49.098  1.00 180.64 ? 46  VAL C CG2 1 
ATOM   4837 N N   . ILE C 1 22  ? -30.248  -25.972 50.385  1.00 170.77 ? 47  ILE C N   1 
ATOM   4838 C CA  . ILE C 1 22  ? -31.116  -25.396 51.406  1.00 186.88 ? 47  ILE C CA  1 
ATOM   4839 C C   . ILE C 1 22  ? -30.738  -23.942 51.693  1.00 199.03 ? 47  ILE C C   1 
ATOM   4840 O O   . ILE C 1 22  ? -31.607  -23.082 51.847  1.00 200.40 ? 47  ILE C O   1 
ATOM   4841 C CB  . ILE C 1 22  ? -31.091  -26.216 52.716  1.00 191.30 ? 47  ILE C CB  1 
ATOM   4842 C CG1 . ILE C 1 22  ? -31.412  -27.687 52.434  1.00 174.04 ? 47  ILE C CG1 1 
ATOM   4843 C CG2 . ILE C 1 22  ? -32.071  -25.638 53.732  1.00 193.06 ? 47  ILE C CG2 1 
ATOM   4844 C CD1 . ILE C 1 22  ? -31.524  -28.545 53.682  1.00 170.63 ? 47  ILE C CD1 1 
ATOM   4845 N N   . GLY C 1 23  ? -29.438  -23.671 51.743  1.00 196.23 ? 48  GLY C N   1 
ATOM   4846 C CA  . GLY C 1 23  ? -28.946  -22.359 52.121  1.00 193.52 ? 48  GLY C CA  1 
ATOM   4847 C C   . GLY C 1 23  ? -28.937  -21.334 51.006  1.00 191.71 ? 48  GLY C C   1 
ATOM   4848 O O   . GLY C 1 23  ? -29.283  -20.174 51.222  1.00 201.18 ? 48  GLY C O   1 
ATOM   4849 N N   . TYR C 1 24  ? -28.531  -21.760 49.815  1.00 186.64 ? 49  TYR C N   1 
ATOM   4850 C CA  . TYR C 1 24  ? -28.397  -20.848 48.685  1.00 188.43 ? 49  TYR C CA  1 
ATOM   4851 C C   . TYR C 1 24  ? -29.632  -20.794 47.793  1.00 184.43 ? 49  TYR C C   1 
ATOM   4852 O O   . TYR C 1 24  ? -30.269  -19.748 47.652  1.00 186.32 ? 49  TYR C O   1 
ATOM   4853 C CB  . TYR C 1 24  ? -27.192  -21.232 47.835  1.00 180.16 ? 49  TYR C CB  1 
ATOM   4854 C CG  . TYR C 1 24  ? -27.106  -20.449 46.553  1.00 170.55 ? 49  TYR C CG  1 
ATOM   4855 C CD1 . TYR C 1 24  ? -26.546  -19.179 46.536  1.00 167.62 ? 49  TYR C CD1 1 
ATOM   4856 C CD2 . TYR C 1 24  ? -27.592  -20.971 45.362  1.00 152.64 ? 49  TYR C CD2 1 
ATOM   4857 C CE1 . TYR C 1 24  ? -26.462  -18.451 45.373  1.00 157.82 ? 49  TYR C CE1 1 
ATOM   4858 C CE2 . TYR C 1 24  ? -27.514  -20.248 44.188  1.00 156.14 ? 49  TYR C CE2 1 
ATOM   4859 C CZ  . TYR C 1 24  ? -26.946  -18.985 44.202  1.00 159.57 ? 49  TYR C CZ  1 
ATOM   4860 O OH  . TYR C 1 24  ? -26.852  -18.240 43.051  1.00 131.28 ? 49  TYR C OH  1 
ATOM   4861 N N   . VAL C 1 25  ? -29.957  -21.930 47.184  1.00 176.65 ? 50  VAL C N   1 
ATOM   4862 C CA  . VAL C 1 25  ? -31.015  -21.983 46.183  1.00 169.88 ? 50  VAL C CA  1 
ATOM   4863 C C   . VAL C 1 25  ? -32.425  -22.014 46.776  1.00 168.21 ? 50  VAL C C   1 
ATOM   4864 O O   . VAL C 1 25  ? -33.409  -22.009 46.042  1.00 170.35 ? 50  VAL C O   1 
ATOM   4865 C CB  . VAL C 1 25  ? -30.839  -23.188 45.239  1.00 148.35 ? 50  VAL C CB  1 
ATOM   4866 C CG1 . VAL C 1 25  ? -31.409  -24.447 45.869  1.00 151.27 ? 50  VAL C CG1 1 
ATOM   4867 C CG2 . VAL C 1 25  ? -31.490  -22.907 43.888  1.00 164.96 ? 50  VAL C CG2 1 
ATOM   4868 N N   . CYS C 1 26  ? -32.534  -22.054 48.098  1.00 170.39 ? 51  CYS C N   1 
ATOM   4869 C CA  . CYS C 1 26  ? -33.855  -22.149 48.713  1.00 167.20 ? 51  CYS C CA  1 
ATOM   4870 C C   . CYS C 1 26  ? -34.203  -20.986 49.640  1.00 166.46 ? 51  CYS C C   1 
ATOM   4871 O O   . CYS C 1 26  ? -35.229  -21.005 50.319  1.00 175.33 ? 51  CYS C O   1 
ATOM   4872 C CB  . CYS C 1 26  ? -34.042  -23.504 49.401  1.00 179.40 ? 51  CYS C CB  1 
ATOM   4873 S SG  . CYS C 1 26  ? -34.158  -24.878 48.222  1.00 135.10 ? 51  CYS C SG  1 
ATOM   4874 N N   . VAL C 1 27  ? -33.351  -19.971 49.662  1.00 167.32 ? 52  VAL C N   1 
ATOM   4875 C CA  . VAL C 1 27  ? -33.679  -18.748 50.376  1.00 187.16 ? 52  VAL C CA  1 
ATOM   4876 C C   . VAL C 1 27  ? -33.287  -17.550 49.516  1.00 183.75 ? 52  VAL C C   1 
ATOM   4877 O O   . VAL C 1 27  ? -34.043  -16.585 49.404  1.00 185.98 ? 52  VAL C O   1 
ATOM   4878 C CB  . VAL C 1 27  ? -33.021  -18.688 51.779  1.00 182.50 ? 52  VAL C CB  1 
ATOM   4879 C CG1 . VAL C 1 27  ? -33.141  -20.036 52.483  1.00 126.92 ? 52  VAL C CG1 1 
ATOM   4880 C CG2 . VAL C 1 27  ? -31.569  -18.261 51.680  1.00 189.18 ? 52  VAL C CG2 1 
ATOM   4881 N N   . TYR C 1 28  ? -32.064  -17.586 48.980  1.00 20.00  ? 53  TYR C N   1 
ATOM   4882 C CA  . TYR C 1 28  ? -31.588  -16.624 47.975  1.00 20.00  ? 53  TYR C CA  1 
ATOM   4883 C C   . TYR C 1 28  ? -32.269  -16.709 46.596  1.00 20.00  ? 53  TYR C C   1 
ATOM   4884 O O   . TYR C 1 28  ? -32.631  -15.689 46.010  1.00 20.00  ? 53  TYR C O   1 
ATOM   4885 C CB  . TYR C 1 28  ? -30.079  -16.788 47.792  1.00 20.00  ? 53  TYR C CB  1 
ATOM   4886 C CG  . TYR C 1 28  ? -29.439  -15.693 46.966  1.00 20.00  ? 53  TYR C CG  1 
ATOM   4887 C CD1 . TYR C 1 28  ? -28.967  -14.532 47.566  1.00 20.00  ? 53  TYR C CD1 1 
ATOM   4888 C CD2 . TYR C 1 28  ? -29.307  -15.823 45.591  1.00 20.00  ? 53  TYR C CD2 1 
ATOM   4889 C CE1 . TYR C 1 28  ? -28.381  -13.531 46.816  1.00 20.00  ? 53  TYR C CE1 1 
ATOM   4890 C CE2 . TYR C 1 28  ? -28.722  -14.825 44.833  1.00 20.00  ? 53  TYR C CE2 1 
ATOM   4891 C CZ  . TYR C 1 28  ? -28.262  -13.682 45.450  1.00 20.00  ? 53  TYR C CZ  1 
ATOM   4892 O OH  . TYR C 1 28  ? -27.680  -12.685 44.701  1.00 20.00  ? 53  TYR C OH  1 
ATOM   4893 N N   . ASN C 1 29  ? -32.444  -17.932 46.097  1.00 168.37 ? 54  ASN C N   1 
ATOM   4894 C CA  . ASN C 1 29  ? -33.178  -18.197 44.865  1.00 164.32 ? 54  ASN C CA  1 
ATOM   4895 C C   . ASN C 1 29  ? -34.618  -18.645 45.143  1.00 171.43 ? 54  ASN C C   1 
ATOM   4896 O O   . ASN C 1 29  ? -35.467  -18.606 44.251  1.00 171.47 ? 54  ASN C O   1 
ATOM   4897 C CB  . ASN C 1 29  ? -32.443  -19.216 44.006  1.00 133.46 ? 54  ASN C CB  1 
ATOM   4898 N N   . LYS C 1 30  ? -34.885  -19.069 46.378  1.00 170.89 ? 55  LYS C N   1 
ATOM   4899 C CA  . LYS C 1 30  ? -36.233  -19.461 46.788  1.00 164.49 ? 55  LYS C CA  1 
ATOM   4900 C C   . LYS C 1 30  ? -36.881  -20.432 45.802  1.00 165.33 ? 55  LYS C C   1 
ATOM   4901 O O   . LYS C 1 30  ? -38.035  -20.256 45.422  1.00 172.54 ? 55  LYS C O   1 
ATOM   4902 C CB  . LYS C 1 30  ? -37.110  -18.225 46.978  1.00 135.76 ? 55  LYS C CB  1 
ATOM   4903 N N   . GLY C 1 31  ? -36.132  -21.451 45.392  1.00 154.99 ? 56  GLY C N   1 
ATOM   4904 C CA  . GLY C 1 31  ? -36.573  -22.376 44.363  1.00 148.07 ? 56  GLY C CA  1 
ATOM   4905 C C   . GLY C 1 31  ? -37.630  -23.395 44.756  1.00 161.68 ? 56  GLY C C   1 
ATOM   4906 O O   . GLY C 1 31  ? -38.031  -24.218 43.933  1.00 167.18 ? 56  GLY C O   1 
ATOM   4907 N N   . TYR C 1 32  ? -38.081  -23.347 46.006  1.00 158.57 ? 57  TYR C N   1 
ATOM   4908 C CA  . TYR C 1 32  ? -39.097  -24.279 46.507  1.00 154.71 ? 57  TYR C CA  1 
ATOM   4909 C C   . TYR C 1 32  ? -40.536  -23.805 46.263  1.00 173.92 ? 57  TYR C C   1 
ATOM   4910 O O   . TYR C 1 32  ? -41.490  -24.478 46.665  1.00 162.57 ? 57  TYR C O   1 
ATOM   4911 C CB  . TYR C 1 32  ? -38.896  -24.522 48.002  1.00 145.39 ? 57  TYR C CB  1 
ATOM   4912 C CG  . TYR C 1 32  ? -38.995  -23.261 48.830  1.00 153.45 ? 57  TYR C CG  1 
ATOM   4913 C CD1 . TYR C 1 32  ? -40.156  -22.951 49.527  1.00 155.92 ? 57  TYR C CD1 1 
ATOM   4914 C CD2 . TYR C 1 32  ? -37.928  -22.371 48.905  1.00 144.28 ? 57  TYR C CD2 1 
ATOM   4915 C CE1 . TYR C 1 32  ? -40.248  -21.790 50.284  1.00 152.42 ? 57  TYR C CE1 1 
ATOM   4916 C CE2 . TYR C 1 32  ? -38.011  -21.212 49.656  1.00 143.51 ? 57  TYR C CE2 1 
ATOM   4917 C CZ  . TYR C 1 32  ? -39.170  -20.927 50.342  1.00 139.35 ? 57  TYR C CZ  1 
ATOM   4918 O OH  . TYR C 1 32  ? -39.248  -19.773 51.082  1.00 108.35 ? 57  TYR C OH  1 
ATOM   4919 N N   . GLN C 1 33  ? -40.686  -22.641 45.629  1.00 177.58 ? 58  GLN C N   1 
ATOM   4920 C CA  . GLN C 1 33  ? -42.002  -22.067 45.319  1.00 154.64 ? 58  GLN C CA  1 
ATOM   4921 C C   . GLN C 1 33  ? -42.413  -22.317 43.860  1.00 155.13 ? 58  GLN C C   1 
ATOM   4922 O O   . GLN C 1 33  ? -41.556  -22.443 42.986  1.00 152.09 ? 58  GLN C O   1 
ATOM   4923 C CB  . GLN C 1 33  ? -42.003  -20.552 45.584  1.00 158.01 ? 58  GLN C CB  1 
ATOM   4924 C CG  . GLN C 1 33  ? -41.659  -20.143 47.016  1.00 172.64 ? 58  GLN C CG  1 
ATOM   4925 C CD  . GLN C 1 33  ? -41.345  -18.655 47.162  1.00 166.69 ? 58  GLN C CD  1 
ATOM   4926 O OE1 . GLN C 1 33  ? -41.357  -17.902 46.185  1.00 155.03 ? 58  GLN C OE1 1 
ATOM   4927 N NE2 . GLN C 1 33  ? -41.056  -18.231 48.391  1.00 156.29 ? 58  GLN C NE2 1 
ATOM   4928 N N   . ASP C 1 34  ? -43.716  -22.384 43.597  1.00 150.26 ? 59  ASP C N   1 
ATOM   4929 C CA  . ASP C 1 34  ? -44.217  -22.392 42.222  1.00 133.74 ? 59  ASP C CA  1 
ATOM   4930 C C   . ASP C 1 34  ? -44.501  -20.948 41.793  1.00 150.07 ? 59  ASP C C   1 
ATOM   4931 O O   . ASP C 1 34  ? -45.032  -20.175 42.582  1.00 155.54 ? 59  ASP C O   1 
ATOM   4932 C CB  . ASP C 1 34  ? -45.475  -23.252 42.120  1.00 92.14  ? 59  ASP C CB  1 
ATOM   4933 N N   . THR C 1 35  ? -44.154  -20.575 40.562  1.00 144.26 ? 60  THR C N   1 
ATOM   4934 C CA  . THR C 1 35  ? -44.329  -19.189 40.103  1.00 131.45 ? 60  THR C CA  1 
ATOM   4935 C C   . THR C 1 35  ? -45.724  -18.897 39.518  1.00 148.18 ? 60  THR C C   1 
ATOM   4936 O O   . THR C 1 35  ? -46.428  -19.814 39.093  1.00 148.10 ? 60  THR C O   1 
ATOM   4937 C CB  . THR C 1 35  ? -43.244  -18.828 39.102  1.00 97.68  ? 60  THR C CB  1 
ATOM   4938 N N   . ASP C 1 36  ? -46.113  -17.619 39.504  1.00 136.06 ? 61  ASP C N   1 
ATOM   4939 C CA  . ASP C 1 36  ? -47.368  -17.181 38.868  1.00 136.48 ? 61  ASP C CA  1 
ATOM   4940 C C   . ASP C 1 36  ? -47.345  -15.684 38.525  1.00 129.47 ? 61  ASP C C   1 
ATOM   4941 O O   . ASP C 1 36  ? -47.061  -14.838 39.376  1.00 109.47 ? 61  ASP C O   1 
ATOM   4942 C CB  . ASP C 1 36  ? -48.593  -17.523 39.736  1.00 129.31 ? 61  ASP C CB  1 
ATOM   4943 C CG  . ASP C 1 36  ? -49.928  -17.279 39.015  1.00 127.53 ? 61  ASP C CG  1 
ATOM   4944 O OD1 . ASP C 1 36  ? -49.938  -17.115 37.777  1.00 128.04 ? 61  ASP C OD1 1 
ATOM   4945 O OD2 . ASP C 1 36  ? -50.978  -17.253 39.691  1.00 115.22 ? 61  ASP C OD2 1 
ATOM   4946 N N   . THR C 1 37  ? -47.641  -15.369 37.267  1.00 122.79 ? 62  THR C N   1 
ATOM   4947 C CA  . THR C 1 37  ? -47.655  -13.989 36.797  1.00 125.08 ? 62  THR C CA  1 
ATOM   4948 C C   . THR C 1 37  ? -48.958  -13.289 37.161  1.00 122.36 ? 62  THR C C   1 
ATOM   4949 O O   . THR C 1 37  ? -49.975  -13.940 37.390  1.00 119.76 ? 62  THR C O   1 
ATOM   4950 C CB  . THR C 1 37  ? -47.465  -13.919 35.277  1.00 122.63 ? 62  THR C CB  1 
ATOM   4951 O OG1 . THR C 1 37  ? -48.537  -14.618 34.636  1.00 132.80 ? 62  THR C OG1 1 
ATOM   4952 C CG2 . THR C 1 37  ? -46.152  -14.555 34.880  1.00 112.72 ? 62  THR C CG2 1 
ATOM   4953 N N   . VAL C 1 38  ? -48.922  -11.961 37.194  1.00 120.60 ? 63  VAL C N   1 
ATOM   4954 C CA  . VAL C 1 38  ? -50.058  -11.166 37.650  1.00 105.97 ? 63  VAL C CA  1 
ATOM   4955 C C   . VAL C 1 38  ? -51.104  -10.902 36.571  1.00 105.35 ? 63  VAL C C   1 
ATOM   4956 O O   . VAL C 1 38  ? -50.762  -10.627 35.424  1.00 92.27  ? 63  VAL C O   1 
ATOM   4957 C CB  . VAL C 1 38  ? -49.588  -9.813  38.184  1.00 97.12  ? 63  VAL C CB  1 
ATOM   4958 C CG1 . VAL C 1 38  ? -50.757  -9.060  38.778  1.00 101.86 ? 63  VAL C CG1 1 
ATOM   4959 C CG2 . VAL C 1 38  ? -48.500  -10.017 39.216  1.00 120.09 ? 63  VAL C CG2 1 
ATOM   4960 N N   . LEU C 1 39  ? -52.379  -10.981 36.942  1.00 118.12 ? 64  LEU C N   1 
ATOM   4961 C CA  . LEU C 1 39  ? -53.451  -10.563 36.044  1.00 108.28 ? 64  LEU C CA  1 
ATOM   4962 C C   . LEU C 1 39  ? -53.937  -9.171  36.456  1.00 99.67  ? 64  LEU C C   1 
ATOM   4963 O O   . LEU C 1 39  ? -54.579  -9.010  37.486  1.00 91.19  ? 64  LEU C O   1 
ATOM   4964 C CB  . LEU C 1 39  ? -54.595  -11.575 36.058  1.00 84.49  ? 64  LEU C CB  1 
ATOM   4965 C CG  . LEU C 1 39  ? -55.632  -11.455 34.938  1.00 108.47 ? 64  LEU C CG  1 
ATOM   4966 C CD1 . LEU C 1 39  ? -54.961  -11.166 33.586  1.00 109.96 ? 64  LEU C CD1 1 
ATOM   4967 C CD2 . LEU C 1 39  ? -56.496  -12.709 34.869  1.00 81.94  ? 64  LEU C CD2 1 
ATOM   4968 N N   . SER C 1 40  ? -53.629  -8.165  35.647  1.00 114.86 ? 65  SER C N   1 
ATOM   4969 C CA  . SER C 1 40  ? -53.797  -6.777  36.069  1.00 101.62 ? 65  SER C CA  1 
ATOM   4970 C C   . SER C 1 40  ? -54.977  -6.038  35.467  1.00 101.59 ? 65  SER C C   1 
ATOM   4971 O O   . SER C 1 40  ? -55.480  -6.390  34.396  1.00 112.18 ? 65  SER C O   1 
ATOM   4972 C CB  . SER C 1 40  ? -52.530  -5.983  35.763  1.00 109.21 ? 65  SER C CB  1 
ATOM   4973 O OG  . SER C 1 40  ? -52.560  -4.732  36.422  1.00 95.78  ? 65  SER C OG  1 
ATOM   4974 N N   . SER C 1 41  ? -55.382  -4.981  36.163  1.00 91.51  ? 66  SER C N   1 
ATOM   4975 C CA  . SER C 1 41  ? -56.414  -4.071  35.690  1.00 98.44  ? 66  SER C CA  1 
ATOM   4976 C C   . SER C 1 41  ? -56.199  -2.742  36.389  1.00 96.38  ? 66  SER C C   1 
ATOM   4977 O O   . SER C 1 41  ? -56.074  -2.709  37.608  1.00 106.13 ? 66  SER C O   1 
ATOM   4978 C CB  . SER C 1 41  ? -57.807  -4.616  36.028  1.00 102.01 ? 66  SER C CB  1 
ATOM   4979 O OG  . SER C 1 41  ? -58.834  -3.723  35.617  1.00 102.12 ? 66  SER C OG  1 
ATOM   4980 N N   . VAL C 1 42  ? -56.153  -1.652  35.626  1.00 86.34  ? 67  VAL C N   1 
ATOM   4981 C CA  . VAL C 1 42  ? -55.916  -0.329  36.201  1.00 87.93  ? 67  VAL C CA  1 
ATOM   4982 C C   . VAL C 1 42  ? -57.014  0.673   35.868  1.00 96.63  ? 67  VAL C C   1 
ATOM   4983 O O   . VAL C 1 42  ? -57.849  0.437   35.005  1.00 107.65 ? 67  VAL C O   1 
ATOM   4984 C CB  . VAL C 1 42  ? -54.588  0.284   35.729  1.00 73.77  ? 67  VAL C CB  1 
ATOM   4985 C CG1 . VAL C 1 42  ? -53.414  -0.556  36.170  1.00 98.00  ? 67  VAL C CG1 1 
ATOM   4986 C CG2 . VAL C 1 42  ? -54.606  0.452   34.238  1.00 105.21 ? 67  VAL C CG2 1 
ATOM   4987 N N   . THR C 1 43  ? -56.982  1.801   36.566  1.00 85.45  ? 68  THR C N   1 
ATOM   4988 C CA  . THR C 1 43  ? -57.972  2.848   36.431  1.00 84.36  ? 68  THR C CA  1 
ATOM   4989 C C   . THR C 1 43  ? -57.310  4.143   36.832  1.00 92.22  ? 68  THR C C   1 
ATOM   4990 O O   . THR C 1 43  ? -56.758  4.248   37.919  1.00 93.36  ? 68  THR C O   1 
ATOM   4991 C CB  . THR C 1 43  ? -59.159  2.612   37.379  1.00 105.15 ? 68  THR C CB  1 
ATOM   4992 O OG1 . THR C 1 43  ? -59.911  1.470   36.949  1.00 125.91 ? 68  THR C OG1 1 
ATOM   4993 C CG2 . THR C 1 43  ? -60.074  3.827   37.423  1.00 88.83  ? 68  THR C CG2 1 
ATOM   4994 N N   . THR C 1 44  ? -57.352  5.127   35.947  1.00 103.63 ? 69  THR C N   1 
ATOM   4995 C CA  . THR C 1 44  ? -56.756  6.424   36.226  1.00 82.41  ? 69  THR C CA  1 
ATOM   4996 C C   . THR C 1 44  ? -57.832  7.502   36.292  1.00 86.93  ? 69  THR C C   1 
ATOM   4997 O O   . THR C 1 44  ? -58.867  7.380   35.637  1.00 107.28 ? 69  THR C O   1 
ATOM   4998 C CB  . THR C 1 44  ? -55.741  6.795   35.132  1.00 91.94  ? 69  THR C CB  1 
ATOM   4999 O OG1 . THR C 1 44  ? -56.384  6.796   33.850  1.00 91.53  ? 69  THR C OG1 1 
ATOM   5000 C CG2 . THR C 1 44  ? -54.619  5.783   35.109  1.00 87.72  ? 69  THR C CG2 1 
ATOM   5001 N N   . LYS C 1 45  ? -57.601  8.546   37.083  1.00 75.33  ? 70  LYS C N   1 
ATOM   5002 C CA  . LYS C 1 45  ? -58.410  9.768   36.987  1.00 95.73  ? 70  LYS C CA  1 
ATOM   5003 C C   . LYS C 1 45  ? -57.544  10.983  37.268  1.00 83.66  ? 70  LYS C C   1 
ATOM   5004 O O   . LYS C 1 45  ? -57.063  11.173  38.375  1.00 83.16  ? 70  LYS C O   1 
ATOM   5005 C CB  . LYS C 1 45  ? -59.647  9.740   37.916  1.00 58.70  ? 70  LYS C CB  1 
ATOM   5006 N N   . VAL C 1 46  ? -57.335  11.795  36.240  1.00 80.53  ? 71  VAL C N   1 
ATOM   5007 C CA  . VAL C 1 46  ? -56.507  12.985  36.353  1.00 78.67  ? 71  VAL C CA  1 
ATOM   5008 C C   . VAL C 1 46  ? -57.321  14.187  36.814  1.00 90.50  ? 71  VAL C C   1 
ATOM   5009 O O   . VAL C 1 46  ? -58.402  14.462  36.290  1.00 93.07  ? 71  VAL C O   1 
ATOM   5010 C CB  . VAL C 1 46  ? -55.826  13.320  35.010  1.00 73.82  ? 71  VAL C CB  1 
ATOM   5011 C CG1 . VAL C 1 46  ? -55.162  14.702  35.059  1.00 90.11  ? 71  VAL C CG1 1 
ATOM   5012 C CG2 . VAL C 1 46  ? -54.837  12.223  34.624  1.00 78.86  ? 71  VAL C CG2 1 
ATOM   5013 N N   . LYS C 1 47  ? -56.788  14.916  37.787  1.00 95.10  ? 72  LYS C N   1 
ATOM   5014 C CA  . LYS C 1 47  ? -57.453  16.118  38.281  1.00 103.14 ? 72  LYS C CA  1 
ATOM   5015 C C   . LYS C 1 47  ? -56.517  17.326  38.188  1.00 98.60  ? 72  LYS C C   1 
ATOM   5016 O O   . LYS C 1 47  ? -55.329  17.252  38.562  1.00 94.04  ? 72  LYS C O   1 
ATOM   5017 C CB  . LYS C 1 47  ? -57.968  15.921  39.726  1.00 66.46  ? 72  LYS C CB  1 
ATOM   5018 N N   . GLY C 1 48  ? -57.059  18.422  37.657  1.00 88.60  ? 73  GLY C N   1 
ATOM   5019 C CA  . GLY C 1 48  ? -56.355  19.690  37.600  1.00 77.49  ? 73  GLY C CA  1 
ATOM   5020 C C   . GLY C 1 48  ? -57.064  20.638  36.655  1.00 92.61  ? 73  GLY C C   1 
ATOM   5021 O O   . GLY C 1 48  ? -58.001  20.229  35.959  1.00 99.54  ? 73  GLY C O   1 
ATOM   5022 N N   . ILE C 1 49  ? -56.651  21.905  36.647  1.00 79.71  ? 74  ILE C N   1 
ATOM   5023 C CA  . ILE C 1 49  ? -57.034  22.815  35.566  1.00 98.42  ? 74  ILE C CA  1 
ATOM   5024 C C   . ILE C 1 49  ? -55.859  23.697  35.218  1.00 109.06 ? 74  ILE C C   1 
ATOM   5025 O O   . ILE C 1 49  ? -54.949  23.891  36.038  1.00 102.66 ? 74  ILE C O   1 
ATOM   5026 C CB  . ILE C 1 49  ? -58.192  23.753  35.923  1.00 84.13  ? 74  ILE C CB  1 
ATOM   5027 C CG1 . ILE C 1 49  ? -57.856  24.535  37.191  1.00 113.26 ? 74  ILE C CG1 1 
ATOM   5028 C CG2 . ILE C 1 49  ? -59.496  22.985  36.041  1.00 100.64 ? 74  ILE C CG2 1 
ATOM   5029 C CD1 . ILE C 1 49  ? -58.851  25.614  37.505  1.00 124.22 ? 74  ILE C CD1 1 
ATOM   5030 N N   . ALA C 1 50  ? -55.897  24.254  34.013  1.00 96.74  ? 75  ALA C N   1 
ATOM   5031 C CA  . ALA C 1 50  ? -54.784  25.046  33.522  1.00 87.19  ? 75  ALA C CA  1 
ATOM   5032 C C   . ALA C 1 50  ? -55.278  26.265  32.756  1.00 101.11 ? 75  ALA C C   1 
ATOM   5033 O O   . ALA C 1 50  ? -56.278  26.212  32.034  1.00 99.94  ? 75  ALA C O   1 
ATOM   5034 C CB  . ALA C 1 50  ? -53.893  24.196  32.657  1.00 95.08  ? 75  ALA C CB  1 
ATOM   5035 N N   . LEU C 1 51  ? -54.564  27.368  32.936  1.00 104.27 ? 76  LEU C N   1 
ATOM   5036 C CA  . LEU C 1 51  ? -54.895  28.622  32.289  1.00 109.50 ? 76  LEU C CA  1 
ATOM   5037 C C   . LEU C 1 51  ? -53.974  28.856  31.101  1.00 91.26  ? 76  LEU C C   1 
ATOM   5038 O O   . LEU C 1 51  ? -52.871  28.306  31.051  1.00 97.78  ? 76  LEU C O   1 
ATOM   5039 C CB  . LEU C 1 51  ? -54.729  29.759  33.289  1.00 109.16 ? 76  LEU C CB  1 
ATOM   5040 C CG  . LEU C 1 51  ? -54.870  31.166  32.727  1.00 106.62 ? 76  LEU C CG  1 
ATOM   5041 C CD1 . LEU C 1 51  ? -56.287  31.397  32.208  1.00 109.88 ? 76  LEU C CD1 1 
ATOM   5042 C CD2 . LEU C 1 51  ? -54.495  32.179  33.795  1.00 101.38 ? 76  LEU C CD2 1 
ATOM   5043 N N   . THR C 1 52  ? -54.417  29.669  30.146  1.00 82.35  ? 77  THR C N   1 
ATOM   5044 C CA  . THR C 1 52  ? -53.521  30.132  29.094  1.00 100.66 ? 77  THR C CA  1 
ATOM   5045 C C   . THR C 1 52  ? -53.882  31.533  28.615  1.00 116.62 ? 77  THR C C   1 
ATOM   5046 O O   . THR C 1 52  ? -55.003  31.773  28.153  1.00 121.01 ? 77  THR C O   1 
ATOM   5047 C CB  . THR C 1 52  ? -53.505  29.190  27.852  1.00 109.72 ? 77  THR C CB  1 
ATOM   5048 O OG1 . THR C 1 52  ? -54.773  29.244  27.177  1.00 93.80  ? 77  THR C OG1 1 
ATOM   5049 C CG2 . THR C 1 52  ? -53.160  27.748  28.232  1.00 87.45  ? 77  THR C CG2 1 
ATOM   5050 N N   . ASN C 1 53  ? -52.931  32.457  28.737  1.00 121.79 ? 78  ASN C N   1 
ATOM   5051 C CA  . ASN C 1 53  ? -53.027  33.749  28.068  1.00 133.96 ? 78  ASN C CA  1 
ATOM   5052 C C   . ASN C 1 53  ? -52.438  33.613  26.674  1.00 148.69 ? 78  ASN C C   1 
ATOM   5053 O O   . ASN C 1 53  ? -51.275  33.939  26.445  1.00 138.28 ? 78  ASN C O   1 
ATOM   5054 C CB  . ASN C 1 53  ? -52.284  34.824  28.858  1.00 135.85 ? 78  ASN C CB  1 
ATOM   5055 C CG  . ASN C 1 53  ? -52.972  35.154  30.150  1.00 150.22 ? 78  ASN C CG  1 
ATOM   5056 O OD1 . ASN C 1 53  ? -53.885  34.441  30.576  1.00 146.05 ? 78  ASN C OD1 1 
ATOM   5057 N ND2 . ASN C 1 53  ? -52.526  36.215  30.807  1.00 175.19 ? 78  ASN C ND2 1 
ATOM   5058 N N   . THR C 1 54  ? -53.234  33.101  25.743  1.00 167.00 ? 79  THR C N   1 
ATOM   5059 C CA  . THR C 1 54  ? -52.787  33.000  24.360  1.00 157.47 ? 79  THR C CA  1 
ATOM   5060 C C   . THR C 1 54  ? -52.439  34.394  23.863  1.00 163.22 ? 79  THR C C   1 
ATOM   5061 O O   . THR C 1 54  ? -52.747  35.395  24.519  1.00 161.00 ? 79  THR C O   1 
ATOM   5062 C CB  . THR C 1 54  ? -53.871  32.394  23.449  1.00 174.30 ? 79  THR C CB  1 
ATOM   5063 O OG1 . THR C 1 54  ? -55.143  32.943  23.810  1.00 186.01 ? 79  THR C OG1 1 
ATOM   5064 C CG2 . THR C 1 54  ? -53.920  30.878  23.616  1.00 163.02 ? 79  THR C CG2 1 
ATOM   5065 N N   . SER C 1 55  ? -51.784  34.467  22.711  1.00 182.17 ? 80  SER C N   1 
ATOM   5066 C CA  . SER C 1 55  ? -51.413  35.759  22.158  1.00 182.92 ? 80  SER C CA  1 
ATOM   5067 C C   . SER C 1 55  ? -52.652  36.637  21.999  1.00 174.36 ? 80  SER C C   1 
ATOM   5068 O O   . SER C 1 55  ? -52.797  37.656  22.678  1.00 136.95 ? 80  SER C O   1 
ATOM   5069 C CB  . SER C 1 55  ? -50.705  35.575  20.814  1.00 168.36 ? 80  SER C CB  1 
ATOM   5070 O OG  . SER C 1 55  ? -51.433  34.709  19.954  1.00 161.12 ? 80  SER C OG  1 
ATOM   5071 N N   . GLU C 1 56  ? -53.550  36.216  21.111  1.00 175.66 ? 81  GLU C N   1 
ATOM   5072 C CA  . GLU C 1 56  ? -54.724  37.008  20.750  1.00 170.72 ? 81  GLU C CA  1 
ATOM   5073 C C   . GLU C 1 56  ? -56.003  36.567  21.459  1.00 186.73 ? 81  GLU C C   1 
ATOM   5074 O O   . GLU C 1 56  ? -56.887  37.386  21.715  1.00 208.32 ? 81  GLU C O   1 
ATOM   5075 C CB  . GLU C 1 56  ? -54.928  36.979  19.242  1.00 162.77 ? 81  GLU C CB  1 
ATOM   5076 N N   . LEU C 1 57  ? -56.100  35.275  21.762  1.00 186.95 ? 82  LEU C N   1 
ATOM   5077 C CA  . LEU C 1 57  ? -57.318  34.688  22.332  1.00 190.69 ? 82  LEU C CA  1 
ATOM   5078 C C   . LEU C 1 57  ? -57.569  35.062  23.797  1.00 182.54 ? 82  LEU C C   1 
ATOM   5079 O O   . LEU C 1 57  ? -58.667  34.857  24.322  1.00 156.02 ? 82  LEU C O   1 
ATOM   5080 C CB  . LEU C 1 57  ? -57.287  33.164  22.206  1.00 165.17 ? 82  LEU C CB  1 
ATOM   5081 C CG  . LEU C 1 57  ? -57.050  32.520  20.840  1.00 151.25 ? 82  LEU C CG  1 
ATOM   5082 C CD1 . LEU C 1 57  ? -55.672  32.867  20.262  1.00 131.60 ? 82  LEU C CD1 1 
ATOM   5083 C CD2 . LEU C 1 57  ? -57.223  31.016  20.976  1.00 129.45 ? 82  LEU C CD2 1 
ATOM   5084 N N   . GLY C 1 58  ? -56.544  35.594  24.455  1.00 190.59 ? 83  GLY C N   1 
ATOM   5085 C CA  . GLY C 1 58  ? -56.666  36.014  25.840  1.00 171.41 ? 83  GLY C CA  1 
ATOM   5086 C C   . GLY C 1 58  ? -56.882  34.860  26.796  1.00 149.54 ? 83  GLY C C   1 
ATOM   5087 O O   . GLY C 1 58  ? -56.908  33.699  26.386  1.00 141.70 ? 83  GLY C O   1 
ATOM   5088 N N   . GLU C 1 59  ? -57.048  35.182  28.076  1.00 155.42 ? 84  GLU C N   1 
ATOM   5089 C CA  . GLU C 1 59  ? -57.191  34.154  29.102  1.00 137.80 ? 84  GLU C CA  1 
ATOM   5090 C C   . GLU C 1 59  ? -58.140  33.039  28.651  1.00 124.60 ? 84  GLU C C   1 
ATOM   5091 O O   . GLU C 1 59  ? -59.194  33.309  28.061  1.00 109.31 ? 84  GLU C O   1 
ATOM   5092 C CB  . GLU C 1 59  ? -57.595  34.756  30.463  1.00 124.49 ? 84  GLU C CB  1 
ATOM   5093 C CG  . GLU C 1 59  ? -58.494  35.999  30.406  1.00 140.06 ? 84  GLU C CG  1 
ATOM   5094 C CD  . GLU C 1 59  ? -58.519  36.785  31.723  1.00 150.30 ? 84  GLU C CD  1 
ATOM   5095 O OE1 . GLU C 1 59  ? -57.633  36.555  32.583  1.00 145.36 ? 84  GLU C OE1 1 
ATOM   5096 O OE2 . GLU C 1 59  ? -59.424  37.638  31.898  1.00 129.47 ? 84  GLU C OE2 1 
ATOM   5097 N N   . ARG C 1 60  ? -57.729  31.791  28.896  1.00 139.48 ? 85  ARG C N   1 
ATOM   5098 C CA  . ARG C 1 60  ? -58.507  30.599  28.536  1.00 133.40 ? 85  ARG C CA  1 
ATOM   5099 C C   . ARG C 1 60  ? -58.210  29.437  29.493  1.00 136.07 ? 85  ARG C C   1 
ATOM   5100 O O   . ARG C 1 60  ? -57.053  29.202  29.865  1.00 118.30 ? 85  ARG C O   1 
ATOM   5101 C CB  . ARG C 1 60  ? -58.231  30.184  27.089  1.00 70.94  ? 85  ARG C CB  1 
ATOM   5102 N N   . ILE C 1 61  ? -59.260  28.722  29.899  1.00 106.24 ? 86  ILE C N   1 
ATOM   5103 C CA  . ILE C 1 61  ? -59.115  27.581  30.799  1.00 103.10 ? 86  ILE C CA  1 
ATOM   5104 C C   . ILE C 1 61  ? -59.278  26.246  30.083  1.00 102.26 ? 86  ILE C C   1 
ATOM   5105 O O   . ILE C 1 61  ? -60.099  26.100  29.179  1.00 103.00 ? 86  ILE C O   1 
ATOM   5106 C CB  . ILE C 1 61  ? -60.132  27.627  31.939  1.00 106.68 ? 86  ILE C CB  1 
ATOM   5107 C CG1 . ILE C 1 61  ? -59.483  28.139  33.220  1.00 102.01 ? 86  ILE C CG1 1 
ATOM   5108 C CG2 . ILE C 1 61  ? -60.673  26.241  32.224  1.00 113.55 ? 86  ILE C CG2 1 
ATOM   5109 C CD1 . ILE C 1 61  ? -60.187  27.616  34.456  1.00 115.51 ? 86  ILE C CD1 1 
ATOM   5110 N N   . TRP C 1 62  ? -58.505  25.266  30.530  1.00 103.15 ? 87  TRP C N   1 
ATOM   5111 C CA  . TRP C 1 62  ? -58.506  23.938  29.951  1.00 100.46 ? 87  TRP C CA  1 
ATOM   5112 C C   . TRP C 1 62  ? -58.683  22.971  31.076  1.00 100.91 ? 87  TRP C C   1 
ATOM   5113 O O   . TRP C 1 62  ? -57.737  22.721  31.815  1.00 106.07 ? 87  TRP C O   1 
ATOM   5114 C CB  . TRP C 1 62  ? -57.145  23.657  29.329  1.00 95.55  ? 87  TRP C CB  1 
ATOM   5115 C CG  . TRP C 1 62  ? -56.818  24.559  28.202  1.00 99.97  ? 87  TRP C CG  1 
ATOM   5116 C CD1 . TRP C 1 62  ? -56.392  25.856  28.278  1.00 114.76 ? 87  TRP C CD1 1 
ATOM   5117 C CD2 . TRP C 1 62  ? -56.899  24.242  26.811  1.00 92.16  ? 87  TRP C CD2 1 
ATOM   5118 N NE1 . TRP C 1 62  ? -56.205  26.362  27.014  1.00 117.87 ? 87  TRP C NE1 1 
ATOM   5119 C CE2 . TRP C 1 62  ? -56.509  25.393  26.101  1.00 97.76  ? 87  TRP C CE2 1 
ATOM   5120 C CE3 . TRP C 1 62  ? -57.259  23.098  26.106  1.00 96.81  ? 87  TRP C CE3 1 
ATOM   5121 C CZ2 . TRP C 1 62  ? -56.476  25.425  24.717  1.00 98.00  ? 87  TRP C CZ2 1 
ATOM   5122 C CZ3 . TRP C 1 62  ? -57.222  23.132  24.750  1.00 101.18 ? 87  TRP C CZ3 1 
ATOM   5123 C CH2 . TRP C 1 62  ? -56.836  24.287  24.060  1.00 112.02 ? 87  TRP C CH2 1 
ATOM   5124 N N   . ASP C 1 63  ? -59.878  22.417  31.232  1.00 110.34 ? 88  ASP C N   1 
ATOM   5125 C CA  . ASP C 1 63  ? -60.070  21.519  32.368  1.00 133.31 ? 88  ASP C CA  1 
ATOM   5126 C C   . ASP C 1 63  ? -59.566  20.120  32.060  1.00 127.84 ? 88  ASP C C   1 
ATOM   5127 O O   . ASP C 1 63  ? -60.289  19.296  31.481  1.00 89.41  ? 88  ASP C O   1 
ATOM   5128 C CB  . ASP C 1 63  ? -61.504  21.518  32.904  1.00 104.75 ? 88  ASP C CB  1 
ATOM   5129 C CG  . ASP C 1 63  ? -62.518  21.237  31.843  1.00 116.08 ? 88  ASP C CG  1 
ATOM   5130 O OD1 . ASP C 1 63  ? -62.129  21.072  30.662  1.00 136.21 ? 88  ASP C OD1 1 
ATOM   5131 O OD2 . ASP C 1 63  ? -63.712  21.191  32.202  1.00 100.03 ? 88  ASP C OD2 1 
ATOM   5132 N N   . VAL C 1 64  ? -58.314  19.886  32.470  1.00 139.76 ? 89  VAL C N   1 
ATOM   5133 C CA  . VAL C 1 64  ? -57.613  18.625  32.259  1.00 120.75 ? 89  VAL C CA  1 
ATOM   5134 C C   . VAL C 1 64  ? -58.559  17.437  32.258  1.00 148.51 ? 89  VAL C C   1 
ATOM   5135 O O   . VAL C 1 64  ? -58.331  16.465  31.530  1.00 143.48 ? 89  VAL C O   1 
ATOM   5136 C CB  . VAL C 1 64  ? -56.409  18.427  33.235  1.00 81.07  ? 89  VAL C CB  1 
ATOM   5137 C CG1 . VAL C 1 64  ? -56.876  17.981  34.585  1.00 91.48  ? 89  VAL C CG1 1 
ATOM   5138 C CG2 . VAL C 1 64  ? -55.427  17.419  32.679  1.00 66.43  ? 89  VAL C CG2 1 
ATOM   5139 N N   . ALA C 1 65  ? -59.632  17.522  33.042  1.00 124.64 ? 90  ALA C N   1 
ATOM   5140 C CA  . ALA C 1 65  ? -60.651  16.501  32.989  1.00 68.73  ? 90  ALA C CA  1 
ATOM   5141 C C   . ALA C 1 65  ? -61.092  16.376  31.533  1.00 101.41 ? 90  ALA C C   1 
ATOM   5142 O O   . ALA C 1 65  ? -60.740  15.409  30.851  1.00 106.93 ? 90  ALA C O   1 
ATOM   5143 C CB  . ALA C 1 65  ? -61.807  16.871  33.893  1.00 90.50  ? 90  ALA C CB  1 
ATOM   5144 N N   . ASP C 1 66  ? -61.823  17.373  31.047  1.00 88.42  ? 91  ASP C N   1 
ATOM   5145 C CA  . ASP C 1 66  ? -62.525  17.227  29.777  1.00 94.72  ? 91  ASP C CA  1 
ATOM   5146 C C   . ASP C 1 66  ? -61.760  17.731  28.579  1.00 99.94  ? 91  ASP C C   1 
ATOM   5147 O O   . ASP C 1 66  ? -61.779  17.117  27.513  1.00 112.43 ? 91  ASP C O   1 
ATOM   5148 C CB  . ASP C 1 66  ? -63.885  17.906  29.831  1.00 87.74  ? 91  ASP C CB  1 
ATOM   5149 N N   . TYR C 1 67  ? -61.114  18.872  28.745  1.00 104.40 ? 92  TYR C N   1 
ATOM   5150 C CA  . TYR C 1 67  ? -60.508  19.535  27.614  1.00 117.09 ? 92  TYR C CA  1 
ATOM   5151 C C   . TYR C 1 67  ? -59.065  19.054  27.384  1.00 105.93 ? 92  TYR C C   1 
ATOM   5152 O O   . TYR C 1 67  ? -58.524  19.149  26.277  1.00 90.25  ? 92  TYR C O   1 
ATOM   5153 C CB  . TYR C 1 67  ? -60.603  21.055  27.783  1.00 112.15 ? 92  TYR C CB  1 
ATOM   5154 C CG  . TYR C 1 67  ? -60.750  21.757  26.460  1.00 153.81 ? 92  TYR C CG  1 
ATOM   5155 C CD1 . TYR C 1 67  ? -60.193  21.203  25.303  1.00 160.69 ? 92  TYR C CD1 1 
ATOM   5156 C CD2 . TYR C 1 67  ? -61.435  22.963  26.352  1.00 151.06 ? 92  TYR C CD2 1 
ATOM   5157 C CE1 . TYR C 1 67  ? -60.315  21.822  24.068  1.00 156.40 ? 92  TYR C CE1 1 
ATOM   5158 C CE2 . TYR C 1 67  ? -61.559  23.603  25.111  1.00 171.81 ? 92  TYR C CE2 1 
ATOM   5159 C CZ  . TYR C 1 67  ? -60.995  23.023  23.972  1.00 172.91 ? 92  TYR C CZ  1 
ATOM   5160 O OH  . TYR C 1 67  ? -61.108  23.634  22.736  1.00 138.13 ? 92  TYR C OH  1 
ATOM   5161 N N   . ILE C 1 68  ? -58.460  18.498  28.426  1.00 101.81 ? 93  ILE C N   1 
ATOM   5162 C CA  . ILE C 1 68  ? -57.033  18.197  28.391  1.00 89.36  ? 93  ILE C CA  1 
ATOM   5163 C C   . ILE C 1 68  ? -56.664  16.783  28.008  1.00 82.93  ? 93  ILE C C   1 
ATOM   5164 O O   . ILE C 1 68  ? -55.503  16.513  27.697  1.00 81.52  ? 93  ILE C O   1 
ATOM   5165 C CB  . ILE C 1 68  ? -56.394  18.434  29.753  1.00 88.18  ? 93  ILE C CB  1 
ATOM   5166 C CG1 . ILE C 1 68  ? -56.147  19.926  29.972  1.00 110.04 ? 93  ILE C CG1 1 
ATOM   5167 C CG2 . ILE C 1 68  ? -55.128  17.598  29.905  1.00 81.57  ? 93  ILE C CG2 1 
ATOM   5168 C CD1 . ILE C 1 68  ? -55.391  20.261  31.218  1.00 99.10  ? 93  ILE C CD1 1 
ATOM   5169 N N   . ILE C 1 69  ? -57.619  15.865  28.078  1.00 88.16  ? 94  ILE C N   1 
ATOM   5170 C CA  . ILE C 1 69  ? -57.267  14.460  27.890  1.00 84.12  ? 94  ILE C CA  1 
ATOM   5171 C C   . ILE C 1 69  ? -57.961  13.780  26.708  1.00 91.42  ? 94  ILE C C   1 
ATOM   5172 O O   . ILE C 1 69  ? -59.052  13.221  26.856  1.00 99.04  ? 94  ILE C O   1 
ATOM   5173 C CB  . ILE C 1 69  ? -57.466  13.667  29.183  1.00 61.73  ? 94  ILE C CB  1 
ATOM   5174 C CG1 . ILE C 1 69  ? -56.670  14.339  30.295  1.00 73.93  ? 94  ILE C CG1 1 
ATOM   5175 C CG2 . ILE C 1 69  ? -57.037  12.221  29.000  1.00 77.34  ? 94  ILE C CG2 1 
ATOM   5176 C CD1 . ILE C 1 69  ? -56.532  13.503  31.534  1.00 92.58  ? 94  ILE C CD1 1 
ATOM   5177 N N   . PRO C 1 70  ? -57.342  13.869  25.515  1.00 93.18  ? 95  PRO C N   1 
ATOM   5178 C CA  . PRO C 1 70  ? -57.786  13.146  24.319  1.00 94.63  ? 95  PRO C CA  1 
ATOM   5179 C C   . PRO C 1 70  ? -57.108  11.791  24.165  1.00 97.09  ? 95  PRO C C   1 
ATOM   5180 O O   . PRO C 1 70  ? -55.880  11.727  24.091  1.00 90.50  ? 95  PRO C O   1 
ATOM   5181 C CB  . PRO C 1 70  ? -57.338  14.060  23.163  1.00 74.07  ? 95  PRO C CB  1 
ATOM   5182 C CG  . PRO C 1 70  ? -56.925  15.357  23.800  1.00 84.64  ? 95  PRO C CG  1 
ATOM   5183 C CD  . PRO C 1 70  ? -56.432  14.967  25.158  1.00 107.46 ? 95  PRO C CD  1 
ATOM   5184 N N   . PRO C 1 71  ? -57.901  10.711  24.167  1.00 96.92  ? 96  PRO C N   1 
ATOM   5185 C CA  . PRO C 1 71  ? -59.274  10.728  24.643  1.00 86.60  ? 96  PRO C CA  1 
ATOM   5186 C C   . PRO C 1 71  ? -59.140  10.126  26.027  1.00 111.50 ? 96  PRO C C   1 
ATOM   5187 O O   . PRO C 1 71  ? -58.068  10.281  26.622  1.00 125.97 ? 96  PRO C O   1 
ATOM   5188 C CB  . PRO C 1 71  ? -59.982  9.758   23.687  1.00 82.94  ? 96  PRO C CB  1 
ATOM   5189 C CG  . PRO C 1 71  ? -58.876  9.131   22.830  1.00 82.20  ? 96  PRO C CG  1 
ATOM   5190 C CD  . PRO C 1 71  ? -57.599  9.416   23.552  1.00 103.24 ? 96  PRO C CD  1 
ATOM   5191 N N   . GLN C 1 72  ? -60.155  9.426   26.518  1.00 111.69 ? 97  GLN C N   1 
ATOM   5192 C CA  . GLN C 1 72  ? -60.093  8.850   27.860  1.00 118.49 ? 97  GLN C CA  1 
ATOM   5193 C C   . GLN C 1 72  ? -59.873  7.339   27.816  1.00 137.89 ? 97  GLN C C   1 
ATOM   5194 O O   . GLN C 1 72  ? -60.814  6.551   27.941  1.00 118.83 ? 97  GLN C O   1 
ATOM   5195 C CB  . GLN C 1 72  ? -61.357  9.194   28.650  1.00 91.03  ? 97  GLN C CB  1 
ATOM   5196 C CG  . GLN C 1 72  ? -61.685  10.697  28.664  1.00 104.18 ? 97  GLN C CG  1 
ATOM   5197 C CD  . GLN C 1 72  ? -61.833  11.285  27.256  1.00 101.36 ? 97  GLN C CD  1 
ATOM   5198 O OE1 . GLN C 1 72  ? -61.979  10.554  26.277  1.00 69.23  ? 97  GLN C OE1 1 
ATOM   5199 N NE2 . GLN C 1 72  ? -61.809  12.609  27.158  1.00 116.33 ? 97  GLN C NE2 1 
ATOM   5200 N N   . GLU C 1 73  ? -58.611  6.954   27.651  1.00 167.59 ? 98  GLU C N   1 
ATOM   5201 C CA  . GLU C 1 73  ? -58.218  5.557   27.469  1.00 148.74 ? 98  GLU C CA  1 
ATOM   5202 C C   . GLU C 1 73  ? -58.339  4.699   28.735  1.00 151.37 ? 98  GLU C C   1 
ATOM   5203 O O   . GLU C 1 73  ? -58.581  5.210   29.838  1.00 143.91 ? 98  GLU C O   1 
ATOM   5204 C CB  . GLU C 1 73  ? -56.793  5.481   26.910  1.00 128.93 ? 98  GLU C CB  1 
ATOM   5205 N N   . ASP C 1 74  ? -58.150  3.392   28.549  1.00 158.05 ? 99  ASP C N   1 
ATOM   5206 C CA  . ASP C 1 74  ? -58.280  2.389   29.613  1.00 158.75 ? 99  ASP C CA  1 
ATOM   5207 C C   . ASP C 1 74  ? -57.196  2.480   30.703  1.00 156.08 ? 99  ASP C C   1 
ATOM   5208 O O   . ASP C 1 74  ? -57.355  3.186   31.710  1.00 111.85 ? 99  ASP C O   1 
ATOM   5209 C CB  . ASP C 1 74  ? -58.303  0.974   29.003  1.00 146.07 ? 99  ASP C CB  1 
ATOM   5210 C CG  . ASP C 1 74  ? -57.062  0.671   28.157  1.00 153.01 ? 99  ASP C CG  1 
ATOM   5211 O OD1 . ASP C 1 74  ? -56.772  -0.526  27.946  1.00 150.29 ? 99  ASP C OD1 1 
ATOM   5212 O OD2 . ASP C 1 74  ? -56.374  1.622   27.710  1.00 134.96 ? 99  ASP C OD2 1 
ATOM   5213 N N   . GLY C 1 75  ? -56.108  1.739   30.495  1.00 159.28 ? 100 GLY C N   1 
ATOM   5214 C CA  . GLY C 1 75  ? -54.935  1.812   31.343  1.00 121.62 ? 100 GLY C CA  1 
ATOM   5215 C C   . GLY C 1 75  ? -54.231  3.149   31.193  1.00 130.02 ? 100 GLY C C   1 
ATOM   5216 O O   . GLY C 1 75  ? -54.416  4.049   32.009  1.00 137.02 ? 100 GLY C O   1 
ATOM   5217 N N   . SER C 1 76  ? -53.434  3.286   30.139  1.00 115.60 ? 101 SER C N   1 
ATOM   5218 C CA  . SER C 1 76  ? -52.684  4.517   29.876  1.00 102.05 ? 101 SER C CA  1 
ATOM   5219 C C   . SER C 1 76  ? -53.564  5.756   29.627  1.00 101.63 ? 101 SER C C   1 
ATOM   5220 O O   . SER C 1 76  ? -54.760  5.633   29.367  1.00 120.29 ? 101 SER C O   1 
ATOM   5221 C CB  . SER C 1 76  ? -51.746  4.293   28.687  1.00 112.52 ? 101 SER C CB  1 
ATOM   5222 O OG  . SER C 1 76  ? -51.157  3.004   28.753  1.00 132.90 ? 101 SER C OG  1 
ATOM   5223 N N   . PHE C 1 77  ? -52.959  6.943   29.702  1.00 95.32  ? 102 PHE C N   1 
ATOM   5224 C CA  . PHE C 1 77  ? -53.673  8.210   29.478  1.00 89.70  ? 102 PHE C CA  1 
ATOM   5225 C C   . PHE C 1 77  ? -52.746  9.319   28.998  1.00 92.19  ? 102 PHE C C   1 
ATOM   5226 O O   . PHE C 1 77  ? -51.533  9.292   29.251  1.00 92.29  ? 102 PHE C O   1 
ATOM   5227 C CB  . PHE C 1 77  ? -54.348  8.695   30.759  1.00 93.07  ? 102 PHE C CB  1 
ATOM   5228 C CG  . PHE C 1 77  ? -53.380  8.997   31.865  1.00 94.27  ? 102 PHE C CG  1 
ATOM   5229 C CD1 . PHE C 1 77  ? -52.998  10.301  32.145  1.00 91.80  ? 102 PHE C CD1 1 
ATOM   5230 C CD2 . PHE C 1 77  ? -52.827  7.967   32.608  1.00 83.20  ? 102 PHE C CD2 1 
ATOM   5231 C CE1 . PHE C 1 77  ? -52.089  10.564  33.163  1.00 88.13  ? 102 PHE C CE1 1 
ATOM   5232 C CE2 . PHE C 1 77  ? -51.923  8.225   33.616  1.00 75.79  ? 102 PHE C CE2 1 
ATOM   5233 C CZ  . PHE C 1 77  ? -51.555  9.523   33.895  1.00 79.06  ? 102 PHE C CZ  1 
ATOM   5234 N N   . PHE C 1 78  ? -53.332  10.322  28.352  1.00 81.35  ? 103 PHE C N   1 
ATOM   5235 C CA  . PHE C 1 78  ? -52.539  11.327  27.661  1.00 79.51  ? 103 PHE C CA  1 
ATOM   5236 C C   . PHE C 1 78  ? -52.927  12.763  27.999  1.00 88.60  ? 103 PHE C C   1 
ATOM   5237 O O   . PHE C 1 78  ? -54.041  13.213  27.736  1.00 89.72  ? 103 PHE C O   1 
ATOM   5238 C CB  . PHE C 1 78  ? -52.618  11.110  26.161  1.00 84.35  ? 103 PHE C CB  1 
ATOM   5239 C CG  . PHE C 1 78  ? -52.151  12.276  25.369  1.00 87.19  ? 103 PHE C CG  1 
ATOM   5240 C CD1 . PHE C 1 78  ? -50.809  12.424  25.077  1.00 83.65  ? 103 PHE C CD1 1 
ATOM   5241 C CD2 . PHE C 1 78  ? -53.056  13.235  24.914  1.00 80.35  ? 103 PHE C CD2 1 
ATOM   5242 C CE1 . PHE C 1 78  ? -50.375  13.507  24.336  1.00 98.45  ? 103 PHE C CE1 1 
ATOM   5243 C CE2 . PHE C 1 78  ? -52.633  14.317  24.177  1.00 72.65  ? 103 PHE C CE2 1 
ATOM   5244 C CZ  . PHE C 1 78  ? -51.294  14.456  23.886  1.00 93.51  ? 103 PHE C CZ  1 
ATOM   5245 N N   . VAL C 1 79  ? -51.966  13.474  28.569  1.00 89.14  ? 104 VAL C N   1 
ATOM   5246 C CA  . VAL C 1 79  ? -52.170  14.819  29.066  1.00 77.90  ? 104 VAL C CA  1 
ATOM   5247 C C   . VAL C 1 79  ? -51.645  15.835  28.072  1.00 86.26  ? 104 VAL C C   1 
ATOM   5248 O O   . VAL C 1 79  ? -50.440  15.886  27.795  1.00 90.08  ? 104 VAL C O   1 
ATOM   5249 C CB  . VAL C 1 79  ? -51.427  14.997  30.389  1.00 86.07  ? 104 VAL C CB  1 
ATOM   5250 C CG1 . VAL C 1 79  ? -51.655  16.396  30.948  1.00 89.30  ? 104 VAL C CG1 1 
ATOM   5251 C CG2 . VAL C 1 79  ? -51.856  13.911  31.372  1.00 77.58  ? 104 VAL C CG2 1 
ATOM   5252 N N   . LEU C 1 80  ? -52.553  16.642  27.535  1.00 82.64  ? 105 LEU C N   1 
ATOM   5253 C CA  . LEU C 1 80  ? -52.182  17.704  26.606  1.00 82.31  ? 105 LEU C CA  1 
ATOM   5254 C C   . LEU C 1 80  ? -51.372  18.782  27.328  1.00 86.73  ? 105 LEU C C   1 
ATOM   5255 O O   . LEU C 1 80  ? -51.788  19.279  28.365  1.00 87.57  ? 105 LEU C O   1 
ATOM   5256 C CB  . LEU C 1 80  ? -53.447  18.326  26.032  1.00 82.14  ? 105 LEU C CB  1 
ATOM   5257 C CG  . LEU C 1 80  ? -53.259  19.320  24.897  1.00 86.66  ? 105 LEU C CG  1 
ATOM   5258 C CD1 . LEU C 1 80  ? -52.408  18.688  23.822  1.00 92.13  ? 105 LEU C CD1 1 
ATOM   5259 C CD2 . LEU C 1 80  ? -54.616  19.703  24.349  1.00 87.89  ? 105 LEU C CD2 1 
ATOM   5260 N N   . THR C 1 81  ? -50.225  19.156  26.770  1.00 93.13  ? 106 THR C N   1 
ATOM   5261 C CA  . THR C 1 81  ? -49.325  20.102  27.432  1.00 81.87  ? 106 THR C CA  1 
ATOM   5262 C C   . THR C 1 81  ? -48.962  21.295  26.545  1.00 85.90  ? 106 THR C C   1 
ATOM   5263 O O   . THR C 1 81  ? -48.710  22.396  27.056  1.00 84.72  ? 106 THR C O   1 
ATOM   5264 C CB  . THR C 1 81  ? -48.023  19.414  27.915  1.00 75.39  ? 106 THR C CB  1 
ATOM   5265 O OG1 . THR C 1 81  ? -47.521  18.557  26.885  1.00 71.55  ? 106 THR C OG1 1 
ATOM   5266 C CG2 . THR C 1 81  ? -48.271  18.583  29.177  1.00 75.33  ? 106 THR C CG2 1 
ATOM   5267 N N   . ASN C 1 82  ? -48.960  21.068  25.229  1.00 89.79  ? 107 ASN C N   1 
ATOM   5268 C CA  . ASN C 1 82  ? -48.618  22.090  24.245  1.00 93.33  ? 107 ASN C CA  1 
ATOM   5269 C C   . ASN C 1 82  ? -49.400  21.860  22.946  1.00 90.23  ? 107 ASN C C   1 
ATOM   5270 O O   . ASN C 1 82  ? -49.925  20.766  22.714  1.00 87.31  ? 107 ASN C O   1 
ATOM   5271 C CB  . ASN C 1 82  ? -47.112  22.056  23.976  1.00 94.45  ? 107 ASN C CB  1 
ATOM   5272 C CG  . ASN C 1 82  ? -46.518  23.435  23.791  1.00 101.60 ? 107 ASN C CG  1 
ATOM   5273 O OD1 . ASN C 1 82  ? -47.196  24.450  23.978  1.00 112.07 ? 107 ASN C OD1 1 
ATOM   5274 N ND2 . ASN C 1 82  ? -45.236  23.480  23.427  1.00 90.89  ? 107 ASN C ND2 1 
ATOM   5275 N N   . MET C 1 83  ? -49.454  22.871  22.082  1.00 94.85  ? 108 MET C N   1 
ATOM   5276 C CA  . MET C 1 83  ? -50.319  22.787  20.901  1.00 97.80  ? 108 MET C CA  1 
ATOM   5277 C C   . MET C 1 83  ? -50.107  23.865  19.825  1.00 102.83 ? 108 MET C C   1 
ATOM   5278 O O   . MET C 1 83  ? -49.577  24.949  20.098  1.00 106.20 ? 108 MET C O   1 
ATOM   5279 C CB  . MET C 1 83  ? -51.758  22.894  21.373  1.00 99.32  ? 108 MET C CB  1 
ATOM   5280 C CG  . MET C 1 83  ? -51.930  24.042  22.340  1.00 90.11  ? 108 MET C CG  1 
ATOM   5281 S SD  . MET C 1 83  ? -53.643  24.317  22.735  1.00 123.95 ? 108 MET C SD  1 
ATOM   5282 C CE  . MET C 1 83  ? -54.043  22.751  23.545  1.00 96.40  ? 108 MET C CE  1 
ATOM   5283 N N   . ILE C 1 84  ? -50.557  23.561  18.608  1.00 94.15  ? 109 ILE C N   1 
ATOM   5284 C CA  . ILE C 1 84  ? -50.552  24.517  17.509  1.00 93.59  ? 109 ILE C CA  1 
ATOM   5285 C C   . ILE C 1 84  ? -51.899  24.407  16.827  1.00 98.90  ? 109 ILE C C   1 
ATOM   5286 O O   . ILE C 1 84  ? -52.175  23.432  16.115  1.00 93.55  ? 109 ILE C O   1 
ATOM   5287 C CB  . ILE C 1 84  ? -49.454  24.205  16.481  1.00 96.67  ? 109 ILE C CB  1 
ATOM   5288 C CG1 . ILE C 1 84  ? -48.092  24.073  17.174  1.00 95.86  ? 109 ILE C CG1 1 
ATOM   5289 C CG2 . ILE C 1 84  ? -49.413  25.280  15.398  1.00 90.68  ? 109 ILE C CG2 1 
ATOM   5290 C CD1 . ILE C 1 84  ? -46.964  23.708  16.239  1.00 88.46  ? 109 ILE C CD1 1 
ATOM   5291 N N   . ILE C 1 85  ? -52.733  25.414  17.052  1.00 89.27  ? 110 ILE C N   1 
ATOM   5292 C CA  . ILE C 1 85  ? -54.130  25.352  16.659  1.00 95.42  ? 110 ILE C CA  1 
ATOM   5293 C C   . ILE C 1 85  ? -54.410  26.014  15.311  1.00 94.20  ? 110 ILE C C   1 
ATOM   5294 O O   . ILE C 1 85  ? -54.192  27.212  15.152  1.00 117.55 ? 110 ILE C O   1 
ATOM   5295 C CB  . ILE C 1 85  ? -55.009  25.999  17.748  1.00 101.14 ? 110 ILE C CB  1 
ATOM   5296 C CG1 . ILE C 1 85  ? -54.786  25.296  19.093  1.00 91.64  ? 110 ILE C CG1 1 
ATOM   5297 C CG2 . ILE C 1 85  ? -56.479  25.982  17.337  1.00 88.82  ? 110 ILE C CG2 1 
ATOM   5298 C CD1 . ILE C 1 85  ? -55.564  25.889  20.237  1.00 100.49 ? 110 ILE C CD1 1 
ATOM   5299 N N   . THR C 1 86  ? -54.883  25.226  14.348  1.00 94.13  ? 111 THR C N   1 
ATOM   5300 C CA  . THR C 1 86  ? -55.288  25.747  13.044  1.00 97.52  ? 111 THR C CA  1 
ATOM   5301 C C   . THR C 1 86  ? -56.807  25.806  12.981  1.00 93.03  ? 111 THR C C   1 
ATOM   5302 O O   . THR C 1 86  ? -57.469  24.793  13.178  1.00 111.35 ? 111 THR C O   1 
ATOM   5303 C CB  . THR C 1 86  ? -54.766  24.860  11.894  1.00 105.52 ? 111 THR C CB  1 
ATOM   5304 O OG1 . THR C 1 86  ? -53.386  24.526  12.115  1.00 107.60 ? 111 THR C OG1 1 
ATOM   5305 C CG2 . THR C 1 86  ? -54.915  25.573  10.558  1.00 101.85 ? 111 THR C CG2 1 
ATOM   5306 N N   . THR C 1 87  ? -57.365  26.987  12.732  1.00 98.09  ? 112 THR C N   1 
ATOM   5307 C CA  . THR C 1 87  ? -58.822  27.160  12.794  1.00 114.63 ? 112 THR C CA  1 
ATOM   5308 C C   . THR C 1 87  ? -59.521  27.419  11.458  1.00 112.25 ? 112 THR C C   1 
ATOM   5309 O O   . THR C 1 87  ? -58.874  27.641  10.443  1.00 124.34 ? 112 THR C O   1 
ATOM   5310 C CB  . THR C 1 87  ? -59.189  28.295  13.760  1.00 105.41 ? 112 THR C CB  1 
ATOM   5311 O OG1 . THR C 1 87  ? -58.436  29.468  13.415  1.00 116.28 ? 112 THR C OG1 1 
ATOM   5312 C CG2 . THR C 1 87  ? -58.854  27.890  15.185  1.00 83.53  ? 112 THR C CG2 1 
ATOM   5313 N N   . ASN C 1 88  ? -60.850  27.409  11.479  1.00 99.46  ? 113 ASN C N   1 
ATOM   5314 C CA  . ASN C 1 88  ? -61.635  27.751  10.300  1.00 116.04 ? 113 ASN C CA  1 
ATOM   5315 C C   . ASN C 1 88  ? -61.222  26.938  9.082   1.00 121.89 ? 113 ASN C C   1 
ATOM   5316 O O   . ASN C 1 88  ? -61.218  27.455  7.962   1.00 120.52 ? 113 ASN C O   1 
ATOM   5317 C CB  . ASN C 1 88  ? -61.514  29.252  9.992   1.00 120.76 ? 113 ASN C CB  1 
ATOM   5318 C CG  . ASN C 1 88  ? -62.587  29.751  9.013   1.00 149.29 ? 113 ASN C CG  1 
ATOM   5319 O OD1 . ASN C 1 88  ? -63.765  29.398  9.140   1.00 135.61 ? 113 ASN C OD1 1 
ATOM   5320 N ND2 . ASN C 1 88  ? -62.184  30.599  8.048   1.00 166.05 ? 113 ASN C ND2 1 
ATOM   5321 N N   . GLN C 1 89  ? -60.860  25.674  9.294   1.00 109.09 ? 114 GLN C N   1 
ATOM   5322 C CA  . GLN C 1 89  ? -60.545  24.796  8.174   1.00 103.82 ? 114 GLN C CA  1 
ATOM   5323 C C   . GLN C 1 89  ? -61.823  24.364  7.460   1.00 118.88 ? 114 GLN C C   1 
ATOM   5324 O O   . GLN C 1 89  ? -62.843  24.108  8.106   1.00 109.15 ? 114 GLN C O   1 
ATOM   5325 C CB  . GLN C 1 89  ? -59.721  23.581  8.624   1.00 92.68  ? 114 GLN C CB  1 
ATOM   5326 C CG  . GLN C 1 89  ? -58.251  23.877  8.821   1.00 95.16  ? 114 GLN C CG  1 
ATOM   5327 C CD  . GLN C 1 89  ? -57.406  22.619  8.912   1.00 97.20  ? 114 GLN C CD  1 
ATOM   5328 O OE1 . GLN C 1 89  ? -57.903  21.547  9.241   1.00 80.91  ? 114 GLN C OE1 1 
ATOM   5329 N NE2 . GLN C 1 89  ? -56.119  22.749  8.620   1.00 100.46 ? 114 GLN C NE2 1 
ATOM   5330 N N   . THR C 1 90  ? -61.756  24.297  6.130   1.00 127.33 ? 115 THR C N   1 
ATOM   5331 C CA  . THR C 1 90  ? -62.886  23.899  5.301   1.00 110.93 ? 115 THR C CA  1 
ATOM   5332 C C   . THR C 1 90  ? -62.346  23.166  4.084   1.00 115.89 ? 115 THR C C   1 
ATOM   5333 O O   . THR C 1 90  ? -61.207  23.399  3.664   1.00 110.90 ? 115 THR C O   1 
ATOM   5334 C CB  . THR C 1 90  ? -63.690  25.113  4.808   1.00 107.58 ? 115 THR C CB  1 
ATOM   5335 O OG1 . THR C 1 90  ? -62.841  25.950  4.015   1.00 111.80 ? 115 THR C OG1 1 
ATOM   5336 C CG2 . THR C 1 90  ? -64.229  25.915  5.975   1.00 108.64 ? 115 THR C CG2 1 
ATOM   5337 N N   . GLN C 1 91  ? -63.161  22.277  3.522   1.00 119.04 ? 116 GLN C N   1 
ATOM   5338 C CA  . GLN C 1 91  ? -62.794  21.589  2.290   1.00 122.76 ? 116 GLN C CA  1 
ATOM   5339 C C   . GLN C 1 91  ? -62.680  22.603  1.148   1.00 129.43 ? 116 GLN C C   1 
ATOM   5340 O O   . GLN C 1 91  ? -63.673  23.242  0.772   1.00 123.09 ? 116 GLN C O   1 
ATOM   5341 C CB  . GLN C 1 91  ? -63.825  20.510  1.952   1.00 101.02 ? 116 GLN C CB  1 
ATOM   5342 C CG  . GLN C 1 91  ? -63.793  19.311  2.879   1.00 96.59  ? 116 GLN C CG  1 
ATOM   5343 C CD  . GLN C 1 91  ? -62.596  18.402  2.639   1.00 111.84 ? 116 GLN C CD  1 
ATOM   5344 O OE1 . GLN C 1 91  ? -61.859  18.557  1.664   1.00 116.90 ? 116 GLN C OE1 1 
ATOM   5345 N NE2 . GLN C 1 91  ? -62.402  17.441  3.534   1.00 111.34 ? 116 GLN C NE2 1 
ATOM   5346 N N   . SER C 1 92  ? -61.471  22.744  0.601   1.00 116.81 ? 117 SER C N   1 
ATOM   5347 C CA  . SER C 1 92  ? -61.197  23.768  -0.403  1.00 111.53 ? 117 SER C CA  1 
ATOM   5348 C C   . SER C 1 92  ? -59.834  23.541  -1.062  1.00 117.78 ? 117 SER C C   1 
ATOM   5349 O O   . SER C 1 92  ? -59.099  22.631  -0.679  1.00 111.10 ? 117 SER C O   1 
ATOM   5350 C CB  . SER C 1 92  ? -61.243  25.159  0.241   1.00 105.82 ? 117 SER C CB  1 
ATOM   5351 O OG  . SER C 1 92  ? -61.038  26.176  -0.722  1.00 131.68 ? 117 SER C OG  1 
ATOM   5352 N N   . LYS C 1 93  ? -59.499  24.366  -2.054  1.00 111.62 ? 118 LYS C N   1 
ATOM   5353 C CA  . LYS C 1 93  ? -58.163  24.358  -2.655  1.00 106.68 ? 118 LYS C CA  1 
ATOM   5354 C C   . LYS C 1 93  ? -57.332  25.536  -2.116  1.00 113.54 ? 118 LYS C C   1 
ATOM   5355 O O   . LYS C 1 93  ? -57.900  26.513  -1.625  1.00 107.05 ? 118 LYS C O   1 
ATOM   5356 C CB  . LYS C 1 93  ? -58.274  24.410  -4.176  1.00 103.84 ? 118 LYS C CB  1 
ATOM   5357 N N   . CYS C 1 94  ? -56.001  25.448  -2.190  1.00 109.35 ? 119 CYS C N   1 
ATOM   5358 C CA  . CYS C 1 94  ? -55.118  26.516  -1.688  1.00 112.08 ? 119 CYS C CA  1 
ATOM   5359 C C   . CYS C 1 94  ? -53.643  26.195  -1.901  1.00 124.05 ? 119 CYS C C   1 
ATOM   5360 O O   . CYS C 1 94  ? -53.299  25.082  -2.299  1.00 130.11 ? 119 CYS C O   1 
ATOM   5361 C CB  . CYS C 1 94  ? -55.353  26.748  -0.198  1.00 118.41 ? 119 CYS C CB  1 
ATOM   5362 S SG  . CYS C 1 94  ? -55.006  25.282  0.825   1.00 150.06 ? 119 CYS C SG  1 
ATOM   5363 N N   . ALA C 1 95  ? -52.773  27.161  -1.610  1.00 114.50 ? 120 ALA C N   1 
ATOM   5364 C CA  . ALA C 1 95  ? -51.342  26.995  -1.851  1.00 125.19 ? 120 ALA C CA  1 
ATOM   5365 C C   . ALA C 1 95  ? -50.668  26.085  -0.833  1.00 125.01 ? 120 ALA C C   1 
ATOM   5366 O O   . ALA C 1 95  ? -50.949  26.175  0.360   1.00 130.15 ? 120 ALA C O   1 
ATOM   5367 C CB  . ALA C 1 95  ? -50.657  28.344  -1.872  1.00 114.21 ? 120 ALA C CB  1 
ATOM   5368 N N   . GLU C 1 96  ? -49.779  25.214  -1.303  1.00 112.46 ? 121 GLU C N   1 
ATOM   5369 C CA  . GLU C 1 96  ? -48.973  24.418  -0.392  1.00 114.63 ? 121 GLU C CA  1 
ATOM   5370 C C   . GLU C 1 96  ? -48.052  25.339  0.386   1.00 131.13 ? 121 GLU C C   1 
ATOM   5371 O O   . GLU C 1 96  ? -48.047  26.551  0.172   1.00 125.83 ? 121 GLU C O   1 
ATOM   5372 C CB  . GLU C 1 96  ? -48.148  23.379  -1.144  1.00 107.57 ? 121 GLU C CB  1 
ATOM   5373 C CG  . GLU C 1 96  ? -48.863  22.071  -1.390  1.00 118.53 ? 121 GLU C CG  1 
ATOM   5374 C CD  . GLU C 1 96  ? -47.930  20.997  -1.915  1.00 138.99 ? 121 GLU C CD  1 
ATOM   5375 O OE1 . GLU C 1 96  ? -48.199  19.795  -1.705  1.00 125.57 ? 121 GLU C OE1 1 
ATOM   5376 O OE2 . GLU C 1 96  ? -46.913  21.360  -2.533  1.00 158.28 ? 121 GLU C OE2 1 
ATOM   5377 N N   . ASN C 1 97  ? -47.285  24.763  1.303   1.00 135.35 ? 122 ASN C N   1 
ATOM   5378 C CA  . ASN C 1 97  ? -46.266  25.522  2.013   1.00 145.25 ? 122 ASN C CA  1 
ATOM   5379 C C   . ASN C 1 97  ? -44.987  25.583  1.185   1.00 156.00 ? 122 ASN C C   1 
ATOM   5380 O O   . ASN C 1 97  ? -44.647  24.614  0.502   1.00 154.95 ? 122 ASN C O   1 
ATOM   5381 C CB  . ASN C 1 97  ? -45.997  24.915  3.390   1.00 142.09 ? 122 ASN C CB  1 
ATOM   5382 C CG  . ASN C 1 97  ? -47.132  25.159  4.365   1.00 152.83 ? 122 ASN C CG  1 
ATOM   5383 O OD1 . ASN C 1 97  ? -47.765  26.219  4.354   1.00 142.77 ? 122 ASN C OD1 1 
ATOM   5384 N ND2 . ASN C 1 97  ? -47.398  24.175  5.215   1.00 150.33 ? 122 ASN C ND2 1 
ATOM   5385 N N   . PRO C 1 98  ? -44.282  26.729  1.225   1.00 158.65 ? 123 PRO C N   1 
ATOM   5386 C CA  . PRO C 1 98  ? -43.030  26.889  0.477   1.00 140.95 ? 123 PRO C CA  1 
ATOM   5387 C C   . PRO C 1 98  ? -42.012  25.793  0.804   1.00 136.55 ? 123 PRO C C   1 
ATOM   5388 O O   . PRO C 1 98  ? -41.653  25.596  1.967   1.00 124.30 ? 123 PRO C O   1 
ATOM   5389 C CB  . PRO C 1 98  ? -42.521  28.255  0.945   1.00 142.06 ? 123 PRO C CB  1 
ATOM   5390 C CG  . PRO C 1 98  ? -43.750  28.997  1.325   1.00 134.90 ? 123 PRO C CG  1 
ATOM   5391 C CD  . PRO C 1 98  ? -44.669  27.969  1.922   1.00 146.77 ? 123 PRO C CD  1 
ATOM   5392 N N   . THR C 1 99  ? -41.553  25.097  -0.233  1.00 136.75 ? 124 THR C N   1 
ATOM   5393 C CA  . THR C 1 99  ? -40.629  23.976  -0.086  1.00 140.14 ? 124 THR C CA  1 
ATOM   5394 C C   . THR C 1 99  ? -40.025  23.636  -1.443  1.00 151.08 ? 124 THR C C   1 
ATOM   5395 O O   . THR C 1 99  ? -40.724  23.671  -2.454  1.00 154.47 ? 124 THR C O   1 
ATOM   5396 C CB  . THR C 1 99  ? -41.349  22.725  0.453   1.00 135.96 ? 124 THR C CB  1 
ATOM   5397 O OG1 . THR C 1 99  ? -41.578  22.875  1.859   1.00 141.08 ? 124 THR C OG1 1 
ATOM   5398 C CG2 . THR C 1 99  ? -40.515  21.466  0.210   1.00 127.14 ? 124 THR C CG2 1 
ATOM   5399 N N   . PRO C 1 100 ? -38.723  23.305  -1.471  1.00 153.83 ? 125 PRO C N   1 
ATOM   5400 C CA  . PRO C 1 100 ? -38.030  22.931  -2.711  1.00 149.18 ? 125 PRO C CA  1 
ATOM   5401 C C   . PRO C 1 100 ? -38.841  21.946  -3.554  1.00 160.84 ? 125 PRO C C   1 
ATOM   5402 O O   . PRO C 1 100 ? -38.851  22.062  -4.783  1.00 150.71 ? 125 PRO C O   1 
ATOM   5403 C CB  . PRO C 1 100 ? -36.765  22.244  -2.200  1.00 146.49 ? 125 PRO C CB  1 
ATOM   5404 C CG  . PRO C 1 100 ? -36.490  22.913  -0.890  1.00 155.73 ? 125 PRO C CG  1 
ATOM   5405 C CD  . PRO C 1 100 ? -37.825  23.286  -0.301  1.00 142.26 ? 125 PRO C CD  1 
ATOM   5406 N N   . ALA C 1 101 ? -39.512  20.999  -2.897  1.00 170.02 ? 126 ALA C N   1 
ATOM   5407 C CA  . ALA C 1 101 ? -40.314  19.995  -3.592  1.00 158.42 ? 126 ALA C CA  1 
ATOM   5408 C C   . ALA C 1 101 ? -41.677  20.541  -4.037  1.00 145.99 ? 126 ALA C C   1 
ATOM   5409 O O   . ALA C 1 101 ? -42.231  20.094  -5.044  1.00 120.88 ? 126 ALA C O   1 
ATOM   5410 C CB  . ALA C 1 101 ? -40.486  18.755  -2.719  1.00 128.68 ? 126 ALA C CB  1 
ATOM   5411 N N   . SER C 1 102 ? -42.196  21.513  -3.287  1.00 148.86 ? 127 SER C N   1 
ATOM   5412 C CA  . SER C 1 102 ? -43.520  22.083  -3.532  1.00 149.00 ? 127 SER C CA  1 
ATOM   5413 C C   . SER C 1 102 ? -43.517  23.301  -4.452  1.00 152.88 ? 127 SER C C   1 
ATOM   5414 O O   . SER C 1 102 ? -44.510  23.572  -5.131  1.00 142.70 ? 127 SER C O   1 
ATOM   5415 C CB  . SER C 1 102 ? -44.161  22.481  -2.206  1.00 156.11 ? 127 SER C CB  1 
ATOM   5416 O OG  . SER C 1 102 ? -43.496  23.603  -1.651  1.00 154.82 ? 127 SER C OG  1 
ATOM   5417 N N   . THR C 1 103 ? -42.415  24.047  -4.445  1.00 160.57 ? 128 THR C N   1 
ATOM   5418 C CA  . THR C 1 103 ? -42.298  25.263  -5.244  1.00 151.65 ? 128 THR C CA  1 
ATOM   5419 C C   . THR C 1 103 ? -42.468  24.985  -6.732  1.00 146.37 ? 128 THR C C   1 
ATOM   5420 O O   . THR C 1 103 ? -42.052  23.933  -7.231  1.00 136.70 ? 128 THR C O   1 
ATOM   5421 C CB  . THR C 1 103 ? -40.933  25.945  -5.046  1.00 150.70 ? 128 THR C CB  1 
ATOM   5422 O OG1 . THR C 1 103 ? -40.687  26.145  -3.648  1.00 142.75 ? 128 THR C OG1 1 
ATOM   5423 C CG2 . THR C 1 103 ? -40.902  27.287  -5.770  1.00 147.29 ? 128 THR C CG2 1 
ATOM   5424 N N   . CYS C 1 104 ? -43.055  25.943  -7.441  1.00 138.55 ? 129 CYS C N   1 
ATOM   5425 C CA  . CYS C 1 104 ? -43.319  25.771  -8.857  1.00 145.91 ? 129 CYS C CA  1 
ATOM   5426 C C   . CYS C 1 104 ? -43.119  27.078  -9.606  1.00 168.24 ? 129 CYS C C   1 
ATOM   5427 O O   . CYS C 1 104 ? -43.335  28.164  -9.057  1.00 160.85 ? 129 CYS C O   1 
ATOM   5428 C CB  . CYS C 1 104 ? -44.758  25.310  -9.059  1.00 146.78 ? 129 CYS C CB  1 
ATOM   5429 S SG  . CYS C 1 104 ? -45.960  26.645  -8.782  1.00 163.01 ? 129 CYS C SG  1 
ATOM   5430 N N   . THR C 1 105 ? -42.716  26.954  -10.868 1.00 170.08 ? 130 THR C N   1 
ATOM   5431 C CA  . THR C 1 105 ? -42.556  28.094  -11.762 1.00 161.48 ? 130 THR C CA  1 
ATOM   5432 C C   . THR C 1 105 ? -43.840  28.370  -12.548 1.00 155.30 ? 130 THR C C   1 
ATOM   5433 O O   . THR C 1 105 ? -44.122  29.511  -12.914 1.00 130.33 ? 130 THR C O   1 
ATOM   5434 C CB  . THR C 1 105 ? -41.406  27.856  -12.760 1.00 156.93 ? 130 THR C CB  1 
ATOM   5435 O OG1 . THR C 1 105 ? -41.702  26.706  -13.563 1.00 163.26 ? 130 THR C OG1 1 
ATOM   5436 C CG2 . THR C 1 105 ? -40.090  27.632  -12.018 1.00 128.57 ? 130 THR C CG2 1 
ATOM   5437 N N   . SER C 1 106 ? -44.617  27.320  -12.800 1.00 167.26 ? 131 SER C N   1 
ATOM   5438 C CA  . SER C 1 106 ? -45.834  27.438  -13.597 1.00 170.93 ? 131 SER C CA  1 
ATOM   5439 C C   . SER C 1 106 ? -46.676  26.166  -13.582 1.00 171.66 ? 131 SER C C   1 
ATOM   5440 O O   . SER C 1 106 ? -46.340  25.184  -12.917 1.00 160.27 ? 131 SER C O   1 
ATOM   5441 C CB  . SER C 1 106 ? -45.481  27.767  -15.044 1.00 179.66 ? 131 SER C CB  1 
ATOM   5442 O OG  . SER C 1 106 ? -44.777  26.688  -15.639 1.00 184.48 ? 131 SER C OG  1 
ATOM   5443 N N   . HIS C 1 107 ? -47.762  26.197  -14.347 1.00 174.26 ? 132 HIS C N   1 
ATOM   5444 C CA  . HIS C 1 107 ? -48.704  25.086  -14.433 1.00 174.67 ? 132 HIS C CA  1 
ATOM   5445 C C   . HIS C 1 107 ? -48.032  23.751  -14.767 1.00 158.22 ? 132 HIS C C   1 
ATOM   5446 O O   . HIS C 1 107 ? -48.586  22.682  -14.500 1.00 153.70 ? 132 HIS C O   1 
ATOM   5447 C CB  . HIS C 1 107 ? -49.783  25.408  -15.471 1.00 165.11 ? 132 HIS C CB  1 
ATOM   5448 C CG  . HIS C 1 107 ? -50.461  26.727  -15.242 1.00 187.19 ? 132 HIS C CG  1 
ATOM   5449 N ND1 . HIS C 1 107 ? -49.877  27.929  -15.573 1.00 156.23 ? 132 HIS C ND1 1 
ATOM   5450 C CD2 . HIS C 1 107 ? -51.670  27.026  -14.711 1.00 188.91 ? 132 HIS C CD2 1 
ATOM   5451 C CE1 . HIS C 1 107 ? -50.699  28.916  -15.257 1.00 146.66 ? 132 HIS C CE1 1 
ATOM   5452 N NE2 . HIS C 1 107 ? -51.792  28.396  -14.733 1.00 179.84 ? 132 HIS C NE2 1 
ATOM   5453 N N   . ARG C 1 108 ? -46.837  23.818  -15.346 1.00 162.14 ? 133 ARG C N   1 
ATOM   5454 C CA  . ARG C 1 108 ? -46.131  22.620  -15.792 1.00 160.57 ? 133 ARG C CA  1 
ATOM   5455 C C   . ARG C 1 108 ? -45.568  21.785  -14.637 1.00 151.62 ? 133 ARG C C   1 
ATOM   5456 O O   . ARG C 1 108 ? -45.528  20.556  -14.715 1.00 148.17 ? 133 ARG C O   1 
ATOM   5457 C CB  . ARG C 1 108 ? -45.024  22.989  -16.781 1.00 153.00 ? 133 ARG C CB  1 
ATOM   5458 N N   . ASP C 1 109 ? -45.131  22.448  -13.571 1.00 152.18 ? 134 ASP C N   1 
ATOM   5459 C CA  . ASP C 1 109 ? -44.521  21.749  -12.437 1.00 166.59 ? 134 ASP C CA  1 
ATOM   5460 C C   . ASP C 1 109 ? -45.540  20.983  -11.578 1.00 162.60 ? 134 ASP C C   1 
ATOM   5461 O O   . ASP C 1 109 ? -45.241  19.907  -11.048 1.00 144.71 ? 134 ASP C O   1 
ATOM   5462 C CB  . ASP C 1 109 ? -43.739  22.730  -11.556 1.00 170.97 ? 134 ASP C CB  1 
ATOM   5463 C CG  . ASP C 1 109 ? -42.684  23.502  -12.326 1.00 161.21 ? 134 ASP C CG  1 
ATOM   5464 O OD1 . ASP C 1 109 ? -42.902  23.778  -13.527 1.00 154.99 ? 134 ASP C OD1 1 
ATOM   5465 O OD2 . ASP C 1 109 ? -41.639  23.838  -11.722 1.00 157.18 ? 134 ASP C OD2 1 
ATOM   5466 N N   . CYS C 1 110 ? -46.737  21.548  -11.440 1.00 156.43 ? 135 CYS C N   1 
ATOM   5467 C CA  . CYS C 1 110 ? -47.803  20.928  -10.660 1.00 137.68 ? 135 CYS C CA  1 
ATOM   5468 C C   . CYS C 1 110 ? -48.482  19.785  -11.415 1.00 148.88 ? 135 CYS C C   1 
ATOM   5469 O O   . CYS C 1 110 ? -49.154  20.014  -12.426 1.00 147.76 ? 135 CYS C O   1 
ATOM   5470 C CB  . CYS C 1 110 ? -48.851  21.974  -10.278 1.00 144.74 ? 135 CYS C CB  1 
ATOM   5471 S SG  . CYS C 1 110 ? -48.307  23.232  -9.107  1.00 169.65 ? 135 CYS C SG  1 
ATOM   5472 N N   . LYS C 1 111 ? -48.323  18.564  -10.907 1.00 143.79 ? 136 LYS C N   1 
ATOM   5473 C CA  . LYS C 1 111 ? -49.028  17.394  -11.441 1.00 141.11 ? 136 LYS C CA  1 
ATOM   5474 C C   . LYS C 1 111 ? -50.241  17.025  -10.571 1.00 154.21 ? 136 LYS C C   1 
ATOM   5475 O O   . LYS C 1 111 ? -50.114  16.880  -9.351  1.00 176.96 ? 136 LYS C O   1 
ATOM   5476 C CB  . LYS C 1 111 ? -48.077  16.211  -11.554 1.00 104.28 ? 136 LYS C CB  1 
ATOM   5477 N N   . ARG C 1 112 ? -51.410  16.868  -11.191 1.00 138.80 ? 137 ARG C N   1 
ATOM   5478 C CA  . ARG C 1 112 ? -52.631  16.546  -10.449 1.00 150.97 ? 137 ARG C CA  1 
ATOM   5479 C C   . ARG C 1 112 ? -52.588  15.151  -9.797  1.00 163.88 ? 137 ARG C C   1 
ATOM   5480 O O   . ARG C 1 112 ? -52.439  14.137  -10.484 1.00 135.91 ? 137 ARG C O   1 
ATOM   5481 C CB  . ARG C 1 112 ? -53.868  16.700  -11.347 1.00 91.10  ? 137 ARG C CB  1 
ATOM   5482 N N   . GLY C 1 113 ? -52.719  15.120  -8.468  1.00 142.06 ? 138 GLY C N   1 
ATOM   5483 C CA  . GLY C 1 113 ? -52.681  13.889  -7.691  1.00 104.77 ? 138 GLY C CA  1 
ATOM   5484 C C   . GLY C 1 113 ? -51.341  13.541  -7.050  1.00 130.75 ? 138 GLY C C   1 
ATOM   5485 O O   . GLY C 1 113 ? -51.277  13.211  -5.867  1.00 125.27 ? 138 GLY C O   1 
ATOM   5486 N N   . PHE C 1 114 ? -50.264  13.612  -7.825  1.00 151.66 ? 139 PHE C N   1 
ATOM   5487 C CA  . PHE C 1 114 ? -48.965  13.094  -7.388  1.00 160.28 ? 139 PHE C CA  1 
ATOM   5488 C C   . PHE C 1 114 ? -48.240  14.023  -6.425  1.00 141.99 ? 139 PHE C C   1 
ATOM   5489 O O   . PHE C 1 114 ? -47.739  13.596  -5.383  1.00 133.87 ? 139 PHE C O   1 
ATOM   5490 C CB  . PHE C 1 114 ? -48.086  12.793  -8.597  1.00 160.03 ? 139 PHE C CB  1 
ATOM   5491 N N   . ASN C 1 115 ? -48.172  15.297  -6.796  1.00 155.94 ? 140 ASN C N   1 
ATOM   5492 C CA  . ASN C 1 115 ? -47.585  16.317  -5.935  1.00 175.26 ? 140 ASN C CA  1 
ATOM   5493 C C   . ASN C 1 115 ? -48.454  16.491  -4.691  1.00 201.40 ? 140 ASN C C   1 
ATOM   5494 O O   . ASN C 1 115 ? -48.109  17.248  -3.772  1.00 196.31 ? 140 ASN C O   1 
ATOM   5495 C CB  . ASN C 1 115 ? -47.444  17.638  -6.681  1.00 129.37 ? 140 ASN C CB  1 
ATOM   5496 N N   . ASP C 1 116 ? -49.577  15.771  -4.677  1.00 199.15 ? 141 ASP C N   1 
ATOM   5497 C CA  . ASP C 1 116 ? -50.523  15.780  -3.564  1.00 180.52 ? 141 ASP C CA  1 
ATOM   5498 C C   . ASP C 1 116 ? -49.982  15.120  -2.293  1.00 173.11 ? 141 ASP C C   1 
ATOM   5499 O O   . ASP C 1 116 ? -49.799  15.781  -1.272  1.00 153.28 ? 141 ASP C O   1 
ATOM   5500 C CB  . ASP C 1 116 ? -51.807  15.108  -3.984  1.00 130.39 ? 141 ASP C CB  1 
ATOM   5501 N N   . ALA C 1 117 ? -49.726  13.817  -2.361  1.00 155.64 ? 142 ALA C N   1 
ATOM   5502 C CA  . ALA C 1 117 ? -49.225  13.060  -1.211  1.00 162.32 ? 142 ALA C CA  1 
ATOM   5503 C C   . ALA C 1 117 ? -48.262  13.818  -0.256  1.00 169.11 ? 142 ALA C C   1 
ATOM   5504 O O   . ALA C 1 117 ? -48.385  13.713  0.968   1.00 128.38 ? 142 ALA C O   1 
ATOM   5505 C CB  . ALA C 1 117 ? -48.594  11.750  -1.691  1.00 123.71 ? 142 ALA C CB  1 
ATOM   5506 N N   . ARG C 1 118 ? -47.322  14.589  -0.802  1.00 175.57 ? 143 ARG C N   1 
ATOM   5507 C CA  . ARG C 1 118 ? -46.249  15.195  0.014   1.00 189.40 ? 143 ARG C CA  1 
ATOM   5508 C C   . ARG C 1 118 ? -46.673  16.240  1.082   1.00 180.36 ? 143 ARG C C   1 
ATOM   5509 O O   . ARG C 1 118 ? -46.457  16.047  2.294   1.00 108.89 ? 143 ARG C O   1 
ATOM   5510 C CB  . ARG C 1 118 ? -45.144  15.773  -0.899  1.00 137.51 ? 143 ARG C CB  1 
ATOM   5511 N N   . GLY C 1 119 ? -47.257  17.347  0.632   1.00 176.48 ? 144 GLY C N   1 
ATOM   5512 C CA  . GLY C 1 119 ? -47.536  18.466  1.518   1.00 142.85 ? 144 GLY C CA  1 
ATOM   5513 C C   . GLY C 1 119 ? -48.866  18.468  2.260   1.00 133.99 ? 144 GLY C C   1 
ATOM   5514 O O   . GLY C 1 119 ? -49.410  19.543  2.531   1.00 127.87 ? 144 GLY C O   1 
ATOM   5515 N N   . ASP C 1 120 ? -49.399  17.292  2.593   1.00 139.05 ? 145 ASP C N   1 
ATOM   5516 C CA  . ASP C 1 120 ? -50.657  17.201  3.358   1.00 128.72 ? 145 ASP C CA  1 
ATOM   5517 C C   . ASP C 1 120 ? -51.859  17.885  2.692   1.00 115.04 ? 145 ASP C C   1 
ATOM   5518 O O   . ASP C 1 120 ? -52.549  18.703  3.304   1.00 86.12  ? 145 ASP C O   1 
ATOM   5519 C CB  . ASP C 1 120 ? -50.467  17.720  4.779   1.00 104.98 ? 145 ASP C CB  1 
ATOM   5520 N N   . GLY C 1 121 ? -52.088  17.533  1.432   1.00 117.19 ? 146 GLY C N   1 
ATOM   5521 C CA  . GLY C 1 121 ? -53.193  18.042  0.637   1.00 108.33 ? 146 GLY C CA  1 
ATOM   5522 C C   . GLY C 1 121 ? -53.015  17.505  -0.775  1.00 123.33 ? 146 GLY C C   1 
ATOM   5523 O O   . GLY C 1 121 ? -51.882  17.258  -1.197  1.00 130.56 ? 146 GLY C O   1 
ATOM   5524 N N   . VAL C 1 122 ? -54.112  17.297  -1.504  1.00 125.43 ? 147 VAL C N   1 
ATOM   5525 C CA  . VAL C 1 122 ? -53.996  16.769  -2.861  1.00 113.15 ? 147 VAL C CA  1 
ATOM   5526 C C   . VAL C 1 122 ? -53.871  17.871  -3.901  1.00 123.76 ? 147 VAL C C   1 
ATOM   5527 O O   . VAL C 1 122 ? -54.699  18.784  -3.959  1.00 106.22 ? 147 VAL C O   1 
ATOM   5528 C CB  . VAL C 1 122 ? -55.129  15.794  -3.202  1.00 71.24  ? 147 VAL C CB  1 
ATOM   5529 N N   . ARG C 1 123 ? -52.819  17.762  -4.714  1.00 140.52 ? 148 ARG C N   1 
ATOM   5530 C CA  . ARG C 1 123 ? -52.463  18.775  -5.696  1.00 131.05 ? 148 ARG C CA  1 
ATOM   5531 C C   . ARG C 1 123 ? -53.376  18.710  -6.900  1.00 132.55 ? 148 ARG C C   1 
ATOM   5532 O O   . ARG C 1 123 ? -53.572  17.651  -7.491  1.00 128.99 ? 148 ARG C O   1 
ATOM   5533 C CB  . ARG C 1 123 ? -51.005  18.617  -6.135  1.00 103.38 ? 148 ARG C CB  1 
ATOM   5534 N N   . THR C 1 124 ? -53.957  19.847  -7.245  1.00 118.99 ? 149 THR C N   1 
ATOM   5535 C CA  . THR C 1 124 ? -54.608  19.990  -8.528  1.00 118.01 ? 149 THR C CA  1 
ATOM   5536 C C   . THR C 1 124 ? -53.530  20.544  -9.457  1.00 148.02 ? 149 THR C C   1 
ATOM   5537 O O   . THR C 1 124 ? -52.624  21.246  -8.997  1.00 156.05 ? 149 THR C O   1 
ATOM   5538 C CB  . THR C 1 124 ? -55.818  20.934  -8.422  1.00 118.77 ? 149 THR C CB  1 
ATOM   5539 O OG1 . THR C 1 124 ? -56.190  21.402  -9.723  1.00 160.23 ? 149 THR C OG1 1 
ATOM   5540 C CG2 . THR C 1 124 ? -55.499  22.118  -7.530  1.00 94.23  ? 149 THR C CG2 1 
ATOM   5541 N N   . GLY C 1 125 ? -53.602  20.211  -10.744 1.00 148.33 ? 150 GLY C N   1 
ATOM   5542 C CA  . GLY C 1 125 ? -52.588  20.632  -11.699 1.00 157.93 ? 150 GLY C CA  1 
ATOM   5543 C C   . GLY C 1 125 ? -52.231  22.113  -11.654 1.00 163.60 ? 150 GLY C C   1 
ATOM   5544 O O   . GLY C 1 125 ? -51.109  22.501  -12.001 1.00 155.76 ? 150 GLY C O   1 
ATOM   5545 N N   . ARG C 1 126 ? -53.185  22.935  -11.222 1.00 163.03 ? 151 ARG C N   1 
ATOM   5546 C CA  . ARG C 1 126 ? -53.001  24.384  -11.141 1.00 144.18 ? 151 ARG C CA  1 
ATOM   5547 C C   . ARG C 1 126 ? -51.804  24.803  -10.270 1.00 153.25 ? 151 ARG C C   1 
ATOM   5548 O O   . ARG C 1 126 ? -51.514  24.181  -9.242  1.00 128.39 ? 151 ARG C O   1 
ATOM   5549 C CB  . ARG C 1 126 ? -54.290  25.049  -10.645 1.00 90.60  ? 151 ARG C CB  1 
ATOM   5550 N N   . CYS C 1 127 ? -51.104  25.854  -10.702 1.00 167.65 ? 152 CYS C N   1 
ATOM   5551 C CA  . CYS C 1 127 ? -50.058  26.479  -9.886  1.00 159.75 ? 152 CYS C CA  1 
ATOM   5552 C C   . CYS C 1 127 ? -50.478  27.868  -9.412  1.00 150.21 ? 152 CYS C C   1 
ATOM   5553 O O   . CYS C 1 127 ? -50.887  28.719  -10.212 1.00 131.78 ? 152 CYS C O   1 
ATOM   5554 C CB  . CYS C 1 127 ? -48.735  26.588  -10.650 1.00 162.20 ? 152 CYS C CB  1 
ATOM   5555 S SG  . CYS C 1 127 ? -47.468  27.578  -9.784  1.00 153.12 ? 152 CYS C SG  1 
ATOM   5556 N N   . VAL C 1 128 ? -50.351  28.104  -8.112  1.00 145.67 ? 153 VAL C N   1 
ATOM   5557 C CA  . VAL C 1 128 ? -50.777  29.374  -7.537  1.00 149.26 ? 153 VAL C CA  1 
ATOM   5558 C C   . VAL C 1 128 ? -49.714  29.983  -6.643  1.00 144.27 ? 153 VAL C C   1 
ATOM   5559 O O   . VAL C 1 128 ? -48.760  29.319  -6.237  1.00 133.93 ? 153 VAL C O   1 
ATOM   5560 C CB  . VAL C 1 128 ? -52.063  29.227  -6.704  1.00 135.88 ? 153 VAL C CB  1 
ATOM   5561 C CG1 . VAL C 1 128 ? -53.260  28.950  -7.607  1.00 127.13 ? 153 VAL C CG1 1 
ATOM   5562 C CG2 . VAL C 1 128 ? -51.885  28.134  -5.645  1.00 130.58 ? 153 VAL C CG2 1 
ATOM   5563 N N   . SER C 1 129 ? -49.902  31.260  -6.342  1.00 138.18 ? 154 SER C N   1 
ATOM   5564 C CA  . SER C 1 129 ? -48.974  32.002  -5.518  1.00 143.25 ? 154 SER C CA  1 
ATOM   5565 C C   . SER C 1 129 ? -49.273  31.762  -4.049  1.00 144.08 ? 154 SER C C   1 
ATOM   5566 O O   . SER C 1 129 ? -50.405  31.941  -3.602  1.00 122.59 ? 154 SER C O   1 
ATOM   5567 C CB  . SER C 1 129 ? -49.098  33.486  -5.838  1.00 149.47 ? 154 SER C CB  1 
ATOM   5568 O OG  . SER C 1 129 ? -50.454  33.883  -5.756  1.00 138.04 ? 154 SER C OG  1 
ATOM   5569 N N   . TYR C 1 130 ? -48.252  31.350  -3.307  1.00 146.77 ? 155 TYR C N   1 
ATOM   5570 C CA  . TYR C 1 130 ? -48.345  31.221  -1.858  1.00 147.92 ? 155 TYR C CA  1 
ATOM   5571 C C   . TYR C 1 130 ? -48.372  32.615  -1.236  1.00 143.67 ? 155 TYR C C   1 
ATOM   5572 O O   . TYR C 1 130 ? -48.870  32.825  -0.123  1.00 118.51 ? 155 TYR C O   1 
ATOM   5573 C CB  . TYR C 1 130 ? -47.150  30.418  -1.340  1.00 147.56 ? 155 TYR C CB  1 
ATOM   5574 C CG  . TYR C 1 130 ? -46.978  30.461  0.155   1.00 144.01 ? 155 TYR C CG  1 
ATOM   5575 C CD1 . TYR C 1 130 ? -46.053  31.309  0.739   1.00 149.54 ? 155 TYR C CD1 1 
ATOM   5576 C CD2 . TYR C 1 130 ? -47.746  29.654  0.983   1.00 150.04 ? 155 TYR C CD2 1 
ATOM   5577 C CE1 . TYR C 1 130 ? -45.894  31.355  2.106   1.00 164.56 ? 155 TYR C CE1 1 
ATOM   5578 C CE2 . TYR C 1 130 ? -47.595  29.691  2.357   1.00 155.17 ? 155 TYR C CE2 1 
ATOM   5579 C CZ  . TYR C 1 130 ? -46.665  30.544  2.913   1.00 164.27 ? 155 TYR C CZ  1 
ATOM   5580 O OH  . TYR C 1 130 ? -46.507  30.585  4.282   1.00 150.73 ? 155 TYR C OH  1 
ATOM   5581 N N   . SER C 1 131 ? -47.833  33.564  -1.992  1.00 163.45 ? 156 SER C N   1 
ATOM   5582 C CA  . SER C 1 131 ? -47.764  34.966  -1.606  1.00 163.49 ? 156 SER C CA  1 
ATOM   5583 C C   . SER C 1 131 ? -47.376  35.759  -2.852  1.00 171.59 ? 156 SER C C   1 
ATOM   5584 O O   . SER C 1 131 ? -47.287  35.197  -3.948  1.00 171.42 ? 156 SER C O   1 
ATOM   5585 C CB  . SER C 1 131 ? -46.710  35.176  -0.514  1.00 157.95 ? 156 SER C CB  1 
ATOM   5586 O OG  . SER C 1 131 ? -45.397  34.967  -1.022  1.00 138.58 ? 156 SER C OG  1 
ATOM   5587 N N   . ALA C 1 132 ? -47.144  37.058  -2.693  1.00 172.69 ? 157 ALA C N   1 
ATOM   5588 C CA  . ALA C 1 132 ? -46.742  37.894  -3.822  1.00 165.03 ? 157 ALA C CA  1 
ATOM   5589 C C   . ALA C 1 132 ? -45.368  37.502  -4.387  1.00 165.74 ? 157 ALA C C   1 
ATOM   5590 O O   . ALA C 1 132 ? -45.199  37.397  -5.607  1.00 132.93 ? 157 ALA C O   1 
ATOM   5591 C CB  . ALA C 1 132 ? -46.764  39.363  -3.429  1.00 136.76 ? 157 ALA C CB  1 
ATOM   5592 N N   . SER C 1 133 ? -44.398  37.281  -3.498  1.00 166.88 ? 158 SER C N   1 
ATOM   5593 C CA  . SER C 1 133 ? -43.011  37.014  -3.898  1.00 160.42 ? 158 SER C CA  1 
ATOM   5594 C C   . SER C 1 133 ? -42.747  35.590  -4.383  1.00 168.07 ? 158 SER C C   1 
ATOM   5595 O O   . SER C 1 133 ? -41.824  35.366  -5.167  1.00 145.86 ? 158 SER C O   1 
ATOM   5596 C CB  . SER C 1 133 ? -42.045  37.337  -2.755  1.00 156.37 ? 158 SER C CB  1 
ATOM   5597 O OG  . SER C 1 133 ? -42.069  38.714  -2.437  1.00 159.00 ? 158 SER C OG  1 
ATOM   5598 N N   . VAL C 1 134 ? -43.542  34.635  -3.907  1.00 176.03 ? 159 VAL C N   1 
ATOM   5599 C CA  . VAL C 1 134 ? -43.334  33.228  -4.244  1.00 166.81 ? 159 VAL C CA  1 
ATOM   5600 C C   . VAL C 1 134 ? -44.618  32.530  -4.687  1.00 153.54 ? 159 VAL C C   1 
ATOM   5601 O O   . VAL C 1 134 ? -45.724  32.999  -4.414  1.00 137.70 ? 159 VAL C O   1 
ATOM   5602 C CB  . VAL C 1 134 ? -42.728  32.437  -3.064  1.00 151.43 ? 159 VAL C CB  1 
ATOM   5603 C CG1 . VAL C 1 134 ? -41.293  32.873  -2.804  1.00 134.81 ? 159 VAL C CG1 1 
ATOM   5604 C CG2 . VAL C 1 134 ? -43.585  32.601  -1.820  1.00 148.43 ? 159 VAL C CG2 1 
ATOM   5605 N N   . LYS C 1 135 ? -44.451  31.400  -5.368  1.00 159.83 ? 160 LYS C N   1 
ATOM   5606 C CA  . LYS C 1 135 ? -45.577  30.634  -5.887  1.00 159.05 ? 160 LYS C CA  1 
ATOM   5607 C C   . LYS C 1 135 ? -45.302  29.139  -5.768  1.00 160.38 ? 160 LYS C C   1 
ATOM   5608 O O   . LYS C 1 135 ? -44.174  28.681  -5.977  1.00 137.39 ? 160 LYS C O   1 
ATOM   5609 C CB  . LYS C 1 135 ? -45.869  31.017  -7.340  1.00 130.99 ? 160 LYS C CB  1 
ATOM   5610 N N   . THR C 1 136 ? -46.351  28.388  -5.442  1.00 161.48 ? 161 THR C N   1 
ATOM   5611 C CA  . THR C 1 136 ? -46.240  26.960  -5.183  1.00 152.70 ? 161 THR C CA  1 
ATOM   5612 C C   . THR C 1 136 ? -47.535  26.234  -5.564  1.00 147.02 ? 161 THR C C   1 
ATOM   5613 O O   . THR C 1 136 ? -48.587  26.856  -5.729  1.00 132.42 ? 161 THR C O   1 
ATOM   5614 C CB  . THR C 1 136 ? -45.911  26.697  -3.700  1.00 141.14 ? 161 THR C CB  1 
ATOM   5615 O OG1 . THR C 1 136 ? -45.477  25.342  -3.526  1.00 129.60 ? 161 THR C OG1 1 
ATOM   5616 C CG2 . THR C 1 136 ? -47.130  26.970  -2.836  1.00 127.50 ? 161 THR C CG2 1 
ATOM   5617 N N   . CYS C 1 137 ? -47.443  24.913  -5.698  1.00 152.87 ? 162 CYS C N   1 
ATOM   5618 C CA  . CYS C 1 137 ? -48.553  24.084  -6.171  1.00 139.41 ? 162 CYS C CA  1 
ATOM   5619 C C   . CYS C 1 137 ? -49.834  24.181  -5.340  1.00 143.06 ? 162 CYS C C   1 
ATOM   5620 O O   . CYS C 1 137 ? -49.819  24.038  -4.113  1.00 131.40 ? 162 CYS C O   1 
ATOM   5621 C CB  . CYS C 1 137 ? -48.117  22.616  -6.272  1.00 123.52 ? 162 CYS C CB  1 
ATOM   5622 S SG  . CYS C 1 137 ? -47.154  22.236  -7.751  1.00 195.82 ? 162 CYS C SG  1 
ATOM   5623 N N   . GLU C 1 138 ? -50.947  24.413  -6.027  1.00 146.16 ? 163 GLU C N   1 
ATOM   5624 C CA  . GLU C 1 138 ? -52.254  24.403  -5.387  1.00 125.68 ? 163 GLU C CA  1 
ATOM   5625 C C   . GLU C 1 138 ? -52.673  22.986  -5.015  1.00 130.62 ? 163 GLU C C   1 
ATOM   5626 O O   . GLU C 1 138 ? -52.498  22.037  -5.793  1.00 109.16 ? 163 GLU C O   1 
ATOM   5627 C CB  . GLU C 1 138 ? -53.312  25.014  -6.302  1.00 121.49 ? 163 GLU C CB  1 
ATOM   5628 C CG  . GLU C 1 138 ? -54.716  24.952  -5.725  1.00 117.83 ? 163 GLU C CG  1 
ATOM   5629 C CD  . GLU C 1 138 ? -55.784  25.402  -6.701  1.00 123.88 ? 163 GLU C CD  1 
ATOM   5630 O OE1 . GLU C 1 138 ? -56.687  26.148  -6.273  1.00 114.94 ? 163 GLU C OE1 1 
ATOM   5631 O OE2 . GLU C 1 138 ? -55.724  25.017  -7.889  1.00 126.85 ? 163 GLU C OE2 1 
ATOM   5632 N N   . VAL C 1 139 ? -53.245  22.859  -3.823  1.00 129.78 ? 164 VAL C N   1 
ATOM   5633 C CA  . VAL C 1 139 ? -53.712  21.579  -3.330  1.00 119.39 ? 164 VAL C CA  1 
ATOM   5634 C C   . VAL C 1 139 ? -55.090  21.748  -2.718  1.00 111.11 ? 164 VAL C C   1 
ATOM   5635 O O   . VAL C 1 139 ? -55.371  22.753  -2.057  1.00 98.48  ? 164 VAL C O   1 
ATOM   5636 C CB  . VAL C 1 139 ? -52.755  21.007  -2.270  1.00 109.61 ? 164 VAL C CB  1 
ATOM   5637 C CG1 . VAL C 1 139 ? -51.383  20.762  -2.877  1.00 118.02 ? 164 VAL C CG1 1 
ATOM   5638 C CG2 . VAL C 1 139 ? -52.660  21.949  -1.083  1.00 112.82 ? 164 VAL C CG2 1 
ATOM   5639 N N   . LEU C 1 140 ? -55.965  20.783  -2.976  1.00 103.93 ? 165 LEU C N   1 
ATOM   5640 C CA  . LEU C 1 140 ? -57.213  20.733  -2.249  1.00 110.17 ? 165 LEU C CA  1 
ATOM   5641 C C   . LEU C 1 140 ? -56.914  19.944  -0.979  1.00 115.41 ? 165 LEU C C   1 
ATOM   5642 O O   . LEU C 1 140 ? -56.057  19.051  -0.980  1.00 87.45  ? 165 LEU C O   1 
ATOM   5643 C CB  . LEU C 1 140 ? -58.336  20.138  -3.099  1.00 92.25  ? 165 LEU C CB  1 
ATOM   5644 C CG  . LEU C 1 140 ? -58.115  18.778  -3.745  1.00 102.68 ? 165 LEU C CG  1 
ATOM   5645 C CD1 . LEU C 1 140 ? -58.410  17.688  -2.726  1.00 144.54 ? 165 LEU C CD1 1 
ATOM   5646 C CD2 . LEU C 1 140 ? -59.008  18.623  -4.964  1.00 106.41 ? 165 LEU C CD2 1 
ATOM   5647 N N   . SER C 1 141 ? -57.592  20.303  0.107   1.00 116.85 ? 166 SER C N   1 
ATOM   5648 C CA  . SER C 1 141 ? -57.209  19.849  1.439   1.00 110.04 ? 166 SER C CA  1 
ATOM   5649 C C   . SER C 1 141 ? -58.091  20.566  2.456   1.00 112.16 ? 166 SER C C   1 
ATOM   5650 O O   . SER C 1 141 ? -59.040  21.266  2.083   1.00 107.95 ? 166 SER C O   1 
ATOM   5651 C CB  . SER C 1 141 ? -55.724  20.165  1.692   1.00 102.28 ? 166 SER C CB  1 
ATOM   5652 O OG  . SER C 1 141 ? -55.351  20.032  3.057   1.00 96.77  ? 166 SER C OG  1 
ATOM   5653 N N   . TRP C 1 142 ? -57.792  20.378  3.737   1.00 113.88 ? 167 TRP C N   1 
ATOM   5654 C CA  . TRP C 1 142 ? -58.411  21.174  4.783   1.00 104.01 ? 167 TRP C CA  1 
ATOM   5655 C C   . TRP C 1 142 ? -57.686  22.511  4.823   1.00 107.85 ? 167 TRP C C   1 
ATOM   5656 O O   . TRP C 1 142 ? -56.499  22.564  5.148   1.00 108.56 ? 167 TRP C O   1 
ATOM   5657 C CB  . TRP C 1 142 ? -58.295  20.469  6.137   1.00 100.81 ? 167 TRP C CB  1 
ATOM   5658 C CG  . TRP C 1 142 ? -59.317  19.363  6.375   1.00 103.71 ? 167 TRP C CG  1 
ATOM   5659 C CD1 . TRP C 1 142 ? -59.073  18.020  6.406   1.00 110.49 ? 167 TRP C CD1 1 
ATOM   5660 C CD2 . TRP C 1 142 ? -60.723  19.511  6.627   1.00 91.95  ? 167 TRP C CD2 1 
ATOM   5661 N NE1 . TRP C 1 142 ? -60.232  17.327  6.654   1.00 102.22 ? 167 TRP C NE1 1 
ATOM   5662 C CE2 . TRP C 1 142 ? -61.262  18.225  6.790   1.00 90.78  ? 167 TRP C CE2 1 
ATOM   5663 C CE3 . TRP C 1 142 ? -61.581  20.610  6.724   1.00 104.02 ? 167 TRP C CE3 1 
ATOM   5664 C CZ2 . TRP C 1 142 ? -62.605  18.000  7.045   1.00 105.65 ? 167 TRP C CZ2 1 
ATOM   5665 C CZ3 . TRP C 1 142 ? -62.921  20.381  6.979   1.00 103.00 ? 167 TRP C CZ3 1 
ATOM   5666 C CH2 . TRP C 1 142 ? -63.416  19.091  7.136   1.00 100.31 ? 167 TRP C CH2 1 
ATOM   5667 N N   . CYS C 1 143 ? -58.406  23.586  4.507   1.00 105.55 ? 168 CYS C N   1 
ATOM   5668 C CA  . CYS C 1 143 ? -57.800  24.902  4.311   1.00 111.52 ? 168 CYS C CA  1 
ATOM   5669 C C   . CYS C 1 143 ? -58.431  25.972  5.189   1.00 108.17 ? 168 CYS C C   1 
ATOM   5670 O O   . CYS C 1 143 ? -59.644  25.976  5.385   1.00 112.83 ? 168 CYS C O   1 
ATOM   5671 C CB  . CYS C 1 143 ? -57.916  25.326  2.843   1.00 111.05 ? 168 CYS C CB  1 
ATOM   5672 S SG  . CYS C 1 143 ? -56.672  24.583  1.762   1.00 133.12 ? 168 CYS C SG  1 
ATOM   5673 N N   . PRO C 1 144 ? -57.614  26.916  5.684   1.00 101.78 ? 169 PRO C N   1 
ATOM   5674 C CA  . PRO C 1 144 ? -56.194  27.103  5.351   1.00 105.01 ? 169 PRO C CA  1 
ATOM   5675 C C   . PRO C 1 144 ? -55.275  26.016  5.916   1.00 103.22 ? 169 PRO C C   1 
ATOM   5676 O O   . PRO C 1 144 ? -55.596  25.462  6.967   1.00 92.52  ? 169 PRO C O   1 
ATOM   5677 C CB  . PRO C 1 144 ? -55.860  28.459  5.991   1.00 112.86 ? 169 PRO C CB  1 
ATOM   5678 C CG  . PRO C 1 144 ? -57.182  29.057  6.405   1.00 111.17 ? 169 PRO C CG  1 
ATOM   5679 C CD  . PRO C 1 144 ? -58.069  27.901  6.675   1.00 102.34 ? 169 PRO C CD  1 
ATOM   5680 N N   . LEU C 1 145 ? -54.174  25.708  5.202   1.00 112.36 ? 170 LEU C N   1 
ATOM   5681 C CA  . LEU C 1 145 ? -53.173  24.719  5.640   1.00 110.52 ? 170 LEU C CA  1 
ATOM   5682 C C   . LEU C 1 145 ? -52.712  25.011  7.056   1.00 110.88 ? 170 LEU C C   1 
ATOM   5683 O O   . LEU C 1 145 ? -52.928  26.105  7.579   1.00 100.93 ? 170 LEU C O   1 
ATOM   5684 C CB  . LEU C 1 145 ? -51.948  24.691  4.704   1.00 111.54 ? 170 LEU C CB  1 
ATOM   5685 C CG  . LEU C 1 145 ? -51.848  23.553  3.688   1.00 112.07 ? 170 LEU C CG  1 
ATOM   5686 C CD1 . LEU C 1 145 ? -51.836  22.191  4.400   1.00 101.13 ? 170 LEU C CD1 1 
ATOM   5687 C CD2 . LEU C 1 145 ? -52.977  23.653  2.664   1.00 107.06 ? 170 LEU C CD2 1 
ATOM   5688 N N   . GLU C 1 146 ? -52.083  24.026  7.682   1.00 107.04 ? 171 GLU C N   1 
ATOM   5689 C CA  . GLU C 1 146 ? -51.484  24.258  8.979   1.00 104.43 ? 171 GLU C CA  1 
ATOM   5690 C C   . GLU C 1 146 ? -50.160  24.966  8.762   1.00 113.82 ? 171 GLU C C   1 
ATOM   5691 O O   . GLU C 1 146 ? -49.301  24.464  8.033   1.00 112.71 ? 171 GLU C O   1 
ATOM   5692 C CB  . GLU C 1 146 ? -51.246  22.939  9.696   1.00 119.55 ? 171 GLU C CB  1 
ATOM   5693 C CG  . GLU C 1 146 ? -50.569  23.109  11.039  1.00 125.74 ? 171 GLU C CG  1 
ATOM   5694 C CD  . GLU C 1 146 ? -50.329  21.781  11.740  1.00 126.80 ? 171 GLU C CD  1 
ATOM   5695 O OE1 . GLU C 1 146 ? -51.114  20.831  11.506  1.00 129.33 ? 171 GLU C OE1 1 
ATOM   5696 O OE2 . GLU C 1 146 ? -49.356  21.689  12.523  1.00 115.93 ? 171 GLU C OE2 1 
ATOM   5697 N N   . LYS C 1 147 ? -49.991  26.132  9.384   1.00 130.99 ? 172 LYS C N   1 
ATOM   5698 C CA  . LYS C 1 147 ? -48.726  26.857  9.270   1.00 138.24 ? 172 LYS C CA  1 
ATOM   5699 C C   . LYS C 1 147 ? -47.591  25.963  9.746   1.00 129.28 ? 172 LYS C C   1 
ATOM   5700 O O   . LYS C 1 147 ? -47.751  25.172  10.680  1.00 97.48  ? 172 LYS C O   1 
ATOM   5701 C CB  . LYS C 1 147 ? -48.736  28.159  10.079  1.00 102.60 ? 172 LYS C CB  1 
ATOM   5702 C CG  . LYS C 1 147 ? -49.677  29.220  9.537   1.00 120.21 ? 172 LYS C CG  1 
ATOM   5703 C CD  . LYS C 1 147 ? -49.728  30.436  10.451  1.00 135.40 ? 172 LYS C CD  1 
ATOM   5704 C CE  . LYS C 1 147 ? -50.881  31.371  10.085  1.00 126.57 ? 172 LYS C CE  1 
ATOM   5705 N NZ  . LYS C 1 147 ? -51.046  32.470  11.082  1.00 120.54 ? 172 LYS C NZ  1 
ATOM   5706 N N   . ILE C 1 148 ? -46.445  26.069  9.090   1.00 118.14 ? 173 ILE C N   1 
ATOM   5707 C CA  . ILE C 1 148 ? -45.278  25.340  9.563   1.00 121.13 ? 173 ILE C CA  1 
ATOM   5708 C C   . ILE C 1 148 ? -44.524  26.190  10.571  1.00 112.72 ? 173 ILE C C   1 
ATOM   5709 O O   . ILE C 1 148 ? -43.798  27.111  10.199  1.00 110.36 ? 173 ILE C O   1 
ATOM   5710 C CB  . ILE C 1 148 ? -44.340  24.925  8.420   1.00 123.79 ? 173 ILE C CB  1 
ATOM   5711 C CG1 . ILE C 1 148 ? -45.003  23.847  7.556   1.00 146.20 ? 173 ILE C CG1 1 
ATOM   5712 C CG2 . ILE C 1 148 ? -43.020  24.410  8.987   1.00 101.99 ? 173 ILE C CG2 1 
ATOM   5713 C CD1 . ILE C 1 148 ? -44.131  23.337  6.410   1.00 156.02 ? 173 ILE C CD1 1 
ATOM   5714 N N   . VAL C 1 149 ? -44.701  25.878  11.850  1.00 113.57 ? 174 VAL C N   1 
ATOM   5715 C CA  . VAL C 1 149 ? -44.113  26.682  12.921  1.00 101.12 ? 174 VAL C CA  1 
ATOM   5716 C C   . VAL C 1 149 ? -43.751  25.790  14.099  1.00 94.14  ? 174 VAL C C   1 
ATOM   5717 O O   . VAL C 1 149 ? -44.273  24.680  14.230  1.00 105.71 ? 174 VAL C O   1 
ATOM   5718 C CB  . VAL C 1 149 ? -45.062  27.821  13.393  1.00 95.85  ? 174 VAL C CB  1 
ATOM   5719 C CG1 . VAL C 1 149 ? -45.621  28.607  12.184  1.00 93.11  ? 174 VAL C CG1 1 
ATOM   5720 C CG2 . VAL C 1 149 ? -46.183  27.267  14.272  1.00 91.38  ? 174 VAL C CG2 1 
ATOM   5721 N N   . ASP C 1 150 ? -42.837  26.260  14.939  1.00 105.91 ? 175 ASP C N   1 
ATOM   5722 C CA  . ASP C 1 150 ? -42.445  25.486  16.111  1.00 128.21 ? 175 ASP C CA  1 
ATOM   5723 C C   . ASP C 1 150 ? -43.484  25.635  17.236  1.00 100.93 ? 175 ASP C C   1 
ATOM   5724 O O   . ASP C 1 150 ? -44.251  26.601  17.262  1.00 84.74  ? 175 ASP C O   1 
ATOM   5725 C CB  . ASP C 1 150 ? -41.023  25.854  16.565  1.00 133.74 ? 175 ASP C CB  1 
ATOM   5726 C CG  . ASP C 1 150 ? -39.953  25.449  15.541  1.00 138.91 ? 175 ASP C CG  1 
ATOM   5727 O OD1 . ASP C 1 150 ? -38.817  25.973  15.610  1.00 131.95 ? 175 ASP C OD1 1 
ATOM   5728 O OD2 . ASP C 1 150 ? -40.247  24.607  14.660  1.00 134.17 ? 175 ASP C OD2 1 
ATOM   5729 N N   . PRO C 1 151 ? -43.537  24.652  18.148  1.00 95.48  ? 176 PRO C N   1 
ATOM   5730 C CA  . PRO C 1 151 ? -44.519  24.708  19.234  1.00 95.48  ? 176 PRO C CA  1 
ATOM   5731 C C   . PRO C 1 151 ? -44.129  25.785  20.230  1.00 105.49 ? 176 PRO C C   1 
ATOM   5732 O O   . PRO C 1 151 ? -42.935  26.048  20.387  1.00 110.01 ? 176 PRO C O   1 
ATOM   5733 C CB  . PRO C 1 151 ? -44.391  23.335  19.912  1.00 104.19 ? 176 PRO C CB  1 
ATOM   5734 C CG  . PRO C 1 151 ? -43.521  22.512  19.022  1.00 129.51 ? 176 PRO C CG  1 
ATOM   5735 C CD  . PRO C 1 151 ? -42.667  23.472  18.254  1.00 115.49 ? 176 PRO C CD  1 
ATOM   5736 N N   . PRO C 1 152 ? -45.118  26.388  20.906  1.00 106.98 ? 177 PRO C N   1 
ATOM   5737 C CA  . PRO C 1 152 ? -44.856  27.457  21.876  1.00 101.85 ? 177 PRO C CA  1 
ATOM   5738 C C   . PRO C 1 152 ? -43.932  27.004  22.991  1.00 99.34  ? 177 PRO C C   1 
ATOM   5739 O O   . PRO C 1 152 ? -43.894  25.822  23.353  1.00 93.94  ? 177 PRO C O   1 
ATOM   5740 C CB  . PRO C 1 152 ? -46.243  27.768  22.440  1.00 89.50  ? 177 PRO C CB  1 
ATOM   5741 C CG  . PRO C 1 152 ? -47.189  27.348  21.357  1.00 104.14 ? 177 PRO C CG  1 
ATOM   5742 C CD  . PRO C 1 152 ? -46.560  26.137  20.730  1.00 100.17 ? 177 PRO C CD  1 
ATOM   5743 N N   . ASN C 1 153 ? -43.181  27.962  23.519  1.00 104.10 ? 178 ASN C N   1 
ATOM   5744 C CA  . ASN C 1 153 ? -42.313  27.722  24.657  1.00 106.11 ? 178 ASN C CA  1 
ATOM   5745 C C   . ASN C 1 153 ? -42.222  28.975  25.520  1.00 109.56 ? 178 ASN C C   1 
ATOM   5746 O O   . ASN C 1 153 ? -41.877  30.048  25.022  1.00 105.25 ? 178 ASN C O   1 
ATOM   5747 C CB  . ASN C 1 153 ? -40.919  27.297  24.204  1.00 83.51  ? 178 ASN C CB  1 
ATOM   5748 C CG  . ASN C 1 153 ? -40.102  26.684  25.330  1.00 90.78  ? 178 ASN C CG  1 
ATOM   5749 O OD1 . ASN C 1 153 ? -40.258  27.038  26.503  1.00 98.72  ? 178 ASN C OD1 1 
ATOM   5750 N ND2 . ASN C 1 153 ? -39.217  25.759  24.974  1.00 86.67  ? 178 ASN C ND2 1 
ATOM   5751 N N   . PRO C 1 154 ? -42.537  28.846  26.822  1.00 109.88 ? 179 PRO C N   1 
ATOM   5752 C CA  . PRO C 1 154 ? -42.951  27.607  27.502  1.00 109.39 ? 179 PRO C CA  1 
ATOM   5753 C C   . PRO C 1 154 ? -44.261  27.019  26.940  1.00 109.56 ? 179 PRO C C   1 
ATOM   5754 O O   . PRO C 1 154 ? -44.941  27.679  26.139  1.00 105.65 ? 179 PRO C O   1 
ATOM   5755 C CB  . PRO C 1 154 ? -43.131  28.053  28.963  1.00 104.24 ? 179 PRO C CB  1 
ATOM   5756 C CG  . PRO C 1 154 ? -42.302  29.284  29.092  1.00 100.49 ? 179 PRO C CG  1 
ATOM   5757 C CD  . PRO C 1 154 ? -42.448  29.976  27.762  1.00 105.42 ? 179 PRO C CD  1 
ATOM   5758 N N   . PRO C 1 155 ? -44.602  25.781  27.344  1.00 98.85  ? 180 PRO C N   1 
ATOM   5759 C CA  . PRO C 1 155 ? -45.834  25.127  26.882  1.00 96.14  ? 180 PRO C CA  1 
ATOM   5760 C C   . PRO C 1 155 ? -47.069  25.880  27.367  1.00 99.36  ? 180 PRO C C   1 
ATOM   5761 O O   . PRO C 1 155 ? -47.034  26.461  28.453  1.00 99.73  ? 180 PRO C O   1 
ATOM   5762 C CB  . PRO C 1 155 ? -45.779  23.752  27.559  1.00 87.26  ? 180 PRO C CB  1 
ATOM   5763 C CG  . PRO C 1 155 ? -44.379  23.590  28.034  1.00 91.63  ? 180 PRO C CG  1 
ATOM   5764 C CD  . PRO C 1 155 ? -43.879  24.956  28.325  1.00 92.21  ? 180 PRO C CD  1 
ATOM   5765 N N   . LEU C 1 156 ? -48.144  25.870  26.587  1.00 90.13  ? 181 LEU C N   1 
ATOM   5766 C CA  . LEU C 1 156 ? -49.353  26.576  27.000  1.00 95.13  ? 181 LEU C CA  1 
ATOM   5767 C C   . LEU C 1 156 ? -49.942  25.932  28.238  1.00 97.27  ? 181 LEU C C   1 
ATOM   5768 O O   . LEU C 1 156 ? -50.274  26.614  29.218  1.00 109.12 ? 181 LEU C O   1 
ATOM   5769 C CB  . LEU C 1 156 ? -50.408  26.570  25.905  1.00 86.75  ? 181 LEU C CB  1 
ATOM   5770 C CG  . LEU C 1 156 ? -50.162  27.549  24.778  1.00 76.40  ? 181 LEU C CG  1 
ATOM   5771 C CD1 . LEU C 1 156 ? -48.770  27.297  24.248  1.00 90.19  ? 181 LEU C CD1 1 
ATOM   5772 C CD2 . LEU C 1 156 ? -51.212  27.390  23.679  1.00 92.67  ? 181 LEU C CD2 1 
ATOM   5773 N N   . LEU C 1 157 ? -50.087  24.612  28.181  1.00 78.42  ? 182 LEU C N   1 
ATOM   5774 C CA  . LEU C 1 157 ? -50.615  23.866  29.310  1.00 100.30 ? 182 LEU C CA  1 
ATOM   5775 C C   . LEU C 1 157 ? -49.474  23.547  30.276  1.00 98.23  ? 182 LEU C C   1 
ATOM   5776 O O   . LEU C 1 157 ? -49.314  22.400  30.713  1.00 86.60  ? 182 LEU C O   1 
ATOM   5777 C CB  . LEU C 1 157 ? -51.357  22.599  28.844  1.00 93.14  ? 182 LEU C CB  1 
ATOM   5778 C CG  . LEU C 1 157 ? -52.754  22.708  28.197  1.00 78.35  ? 182 LEU C CG  1 
ATOM   5779 C CD1 . LEU C 1 157 ? -53.758  23.434  29.084  1.00 73.63  ? 182 LEU C CD1 1 
ATOM   5780 C CD2 . LEU C 1 157 ? -52.719  23.346  26.813  1.00 89.65  ? 182 LEU C CD2 1 
ATOM   5781 N N   . ALA C 1 158 ? -48.679  24.571  30.591  1.00 97.69  ? 183 ALA C N   1 
ATOM   5782 C CA  . ALA C 1 158 ? -47.547  24.409  31.494  1.00 86.73  ? 183 ALA C CA  1 
ATOM   5783 C C   . ALA C 1 158 ? -48.023  24.131  32.912  1.00 87.49  ? 183 ALA C C   1 
ATOM   5784 O O   . ALA C 1 158 ? -47.276  23.571  33.722  1.00 83.44  ? 183 ALA C O   1 
ATOM   5785 C CB  . ALA C 1 158 ? -46.620  25.631  31.449  1.00 90.96  ? 183 ALA C CB  1 
ATOM   5786 N N   . ASP C 1 159 ? -49.270  24.508  33.195  1.00 86.08  ? 184 ASP C N   1 
ATOM   5787 C CA  . ASP C 1 159 ? -49.875  24.269  34.500  1.00 94.84  ? 184 ASP C CA  1 
ATOM   5788 C C   . ASP C 1 159 ? -50.035  22.774  34.764  1.00 98.98  ? 184 ASP C C   1 
ATOM   5789 O O   . ASP C 1 159 ? -50.406  22.349  35.869  1.00 83.53  ? 184 ASP C O   1 
ATOM   5790 C CB  . ASP C 1 159 ? -51.230  24.961  34.576  1.00 95.06  ? 184 ASP C CB  1 
ATOM   5791 C CG  . ASP C 1 159 ? -51.113  26.461  34.806  1.00 122.71 ? 184 ASP C CG  1 
ATOM   5792 O OD1 . ASP C 1 159 ? -50.177  26.901  35.519  1.00 122.20 ? 184 ASP C OD1 1 
ATOM   5793 O OD2 . ASP C 1 159 ? -51.974  27.201  34.279  1.00 115.25 ? 184 ASP C OD2 1 
ATOM   5794 N N   . ALA C 1 160 ? -49.736  21.990  33.731  1.00 99.04  ? 185 ALA C N   1 
ATOM   5795 C CA  . ALA C 1 160 ? -49.861  20.538  33.753  1.00 80.93  ? 185 ALA C CA  1 
ATOM   5796 C C   . ALA C 1 160 ? -48.984  19.887  34.807  1.00 80.65  ? 185 ALA C C   1 
ATOM   5797 O O   . ALA C 1 160 ? -49.287  18.800  35.289  1.00 84.29  ? 185 ALA C O   1 
ATOM   5798 C CB  . ALA C 1 160 ? -49.522  19.978  32.386  1.00 74.42  ? 185 ALA C CB  1 
ATOM   5799 N N   . GLU C 1 161 ? -47.885  20.552  35.139  1.00 95.79  ? 186 GLU C N   1 
ATOM   5800 C CA  . GLU C 1 161 ? -46.893  19.966  36.022  1.00 100.54 ? 186 GLU C CA  1 
ATOM   5801 C C   . GLU C 1 161 ? -47.545  19.640  37.341  1.00 98.94  ? 186 GLU C C   1 
ATOM   5802 O O   . GLU C 1 161 ? -47.247  18.606  37.951  1.00 91.20  ? 186 GLU C O   1 
ATOM   5803 C CB  . GLU C 1 161 ? -45.732  20.933  36.239  1.00 107.29 ? 186 GLU C CB  1 
ATOM   5804 C CG  . GLU C 1 161 ? -44.663  20.435  37.194  1.00 130.66 ? 186 GLU C CG  1 
ATOM   5805 C CD  . GLU C 1 161 ? -43.560  21.459  37.413  1.00 142.90 ? 186 GLU C CD  1 
ATOM   5806 O OE1 . GLU C 1 161 ? -42.495  21.066  37.947  1.00 144.15 ? 186 GLU C OE1 1 
ATOM   5807 O OE2 . GLU C 1 161 ? -43.765  22.645  37.049  1.00 117.99 ? 186 GLU C OE2 1 
ATOM   5808 N N   . ASN C 1 162 ? -48.453  20.531  37.745  1.00 100.55 ? 187 ASN C N   1 
ATOM   5809 C CA  . ASN C 1 162 ? -49.124  20.506  39.045  1.00 93.87  ? 187 ASN C CA  1 
ATOM   5810 C C   . ASN C 1 162 ? -50.387  19.644  39.080  1.00 104.31 ? 187 ASN C C   1 
ATOM   5811 O O   . ASN C 1 162 ? -51.059  19.566  40.103  1.00 111.58 ? 187 ASN C O   1 
ATOM   5812 C CB  . ASN C 1 162 ? -49.417  21.945  39.506  1.00 99.45  ? 187 ASN C CB  1 
ATOM   5813 C CG  . ASN C 1 162 ? -48.239  22.570  40.220  1.00 116.98 ? 187 ASN C CG  1 
ATOM   5814 O OD1 . ASN C 1 162 ? -47.312  21.864  40.660  1.00 110.14 ? 187 ASN C OD1 1 
ATOM   5815 N ND2 . ASN C 1 162 ? -48.278  23.893  40.373  1.00 120.19 ? 187 ASN C ND2 1 
ATOM   5816 N N   . PHE C 1 163 ? -50.702  18.984  37.969  1.00 110.51 ? 188 PHE C N   1 
ATOM   5817 C CA  . PHE C 1 163 ? -51.840  18.070  37.955  1.00 93.34  ? 188 PHE C CA  1 
ATOM   5818 C C   . PHE C 1 163 ? -51.543  16.856  38.784  1.00 84.84  ? 188 PHE C C   1 
ATOM   5819 O O   . PHE C 1 163 ? -50.405  16.613  39.185  1.00 90.48  ? 188 PHE C O   1 
ATOM   5820 C CB  . PHE C 1 163 ? -52.192  17.603  36.550  1.00 85.04  ? 188 PHE C CB  1 
ATOM   5821 C CG  . PHE C 1 163 ? -52.719  18.681  35.677  1.00 80.96  ? 188 PHE C CG  1 
ATOM   5822 C CD1 . PHE C 1 163 ? -52.429  18.697  34.335  1.00 75.08  ? 188 PHE C CD1 1 
ATOM   5823 C CD2 . PHE C 1 163 ? -53.493  19.696  36.203  1.00 97.76  ? 188 PHE C CD2 1 
ATOM   5824 C CE1 . PHE C 1 163 ? -52.918  19.706  33.528  1.00 87.33  ? 188 PHE C CE1 1 
ATOM   5825 C CE2 . PHE C 1 163 ? -53.978  20.700  35.404  1.00 102.77 ? 188 PHE C CE2 1 
ATOM   5826 C CZ  . PHE C 1 163 ? -53.689  20.709  34.064  1.00 90.83  ? 188 PHE C CZ  1 
ATOM   5827 N N   . THR C 1 164 ? -52.570  16.057  38.994  1.00 76.39  ? 189 THR C N   1 
ATOM   5828 C CA  . THR C 1 164 ? -52.400  14.876  39.794  1.00 94.74  ? 189 THR C CA  1 
ATOM   5829 C C   . THR C 1 164 ? -53.282  13.758  39.263  1.00 98.37  ? 189 THR C C   1 
ATOM   5830 O O   . THR C 1 164 ? -54.434  13.974  38.884  1.00 86.25  ? 189 THR C O   1 
ATOM   5831 C CB  . THR C 1 164 ? -52.708  15.178  41.267  1.00 90.47  ? 189 THR C CB  1 
ATOM   5832 O OG1 . THR C 1 164 ? -52.573  13.983  42.045  1.00 105.16 ? 189 THR C OG1 1 
ATOM   5833 C CG2 . THR C 1 164 ? -54.115  15.749  41.419  1.00 65.81  ? 189 THR C CG2 1 
ATOM   5834 N N   . VAL C 1 165 ? -52.715  12.562  39.213  1.00 85.50  ? 190 VAL C N   1 
ATOM   5835 C CA  . VAL C 1 165 ? -53.440  11.404  38.745  1.00 80.69  ? 190 VAL C CA  1 
ATOM   5836 C C   . VAL C 1 165 ? -53.624  10.351  39.831  1.00 88.35  ? 190 VAL C C   1 
ATOM   5837 O O   . VAL C 1 165 ? -52.663  9.862   40.422  1.00 79.48  ? 190 VAL C O   1 
ATOM   5838 C CB  . VAL C 1 165 ? -52.737  10.768  37.543  1.00 88.35  ? 190 VAL C CB  1 
ATOM   5839 C CG1 . VAL C 1 165 ? -51.360  10.245  37.941  1.00 95.30  ? 190 VAL C CG1 1 
ATOM   5840 C CG2 . VAL C 1 165 ? -53.589  9.652   36.975  1.00 90.20  ? 190 VAL C CG2 1 
ATOM   5841 N N   . LEU C 1 166 ? -54.878  10.006  40.081  1.00 89.20  ? 191 LEU C N   1 
ATOM   5842 C CA  . LEU C 1 166 ? -55.203  8.863   40.912  1.00 91.28  ? 191 LEU C CA  1 
ATOM   5843 C C   . LEU C 1 166 ? -55.104  7.574   40.103  1.00 89.90  ? 191 LEU C C   1 
ATOM   5844 O O   . LEU C 1 166 ? -55.710  7.439   39.042  1.00 87.31  ? 191 LEU C O   1 
ATOM   5845 C CB  . LEU C 1 166 ? -56.612  8.993   41.475  1.00 83.53  ? 191 LEU C CB  1 
ATOM   5846 C CG  . LEU C 1 166 ? -57.037  7.697   42.159  1.00 78.75  ? 191 LEU C CG  1 
ATOM   5847 C CD1 . LEU C 1 166 ? -56.224  7.501   43.421  1.00 89.76  ? 191 LEU C CD1 1 
ATOM   5848 C CD2 . LEU C 1 166 ? -58.514  7.705   42.466  1.00 81.87  ? 191 LEU C CD2 1 
ATOM   5849 N N   . ILE C 1 167 ? -54.356  6.616   40.621  1.00 79.09  ? 192 ILE C N   1 
ATOM   5850 C CA  . ILE C 1 167 ? -54.115  5.377   39.908  1.00 75.48  ? 192 ILE C CA  1 
ATOM   5851 C C   . ILE C 1 167 ? -54.548  4.218   40.770  1.00 79.78  ? 192 ILE C C   1 
ATOM   5852 O O   . ILE C 1 167 ? -53.890  3.881   41.748  1.00 95.70  ? 192 ILE C O   1 
ATOM   5853 C CB  . ILE C 1 167 ? -52.624  5.215   39.593  1.00 82.18  ? 192 ILE C CB  1 
ATOM   5854 C CG1 . ILE C 1 167 ? -52.130  6.407   38.773  1.00 86.18  ? 192 ILE C CG1 1 
ATOM   5855 C CG2 . ILE C 1 167 ? -52.362  3.889   38.889  1.00 60.37  ? 192 ILE C CG2 1 
ATOM   5856 C CD1 . ILE C 1 167 ? -50.719  6.267   38.306  1.00 88.64  ? 192 ILE C CD1 1 
ATOM   5857 N N   . LYS C 1 168 ? -55.677  3.626   40.425  1.00 73.76  ? 193 LYS C N   1 
ATOM   5858 C CA  . LYS C 1 168 ? -56.156  2.466   41.144  1.00 82.23  ? 193 LYS C CA  1 
ATOM   5859 C C   . LYS C 1 168 ? -55.657  1.226   40.407  1.00 84.22  ? 193 LYS C C   1 
ATOM   5860 O O   . LYS C 1 168 ? -55.604  1.222   39.185  1.00 91.61  ? 193 LYS C O   1 
ATOM   5861 C CB  . LYS C 1 168 ? -57.687  2.520   41.262  1.00 102.36 ? 193 LYS C CB  1 
ATOM   5862 C CG  . LYS C 1 168 ? -58.204  3.823   41.928  1.00 88.46  ? 193 LYS C CG  1 
ATOM   5863 C CD  . LYS C 1 168 ? -59.694  3.797   42.303  1.00 98.68  ? 193 LYS C CD  1 
ATOM   5864 C CE  . LYS C 1 168 ? -60.010  2.693   43.302  1.00 102.58 ? 193 LYS C CE  1 
ATOM   5865 N NZ  . LYS C 1 168 ? -61.464  2.524   43.562  1.00 117.77 ? 193 LYS C NZ  1 
ATOM   5866 N N   . ASN C 1 169 ? -55.251  0.195   41.141  1.00 82.33  ? 194 ASN C N   1 
ATOM   5867 C CA  . ASN C 1 169 ? -54.748  -1.030  40.515  1.00 84.12  ? 194 ASN C CA  1 
ATOM   5868 C C   . ASN C 1 169 ? -55.144  -2.292  41.270  1.00 97.26  ? 194 ASN C C   1 
ATOM   5869 O O   . ASN C 1 169 ? -54.588  -2.606  42.314  1.00 105.00 ? 194 ASN C O   1 
ATOM   5870 C CB  . ASN C 1 169 ? -53.223  -0.980  40.347  1.00 93.84  ? 194 ASN C CB  1 
ATOM   5871 C CG  . ASN C 1 169 ? -52.663  -2.217  39.649  1.00 100.16 ? 194 ASN C CG  1 
ATOM   5872 O OD1 . ASN C 1 169 ? -51.470  -2.511  39.737  1.00 95.06  ? 194 ASN C OD1 1 
ATOM   5873 N ND2 . ASN C 1 169 ? -53.526  -2.943  38.951  1.00 95.66  ? 194 ASN C ND2 1 
ATOM   5874 N N   . ASN C 1 170 ? -56.117  -3.010  40.730  1.00 105.96 ? 195 ASN C N   1 
ATOM   5875 C CA  . ASN C 1 170 ? -56.515  -4.297  41.267  1.00 107.21 ? 195 ASN C CA  1 
ATOM   5876 C C   . ASN C 1 170 ? -55.757  -5.398  40.537  1.00 110.46 ? 195 ASN C C   1 
ATOM   5877 O O   . ASN C 1 170 ? -55.727  -5.417  39.305  1.00 112.02 ? 195 ASN C O   1 
ATOM   5878 C CB  . ASN C 1 170 ? -58.033  -4.465  41.112  1.00 125.58 ? 195 ASN C CB  1 
ATOM   5879 C CG  . ASN C 1 170 ? -58.518  -5.867  41.471  1.00 151.20 ? 195 ASN C CG  1 
ATOM   5880 O OD1 . ASN C 1 170 ? -57.760  -6.691  41.985  1.00 158.22 ? 195 ASN C OD1 1 
ATOM   5881 N ND2 . ASN C 1 170 ? -59.793  -6.138  41.200  1.00 152.36 ? 195 ASN C ND2 1 
ATOM   5882 N N   . ILE C 1 171 ? -55.146  -6.312  41.286  1.00 97.65  ? 196 ILE C N   1 
ATOM   5883 C CA  . ILE C 1 171 ? -54.440  -7.429  40.667  1.00 114.08 ? 196 ILE C CA  1 
ATOM   5884 C C   . ILE C 1 171 ? -54.810  -8.775  41.282  1.00 115.54 ? 196 ILE C C   1 
ATOM   5885 O O   . ILE C 1 171 ? -55.316  -8.842  42.401  1.00 101.59 ? 196 ILE C O   1 
ATOM   5886 C CB  . ILE C 1 171 ? -52.906  -7.249  40.711  1.00 106.46 ? 196 ILE C CB  1 
ATOM   5887 C CG1 . ILE C 1 171 ? -52.418  -7.052  42.150  1.00 107.80 ? 196 ILE C CG1 1 
ATOM   5888 C CG2 . ILE C 1 171 ? -52.471  -6.093  39.816  1.00 101.37 ? 196 ILE C CG2 1 
ATOM   5889 C CD1 . ILE C 1 171 ? -52.238  -8.330  42.939  1.00 98.49  ? 196 ILE C CD1 1 
ATOM   5890 N N   . ARG C 1 172 ? -54.544  -9.846  40.538  1.00 118.88 ? 197 ARG C N   1 
ATOM   5891 C CA  . ARG C 1 172 ? -54.863  -11.202 40.981  1.00 124.65 ? 197 ARG C CA  1 
ATOM   5892 C C   . ARG C 1 172 ? -53.888  -12.229 40.419  1.00 125.06 ? 197 ARG C C   1 
ATOM   5893 O O   . ARG C 1 172 ? -53.398  -12.096 39.299  1.00 109.82 ? 197 ARG C O   1 
ATOM   5894 C CB  . ARG C 1 172 ? -56.295  -11.595 40.588  1.00 115.69 ? 197 ARG C CB  1 
ATOM   5895 C CG  . ARG C 1 172 ? -56.634  -13.078 40.835  1.00 111.43 ? 197 ARG C CG  1 
ATOM   5896 C CD  . ARG C 1 172 ? -58.137  -13.341 40.765  1.00 130.96 ? 197 ARG C CD  1 
ATOM   5897 N NE  . ARG C 1 172 ? -58.513  -14.705 41.145  1.00 118.56 ? 197 ARG C NE  1 
ATOM   5898 C CZ  . ARG C 1 172 ? -58.861  -15.662 40.281  1.00 141.55 ? 197 ARG C CZ  1 
ATOM   5899 N NH1 . ARG C 1 172 ? -58.882  -15.425 38.971  1.00 117.11 ? 197 ARG C NH1 1 
ATOM   5900 N NH2 . ARG C 1 172 ? -59.194  -16.866 40.728  1.00 152.33 ? 197 ARG C NH2 1 
ATOM   5901 N N   . TYR C 1 173 ? -53.607  -13.247 41.223  1.00 134.35 ? 198 TYR C N   1 
ATOM   5902 C CA  . TYR C 1 173 ? -52.851  -14.406 40.780  1.00 126.58 ? 198 TYR C CA  1 
ATOM   5903 C C   . TYR C 1 173 ? -53.786  -15.583 40.619  1.00 123.91 ? 198 TYR C C   1 
ATOM   5904 O O   . TYR C 1 173 ? -54.201  -16.186 41.602  1.00 118.52 ? 198 TYR C O   1 
ATOM   5905 C CB  . TYR C 1 173 ? -51.774  -14.760 41.796  1.00 115.36 ? 198 TYR C CB  1 
ATOM   5906 C CG  . TYR C 1 173 ? -50.718  -13.696 41.935  1.00 122.55 ? 198 TYR C CG  1 
ATOM   5907 C CD1 . TYR C 1 173 ? -50.780  -12.772 42.960  1.00 120.16 ? 198 TYR C CD1 1 
ATOM   5908 C CD2 . TYR C 1 173 ? -49.664  -13.603 41.030  1.00 128.47 ? 198 TYR C CD2 1 
ATOM   5909 C CE1 . TYR C 1 173 ? -49.821  -11.792 43.093  1.00 126.69 ? 198 TYR C CE1 1 
ATOM   5910 C CE2 . TYR C 1 173 ? -48.694  -12.625 41.156  1.00 119.11 ? 198 TYR C CE2 1 
ATOM   5911 C CZ  . TYR C 1 173 ? -48.781  -11.722 42.189  1.00 118.06 ? 198 TYR C CZ  1 
ATOM   5912 O OH  . TYR C 1 173 ? -47.829  -10.741 42.326  1.00 109.49 ? 198 TYR C OH  1 
ATOM   5913 N N   . PRO C 1 174 ? -54.096  -15.929 39.371  1.00 119.22 ? 199 PRO C N   1 
ATOM   5914 C CA  . PRO C 1 174 ? -55.049  -16.994 39.053  1.00 120.47 ? 199 PRO C CA  1 
ATOM   5915 C C   . PRO C 1 174 ? -54.708  -18.293 39.774  1.00 132.70 ? 199 PRO C C   1 
ATOM   5916 O O   . PRO C 1 174 ? -55.570  -18.873 40.432  1.00 116.58 ? 199 PRO C O   1 
ATOM   5917 C CB  . PRO C 1 174 ? -54.867  -17.176 37.545  1.00 150.72 ? 199 PRO C CB  1 
ATOM   5918 C CG  . PRO C 1 174 ? -54.301  -15.870 37.069  1.00 145.02 ? 199 PRO C CG  1 
ATOM   5919 C CD  . PRO C 1 174 ? -53.420  -15.407 38.173  1.00 124.17 ? 199 PRO C CD  1 
ATOM   5920 N N   . LYS C 1 175 ? -53.460  -18.736 39.654  1.00 146.87 ? 200 LYS C N   1 
ATOM   5921 C CA  . LYS C 1 175 ? -53.042  -20.013 40.228  1.00 137.73 ? 200 LYS C CA  1 
ATOM   5922 C C   . LYS C 1 175 ? -53.353  -20.111 41.721  1.00 125.70 ? 200 LYS C C   1 
ATOM   5923 O O   . LYS C 1 175 ? -53.955  -21.081 42.177  1.00 138.07 ? 200 LYS C O   1 
ATOM   5924 C CB  . LYS C 1 175 ? -51.552  -20.256 39.971  1.00 101.69 ? 200 LYS C CB  1 
ATOM   5925 N N   . PHE C 1 176 ? -52.949  -19.096 42.476  1.00 120.10 ? 201 PHE C N   1 
ATOM   5926 C CA  . PHE C 1 176 ? -53.118  -19.105 43.925  1.00 127.86 ? 201 PHE C CA  1 
ATOM   5927 C C   . PHE C 1 176 ? -54.443  -18.521 44.398  1.00 140.07 ? 201 PHE C C   1 
ATOM   5928 O O   . PHE C 1 176 ? -54.601  -18.225 45.581  1.00 119.17 ? 201 PHE C O   1 
ATOM   5929 C CB  . PHE C 1 176 ? -51.966  -18.353 44.588  1.00 125.17 ? 201 PHE C CB  1 
ATOM   5930 C CG  . PHE C 1 176 ? -50.622  -18.791 44.118  1.00 124.30 ? 201 PHE C CG  1 
ATOM   5931 C CD1 . PHE C 1 176 ? -50.286  -20.129 44.129  1.00 127.63 ? 201 PHE C CD1 1 
ATOM   5932 C CD2 . PHE C 1 176 ? -49.694  -17.872 43.661  1.00 130.62 ? 201 PHE C CD2 1 
ATOM   5933 C CE1 . PHE C 1 176 ? -49.056  -20.549 43.695  1.00 137.95 ? 201 PHE C CE1 1 
ATOM   5934 C CE2 . PHE C 1 176 ? -48.458  -18.288 43.224  1.00 134.61 ? 201 PHE C CE2 1 
ATOM   5935 C CZ  . PHE C 1 176 ? -48.139  -19.630 43.240  1.00 141.36 ? 201 PHE C CZ  1 
ATOM   5936 N N   . ASN C 1 177 ? -55.386  -18.348 43.479  1.00 146.89 ? 202 ASN C N   1 
ATOM   5937 C CA  . ASN C 1 177 ? -56.673  -17.744 43.818  1.00 141.87 ? 202 ASN C CA  1 
ATOM   5938 C C   . ASN C 1 177 ? -56.512  -16.641 44.860  1.00 133.96 ? 202 ASN C C   1 
ATOM   5939 O O   . ASN C 1 177 ? -57.181  -16.638 45.889  1.00 122.44 ? 202 ASN C O   1 
ATOM   5940 C CB  . ASN C 1 177 ? -57.666  -18.798 44.311  1.00 134.43 ? 202 ASN C CB  1 
ATOM   5941 C CG  . ASN C 1 177 ? -59.062  -18.237 44.497  1.00 146.51 ? 202 ASN C CG  1 
ATOM   5942 O OD1 . ASN C 1 177 ? -59.316  -17.060 44.218  1.00 134.19 ? 202 ASN C OD1 1 
ATOM   5943 N ND2 . ASN C 1 177 ? -59.978  -19.077 44.967  1.00 147.58 ? 202 ASN C ND2 1 
ATOM   5944 N N   . PHE C 1 178 ? -55.608  -15.712 44.584  1.00 136.61 ? 203 PHE C N   1 
ATOM   5945 C CA  . PHE C 1 178 ? -55.293  -14.644 45.512  1.00 114.92 ? 203 PHE C CA  1 
ATOM   5946 C C   . PHE C 1 178 ? -55.284  -13.317 44.787  1.00 114.97 ? 203 PHE C C   1 
ATOM   5947 O O   . PHE C 1 178 ? -54.775  -13.212 43.678  1.00 123.86 ? 203 PHE C O   1 
ATOM   5948 C CB  . PHE C 1 178 ? -53.920  -14.881 46.133  1.00 124.68 ? 203 PHE C CB  1 
ATOM   5949 C CG  . PHE C 1 178 ? -53.314  -13.650 46.732  1.00 127.16 ? 203 PHE C CG  1 
ATOM   5950 C CD1 . PHE C 1 178 ? -53.727  -13.201 47.970  1.00 141.80 ? 203 PHE C CD1 1 
ATOM   5951 C CD2 . PHE C 1 178 ? -52.343  -12.934 46.056  1.00 116.89 ? 203 PHE C CD2 1 
ATOM   5952 C CE1 . PHE C 1 178 ? -53.180  -12.064 48.527  1.00 134.08 ? 203 PHE C CE1 1 
ATOM   5953 C CE2 . PHE C 1 178 ? -51.790  -11.796 46.614  1.00 114.81 ? 203 PHE C CE2 1 
ATOM   5954 C CZ  . PHE C 1 178 ? -52.210  -11.360 47.848  1.00 115.26 ? 203 PHE C CZ  1 
ATOM   5955 N N   . ASN C 1 179 ? -55.841  -12.296 45.420  1.00 110.45 ? 204 ASN C N   1 
ATOM   5956 C CA  . ASN C 1 179 ? -55.852  -10.968 44.818  1.00 123.05 ? 204 ASN C CA  1 
ATOM   5957 C C   . ASN C 1 179 ? -55.819  -9.829  45.832  1.00 123.55 ? 204 ASN C C   1 
ATOM   5958 O O   . ASN C 1 179 ? -56.170  -10.008 47.000  1.00 113.56 ? 204 ASN C O   1 
ATOM   5959 C CB  . ASN C 1 179 ? -57.051  -10.817 43.884  1.00 118.37 ? 204 ASN C CB  1 
ATOM   5960 C CG  . ASN C 1 179 ? -58.282  -11.532 44.397  1.00 122.16 ? 204 ASN C CG  1 
ATOM   5961 O OD1 . ASN C 1 179 ? -58.966  -12.229 43.645  1.00 99.88  ? 204 ASN C OD1 1 
ATOM   5962 N ND2 . ASN C 1 179 ? -58.570  -11.370 45.686  1.00 131.36 ? 204 ASN C ND2 1 
ATOM   5963 N N   . LYS C 1 180 ? -55.406  -8.653  45.369  1.00 117.31 ? 205 LYS C N   1 
ATOM   5964 C CA  . LYS C 1 180 ? -55.224  -7.506  46.247  1.00 105.30 ? 205 LYS C CA  1 
ATOM   5965 C C   . LYS C 1 180 ? -55.198  -6.206  45.447  1.00 108.98 ? 205 LYS C C   1 
ATOM   5966 O O   . LYS C 1 180 ? -55.066  -6.229  44.225  1.00 116.49 ? 205 LYS C O   1 
ATOM   5967 C CB  . LYS C 1 180 ? -53.927  -7.662  47.039  1.00 103.58 ? 205 LYS C CB  1 
ATOM   5968 C CG  . LYS C 1 180 ? -53.785  -6.666  48.151  1.00 102.51 ? 205 LYS C CG  1 
ATOM   5969 C CD  . LYS C 1 180 ? -52.574  -6.940  49.004  1.00 95.33  ? 205 LYS C CD  1 
ATOM   5970 C CE  . LYS C 1 180 ? -52.429  -5.843  50.033  1.00 103.10 ? 205 LYS C CE  1 
ATOM   5971 N NZ  . LYS C 1 180 ? -51.424  -6.195  51.065  1.00 127.28 ? 205 LYS C NZ  1 
ATOM   5972 N N   . ARG C 1 181 ? -55.317  -5.075  46.141  1.00 105.82 ? 206 ARG C N   1 
ATOM   5973 C CA  . ARG C 1 181 ? -55.437  -3.768  45.493  1.00 110.17 ? 206 ARG C CA  1 
ATOM   5974 C C   . ARG C 1 181 ? -54.416  -2.781  46.051  1.00 107.15 ? 206 ARG C C   1 
ATOM   5975 O O   . ARG C 1 181 ? -54.079  -2.829  47.230  1.00 114.81 ? 206 ARG C O   1 
ATOM   5976 C CB  . ARG C 1 181 ? -56.860  -3.209  45.659  1.00 103.22 ? 206 ARG C CB  1 
ATOM   5977 C CG  . ARG C 1 181 ? -57.936  -4.271  45.578  1.00 123.12 ? 206 ARG C CG  1 
ATOM   5978 C CD  . ARG C 1 181 ? -59.353  -3.715  45.654  1.00 130.92 ? 206 ARG C CD  1 
ATOM   5979 N NE  . ARG C 1 181 ? -60.328  -4.809  45.665  1.00 170.61 ? 206 ARG C NE  1 
ATOM   5980 C CZ  . ARG C 1 181 ? -61.608  -4.686  45.324  1.00 157.51 ? 206 ARG C CZ  1 
ATOM   5981 N NH1 . ARG C 1 181 ? -62.081  -3.510  44.940  1.00 155.12 ? 206 ARG C NH1 1 
ATOM   5982 N NH2 . ARG C 1 181 ? -62.419  -5.741  45.359  1.00 119.04 ? 206 ARG C NH2 1 
ATOM   5983 N N   . ASN C 1 182 ? -53.924  -1.889  45.198  1.00 105.47 ? 207 ASN C N   1 
ATOM   5984 C CA  . ASN C 1 182 ? -52.877  -0.936  45.575  1.00 107.42 ? 207 ASN C CA  1 
ATOM   5985 C C   . ASN C 1 182 ? -53.289  0.061   46.650  1.00 109.29 ? 207 ASN C C   1 
ATOM   5986 O O   . ASN C 1 182 ? -52.471  0.857   47.110  1.00 96.62  ? 207 ASN C O   1 
ATOM   5987 C CB  . ASN C 1 182 ? -52.392  -0.173  44.348  1.00 101.87 ? 207 ASN C CB  1 
ATOM   5988 C CG  . ASN C 1 182 ? -53.458  0.726   43.772  1.00 108.16 ? 207 ASN C CG  1 
ATOM   5989 O OD1 . ASN C 1 182 ? -54.615  0.322   43.631  1.00 107.67 ? 207 ASN C OD1 1 
ATOM   5990 N ND2 . ASN C 1 182 ? -53.079  1.953   43.436  1.00 94.36  ? 207 ASN C ND2 1 
ATOM   5991 N N   . ILE C 1 183 ? -54.564  0.038   47.020  1.00 109.74 ? 208 ILE C N   1 
ATOM   5992 C CA  . ILE C 1 183 ? -55.039  0.797   48.168  1.00 118.79 ? 208 ILE C CA  1 
ATOM   5993 C C   . ILE C 1 183 ? -55.129  -0.128  49.372  1.00 130.26 ? 208 ILE C C   1 
ATOM   5994 O O   . ILE C 1 183 ? -56.104  -0.859  49.535  1.00 124.72 ? 208 ILE C O   1 
ATOM   5995 C CB  . ILE C 1 183 ? -56.425  1.394   47.922  1.00 109.16 ? 208 ILE C CB  1 
ATOM   5996 C CG1 . ILE C 1 183 ? -56.464  2.121   46.584  1.00 77.54  ? 208 ILE C CG1 1 
ATOM   5997 C CG2 . ILE C 1 183 ? -56.799  2.333   49.050  1.00 119.96 ? 208 ILE C CG2 1 
ATOM   5998 C CD1 . ILE C 1 183 ? -57.851  2.520   46.186  1.00 102.43 ? 208 ILE C CD1 1 
ATOM   5999 N N   . LEU C 1 184 ? -54.113  -0.088  50.220  1.00 126.70 ? 209 LEU C N   1 
ATOM   6000 C CA  . LEU C 1 184 ? -54.046  -0.978  51.369  1.00 136.58 ? 209 LEU C CA  1 
ATOM   6001 C C   . LEU C 1 184 ? -55.187  -0.710  52.362  1.00 145.04 ? 209 LEU C C   1 
ATOM   6002 O O   . LEU C 1 184 ? -55.660  0.420   52.477  1.00 153.06 ? 209 LEU C O   1 
ATOM   6003 C CB  . LEU C 1 184 ? -52.678  -0.844  52.041  1.00 158.35 ? 209 LEU C CB  1 
ATOM   6004 C CG  . LEU C 1 184 ? -51.462  -1.391  51.284  1.00 128.91 ? 209 LEU C CG  1 
ATOM   6005 C CD1 . LEU C 1 184 ? -51.268  -0.706  49.946  1.00 126.24 ? 209 LEU C CD1 1 
ATOM   6006 C CD2 . LEU C 1 184 ? -50.209  -1.250  52.129  1.00 152.51 ? 209 LEU C CD2 1 
ATOM   6007 N N   . PRO C 1 185 ? -55.632  -1.754  53.080  1.00 144.67 ? 210 PRO C N   1 
ATOM   6008 C CA  . PRO C 1 185 ? -56.807  -1.700  53.964  1.00 157.35 ? 210 PRO C CA  1 
ATOM   6009 C C   . PRO C 1 185 ? -56.619  -0.786  55.170  1.00 143.23 ? 210 PRO C C   1 
ATOM   6010 O O   . PRO C 1 185 ? -57.588  -0.303  55.759  1.00 115.20 ? 210 PRO C O   1 
ATOM   6011 C CB  . PRO C 1 185 ? -56.953  -3.149  54.440  1.00 156.83 ? 210 PRO C CB  1 
ATOM   6012 C CG  . PRO C 1 185 ? -56.170  -3.967  53.458  1.00 141.76 ? 210 PRO C CG  1 
ATOM   6013 C CD  . PRO C 1 185 ? -55.035  -3.096  53.050  1.00 122.04 ? 210 PRO C CD  1 
ATOM   6014 N N   . ASN C 1 186 ? -55.367  -0.575  55.543  1.00 149.35 ? 211 ASN C N   1 
ATOM   6015 C CA  . ASN C 1 186 ? -55.039  0.292   56.657  1.00 159.71 ? 211 ASN C CA  1 
ATOM   6016 C C   . ASN C 1 186 ? -55.005  1.750   56.217  1.00 151.61 ? 211 ASN C C   1 
ATOM   6017 O O   . ASN C 1 186 ? -54.064  2.468   56.548  1.00 167.45 ? 211 ASN C O   1 
ATOM   6018 C CB  . ASN C 1 186 ? -53.695  -0.115  57.257  1.00 165.03 ? 211 ASN C CB  1 
ATOM   6019 N N   . ILE C 1 187 ? -56.015  2.194   55.472  1.00 126.01 ? 212 ILE C N   1 
ATOM   6020 C CA  . ILE C 1 187 ? -55.998  3.571   54.978  1.00 128.11 ? 212 ILE C CA  1 
ATOM   6021 C C   . ILE C 1 187 ? -57.338  4.311   55.052  1.00 129.42 ? 212 ILE C C   1 
ATOM   6022 O O   . ILE C 1 187 ? -58.342  3.859   54.520  1.00 106.81 ? 212 ILE C O   1 
ATOM   6023 C CB  . ILE C 1 187 ? -55.438  3.659   53.543  1.00 118.09 ? 212 ILE C CB  1 
ATOM   6024 C CG1 . ILE C 1 187 ? -53.968  3.233   53.521  1.00 125.44 ? 212 ILE C CG1 1 
ATOM   6025 C CG2 . ILE C 1 187 ? -55.578  5.062   53.013  1.00 101.42 ? 212 ILE C CG2 1 
ATOM   6026 C CD1 . ILE C 1 187 ? -53.302  3.350   52.159  1.00 139.43 ? 212 ILE C CD1 1 
ATOM   6027 N N   . ASN C 1 188 ? -57.320  5.462   55.726  1.00 145.39 ? 213 ASN C N   1 
ATOM   6028 C CA  . ASN C 1 188 ? -58.463  6.374   55.861  1.00 110.37 ? 213 ASN C CA  1 
ATOM   6029 C C   . ASN C 1 188 ? -58.907  6.857   54.492  1.00 112.11 ? 213 ASN C C   1 
ATOM   6030 O O   . ASN C 1 188 ? -58.082  6.973   53.589  1.00 109.73 ? 213 ASN C O   1 
ATOM   6031 C CB  . ASN C 1 188 ? -58.068  7.591   56.728  1.00 86.04  ? 213 ASN C CB  1 
ATOM   6032 C CG  . ASN C 1 188 ? -57.062  7.236   57.831  1.00 110.26 ? 213 ASN C CG  1 
ATOM   6033 O OD1 . ASN C 1 188 ? -57.194  6.215   58.494  1.00 116.58 ? 213 ASN C OD1 1 
ATOM   6034 N ND2 . ASN C 1 188 ? -56.050  8.086   58.024  1.00 115.47 ? 213 ASN C ND2 1 
ATOM   6035 N N   . SER C 1 189 ? -60.199  7.136   54.337  1.00 127.13 ? 214 SER C N   1 
ATOM   6036 C CA  . SER C 1 189 ? -60.715  7.710   53.095  1.00 110.13 ? 214 SER C CA  1 
ATOM   6037 C C   . SER C 1 189 ? -60.442  9.204   53.037  1.00 107.58 ? 214 SER C C   1 
ATOM   6038 O O   . SER C 1 189 ? -60.155  9.752   51.984  1.00 105.42 ? 214 SER C O   1 
ATOM   6039 C CB  . SER C 1 189 ? -62.212  7.451   52.973  1.00 120.35 ? 214 SER C CB  1 
ATOM   6040 O OG  . SER C 1 189 ? -62.498  6.094   53.268  1.00 154.95 ? 214 SER C OG  1 
ATOM   6041 N N   . SER C 1 190 ? -60.535  9.861   54.185  1.00 122.63 ? 215 SER C N   1 
ATOM   6042 C CA  . SER C 1 190 ? -60.168  11.266  54.276  1.00 115.62 ? 215 SER C CA  1 
ATOM   6043 C C   . SER C 1 190 ? -58.692  11.428  53.954  1.00 112.24 ? 215 SER C C   1 
ATOM   6044 O O   . SER C 1 190 ? -58.257  12.492  53.523  1.00 107.84 ? 215 SER C O   1 
ATOM   6045 C CB  . SER C 1 190 ? -60.472  11.828  55.665  1.00 95.82  ? 215 SER C CB  1 
ATOM   6046 O OG  . SER C 1 190 ? -61.767  12.389  55.715  1.00 113.64 ? 215 SER C OG  1 
ATOM   6047 N N   . TYR C 1 191 ? -57.917  10.369  54.162  1.00 110.94 ? 216 TYR C N   1 
ATOM   6048 C CA  . TYR C 1 191 ? -56.491  10.436  53.867  1.00 105.11 ? 216 TYR C CA  1 
ATOM   6049 C C   . TYR C 1 191 ? -56.281  10.650  52.377  1.00 112.94 ? 216 TYR C C   1 
ATOM   6050 O O   . TYR C 1 191 ? -55.538  11.537  51.958  1.00 125.05 ? 216 TYR C O   1 
ATOM   6051 C CB  . TYR C 1 191 ? -55.753  9.177   54.343  1.00 106.87 ? 216 TYR C CB  1 
ATOM   6052 C CG  . TYR C 1 191 ? -54.304  9.137   53.910  1.00 103.25 ? 216 TYR C CG  1 
ATOM   6053 C CD1 . TYR C 1 191 ? -53.816  8.090   53.143  1.00 111.45 ? 216 TYR C CD1 1 
ATOM   6054 C CD2 . TYR C 1 191 ? -53.427  10.162  54.247  1.00 110.24 ? 216 TYR C CD2 1 
ATOM   6055 C CE1 . TYR C 1 191 ? -52.488  8.057   52.728  1.00 121.57 ? 216 TYR C CE1 1 
ATOM   6056 C CE2 . TYR C 1 191 ? -52.094  10.139  53.836  1.00 120.88 ? 216 TYR C CE2 1 
ATOM   6057 C CZ  . TYR C 1 191 ? -51.634  9.085   53.079  1.00 115.19 ? 216 TYR C CZ  1 
ATOM   6058 O OH  . TYR C 1 191 ? -50.320  9.057   52.675  1.00 95.64  ? 216 TYR C OH  1 
ATOM   6059 N N   . LEU C 1 192 ? -56.964  9.837   51.581  1.00 113.73 ? 217 LEU C N   1 
ATOM   6060 C CA  . LEU C 1 192 ? -56.854  9.898   50.129  1.00 109.80 ? 217 LEU C CA  1 
ATOM   6061 C C   . LEU C 1 192 ? -57.559  11.135  49.573  1.00 114.15 ? 217 LEU C C   1 
ATOM   6062 O O   . LEU C 1 192 ? -57.474  11.432  48.394  1.00 89.12  ? 217 LEU C O   1 
ATOM   6063 C CB  . LEU C 1 192 ? -57.392  8.604   49.511  1.00 86.61  ? 217 LEU C CB  1 
ATOM   6064 C CG  . LEU C 1 192 ? -56.883  7.351   50.242  1.00 100.25 ? 217 LEU C CG  1 
ATOM   6065 C CD1 . LEU C 1 192 ? -57.447  6.056   49.706  1.00 66.81  ? 217 LEU C CD1 1 
ATOM   6066 C CD2 . LEU C 1 192 ? -55.375  7.302   50.199  1.00 127.91 ? 217 LEU C CD2 1 
ATOM   6067 N N   . THR C 1 193 ? -58.235  11.867  50.449  1.00 134.11 ? 218 THR C N   1 
ATOM   6068 C CA  . THR C 1 193 ? -58.905  13.105  50.076  1.00 136.38 ? 218 THR C CA  1 
ATOM   6069 C C   . THR C 1 193 ? -57.914  14.200  49.683  1.00 145.14 ? 218 THR C C   1 
ATOM   6070 O O   . THR C 1 193 ? -58.251  15.096  48.910  1.00 152.16 ? 218 THR C O   1 
ATOM   6071 C CB  . THR C 1 193 ? -59.781  13.643  51.232  1.00 149.34 ? 218 THR C CB  1 
ATOM   6072 O OG1 . THR C 1 193 ? -61.039  14.089  50.715  1.00 164.84 ? 218 THR C OG1 1 
ATOM   6073 C CG2 . THR C 1 193 ? -59.083  14.807  51.951  1.00 136.55 ? 218 THR C CG2 1 
ATOM   6074 N N   . HIS C 1 194 ? -56.699  14.146  50.221  1.00 132.72 ? 219 HIS C N   1 
ATOM   6075 C CA  . HIS C 1 194 ? -55.739  15.218  49.967  1.00 157.87 ? 219 HIS C CA  1 
ATOM   6076 C C   . HIS C 1 194 ? -54.281  14.763  50.030  1.00 146.56 ? 219 HIS C C   1 
ATOM   6077 O O   . HIS C 1 194 ? -53.363  15.563  49.852  1.00 154.02 ? 219 HIS C O   1 
ATOM   6078 C CB  . HIS C 1 194 ? -55.978  16.412  50.910  1.00 183.09 ? 219 HIS C CB  1 
ATOM   6079 C CG  . HIS C 1 194 ? -55.130  17.618  50.603  1.00 214.97 ? 219 HIS C CG  1 
ATOM   6080 N ND1 . HIS C 1 194 ? -55.470  18.546  49.639  1.00 205.82 ? 219 HIS C ND1 1 
ATOM   6081 C CD2 . HIS C 1 194 ? -53.961  18.050  51.137  1.00 205.42 ? 219 HIS C CD2 1 
ATOM   6082 C CE1 . HIS C 1 194 ? -54.549  19.492  49.590  1.00 177.72 ? 219 HIS C CE1 1 
ATOM   6083 N NE2 . HIS C 1 194 ? -53.621  19.215  50.490  1.00 186.49 ? 219 HIS C NE2 1 
ATOM   6084 N N   . CYS C 1 195 ? -54.058  13.479  50.274  1.00 118.78 ? 220 CYS C N   1 
ATOM   6085 C CA  . CYS C 1 195 ? -52.696  12.966  50.228  1.00 117.64 ? 220 CYS C CA  1 
ATOM   6086 C C   . CYS C 1 195 ? -52.135  13.100  48.813  1.00 113.57 ? 220 CYS C C   1 
ATOM   6087 O O   . CYS C 1 195 ? -52.879  13.278  47.848  1.00 99.67  ? 220 CYS C O   1 
ATOM   6088 C CB  . CYS C 1 195 ? -52.630  11.507  50.684  1.00 121.25 ? 220 CYS C CB  1 
ATOM   6089 S SG  . CYS C 1 195 ? -53.095  10.295  49.421  1.00 121.32 ? 220 CYS C SG  1 
ATOM   6090 N N   . VAL C 1 196 ? -50.812  13.038  48.709  1.00 114.96 ? 221 VAL C N   1 
ATOM   6091 C CA  . VAL C 1 196 ? -50.108  13.022  47.430  1.00 89.21  ? 221 VAL C CA  1 
ATOM   6092 C C   . VAL C 1 196 ? -48.804  12.279  47.600  1.00 93.83  ? 221 VAL C C   1 
ATOM   6093 O O   . VAL C 1 196 ? -47.989  12.617  48.465  1.00 98.92  ? 221 VAL C O   1 
ATOM   6094 C CB  . VAL C 1 196 ? -49.736  14.414  46.931  1.00 80.72  ? 221 VAL C CB  1 
ATOM   6095 C CG1 . VAL C 1 196 ? -48.905  14.303  45.659  1.00 71.01  ? 221 VAL C CG1 1 
ATOM   6096 C CG2 . VAL C 1 196 ? -50.982  15.247  46.698  1.00 107.83 ? 221 VAL C CG2 1 
ATOM   6097 N N   . PHE C 1 197 ? -48.604  11.284  46.746  1.00 102.79 ? 222 PHE C N   1 
ATOM   6098 C CA  . PHE C 1 197 ? -47.449  10.406  46.821  1.00 96.97  ? 222 PHE C CA  1 
ATOM   6099 C C   . PHE C 1 197 ? -46.104  11.115  46.965  1.00 110.75 ? 222 PHE C C   1 
ATOM   6100 O O   . PHE C 1 197 ? -45.868  12.176  46.375  1.00 117.33 ? 222 PHE C O   1 
ATOM   6101 C CB  . PHE C 1 197 ? -47.407  9.516   45.591  1.00 91.56  ? 222 PHE C CB  1 
ATOM   6102 C CG  . PHE C 1 197 ? -46.243  8.588   45.569  1.00 97.76  ? 222 PHE C CG  1 
ATOM   6103 C CD1 . PHE C 1 197 ? -46.328  7.344   46.161  1.00 95.80  ? 222 PHE C CD1 1 
ATOM   6104 C CD2 . PHE C 1 197 ? -45.061  8.961   44.962  1.00 100.77 ? 222 PHE C CD2 1 
ATOM   6105 C CE1 . PHE C 1 197 ? -45.265  6.483   46.139  1.00 91.78  ? 222 PHE C CE1 1 
ATOM   6106 C CE2 . PHE C 1 197 ? -43.992  8.109   44.938  1.00 110.69 ? 222 PHE C CE2 1 
ATOM   6107 C CZ  . PHE C 1 197 ? -44.091  6.859   45.528  1.00 115.35 ? 222 PHE C CZ  1 
ATOM   6108 N N   . SER C 1 198 ? -45.232  10.499  47.758  1.00 116.34 ? 223 SER C N   1 
ATOM   6109 C CA  . SER C 1 198 ? -43.846  10.919  47.911  1.00 119.70 ? 223 SER C CA  1 
ATOM   6110 C C   . SER C 1 198 ? -43.128  9.766   48.591  1.00 115.37 ? 223 SER C C   1 
ATOM   6111 O O   . SER C 1 198 ? -43.627  9.217   49.571  1.00 96.09  ? 223 SER C O   1 
ATOM   6112 C CB  . SER C 1 198 ? -43.754  12.174  48.769  1.00 113.53 ? 223 SER C CB  1 
ATOM   6113 O OG  . SER C 1 198 ? -44.139  11.882  50.096  1.00 116.13 ? 223 SER C OG  1 
ATOM   6114 N N   . ARG C 1 199 ? -41.969  9.389   48.062  1.00 125.55 ? 224 ARG C N   1 
ATOM   6115 C CA  . ARG C 1 199 ? -41.265  8.210   48.548  1.00 127.76 ? 224 ARG C CA  1 
ATOM   6116 C C   . ARG C 1 199 ? -41.057  8.284   50.053  1.00 132.86 ? 224 ARG C C   1 
ATOM   6117 O O   . ARG C 1 199 ? -41.245  7.302   50.771  1.00 110.18 ? 224 ARG C O   1 
ATOM   6118 C CB  . ARG C 1 199 ? -39.914  8.076   47.844  1.00 136.76 ? 224 ARG C CB  1 
ATOM   6119 C CG  . ARG C 1 199 ? -39.255  6.717   48.025  1.00 136.03 ? 224 ARG C CG  1 
ATOM   6120 C CD  . ARG C 1 199 ? -39.935  5.677   47.158  1.00 141.08 ? 224 ARG C CD  1 
ATOM   6121 N NE  . ARG C 1 199 ? -40.032  6.123   45.772  1.00 145.87 ? 224 ARG C NE  1 
ATOM   6122 C CZ  . ARG C 1 199 ? -40.475  5.366   44.771  1.00 134.18 ? 224 ARG C CZ  1 
ATOM   6123 N NH1 . ARG C 1 199 ? -40.866  4.110   44.992  1.00 96.21  ? 224 ARG C NH1 1 
ATOM   6124 N NH2 . ARG C 1 199 ? -40.526  5.868   43.543  1.00 127.89 ? 224 ARG C NH2 1 
ATOM   6125 N N   . LYS C 1 200 ? -40.674  9.469   50.515  1.00 142.27 ? 225 LYS C N   1 
ATOM   6126 C CA  . LYS C 1 200 ? -40.387  9.721   51.926  1.00 132.88 ? 225 LYS C CA  1 
ATOM   6127 C C   . LYS C 1 200 ? -41.624  9.640   52.829  1.00 132.94 ? 225 LYS C C   1 
ATOM   6128 O O   . LYS C 1 200 ? -41.883  8.611   53.472  1.00 90.69  ? 225 LYS C O   1 
ATOM   6129 C CB  . LYS C 1 200 ? -39.719  11.093  52.080  1.00 101.67 ? 225 LYS C CB  1 
ATOM   6130 N N   . THR C 1 201 ? -42.380  10.739  52.866  1.00 126.29 ? 226 THR C N   1 
ATOM   6131 C CA  . THR C 1 201 ? -43.515  10.889  53.780  1.00 106.36 ? 226 THR C CA  1 
ATOM   6132 C C   . THR C 1 201 ? -44.693  9.931   53.518  1.00 119.12 ? 226 THR C C   1 
ATOM   6133 O O   . THR C 1 201 ? -44.975  9.076   54.354  1.00 108.57 ? 226 THR C O   1 
ATOM   6134 C CB  . THR C 1 201 ? -44.020  12.360  53.837  1.00 111.88 ? 226 THR C CB  1 
ATOM   6135 O OG1 . THR C 1 201 ? -44.756  12.676  52.649  1.00 134.60 ? 226 THR C OG1 1 
ATOM   6136 C CG2 . THR C 1 201 ? -42.852  13.330  53.968  1.00 103.74 ? 226 THR C CG2 1 
ATOM   6137 N N   . ASP C 1 202 ? -45.372  10.080  52.375  1.00 120.80 ? 227 ASP C N   1 
ATOM   6138 C CA  . ASP C 1 202 ? -46.546  9.263   52.032  1.00 96.92  ? 227 ASP C CA  1 
ATOM   6139 C C   . ASP C 1 202 ? -46.275  8.274   50.893  1.00 103.48 ? 227 ASP C C   1 
ATOM   6140 O O   . ASP C 1 202 ? -46.483  8.598   49.727  1.00 104.02 ? 227 ASP C O   1 
ATOM   6141 C CB  . ASP C 1 202 ? -47.710  10.165  51.619  1.00 106.53 ? 227 ASP C CB  1 
ATOM   6142 C CG  . ASP C 1 202 ? -47.736  11.480  52.379  1.00 117.65 ? 227 ASP C CG  1 
ATOM   6143 O OD1 . ASP C 1 202 ? -47.818  11.442  53.625  1.00 132.06 ? 227 ASP C OD1 1 
ATOM   6144 O OD2 . ASP C 1 202 ? -47.692  12.550  51.727  1.00 108.43 ? 227 ASP C OD2 1 
ATOM   6145 N N   . PRO C 1 203 ? -45.821  7.061   51.230  1.00 101.89 ? 228 PRO C N   1 
ATOM   6146 C CA  . PRO C 1 203 ? -45.471  6.044   50.237  1.00 116.30 ? 228 PRO C CA  1 
ATOM   6147 C C   . PRO C 1 203 ? -46.674  5.234   49.783  1.00 117.55 ? 228 PRO C C   1 
ATOM   6148 O O   . PRO C 1 203 ? -46.594  4.549   48.769  1.00 100.14 ? 228 PRO C O   1 
ATOM   6149 C CB  . PRO C 1 203 ? -44.503  5.125   51.003  1.00 123.85 ? 228 PRO C CB  1 
ATOM   6150 C CG  . PRO C 1 203 ? -44.163  5.864   52.279  1.00 119.48 ? 228 PRO C CG  1 
ATOM   6151 C CD  . PRO C 1 203 ? -45.392  6.657   52.573  1.00 105.45 ? 228 PRO C CD  1 
ATOM   6152 N N   . ASP C 1 204 ? -47.762  5.302   50.542  1.00 130.64 ? 229 ASP C N   1 
ATOM   6153 C CA  . ASP C 1 204 ? -48.967  4.528   50.259  1.00 128.00 ? 229 ASP C CA  1 
ATOM   6154 C C   . ASP C 1 204 ? -50.065  5.366   49.617  1.00 125.78 ? 229 ASP C C   1 
ATOM   6155 O O   . ASP C 1 204 ? -51.211  4.932   49.524  1.00 121.68 ? 229 ASP C O   1 
ATOM   6156 C CB  . ASP C 1 204 ? -49.497  3.905   51.544  1.00 138.57 ? 229 ASP C CB  1 
ATOM   6157 C CG  . ASP C 1 204 ? -48.518  2.943   52.160  1.00 142.66 ? 229 ASP C CG  1 
ATOM   6158 O OD1 . ASP C 1 204 ? -47.933  2.140   51.400  1.00 142.52 ? 229 ASP C OD1 1 
ATOM   6159 O OD2 . ASP C 1 204 ? -48.339  2.989   53.396  1.00 159.54 ? 229 ASP C OD2 1 
ATOM   6160 N N   . CYS C 1 205 ? -49.717  6.574   49.194  1.00 119.53 ? 230 CYS C N   1 
ATOM   6161 C CA  . CYS C 1 205 ? -50.679  7.460   48.554  1.00 106.69 ? 230 CYS C CA  1 
ATOM   6162 C C   . CYS C 1 205 ? -50.685  7.268   47.038  1.00 108.45 ? 230 CYS C C   1 
ATOM   6163 O O   . CYS C 1 205 ? -49.747  7.663   46.356  1.00 113.39 ? 230 CYS C O   1 
ATOM   6164 C CB  . CYS C 1 205 ? -50.349  8.909   48.885  1.00 107.38 ? 230 CYS C CB  1 
ATOM   6165 S SG  . CYS C 1 205 ? -51.505  10.072  48.178  1.00 110.59 ? 230 CYS C SG  1 
ATOM   6166 N N   . PRO C 1 206 ? -51.760  6.676   46.506  1.00 106.16 ? 231 PRO C N   1 
ATOM   6167 C CA  . PRO C 1 206 ? -51.873  6.308   45.093  1.00 100.24 ? 231 PRO C CA  1 
ATOM   6168 C C   . PRO C 1 206 ? -52.167  7.493   44.190  1.00 98.54  ? 231 PRO C C   1 
ATOM   6169 O O   . PRO C 1 206 ? -52.356  7.304   42.993  1.00 100.89 ? 231 PRO C O   1 
ATOM   6170 C CB  . PRO C 1 206 ? -53.077  5.358   45.068  1.00 98.15  ? 231 PRO C CB  1 
ATOM   6171 C CG  . PRO C 1 206 ? -53.556  5.240   46.486  1.00 122.03 ? 231 PRO C CG  1 
ATOM   6172 C CD  . PRO C 1 206 ? -52.996  6.389   47.241  1.00 119.21 ? 231 PRO C CD  1 
ATOM   6173 N N   . ILE C 1 207 ? -52.243  8.689   44.752  1.00 91.74  ? 232 ILE C N   1 
ATOM   6174 C CA  . ILE C 1 207 ? -52.452  9.881   43.946  1.00 92.47  ? 232 ILE C CA  1 
ATOM   6175 C C   . ILE C 1 207 ? -51.105  10.535  43.668  1.00 94.82  ? 232 ILE C C   1 
ATOM   6176 O O   . ILE C 1 207 ? -50.531  11.153  44.559  1.00 104.35 ? 232 ILE C O   1 
ATOM   6177 C CB  . ILE C 1 207 ? -53.340  10.882  44.690  1.00 94.00  ? 232 ILE C CB  1 
ATOM   6178 C CG1 . ILE C 1 207 ? -54.550  10.170  45.276  1.00 86.51  ? 232 ILE C CG1 1 
ATOM   6179 C CG2 . ILE C 1 207 ? -53.776  12.007  43.784  1.00 89.26  ? 232 ILE C CG2 1 
ATOM   6180 C CD1 . ILE C 1 207 ? -55.482  11.107  46.005  1.00 106.37 ? 232 ILE C CD1 1 
ATOM   6181 N N   . PHE C 1 208 ? -50.596  10.398  42.447  1.00 90.37  ? 233 PHE C N   1 
ATOM   6182 C CA  . PHE C 1 208 ? -49.288  10.951  42.117  1.00 81.31  ? 233 PHE C CA  1 
ATOM   6183 C C   . PHE C 1 208 ? -49.405  12.289  41.403  1.00 91.11  ? 233 PHE C C   1 
ATOM   6184 O O   . PHE C 1 208 ? -50.226  12.446  40.504  1.00 81.68  ? 233 PHE C O   1 
ATOM   6185 C CB  . PHE C 1 208 ? -48.507  9.986   41.229  1.00 62.88  ? 233 PHE C CB  1 
ATOM   6186 C CG  . PHE C 1 208 ? -48.386  8.603   41.789  1.00 86.18  ? 233 PHE C CG  1 
ATOM   6187 C CD1 . PHE C 1 208 ? -47.254  8.215   42.484  1.00 96.98  ? 233 PHE C CD1 1 
ATOM   6188 C CD2 . PHE C 1 208 ? -49.395  7.675   41.600  1.00 94.77  ? 233 PHE C CD2 1 
ATOM   6189 C CE1 . PHE C 1 208 ? -47.140  6.922   42.994  1.00 101.91 ? 233 PHE C CE1 1 
ATOM   6190 C CE2 . PHE C 1 208 ? -49.284  6.390   42.103  1.00 83.34  ? 233 PHE C CE2 1 
ATOM   6191 C CZ  . PHE C 1 208 ? -48.157  6.013   42.799  1.00 90.95  ? 233 PHE C CZ  1 
ATOM   6192 N N   . ARG C 1 209 ? -48.587  13.261  41.794  1.00 110.38 ? 234 ARG C N   1 
ATOM   6193 C CA  . ARG C 1 209 ? -48.506  14.494  41.018  1.00 96.10  ? 234 ARG C CA  1 
ATOM   6194 C C   . ARG C 1 209 ? -47.751  14.178  39.746  1.00 96.30  ? 234 ARG C C   1 
ATOM   6195 O O   . ARG C 1 209 ? -46.843  13.347  39.733  1.00 84.03  ? 234 ARG C O   1 
ATOM   6196 C CB  . ARG C 1 209 ? -47.802  15.611  41.790  1.00 79.37  ? 234 ARG C CB  1 
ATOM   6197 N N   . LEU C 1 210 ? -48.124  14.848  38.669  1.00 98.28  ? 235 LEU C N   1 
ATOM   6198 C CA  . LEU C 1 210 ? -47.485  14.600  37.381  1.00 100.61 ? 235 LEU C CA  1 
ATOM   6199 C C   . LEU C 1 210 ? -46.005  14.978  37.396  1.00 102.11 ? 235 LEU C C   1 
ATOM   6200 O O   . LEU C 1 210 ? -45.149  14.141  37.098  1.00 94.03  ? 235 LEU C O   1 
ATOM   6201 C CB  . LEU C 1 210 ? -48.223  15.317  36.249  1.00 97.81  ? 235 LEU C CB  1 
ATOM   6202 C CG  . LEU C 1 210 ? -49.587  14.713  35.914  1.00 84.42  ? 235 LEU C CG  1 
ATOM   6203 C CD1 . LEU C 1 210 ? -50.149  15.316  34.637  1.00 66.90  ? 235 LEU C CD1 1 
ATOM   6204 C CD2 . LEU C 1 210 ? -49.516  13.189  35.811  1.00 74.95  ? 235 LEU C CD2 1 
ATOM   6205 N N   . GLY C 1 211 ? -45.707  16.227  37.748  1.00 104.50 ? 236 GLY C N   1 
ATOM   6206 C CA  . GLY C 1 211 ? -44.327  16.651  37.924  1.00 105.31 ? 236 GLY C CA  1 
ATOM   6207 C C   . GLY C 1 211 ? -43.458  15.683  38.720  1.00 103.45 ? 236 GLY C C   1 
ATOM   6208 O O   . GLY C 1 211 ? -42.363  15.332  38.292  1.00 98.03  ? 236 GLY C O   1 
ATOM   6209 N N   . ASP C 1 212 ? -43.940  15.246  39.880  1.00 106.15 ? 237 ASP C N   1 
ATOM   6210 C CA  . ASP C 1 212 ? -43.187  14.293  40.694  1.00 104.28 ? 237 ASP C CA  1 
ATOM   6211 C C   . ASP C 1 212 ? -42.918  13.018  39.914  1.00 90.56  ? 237 ASP C C   1 
ATOM   6212 O O   . ASP C 1 212 ? -41.878  12.391  40.070  1.00 104.85 ? 237 ASP C O   1 
ATOM   6213 C CB  . ASP C 1 212 ? -43.931  13.938  41.988  1.00 109.42 ? 237 ASP C CB  1 
ATOM   6214 C CG  . ASP C 1 212 ? -44.305  15.159  42.809  1.00 122.56 ? 237 ASP C CG  1 
ATOM   6215 O OD1 . ASP C 1 212 ? -44.208  16.296  42.296  1.00 114.26 ? 237 ASP C OD1 1 
ATOM   6216 O OD2 . ASP C 1 212 ? -44.713  14.973  43.973  1.00 111.50 ? 237 ASP C OD2 1 
ATOM   6217 N N   . ILE C 1 213 ? -43.868  12.622  39.082  1.00 95.34  ? 238 ILE C N   1 
ATOM   6218 C CA  . ILE C 1 213 ? -43.688  11.419  38.284  1.00 102.74 ? 238 ILE C CA  1 
ATOM   6219 C C   . ILE C 1 213 ? -42.525  11.598  37.322  1.00 96.66  ? 238 ILE C C   1 
ATOM   6220 O O   . ILE C 1 213 ? -41.633  10.753  37.254  1.00 90.48  ? 238 ILE C O   1 
ATOM   6221 C CB  . ILE C 1 213 ? -44.954  11.078  37.481  1.00 92.29  ? 238 ILE C CB  1 
ATOM   6222 C CG1 . ILE C 1 213 ? -45.976  10.394  38.384  1.00 87.29  ? 238 ILE C CG1 1 
ATOM   6223 C CG2 . ILE C 1 213 ? -44.623  10.175  36.314  1.00 81.04  ? 238 ILE C CG2 1 
ATOM   6224 C CD1 . ILE C 1 213 ? -47.160  9.852   37.641  1.00 93.38  ? 238 ILE C CD1 1 
ATOM   6225 N N   . VAL C 1 214 ? -42.544  12.705  36.583  1.00 85.58  ? 239 VAL C N   1 
ATOM   6226 C CA  . VAL C 1 214 ? -41.495  13.017  35.623  1.00 82.79  ? 239 VAL C CA  1 
ATOM   6227 C C   . VAL C 1 214 ? -40.177  13.246  36.332  1.00 103.34 ? 239 VAL C C   1 
ATOM   6228 O O   . VAL C 1 214 ? -39.127  12.765  35.891  1.00 91.93  ? 239 VAL C O   1 
ATOM   6229 C CB  . VAL C 1 214 ? -41.812  14.294  34.848  1.00 84.01  ? 239 VAL C CB  1 
ATOM   6230 C CG1 . VAL C 1 214 ? -40.594  14.750  34.080  1.00 92.91  ? 239 VAL C CG1 1 
ATOM   6231 C CG2 . VAL C 1 214 ? -42.977  14.069  33.915  1.00 101.35 ? 239 VAL C CG2 1 
ATOM   6232 N N   . GLY C 1 215 ? -40.239  13.999  37.429  1.00 105.24 ? 240 GLY C N   1 
ATOM   6233 C CA  . GLY C 1 215 ? -39.064  14.286  38.226  1.00 95.29  ? 240 GLY C CA  1 
ATOM   6234 C C   . GLY C 1 215 ? -38.381  13.001  38.637  1.00 97.46  ? 240 GLY C C   1 
ATOM   6235 O O   . GLY C 1 215 ? -37.277  12.704  38.194  1.00 103.13 ? 240 GLY C O   1 
ATOM   6236 N N   . GLU C 1 216 ? -39.067  12.219  39.460  1.00 92.29  ? 241 GLU C N   1 
ATOM   6237 C CA  . GLU C 1 216 ? -38.549  10.946  39.956  1.00 103.08 ? 241 GLU C CA  1 
ATOM   6238 C C   . GLU C 1 216 ? -37.809  10.155  38.881  1.00 97.56  ? 241 GLU C C   1 
ATOM   6239 O O   . GLU C 1 216 ? -36.892  9.393   39.174  1.00 96.09  ? 241 GLU C O   1 
ATOM   6240 C CB  . GLU C 1 216 ? -39.700  10.097  40.501  1.00 124.03 ? 241 GLU C CB  1 
ATOM   6241 C CG  . GLU C 1 216 ? -39.275  8.814   41.206  1.00 130.85 ? 241 GLU C CG  1 
ATOM   6242 C CD  . GLU C 1 216 ? -39.143  8.998   42.705  1.00 142.52 ? 241 GLU C CD  1 
ATOM   6243 O OE1 . GLU C 1 216 ? -39.156  10.164  43.158  1.00 144.76 ? 241 GLU C OE1 1 
ATOM   6244 O OE2 . GLU C 1 216 ? -39.033  7.978   43.424  1.00 130.81 ? 241 GLU C OE2 1 
ATOM   6245 N N   . ALA C 1 217 ? -38.228  10.334  37.636  1.00 98.56  ? 242 ALA C N   1 
ATOM   6246 C CA  . ALA C 1 217 ? -37.666  9.601   36.511  1.00 101.01 ? 242 ALA C CA  1 
ATOM   6247 C C   . ALA C 1 217 ? -36.405  10.275  35.986  1.00 106.90 ? 242 ALA C C   1 
ATOM   6248 O O   . ALA C 1 217 ? -35.872  9.903   34.933  1.00 108.24 ? 242 ALA C O   1 
ATOM   6249 C CB  . ALA C 1 217 ? -38.703  9.477   35.409  1.00 103.65 ? 242 ALA C CB  1 
ATOM   6250 N N   . GLU C 1 218 ? -35.934  11.271  36.726  1.00 103.85 ? 243 GLU C N   1 
ATOM   6251 C CA  . GLU C 1 218 ? -34.733  12.008  36.344  1.00 105.27 ? 243 GLU C CA  1 
ATOM   6252 C C   . GLU C 1 218 ? -34.954  12.791  35.061  1.00 106.35 ? 243 GLU C C   1 
ATOM   6253 O O   . GLU C 1 218 ? -34.132  12.737  34.147  1.00 117.41 ? 243 GLU C O   1 
ATOM   6254 C CB  . GLU C 1 218 ? -33.537  11.062  36.166  1.00 121.66 ? 243 GLU C CB  1 
ATOM   6255 C CG  . GLU C 1 218 ? -33.124  10.311  37.424  1.00 127.12 ? 243 GLU C CG  1 
ATOM   6256 C CD  . GLU C 1 218 ? -32.538  11.222  38.500  1.00 145.36 ? 243 GLU C CD  1 
ATOM   6257 O OE1 . GLU C 1 218 ? -32.030  12.314  38.156  1.00 128.61 ? 243 GLU C OE1 1 
ATOM   6258 O OE2 . GLU C 1 218 ? -32.583  10.838  39.691  1.00 147.61 ? 243 GLU C OE2 1 
ATOM   6259 N N   . GLU C 1 219 ? -36.064  13.515  34.996  1.00 94.80  ? 244 GLU C N   1 
ATOM   6260 C CA  . GLU C 1 219 ? -36.383  14.312  33.818  1.00 94.48  ? 244 GLU C CA  1 
ATOM   6261 C C   . GLU C 1 219 ? -36.982  15.617  34.265  1.00 100.38 ? 244 GLU C C   1 
ATOM   6262 O O   . GLU C 1 219 ? -37.126  15.863  35.460  1.00 108.48 ? 244 GLU C O   1 
ATOM   6263 C CB  . GLU C 1 219 ? -37.396  13.597  32.928  1.00 94.66  ? 244 GLU C CB  1 
ATOM   6264 C CG  . GLU C 1 219 ? -36.909  12.298  32.336  1.00 103.73 ? 244 GLU C CG  1 
ATOM   6265 C CD  . GLU C 1 219 ? -36.049  12.512  31.112  1.00 110.70 ? 244 GLU C CD  1 
ATOM   6266 O OE1 . GLU C 1 219 ? -36.152  13.603  30.500  1.00 94.49  ? 244 GLU C OE1 1 
ATOM   6267 O OE2 . GLU C 1 219 ? -35.281  11.585  30.767  1.00 118.54 ? 244 GLU C OE2 1 
ATOM   6268 N N   . ASP C 1 220 ? -37.357  16.450  33.305  1.00 88.66  ? 245 ASP C N   1 
ATOM   6269 C CA  . ASP C 1 220 ? -37.936  17.729  33.667  1.00 109.83 ? 245 ASP C CA  1 
ATOM   6270 C C   . ASP C 1 220 ? -39.242  18.038  32.942  1.00 118.57 ? 245 ASP C C   1 
ATOM   6271 O O   . ASP C 1 220 ? -39.266  18.210  31.714  1.00 96.48  ? 245 ASP C O   1 
ATOM   6272 C CB  . ASP C 1 220 ? -36.949  18.865  33.438  1.00 109.82 ? 245 ASP C CB  1 
ATOM   6273 C CG  . ASP C 1 220 ? -37.568  20.207  33.734  1.00 124.58 ? 245 ASP C CG  1 
ATOM   6274 O OD1 . ASP C 1 220 ? -38.442  20.249  34.641  1.00 135.18 ? 245 ASP C OD1 1 
ATOM   6275 O OD2 . ASP C 1 220 ? -37.203  21.197  33.060  1.00 107.08 ? 245 ASP C OD2 1 
ATOM   6276 N N   . PHE C 1 221 ? -40.320  18.141  33.719  1.00 115.20 ? 246 PHE C N   1 
ATOM   6277 C CA  . PHE C 1 221 ? -41.650  18.301  33.146  1.00 105.49 ? 246 PHE C CA  1 
ATOM   6278 C C   . PHE C 1 221 ? -41.738  19.467  32.163  1.00 93.63  ? 246 PHE C C   1 
ATOM   6279 O O   . PHE C 1 221 ? -42.370  19.358  31.120  1.00 101.07 ? 246 PHE C O   1 
ATOM   6280 C CB  . PHE C 1 221 ? -42.712  18.431  34.242  1.00 115.64 ? 246 PHE C CB  1 
ATOM   6281 C CG  . PHE C 1 221 ? -44.122  18.261  33.740  1.00 109.36 ? 246 PHE C CG  1 
ATOM   6282 C CD1 . PHE C 1 221 ? -44.800  17.074  33.944  1.00 92.77  ? 246 PHE C CD1 1 
ATOM   6283 C CD2 . PHE C 1 221 ? -44.763  19.289  33.045  1.00 100.25 ? 246 PHE C CD2 1 
ATOM   6284 C CE1 . PHE C 1 221 ? -46.100  16.921  33.473  1.00 98.92  ? 246 PHE C CE1 1 
ATOM   6285 C CE2 . PHE C 1 221 ? -46.058  19.139  32.569  1.00 81.41  ? 246 PHE C CE2 1 
ATOM   6286 C CZ  . PHE C 1 221 ? -46.725  17.961  32.782  1.00 82.96  ? 246 PHE C CZ  1 
ATOM   6287 N N   . GLN C 1 222 ? -41.094  20.576  32.480  1.00 79.37  ? 247 GLN C N   1 
ATOM   6288 C CA  . GLN C 1 222 ? -41.215  21.751  31.630  1.00 89.53  ? 247 GLN C CA  1 
ATOM   6289 C C   . GLN C 1 222 ? -40.455  21.661  30.296  1.00 108.06 ? 247 GLN C C   1 
ATOM   6290 O O   . GLN C 1 222 ? -40.896  22.215  29.280  1.00 101.23 ? 247 GLN C O   1 
ATOM   6291 C CB  . GLN C 1 222 ? -40.816  22.989  32.422  1.00 113.35 ? 247 GLN C CB  1 
ATOM   6292 C CG  . GLN C 1 222 ? -41.753  23.243  33.577  1.00 115.31 ? 247 GLN C CG  1 
ATOM   6293 C CD  . GLN C 1 222 ? -43.148  23.543  33.089  1.00 103.49 ? 247 GLN C CD  1 
ATOM   6294 O OE1 . GLN C 1 222 ? -43.334  24.181  32.043  1.00 78.21  ? 247 GLN C OE1 1 
ATOM   6295 N NE2 . GLN C 1 222 ? -44.145  23.085  33.840  1.00 109.32 ? 247 GLN C NE2 1 
ATOM   6296 N N   . ILE C 1 223 ? -39.325  20.958  30.287  1.00 113.92 ? 248 ILE C N   1 
ATOM   6297 C CA  . ILE C 1 223 ? -38.605  20.763  29.032  1.00 109.47 ? 248 ILE C CA  1 
ATOM   6298 C C   . ILE C 1 223 ? -39.307  19.698  28.183  1.00 106.61 ? 248 ILE C C   1 
ATOM   6299 O O   . ILE C 1 223 ? -39.419  19.839  26.965  1.00 102.61 ? 248 ILE C O   1 
ATOM   6300 C CB  . ILE C 1 223 ? -37.105  20.412  29.245  1.00 107.18 ? 248 ILE C CB  1 
ATOM   6301 C CG1 . ILE C 1 223 ? -36.945  19.073  29.976  1.00 137.39 ? 248 ILE C CG1 1 
ATOM   6302 C CG2 . ILE C 1 223 ? -36.399  21.541  30.008  1.00 100.58 ? 248 ILE C CG2 1 
ATOM   6303 C CD1 . ILE C 1 223 ? -35.515  18.532  29.980  1.00 122.92 ? 248 ILE C CD1 1 
ATOM   6304 N N   . MET C 1 224 ? -39.802  18.649  28.837  1.00 105.56 ? 249 MET C N   1 
ATOM   6305 C CA  . MET C 1 224 ? -40.523  17.582  28.151  1.00 101.47 ? 249 MET C CA  1 
ATOM   6306 C C   . MET C 1 224 ? -41.805  18.118  27.520  1.00 97.43  ? 249 MET C C   1 
ATOM   6307 O O   . MET C 1 224 ? -41.998  18.032  26.303  1.00 92.85  ? 249 MET C O   1 
ATOM   6308 C CB  . MET C 1 224 ? -40.856  16.445  29.127  1.00 82.53  ? 249 MET C CB  1 
ATOM   6309 C CG  . MET C 1 224 ? -41.129  15.122  28.435  1.00 87.58  ? 249 MET C CG  1 
ATOM   6310 S SD  . MET C 1 224 ? -41.635  13.738  29.497  1.00 109.06 ? 249 MET C SD  1 
ATOM   6311 C CE  . MET C 1 224 ? -40.287  13.608  30.664  1.00 98.43  ? 249 MET C CE  1 
ATOM   6312 N N   . ALA C 1 225 ? -42.655  18.695  28.364  1.00 93.29  ? 250 ALA C N   1 
ATOM   6313 C CA  . ALA C 1 225 ? -44.007  19.113  27.995  1.00 93.82  ? 250 ALA C CA  1 
ATOM   6314 C C   . ALA C 1 225 ? -44.077  20.048  26.799  1.00 94.52  ? 250 ALA C C   1 
ATOM   6315 O O   . ALA C 1 225 ? -45.162  20.461  26.389  1.00 92.24  ? 250 ALA C O   1 
ATOM   6316 C CB  . ALA C 1 225 ? -44.688  19.767  29.184  1.00 92.60  ? 250 ALA C CB  1 
ATOM   6317 N N   . VAL C 1 226 ? -42.931  20.418  26.254  1.00 94.45  ? 251 VAL C N   1 
ATOM   6318 C CA  . VAL C 1 226 ? -42.953  21.327  25.122  1.00 105.48 ? 251 VAL C CA  1 
ATOM   6319 C C   . VAL C 1 226 ? -43.140  20.549  23.819  1.00 95.10  ? 251 VAL C C   1 
ATOM   6320 O O   . VAL C 1 226 ? -43.971  20.917  22.986  1.00 93.31  ? 251 VAL C O   1 
ATOM   6321 C CB  . VAL C 1 226 ? -41.708  22.241  25.093  1.00 84.14  ? 251 VAL C CB  1 
ATOM   6322 C CG1 . VAL C 1 226 ? -40.451  21.401  25.097  1.00 92.60  ? 251 VAL C CG1 1 
ATOM   6323 C CG2 . VAL C 1 226 ? -41.757  23.183  23.885  1.00 66.02  ? 251 VAL C CG2 1 
ATOM   6324 N N   . ARG C 1 227 ? -42.390  19.455  23.677  1.00 100.02 ? 252 ARG C N   1 
ATOM   6325 C CA  . ARG C 1 227 ? -42.434  18.603  22.486  1.00 112.81 ? 252 ARG C CA  1 
ATOM   6326 C C   . ARG C 1 227 ? -43.079  17.236  22.759  1.00 104.17 ? 252 ARG C C   1 
ATOM   6327 O O   . ARG C 1 227 ? -43.307  16.435  21.846  1.00 85.22  ? 252 ARG C O   1 
ATOM   6328 C CB  . ARG C 1 227 ? -41.032  18.426  21.918  1.00 115.76 ? 252 ARG C CB  1 
ATOM   6329 N N   . GLY C 1 228 ? -43.357  16.969  24.026  1.00 97.31  ? 253 GLY C N   1 
ATOM   6330 C CA  . GLY C 1 228 ? -44.015  15.735  24.406  1.00 90.24  ? 253 GLY C CA  1 
ATOM   6331 C C   . GLY C 1 228 ? -43.075  14.569  24.653  1.00 95.37  ? 253 GLY C C   1 
ATOM   6332 O O   . GLY C 1 228 ? -41.885  14.626  24.334  1.00 105.11 ? 253 GLY C O   1 
ATOM   6333 N N   . GLY C 1 229 ? -43.620  13.506  25.234  1.00 87.07  ? 254 GLY C N   1 
ATOM   6334 C CA  . GLY C 1 229 ? -42.867  12.297  25.513  1.00 89.25  ? 254 GLY C CA  1 
ATOM   6335 C C   . GLY C 1 229 ? -43.789  11.257  26.116  1.00 87.13  ? 254 GLY C C   1 
ATOM   6336 O O   . GLY C 1 229 ? -44.990  11.506  26.238  1.00 102.10 ? 254 GLY C O   1 
ATOM   6337 N N   . VAL C 1 230 ? -43.242  10.102  26.496  1.00 75.21  ? 255 VAL C N   1 
ATOM   6338 C CA  . VAL C 1 230 ? -44.041  9.065   27.156  1.00 87.90  ? 255 VAL C CA  1 
ATOM   6339 C C   . VAL C 1 230 ? -43.373  8.545   28.414  1.00 91.26  ? 255 VAL C C   1 
ATOM   6340 O O   . VAL C 1 230 ? -42.223  8.083   28.394  1.00 88.60  ? 255 VAL C O   1 
ATOM   6341 C CB  . VAL C 1 230 ? -44.374  7.870   26.248  1.00 60.67  ? 255 VAL C CB  1 
ATOM   6342 C CG1 . VAL C 1 230 ? -45.142  8.348   25.031  1.00 80.04  ? 255 VAL C CG1 1 
ATOM   6343 C CG2 . VAL C 1 230 ? -43.117  7.135   25.849  1.00 89.69  ? 255 VAL C CG2 1 
ATOM   6344 N N   . MET C 1 231 ? -44.116  8.633   29.511  1.00 99.04  ? 256 MET C N   1 
ATOM   6345 C CA  . MET C 1 231 ? -43.638  8.220   30.820  1.00 93.70  ? 256 MET C CA  1 
ATOM   6346 C C   . MET C 1 231 ? -44.152  6.832   31.182  1.00 83.18  ? 256 MET C C   1 
ATOM   6347 O O   . MET C 1 231 ? -45.351  6.564   31.090  1.00 88.91  ? 256 MET C O   1 
ATOM   6348 C CB  . MET C 1 231 ? -44.104  9.228   31.866  1.00 95.41  ? 256 MET C CB  1 
ATOM   6349 C CG  . MET C 1 231 ? -43.318  10.518  31.839  1.00 86.92  ? 256 MET C CG  1 
ATOM   6350 S SD  . MET C 1 231 ? -41.583  10.125  32.114  1.00 109.13 ? 256 MET C SD  1 
ATOM   6351 C CE  . MET C 1 231 ? -41.733  9.063   33.564  1.00 85.56  ? 256 MET C CE  1 
ATOM   6352 N N   . GLY C 1 232 ? -43.248  5.949   31.586  1.00 87.71  ? 257 GLY C N   1 
ATOM   6353 C CA  . GLY C 1 232 ? -43.637  4.631   32.045  1.00 93.91  ? 257 GLY C CA  1 
ATOM   6354 C C   . GLY C 1 232 ? -43.798  4.589   33.552  1.00 103.30 ? 257 GLY C C   1 
ATOM   6355 O O   . GLY C 1 232 ? -42.837  4.772   34.302  1.00 104.70 ? 257 GLY C O   1 
ATOM   6356 N N   . VAL C 1 233 ? -45.027  4.365   33.999  1.00 99.75  ? 258 VAL C N   1 
ATOM   6357 C CA  . VAL C 1 233 ? -45.291  4.190   35.415  1.00 98.80  ? 258 VAL C CA  1 
ATOM   6358 C C   . VAL C 1 233 ? -45.336  2.697   35.701  1.00 92.68  ? 258 VAL C C   1 
ATOM   6359 O O   . VAL C 1 233 ? -46.364  2.054   35.506  1.00 99.17  ? 258 VAL C O   1 
ATOM   6360 C CB  . VAL C 1 233 ? -46.628  4.847   35.814  1.00 92.83  ? 258 VAL C CB  1 
ATOM   6361 C CG1 . VAL C 1 233 ? -46.884  4.689   37.312  1.00 77.17  ? 258 VAL C CG1 1 
ATOM   6362 C CG2 . VAL C 1 233 ? -46.632  6.315   35.418  1.00 81.35  ? 258 VAL C CG2 1 
ATOM   6363 N N   . GLN C 1 234 ? -44.218  2.137   36.146  1.00 90.49  ? 259 GLN C N   1 
ATOM   6364 C CA  . GLN C 1 234 ? -44.163  0.701   36.370  1.00 100.96 ? 259 GLN C CA  1 
ATOM   6365 C C   . GLN C 1 234 ? -44.621  0.333   37.760  1.00 92.33  ? 259 GLN C C   1 
ATOM   6366 O O   . GLN C 1 234 ? -44.094  0.842   38.740  1.00 108.98 ? 259 GLN C O   1 
ATOM   6367 C CB  . GLN C 1 234 ? -42.754  0.166   36.129  1.00 115.16 ? 259 GLN C CB  1 
ATOM   6368 C CG  . GLN C 1 234 ? -42.264  0.356   34.715  1.00 123.52 ? 259 GLN C CG  1 
ATOM   6369 C CD  . GLN C 1 234 ? -40.770  0.220   34.616  1.00 144.78 ? 259 GLN C CD  1 
ATOM   6370 O OE1 . GLN C 1 234 ? -40.169  0.572   33.595  1.00 152.41 ? 259 GLN C OE1 1 
ATOM   6371 N NE2 . GLN C 1 234 ? -40.149  -0.284  35.686  1.00 137.30 ? 259 GLN C NE2 1 
ATOM   6372 N N   . ILE C 1 235 ? -45.604  -0.557  37.841  1.00 85.24  ? 260 ILE C N   1 
ATOM   6373 C CA  . ILE C 1 235 ? -46.006  -1.124  39.123  1.00 96.09  ? 260 ILE C CA  1 
ATOM   6374 C C   . ILE C 1 235 ? -45.573  -2.587  39.198  1.00 103.76 ? 260 ILE C C   1 
ATOM   6375 O O   . ILE C 1 235 ? -45.948  -3.390  38.338  1.00 91.70  ? 260 ILE C O   1 
ATOM   6376 C CB  . ILE C 1 235 ? -47.523  -1.008  39.340  1.00 90.67  ? 260 ILE C CB  1 
ATOM   6377 C CG1 . ILE C 1 235 ? -47.949  0.459   39.281  1.00 87.58  ? 260 ILE C CG1 1 
ATOM   6378 C CG2 . ILE C 1 235 ? -47.920  -1.629  40.664  1.00 92.89  ? 260 ILE C CG2 1 
ATOM   6379 C CD1 . ILE C 1 235 ? -49.446  0.654   39.250  1.00 75.46  ? 260 ILE C CD1 1 
ATOM   6380 N N   . ARG C 1 236 ? -44.773  -2.924  40.211  1.00 99.27  ? 261 ARG C N   1 
ATOM   6381 C CA  . ARG C 1 236 ? -44.272  -4.289  40.374  1.00 105.48 ? 261 ARG C CA  1 
ATOM   6382 C C   . ARG C 1 236 ? -44.867  -5.007  41.591  1.00 103.54 ? 261 ARG C C   1 
ATOM   6383 O O   . ARG C 1 236 ? -44.671  -4.575  42.726  1.00 94.51  ? 261 ARG C O   1 
ATOM   6384 C CB  . ARG C 1 236 ? -42.736  -4.304  40.429  1.00 120.74 ? 261 ARG C CB  1 
ATOM   6385 C CG  . ARG C 1 236 ? -42.105  -5.606  39.917  1.00 130.07 ? 261 ARG C CG  1 
ATOM   6386 C CD  . ARG C 1 236 ? -40.566  -5.590  39.956  1.00 114.27 ? 261 ARG C CD  1 
ATOM   6387 N NE  . ARG C 1 236 ? -40.059  -5.940  41.281  1.00 159.27 ? 261 ARG C NE  1 
ATOM   6388 C CZ  . ARG C 1 236 ? -39.710  -5.052  42.211  1.00 171.65 ? 261 ARG C CZ  1 
ATOM   6389 N NH1 . ARG C 1 236 ? -39.803  -3.754  41.954  1.00 169.08 ? 261 ARG C NH1 1 
ATOM   6390 N NH2 . ARG C 1 236 ? -39.263  -5.457  43.398  1.00 138.22 ? 261 ARG C NH2 1 
ATOM   6391 N N   . TRP C 1 237 ? -45.590  -6.094  41.342  1.00 99.61  ? 262 TRP C N   1 
ATOM   6392 C CA  . TRP C 1 237 ? -46.137  -6.945  42.408  1.00 105.38 ? 262 TRP C CA  1 
ATOM   6393 C C   . TRP C 1 237 ? -45.319  -8.214  42.592  1.00 107.44 ? 262 TRP C C   1 
ATOM   6394 O O   . TRP C 1 237 ? -45.578  -9.226  41.945  1.00 107.86 ? 262 TRP C O   1 
ATOM   6395 C CB  . TRP C 1 237 ? -47.593  -7.330  42.127  1.00 108.16 ? 262 TRP C CB  1 
ATOM   6396 C CG  . TRP C 1 237 ? -48.519  -6.160  42.055  1.00 110.33 ? 262 TRP C CG  1 
ATOM   6397 C CD1 . TRP C 1 237 ? -48.724  -5.340  40.986  1.00 110.95 ? 262 TRP C CD1 1 
ATOM   6398 C CD2 . TRP C 1 237 ? -49.366  -5.674  43.099  1.00 103.86 ? 262 TRP C CD2 1 
ATOM   6399 N NE1 . TRP C 1 237 ? -49.644  -4.371  41.300  1.00 95.13  ? 262 TRP C NE1 1 
ATOM   6400 C CE2 . TRP C 1 237 ? -50.053  -4.556  42.593  1.00 99.99  ? 262 TRP C CE2 1 
ATOM   6401 C CE3 . TRP C 1 237 ? -49.608  -6.075  44.414  1.00 113.77 ? 262 TRP C CE3 1 
ATOM   6402 C CZ2 . TRP C 1 237 ? -50.967  -3.838  43.356  1.00 105.62 ? 262 TRP C CZ2 1 
ATOM   6403 C CZ3 . TRP C 1 237 ? -50.517  -5.360  45.169  1.00 103.44 ? 262 TRP C CZ3 1 
ATOM   6404 C CH2 . TRP C 1 237 ? -51.185  -4.257  44.640  1.00 95.33  ? 262 TRP C CH2 1 
ATOM   6405 N N   . ASP C 1 238 ? -44.334  -8.159  43.479  1.00 114.93 ? 263 ASP C N   1 
ATOM   6406 C CA  . ASP C 1 238 ? -43.525  -9.325  43.790  1.00 115.87 ? 263 ASP C CA  1 
ATOM   6407 C C   . ASP C 1 238 ? -43.812  -9.783  45.201  1.00 109.11 ? 263 ASP C C   1 
ATOM   6408 O O   . ASP C 1 238 ? -43.237  -9.281  46.162  1.00 134.56 ? 263 ASP C O   1 
ATOM   6409 C CB  . ASP C 1 238 ? -42.043  -9.007  43.620  1.00 123.15 ? 263 ASP C CB  1 
ATOM   6410 C CG  . ASP C 1 238 ? -41.630  -8.953  42.164  1.00 132.55 ? 263 ASP C CG  1 
ATOM   6411 O OD1 . ASP C 1 238 ? -42.462  -9.314  41.305  1.00 132.36 ? 263 ASP C OD1 1 
ATOM   6412 O OD2 . ASP C 1 238 ? -40.482  -8.560  41.875  1.00 139.96 ? 263 ASP C OD2 1 
ATOM   6413 N N   . CYS C 1 239 ? -44.708  -10.749 45.316  1.00 111.56 ? 264 CYS C N   1 
ATOM   6414 C CA  . CYS C 1 239 ? -45.159  -11.226 46.611  1.00 129.79 ? 264 CYS C CA  1 
ATOM   6415 C C   . CYS C 1 239 ? -44.663  -12.629 46.933  1.00 140.79 ? 264 CYS C C   1 
ATOM   6416 O O   . CYS C 1 239 ? -44.474  -13.455 46.036  1.00 138.26 ? 264 CYS C O   1 
ATOM   6417 C CB  . CYS C 1 239 ? -46.685  -11.184 46.671  1.00 127.01 ? 264 CYS C CB  1 
ATOM   6418 S SG  . CYS C 1 239 ? -47.366  -9.518  46.585  1.00 130.35 ? 264 CYS C SG  1 
ATOM   6419 N N   . ASP C 1 240 ? -44.441  -12.885 48.218  1.00 132.90 ? 265 ASP C N   1 
ATOM   6420 C CA  . ASP C 1 240 ? -44.193  -14.237 48.682  1.00 134.83 ? 265 ASP C CA  1 
ATOM   6421 C C   . ASP C 1 240 ? -45.485  -14.755 49.284  1.00 129.09 ? 265 ASP C C   1 
ATOM   6422 O O   . ASP C 1 240 ? -45.874  -14.356 50.375  1.00 134.32 ? 265 ASP C O   1 
ATOM   6423 C CB  . ASP C 1 240 ? -43.062  -14.257 49.707  1.00 141.99 ? 265 ASP C CB  1 
ATOM   6424 C CG  . ASP C 1 240 ? -42.406  -15.619 49.828  1.00 150.14 ? 265 ASP C CG  1 
ATOM   6425 O OD1 . ASP C 1 240 ? -42.814  -16.540 49.093  1.00 163.48 ? 265 ASP C OD1 1 
ATOM   6426 O OD2 . ASP C 1 240 ? -41.480  -15.770 50.652  1.00 121.31 ? 265 ASP C OD2 1 
ATOM   6427 N N   . LEU C 1 241 ? -46.145  -15.645 48.556  1.00 137.37 ? 266 LEU C N   1 
ATOM   6428 C CA  . LEU C 1 241 ? -47.476  -16.109 48.925  1.00 135.93 ? 266 LEU C CA  1 
ATOM   6429 C C   . LEU C 1 241 ? -47.517  -16.792 50.293  1.00 144.94 ? 266 LEU C C   1 
ATOM   6430 O O   . LEU C 1 241 ? -48.463  -16.598 51.058  1.00 139.31 ? 266 LEU C O   1 
ATOM   6431 C CB  . LEU C 1 241 ? -48.031  -17.031 47.846  1.00 118.80 ? 266 LEU C CB  1 
ATOM   6432 N N   . ASP C 1 242 ? -46.491  -17.585 50.594  1.00 163.64 ? 267 ASP C N   1 
ATOM   6433 C CA  . ASP C 1 242 ? -46.412  -18.307 51.864  1.00 159.11 ? 267 ASP C CA  1 
ATOM   6434 C C   . ASP C 1 242 ? -46.298  -17.350 53.068  1.00 165.47 ? 267 ASP C C   1 
ATOM   6435 O O   . ASP C 1 242 ? -46.668  -17.698 54.194  1.00 176.09 ? 267 ASP C O   1 
ATOM   6436 C CB  . ASP C 1 242 ? -45.281  -19.353 51.830  1.00 147.77 ? 267 ASP C CB  1 
ATOM   6437 C CG  . ASP C 1 242 ? -44.009  -18.828 51.179  1.00 153.74 ? 267 ASP C CG  1 
ATOM   6438 O OD1 . ASP C 1 242 ? -43.378  -19.580 50.402  1.00 127.21 ? 267 ASP C OD1 1 
ATOM   6439 O OD2 . ASP C 1 242 ? -43.638  -17.664 51.448  1.00 158.35 ? 267 ASP C OD2 1 
ATOM   6440 N N   . MET C 1 243 ? -45.796  -16.142 52.809  1.00 148.74 ? 268 MET C N   1 
ATOM   6441 C CA  . MET C 1 243 ? -45.816  -15.038 53.773  1.00 137.83 ? 268 MET C CA  1 
ATOM   6442 C C   . MET C 1 243 ? -47.230  -14.513 53.957  1.00 157.50 ? 268 MET C C   1 
ATOM   6443 O O   . MET C 1 243 ? -48.103  -14.795 53.140  1.00 165.46 ? 268 MET C O   1 
ATOM   6444 C CB  . MET C 1 243 ? -44.965  -13.879 53.260  1.00 144.00 ? 268 MET C CB  1 
ATOM   6445 C CG  . MET C 1 243 ? -43.530  -14.235 53.003  1.00 154.89 ? 268 MET C CG  1 
ATOM   6446 S SD  . MET C 1 243 ? -42.677  -14.504 54.554  1.00 151.72 ? 268 MET C SD  1 
ATOM   6447 C CE  . MET C 1 243 ? -43.093  -12.987 55.412  1.00 127.91 ? 268 MET C CE  1 
ATOM   6448 N N   . PRO C 1 244 ? -47.458  -13.716 55.015  1.00 158.52 ? 269 PRO C N   1 
ATOM   6449 C CA  . PRO C 1 244 ? -48.796  -13.153 55.229  1.00 163.88 ? 269 PRO C CA  1 
ATOM   6450 C C   . PRO C 1 244 ? -49.230  -12.281 54.055  1.00 154.67 ? 269 PRO C C   1 
ATOM   6451 O O   . PRO C 1 244 ? -48.408  -11.565 53.476  1.00 133.02 ? 269 PRO C O   1 
ATOM   6452 C CB  . PRO C 1 244 ? -48.620  -12.300 56.490  1.00 154.68 ? 269 PRO C CB  1 
ATOM   6453 C CG  . PRO C 1 244 ? -47.439  -12.894 57.184  1.00 140.03 ? 269 PRO C CG  1 
ATOM   6454 C CD  . PRO C 1 244 ? -46.522  -13.325 56.082  1.00 139.31 ? 269 PRO C CD  1 
ATOM   6455 N N   . GLN C 1 245 ? -50.512  -12.356 53.709  1.00 155.50 ? 270 GLN C N   1 
ATOM   6456 C CA  . GLN C 1 245 ? -51.051  -11.595 52.593  1.00 142.88 ? 270 GLN C CA  1 
ATOM   6457 C C   . GLN C 1 245 ? -50.857  -10.100 52.825  1.00 130.98 ? 270 GLN C C   1 
ATOM   6458 O O   . GLN C 1 245 ? -51.030  -9.291  51.920  1.00 128.65 ? 270 GLN C O   1 
ATOM   6459 C CB  . GLN C 1 245 ? -52.523  -11.930 52.387  1.00 116.99 ? 270 GLN C CB  1 
ATOM   6460 N N   . SER C 1 246 ? -50.490  -9.743  54.048  1.00 134.00 ? 271 SER C N   1 
ATOM   6461 C CA  . SER C 1 246 ? -50.277  -8.348  54.409  1.00 137.96 ? 271 SER C CA  1 
ATOM   6462 C C   . SER C 1 246 ? -48.951  -7.797  53.873  1.00 135.66 ? 271 SER C C   1 
ATOM   6463 O O   . SER C 1 246 ? -48.799  -6.590  53.707  1.00 108.74 ? 271 SER C O   1 
ATOM   6464 C CB  . SER C 1 246 ? -50.363  -8.180  55.931  1.00 134.53 ? 271 SER C CB  1 
ATOM   6465 O OG  . SER C 1 246 ? -50.230  -6.823  56.310  1.00 127.84 ? 271 SER C OG  1 
ATOM   6466 N N   . TRP C 1 247 ? -47.998  -8.686  53.604  1.00 149.21 ? 272 TRP C N   1 
ATOM   6467 C CA  . TRP C 1 247 ? -46.668  -8.289  53.133  1.00 148.09 ? 272 TRP C CA  1 
ATOM   6468 C C   . TRP C 1 247 ? -46.638  -8.010  51.630  1.00 136.19 ? 272 TRP C C   1 
ATOM   6469 O O   . TRP C 1 247 ? -45.628  -7.550  51.092  1.00 125.00 ? 272 TRP C O   1 
ATOM   6470 C CB  . TRP C 1 247 ? -45.632  -9.369  53.464  1.00 165.30 ? 272 TRP C CB  1 
ATOM   6471 C CG  . TRP C 1 247 ? -45.412  -9.598  54.933  1.00 171.99 ? 272 TRP C CG  1 
ATOM   6472 C CD1 . TRP C 1 247 ? -46.242  -10.254 55.792  1.00 163.17 ? 272 TRP C CD1 1 
ATOM   6473 C CD2 . TRP C 1 247 ? -44.277  -9.186  55.710  1.00 171.53 ? 272 TRP C CD2 1 
ATOM   6474 N NE1 . TRP C 1 247 ? -45.701  -10.272 57.053  1.00 146.69 ? 272 TRP C NE1 1 
ATOM   6475 C CE2 . TRP C 1 247 ? -44.497  -9.624  57.029  1.00 157.45 ? 272 TRP C CE2 1 
ATOM   6476 C CE3 . TRP C 1 247 ? -43.102  -8.487  55.416  1.00 164.81 ? 272 TRP C CE3 1 
ATOM   6477 C CZ2 . TRP C 1 247 ? -43.584  -9.383  58.052  1.00 171.85 ? 272 TRP C CZ2 1 
ATOM   6478 C CZ3 . TRP C 1 247 ? -42.199  -8.252  56.433  1.00 138.79 ? 272 TRP C CZ3 1 
ATOM   6479 C CH2 . TRP C 1 247 ? -42.445  -8.698  57.735  1.00 164.17 ? 272 TRP C CH2 1 
ATOM   6480 N N   . CYS C 1 248 ? -47.746  -8.315  50.961  1.00 136.30 ? 273 CYS C N   1 
ATOM   6481 C CA  . CYS C 1 248 ? -47.887  -8.122  49.520  1.00 115.48 ? 273 CYS C CA  1 
ATOM   6482 C C   . CYS C 1 248 ? -48.166  -6.667  49.186  1.00 116.09 ? 273 CYS C C   1 
ATOM   6483 O O   . CYS C 1 248 ? -49.207  -6.133  49.549  1.00 124.50 ? 273 CYS C O   1 
ATOM   6484 C CB  . CYS C 1 248 ? -49.039  -8.978  49.008  1.00 119.04 ? 273 CYS C CB  1 
ATOM   6485 S SG  . CYS C 1 248 ? -49.218  -8.988  47.230  1.00 152.72 ? 273 CYS C SG  1 
ATOM   6486 N N   . VAL C 1 249 ? -47.249  -6.031  48.470  1.00 115.85 ? 274 VAL C N   1 
ATOM   6487 C CA  . VAL C 1 249 ? -47.325  -4.591  48.258  1.00 112.90 ? 274 VAL C CA  1 
ATOM   6488 C C   . VAL C 1 249 ? -46.731  -4.228  46.899  1.00 117.14 ? 274 VAL C C   1 
ATOM   6489 O O   . VAL C 1 249 ? -45.836  -4.913  46.415  1.00 124.13 ? 274 VAL C O   1 
ATOM   6490 C CB  . VAL C 1 249 ? -46.572  -3.840  49.386  1.00 109.59 ? 274 VAL C CB  1 
ATOM   6491 C CG1 . VAL C 1 249 ? -46.604  -2.337  49.178  1.00 114.67 ? 274 VAL C CG1 1 
ATOM   6492 C CG2 . VAL C 1 249 ? -47.151  -4.200  50.747  1.00 100.13 ? 274 VAL C CG2 1 
ATOM   6493 N N   . PRO C 1 250 ? -47.250  -3.164  46.269  1.00 107.43 ? 275 PRO C N   1 
ATOM   6494 C CA  . PRO C 1 250 ? -46.790  -2.654  44.970  1.00 113.53 ? 275 PRO C CA  1 
ATOM   6495 C C   . PRO C 1 250 ? -45.518  -1.816  45.055  1.00 119.11 ? 275 PRO C C   1 
ATOM   6496 O O   . PRO C 1 250 ? -45.447  -0.943  45.914  1.00 116.11 ? 275 PRO C O   1 
ATOM   6497 C CB  . PRO C 1 250 ? -47.938  -1.738  44.528  1.00 112.49 ? 275 PRO C CB  1 
ATOM   6498 C CG  . PRO C 1 250 ? -49.074  -2.039  45.430  1.00 111.84 ? 275 PRO C CG  1 
ATOM   6499 C CD  . PRO C 1 250 ? -48.491  -2.510  46.703  1.00 107.52 ? 275 PRO C CD  1 
ATOM   6500 N N   . ARG C 1 251 ? -44.551  -2.049  44.167  1.00 113.56 ? 276 ARG C N   1 
ATOM   6501 C CA  . ARG C 1 251 ? -43.372  -1.184  44.080  1.00 118.34 ? 276 ARG C CA  1 
ATOM   6502 C C   . ARG C 1 251 ? -43.383  -0.281  42.831  1.00 115.63 ? 276 ARG C C   1 
ATOM   6503 O O   . ARG C 1 251 ? -43.239  -0.752  41.696  1.00 97.51  ? 276 ARG C O   1 
ATOM   6504 C CB  . ARG C 1 251 ? -42.090  -2.008  44.150  1.00 102.57 ? 276 ARG C CB  1 
ATOM   6505 N N   . TYR C 1 252 ? -43.539  1.022   43.056  1.00 99.16  ? 277 TYR C N   1 
ATOM   6506 C CA  . TYR C 1 252 ? -43.640  1.996   41.963  1.00 101.59 ? 277 TYR C CA  1 
ATOM   6507 C C   . TYR C 1 252 ? -42.294  2.520   41.441  1.00 108.32 ? 277 TYR C C   1 
ATOM   6508 O O   . TYR C 1 252 ? -41.423  2.903   42.201  1.00 112.50 ? 277 TYR C O   1 
ATOM   6509 C CB  . TYR C 1 252 ? -44.489  3.197   42.391  1.00 91.54  ? 277 TYR C CB  1 
ATOM   6510 C CG  . TYR C 1 252 ? -45.850  2.844   42.968  1.00 112.79 ? 277 TYR C CG  1 
ATOM   6511 C CD1 . TYR C 1 252 ? -46.025  2.646   44.336  1.00 129.65 ? 277 TYR C CD1 1 
ATOM   6512 C CD2 . TYR C 1 252 ? -46.963  2.706   42.145  1.00 106.14 ? 277 TYR C CD2 1 
ATOM   6513 C CE1 . TYR C 1 252 ? -47.271  2.315   44.862  1.00 131.99 ? 277 TYR C CE1 1 
ATOM   6514 C CE2 . TYR C 1 252 ? -48.212  2.377   42.667  1.00 86.85  ? 277 TYR C CE2 1 
ATOM   6515 C CZ  . TYR C 1 252 ? -48.356  2.184   44.021  1.00 108.95 ? 277 TYR C CZ  1 
ATOM   6516 O OH  . TYR C 1 252 ? -49.585  1.860   44.542  1.00 95.38  ? 277 TYR C OH  1 
ATOM   6517 N N   . THR C 1 253 ? -42.146  2.534   40.123  1.00 108.96 ? 278 THR C N   1 
ATOM   6518 C CA  . THR C 1 253 ? -40.931  2.982   39.454  1.00 93.98  ? 278 THR C CA  1 
ATOM   6519 C C   . THR C 1 253 ? -41.348  3.982   38.394  1.00 99.52  ? 278 THR C C   1 
ATOM   6520 O O   . THR C 1 253 ? -42.520  4.050   38.036  1.00 100.92 ? 278 THR C O   1 
ATOM   6521 C CB  . THR C 1 253 ? -40.191  1.811   38.761  1.00 101.38 ? 278 THR C CB  1 
ATOM   6522 O OG1 . THR C 1 253 ? -40.411  0.588   39.477  1.00 97.53  ? 278 THR C OG1 1 
ATOM   6523 C CG2 . THR C 1 253 ? -38.702  2.090   38.660  1.00 99.71  ? 278 THR C CG2 1 
ATOM   6524 N N   . PHE C 1 254 ? -40.391  4.736   37.868  1.00 102.46 ? 279 PHE C N   1 
ATOM   6525 C CA  . PHE C 1 254 ? -40.711  5.736   36.852  1.00 107.04 ? 279 PHE C CA  1 
ATOM   6526 C C   . PHE C 1 254 ? -39.593  5.870   35.842  1.00 110.92 ? 279 PHE C C   1 
ATOM   6527 O O   . PHE C 1 254 ? -38.445  6.127   36.215  1.00 117.98 ? 279 PHE C O   1 
ATOM   6528 C CB  . PHE C 1 254 ? -40.964  7.104   37.483  1.00 102.95 ? 279 PHE C CB  1 
ATOM   6529 C CG  . PHE C 1 254 ? -42.092  7.118   38.458  1.00 107.28 ? 279 PHE C CG  1 
ATOM   6530 C CD1 . PHE C 1 254 ? -41.905  6.677   39.757  1.00 122.56 ? 279 PHE C CD1 1 
ATOM   6531 C CD2 . PHE C 1 254 ? -43.339  7.572   38.086  1.00 104.15 ? 279 PHE C CD2 1 
ATOM   6532 C CE1 . PHE C 1 254 ? -42.948  6.688   40.666  1.00 114.48 ? 279 PHE C CE1 1 
ATOM   6533 C CE2 . PHE C 1 254 ? -44.386  7.582   38.994  1.00 104.10 ? 279 PHE C CE2 1 
ATOM   6534 C CZ  . PHE C 1 254 ? -44.187  7.143   40.283  1.00 102.94 ? 279 PHE C CZ  1 
ATOM   6535 N N   . ARG C 1 255 ? -39.944  5.706   34.567  1.00 108.94 ? 280 ARG C N   1 
ATOM   6536 C CA  . ARG C 1 255 ? -38.989  5.800   33.470  1.00 105.20 ? 280 ARG C CA  1 
ATOM   6537 C C   . ARG C 1 255 ? -39.558  6.708   32.409  1.00 107.89 ? 280 ARG C C   1 
ATOM   6538 O O   . ARG C 1 255 ? -40.771  6.730   32.196  1.00 109.22 ? 280 ARG C O   1 
ATOM   6539 C CB  . ARG C 1 255 ? -38.753  4.431   32.822  1.00 99.30  ? 280 ARG C CB  1 
ATOM   6540 C CG  . ARG C 1 255 ? -37.681  3.571   33.469  1.00 114.90 ? 280 ARG C CG  1 
ATOM   6541 C CD  . ARG C 1 255 ? -37.230  2.446   32.526  1.00 151.30 ? 280 ARG C CD  1 
ATOM   6542 N NE  . ARG C 1 255 ? -38.328  1.864   31.742  1.00 160.41 ? 280 ARG C NE  1 
ATOM   6543 C CZ  . ARG C 1 255 ? -38.155  1.088   30.668  1.00 155.11 ? 280 ARG C CZ  1 
ATOM   6544 N NH1 . ARG C 1 255 ? -36.929  0.800   30.245  1.00 154.26 ? 280 ARG C NH1 1 
ATOM   6545 N NH2 . ARG C 1 255 ? -39.199  0.598   30.004  1.00 124.33 ? 280 ARG C NH2 1 
ATOM   6546 N N   . ARG C 1 256 ? -38.688  7.470   31.755  1.00 98.34  ? 281 ARG C N   1 
ATOM   6547 C CA  . ARG C 1 256 ? -39.032  8.062   30.470  1.00 91.99  ? 281 ARG C CA  1 
ATOM   6548 C C   . ARG C 1 256 ? -38.816  6.967   29.435  1.00 100.65 ? 281 ARG C C   1 
ATOM   6549 O O   . ARG C 1 256 ? -37.811  6.255   29.490  1.00 101.72 ? 281 ARG C O   1 
ATOM   6550 C CB  . ARG C 1 256 ? -38.140  9.260   30.159  1.00 86.19  ? 281 ARG C CB  1 
ATOM   6551 C CG  . ARG C 1 256 ? -38.111  9.629   28.686  1.00 92.94  ? 281 ARG C CG  1 
ATOM   6552 C CD  . ARG C 1 256 ? -39.210  10.612  28.335  1.00 94.32  ? 281 ARG C CD  1 
ATOM   6553 N NE  . ARG C 1 256 ? -38.741  11.999  28.369  1.00 102.19 ? 281 ARG C NE  1 
ATOM   6554 C CZ  . ARG C 1 256 ? -38.480  12.737  27.293  1.00 96.69  ? 281 ARG C CZ  1 
ATOM   6555 N NH1 . ARG C 1 256 ? -38.642  12.230  26.084  1.00 89.27  ? 281 ARG C NH1 1 
ATOM   6556 N NH2 . ARG C 1 256 ? -38.062  13.985  27.426  1.00 104.97 ? 281 ARG C NH2 1 
ATOM   6557 N N   . LEU C 1 257 ? -39.754  6.806   28.509  1.00 91.91  ? 282 LEU C N   1 
ATOM   6558 C CA  . LEU C 1 257 ? -39.658  5.701   27.560  1.00 86.11  ? 282 LEU C CA  1 
ATOM   6559 C C   . LEU C 1 257 ? -39.125  6.076   26.173  1.00 103.75 ? 282 LEU C C   1 
ATOM   6560 O O   . LEU C 1 257 ? -38.394  5.296   25.563  1.00 120.84 ? 282 LEU C O   1 
ATOM   6561 C CB  . LEU C 1 257 ? -40.990  4.954   27.460  1.00 101.59 ? 282 LEU C CB  1 
ATOM   6562 C CG  . LEU C 1 257 ? -41.439  4.326   28.784  1.00 104.87 ? 282 LEU C CG  1 
ATOM   6563 C CD1 . LEU C 1 257 ? -42.883  3.817   28.734  1.00 103.09 ? 282 LEU C CD1 1 
ATOM   6564 C CD2 . LEU C 1 257 ? -40.481  3.213   29.208  1.00 105.67 ? 282 LEU C CD2 1 
ATOM   6565 N N   . ASP C 1 258 ? -39.483  7.256   25.673  1.00 92.34  ? 283 ASP C N   1 
ATOM   6566 C CA  . ASP C 1 258 ? -39.003  7.680   24.356  1.00 98.81  ? 283 ASP C CA  1 
ATOM   6567 C C   . ASP C 1 258 ? -37.595  8.267   24.394  1.00 117.50 ? 283 ASP C C   1 
ATOM   6568 O O   . ASP C 1 258 ? -37.065  8.615   25.452  1.00 116.42 ? 283 ASP C O   1 
ATOM   6569 C CB  . ASP C 1 258 ? -39.953  8.694   23.721  1.00 97.19  ? 283 ASP C CB  1 
ATOM   6570 C CG  . ASP C 1 258 ? -40.156  9.916   24.589  1.00 98.79  ? 283 ASP C CG  1 
ATOM   6571 O OD1 . ASP C 1 258 ? -40.412  9.739   25.801  1.00 87.99  ? 283 ASP C OD1 1 
ATOM   6572 O OD2 . ASP C 1 258 ? -40.062  11.044  24.056  1.00 104.46 ? 283 ASP C OD2 1 
ATOM   6573 N N   . ASN C 1 259 ? -36.992  8.374   23.218  1.00 127.33 ? 284 ASN C N   1 
ATOM   6574 C CA  . ASN C 1 259 ? -35.654  8.935   23.103  1.00 134.88 ? 284 ASN C CA  1 
ATOM   6575 C C   . ASN C 1 259 ? -35.675  10.457  22.951  1.00 141.44 ? 284 ASN C C   1 
ATOM   6576 O O   . ASN C 1 259 ? -36.398  11.000  22.103  1.00 133.50 ? 284 ASN C O   1 
ATOM   6577 C CB  . ASN C 1 259 ? -34.910  8.298   21.923  1.00 134.47 ? 284 ASN C CB  1 
ATOM   6578 C CG  . ASN C 1 259 ? -33.427  8.627   21.923  1.00 152.05 ? 284 ASN C CG  1 
ATOM   6579 O OD1 . ASN C 1 259 ? -32.873  9.074   22.935  1.00 157.68 ? 284 ASN C OD1 1 
ATOM   6580 N ND2 . ASN C 1 259 ? -32.773  8.404   20.788  1.00 150.73 ? 284 ASN C ND2 1 
ATOM   6581 N N   . LYS C 1 260 ? -34.878  11.132  23.777  1.00 148.58 ? 285 LYS C N   1 
ATOM   6582 C CA  . LYS C 1 260 ? -34.737  12.584  23.712  1.00 141.66 ? 285 LYS C CA  1 
ATOM   6583 C C   . LYS C 1 260 ? -33.720  13.032  22.644  1.00 147.80 ? 285 LYS C C   1 
ATOM   6584 O O   . LYS C 1 260 ? -33.769  14.167  22.168  1.00 149.85 ? 285 LYS C O   1 
ATOM   6585 C CB  . LYS C 1 260 ? -34.369  13.142  25.087  1.00 118.84 ? 285 LYS C CB  1 
ATOM   6586 N N   . ASP C 1 261 ? -32.808  12.134  22.275  1.00 140.78 ? 286 ASP C N   1 
ATOM   6587 C CA  . ASP C 1 261 ? -31.789  12.403  21.260  1.00 134.03 ? 286 ASP C CA  1 
ATOM   6588 C C   . ASP C 1 261 ? -32.404  12.646  19.877  1.00 145.49 ? 286 ASP C C   1 
ATOM   6589 O O   . ASP C 1 261 ? -32.995  11.735  19.294  1.00 142.05 ? 286 ASP C O   1 
ATOM   6590 C CB  . ASP C 1 261 ? -30.813  11.224  21.199  1.00 135.29 ? 286 ASP C CB  1 
ATOM   6591 C CG  . ASP C 1 261 ? -29.797  11.358  20.076  1.00 156.62 ? 286 ASP C CG  1 
ATOM   6592 O OD1 . ASP C 1 261 ? -29.532  12.497  19.631  1.00 161.99 ? 286 ASP C OD1 1 
ATOM   6593 O OD2 . ASP C 1 261 ? -29.255  10.320  19.638  1.00 162.11 ? 286 ASP C OD2 1 
ATOM   6594 N N   . PRO C 1 262 ? -32.256  13.876  19.342  1.00 153.95 ? 287 PRO C N   1 
ATOM   6595 C CA  . PRO C 1 262 ? -32.819  14.230  18.027  1.00 138.61 ? 287 PRO C CA  1 
ATOM   6596 C C   . PRO C 1 262 ? -32.315  13.332  16.895  1.00 145.59 ? 287 PRO C C   1 
ATOM   6597 O O   . PRO C 1 262 ? -33.083  13.004  15.985  1.00 149.02 ? 287 PRO C O   1 
ATOM   6598 C CB  . PRO C 1 262 ? -32.326  15.664  17.805  1.00 145.73 ? 287 PRO C CB  1 
ATOM   6599 C CG  . PRO C 1 262 ? -32.083  16.199  19.175  1.00 151.86 ? 287 PRO C CG  1 
ATOM   6600 C CD  . PRO C 1 262 ? -31.600  15.028  19.989  1.00 160.41 ? 287 PRO C CD  1 
ATOM   6601 N N   . ASP C 1 263 ? -31.038  12.961  16.945  1.00 151.76 ? 288 ASP C N   1 
ATOM   6602 C CA  . ASP C 1 263 ? -30.463  12.031  15.973  1.00 165.70 ? 288 ASP C CA  1 
ATOM   6603 C C   . ASP C 1 263 ? -30.818  10.588  16.320  1.00 159.64 ? 288 ASP C C   1 
ATOM   6604 O O   . ASP C 1 263 ? -31.229  10.298  17.450  1.00 165.18 ? 288 ASP C O   1 
ATOM   6605 C CB  . ASP C 1 263 ? -28.943  12.169  15.928  1.00 167.21 ? 288 ASP C CB  1 
ATOM   6606 C CG  . ASP C 1 263 ? -28.493  13.498  15.364  1.00 173.51 ? 288 ASP C CG  1 
ATOM   6607 O OD1 . ASP C 1 263 ? -29.088  13.958  14.360  1.00 177.33 ? 288 ASP C OD1 1 
ATOM   6608 O OD2 . ASP C 1 263 ? -27.533  14.073  15.924  1.00 157.47 ? 288 ASP C OD2 1 
ATOM   6609 N N   . ASN C 1 264 ? -30.649  9.683   15.357  1.00 147.25 ? 289 ASN C N   1 
ATOM   6610 C CA  . ASN C 1 264 ? -30.885  8.266   15.607  1.00 147.38 ? 289 ASN C CA  1 
ATOM   6611 C C   . ASN C 1 264 ? -32.350  7.954   15.924  1.00 147.49 ? 289 ASN C C   1 
ATOM   6612 O O   . ASN C 1 264 ? -32.650  7.003   16.664  1.00 144.69 ? 289 ASN C O   1 
ATOM   6613 C CB  . ASN C 1 264 ? -29.978  7.760   16.734  1.00 151.49 ? 289 ASN C CB  1 
ATOM   6614 C CG  . ASN C 1 264 ? -30.115  6.274   16.963  1.00 145.95 ? 289 ASN C CG  1 
ATOM   6615 O OD1 . ASN C 1 264 ? -30.343  5.508   16.024  1.00 143.86 ? 289 ASN C OD1 1 
ATOM   6616 N ND2 . ASN C 1 264 ? -29.980  5.855   18.215  1.00 134.66 ? 289 ASN C ND2 1 
ATOM   6617 N N   . ASN C 1 265 ? -33.254  8.766   15.379  1.00 138.88 ? 290 ASN C N   1 
ATOM   6618 C CA  . ASN C 1 265 ? -34.685  8.496   15.495  1.00 140.68 ? 290 ASN C CA  1 
ATOM   6619 C C   . ASN C 1 265 ? -35.520  9.509   14.719  1.00 134.05 ? 290 ASN C C   1 
ATOM   6620 O O   . ASN C 1 265 ? -34.977  10.406  14.057  1.00 121.41 ? 290 ASN C O   1 
ATOM   6621 C CB  . ASN C 1 265 ? -35.137  8.409   16.967  1.00 124.47 ? 290 ASN C CB  1 
ATOM   6622 C CG  . ASN C 1 265 ? -35.458  9.763   17.568  1.00 122.77 ? 290 ASN C CG  1 
ATOM   6623 O OD1 . ASN C 1 265 ? -35.050  10.804  17.052  1.00 130.68 ? 290 ASN C OD1 1 
ATOM   6624 N ND2 . ASN C 1 265 ? -36.195  9.753   18.669  1.00 111.92 ? 290 ASN C ND2 1 
ATOM   6625 N N   . VAL C 1 266 ? -36.840  9.345   14.803  1.00 132.35 ? 291 VAL C N   1 
ATOM   6626 C CA  . VAL C 1 266 ? -37.796  10.245  14.160  1.00 130.01 ? 291 VAL C CA  1 
ATOM   6627 C C   . VAL C 1 266 ? -39.019  10.412  15.053  1.00 135.89 ? 291 VAL C C   1 
ATOM   6628 O O   . VAL C 1 266 ? -39.193  9.670   16.034  1.00 131.94 ? 291 VAL C O   1 
ATOM   6629 C CB  . VAL C 1 266 ? -38.263  9.709   12.799  1.00 108.82 ? 291 VAL C CB  1 
ATOM   6630 C CG1 . VAL C 1 266 ? -37.299  10.138  11.689  1.00 110.99 ? 291 VAL C CG1 1 
ATOM   6631 C CG2 . VAL C 1 266 ? -38.428  8.187   12.867  1.00 79.65  ? 291 VAL C CG2 1 
ATOM   6632 N N   . ALA C 1 267 ? -39.868  11.378  14.705  1.00 132.40 ? 292 ALA C N   1 
ATOM   6633 C CA  . ALA C 1 267 ? -41.045  11.680  15.514  1.00 141.47 ? 292 ALA C CA  1 
ATOM   6634 C C   . ALA C 1 267 ? -40.613  11.893  16.961  1.00 146.46 ? 292 ALA C C   1 
ATOM   6635 O O   . ALA C 1 267 ? -41.111  11.217  17.872  1.00 146.32 ? 292 ALA C O   1 
ATOM   6636 C CB  . ALA C 1 267 ? -42.081  10.555  15.416  1.00 136.64 ? 292 ALA C CB  1 
ATOM   6637 N N   . PRO C 1 268 ? -39.666  12.827  17.175  1.00 136.46 ? 293 PRO C N   1 
ATOM   6638 C CA  . PRO C 1 268 ? -39.152  13.061  18.532  1.00 115.76 ? 293 PRO C CA  1 
ATOM   6639 C C   . PRO C 1 268 ? -40.302  13.470  19.449  1.00 123.93 ? 293 PRO C C   1 
ATOM   6640 O O   . PRO C 1 268 ? -41.272  14.083  18.981  1.00 126.15 ? 293 PRO C O   1 
ATOM   6641 C CB  . PRO C 1 268 ? -38.177  14.231  18.343  1.00 117.37 ? 293 PRO C CB  1 
ATOM   6642 C CG  . PRO C 1 268 ? -37.872  14.256  16.852  1.00 131.73 ? 293 PRO C CG  1 
ATOM   6643 C CD  . PRO C 1 268 ? -39.130  13.794  16.196  1.00 113.86 ? 293 PRO C CD  1 
ATOM   6644 N N   . GLY C 1 269 ? -40.206  13.129  20.729  1.00 131.56 ? 294 GLY C N   1 
ATOM   6645 C CA  . GLY C 1 269 ? -41.258  13.470  21.666  1.00 131.43 ? 294 GLY C CA  1 
ATOM   6646 C C   . GLY C 1 269 ? -42.526  12.690  21.383  1.00 120.30 ? 294 GLY C C   1 
ATOM   6647 O O   . GLY C 1 269 ? -42.457  11.516  20.995  1.00 116.37 ? 294 GLY C O   1 
ATOM   6648 N N   . TYR C 1 270 ? -43.680  13.334  21.563  1.00 107.90 ? 295 TYR C N   1 
ATOM   6649 C CA  . TYR C 1 270 ? -44.964  12.656  21.368  1.00 105.36 ? 295 TYR C CA  1 
ATOM   6650 C C   . TYR C 1 270 ? -46.099  13.651  21.097  1.00 101.01 ? 295 TYR C C   1 
ATOM   6651 O O   . TYR C 1 270 ? -46.305  14.620  21.843  1.00 92.33  ? 295 TYR C O   1 
ATOM   6652 C CB  . TYR C 1 270 ? -45.287  11.776  22.581  1.00 94.84  ? 295 TYR C CB  1 
ATOM   6653 C CG  . TYR C 1 270 ? -46.515  10.910  22.426  1.00 106.36 ? 295 TYR C CG  1 
ATOM   6654 C CD1 . TYR C 1 270 ? -46.407  9.591   22.019  1.00 99.62  ? 295 TYR C CD1 1 
ATOM   6655 C CD2 . TYR C 1 270 ? -47.782  11.409  22.705  1.00 119.16 ? 295 TYR C CD2 1 
ATOM   6656 C CE1 . TYR C 1 270 ? -47.533  8.783   21.887  1.00 106.90 ? 295 TYR C CE1 1 
ATOM   6657 C CE2 . TYR C 1 270 ? -48.912  10.615  22.574  1.00 108.89 ? 295 TYR C CE2 1 
ATOM   6658 C CZ  . TYR C 1 270 ? -48.782  9.304   22.164  1.00 102.85 ? 295 TYR C CZ  1 
ATOM   6659 O OH  . TYR C 1 270 ? -49.900  8.513   22.033  1.00 105.07 ? 295 TYR C OH  1 
ATOM   6660 N N   . ASN C 1 271 ? -46.841  13.402  20.025  1.00 99.48  ? 296 ASN C N   1 
ATOM   6661 C CA  . ASN C 1 271 ? -47.903  14.312  19.626  1.00 96.71  ? 296 ASN C CA  1 
ATOM   6662 C C   . ASN C 1 271 ? -48.786  13.681  18.567  1.00 96.78  ? 296 ASN C C   1 
ATOM   6663 O O   . ASN C 1 271 ? -48.398  12.715  17.911  1.00 105.63 ? 296 ASN C O   1 
ATOM   6664 C CB  . ASN C 1 271 ? -47.318  15.598  19.044  1.00 97.41  ? 296 ASN C CB  1 
ATOM   6665 C CG  . ASN C 1 271 ? -47.005  15.471  17.559  1.00 101.82 ? 296 ASN C CG  1 
ATOM   6666 O OD1 . ASN C 1 271 ? -47.444  16.292  16.748  1.00 84.75  ? 296 ASN C OD1 1 
ATOM   6667 N ND2 . ASN C 1 271 ? -46.253  14.428  17.194  1.00 99.10  ? 296 ASN C ND2 1 
ATOM   6668 N N   . PHE C 1 272 ? -49.973  14.242  18.383  1.00 69.55  ? 297 PHE C N   1 
ATOM   6669 C CA  . PHE C 1 272 ? -50.853  13.768  17.336  1.00 63.35  ? 297 PHE C CA  1 
ATOM   6670 C C   . PHE C 1 272 ? -51.806  14.872  16.929  1.00 76.22  ? 297 PHE C C   1 
ATOM   6671 O O   . PHE C 1 272 ? -51.915  15.887  17.612  1.00 89.38  ? 297 PHE C O   1 
ATOM   6672 C CB  . PHE C 1 272 ? -51.604  12.506  17.780  1.00 81.43  ? 297 PHE C CB  1 
ATOM   6673 C CG  . PHE C 1 272 ? -52.462  12.690  19.013  1.00 80.80  ? 297 PHE C CG  1 
ATOM   6674 C CD1 . PHE C 1 272 ? -52.085  12.135  20.235  1.00 80.95  ? 297 PHE C CD1 1 
ATOM   6675 C CD2 . PHE C 1 272 ? -53.659  13.398  18.945  1.00 80.62  ? 297 PHE C CD2 1 
ATOM   6676 C CE1 . PHE C 1 272 ? -52.879  12.294  21.369  1.00 88.53  ? 297 PHE C CE1 1 
ATOM   6677 C CE2 . PHE C 1 272 ? -54.459  13.561  20.077  1.00 85.57  ? 297 PHE C CE2 1 
ATOM   6678 C CZ  . PHE C 1 272 ? -54.070  13.009  21.288  1.00 93.12  ? 297 PHE C CZ  1 
ATOM   6679 N N   . ARG C 1 273 ? -52.449  14.708  15.779  1.00 90.11  ? 298 ARG C N   1 
ATOM   6680 C CA  . ARG C 1 273 ? -53.455  15.671  15.347  1.00 104.12 ? 298 ARG C CA  1 
ATOM   6681 C C   . ARG C 1 273 ? -54.867  15.158  15.664  1.00 116.04 ? 298 ARG C C   1 
ATOM   6682 O O   . ARG C 1 273 ? -55.114  13.949  15.636  1.00 99.40  ? 298 ARG C O   1 
ATOM   6683 C CB  . ARG C 1 273 ? -53.297  15.981  13.858  1.00 82.19  ? 298 ARG C CB  1 
ATOM   6684 N N   . PHE C 1 274 ? -55.775  16.081  15.986  1.00 98.76  ? 299 PHE C N   1 
ATOM   6685 C CA  . PHE C 1 274 ? -57.191  15.769  16.142  1.00 90.79  ? 299 PHE C CA  1 
ATOM   6686 C C   . PHE C 1 274 ? -58.010  17.002  15.822  1.00 88.61  ? 299 PHE C C   1 
ATOM   6687 O O   . PHE C 1 274 ? -57.451  18.079  15.629  1.00 95.01  ? 299 PHE C O   1 
ATOM   6688 C CB  . PHE C 1 274 ? -57.496  15.282  17.552  1.00 78.28  ? 299 PHE C CB  1 
ATOM   6689 C CG  . PHE C 1 274 ? -57.181  16.279  18.630  1.00 85.03  ? 299 PHE C CG  1 
ATOM   6690 C CD1 . PHE C 1 274 ? -56.149  16.043  19.516  1.00 86.17  ? 299 PHE C CD1 1 
ATOM   6691 C CD2 . PHE C 1 274 ? -57.932  17.438  18.782  1.00 92.91  ? 299 PHE C CD2 1 
ATOM   6692 C CE1 . PHE C 1 274 ? -55.862  16.947  20.535  1.00 89.09  ? 299 PHE C CE1 1 
ATOM   6693 C CE2 . PHE C 1 274 ? -57.640  18.347  19.799  1.00 80.50  ? 299 PHE C CE2 1 
ATOM   6694 C CZ  . PHE C 1 274 ? -56.604  18.098  20.669  1.00 80.45  ? 299 PHE C CZ  1 
ATOM   6695 N N   . ALA C 1 275 ? -59.329  16.859  15.771  1.00 75.64  ? 300 ALA C N   1 
ATOM   6696 C CA  . ALA C 1 275 ? -60.146  17.955  15.282  1.00 89.40  ? 300 ALA C CA  1 
ATOM   6697 C C   . ALA C 1 275 ? -61.498  18.082  15.952  1.00 89.59  ? 300 ALA C C   1 
ATOM   6698 O O   . ALA C 1 275 ? -61.997  17.152  16.587  1.00 83.39  ? 300 ALA C O   1 
ATOM   6699 C CB  . ALA C 1 275 ? -60.315  17.856  13.770  1.00 103.29 ? 300 ALA C CB  1 
ATOM   6700 N N   . LYS C 1 276 ? -62.076  19.265  15.775  1.00 89.47  ? 301 LYS C N   1 
ATOM   6701 C CA  . LYS C 1 276 ? -63.380  19.616  16.301  1.00 93.06  ? 301 LYS C CA  1 
ATOM   6702 C C   . LYS C 1 276 ? -64.212  20.024  15.113  1.00 98.33  ? 301 LYS C C   1 
ATOM   6703 O O   . LYS C 1 276 ? -63.846  20.941  14.386  1.00 105.27 ? 301 LYS C O   1 
ATOM   6704 C CB  . LYS C 1 276 ? -63.257  20.804  17.254  1.00 94.84  ? 301 LYS C CB  1 
ATOM   6705 C CG  . LYS C 1 276 ? -62.023  20.754  18.140  1.00 103.27 ? 301 LYS C CG  1 
ATOM   6706 C CD  . LYS C 1 276 ? -62.180  19.814  19.327  1.00 92.84  ? 301 LYS C CD  1 
ATOM   6707 C CE  . LYS C 1 276 ? -62.835  20.524  20.510  1.00 123.93 ? 301 LYS C CE  1 
ATOM   6708 N NZ  . LYS C 1 276 ? -62.108  21.764  20.938  1.00 115.12 ? 301 LYS C NZ  1 
ATOM   6709 N N   . TYR C 1 277 ? -65.326  19.340  14.901  1.00 91.13  ? 302 TYR C N   1 
ATOM   6710 C CA  . TYR C 1 277 ? -66.124  19.600  13.718  1.00 94.07  ? 302 TYR C CA  1 
ATOM   6711 C C   . TYR C 1 277 ? -67.347  20.440  14.054  1.00 105.32 ? 302 TYR C C   1 
ATOM   6712 O O   . TYR C 1 277 ? -67.965  20.253  15.108  1.00 104.65 ? 302 TYR C O   1 
ATOM   6713 C CB  . TYR C 1 277 ? -66.489  18.283  13.045  1.00 100.05 ? 302 TYR C CB  1 
ATOM   6714 C CG  . TYR C 1 277 ? -65.266  17.472  12.665  1.00 100.31 ? 302 TYR C CG  1 
ATOM   6715 C CD1 . TYR C 1 277 ? -64.740  16.524  13.530  1.00 96.45  ? 302 TYR C CD1 1 
ATOM   6716 C CD2 . TYR C 1 277 ? -64.623  17.670  11.450  1.00 110.44 ? 302 TYR C CD2 1 
ATOM   6717 C CE1 . TYR C 1 277 ? -63.619  15.784  13.187  1.00 94.66  ? 302 TYR C CE1 1 
ATOM   6718 C CE2 . TYR C 1 277 ? -63.501  16.938  11.104  1.00 105.52 ? 302 TYR C CE2 1 
ATOM   6719 C CZ  . TYR C 1 277 ? -63.005  15.996  11.975  1.00 104.83 ? 302 TYR C CZ  1 
ATOM   6720 O OH  . TYR C 1 277 ? -61.893  15.262  11.634  1.00 111.19 ? 302 TYR C OH  1 
ATOM   6721 N N   . TYR C 1 278 ? -67.675  21.376  13.166  1.00 97.39  ? 303 TYR C N   1 
ATOM   6722 C CA  . TYR C 1 278 ? -68.769  22.310  13.405  1.00 113.30 ? 303 TYR C CA  1 
ATOM   6723 C C   . TYR C 1 278 ? -69.604  22.509  12.150  1.00 127.93 ? 303 TYR C C   1 
ATOM   6724 O O   . TYR C 1 278 ? -69.112  22.994  11.131  1.00 125.03 ? 303 TYR C O   1 
ATOM   6725 C CB  . TYR C 1 278 ? -68.247  23.681  13.843  1.00 122.59 ? 303 TYR C CB  1 
ATOM   6726 C CG  . TYR C 1 278 ? -67.242  23.680  14.976  1.00 142.81 ? 303 TYR C CG  1 
ATOM   6727 C CD1 . TYR C 1 278 ? -67.543  23.099  16.204  1.00 151.30 ? 303 TYR C CD1 1 
ATOM   6728 C CD2 . TYR C 1 278 ? -66.001  24.295  14.829  1.00 136.73 ? 303 TYR C CD2 1 
ATOM   6729 C CE1 . TYR C 1 278 ? -66.627  23.110  17.243  1.00 133.03 ? 303 TYR C CE1 1 
ATOM   6730 C CE2 . TYR C 1 278 ? -65.079  24.310  15.866  1.00 136.29 ? 303 TYR C CE2 1 
ATOM   6731 C CZ  . TYR C 1 278 ? -65.398  23.716  17.068  1.00 119.21 ? 303 TYR C CZ  1 
ATOM   6732 O OH  . TYR C 1 278 ? -64.483  23.729  18.095  1.00 112.59 ? 303 TYR C OH  1 
ATOM   6733 N N   . LYS C 1 279 ? -70.877  22.149  12.226  1.00 157.12 ? 304 LYS C N   1 
ATOM   6734 C CA  . LYS C 1 279 ? -71.787  22.432  11.128  1.00 153.19 ? 304 LYS C CA  1 
ATOM   6735 C C   . LYS C 1 279 ? -72.091  23.921  11.111  1.00 148.34 ? 304 LYS C C   1 
ATOM   6736 O O   . LYS C 1 279 ? -72.890  24.419  11.902  1.00 145.62 ? 304 LYS C O   1 
ATOM   6737 C CB  . LYS C 1 279 ? -73.066  21.626  11.258  1.00 145.77 ? 304 LYS C CB  1 
ATOM   6738 N N   . ASN C 1 280 ? -71.423  24.624  10.208  1.00 152.46 ? 305 ASN C N   1 
ATOM   6739 C CA  . ASN C 1 280 ? -71.681  26.034  9.972   1.00 164.02 ? 305 ASN C CA  1 
ATOM   6740 C C   . ASN C 1 280 ? -73.167  26.261  9.675   1.00 190.22 ? 305 ASN C C   1 
ATOM   6741 O O   . ASN C 1 280 ? -73.851  25.364  9.176   1.00 196.65 ? 305 ASN C O   1 
ATOM   6742 C CB  . ASN C 1 280 ? -70.812  26.506  8.804   1.00 158.91 ? 305 ASN C CB  1 
ATOM   6743 C CG  . ASN C 1 280 ? -70.992  27.972  8.490   1.00 168.23 ? 305 ASN C CG  1 
ATOM   6744 O OD1 . ASN C 1 280 ? -71.418  28.758  9.336   1.00 170.53 ? 305 ASN C OD1 1 
ATOM   6745 N ND2 . ASN C 1 280 ? -70.658  28.353  7.262   1.00 174.12 ? 305 ASN C ND2 1 
ATOM   6746 N N   . SER C 1 281 ? -73.666  27.454  9.992   1.00 197.49 ? 306 SER C N   1 
ATOM   6747 C CA  . SER C 1 281 ? -75.075  27.791  9.769   1.00 190.15 ? 306 SER C CA  1 
ATOM   6748 C C   . SER C 1 281 ? -75.465  27.711  8.293   1.00 178.22 ? 306 SER C C   1 
ATOM   6749 O O   . SER C 1 281 ? -76.640  27.561  7.956   1.00 167.90 ? 306 SER C O   1 
ATOM   6750 C CB  . SER C 1 281 ? -75.388  29.186  10.322  1.00 173.67 ? 306 SER C CB  1 
ATOM   6751 O OG  . SER C 1 281 ? -75.280  29.214  11.736  1.00 168.70 ? 306 SER C OG  1 
ATOM   6752 N N   . ASP C 1 282 ? -74.466  27.815  7.422   1.00 175.64 ? 307 ASP C N   1 
ATOM   6753 C CA  . ASP C 1 282 ? -74.668  27.708  5.981   1.00 171.19 ? 307 ASP C CA  1 
ATOM   6754 C C   . ASP C 1 282 ? -74.841  26.256  5.562   1.00 167.34 ? 307 ASP C C   1 
ATOM   6755 O O   . ASP C 1 282 ? -75.050  25.965  4.384   1.00 167.85 ? 307 ASP C O   1 
ATOM   6756 C CB  . ASP C 1 282 ? -73.479  28.302  5.222   1.00 159.78 ? 307 ASP C CB  1 
ATOM   6757 C CG  . ASP C 1 282 ? -73.179  29.732  5.624   1.00 172.85 ? 307 ASP C CG  1 
ATOM   6758 O OD1 . ASP C 1 282 ? -73.715  30.199  6.653   1.00 174.70 ? 307 ASP C OD1 1 
ATOM   6759 O OD2 . ASP C 1 282 ? -72.395  30.386  4.906   1.00 162.43 ? 307 ASP C OD2 1 
ATOM   6760 N N   . GLY C 1 283 ? -74.738  25.347  6.526   1.00 156.17 ? 308 GLY C N   1 
ATOM   6761 C CA  . GLY C 1 283 ? -74.816  23.926  6.242   1.00 159.46 ? 308 GLY C CA  1 
ATOM   6762 C C   . GLY C 1 283 ? -73.481  23.315  5.848   1.00 157.19 ? 308 GLY C C   1 
ATOM   6763 O O   . GLY C 1 283 ? -73.338  22.093  5.815   1.00 139.17 ? 308 GLY C O   1 
ATOM   6764 N N   . THR C 1 284 ? -72.504  24.164  5.544   1.00 167.20 ? 309 THR C N   1 
ATOM   6765 C CA  . THR C 1 284 ? -71.166  23.709  5.171   1.00 155.89 ? 309 THR C CA  1 
ATOM   6766 C C   . THR C 1 284 ? -70.329  23.345  6.402   1.00 144.04 ? 309 THR C C   1 
ATOM   6767 O O   . THR C 1 284 ? -70.497  23.928  7.470   1.00 145.59 ? 309 THR C O   1 
ATOM   6768 C CB  . THR C 1 284 ? -70.431  24.777  4.338   1.00 152.80 ? 309 THR C CB  1 
ATOM   6769 O OG1 . THR C 1 284 ? -70.370  26.003  5.079   1.00 152.84 ? 309 THR C OG1 1 
ATOM   6770 C CG2 . THR C 1 284 ? -71.166  25.024  3.024   1.00 139.47 ? 309 THR C CG2 1 
ATOM   6771 N N   . GLU C 1 285 ? -69.428  22.378  6.243   1.00 142.81 ? 310 GLU C N   1 
ATOM   6772 C CA  . GLU C 1 285 ? -68.583  21.902  7.342   1.00 120.36 ? 310 GLU C CA  1 
ATOM   6773 C C   . GLU C 1 285 ? -67.293  22.694  7.540   1.00 115.67 ? 310 GLU C C   1 
ATOM   6774 O O   . GLU C 1 285 ? -66.616  23.055  6.581   1.00 134.08 ? 310 GLU C O   1 
ATOM   6775 C CB  . GLU C 1 285 ? -68.220  20.425  7.142   1.00 117.25 ? 310 GLU C CB  1 
ATOM   6776 C CG  . GLU C 1 285 ? -68.744  19.480  8.221   1.00 135.86 ? 310 GLU C CG  1 
ATOM   6777 C CD  . GLU C 1 285 ? -67.865  18.240  8.388   1.00 143.06 ? 310 GLU C CD  1 
ATOM   6778 O OE1 . GLU C 1 285 ? -66.982  18.013  7.536   1.00 140.94 ? 310 GLU C OE1 1 
ATOM   6779 O OE2 . GLU C 1 285 ? -68.048  17.492  9.373   1.00 132.01 ? 310 GLU C OE2 1 
ATOM   6780 N N   . THR C 1 286 ? -66.947  22.937  8.796   1.00 104.08 ? 311 THR C N   1 
ATOM   6781 C CA  . THR C 1 286 ? -65.663  23.528  9.137   1.00 110.21 ? 311 THR C CA  1 
ATOM   6782 C C   . THR C 1 286 ? -65.088  22.781  10.329  1.00 110.17 ? 311 THR C C   1 
ATOM   6783 O O   . THR C 1 286 ? -65.825  22.243  11.150  1.00 114.72 ? 311 THR C O   1 
ATOM   6784 C CB  . THR C 1 286 ? -65.792  25.010  9.526   1.00 109.69 ? 311 THR C CB  1 
ATOM   6785 O OG1 . THR C 1 286 ? -66.515  25.123  10.758  1.00 118.75 ? 311 THR C OG1 1 
ATOM   6786 C CG2 . THR C 1 286 ? -66.517  25.793  8.451   1.00 100.99 ? 311 THR C CG2 1 
ATOM   6787 N N   . ARG C 1 287 ? -63.769  22.753  10.438  1.00 100.34 ? 312 ARG C N   1 
ATOM   6788 C CA  . ARG C 1 287 ? -63.142  22.035  11.534  1.00 107.32 ? 312 ARG C CA  1 
ATOM   6789 C C   . ARG C 1 287 ? -61.935  22.791  12.083  1.00 113.04 ? 312 ARG C C   1 
ATOM   6790 O O   . ARG C 1 287 ? -61.307  23.583  11.385  1.00 117.53 ? 312 ARG C O   1 
ATOM   6791 C CB  . ARG C 1 287 ? -62.691  20.654  11.072  1.00 102.79 ? 312 ARG C CB  1 
ATOM   6792 C CG  . ARG C 1 287 ? -61.353  20.696  10.396  1.00 93.62  ? 312 ARG C CG  1 
ATOM   6793 C CD  . ARG C 1 287 ? -60.790  19.328  10.183  1.00 95.05  ? 312 ARG C CD  1 
ATOM   6794 N NE  . ARG C 1 287 ? -59.385  19.421  9.815   1.00 100.57 ? 312 ARG C NE  1 
ATOM   6795 C CZ  . ARG C 1 287 ? -58.629  18.376  9.508   1.00 104.21 ? 312 ARG C CZ  1 
ATOM   6796 N NH1 . ARG C 1 287 ? -59.155  17.156  9.522   1.00 110.41 ? 312 ARG C NH1 1 
ATOM   6797 N NH2 . ARG C 1 287 ? -57.353  18.551  9.188   1.00 82.53  ? 312 ARG C NH2 1 
ATOM   6798 N N   . THR C 1 288 ? -61.620  22.539  13.346  1.00 104.07 ? 313 THR C N   1 
ATOM   6799 C CA  . THR C 1 288 ? -60.454  23.125  13.975  1.00 93.68  ? 313 THR C CA  1 
ATOM   6800 C C   . THR C 1 288 ? -59.389  22.071  14.177  1.00 90.28  ? 313 THR C C   1 
ATOM   6801 O O   . THR C 1 288 ? -59.555  21.163  14.980  1.00 83.06  ? 313 THR C O   1 
ATOM   6802 C CB  . THR C 1 288 ? -60.806  23.717  15.335  1.00 99.14  ? 313 THR C CB  1 
ATOM   6803 O OG1 . THR C 1 288 ? -61.625  24.882  15.152  1.00 97.14  ? 313 THR C OG1 1 
ATOM   6804 C CG2 . THR C 1 288 ? -59.532  24.079  16.093  1.00 91.97  ? 313 THR C CG2 1 
ATOM   6805 N N   . LEU C 1 289 ? -58.290  22.202  13.447  1.00 104.12 ? 314 LEU C N   1 
ATOM   6806 C CA  . LEU C 1 289 ? -57.199  21.238  13.540  1.00 98.71  ? 314 LEU C CA  1 
ATOM   6807 C C   . LEU C 1 289 ? -56.216  21.574  14.655  1.00 87.98  ? 314 LEU C C   1 
ATOM   6808 O O   . LEU C 1 289 ? -55.745  22.707  14.785  1.00 90.62  ? 314 LEU C O   1 
ATOM   6809 C CB  . LEU C 1 289 ? -56.470  21.096  12.202  1.00 85.53  ? 314 LEU C CB  1 
ATOM   6810 C CG  . LEU C 1 289 ? -55.345  20.061  12.115  1.00 92.49  ? 314 LEU C CG  1 
ATOM   6811 C CD1 . LEU C 1 289 ? -55.738  18.726  12.762  1.00 80.16  ? 314 LEU C CD1 1 
ATOM   6812 C CD2 . LEU C 1 289 ? -54.949  19.870  10.655  1.00 103.29 ? 314 LEU C CD2 1 
ATOM   6813 N N   . ILE C 1 290 ? -55.889  20.563  15.444  1.00 87.61  ? 315 ILE C N   1 
ATOM   6814 C CA  . ILE C 1 290 ? -55.081  20.764  16.628  1.00 85.63  ? 315 ILE C CA  1 
ATOM   6815 C C   . ILE C 1 290 ? -53.918  19.774  16.652  1.00 95.21  ? 315 ILE C C   1 
ATOM   6816 O O   . ILE C 1 290 ? -54.123  18.555  16.756  1.00 85.64  ? 315 ILE C O   1 
ATOM   6817 C CB  . ILE C 1 290 ? -55.929  20.546  17.880  1.00 84.32  ? 315 ILE C CB  1 
ATOM   6818 C CG1 . ILE C 1 290 ? -57.121  21.504  17.892  1.00 81.15  ? 315 ILE C CG1 1 
ATOM   6819 C CG2 . ILE C 1 290 ? -55.083  20.677  19.140  1.00 85.51  ? 315 ILE C CG2 1 
ATOM   6820 C CD1 . ILE C 1 290 ? -57.771  21.600  19.254  1.00 98.88  ? 315 ILE C CD1 1 
ATOM   6821 N N   . LYS C 1 291 ? -52.699  20.296  16.547  1.00 83.04  ? 316 LYS C N   1 
ATOM   6822 C CA  . LYS C 1 291 ? -51.527  19.460  16.704  1.00 71.12  ? 316 LYS C CA  1 
ATOM   6823 C C   . LYS C 1 291 ? -51.111  19.486  18.165  1.00 92.96  ? 316 LYS C C   1 
ATOM   6824 O O   . LYS C 1 291 ? -50.361  20.361  18.609  1.00 103.55 ? 316 LYS C O   1 
ATOM   6825 C CB  . LYS C 1 291 ? -50.394  19.941  15.814  1.00 93.10  ? 316 LYS C CB  1 
ATOM   6826 C CG  . LYS C 1 291 ? -49.199  18.985  15.767  1.00 90.20  ? 316 LYS C CG  1 
ATOM   6827 C CD  . LYS C 1 291 ? -48.117  19.507  14.829  1.00 102.69 ? 316 LYS C CD  1 
ATOM   6828 C CE  . LYS C 1 291 ? -46.916  18.574  14.768  1.00 102.86 ? 316 LYS C CE  1 
ATOM   6829 N NZ  . LYS C 1 291 ? -46.051  18.874  13.589  1.00 146.17 ? 316 LYS C NZ  1 
ATOM   6830 N N   . GLY C 1 292 ? -51.619  18.519  18.916  1.00 89.77  ? 317 GLY C N   1 
ATOM   6831 C CA  . GLY C 1 292 ? -51.388  18.480  20.339  1.00 77.51  ? 317 GLY C CA  1 
ATOM   6832 C C   . GLY C 1 292 ? -50.118  17.738  20.683  1.00 90.16  ? 317 GLY C C   1 
ATOM   6833 O O   . GLY C 1 292 ? -49.899  16.602  20.264  1.00 79.64  ? 317 GLY C O   1 
ATOM   6834 N N   . TYR C 1 293 ? -49.265  18.407  21.441  1.00 93.07  ? 318 TYR C N   1 
ATOM   6835 C CA  . TYR C 1 293 ? -48.126  17.756  22.063  1.00 86.54  ? 318 TYR C CA  1 
ATOM   6836 C C   . TYR C 1 293 ? -48.502  17.474  23.514  1.00 86.18  ? 318 TYR C C   1 
ATOM   6837 O O   . TYR C 1 293 ? -49.294  18.210  24.109  1.00 89.12  ? 318 TYR C O   1 
ATOM   6838 C CB  . TYR C 1 293 ? -46.903  18.670  22.015  1.00 86.47  ? 318 TYR C CB  1 
ATOM   6839 C CG  . TYR C 1 293 ? -46.538  19.132  20.623  1.00 96.91  ? 318 TYR C CG  1 
ATOM   6840 C CD1 . TYR C 1 293 ? -47.210  20.202  20.023  1.00 92.83  ? 318 TYR C CD1 1 
ATOM   6841 C CD2 . TYR C 1 293 ? -45.516  18.505  19.911  1.00 88.35  ? 318 TYR C CD2 1 
ATOM   6842 C CE1 . TYR C 1 293 ? -46.876  20.630  18.751  1.00 103.88 ? 318 TYR C CE1 1 
ATOM   6843 C CE2 . TYR C 1 293 ? -45.174  18.921  18.638  1.00 93.05  ? 318 TYR C CE2 1 
ATOM   6844 C CZ  . TYR C 1 293 ? -45.857  19.986  18.055  1.00 112.36 ? 318 TYR C CZ  1 
ATOM   6845 O OH  . TYR C 1 293 ? -45.521  20.406  16.775  1.00 97.72  ? 318 TYR C OH  1 
ATOM   6846 N N   . GLY C 1 294 ? -47.941  16.415  24.087  1.00 76.76  ? 319 GLY C N   1 
ATOM   6847 C CA  . GLY C 1 294 ? -48.193  16.115  25.482  1.00 74.53  ? 319 GLY C CA  1 
ATOM   6848 C C   . GLY C 1 294 ? -47.392  14.926  25.960  1.00 83.20  ? 319 GLY C C   1 
ATOM   6849 O O   . GLY C 1 294 ? -46.614  14.342  25.216  1.00 90.16  ? 319 GLY C O   1 
ATOM   6850 N N   . ILE C 1 295 ? -47.574  14.575  27.221  1.00 84.26  ? 320 ILE C N   1 
ATOM   6851 C CA  . ILE C 1 295 ? -46.927  13.404  27.776  1.00 80.16  ? 320 ILE C CA  1 
ATOM   6852 C C   . ILE C 1 295 ? -47.944  12.288  27.921  1.00 89.09  ? 320 ILE C C   1 
ATOM   6853 O O   . ILE C 1 295 ? -48.983  12.456  28.564  1.00 96.54  ? 320 ILE C O   1 
ATOM   6854 C CB  . ILE C 1 295 ? -46.338  13.710  29.153  1.00 88.09  ? 320 ILE C CB  1 
ATOM   6855 C CG1 . ILE C 1 295 ? -45.683  15.095  29.150  1.00 85.53  ? 320 ILE C CG1 1 
ATOM   6856 C CG2 . ILE C 1 295 ? -45.376  12.600  29.580  1.00 86.68  ? 320 ILE C CG2 1 
ATOM   6857 C CD1 . ILE C 1 295 ? -45.144  15.517  30.491  1.00 79.69  ? 320 ILE C CD1 1 
ATOM   6858 N N   . ARG C 1 296 ? -47.661  11.150  27.308  1.00 85.37  ? 321 ARG C N   1 
ATOM   6859 C CA  . ARG C 1 296 ? -48.530  10.000  27.477  1.00 88.83  ? 321 ARG C CA  1 
ATOM   6860 C C   . ARG C 1 296 ? -48.030  9.136   28.628  1.00 79.32  ? 321 ARG C C   1 
ATOM   6861 O O   . ARG C 1 296 ? -46.867  8.749   28.659  1.00 78.09  ? 321 ARG C O   1 
ATOM   6862 C CB  . ARG C 1 296 ? -48.593  9.174   26.193  1.00 86.72  ? 321 ARG C CB  1 
ATOM   6863 C CG  . ARG C 1 296 ? -49.806  8.266   26.116  1.00 91.57  ? 321 ARG C CG  1 
ATOM   6864 C CD  . ARG C 1 296 ? -49.413  6.817   25.886  1.00 84.08  ? 321 ARG C CD  1 
ATOM   6865 N NE  . ARG C 1 296 ? -48.918  6.603   24.530  1.00 102.75 ? 321 ARG C NE  1 
ATOM   6866 C CZ  . ARG C 1 296 ? -48.393  5.459   24.106  1.00 120.59 ? 321 ARG C CZ  1 
ATOM   6867 N NH1 . ARG C 1 296 ? -48.294  4.427   24.940  1.00 100.17 ? 321 ARG C NH1 1 
ATOM   6868 N NH2 . ARG C 1 296 ? -47.967  5.347   22.854  1.00 128.15 ? 321 ARG C NH2 1 
ATOM   6869 N N   . PHE C 1 297 ? -48.906  8.825   29.573  1.00 72.51  ? 322 PHE C N   1 
ATOM   6870 C CA  . PHE C 1 297 ? -48.512  7.960   30.678  1.00 86.89  ? 322 PHE C CA  1 
ATOM   6871 C C   . PHE C 1 297 ? -48.927  6.500   30.495  1.00 81.70  ? 322 PHE C C   1 
ATOM   6872 O O   . PHE C 1 297 ? -50.111  6.183   30.478  1.00 98.06  ? 322 PHE C O   1 
ATOM   6873 C CB  . PHE C 1 297 ? -49.033  8.519   32.007  1.00 86.74  ? 322 PHE C CB  1 
ATOM   6874 C CG  . PHE C 1 297 ? -48.461  9.865   32.358  1.00 90.19  ? 322 PHE C CG  1 
ATOM   6875 C CD1 . PHE C 1 297 ? -48.950  11.020  31.766  1.00 87.53  ? 322 PHE C CD1 1 
ATOM   6876 C CD2 . PHE C 1 297 ? -47.424  9.973   33.264  1.00 83.63  ? 322 PHE C CD2 1 
ATOM   6877 C CE1 . PHE C 1 297 ? -48.423  12.252  32.085  1.00 84.75  ? 322 PHE C CE1 1 
ATOM   6878 C CE2 . PHE C 1 297 ? -46.892  11.204  33.582  1.00 88.13  ? 322 PHE C CE2 1 
ATOM   6879 C CZ  . PHE C 1 297 ? -47.392  12.344  32.993  1.00 77.74  ? 322 PHE C CZ  1 
ATOM   6880 N N   . ASP C 1 298 ? -47.944  5.616   30.367  1.00 71.38  ? 323 ASP C N   1 
ATOM   6881 C CA  . ASP C 1 298 ? -48.213  4.186   30.251  1.00 82.60  ? 323 ASP C CA  1 
ATOM   6882 C C   . ASP C 1 298 ? -48.090  3.490   31.588  1.00 94.38  ? 323 ASP C C   1 
ATOM   6883 O O   . ASP C 1 298 ? -46.993  3.368   32.133  1.00 95.71  ? 323 ASP C O   1 
ATOM   6884 C CB  . ASP C 1 298 ? -47.256  3.526   29.264  1.00 94.73  ? 323 ASP C CB  1 
ATOM   6885 C CG  . ASP C 1 298 ? -47.623  3.811   27.811  1.00 119.73 ? 323 ASP C CG  1 
ATOM   6886 O OD1 . ASP C 1 298 ? -48.465  4.706   27.565  1.00 113.48 ? 323 ASP C OD1 1 
ATOM   6887 O OD2 . ASP C 1 298 ? -47.067  3.140   26.912  1.00 116.96 ? 323 ASP C OD2 1 
ATOM   6888 N N   . VAL C 1 299 ? -49.215  3.024   32.119  1.00 94.89  ? 324 VAL C N   1 
ATOM   6889 C CA  . VAL C 1 299 ? -49.183  2.260   33.362  1.00 94.31  ? 324 VAL C CA  1 
ATOM   6890 C C   . VAL C 1 299 ? -48.858  0.804   33.059  1.00 93.89  ? 324 VAL C C   1 
ATOM   6891 O O   . VAL C 1 299 ? -49.712  0.053   32.568  1.00 95.47  ? 324 VAL C O   1 
ATOM   6892 C CB  . VAL C 1 299 ? -50.508  2.342   34.139  1.00 94.67  ? 324 VAL C CB  1 
ATOM   6893 C CG1 . VAL C 1 299 ? -50.469  1.422   35.351  1.00 85.99  ? 324 VAL C CG1 1 
ATOM   6894 C CG2 . VAL C 1 299 ? -50.774  3.771   34.565  1.00 93.03  ? 324 VAL C CG2 1 
ATOM   6895 N N   . MET C 1 300 ? -47.619  0.416   33.346  1.00 78.62  ? 325 MET C N   1 
ATOM   6896 C CA  . MET C 1 300 ? -47.160  -0.930  33.064  1.00 83.71  ? 325 MET C CA  1 
ATOM   6897 C C   . MET C 1 300 ? -47.113  -1.782  34.322  1.00 95.64  ? 325 MET C C   1 
ATOM   6898 O O   . MET C 1 300 ? -46.264  -1.571  35.183  1.00 101.57 ? 325 MET C O   1 
ATOM   6899 C CB  . MET C 1 300 ? -45.787  -0.859  32.412  1.00 85.04  ? 325 MET C CB  1 
ATOM   6900 C CG  . MET C 1 300 ? -45.790  -0.100  31.110  1.00 90.03  ? 325 MET C CG  1 
ATOM   6901 S SD  . MET C 1 300 ? -44.135  0.148   30.453  1.00 124.71 ? 325 MET C SD  1 
ATOM   6902 C CE  . MET C 1 300 ? -43.504  1.361   31.604  1.00 112.58 ? 325 MET C CE  1 
ATOM   6903 N N   . VAL C 1 301 ? -48.014  -2.753  34.431  1.00 85.42  ? 326 VAL C N   1 
ATOM   6904 C CA  . VAL C 1 301 ? -48.068  -3.588  35.630  1.00 89.55  ? 326 VAL C CA  1 
ATOM   6905 C C   . VAL C 1 301 ? -47.571  -4.995  35.370  1.00 95.14  ? 326 VAL C C   1 
ATOM   6906 O O   . VAL C 1 301 ? -47.922  -5.602  34.363  1.00 100.92 ? 326 VAL C O   1 
ATOM   6907 C CB  . VAL C 1 301 ? -49.485  -3.681  36.200  1.00 88.84  ? 326 VAL C CB  1 
ATOM   6908 C CG1 . VAL C 1 301 ? -49.514  -4.624  37.394  1.00 89.70  ? 326 VAL C CG1 1 
ATOM   6909 C CG2 . VAL C 1 301 ? -49.983  -2.298  36.581  1.00 99.71  ? 326 VAL C CG2 1 
ATOM   6910 N N   . PHE C 1 302 ? -46.771  -5.518  36.291  1.00 102.16 ? 327 PHE C N   1 
ATOM   6911 C CA  . PHE C 1 302 ? -46.227  -6.860  36.155  1.00 115.48 ? 327 PHE C CA  1 
ATOM   6912 C C   . PHE C 1 302 ? -45.792  -7.409  37.503  1.00 117.70 ? 327 PHE C C   1 
ATOM   6913 O O   . PHE C 1 302 ? -45.693  -6.672  38.479  1.00 117.04 ? 327 PHE C O   1 
ATOM   6914 C CB  . PHE C 1 302 ? -45.046  -6.859  35.187  1.00 114.19 ? 327 PHE C CB  1 
ATOM   6915 C CG  . PHE C 1 302 ? -43.802  -6.218  35.737  1.00 112.85 ? 327 PHE C CG  1 
ATOM   6916 C CD1 . PHE C 1 302 ? -43.601  -4.846  35.639  1.00 115.38 ? 327 PHE C CD1 1 
ATOM   6917 C CD2 . PHE C 1 302 ? -42.827  -6.993  36.338  1.00 124.42 ? 327 PHE C CD2 1 
ATOM   6918 C CE1 . PHE C 1 302 ? -42.457  -4.258  36.133  1.00 111.60 ? 327 PHE C CE1 1 
ATOM   6919 C CE2 . PHE C 1 302 ? -41.679  -6.413  36.836  1.00 134.80 ? 327 PHE C CE2 1 
ATOM   6920 C CZ  . PHE C 1 302 ? -41.493  -5.039  36.732  1.00 131.20 ? 327 PHE C CZ  1 
ATOM   6921 N N   . GLY C 1 303 ? -45.533  -8.708  37.557  1.00 108.01 ? 328 GLY C N   1 
ATOM   6922 C CA  . GLY C 1 303 ? -45.086  -9.317  38.793  1.00 115.99 ? 328 GLY C CA  1 
ATOM   6923 C C   . GLY C 1 303 ? -45.136  -10.830 38.818  1.00 129.43 ? 328 GLY C C   1 
ATOM   6924 O O   . GLY C 1 303 ? -45.587  -11.470 37.867  1.00 133.59 ? 328 GLY C O   1 
ATOM   6925 N N   . GLN C 1 304 ? -44.672  -11.396 39.926  1.00 118.55 ? 329 GLN C N   1 
ATOM   6926 C CA  . GLN C 1 304 ? -44.613  -12.836 40.096  1.00 128.83 ? 329 GLN C CA  1 
ATOM   6927 C C   . GLN C 1 304 ? -44.762  -13.165 41.573  1.00 133.12 ? 329 GLN C C   1 
ATOM   6928 O O   . GLN C 1 304 ? -44.480  -12.329 42.427  1.00 122.29 ? 329 GLN C O   1 
ATOM   6929 C CB  . GLN C 1 304 ? -43.288  -13.375 39.560  1.00 114.65 ? 329 GLN C CB  1 
ATOM   6930 N N   . ALA C 1 305 ? -45.194  -14.387 41.868  1.00 135.27 ? 330 ALA C N   1 
ATOM   6931 C CA  . ALA C 1 305 ? -45.378  -14.835 43.247  1.00 112.83 ? 330 ALA C CA  1 
ATOM   6932 C C   . ALA C 1 305 ? -45.314  -16.353 43.329  1.00 138.86 ? 330 ALA C C   1 
ATOM   6933 O O   . ALA C 1 305 ? -45.351  -17.036 42.301  1.00 141.16 ? 330 ALA C O   1 
ATOM   6934 C CB  . ALA C 1 305 ? -46.696  -14.346 43.783  1.00 112.51 ? 330 ALA C CB  1 
ATOM   6935 N N   . GLY C 1 306 ? -45.215  -16.878 44.550  1.00 142.48 ? 331 GLY C N   1 
ATOM   6936 C CA  . GLY C 1 306 ? -45.178  -18.317 44.747  1.00 159.28 ? 331 GLY C CA  1 
ATOM   6937 C C   . GLY C 1 306 ? -45.160  -18.799 46.187  1.00 154.55 ? 331 GLY C C   1 
ATOM   6938 O O   . GLY C 1 306 ? -44.397  -18.296 47.009  1.00 147.66 ? 331 GLY C O   1 
ATOM   6939 N N   . LYS C 1 307 ? -46.008  -19.781 46.484  1.00 155.63 ? 332 LYS C N   1 
ATOM   6940 C CA  . LYS C 1 307 ? -46.021  -20.452 47.781  1.00 160.05 ? 332 LYS C CA  1 
ATOM   6941 C C   . LYS C 1 307 ? -45.147  -21.707 47.727  1.00 171.61 ? 332 LYS C C   1 
ATOM   6942 O O   . LYS C 1 307 ? -44.549  -22.006 46.695  1.00 165.61 ? 332 LYS C O   1 
ATOM   6943 C CB  . LYS C 1 307 ? -47.452  -20.808 48.177  1.00 130.86 ? 332 LYS C CB  1 
ATOM   6944 N N   . PHE C 1 308 ? -45.074  -22.440 48.835  1.00 174.79 ? 333 PHE C N   1 
ATOM   6945 C CA  . PHE C 1 308 ? -44.320  -23.693 48.872  1.00 178.51 ? 333 PHE C CA  1 
ATOM   6946 C C   . PHE C 1 308 ? -44.963  -24.784 48.010  1.00 180.50 ? 333 PHE C C   1 
ATOM   6947 O O   . PHE C 1 308 ? -46.175  -24.779 47.794  1.00 179.97 ? 333 PHE C O   1 
ATOM   6948 C CB  . PHE C 1 308 ? -44.189  -24.195 50.312  1.00 182.36 ? 333 PHE C CB  1 
ATOM   6949 C CG  . PHE C 1 308 ? -43.781  -25.637 50.413  1.00 180.85 ? 333 PHE C CG  1 
ATOM   6950 C CD1 . PHE C 1 308 ? -44.733  -26.634 50.582  1.00 172.19 ? 333 PHE C CD1 1 
ATOM   6951 C CD2 . PHE C 1 308 ? -42.448  -25.996 50.324  1.00 168.56 ? 333 PHE C CD2 1 
ATOM   6952 C CE1 . PHE C 1 308 ? -44.363  -27.961 50.666  1.00 172.24 ? 333 PHE C CE1 1 
ATOM   6953 C CE2 . PHE C 1 308 ? -42.069  -27.321 50.410  1.00 182.74 ? 333 PHE C CE2 1 
ATOM   6954 C CZ  . PHE C 1 308 ? -43.028  -28.306 50.581  1.00 188.30 ? 333 PHE C CZ  1 
ATOM   6955 N N   . ASN C 1 309 ? -44.153  -25.726 47.534  1.00 175.37 ? 334 ASN C N   1 
ATOM   6956 C CA  . ASN C 1 309 ? -44.667  -26.862 46.773  1.00 174.63 ? 334 ASN C CA  1 
ATOM   6957 C C   . ASN C 1 309 ? -43.684  -28.030 46.818  1.00 175.44 ? 334 ASN C C   1 
ATOM   6958 O O   . ASN C 1 309 ? -42.476  -27.839 46.676  1.00 164.40 ? 334 ASN C O   1 
ATOM   6959 C CB  . ASN C 1 309 ? -44.960  -26.451 45.321  1.00 179.55 ? 334 ASN C CB  1 
ATOM   6960 C CG  . ASN C 1 309 ? -45.882  -27.432 44.598  1.00 172.53 ? 334 ASN C CG  1 
ATOM   6961 O OD1 . ASN C 1 309 ? -46.427  -28.355 45.204  1.00 160.08 ? 334 ASN C OD1 1 
ATOM   6962 N ND2 . ASN C 1 309 ? -46.063  -27.226 43.293  1.00 158.05 ? 334 ASN C ND2 1 
ATOM   6963 N N   . ILE C 1 310 ? -44.204  -29.235 47.027  1.00 171.77 ? 335 ILE C N   1 
ATOM   6964 C CA  . ILE C 1 310 ? -43.363  -30.422 47.120  1.00 157.01 ? 335 ILE C CA  1 
ATOM   6965 C C   . ILE C 1 310 ? -42.764  -30.814 45.768  1.00 160.55 ? 335 ILE C C   1 
ATOM   6966 O O   . ILE C 1 310 ? -41.645  -31.319 45.706  1.00 170.87 ? 335 ILE C O   1 
ATOM   6967 C CB  . ILE C 1 310 ? -44.144  -31.585 47.720  1.00 109.44 ? 335 ILE C CB  1 
ATOM   6968 N N   . ILE C 1 311 ? -43.502  -30.575 44.687  1.00 152.49 ? 336 ILE C N   1 
ATOM   6969 C CA  . ILE C 1 311 ? -43.037  -30.966 43.358  1.00 143.14 ? 336 ILE C CA  1 
ATOM   6970 C C   . ILE C 1 311 ? -41.673  -30.364 43.005  1.00 157.05 ? 336 ILE C C   1 
ATOM   6971 O O   . ILE C 1 311 ? -40.758  -31.094 42.631  1.00 170.51 ? 336 ILE C O   1 
ATOM   6972 C CB  . ILE C 1 311 ? -44.079  -30.632 42.294  1.00 98.19  ? 336 ILE C CB  1 
ATOM   6973 N N   . PRO C 1 312 ? -41.530  -29.032 43.131  1.00 155.23 ? 337 PRO C N   1 
ATOM   6974 C CA  . PRO C 1 312 ? -40.276  -28.329 42.822  1.00 159.57 ? 337 PRO C CA  1 
ATOM   6975 C C   . PRO C 1 312 ? -39.177  -28.557 43.865  1.00 174.90 ? 337 PRO C C   1 
ATOM   6976 O O   . PRO C 1 312 ? -37.993  -28.589 43.518  1.00 168.39 ? 337 PRO C O   1 
ATOM   6977 C CB  . PRO C 1 312 ? -40.700  -26.861 42.860  1.00 152.60 ? 337 PRO C CB  1 
ATOM   6978 C CG  . PRO C 1 312 ? -41.830  -26.858 43.827  1.00 164.45 ? 337 PRO C CG  1 
ATOM   6979 C CD  . PRO C 1 312 ? -42.602  -28.075 43.440  1.00 158.07 ? 337 PRO C CD  1 
ATOM   6980 N N   . THR C 1 313 ? -39.568  -28.696 45.130  1.00 177.37 ? 338 THR C N   1 
ATOM   6981 C CA  . THR C 1 313 ? -38.613  -28.916 46.212  1.00 163.84 ? 338 THR C CA  1 
ATOM   6982 C C   . THR C 1 313 ? -37.901  -30.262 46.063  1.00 169.93 ? 338 THR C C   1 
ATOM   6983 O O   . THR C 1 313 ? -36.672  -30.329 46.078  1.00 169.49 ? 338 THR C O   1 
ATOM   6984 C CB  . THR C 1 313 ? -39.298  -28.838 47.588  1.00 153.24 ? 338 THR C CB  1 
ATOM   6985 O OG1 . THR C 1 313 ? -40.048  -27.621 47.684  1.00 155.24 ? 338 THR C OG1 1 
ATOM   6986 C CG2 . THR C 1 313 ? -38.263  -28.877 48.697  1.00 158.61 ? 338 THR C CG2 1 
ATOM   6987 N N   . LEU C 1 314 ? -38.678  -31.329 45.909  1.00 167.48 ? 339 LEU C N   1 
ATOM   6988 C CA  . LEU C 1 314 ? -38.117  -32.660 45.721  1.00 156.48 ? 339 LEU C CA  1 
ATOM   6989 C C   . LEU C 1 314 ? -37.266  -32.734 44.458  1.00 165.21 ? 339 LEU C C   1 
ATOM   6990 O O   . LEU C 1 314 ? -36.217  -33.375 44.456  1.00 171.62 ? 339 LEU C O   1 
ATOM   6991 C CB  . LEU C 1 314 ? -39.225  -33.713 45.662  1.00 149.63 ? 339 LEU C CB  1 
ATOM   6992 C CG  . LEU C 1 314 ? -40.117  -33.814 46.901  1.00 153.41 ? 339 LEU C CG  1 
ATOM   6993 C CD1 . LEU C 1 314 ? -41.040  -35.012 46.808  1.00 141.07 ? 339 LEU C CD1 1 
ATOM   6994 C CD2 . LEU C 1 314 ? -39.286  -33.897 48.166  1.00 110.45 ? 339 LEU C CD2 1 
ATOM   6995 N N   . LEU C 1 315 ? -37.719  -32.082 43.388  1.00 163.35 ? 340 LEU C N   1 
ATOM   6996 C CA  . LEU C 1 315 ? -36.999  -32.095 42.111  1.00 161.51 ? 340 LEU C CA  1 
ATOM   6997 C C   . LEU C 1 315 ? -35.660  -31.350 42.150  1.00 171.40 ? 340 LEU C C   1 
ATOM   6998 O O   . LEU C 1 315 ? -34.735  -31.699 41.418  1.00 188.74 ? 340 LEU C O   1 
ATOM   6999 C CB  . LEU C 1 315 ? -37.879  -31.565 40.976  1.00 114.29 ? 340 LEU C CB  1 
ATOM   7000 N N   . ASN C 1 316 ? -35.554  -30.326 42.994  1.00 168.03 ? 341 ASN C N   1 
ATOM   7001 C CA  . ASN C 1 316 ? -34.279  -29.639 43.193  1.00 177.48 ? 341 ASN C CA  1 
ATOM   7002 C C   . ASN C 1 316 ? -33.370  -30.396 44.166  1.00 189.55 ? 341 ASN C C   1 
ATOM   7003 O O   . ASN C 1 316 ? -32.154  -30.473 43.967  1.00 184.27 ? 341 ASN C O   1 
ATOM   7004 C CB  . ASN C 1 316 ? -34.507  -28.207 43.679  1.00 168.87 ? 341 ASN C CB  1 
ATOM   7005 C CG  . ASN C 1 316 ? -33.269  -27.342 43.547  1.00 181.13 ? 341 ASN C CG  1 
ATOM   7006 O OD1 . ASN C 1 316 ? -32.265  -27.760 42.973  1.00 188.25 ? 341 ASN C OD1 1 
ATOM   7007 N ND2 . ASN C 1 316 ? -33.335  -26.128 44.079  1.00 173.96 ? 341 ASN C ND2 1 
ATOM   7008 N N   . ILE C 1 317 ? -33.970  -30.954 45.216  1.00 185.44 ? 342 ILE C N   1 
ATOM   7009 C CA  . ILE C 1 317 ? -33.238  -31.776 46.177  1.00 180.33 ? 342 ILE C CA  1 
ATOM   7010 C C   . ILE C 1 317 ? -32.674  -33.029 45.503  1.00 183.49 ? 342 ILE C C   1 
ATOM   7011 O O   . ILE C 1 317 ? -31.551  -33.442 45.785  1.00 188.05 ? 342 ILE C O   1 
ATOM   7012 C CB  . ILE C 1 317 ? -34.123  -32.176 47.381  1.00 166.56 ? 342 ILE C CB  1 
ATOM   7013 C CG1 . ILE C 1 317 ? -34.563  -30.932 48.157  1.00 170.44 ? 342 ILE C CG1 1 
ATOM   7014 C CG2 . ILE C 1 317 ? -33.380  -33.128 48.306  1.00 157.60 ? 342 ILE C CG2 1 
ATOM   7015 C CD1 . ILE C 1 317 ? -35.428  -31.230 49.370  1.00 167.80 ? 342 ILE C CD1 1 
ATOM   7016 N N   . GLY C 1 318 ? -33.455  -33.622 44.605  1.00 176.14 ? 343 GLY C N   1 
ATOM   7017 C CA  . GLY C 1 318 ? -33.024  -34.800 43.873  1.00 162.09 ? 343 GLY C CA  1 
ATOM   7018 C C   . GLY C 1 318 ? -31.742  -34.562 43.098  1.00 170.69 ? 343 GLY C C   1 
ATOM   7019 O O   . GLY C 1 318 ? -30.828  -35.385 43.129  1.00 183.82 ? 343 GLY C O   1 
ATOM   7020 N N   . ALA C 1 319 ? -31.672  -33.429 42.406  1.00 162.38 ? 344 ALA C N   1 
ATOM   7021 C CA  . ALA C 1 319 ? -30.488  -33.068 41.634  1.00 170.42 ? 344 ALA C CA  1 
ATOM   7022 C C   . ALA C 1 319 ? -29.312  -32.709 42.541  1.00 190.35 ? 344 ALA C C   1 
ATOM   7023 O O   . ALA C 1 319 ? -28.151  -32.831 42.146  1.00 186.52 ? 344 ALA C O   1 
ATOM   7024 C CB  . ALA C 1 319 ? -30.798  -31.918 40.687  1.00 165.00 ? 344 ALA C CB  1 
ATOM   7025 N N   . GLY C 1 320 ? -29.619  -32.265 43.756  1.00 192.35 ? 345 GLY C N   1 
ATOM   7026 C CA  . GLY C 1 320 ? -28.592  -31.934 44.727  1.00 184.77 ? 345 GLY C CA  1 
ATOM   7027 C C   . GLY C 1 320 ? -27.835  -33.166 45.184  1.00 185.20 ? 345 GLY C C   1 
ATOM   7028 O O   . GLY C 1 320 ? -26.654  -33.097 45.517  1.00 185.32 ? 345 GLY C O   1 
ATOM   7029 N N   . LEU C 1 321 ? -28.527  -34.299 45.203  1.00 178.15 ? 346 LEU C N   1 
ATOM   7030 C CA  . LEU C 1 321 ? -27.910  -35.575 45.542  1.00 178.79 ? 346 LEU C CA  1 
ATOM   7031 C C   . LEU C 1 321 ? -27.013  -36.066 44.413  1.00 173.97 ? 346 LEU C C   1 
ATOM   7032 O O   . LEU C 1 321 ? -25.869  -36.457 44.641  1.00 183.84 ? 346 LEU C O   1 
ATOM   7033 C CB  . LEU C 1 321 ? -28.979  -36.624 45.856  1.00 169.27 ? 346 LEU C CB  1 
ATOM   7034 C CG  . LEU C 1 321 ? -29.495  -36.662 47.298  1.00 171.21 ? 346 LEU C CG  1 
ATOM   7035 C CD1 . LEU C 1 321 ? -29.907  -35.281 47.784  1.00 132.27 ? 346 LEU C CD1 1 
ATOM   7036 C CD2 . LEU C 1 321 ? -30.647  -37.644 47.430  1.00 168.63 ? 346 LEU C CD2 1 
ATOM   7037 N N   . ALA C 1 322 ? -27.530  -36.049 43.192  1.00 166.84 ? 347 ALA C N   1 
ATOM   7038 C CA  . ALA C 1 322 ? -26.723  -36.446 42.050  1.00 178.41 ? 347 ALA C CA  1 
ATOM   7039 C C   . ALA C 1 322 ? -25.526  -35.510 41.912  1.00 184.38 ? 347 ALA C C   1 
ATOM   7040 O O   . ALA C 1 322 ? -24.446  -35.924 41.488  1.00 175.23 ? 347 ALA C O   1 
ATOM   7041 C CB  . ALA C 1 322 ? -27.556  -36.450 40.785  1.00 177.37 ? 347 ALA C CB  1 
ATOM   7042 N N   . LEU C 1 323 ? -25.724  -34.251 42.289  1.00 190.36 ? 348 LEU C N   1 
ATOM   7043 C CA  . LEU C 1 323 ? -24.666  -33.248 42.223  1.00 185.99 ? 348 LEU C CA  1 
ATOM   7044 C C   . LEU C 1 323 ? -23.555  -33.492 43.249  1.00 203.03 ? 348 LEU C C   1 
ATOM   7045 O O   . LEU C 1 323 ? -22.414  -33.083 43.037  1.00 208.75 ? 348 LEU C O   1 
ATOM   7046 C CB  . LEU C 1 323 ? -25.245  -31.849 42.379  1.00 143.60 ? 348 LEU C CB  1 
ATOM   7047 N N   . LEU C 1 324 ? -23.884  -34.155 44.355  1.00 204.56 ? 349 LEU C N   1 
ATOM   7048 C CA  . LEU C 1 324 ? -22.881  -34.480 45.369  1.00 205.13 ? 349 LEU C CA  1 
ATOM   7049 C C   . LEU C 1 324 ? -22.069  -35.712 44.959  1.00 201.54 ? 349 LEU C C   1 
ATOM   7050 O O   . LEU C 1 324 ? -20.983  -35.967 45.490  1.00 196.88 ? 349 LEU C O   1 
ATOM   7051 C CB  . LEU C 1 324 ? -23.539  -34.649 46.748  1.00 207.16 ? 349 LEU C CB  1 
ATOM   7052 C CG  . LEU C 1 324 ? -23.731  -35.973 47.514  1.00 193.81 ? 349 LEU C CG  1 
ATOM   7053 C CD1 . LEU C 1 324 ? -24.712  -35.860 48.692  1.00 169.81 ? 349 LEU C CD1 1 
ATOM   7054 C CD2 . LEU C 1 324 ? -23.908  -37.268 46.712  1.00 162.84 ? 349 LEU C CD2 1 
ATOM   7055 N N   . GLY C 1 325 ? -22.609  -36.472 44.010  1.00 186.71 ? 350 GLY C N   1 
ATOM   7056 C CA  . GLY C 1 325 ? -21.900  -37.603 43.441  1.00 180.02 ? 350 GLY C CA  1 
ATOM   7057 C C   . GLY C 1 325 ? -20.777  -37.133 42.538  1.00 191.65 ? 350 GLY C C   1 
ATOM   7058 O O   . GLY C 1 325 ? -19.672  -37.673 42.574  1.00 200.27 ? 350 GLY C O   1 
ATOM   7059 N N   . LEU C 1 326 ? -21.069  -36.115 41.731  1.00 190.15 ? 351 LEU C N   1 
ATOM   7060 C CA  . LEU C 1 326 ? -20.081  -35.484 40.858  1.00 195.49 ? 351 LEU C CA  1 
ATOM   7061 C C   . LEU C 1 326 ? -19.064  -34.683 41.665  1.00 198.41 ? 351 LEU C C   1 
ATOM   7062 O O   . LEU C 1 326 ? -17.881  -34.635 41.331  1.00 199.16 ? 351 LEU C O   1 
ATOM   7063 C CB  . LEU C 1 326 ? -20.786  -34.574 39.843  1.00 206.03 ? 351 LEU C CB  1 
ATOM   7064 C CG  . LEU C 1 326 ? -20.054  -33.442 39.104  1.00 210.46 ? 351 LEU C CG  1 
ATOM   7065 C CD1 . LEU C 1 326 ? -19.799  -32.235 40.013  1.00 208.71 ? 351 LEU C CD1 1 
ATOM   7066 C CD2 . LEU C 1 326 ? -18.764  -33.924 38.451  1.00 182.79 ? 351 LEU C CD2 1 
ATOM   7067 N N   . VAL C 1 327 ? -19.540  -34.052 42.731  1.00 200.60 ? 352 VAL C N   1 
ATOM   7068 C CA  . VAL C 1 327 ? -18.699  -33.201 43.564  1.00 199.08 ? 352 VAL C CA  1 
ATOM   7069 C C   . VAL C 1 327 ? -17.607  -33.997 44.278  1.00 216.90 ? 352 VAL C C   1 
ATOM   7070 O O   . VAL C 1 327 ? -16.484  -33.512 44.447  1.00 213.42 ? 352 VAL C O   1 
ATOM   7071 C CB  . VAL C 1 327 ? -19.550  -32.448 44.573  1.00 185.44 ? 352 VAL C CB  1 
ATOM   7072 N N   . ASN C 1 328 ? -17.958  -35.204 44.720  1.00 227.83 ? 353 ASN C N   1 
ATOM   7073 C CA  . ASN C 1 328 ? -17.002  -36.121 45.336  1.00 211.93 ? 353 ASN C CA  1 
ATOM   7074 C C   . ASN C 1 328 ? -16.055  -36.690 44.280  1.00 213.16 ? 353 ASN C C   1 
ATOM   7075 O O   . ASN C 1 328 ? -14.945  -37.120 44.598  1.00 209.35 ? 353 ASN C O   1 
ATOM   7076 C CB  . ASN C 1 328 ? -17.729  -37.244 46.066  1.00 154.79 ? 353 ASN C CB  1 
ATOM   7077 N N   . VAL C 1 329 ? -16.506  -36.697 43.026  1.00 208.26 ? 354 VAL C N   1 
ATOM   7078 C CA  . VAL C 1 329 ? -15.674  -37.118 41.901  1.00 189.55 ? 354 VAL C CA  1 
ATOM   7079 C C   . VAL C 1 329 ? -14.794  -35.969 41.413  1.00 187.39 ? 354 VAL C C   1 
ATOM   7080 O O   . VAL C 1 329 ? -13.778  -36.188 40.751  1.00 166.74 ? 354 VAL C O   1 
ATOM   7081 C CB  . VAL C 1 329 ? -16.538  -37.657 40.767  1.00 163.50 ? 354 VAL C CB  1 
ATOM   7082 N N   . ILE C 1 330 ? -15.202  -34.745 41.734  1.00 193.60 ? 355 ILE C N   1 
ATOM   7083 C CA  . ILE C 1 330 ? -14.401  -33.559 41.449  1.00 188.92 ? 355 ILE C CA  1 
ATOM   7084 C C   . ILE C 1 330 ? -13.356  -33.368 42.544  1.00 210.87 ? 355 ILE C C   1 
ATOM   7085 O O   . ILE C 1 330 ? -12.319  -32.738 42.326  1.00 201.04 ? 355 ILE C O   1 
ATOM   7086 C CB  . ILE C 1 330 ? -15.288  -32.328 41.336  1.00 164.45 ? 355 ILE C CB  1 
ATOM   7087 N N   . CYS C 1 331 ? -13.644  -33.913 43.724  1.00 226.96 ? 356 CYS C N   1 
ATOM   7088 C CA  . CYS C 1 331 ? -12.699  -33.903 44.838  1.00 219.25 ? 356 CYS C CA  1 
ATOM   7089 C C   . CYS C 1 331 ? -11.605  -34.951 44.632  1.00 210.96 ? 356 CYS C C   1 
ATOM   7090 O O   . CYS C 1 331 ? -10.467  -34.766 45.063  1.00 190.42 ? 356 CYS C O   1 
ATOM   7091 C CB  . CYS C 1 331 ? -13.423  -34.130 46.163  1.00 195.56 ? 356 CYS C CB  1 
ATOM   7092 N N   . ASP C 1 332 ? -11.958  -36.049 43.966  1.00 215.29 ? 357 ASP C N   1 
ATOM   7093 C CA  . ASP C 1 332 ? -10.990  -37.087 43.622  1.00 193.52 ? 357 ASP C CA  1 
ATOM   7094 C C   . ASP C 1 332 ? -9.987   -36.604 42.570  1.00 203.13 ? 357 ASP C C   1 
ATOM   7095 O O   . ASP C 1 332 ? -8.823   -36.999 42.593  1.00 200.27 ? 357 ASP C O   1 
ATOM   7096 C CB  . ASP C 1 332 ? -11.703  -38.355 43.148  1.00 142.25 ? 357 ASP C CB  1 
ATOM   7097 N N   . TRP C 1 333 ? -10.443  -35.753 41.652  1.00 216.40 ? 358 TRP C N   1 
ATOM   7098 C CA  . TRP C 1 333 ? -9.580   -35.220 40.596  1.00 195.74 ? 358 TRP C CA  1 
ATOM   7099 C C   . TRP C 1 333 ? -8.714   -34.053 41.075  1.00 192.05 ? 358 TRP C C   1 
ATOM   7100 O O   . TRP C 1 333 ? -9.027   -33.393 42.068  1.00 181.93 ? 358 TRP C O   1 
ATOM   7101 C CB  . TRP C 1 333 ? -10.406  -34.811 39.379  1.00 143.36 ? 358 TRP C CB  1 
HETATM 7102 C C1  . NAG D 2 .   ? -26.886  5.893   7.113   1.00 183.22 ? 1   NAG D C1  1 
HETATM 7103 C C2  . NAG D 2 .   ? -27.069  4.682   6.206   1.00 184.13 ? 1   NAG D C2  1 
HETATM 7104 C C3  . NAG D 2 .   ? -26.326  4.672   4.887   1.00 195.42 ? 1   NAG D C3  1 
HETATM 7105 C C4  . NAG D 2 .   ? -26.530  6.010   4.171   1.00 212.42 ? 1   NAG D C4  1 
HETATM 7106 C C5  . NAG D 2 .   ? -26.071  7.123   5.133   1.00 196.32 ? 1   NAG D C5  1 
HETATM 7107 C C6  . NAG D 2 .   ? -26.169  8.498   4.501   1.00 174.26 ? 1   NAG D C6  1 
HETATM 7108 C C7  . NAG D 2 .   ? -27.546  2.546   7.224   1.00 184.32 ? 1   NAG D C7  1 
HETATM 7109 C C8  . NAG D 2 .   ? -28.291  2.762   8.513   1.00 152.09 ? 1   NAG D C8  1 
HETATM 7110 N N2  . NAG D 2 .   ? -26.675  3.498   6.922   1.00 188.93 ? 1   NAG D N2  1 
HETATM 7111 O O3  . NAG D 2 .   ? -26.970  3.626   4.192   1.00 171.83 ? 1   NAG D O3  1 
HETATM 7112 O O4  . NAG D 2 .   ? -25.780  6.186   2.968   1.00 223.19 ? 1   NAG D O4  1 
HETATM 7113 O O5  . NAG D 2 .   ? -26.594  7.127   6.473   1.00 192.44 ? 1   NAG D O5  1 
HETATM 7114 O O6  . NAG D 2 .   ? -27.494  8.771   4.094   1.00 148.38 ? 1   NAG D O6  1 
HETATM 7115 O O7  . NAG D 2 .   ? -27.733  1.568   6.513   1.00 174.94 ? 1   NAG D O7  1 
HETATM 7116 C C1  . NAG D 2 .   ? -26.531  5.861   1.763   1.00 231.23 ? 2   NAG D C1  1 
HETATM 7117 C C2  . NAG D 2 .   ? -26.150  6.386   0.358   1.00 229.61 ? 2   NAG D C2  1 
HETATM 7118 C C3  . NAG D 2 .   ? -25.993  5.331   -0.717  1.00 229.46 ? 2   NAG D C3  1 
HETATM 7119 C C4  . NAG D 2 .   ? -25.203  4.128   -0.224  1.00 227.73 ? 2   NAG D C4  1 
HETATM 7120 C C5  . NAG D 2 .   ? -25.885  3.580   1.034   1.00 232.52 ? 2   NAG D C5  1 
HETATM 7121 C C6  . NAG D 2 .   ? -25.309  2.255   1.564   1.00 188.77 ? 2   NAG D C6  1 
HETATM 7122 C C7  . NAG D 2 .   ? -26.804  8.697   -0.366  1.00 191.56 ? 2   NAG D C7  1 
HETATM 7123 C C8  . NAG D 2 .   ? -27.277  9.199   -1.684  1.00 130.00 ? 2   NAG D C8  1 
HETATM 7124 N N2  . NAG D 2 .   ? -27.083  7.418   -0.101  1.00 225.57 ? 2   NAG D N2  1 
HETATM 7125 O O3  . NAG D 2 .   ? -25.252  5.968   -1.721  1.00 203.13 ? 2   NAG D O3  1 
HETATM 7126 O O4  . NAG D 2 .   ? -25.201  3.046   -1.125  1.00 195.57 ? 2   NAG D O4  1 
HETATM 7127 O O5  . NAG D 2 .   ? -26.196  4.505   2.096   1.00 239.76 ? 2   NAG D O5  1 
HETATM 7128 O O6  . NAG D 2 .   ? -23.972  2.373   1.988   1.00 131.91 ? 2   NAG D O6  1 
HETATM 7129 O O7  . NAG D 2 .   ? -26.205  9.447   0.396   1.00 182.80 ? 2   NAG D O7  1 
HETATM 7130 C C1  . NAG E 2 .   ? -54.913  8.229   58.945  1.00 126.84 ? 1   NAG E C1  1 
HETATM 7131 C C2  . NAG E 2 .   ? -53.846  8.044   57.866  1.00 144.90 ? 1   NAG E C2  1 
HETATM 7132 C C3  . NAG E 2 .   ? -52.366  7.815   58.240  1.00 157.34 ? 1   NAG E C3  1 
HETATM 7133 C C4  . NAG E 2 .   ? -51.902  8.682   59.382  1.00 143.80 ? 1   NAG E C4  1 
HETATM 7134 C C5  . NAG E 2 .   ? -52.928  8.393   60.511  1.00 134.85 ? 1   NAG E C5  1 
HETATM 7135 C C6  . NAG E 2 .   ? -52.683  9.325   61.702  1.00 152.68 ? 1   NAG E C6  1 
HETATM 7136 C C7  . NAG E 2 .   ? -53.538  5.781   57.235  1.00 125.85 ? 1   NAG E C7  1 
HETATM 7137 C C8  . NAG E 2 .   ? -54.131  4.776   58.171  1.00 137.54 ? 1   NAG E C8  1 
HETATM 7138 N N2  . NAG E 2 .   ? -54.261  6.890   57.097  1.00 109.98 ? 1   NAG E N2  1 
HETATM 7139 O O3  . NAG E 2 .   ? -51.661  8.147   57.059  1.00 159.96 ? 1   NAG E O3  1 
HETATM 7140 O O4  . NAG E 2 .   ? -50.609  8.188   59.716  1.00 134.10 ? 1   NAG E O4  1 
HETATM 7141 O O5  . NAG E 2 .   ? -54.339  8.501   60.218  1.00 99.54  ? 1   NAG E O5  1 
HETATM 7142 O O6  . NAG E 2 .   ? -51.373  9.194   62.219  1.00 114.08 ? 1   NAG E O6  1 
HETATM 7143 O O7  . NAG E 2 .   ? -52.459  5.556   56.657  1.00 134.86 ? 1   NAG E O7  1 
HETATM 7144 C C1  . NAG E 2 .   ? -49.558  9.000   59.069  1.00 150.40 ? 2   NAG E C1  1 
HETATM 7145 C C2  . NAG E 2 .   ? -48.287  8.679   59.878  1.00 173.36 ? 2   NAG E C2  1 
HETATM 7146 C C3  . NAG E 2 .   ? -47.158  9.703   59.701  1.00 214.18 ? 2   NAG E C3  1 
HETATM 7147 C C4  . NAG E 2 .   ? -46.936  10.270  58.306  1.00 206.45 ? 2   NAG E C4  1 
HETATM 7148 C C5  . NAG E 2 .   ? -48.302  10.797  57.830  1.00 195.71 ? 2   NAG E C5  1 
HETATM 7149 C C6  . NAG E 2 .   ? -48.237  11.319  56.385  1.00 141.13 ? 2   NAG E C6  1 
HETATM 7150 C C7  . NAG E 2 .   ? -48.672  7.801   62.190  1.00 133.52 ? 2   NAG E C7  1 
HETATM 7151 C C8  . NAG E 2 .   ? -47.527  7.707   63.163  1.00 93.46  ? 2   NAG E C8  1 
HETATM 7152 N N2  . NAG E 2 .   ? -48.619  8.780   61.300  1.00 149.26 ? 2   NAG E N2  1 
HETATM 7153 O O3  . NAG E 2 .   ? -45.966  9.070   60.110  1.00 207.16 ? 2   NAG E O3  1 
HETATM 7154 O O4  . NAG E 2 .   ? -46.100  11.408  58.474  1.00 145.05 ? 2   NAG E O4  1 
HETATM 7155 O O5  . NAG E 2 .   ? -49.461  9.952   57.986  1.00 139.80 ? 2   NAG E O5  1 
HETATM 7156 O O6  . NAG E 2 .   ? -47.299  12.362  56.213  1.00 91.82  ? 2   NAG E O6  1 
HETATM 7157 O O7  . NAG E 2 .   ? -49.621  7.024   62.210  1.00 113.21 ? 2   NAG E O7  1 
HETATM 7158 C C1  . NAG F 3 .   ? -63.605  14.082  -8.957  1.00 171.47 ? 401 NAG A C1  1 
HETATM 7159 C C2  . NAG F 3 .   ? -62.500  14.702  -9.826  1.00 174.08 ? 401 NAG A C2  1 
HETATM 7160 C C3  . NAG F 3 .   ? -62.984  15.783  -10.786 1.00 169.68 ? 401 NAG A C3  1 
HETATM 7161 C C4  . NAG F 3 .   ? -64.280  15.400  -11.492 1.00 159.95 ? 401 NAG A C4  1 
HETATM 7162 C C5  . NAG F 3 .   ? -65.331  15.037  -10.423 1.00 149.80 ? 401 NAG A C5  1 
HETATM 7163 C C6  . NAG F 3 .   ? -66.749  14.810  -10.994 1.00 130.05 ? 401 NAG A C6  1 
HETATM 7164 C C7  . NAG F 3 .   ? -60.159  14.665  -8.996  1.00 129.72 ? 401 NAG A C7  1 
HETATM 7165 C C8  . NAG F 3 .   ? -59.070  15.653  -8.770  1.00 94.36  ? 401 NAG A C8  1 
HETATM 7166 N N2  . NAG F 3 .   ? -61.384  15.197  -9.012  1.00 148.28 ? 401 NAG A N2  1 
HETATM 7167 O O3  . NAG F 3 .   ? -61.972  15.874  -11.767 1.00 129.89 ? 401 NAG A O3  1 
HETATM 7168 O O4  . NAG F 3 .   ? -64.841  16.460  -12.230 1.00 146.77 ? 401 NAG A O4  1 
HETATM 7169 O O5  . NAG F 3 .   ? -64.949  14.098  -9.409  1.00 165.29 ? 401 NAG A O5  1 
HETATM 7170 O O6  . NAG F 3 .   ? -66.784  13.762  -11.945 1.00 128.61 ? 401 NAG A O6  1 
HETATM 7171 O O7  . NAG F 3 .   ? -59.906  13.475  -9.148  1.00 122.46 ? 401 NAG A O7  1 
HETATM 7172 C C1  . NAG G 3 .   ? -82.934  17.828  8.312   1.00 158.59 ? 402 NAG A C1  1 
HETATM 7173 C C2  . NAG G 3 .   ? -83.129  18.041  6.804   1.00 175.32 ? 402 NAG A C2  1 
HETATM 7174 C C3  . NAG G 3 .   ? -84.481  18.658  6.440   1.00 166.21 ? 402 NAG A C3  1 
HETATM 7175 C C4  . NAG G 3 .   ? -85.658  18.099  7.212   1.00 178.27 ? 402 NAG A C4  1 
HETATM 7176 C C5  . NAG G 3 .   ? -85.368  18.128  8.714   1.00 178.06 ? 402 NAG A C5  1 
HETATM 7177 C C6  . NAG G 3 .   ? -86.316  17.196  9.477   1.00 160.11 ? 402 NAG A C6  1 
HETATM 7178 C C7  . NAG G 3 .   ? -81.253  18.459  5.256   1.00 150.50 ? 402 NAG A C7  1 
HETATM 7179 C C8  . NAG G 3 .   ? -80.135  19.402  4.911   1.00 94.94  ? 402 NAG A C8  1 
HETATM 7180 N N2  . NAG G 3 .   ? -82.064  18.868  6.229   1.00 175.17 ? 402 NAG A N2  1 
HETATM 7181 O O3  . NAG G 3 .   ? -84.703  18.383  5.083   1.00 134.47 ? 402 NAG A O3  1 
HETATM 7182 O O4  . NAG G 3 .   ? -86.749  18.963  6.983   1.00 158.50 ? 402 NAG A O4  1 
HETATM 7183 O O5  . NAG G 3 .   ? -84.079  17.719  9.141   1.00 146.64 ? 402 NAG A O5  1 
HETATM 7184 O O6  . NAG G 3 .   ? -87.678  17.463  9.223   1.00 182.33 ? 402 NAG A O6  1 
HETATM 7185 O O7  . NAG G 3 .   ? -81.365  17.384  4.670   1.00 114.96 ? 402 NAG A O7  1 
HETATM 7186 C C1  . NAG H 3 .   ? -49.962  3.870   -4.621  1.00 124.24 ? 403 NAG A C1  1 
HETATM 7187 C C2  . NAG H 3 .   ? -51.234  3.839   -5.491  1.00 156.96 ? 403 NAG A C2  1 
HETATM 7188 C C3  . NAG H 3 .   ? -51.086  3.295   -6.916  1.00 162.90 ? 403 NAG A C3  1 
HETATM 7189 C C4  . NAG H 3 .   ? -49.855  3.763   -7.650  1.00 162.64 ? 403 NAG A C4  1 
HETATM 7190 C C5  . NAG H 3 .   ? -48.628  3.560   -6.759  1.00 154.50 ? 403 NAG A C5  1 
HETATM 7191 C C6  . NAG H 3 .   ? -47.529  4.499   -7.302  1.00 167.75 ? 403 NAG A C6  1 
HETATM 7192 C C7  . NAG H 3 .   ? -53.529  3.682   -4.694  1.00 114.08 ? 403 NAG A C7  1 
HETATM 7193 C C8  . NAG H 3 .   ? -54.597  2.708   -4.332  1.00 114.70 ? 403 NAG A C8  1 
HETATM 7194 N N2  . NAG H 3 .   ? -52.346  3.109   -4.884  1.00 124.37 ? 403 NAG A N2  1 
HETATM 7195 O O3  . NAG H 3 .   ? -52.173  3.779   -7.679  1.00 135.54 ? 403 NAG A O3  1 
HETATM 7196 O O4  . NAG H 3 .   ? -49.715  2.959   -8.803  1.00 147.47 ? 403 NAG A O4  1 
HETATM 7197 O O5  . NAG H 3 .   ? -48.743  3.853   -5.366  1.00 113.24 ? 403 NAG A O5  1 
HETATM 7198 O O6  . NAG H 3 .   ? -47.284  4.345   -8.689  1.00 160.95 ? 403 NAG A O6  1 
HETATM 7199 O O7  . NAG H 3 .   ? -53.773  4.886   -4.802  1.00 101.33 ? 403 NAG A O7  1 
HETATM 7200 C C1  . NAG I 3 .   ? -92.022  9.283   28.267  1.00 162.50 ? 401 NAG B C1  1 
HETATM 7201 C C2  . NAG I 3 .   ? -93.212  8.422   27.828  1.00 165.74 ? 401 NAG B C2  1 
HETATM 7202 C C3  . NAG I 3 .   ? -94.513  9.158   27.554  1.00 170.83 ? 401 NAG B C3  1 
HETATM 7203 C C4  . NAG I 3 .   ? -94.781  10.173  28.653  1.00 180.98 ? 401 NAG B C4  1 
HETATM 7204 C C5  . NAG I 3 .   ? -93.565  11.115  28.760  1.00 167.97 ? 401 NAG B C5  1 
HETATM 7205 C C6  . NAG I 3 .   ? -93.777  12.221  29.804  1.00 154.15 ? 401 NAG B C6  1 
HETATM 7206 C C7  . NAG I 3 .   ? -92.714  6.283   26.738  1.00 149.58 ? 401 NAG B C7  1 
HETATM 7207 C C8  . NAG I 3 .   ? -92.598  5.665   25.389  1.00 112.15 ? 401 NAG B C8  1 
HETATM 7208 N N2  . NAG I 3 .   ? -92.835  7.606   26.684  1.00 145.53 ? 401 NAG B N2  1 
HETATM 7209 O O3  . NAG I 3 .   ? -95.507  8.163   27.605  1.00 157.82 ? 401 NAG B O3  1 
HETATM 7210 O O4  . NAG I 3 .   ? -95.882  11.027  28.381  1.00 187.95 ? 401 NAG B O4  1 
HETATM 7211 O O5  . NAG I 3 .   ? -92.262  10.536  28.886  1.00 168.88 ? 401 NAG B O5  1 
HETATM 7212 O O6  . NAG I 3 .   ? -94.026  11.643  31.077  1.00 134.10 ? 401 NAG B O6  1 
HETATM 7213 O O7  . NAG I 3 .   ? -92.695  5.605   27.765  1.00 112.12 ? 401 NAG B O7  1 
HETATM 7214 C C1  . NAG J 3 .   ? -75.345  30.494  27.504  1.00 172.59 ? 402 NAG B C1  1 
HETATM 7215 C C2  . NAG J 3 .   ? -76.711  31.132  27.803  1.00 170.82 ? 402 NAG B C2  1 
HETATM 7216 C C3  . NAG J 3 .   ? -76.768  32.667  27.763  1.00 180.18 ? 402 NAG B C3  1 
HETATM 7217 C C4  . NAG J 3 .   ? -75.541  33.296  28.418  1.00 193.43 ? 402 NAG B C4  1 
HETATM 7218 C C5  . NAG J 3 .   ? -74.285  32.711  27.733  1.00 188.35 ? 402 NAG B C5  1 
HETATM 7219 C C6  . NAG J 3 .   ? -72.954  33.408  28.118  1.00 166.02 ? 402 NAG B C6  1 
HETATM 7220 C C7  . NAG J 3 .   ? -78.778  29.892  27.274  1.00 168.21 ? 402 NAG B C7  1 
HETATM 7221 C C8  . NAG J 3 .   ? -79.451  29.174  26.151  1.00 116.05 ? 402 NAG B C8  1 
HETATM 7222 N N2  . NAG J 3 .   ? -77.730  30.608  26.904  1.00 173.41 ? 402 NAG B N2  1 
HETATM 7223 O O3  . NAG J 3 .   ? -77.914  32.983  28.505  1.00 178.63 ? 402 NAG B O3  1 
HETATM 7224 O O4  . NAG J 3 .   ? -75.463  34.694  28.236  1.00 179.65 ? 402 NAG B O4  1 
HETATM 7225 O O5  . NAG J 3 .   ? -74.173  31.288  27.659  1.00 175.76 ? 402 NAG B O5  1 
HETATM 7226 O O6  . NAG J 3 .   ? -72.696  33.320  29.503  1.00 149.58 ? 402 NAG B O6  1 
HETATM 7227 O O7  . NAG J 3 .   ? -79.182  29.794  28.429  1.00 166.76 ? 402 NAG B O7  1 
HETATM 7228 C C1  . NAG K 3 .   ? -84.765  -5.635  30.439  1.00 115.25 ? 403 NAG B C1  1 
HETATM 7229 C C2  . NAG K 3 .   ? -85.744  -4.657  31.072  1.00 121.59 ? 403 NAG B C2  1 
HETATM 7230 C C3  . NAG K 3 .   ? -86.852  -5.217  31.942  1.00 127.07 ? 403 NAG B C3  1 
HETATM 7231 C C4  . NAG K 3 .   ? -87.481  -6.444  31.313  1.00 129.85 ? 403 NAG B C4  1 
HETATM 7232 C C5  . NAG K 3 .   ? -86.341  -7.447  30.990  1.00 133.69 ? 403 NAG B C5  1 
HETATM 7233 C C6  . NAG K 3 .   ? -86.839  -8.705  30.264  1.00 119.48 ? 403 NAG B C6  1 
HETATM 7234 C C7  . NAG K 3 .   ? -85.188  -2.346  31.360  1.00 113.41 ? 403 NAG B C7  1 
HETATM 7235 C C8  . NAG K 3 .   ? -84.478  -1.318  32.160  1.00 114.76 ? 403 NAG B C8  1 
HETATM 7236 N N2  . NAG K 3 .   ? -85.040  -3.596  31.776  1.00 98.08  ? 403 NAG B N2  1 
HETATM 7237 O O3  . NAG K 3 .   ? -87.826  -4.206  31.907  1.00 136.05 ? 403 NAG B O3  1 
HETATM 7238 O O4  . NAG K 3 .   ? -88.447  -7.089  32.140  1.00 85.52  ? 403 NAG B O4  1 
HETATM 7239 O O5  . NAG K 3 .   ? -85.182  -6.974  30.277  1.00 112.72 ? 403 NAG B O5  1 
HETATM 7240 O O6  . NAG K 3 .   ? -87.308  -8.281  28.992  1.00 75.70  ? 403 NAG B O6  1 
HETATM 7241 O O7  . NAG K 3 .   ? -85.856  -2.030  30.387  1.00 125.57 ? 403 NAG B O7  1 
HETATM 7242 C C1  . NAG L 3 .   ? -77.022  -25.589 14.183  1.00 104.26 ? 404 NAG B C1  1 
HETATM 7243 C C2  . NAG L 3 .   ? -77.018  -25.582 15.704  1.00 109.55 ? 404 NAG B C2  1 
HETATM 7244 C C3  . NAG L 3 .   ? -77.729  -26.729 16.408  1.00 123.24 ? 404 NAG B C3  1 
HETATM 7245 C C4  . NAG L 3 .   ? -79.007  -27.143 15.729  1.00 156.34 ? 404 NAG B C4  1 
HETATM 7246 C C5  . NAG L 3 .   ? -78.775  -27.318 14.211  1.00 173.29 ? 404 NAG B C5  1 
HETATM 7247 C C6  . NAG L 3 .   ? -80.099  -27.304 13.424  1.00 162.60 ? 404 NAG B C6  1 
HETATM 7248 C C7  . NAG L 3 .   ? -75.222  -24.663 16.916  1.00 99.22  ? 404 NAG B C7  1 
HETATM 7249 C C8  . NAG L 3 .   ? -73.761  -24.668 17.205  1.00 101.54 ? 404 NAG B C8  1 
HETATM 7250 N N2  . NAG L 3 .   ? -75.651  -25.641 16.170  1.00 93.39  ? 404 NAG B N2  1 
HETATM 7251 O O3  . NAG L 3 .   ? -78.034  -26.343 17.730  1.00 115.43 ? 404 NAG B O3  1 
HETATM 7252 O O4  . NAG L 3 .   ? -79.265  -28.402 16.314  1.00 152.07 ? 404 NAG B O4  1 
HETATM 7253 O O5  . NAG L 3 .   ? -77.991  -26.357 13.520  1.00 118.27 ? 404 NAG B O5  1 
HETATM 7254 O O6  . NAG L 3 .   ? -81.018  -28.294 13.838  1.00 131.20 ? 404 NAG B O6  1 
HETATM 7255 O O7  . NAG L 3 .   ? -75.980  -23.812 17.352  1.00 109.87 ? 404 NAG B O7  1 
HETATM 7256 C C1  . NAG M 3 .   ? -53.632  37.128  31.021  1.00 189.62 ? 401 NAG C C1  1 
HETATM 7257 C C2  . NAG M 3 .   ? -53.527  37.788  32.395  1.00 182.73 ? 401 NAG C C2  1 
HETATM 7258 C C3  . NAG M 3 .   ? -53.877  39.270  32.441  1.00 196.47 ? 401 NAG C C3  1 
HETATM 7259 C C4  . NAG M 3 .   ? -53.190  40.004  31.298  1.00 200.57 ? 401 NAG C C4  1 
HETATM 7260 C C5  . NAG M 3 .   ? -53.614  39.327  29.974  1.00 208.38 ? 401 NAG C C5  1 
HETATM 7261 C C6  . NAG M 3 .   ? -53.085  40.054  28.724  1.00 200.06 ? 401 NAG C C6  1 
HETATM 7262 C C7  . NAG M 3 .   ? -53.680  36.337  34.322  1.00 156.20 ? 401 NAG C C7  1 
HETATM 7263 C C8  . NAG M 3 .   ? -54.588  35.824  35.372  1.00 134.09 ? 401 NAG C C8  1 
HETATM 7264 N N2  . NAG M 3 .   ? -54.295  37.012  33.360  1.00 158.97 ? 401 NAG C N2  1 
HETATM 7265 O O3  . NAG M 3 .   ? -53.330  39.708  33.662  1.00 196.61 ? 401 NAG C O3  1 
HETATM 7266 O O4  . NAG M 3 .   ? -53.560  41.360  31.150  1.00 172.38 ? 401 NAG C O4  1 
HETATM 7267 O O5  . NAG M 3 .   ? -53.469  37.908  29.857  1.00 208.10 ? 401 NAG C O5  1 
HETATM 7268 O O6  . NAG M 3 .   ? -51.665  40.087  28.749  1.00 210.60 ? 401 NAG C O6  1 
HETATM 7269 O O7  . NAG M 3 .   ? -52.476  36.113  34.356  1.00 146.92 ? 401 NAG C O7  1 
HETATM 7270 C C1  . NAG N 3 .   ? -63.135  31.684  7.900   1.00 185.80 ? 402 NAG C C1  1 
HETATM 7271 C C2  . NAG N 3 .   ? -64.366  32.592  8.136   1.00 185.49 ? 402 NAG C C2  1 
HETATM 7272 C C3  . NAG N 3 .   ? -65.136  32.986  6.888   1.00 186.61 ? 402 NAG C C3  1 
HETATM 7273 C C4  . NAG N 3 .   ? -64.227  33.459  5.780   1.00 196.39 ? 402 NAG C C4  1 
HETATM 7274 C C5  . NAG N 3 .   ? -63.138  32.433  5.490   1.00 179.26 ? 402 NAG C C5  1 
HETATM 7275 C C6  . NAG N 3 .   ? -62.001  33.119  4.719   1.00 183.99 ? 402 NAG C C6  1 
HETATM 7276 C C7  . NAG N 3 .   ? -65.770  32.651  10.188  1.00 166.61 ? 402 NAG C C7  1 
HETATM 7277 C C8  . NAG N 3 .   ? -67.225  32.998  10.245  1.00 130.73 ? 402 NAG C C8  1 
HETATM 7278 N N2  . NAG N 3 .   ? -65.368  32.062  9.061   1.00 188.03 ? 402 NAG C N2  1 
HETATM 7279 O O3  . NAG N 3 .   ? -65.993  34.033  7.275   1.00 165.20 ? 402 NAG C O3  1 
HETATM 7280 O O4  . NAG N 3 .   ? -65.012  33.526  4.605   1.00 204.32 ? 402 NAG C O4  1 
HETATM 7281 O O5  . NAG N 3 .   ? -62.520  31.781  6.606   1.00 164.95 ? 402 NAG C O5  1 
HETATM 7282 O O6  . NAG N 3 .   ? -62.470  33.755  3.552   1.00 160.67 ? 402 NAG C O6  1 
HETATM 7283 O O7  . NAG N 3 .   ? -65.028  32.913  11.130  1.00 134.46 ? 402 NAG C O7  1 
HETATM 7284 C C1  . NAG O 3 .   ? -46.951  24.445  40.302  1.00 163.56 ? 403 NAG C C1  1 
HETATM 7285 C C2  . NAG O 3 .   ? -46.772  25.781  39.591  1.00 151.30 ? 403 NAG C C2  1 
HETATM 7286 C C3  . NAG O 3 .   ? -46.053  26.902  40.303  1.00 160.73 ? 403 NAG C C3  1 
HETATM 7287 C C4  . NAG O 3 .   ? -46.614  27.007  41.702  1.00 164.74 ? 403 NAG C C4  1 
HETATM 7288 C C5  . NAG O 3 .   ? -46.450  25.636  42.385  1.00 171.13 ? 403 NAG C C5  1 
HETATM 7289 C C6  . NAG O 3 .   ? -46.997  25.693  43.802  1.00 153.54 ? 403 NAG C C6  1 
HETATM 7290 C C7  . NAG O 3 .   ? -46.947  25.856  37.260  1.00 145.13 ? 403 NAG C C7  1 
HETATM 7291 C C8  . NAG O 3 .   ? -46.217  26.172  36.005  1.00 151.34 ? 403 NAG C C8  1 
HETATM 7292 N N2  . NAG O 3 .   ? -46.186  25.544  38.294  1.00 137.63 ? 403 NAG C N2  1 
HETATM 7293 O O3  . NAG O 3 .   ? -46.456  28.031  39.580  1.00 178.59 ? 403 NAG C O3  1 
HETATM 7294 O O4  . NAG O 3 .   ? -45.987  27.953  42.554  1.00 132.24 ? 403 NAG C O4  1 
HETATM 7295 O O5  . NAG O 3 .   ? -46.959  24.460  41.725  1.00 177.43 ? 403 NAG C O5  1 
HETATM 7296 O O6  . NAG O 3 .   ? -48.347  26.094  43.657  1.00 141.42 ? 403 NAG C O6  1 
HETATM 7297 O O7  . NAG O 3 .   ? -48.167  25.886  37.337  1.00 133.25 ? 403 NAG C O7  1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'NAG E 1 HAS WRONG CHIRALITY AT ATOM C1'   
2 'NAG E 2 HAS WRONG CHIRALITY AT ATOM C1'   
3 'NAG C 402 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   26  ?   ?   ?   A . n 
A 1 2   SER 2   27  ?   ?   ?   A . n 
A 1 3   SER 3   28  ?   ?   ?   A . n 
A 1 4   LYS 4   29  ?   ?   ?   A . n 
A 1 5   LYS 5   30  ?   ?   ?   A . n 
A 1 6   VAL 6   31  ?   ?   ?   A . n 
A 1 7   GLY 7   32  ?   ?   ?   A . n 
A 1 8   THR 8   33  ?   ?   ?   A . n 
A 1 9   LEU 9   34  ?   ?   ?   A . n 
A 1 10  ASN 10  35  ?   ?   ?   A . n 
A 1 11  ARG 11  36  36  ARG ALA A . n 
A 1 12  PHE 12  37  37  PHE ALA A . n 
A 1 13  THR 13  38  38  THR THR A . n 
A 1 14  GLN 14  39  39  GLN ALA A . n 
A 1 15  ALA 15  40  40  ALA ALA A . n 
A 1 16  LEU 16  41  41  LEU LEU A . n 
A 1 17  VAL 17  42  42  VAL VAL A . n 
A 1 18  ILE 18  43  43  ILE ILE A . n 
A 1 19  ALA 19  44  44  ALA ALA A . n 
A 1 20  TYR 20  45  45  TYR TYR A . n 
A 1 21  VAL 21  46  46  VAL VAL A . n 
A 1 22  ILE 22  47  47  ILE ILE A . n 
A 1 23  GLY 23  48  48  GLY GLY A . n 
A 1 24  TYR 24  49  49  TYR TYR A . n 
A 1 25  VAL 25  50  50  VAL VAL A . n 
A 1 26  CYS 26  51  51  CYS CYS A . n 
A 1 27  VAL 27  52  52  VAL VAL A . n 
A 1 28  TYR 28  53  53  TYR TYR A . n 
A 1 29  ASN 29  54  54  ASN ALA A . n 
A 1 30  LYS 30  55  55  LYS ALA A . n 
A 1 31  GLY 31  56  56  GLY GLY A . n 
A 1 32  TYR 32  57  57  TYR TYR A . n 
A 1 33  GLN 33  58  58  GLN ALA A . n 
A 1 34  ASP 34  59  59  ASP ALA A . n 
A 1 35  THR 35  60  60  THR ALA A . n 
A 1 36  ASP 36  61  61  ASP ASP A . n 
A 1 37  THR 37  62  62  THR THR A . n 
A 1 38  VAL 38  63  63  VAL VAL A . n 
A 1 39  LEU 39  64  64  LEU ALA A . n 
A 1 40  SER 40  65  65  SER SER A . n 
A 1 41  SER 41  66  66  SER SER A . n 
A 1 42  VAL 42  67  67  VAL VAL A . n 
A 1 43  THR 43  68  68  THR THR A . n 
A 1 44  THR 44  69  69  THR THR A . n 
A 1 45  LYS 45  70  70  LYS ALA A . n 
A 1 46  VAL 46  71  71  VAL VAL A . n 
A 1 47  LYS 47  72  72  LYS ALA A . n 
A 1 48  GLY 48  73  73  GLY GLY A . n 
A 1 49  ILE 49  74  74  ILE ILE A . n 
A 1 50  ALA 50  75  75  ALA ALA A . n 
A 1 51  LEU 51  76  76  LEU ALA A . n 
A 1 52  THR 52  77  77  THR THR A . n 
A 1 53  ASN 53  78  78  ASN ASN A . n 
A 1 54  THR 54  79  79  THR THR A . n 
A 1 55  SER 55  80  80  SER SER A . n 
A 1 56  GLU 56  81  81  GLU GLU A . n 
A 1 57  LEU 57  82  82  LEU LEU A . n 
A 1 58  GLY 58  83  83  GLY GLY A . n 
A 1 59  GLU 59  84  84  GLU ALA A . n 
A 1 60  ARG 60  85  85  ARG ARG A . n 
A 1 61  ILE 61  86  86  ILE ILE A . n 
A 1 62  TRP 62  87  87  TRP TRP A . n 
A 1 63  ASP 63  88  88  ASP ASP A . n 
A 1 64  VAL 64  89  89  VAL VAL A . n 
A 1 65  ALA 65  90  90  ALA ALA A . n 
A 1 66  ASP 66  91  91  ASP ALA A . n 
A 1 67  TYR 67  92  92  TYR TYR A . n 
A 1 68  ILE 68  93  93  ILE ILE A . n 
A 1 69  ILE 69  94  94  ILE ILE A . n 
A 1 70  PRO 70  95  95  PRO PRO A . n 
A 1 71  PRO 71  96  96  PRO PRO A . n 
A 1 72  GLN 72  97  97  GLN GLN A . n 
A 1 73  GLU 73  98  98  GLU ALA A . n 
A 1 74  ASP 74  99  99  ASP ASP A . n 
A 1 75  GLY 75  100 100 GLY GLY A . n 
A 1 76  SER 76  101 101 SER SER A . n 
A 1 77  PHE 77  102 102 PHE PHE A . n 
A 1 78  PHE 78  103 103 PHE PHE A . n 
A 1 79  VAL 79  104 104 VAL VAL A . n 
A 1 80  LEU 80  105 105 LEU LEU A . n 
A 1 81  THR 81  106 106 THR THR A . n 
A 1 82  ASN 82  107 107 ASN ASN A . n 
A 1 83  MET 83  108 108 MET MET A . n 
A 1 84  ILE 84  109 109 ILE ILE A . n 
A 1 85  ILE 85  110 110 ILE ILE A . n 
A 1 86  THR 86  111 111 THR THR A . n 
A 1 87  THR 87  112 112 THR THR A . n 
A 1 88  ASN 88  113 113 ASN ASN A . n 
A 1 89  GLN 89  114 114 GLN GLN A . n 
A 1 90  THR 90  115 115 THR THR A . n 
A 1 91  GLN 91  116 116 GLN GLN A . n 
A 1 92  SER 92  117 117 SER SER A . n 
A 1 93  LYS 93  118 118 LYS ALA A . n 
A 1 94  CYS 94  119 119 CYS CYS A . n 
A 1 95  ALA 95  120 120 ALA ALA A . n 
A 1 96  GLU 96  121 121 GLU GLU A . n 
A 1 97  ASN 97  122 122 ASN ASN A . n 
A 1 98  PRO 98  123 123 PRO PRO A . n 
A 1 99  THR 99  124 124 THR THR A . n 
A 1 100 PRO 100 125 125 PRO PRO A . n 
A 1 101 ALA 101 126 126 ALA ALA A . n 
A 1 102 SER 102 127 127 SER SER A . n 
A 1 103 THR 103 128 128 THR THR A . n 
A 1 104 CYS 104 129 129 CYS CYS A . n 
A 1 105 THR 105 130 130 THR THR A . n 
A 1 106 SER 106 131 131 SER SER A . n 
A 1 107 HIS 107 132 132 HIS HIS A . n 
A 1 108 ARG 108 133 133 ARG ALA A . n 
A 1 109 ASP 109 134 134 ASP ASP A . n 
A 1 110 CYS 110 135 135 CYS CYS A . n 
A 1 111 LYS 111 136 136 LYS LYS A . n 
A 1 112 ARG 112 137 137 ARG ARG A . n 
A 1 113 GLY 113 138 138 GLY GLY A . n 
A 1 114 PHE 114 139 139 PHE ALA A . n 
A 1 115 ASN 115 140 140 ASN ALA A . n 
A 1 116 ASP 116 141 141 ASP ALA A . n 
A 1 117 ALA 117 142 142 ALA ALA A . n 
A 1 118 ARG 118 143 143 ARG ALA A . n 
A 1 119 GLY 119 144 144 GLY GLY A . n 
A 1 120 ASP 120 145 145 ASP ALA A . n 
A 1 121 GLY 121 146 146 GLY GLY A . n 
A 1 122 VAL 122 147 147 VAL VAL A . n 
A 1 123 ARG 123 148 148 ARG ARG A . n 
A 1 124 THR 124 149 149 THR THR A . n 
A 1 125 GLY 125 150 150 GLY GLY A . n 
A 1 126 ARG 126 151 151 ARG ALA A . n 
A 1 127 CYS 127 152 152 CYS CYS A . n 
A 1 128 VAL 128 153 153 VAL VAL A . n 
A 1 129 SER 129 154 154 SER SER A . n 
A 1 130 TYR 130 155 155 TYR TYR A . n 
A 1 131 SER 131 156 156 SER SER A . n 
A 1 132 ALA 132 157 157 ALA ALA A . n 
A 1 133 SER 133 158 158 SER SER A . n 
A 1 134 VAL 134 159 159 VAL VAL A . n 
A 1 135 LYS 135 160 160 LYS ALA A . n 
A 1 136 THR 136 161 161 THR THR A . n 
A 1 137 CYS 137 162 162 CYS CYS A . n 
A 1 138 GLU 138 163 163 GLU GLU A . n 
A 1 139 VAL 139 164 164 VAL VAL A . n 
A 1 140 LEU 140 165 165 LEU LEU A . n 
A 1 141 SER 141 166 166 SER SER A . n 
A 1 142 TRP 142 167 167 TRP TRP A . n 
A 1 143 CYS 143 168 168 CYS CYS A . n 
A 1 144 PRO 144 169 169 PRO PRO A . n 
A 1 145 LEU 145 170 170 LEU LEU A . n 
A 1 146 GLU 146 171 171 GLU GLU A . n 
A 1 147 LYS 147 172 172 LYS ALA A . n 
A 1 148 ILE 148 173 173 ILE ILE A . n 
A 1 149 VAL 149 174 174 VAL VAL A . n 
A 1 150 ASP 150 175 175 ASP ASP A . n 
A 1 151 PRO 151 176 176 PRO PRO A . n 
A 1 152 PRO 152 177 177 PRO PRO A . n 
A 1 153 ASN 153 178 178 ASN ASN A . n 
A 1 154 PRO 154 179 179 PRO PRO A . n 
A 1 155 PRO 155 180 180 PRO PRO A . n 
A 1 156 LEU 156 181 181 LEU LEU A . n 
A 1 157 LEU 157 182 182 LEU LEU A . n 
A 1 158 ALA 158 183 183 ALA ALA A . n 
A 1 159 ASP 159 184 184 ASP ASP A . n 
A 1 160 ALA 160 185 185 ALA ALA A . n 
A 1 161 GLU 161 186 186 GLU ALA A . n 
A 1 162 ASN 162 187 187 ASN ASN A . n 
A 1 163 PHE 163 188 188 PHE PHE A . n 
A 1 164 THR 164 189 189 THR THR A . n 
A 1 165 VAL 165 190 190 VAL VAL A . n 
A 1 166 LEU 166 191 191 LEU LEU A . n 
A 1 167 ILE 167 192 192 ILE ILE A . n 
A 1 168 LYS 168 193 193 LYS LYS A . n 
A 1 169 ASN 169 194 194 ASN ASN A . n 
A 1 170 ASN 170 195 195 ASN ASN A . n 
A 1 171 ILE 171 196 196 ILE ILE A . n 
A 1 172 ARG 172 197 197 ARG ALA A . n 
A 1 173 TYR 173 198 198 TYR TYR A . n 
A 1 174 PRO 174 199 199 PRO PRO A . n 
A 1 175 LYS 175 200 200 LYS ALA A . n 
A 1 176 PHE 176 201 201 PHE PHE A . n 
A 1 177 ASN 177 202 202 ASN ASN A . n 
A 1 178 PHE 178 203 203 PHE PHE A . n 
A 1 179 ASN 179 204 204 ASN ASN A . n 
A 1 180 LYS 180 205 205 LYS ALA A . n 
A 1 181 ARG 181 206 206 ARG ARG A . n 
A 1 182 ASN 182 207 207 ASN ASN A . n 
A 1 183 ILE 183 208 208 ILE ILE A . n 
A 1 184 LEU 184 209 209 LEU LEU A . n 
A 1 185 PRO 185 210 210 PRO PRO A . n 
A 1 186 ASN 186 211 211 ASN ALA A . n 
A 1 187 ILE 187 212 212 ILE ILE A . n 
A 1 188 ASN 188 213 213 ASN ASN A . n 
A 1 189 SER 189 214 214 SER SER A . n 
A 1 190 SER 190 215 215 SER SER A . n 
A 1 191 TYR 191 216 216 TYR TYR A . n 
A 1 192 LEU 192 217 217 LEU LEU A . n 
A 1 193 THR 193 218 218 THR THR A . n 
A 1 194 HIS 194 219 219 HIS HIS A . n 
A 1 195 CYS 195 220 220 CYS CYS A . n 
A 1 196 VAL 196 221 221 VAL VAL A . n 
A 1 197 PHE 197 222 222 PHE PHE A . n 
A 1 198 SER 198 223 223 SER SER A . n 
A 1 199 ARG 199 224 224 ARG ARG A . n 
A 1 200 LYS 200 225 225 LYS ALA A . n 
A 1 201 THR 201 226 226 THR THR A . n 
A 1 202 ASP 202 227 227 ASP ASP A . n 
A 1 203 PRO 203 228 228 PRO PRO A . n 
A 1 204 ASP 204 229 229 ASP ASP A . n 
A 1 205 CYS 205 230 230 CYS CYS A . n 
A 1 206 PRO 206 231 231 PRO PRO A . n 
A 1 207 ILE 207 232 232 ILE ILE A . n 
A 1 208 PHE 208 233 233 PHE PHE A . n 
A 1 209 ARG 209 234 234 ARG ALA A . n 
A 1 210 LEU 210 235 235 LEU LEU A . n 
A 1 211 GLY 211 236 236 GLY GLY A . n 
A 1 212 ASP 212 237 237 ASP ASP A . n 
A 1 213 ILE 213 238 238 ILE ILE A . n 
A 1 214 VAL 214 239 239 VAL VAL A . n 
A 1 215 GLY 215 240 240 GLY GLY A . n 
A 1 216 GLU 216 241 241 GLU GLU A . n 
A 1 217 ALA 217 242 242 ALA ALA A . n 
A 1 218 GLU 218 243 243 GLU GLU A . n 
A 1 219 GLU 219 244 244 GLU GLU A . n 
A 1 220 ASP 220 245 245 ASP ASP A . n 
A 1 221 PHE 221 246 246 PHE PHE A . n 
A 1 222 GLN 222 247 247 GLN GLN A . n 
A 1 223 ILE 223 248 248 ILE ILE A . n 
A 1 224 MET 224 249 249 MET MET A . n 
A 1 225 ALA 225 250 250 ALA ALA A . n 
A 1 226 VAL 226 251 251 VAL VAL A . n 
A 1 227 ARG 227 252 252 ARG ARG A . n 
A 1 228 GLY 228 253 253 GLY GLY A . n 
A 1 229 GLY 229 254 254 GLY GLY A . n 
A 1 230 VAL 230 255 255 VAL VAL A . n 
A 1 231 MET 231 256 256 MET MET A . n 
A 1 232 GLY 232 257 257 GLY GLY A . n 
A 1 233 VAL 233 258 258 VAL VAL A . n 
A 1 234 GLN 234 259 259 GLN GLN A . n 
A 1 235 ILE 235 260 260 ILE ILE A . n 
A 1 236 ARG 236 261 261 ARG ARG A . n 
A 1 237 TRP 237 262 262 TRP TRP A . n 
A 1 238 ASP 238 263 263 ASP ASP A . n 
A 1 239 CYS 239 264 264 CYS CYS A . n 
A 1 240 ASP 240 265 265 ASP ASP A . n 
A 1 241 LEU 241 266 266 LEU LEU A . n 
A 1 242 ASP 242 267 267 ASP ASP A . n 
A 1 243 MET 243 268 268 MET MET A . n 
A 1 244 PRO 244 269 269 PRO PRO A . n 
A 1 245 GLN 245 270 270 GLN ALA A . n 
A 1 246 SER 246 271 271 SER SER A . n 
A 1 247 TRP 247 272 272 TRP TRP A . n 
A 1 248 CYS 248 273 273 CYS CYS A . n 
A 1 249 VAL 249 274 274 VAL VAL A . n 
A 1 250 PRO 250 275 275 PRO PRO A . n 
A 1 251 ARG 251 276 276 ARG ALA A . n 
A 1 252 TYR 252 277 277 TYR TYR A . n 
A 1 253 THR 253 278 278 THR THR A . n 
A 1 254 PHE 254 279 279 PHE PHE A . n 
A 1 255 ARG 255 280 280 ARG ARG A . n 
A 1 256 ARG 256 281 281 ARG ARG A . n 
A 1 257 LEU 257 282 282 LEU LEU A . n 
A 1 258 ASP 258 283 283 ASP ASP A . n 
A 1 259 ASN 259 284 284 ASN ASN A . n 
A 1 260 LYS 260 285 285 LYS ALA A . n 
A 1 261 ASP 261 286 286 ASP ASP A . n 
A 1 262 PRO 262 287 287 PRO PRO A . n 
A 1 263 ASP 263 288 288 ASP ASP A . n 
A 1 264 ASN 264 289 289 ASN ASN A . n 
A 1 265 ASN 265 290 290 ASN ASN A . n 
A 1 266 VAL 266 291 291 VAL VAL A . n 
A 1 267 ALA 267 292 292 ALA ALA A . n 
A 1 268 PRO 268 293 293 PRO PRO A . n 
A 1 269 GLY 269 294 294 GLY GLY A . n 
A 1 270 TYR 270 295 295 TYR TYR A . n 
A 1 271 ASN 271 296 296 ASN ASN A . n 
A 1 272 PHE 272 297 297 PHE PHE A . n 
A 1 273 ARG 273 298 298 ARG ARG A . n 
A 1 274 PHE 274 299 299 PHE PHE A . n 
A 1 275 ALA 275 300 300 ALA ALA A . n 
A 1 276 LYS 276 301 301 LYS LYS A . n 
A 1 277 TYR 277 302 302 TYR TYR A . n 
A 1 278 TYR 278 303 303 TYR TYR A . n 
A 1 279 LYS 279 304 304 LYS ALA A . n 
A 1 280 ASN 280 305 305 ASN ASN A . n 
A 1 281 SER 281 306 306 SER SER A . n 
A 1 282 ASP 282 307 307 ASP ASP A . n 
A 1 283 GLY 283 308 308 GLY GLY A . n 
A 1 284 THR 284 309 309 THR THR A . n 
A 1 285 GLU 285 310 310 GLU GLU A . n 
A 1 286 THR 286 311 311 THR THR A . n 
A 1 287 ARG 287 312 312 ARG ARG A . n 
A 1 288 THR 288 313 313 THR THR A . n 
A 1 289 LEU 289 314 314 LEU LEU A . n 
A 1 290 ILE 290 315 315 ILE ILE A . n 
A 1 291 LYS 291 316 316 LYS LYS A . n 
A 1 292 GLY 292 317 317 GLY GLY A . n 
A 1 293 TYR 293 318 318 TYR TYR A . n 
A 1 294 GLY 294 319 319 GLY GLY A . n 
A 1 295 ILE 295 320 320 ILE ILE A . n 
A 1 296 ARG 296 321 321 ARG ARG A . n 
A 1 297 PHE 297 322 322 PHE PHE A . n 
A 1 298 ASP 298 323 323 ASP ASP A . n 
A 1 299 VAL 299 324 324 VAL VAL A . n 
A 1 300 MET 300 325 325 MET MET A . n 
A 1 301 VAL 301 326 326 VAL VAL A . n 
A 1 302 PHE 302 327 327 PHE PHE A . n 
A 1 303 GLY 303 328 328 GLY GLY A . n 
A 1 304 GLN 304 329 329 GLN ALA A . n 
A 1 305 ALA 305 330 330 ALA ALA A . n 
A 1 306 GLY 306 331 331 GLY GLY A . n 
A 1 307 LYS 307 332 332 LYS ALA A . n 
A 1 308 PHE 308 333 333 PHE PHE A . n 
A 1 309 ASN 309 334 334 ASN ASN A . n 
A 1 310 ILE 310 335 335 ILE ALA A . n 
A 1 311 ILE 311 336 336 ILE ALA A . n 
A 1 312 PRO 312 337 337 PRO PRO A . n 
A 1 313 THR 313 338 338 THR THR A . n 
A 1 314 LEU 314 339 339 LEU LEU A . n 
A 1 315 LEU 315 340 340 LEU LEU A . n 
A 1 316 ASN 316 341 341 ASN ASN A . n 
A 1 317 ILE 317 342 342 ILE ILE A . n 
A 1 318 GLY 318 343 343 GLY GLY A . n 
A 1 319 ALA 319 344 344 ALA ALA A . n 
A 1 320 GLY 320 345 345 GLY GLY A . n 
A 1 321 LEU 321 346 346 LEU LEU A . n 
A 1 322 ALA 322 347 347 ALA ALA A . n 
A 1 323 LEU 323 348 348 LEU ALA A . n 
A 1 324 LEU 324 349 349 LEU LEU A . n 
A 1 325 GLY 325 350 350 GLY GLY A . n 
A 1 326 LEU 326 351 351 LEU ALA A . n 
A 1 327 VAL 327 352 352 VAL ALA A . n 
A 1 328 ASN 328 353 353 ASN ALA A . n 
A 1 329 VAL 329 354 354 VAL ALA A . n 
A 1 330 ILE 330 355 355 ILE ALA A . n 
A 1 331 CYS 331 356 356 CYS CYS A . n 
A 1 332 ASP 332 357 357 ASP ALA A . n 
A 1 333 TRP 333 358 358 TRP ALA A . n 
A 1 334 ILE 334 359 359 ILE ALA A . n 
A 1 335 VAL 335 360 ?   ?   ?   A . n 
A 1 336 LEU 336 361 ?   ?   ?   A . n 
A 1 337 THR 337 362 ?   ?   ?   A . n 
A 1 338 PHE 338 363 ?   ?   ?   A . n 
A 1 339 MET 339 364 ?   ?   ?   A . n 
A 1 340 LYS 340 365 ?   ?   ?   A . n 
A 1 341 ARG 341 366 ?   ?   ?   A . n 
A 1 342 LYS 342 367 ?   ?   ?   A . n 
A 1 343 GLN 343 368 ?   ?   ?   A . n 
A 1 344 HIS 344 369 ?   ?   ?   A . n 
A 1 345 TYR 345 370 ?   ?   ?   A . n 
A 1 346 LYS 346 371 ?   ?   ?   A . n 
A 1 347 GLU 347 372 ?   ?   ?   A . n 
A 1 348 GLN 348 373 ?   ?   ?   A . n 
A 1 349 LYS 349 374 ?   ?   ?   A . n 
A 1 350 TYR 350 375 ?   ?   ?   A . n 
A 1 351 THR 351 376 ?   ?   ?   A . n 
A 1 352 TYR 352 377 ?   ?   ?   A . n 
A 1 353 VAL 353 378 ?   ?   ?   A . n 
A 1 354 ASP 354 379 ?   ?   ?   A . n 
A 1 355 ASP 355 380 ?   ?   ?   A . n 
A 1 356 PHE 356 381 ?   ?   ?   A . n 
B 1 1   GLY 1   26  ?   ?   ?   B . n 
B 1 2   SER 2   27  ?   ?   ?   B . n 
B 1 3   SER 3   28  ?   ?   ?   B . n 
B 1 4   LYS 4   29  ?   ?   ?   B . n 
B 1 5   LYS 5   30  ?   ?   ?   B . n 
B 1 6   VAL 6   31  ?   ?   ?   B . n 
B 1 7   GLY 7   32  ?   ?   ?   B . n 
B 1 8   THR 8   33  ?   ?   ?   B . n 
B 1 9   LEU 9   34  34  LEU ALA B . n 
B 1 10  ASN 10  35  35  ASN ALA B . n 
B 1 11  ARG 11  36  36  ARG ALA B . n 
B 1 12  PHE 12  37  37  PHE PHE B . n 
B 1 13  THR 13  38  38  THR THR B . n 
B 1 14  GLN 14  39  39  GLN ALA B . n 
B 1 15  ALA 15  40  40  ALA ALA B . n 
B 1 16  LEU 16  41  41  LEU LEU B . n 
B 1 17  VAL 17  42  42  VAL VAL B . n 
B 1 18  ILE 18  43  43  ILE ALA B . n 
B 1 19  ALA 19  44  44  ALA ALA B . n 
B 1 20  TYR 20  45  45  TYR TYR B . n 
B 1 21  VAL 21  46  46  VAL VAL B . n 
B 1 22  ILE 22  47  47  ILE ILE B . n 
B 1 23  GLY 23  48  48  GLY GLY B . n 
B 1 24  TYR 24  49  49  TYR TYR B . n 
B 1 25  VAL 25  50  50  VAL VAL B . n 
B 1 26  CYS 26  51  51  CYS CYS B . n 
B 1 27  VAL 27  52  52  VAL VAL B . n 
B 1 28  TYR 28  53  53  TYR TYR B . n 
B 1 29  ASN 29  54  54  ASN ALA B . n 
B 1 30  LYS 30  55  55  LYS ALA B . n 
B 1 31  GLY 31  56  56  GLY GLY B . n 
B 1 32  TYR 32  57  57  TYR TYR B . n 
B 1 33  GLN 33  58  58  GLN GLN B . n 
B 1 34  ASP 34  59  59  ASP ALA B . n 
B 1 35  THR 35  60  60  THR ALA B . n 
B 1 36  ASP 36  61  61  ASP ASP B . n 
B 1 37  THR 37  62  62  THR THR B . n 
B 1 38  VAL 38  63  63  VAL VAL B . n 
B 1 39  LEU 39  64  64  LEU ALA B . n 
B 1 40  SER 40  65  65  SER SER B . n 
B 1 41  SER 41  66  66  SER SER B . n 
B 1 42  VAL 42  67  67  VAL VAL B . n 
B 1 43  THR 43  68  68  THR THR B . n 
B 1 44  THR 44  69  69  THR THR B . n 
B 1 45  LYS 45  70  70  LYS ALA B . n 
B 1 46  VAL 46  71  71  VAL VAL B . n 
B 1 47  LYS 47  72  72  LYS ALA B . n 
B 1 48  GLY 48  73  73  GLY GLY B . n 
B 1 49  ILE 49  74  74  ILE ILE B . n 
B 1 50  ALA 50  75  75  ALA ALA B . n 
B 1 51  LEU 51  76  76  LEU LEU B . n 
B 1 52  THR 52  77  77  THR THR B . n 
B 1 53  ASN 53  78  78  ASN ASN B . n 
B 1 54  THR 54  79  79  THR THR B . n 
B 1 55  SER 55  80  80  SER SER B . n 
B 1 56  GLU 56  81  81  GLU ALA B . n 
B 1 57  LEU 57  82  82  LEU LEU B . n 
B 1 58  GLY 58  83  83  GLY GLY B . n 
B 1 59  GLU 59  84  84  GLU GLU B . n 
B 1 60  ARG 60  85  85  ARG ARG B . n 
B 1 61  ILE 61  86  86  ILE ILE B . n 
B 1 62  TRP 62  87  87  TRP TRP B . n 
B 1 63  ASP 63  88  88  ASP ASP B . n 
B 1 64  VAL 64  89  89  VAL VAL B . n 
B 1 65  ALA 65  90  90  ALA ALA B . n 
B 1 66  ASP 66  91  91  ASP ALA B . n 
B 1 67  TYR 67  92  92  TYR TYR B . n 
B 1 68  ILE 68  93  93  ILE ILE B . n 
B 1 69  ILE 69  94  94  ILE ILE B . n 
B 1 70  PRO 70  95  95  PRO PRO B . n 
B 1 71  PRO 71  96  96  PRO PRO B . n 
B 1 72  GLN 72  97  97  GLN GLN B . n 
B 1 73  GLU 73  98  98  GLU ALA B . n 
B 1 74  ASP 74  99  99  ASP ASP B . n 
B 1 75  GLY 75  100 100 GLY GLY B . n 
B 1 76  SER 76  101 101 SER SER B . n 
B 1 77  PHE 77  102 102 PHE PHE B . n 
B 1 78  PHE 78  103 103 PHE PHE B . n 
B 1 79  VAL 79  104 104 VAL VAL B . n 
B 1 80  LEU 80  105 105 LEU LEU B . n 
B 1 81  THR 81  106 106 THR THR B . n 
B 1 82  ASN 82  107 107 ASN ASN B . n 
B 1 83  MET 83  108 108 MET MET B . n 
B 1 84  ILE 84  109 109 ILE ILE B . n 
B 1 85  ILE 85  110 110 ILE ILE B . n 
B 1 86  THR 86  111 111 THR THR B . n 
B 1 87  THR 87  112 112 THR THR B . n 
B 1 88  ASN 88  113 113 ASN ASN B . n 
B 1 89  GLN 89  114 114 GLN GLN B . n 
B 1 90  THR 90  115 115 THR THR B . n 
B 1 91  GLN 91  116 116 GLN GLN B . n 
B 1 92  SER 92  117 117 SER SER B . n 
B 1 93  LYS 93  118 118 LYS LYS B . n 
B 1 94  CYS 94  119 119 CYS CYS B . n 
B 1 95  ALA 95  120 120 ALA ALA B . n 
B 1 96  GLU 96  121 121 GLU GLU B . n 
B 1 97  ASN 97  122 122 ASN ASN B . n 
B 1 98  PRO 98  123 123 PRO PRO B . n 
B 1 99  THR 99  124 124 THR THR B . n 
B 1 100 PRO 100 125 125 PRO PRO B . n 
B 1 101 ALA 101 126 126 ALA ALA B . n 
B 1 102 SER 102 127 127 SER SER B . n 
B 1 103 THR 103 128 128 THR THR B . n 
B 1 104 CYS 104 129 129 CYS CYS B . n 
B 1 105 THR 105 130 130 THR THR B . n 
B 1 106 SER 106 131 131 SER SER B . n 
B 1 107 HIS 107 132 132 HIS HIS B . n 
B 1 108 ARG 108 133 133 ARG ALA B . n 
B 1 109 ASP 109 134 134 ASP ASP B . n 
B 1 110 CYS 110 135 135 CYS CYS B . n 
B 1 111 LYS 111 136 136 LYS ALA B . n 
B 1 112 ARG 112 137 137 ARG ALA B . n 
B 1 113 GLY 113 138 138 GLY GLY B . n 
B 1 114 PHE 114 139 139 PHE ALA B . n 
B 1 115 ASN 115 140 140 ASN ALA B . n 
B 1 116 ASP 116 141 141 ASP ALA B . n 
B 1 117 ALA 117 142 142 ALA ALA B . n 
B 1 118 ARG 118 143 143 ARG ALA B . n 
B 1 119 GLY 119 144 144 GLY GLY B . n 
B 1 120 ASP 120 145 145 ASP ALA B . n 
B 1 121 GLY 121 146 146 GLY GLY B . n 
B 1 122 VAL 122 147 147 VAL VAL B . n 
B 1 123 ARG 123 148 148 ARG ALA B . n 
B 1 124 THR 124 149 149 THR THR B . n 
B 1 125 GLY 125 150 150 GLY GLY B . n 
B 1 126 ARG 126 151 151 ARG ARG B . n 
B 1 127 CYS 127 152 152 CYS CYS B . n 
B 1 128 VAL 128 153 153 VAL VAL B . n 
B 1 129 SER 129 154 154 SER SER B . n 
B 1 130 TYR 130 155 155 TYR TYR B . n 
B 1 131 SER 131 156 156 SER SER B . n 
B 1 132 ALA 132 157 157 ALA ALA B . n 
B 1 133 SER 133 158 158 SER SER B . n 
B 1 134 VAL 134 159 159 VAL VAL B . n 
B 1 135 LYS 135 160 160 LYS ALA B . n 
B 1 136 THR 136 161 161 THR THR B . n 
B 1 137 CYS 137 162 162 CYS CYS B . n 
B 1 138 GLU 138 163 163 GLU GLU B . n 
B 1 139 VAL 139 164 164 VAL VAL B . n 
B 1 140 LEU 140 165 165 LEU LEU B . n 
B 1 141 SER 141 166 166 SER SER B . n 
B 1 142 TRP 142 167 167 TRP TRP B . n 
B 1 143 CYS 143 168 168 CYS CYS B . n 
B 1 144 PRO 144 169 169 PRO PRO B . n 
B 1 145 LEU 145 170 170 LEU LEU B . n 
B 1 146 GLU 146 171 171 GLU GLU B . n 
B 1 147 LYS 147 172 172 LYS ALA B . n 
B 1 148 ILE 148 173 173 ILE ILE B . n 
B 1 149 VAL 149 174 174 VAL VAL B . n 
B 1 150 ASP 150 175 175 ASP ALA B . n 
B 1 151 PRO 151 176 176 PRO PRO B . n 
B 1 152 PRO 152 177 177 PRO PRO B . n 
B 1 153 ASN 153 178 178 ASN ASN B . n 
B 1 154 PRO 154 179 179 PRO PRO B . n 
B 1 155 PRO 155 180 180 PRO PRO B . n 
B 1 156 LEU 156 181 181 LEU LEU B . n 
B 1 157 LEU 157 182 182 LEU LEU B . n 
B 1 158 ALA 158 183 183 ALA ALA B . n 
B 1 159 ASP 159 184 184 ASP ASP B . n 
B 1 160 ALA 160 185 185 ALA ALA B . n 
B 1 161 GLU 161 186 186 GLU GLU B . n 
B 1 162 ASN 162 187 187 ASN ASN B . n 
B 1 163 PHE 163 188 188 PHE PHE B . n 
B 1 164 THR 164 189 189 THR THR B . n 
B 1 165 VAL 165 190 190 VAL VAL B . n 
B 1 166 LEU 166 191 191 LEU LEU B . n 
B 1 167 ILE 167 192 192 ILE ILE B . n 
B 1 168 LYS 168 193 193 LYS ALA B . n 
B 1 169 ASN 169 194 194 ASN ASN B . n 
B 1 170 ASN 170 195 195 ASN ASN B . n 
B 1 171 ILE 171 196 196 ILE ILE B . n 
B 1 172 ARG 172 197 197 ARG ARG B . n 
B 1 173 TYR 173 198 198 TYR TYR B . n 
B 1 174 PRO 174 199 199 PRO PRO B . n 
B 1 175 LYS 175 200 200 LYS ALA B . n 
B 1 176 PHE 176 201 201 PHE PHE B . n 
B 1 177 ASN 177 202 202 ASN ASN B . n 
B 1 178 PHE 178 203 203 PHE PHE B . n 
B 1 179 ASN 179 204 204 ASN ASN B . n 
B 1 180 LYS 180 205 205 LYS LYS B . n 
B 1 181 ARG 181 206 206 ARG ARG B . n 
B 1 182 ASN 182 207 207 ASN ASN B . n 
B 1 183 ILE 183 208 208 ILE ILE B . n 
B 1 184 LEU 184 209 209 LEU LEU B . n 
B 1 185 PRO 185 210 210 PRO PRO B . n 
B 1 186 ASN 186 211 211 ASN ALA B . n 
B 1 187 ILE 187 212 212 ILE ILE B . n 
B 1 188 ASN 188 213 213 ASN ASN B . n 
B 1 189 SER 189 214 214 SER SER B . n 
B 1 190 SER 190 215 215 SER SER B . n 
B 1 191 TYR 191 216 216 TYR TYR B . n 
B 1 192 LEU 192 217 217 LEU LEU B . n 
B 1 193 THR 193 218 218 THR THR B . n 
B 1 194 HIS 194 219 219 HIS HIS B . n 
B 1 195 CYS 195 220 220 CYS CYS B . n 
B 1 196 VAL 196 221 221 VAL VAL B . n 
B 1 197 PHE 197 222 222 PHE PHE B . n 
B 1 198 SER 198 223 223 SER SER B . n 
B 1 199 ARG 199 224 224 ARG ARG B . n 
B 1 200 LYS 200 225 225 LYS ALA B . n 
B 1 201 THR 201 226 226 THR THR B . n 
B 1 202 ASP 202 227 227 ASP ASP B . n 
B 1 203 PRO 203 228 228 PRO PRO B . n 
B 1 204 ASP 204 229 229 ASP ASP B . n 
B 1 205 CYS 205 230 230 CYS CYS B . n 
B 1 206 PRO 206 231 231 PRO PRO B . n 
B 1 207 ILE 207 232 232 ILE ILE B . n 
B 1 208 PHE 208 233 233 PHE PHE B . n 
B 1 209 ARG 209 234 234 ARG ARG B . n 
B 1 210 LEU 210 235 235 LEU LEU B . n 
B 1 211 GLY 211 236 236 GLY GLY B . n 
B 1 212 ASP 212 237 237 ASP ASP B . n 
B 1 213 ILE 213 238 238 ILE ILE B . n 
B 1 214 VAL 214 239 239 VAL VAL B . n 
B 1 215 GLY 215 240 240 GLY GLY B . n 
B 1 216 GLU 216 241 241 GLU GLU B . n 
B 1 217 ALA 217 242 242 ALA ALA B . n 
B 1 218 GLU 218 243 243 GLU GLU B . n 
B 1 219 GLU 219 244 244 GLU GLU B . n 
B 1 220 ASP 220 245 245 ASP ASP B . n 
B 1 221 PHE 221 246 246 PHE PHE B . n 
B 1 222 GLN 222 247 247 GLN GLN B . n 
B 1 223 ILE 223 248 248 ILE ILE B . n 
B 1 224 MET 224 249 249 MET MET B . n 
B 1 225 ALA 225 250 250 ALA ALA B . n 
B 1 226 VAL 226 251 251 VAL VAL B . n 
B 1 227 ARG 227 252 252 ARG ARG B . n 
B 1 228 GLY 228 253 253 GLY GLY B . n 
B 1 229 GLY 229 254 254 GLY GLY B . n 
B 1 230 VAL 230 255 255 VAL VAL B . n 
B 1 231 MET 231 256 256 MET MET B . n 
B 1 232 GLY 232 257 257 GLY GLY B . n 
B 1 233 VAL 233 258 258 VAL VAL B . n 
B 1 234 GLN 234 259 259 GLN GLN B . n 
B 1 235 ILE 235 260 260 ILE ILE B . n 
B 1 236 ARG 236 261 261 ARG ARG B . n 
B 1 237 TRP 237 262 262 TRP TRP B . n 
B 1 238 ASP 238 263 263 ASP ASP B . n 
B 1 239 CYS 239 264 264 CYS CYS B . n 
B 1 240 ASP 240 265 265 ASP ASP B . n 
B 1 241 LEU 241 266 266 LEU LEU B . n 
B 1 242 ASP 242 267 267 ASP ASP B . n 
B 1 243 MET 243 268 268 MET MET B . n 
B 1 244 PRO 244 269 269 PRO PRO B . n 
B 1 245 GLN 245 270 270 GLN ALA B . n 
B 1 246 SER 246 271 271 SER SER B . n 
B 1 247 TRP 247 272 272 TRP TRP B . n 
B 1 248 CYS 248 273 273 CYS CYS B . n 
B 1 249 VAL 249 274 274 VAL VAL B . n 
B 1 250 PRO 250 275 275 PRO PRO B . n 
B 1 251 ARG 251 276 276 ARG ARG B . n 
B 1 252 TYR 252 277 277 TYR TYR B . n 
B 1 253 THR 253 278 278 THR THR B . n 
B 1 254 PHE 254 279 279 PHE PHE B . n 
B 1 255 ARG 255 280 280 ARG ALA B . n 
B 1 256 ARG 256 281 281 ARG ARG B . n 
B 1 257 LEU 257 282 282 LEU LEU B . n 
B 1 258 ASP 258 283 283 ASP ASP B . n 
B 1 259 ASN 259 284 284 ASN ASN B . n 
B 1 260 LYS 260 285 285 LYS LYS B . n 
B 1 261 ASP 261 286 286 ASP ASP B . n 
B 1 262 PRO 262 287 287 PRO PRO B . n 
B 1 263 ASP 263 288 288 ASP ASP B . n 
B 1 264 ASN 264 289 289 ASN ASN B . n 
B 1 265 ASN 265 290 290 ASN ASN B . n 
B 1 266 VAL 266 291 291 VAL VAL B . n 
B 1 267 ALA 267 292 292 ALA ALA B . n 
B 1 268 PRO 268 293 293 PRO PRO B . n 
B 1 269 GLY 269 294 294 GLY GLY B . n 
B 1 270 TYR 270 295 295 TYR TYR B . n 
B 1 271 ASN 271 296 296 ASN ASN B . n 
B 1 272 PHE 272 297 297 PHE PHE B . n 
B 1 273 ARG 273 298 298 ARG ARG B . n 
B 1 274 PHE 274 299 299 PHE PHE B . n 
B 1 275 ALA 275 300 300 ALA ALA B . n 
B 1 276 LYS 276 301 301 LYS LYS B . n 
B 1 277 TYR 277 302 302 TYR TYR B . n 
B 1 278 TYR 278 303 303 TYR TYR B . n 
B 1 279 LYS 279 304 304 LYS ALA B . n 
B 1 280 ASN 280 305 305 ASN ASN B . n 
B 1 281 SER 281 306 306 SER SER B . n 
B 1 282 ASP 282 307 307 ASP ASP B . n 
B 1 283 GLY 283 308 308 GLY GLY B . n 
B 1 284 THR 284 309 309 THR THR B . n 
B 1 285 GLU 285 310 310 GLU GLU B . n 
B 1 286 THR 286 311 311 THR THR B . n 
B 1 287 ARG 287 312 312 ARG ARG B . n 
B 1 288 THR 288 313 313 THR THR B . n 
B 1 289 LEU 289 314 314 LEU LEU B . n 
B 1 290 ILE 290 315 315 ILE ILE B . n 
B 1 291 LYS 291 316 316 LYS ALA B . n 
B 1 292 GLY 292 317 317 GLY GLY B . n 
B 1 293 TYR 293 318 318 TYR TYR B . n 
B 1 294 GLY 294 319 319 GLY GLY B . n 
B 1 295 ILE 295 320 320 ILE ILE B . n 
B 1 296 ARG 296 321 321 ARG ARG B . n 
B 1 297 PHE 297 322 322 PHE PHE B . n 
B 1 298 ASP 298 323 323 ASP ASP B . n 
B 1 299 VAL 299 324 324 VAL VAL B . n 
B 1 300 MET 300 325 325 MET MET B . n 
B 1 301 VAL 301 326 326 VAL VAL B . n 
B 1 302 PHE 302 327 327 PHE PHE B . n 
B 1 303 GLY 303 328 328 GLY GLY B . n 
B 1 304 GLN 304 329 329 GLN ALA B . n 
B 1 305 ALA 305 330 330 ALA ALA B . n 
B 1 306 GLY 306 331 331 GLY GLY B . n 
B 1 307 LYS 307 332 332 LYS ALA B . n 
B 1 308 PHE 308 333 333 PHE PHE B . n 
B 1 309 ASN 309 334 334 ASN ASN B . n 
B 1 310 ILE 310 335 335 ILE ALA B . n 
B 1 311 ILE 311 336 336 ILE ALA B . n 
B 1 312 PRO 312 337 337 PRO PRO B . n 
B 1 313 THR 313 338 338 THR THR B . n 
B 1 314 LEU 314 339 339 LEU LEU B . n 
B 1 315 LEU 315 340 340 LEU LEU B . n 
B 1 316 ASN 316 341 341 ASN ASN B . n 
B 1 317 ILE 317 342 342 ILE ILE B . n 
B 1 318 GLY 318 343 343 GLY GLY B . n 
B 1 319 ALA 319 344 344 ALA ALA B . n 
B 1 320 GLY 320 345 345 GLY GLY B . n 
B 1 321 LEU 321 346 346 LEU ALA B . n 
B 1 322 ALA 322 347 347 ALA ALA B . n 
B 1 323 LEU 323 348 348 LEU ALA B . n 
B 1 324 LEU 324 349 349 LEU ALA B . n 
B 1 325 GLY 325 350 350 GLY GLY B . n 
B 1 326 LEU 326 351 351 LEU ALA B . n 
B 1 327 VAL 327 352 352 VAL ALA B . n 
B 1 328 ASN 328 353 353 ASN ASN B . n 
B 1 329 VAL 329 354 354 VAL ALA B . n 
B 1 330 ILE 330 355 355 ILE ALA B . n 
B 1 331 CYS 331 356 356 CYS CYS B . n 
B 1 332 ASP 332 357 357 ASP ALA B . n 
B 1 333 TRP 333 358 358 TRP ALA B . n 
B 1 334 ILE 334 359 359 ILE ALA B . n 
B 1 335 VAL 335 360 360 VAL ALA B . n 
B 1 336 LEU 336 361 361 LEU ALA B . n 
B 1 337 THR 337 362 ?   ?   ?   B . n 
B 1 338 PHE 338 363 ?   ?   ?   B . n 
B 1 339 MET 339 364 ?   ?   ?   B . n 
B 1 340 LYS 340 365 ?   ?   ?   B . n 
B 1 341 ARG 341 366 ?   ?   ?   B . n 
B 1 342 LYS 342 367 ?   ?   ?   B . n 
B 1 343 GLN 343 368 ?   ?   ?   B . n 
B 1 344 HIS 344 369 ?   ?   ?   B . n 
B 1 345 TYR 345 370 ?   ?   ?   B . n 
B 1 346 LYS 346 371 ?   ?   ?   B . n 
B 1 347 GLU 347 372 ?   ?   ?   B . n 
B 1 348 GLN 348 373 ?   ?   ?   B . n 
B 1 349 LYS 349 374 ?   ?   ?   B . n 
B 1 350 TYR 350 375 ?   ?   ?   B . n 
B 1 351 THR 351 376 ?   ?   ?   B . n 
B 1 352 TYR 352 377 ?   ?   ?   B . n 
B 1 353 VAL 353 378 ?   ?   ?   B . n 
B 1 354 ASP 354 379 ?   ?   ?   B . n 
B 1 355 ASP 355 380 ?   ?   ?   B . n 
B 1 356 PHE 356 381 ?   ?   ?   B . n 
C 1 1   GLY 1   26  ?   ?   ?   C . n 
C 1 2   SER 2   27  ?   ?   ?   C . n 
C 1 3   SER 3   28  ?   ?   ?   C . n 
C 1 4   LYS 4   29  ?   ?   ?   C . n 
C 1 5   LYS 5   30  ?   ?   ?   C . n 
C 1 6   VAL 6   31  ?   ?   ?   C . n 
C 1 7   GLY 7   32  ?   ?   ?   C . n 
C 1 8   THR 8   33  ?   ?   ?   C . n 
C 1 9   LEU 9   34  34  LEU ALA C . n 
C 1 10  ASN 10  35  35  ASN ALA C . n 
C 1 11  ARG 11  36  36  ARG ALA C . n 
C 1 12  PHE 12  37  37  PHE PHE C . n 
C 1 13  THR 13  38  38  THR THR C . n 
C 1 14  GLN 14  39  39  GLN ALA C . n 
C 1 15  ALA 15  40  40  ALA ALA C . n 
C 1 16  LEU 16  41  41  LEU LEU C . n 
C 1 17  VAL 17  42  42  VAL VAL C . n 
C 1 18  ILE 18  43  43  ILE ILE C . n 
C 1 19  ALA 19  44  44  ALA ALA C . n 
C 1 20  TYR 20  45  45  TYR TYR C . n 
C 1 21  VAL 21  46  46  VAL VAL C . n 
C 1 22  ILE 22  47  47  ILE ILE C . n 
C 1 23  GLY 23  48  48  GLY GLY C . n 
C 1 24  TYR 24  49  49  TYR TYR C . n 
C 1 25  VAL 25  50  50  VAL VAL C . n 
C 1 26  CYS 26  51  51  CYS CYS C . n 
C 1 27  VAL 27  52  52  VAL VAL C . n 
C 1 28  TYR 28  53  53  TYR TYR C . n 
C 1 29  ASN 29  54  54  ASN ALA C . n 
C 1 30  LYS 30  55  55  LYS ALA C . n 
C 1 31  GLY 31  56  56  GLY GLY C . n 
C 1 32  TYR 32  57  57  TYR TYR C . n 
C 1 33  GLN 33  58  58  GLN GLN C . n 
C 1 34  ASP 34  59  59  ASP ALA C . n 
C 1 35  THR 35  60  60  THR ALA C . n 
C 1 36  ASP 36  61  61  ASP ASP C . n 
C 1 37  THR 37  62  62  THR THR C . n 
C 1 38  VAL 38  63  63  VAL VAL C . n 
C 1 39  LEU 39  64  64  LEU LEU C . n 
C 1 40  SER 40  65  65  SER SER C . n 
C 1 41  SER 41  66  66  SER SER C . n 
C 1 42  VAL 42  67  67  VAL VAL C . n 
C 1 43  THR 43  68  68  THR THR C . n 
C 1 44  THR 44  69  69  THR THR C . n 
C 1 45  LYS 45  70  70  LYS ALA C . n 
C 1 46  VAL 46  71  71  VAL VAL C . n 
C 1 47  LYS 47  72  72  LYS ALA C . n 
C 1 48  GLY 48  73  73  GLY GLY C . n 
C 1 49  ILE 49  74  74  ILE ILE C . n 
C 1 50  ALA 50  75  75  ALA ALA C . n 
C 1 51  LEU 51  76  76  LEU LEU C . n 
C 1 52  THR 52  77  77  THR THR C . n 
C 1 53  ASN 53  78  78  ASN ASN C . n 
C 1 54  THR 54  79  79  THR THR C . n 
C 1 55  SER 55  80  80  SER SER C . n 
C 1 56  GLU 56  81  81  GLU ALA C . n 
C 1 57  LEU 57  82  82  LEU LEU C . n 
C 1 58  GLY 58  83  83  GLY GLY C . n 
C 1 59  GLU 59  84  84  GLU GLU C . n 
C 1 60  ARG 60  85  85  ARG ALA C . n 
C 1 61  ILE 61  86  86  ILE ILE C . n 
C 1 62  TRP 62  87  87  TRP TRP C . n 
C 1 63  ASP 63  88  88  ASP ASP C . n 
C 1 64  VAL 64  89  89  VAL VAL C . n 
C 1 65  ALA 65  90  90  ALA ALA C . n 
C 1 66  ASP 66  91  91  ASP ALA C . n 
C 1 67  TYR 67  92  92  TYR TYR C . n 
C 1 68  ILE 68  93  93  ILE ILE C . n 
C 1 69  ILE 69  94  94  ILE ILE C . n 
C 1 70  PRO 70  95  95  PRO PRO C . n 
C 1 71  PRO 71  96  96  PRO PRO C . n 
C 1 72  GLN 72  97  97  GLN GLN C . n 
C 1 73  GLU 73  98  98  GLU ALA C . n 
C 1 74  ASP 74  99  99  ASP ASP C . n 
C 1 75  GLY 75  100 100 GLY GLY C . n 
C 1 76  SER 76  101 101 SER SER C . n 
C 1 77  PHE 77  102 102 PHE PHE C . n 
C 1 78  PHE 78  103 103 PHE PHE C . n 
C 1 79  VAL 79  104 104 VAL VAL C . n 
C 1 80  LEU 80  105 105 LEU LEU C . n 
C 1 81  THR 81  106 106 THR THR C . n 
C 1 82  ASN 82  107 107 ASN ASN C . n 
C 1 83  MET 83  108 108 MET MET C . n 
C 1 84  ILE 84  109 109 ILE ILE C . n 
C 1 85  ILE 85  110 110 ILE ILE C . n 
C 1 86  THR 86  111 111 THR THR C . n 
C 1 87  THR 87  112 112 THR THR C . n 
C 1 88  ASN 88  113 113 ASN ASN C . n 
C 1 89  GLN 89  114 114 GLN GLN C . n 
C 1 90  THR 90  115 115 THR THR C . n 
C 1 91  GLN 91  116 116 GLN GLN C . n 
C 1 92  SER 92  117 117 SER SER C . n 
C 1 93  LYS 93  118 118 LYS ALA C . n 
C 1 94  CYS 94  119 119 CYS CYS C . n 
C 1 95  ALA 95  120 120 ALA ALA C . n 
C 1 96  GLU 96  121 121 GLU GLU C . n 
C 1 97  ASN 97  122 122 ASN ASN C . n 
C 1 98  PRO 98  123 123 PRO PRO C . n 
C 1 99  THR 99  124 124 THR THR C . n 
C 1 100 PRO 100 125 125 PRO PRO C . n 
C 1 101 ALA 101 126 126 ALA ALA C . n 
C 1 102 SER 102 127 127 SER SER C . n 
C 1 103 THR 103 128 128 THR THR C . n 
C 1 104 CYS 104 129 129 CYS CYS C . n 
C 1 105 THR 105 130 130 THR THR C . n 
C 1 106 SER 106 131 131 SER SER C . n 
C 1 107 HIS 107 132 132 HIS HIS C . n 
C 1 108 ARG 108 133 133 ARG ALA C . n 
C 1 109 ASP 109 134 134 ASP ASP C . n 
C 1 110 CYS 110 135 135 CYS CYS C . n 
C 1 111 LYS 111 136 136 LYS ALA C . n 
C 1 112 ARG 112 137 137 ARG ALA C . n 
C 1 113 GLY 113 138 138 GLY GLY C . n 
C 1 114 PHE 114 139 139 PHE ALA C . n 
C 1 115 ASN 115 140 140 ASN ALA C . n 
C 1 116 ASP 116 141 141 ASP ALA C . n 
C 1 117 ALA 117 142 142 ALA ALA C . n 
C 1 118 ARG 118 143 143 ARG ALA C . n 
C 1 119 GLY 119 144 144 GLY GLY C . n 
C 1 120 ASP 120 145 145 ASP ALA C . n 
C 1 121 GLY 121 146 146 GLY GLY C . n 
C 1 122 VAL 122 147 147 VAL ALA C . n 
C 1 123 ARG 123 148 148 ARG ALA C . n 
C 1 124 THR 124 149 149 THR THR C . n 
C 1 125 GLY 125 150 150 GLY GLY C . n 
C 1 126 ARG 126 151 151 ARG ALA C . n 
C 1 127 CYS 127 152 152 CYS CYS C . n 
C 1 128 VAL 128 153 153 VAL VAL C . n 
C 1 129 SER 129 154 154 SER SER C . n 
C 1 130 TYR 130 155 155 TYR TYR C . n 
C 1 131 SER 131 156 156 SER SER C . n 
C 1 132 ALA 132 157 157 ALA ALA C . n 
C 1 133 SER 133 158 158 SER SER C . n 
C 1 134 VAL 134 159 159 VAL VAL C . n 
C 1 135 LYS 135 160 160 LYS ALA C . n 
C 1 136 THR 136 161 161 THR THR C . n 
C 1 137 CYS 137 162 162 CYS CYS C . n 
C 1 138 GLU 138 163 163 GLU GLU C . n 
C 1 139 VAL 139 164 164 VAL VAL C . n 
C 1 140 LEU 140 165 165 LEU LEU C . n 
C 1 141 SER 141 166 166 SER SER C . n 
C 1 142 TRP 142 167 167 TRP TRP C . n 
C 1 143 CYS 143 168 168 CYS CYS C . n 
C 1 144 PRO 144 169 169 PRO PRO C . n 
C 1 145 LEU 145 170 170 LEU LEU C . n 
C 1 146 GLU 146 171 171 GLU GLU C . n 
C 1 147 LYS 147 172 172 LYS LYS C . n 
C 1 148 ILE 148 173 173 ILE ILE C . n 
C 1 149 VAL 149 174 174 VAL VAL C . n 
C 1 150 ASP 150 175 175 ASP ASP C . n 
C 1 151 PRO 151 176 176 PRO PRO C . n 
C 1 152 PRO 152 177 177 PRO PRO C . n 
C 1 153 ASN 153 178 178 ASN ASN C . n 
C 1 154 PRO 154 179 179 PRO PRO C . n 
C 1 155 PRO 155 180 180 PRO PRO C . n 
C 1 156 LEU 156 181 181 LEU LEU C . n 
C 1 157 LEU 157 182 182 LEU LEU C . n 
C 1 158 ALA 158 183 183 ALA ALA C . n 
C 1 159 ASP 159 184 184 ASP ASP C . n 
C 1 160 ALA 160 185 185 ALA ALA C . n 
C 1 161 GLU 161 186 186 GLU GLU C . n 
C 1 162 ASN 162 187 187 ASN ASN C . n 
C 1 163 PHE 163 188 188 PHE PHE C . n 
C 1 164 THR 164 189 189 THR THR C . n 
C 1 165 VAL 165 190 190 VAL VAL C . n 
C 1 166 LEU 166 191 191 LEU LEU C . n 
C 1 167 ILE 167 192 192 ILE ILE C . n 
C 1 168 LYS 168 193 193 LYS LYS C . n 
C 1 169 ASN 169 194 194 ASN ASN C . n 
C 1 170 ASN 170 195 195 ASN ASN C . n 
C 1 171 ILE 171 196 196 ILE ILE C . n 
C 1 172 ARG 172 197 197 ARG ARG C . n 
C 1 173 TYR 173 198 198 TYR TYR C . n 
C 1 174 PRO 174 199 199 PRO PRO C . n 
C 1 175 LYS 175 200 200 LYS ALA C . n 
C 1 176 PHE 176 201 201 PHE PHE C . n 
C 1 177 ASN 177 202 202 ASN ASN C . n 
C 1 178 PHE 178 203 203 PHE PHE C . n 
C 1 179 ASN 179 204 204 ASN ASN C . n 
C 1 180 LYS 180 205 205 LYS LYS C . n 
C 1 181 ARG 181 206 206 ARG ARG C . n 
C 1 182 ASN 182 207 207 ASN ASN C . n 
C 1 183 ILE 183 208 208 ILE ILE C . n 
C 1 184 LEU 184 209 209 LEU LEU C . n 
C 1 185 PRO 185 210 210 PRO PRO C . n 
C 1 186 ASN 186 211 211 ASN ALA C . n 
C 1 187 ILE 187 212 212 ILE ILE C . n 
C 1 188 ASN 188 213 213 ASN ASN C . n 
C 1 189 SER 189 214 214 SER SER C . n 
C 1 190 SER 190 215 215 SER SER C . n 
C 1 191 TYR 191 216 216 TYR TYR C . n 
C 1 192 LEU 192 217 217 LEU LEU C . n 
C 1 193 THR 193 218 218 THR THR C . n 
C 1 194 HIS 194 219 219 HIS HIS C . n 
C 1 195 CYS 195 220 220 CYS CYS C . n 
C 1 196 VAL 196 221 221 VAL VAL C . n 
C 1 197 PHE 197 222 222 PHE PHE C . n 
C 1 198 SER 198 223 223 SER SER C . n 
C 1 199 ARG 199 224 224 ARG ARG C . n 
C 1 200 LYS 200 225 225 LYS ALA C . n 
C 1 201 THR 201 226 226 THR THR C . n 
C 1 202 ASP 202 227 227 ASP ASP C . n 
C 1 203 PRO 203 228 228 PRO PRO C . n 
C 1 204 ASP 204 229 229 ASP ASP C . n 
C 1 205 CYS 205 230 230 CYS CYS C . n 
C 1 206 PRO 206 231 231 PRO PRO C . n 
C 1 207 ILE 207 232 232 ILE ILE C . n 
C 1 208 PHE 208 233 233 PHE PHE C . n 
C 1 209 ARG 209 234 234 ARG ALA C . n 
C 1 210 LEU 210 235 235 LEU LEU C . n 
C 1 211 GLY 211 236 236 GLY GLY C . n 
C 1 212 ASP 212 237 237 ASP ASP C . n 
C 1 213 ILE 213 238 238 ILE ILE C . n 
C 1 214 VAL 214 239 239 VAL VAL C . n 
C 1 215 GLY 215 240 240 GLY GLY C . n 
C 1 216 GLU 216 241 241 GLU GLU C . n 
C 1 217 ALA 217 242 242 ALA ALA C . n 
C 1 218 GLU 218 243 243 GLU GLU C . n 
C 1 219 GLU 219 244 244 GLU GLU C . n 
C 1 220 ASP 220 245 245 ASP ASP C . n 
C 1 221 PHE 221 246 246 PHE PHE C . n 
C 1 222 GLN 222 247 247 GLN GLN C . n 
C 1 223 ILE 223 248 248 ILE ILE C . n 
C 1 224 MET 224 249 249 MET MET C . n 
C 1 225 ALA 225 250 250 ALA ALA C . n 
C 1 226 VAL 226 251 251 VAL VAL C . n 
C 1 227 ARG 227 252 252 ARG ALA C . n 
C 1 228 GLY 228 253 253 GLY GLY C . n 
C 1 229 GLY 229 254 254 GLY GLY C . n 
C 1 230 VAL 230 255 255 VAL VAL C . n 
C 1 231 MET 231 256 256 MET MET C . n 
C 1 232 GLY 232 257 257 GLY GLY C . n 
C 1 233 VAL 233 258 258 VAL VAL C . n 
C 1 234 GLN 234 259 259 GLN GLN C . n 
C 1 235 ILE 235 260 260 ILE ILE C . n 
C 1 236 ARG 236 261 261 ARG ARG C . n 
C 1 237 TRP 237 262 262 TRP TRP C . n 
C 1 238 ASP 238 263 263 ASP ASP C . n 
C 1 239 CYS 239 264 264 CYS CYS C . n 
C 1 240 ASP 240 265 265 ASP ASP C . n 
C 1 241 LEU 241 266 266 LEU ALA C . n 
C 1 242 ASP 242 267 267 ASP ASP C . n 
C 1 243 MET 243 268 268 MET MET C . n 
C 1 244 PRO 244 269 269 PRO PRO C . n 
C 1 245 GLN 245 270 270 GLN ALA C . n 
C 1 246 SER 246 271 271 SER SER C . n 
C 1 247 TRP 247 272 272 TRP TRP C . n 
C 1 248 CYS 248 273 273 CYS CYS C . n 
C 1 249 VAL 249 274 274 VAL VAL C . n 
C 1 250 PRO 250 275 275 PRO PRO C . n 
C 1 251 ARG 251 276 276 ARG ALA C . n 
C 1 252 TYR 252 277 277 TYR TYR C . n 
C 1 253 THR 253 278 278 THR THR C . n 
C 1 254 PHE 254 279 279 PHE PHE C . n 
C 1 255 ARG 255 280 280 ARG ARG C . n 
C 1 256 ARG 256 281 281 ARG ARG C . n 
C 1 257 LEU 257 282 282 LEU LEU C . n 
C 1 258 ASP 258 283 283 ASP ASP C . n 
C 1 259 ASN 259 284 284 ASN ASN C . n 
C 1 260 LYS 260 285 285 LYS ALA C . n 
C 1 261 ASP 261 286 286 ASP ASP C . n 
C 1 262 PRO 262 287 287 PRO PRO C . n 
C 1 263 ASP 263 288 288 ASP ASP C . n 
C 1 264 ASN 264 289 289 ASN ASN C . n 
C 1 265 ASN 265 290 290 ASN ASN C . n 
C 1 266 VAL 266 291 291 VAL VAL C . n 
C 1 267 ALA 267 292 292 ALA ALA C . n 
C 1 268 PRO 268 293 293 PRO PRO C . n 
C 1 269 GLY 269 294 294 GLY GLY C . n 
C 1 270 TYR 270 295 295 TYR TYR C . n 
C 1 271 ASN 271 296 296 ASN ASN C . n 
C 1 272 PHE 272 297 297 PHE PHE C . n 
C 1 273 ARG 273 298 298 ARG ALA C . n 
C 1 274 PHE 274 299 299 PHE PHE C . n 
C 1 275 ALA 275 300 300 ALA ALA C . n 
C 1 276 LYS 276 301 301 LYS LYS C . n 
C 1 277 TYR 277 302 302 TYR TYR C . n 
C 1 278 TYR 278 303 303 TYR TYR C . n 
C 1 279 LYS 279 304 304 LYS ALA C . n 
C 1 280 ASN 280 305 305 ASN ASN C . n 
C 1 281 SER 281 306 306 SER SER C . n 
C 1 282 ASP 282 307 307 ASP ASP C . n 
C 1 283 GLY 283 308 308 GLY GLY C . n 
C 1 284 THR 284 309 309 THR THR C . n 
C 1 285 GLU 285 310 310 GLU GLU C . n 
C 1 286 THR 286 311 311 THR THR C . n 
C 1 287 ARG 287 312 312 ARG ARG C . n 
C 1 288 THR 288 313 313 THR THR C . n 
C 1 289 LEU 289 314 314 LEU LEU C . n 
C 1 290 ILE 290 315 315 ILE ILE C . n 
C 1 291 LYS 291 316 316 LYS LYS C . n 
C 1 292 GLY 292 317 317 GLY GLY C . n 
C 1 293 TYR 293 318 318 TYR TYR C . n 
C 1 294 GLY 294 319 319 GLY GLY C . n 
C 1 295 ILE 295 320 320 ILE ILE C . n 
C 1 296 ARG 296 321 321 ARG ARG C . n 
C 1 297 PHE 297 322 322 PHE PHE C . n 
C 1 298 ASP 298 323 323 ASP ASP C . n 
C 1 299 VAL 299 324 324 VAL VAL C . n 
C 1 300 MET 300 325 325 MET MET C . n 
C 1 301 VAL 301 326 326 VAL VAL C . n 
C 1 302 PHE 302 327 327 PHE PHE C . n 
C 1 303 GLY 303 328 328 GLY GLY C . n 
C 1 304 GLN 304 329 329 GLN ALA C . n 
C 1 305 ALA 305 330 330 ALA ALA C . n 
C 1 306 GLY 306 331 331 GLY GLY C . n 
C 1 307 LYS 307 332 332 LYS ALA C . n 
C 1 308 PHE 308 333 333 PHE PHE C . n 
C 1 309 ASN 309 334 334 ASN ASN C . n 
C 1 310 ILE 310 335 335 ILE ALA C . n 
C 1 311 ILE 311 336 336 ILE ALA C . n 
C 1 312 PRO 312 337 337 PRO PRO C . n 
C 1 313 THR 313 338 338 THR THR C . n 
C 1 314 LEU 314 339 339 LEU LEU C . n 
C 1 315 LEU 315 340 340 LEU ALA C . n 
C 1 316 ASN 316 341 341 ASN ASN C . n 
C 1 317 ILE 317 342 342 ILE ILE C . n 
C 1 318 GLY 318 343 343 GLY GLY C . n 
C 1 319 ALA 319 344 344 ALA ALA C . n 
C 1 320 GLY 320 345 345 GLY GLY C . n 
C 1 321 LEU 321 346 346 LEU LEU C . n 
C 1 322 ALA 322 347 347 ALA ALA C . n 
C 1 323 LEU 323 348 348 LEU ALA C . n 
C 1 324 LEU 324 349 349 LEU LEU C . n 
C 1 325 GLY 325 350 350 GLY GLY C . n 
C 1 326 LEU 326 351 351 LEU LEU C . n 
C 1 327 VAL 327 352 352 VAL ALA C . n 
C 1 328 ASN 328 353 353 ASN ALA C . n 
C 1 329 VAL 329 354 354 VAL ALA C . n 
C 1 330 ILE 330 355 355 ILE ALA C . n 
C 1 331 CYS 331 356 356 CYS ALA C . n 
C 1 332 ASP 332 357 357 ASP ALA C . n 
C 1 333 TRP 333 358 358 TRP ALA C . n 
C 1 334 ILE 334 359 ?   ?   ?   C . n 
C 1 335 VAL 335 360 ?   ?   ?   C . n 
C 1 336 LEU 336 361 ?   ?   ?   C . n 
C 1 337 THR 337 362 ?   ?   ?   C . n 
C 1 338 PHE 338 363 ?   ?   ?   C . n 
C 1 339 MET 339 364 ?   ?   ?   C . n 
C 1 340 LYS 340 365 ?   ?   ?   C . n 
C 1 341 ARG 341 366 ?   ?   ?   C . n 
C 1 342 LYS 342 367 ?   ?   ?   C . n 
C 1 343 GLN 343 368 ?   ?   ?   C . n 
C 1 344 HIS 344 369 ?   ?   ?   C . n 
C 1 345 TYR 345 370 ?   ?   ?   C . n 
C 1 346 LYS 346 371 ?   ?   ?   C . n 
C 1 347 GLU 347 372 ?   ?   ?   C . n 
C 1 348 GLN 348 373 ?   ?   ?   C . n 
C 1 349 LYS 349 374 ?   ?   ?   C . n 
C 1 350 TYR 350 375 ?   ?   ?   C . n 
C 1 351 THR 351 376 ?   ?   ?   C . n 
C 1 352 TYR 352 377 ?   ?   ?   C . n 
C 1 353 VAL 353 378 ?   ?   ?   C . n 
C 1 354 ASP 354 379 ?   ?   ?   C . n 
C 1 355 ASP 355 380 ?   ?   ?   C . n 
C 1 356 PHE 356 381 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 3 NAG 1 401 401 NAG NAG A . 
G 3 NAG 1 402 402 NAG NAG A . 
H 3 NAG 1 403 403 NAG NAG A . 
I 3 NAG 1 401 401 NAG NAG B . 
J 3 NAG 1 402 402 NAG NAG B . 
K 3 NAG 1 403 403 NAG NAG B . 
L 3 NAG 1 404 404 NAG NAG B . 
M 3 NAG 1 401 401 NAG NAG C . 
N 3 NAG 1 402 402 NAG NAG C . 
O 3 NAG 1 403 403 NAG NAG C . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A ASN 53  A ASN 78  ? ASN 'GLYCOSYLATION SITE' 
2  A ASN 88  A ASN 113 ? ASN 'GLYCOSYLATION SITE' 
3  A ASN 162 A ASN 187 ? ASN 'GLYCOSYLATION SITE' 
4  A ASN 188 A ASN 213 ? ASN 'GLYCOSYLATION SITE' 
5  B ASN 53  B ASN 78  ? ASN 'GLYCOSYLATION SITE' 
6  B ASN 88  B ASN 113 ? ASN 'GLYCOSYLATION SITE' 
7  B ASN 162 B ASN 187 ? ASN 'GLYCOSYLATION SITE' 
8  B ASN 188 B ASN 213 ? ASN 'GLYCOSYLATION SITE' 
9  C ASN 53  C ASN 78  ? ASN 'GLYCOSYLATION SITE' 
10 C ASN 88  C ASN 113 ? ASN 'GLYCOSYLATION SITE' 
11 C ASN 162 C ASN 187 ? ASN 'GLYCOSYLATION SITE' 
12 C ASN 188 C ASN 213 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 13380 ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  45610 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-08-04 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
4 'Structure model' 2 0 2020-07-29 
5 'Structure model' 2 1 2021-10-13 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Non-polymer description'   
2  2 'Structure model' 'Version format compliance' 
3  3 'Structure model' 'Refinement description'    
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Atomic model'              
6  4 'Structure model' 'Data collection'           
7  4 'Structure model' 'Database references'       
8  4 'Structure model' 'Derived calculations'      
9  4 'Structure model' 'Structure summary'         
10 5 'Structure model' 'Database references'       
11 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' software                      
2  4 'Structure model' atom_site                     
3  4 'Structure model' chem_comp                     
4  4 'Structure model' database_PDB_caveat           
5  4 'Structure model' entity                        
6  4 'Structure model' pdbx_branch_scheme            
7  4 'Structure model' pdbx_chem_comp_identifier     
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' pdbx_struct_assembly_gen      
15 4 'Structure model' pdbx_validate_chiral          
16 4 'Structure model' pdbx_validate_close_contact   
17 4 'Structure model' struct_asym                   
18 4 'Structure model' struct_conn                   
19 4 'Structure model' struct_ref_seq_dif            
20 4 'Structure model' struct_site                   
21 4 'Structure model' struct_site_gen               
22 5 'Structure model' chem_comp                     
23 5 'Structure model' database_2                    
24 5 'Structure model' struct_ref_seq_dif            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_seq_id'                      
7  4 'Structure model' '_atom_site.label_asym_id'                    
8  4 'Structure model' '_atom_site.label_entity_id'                  
9  4 'Structure model' '_chem_comp.name'                             
10 4 'Structure model' '_chem_comp.type'                             
11 4 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
12 4 'Structure model' '_pdbx_entity_nonpoly.name'                   
13 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
14 4 'Structure model' '_pdbx_validate_chiral.auth_asym_id'          
15 4 'Structure model' '_pdbx_validate_chiral.auth_seq_id'           
16 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 
17 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
18 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'  
19 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
20 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
21 4 'Structure model' '_struct_conn.pdbx_role'                      
22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
25 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
28 4 'Structure model' '_struct_ref_seq_dif.details'                 
29 5 'Structure model' '_chem_comp.pdbx_synonyms'                    
30 5 'Structure model' '_database_2.pdbx_DOI'                        
31 5 'Structure model' '_database_2.pdbx_database_accession'         
32 5 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data reduction'  http://www.hkl-xray.com/ 
?   ? 
2 SCALEPACK   .     ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com      'data scaling'    http://www.hkl-xray.com/ 
?   ? 
3 PHENIX      .     ?               package 'Paul D. Adams'      PDAdams@lbl.gov       refinement        
http://www.phenix-online.org/             C++ ? 
4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 
5 HKL-2000    .     ?               ?       ?                    ?                     'data scaling'    ? ?   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 ND2 A ASN 213 ? ? O5 D NAG 1   ? ? 1.55 
2  1 ND2 C ASN 113 ? ? O5 C NAG 402 ? ? 1.89 
3  1 ND2 B ASN 78  ? ? O5 B NAG 401 ? ? 1.90 
4  1 O4  D NAG 1   ? ? O5 D NAG 2   ? ? 1.94 
5  1 ND2 C ASN 187 ? ? O5 C NAG 403 ? ? 1.97 
6  1 ND2 B ASN 113 ? ? C2 B NAG 402 ? ? 2.04 
7  1 ND2 B ASN 187 ? ? O5 B NAG 403 ? ? 2.06 
8  1 ND2 B ASN 213 ? ? C2 B NAG 404 ? ? 2.10 
9  1 ND2 C ASN 78  ? ? O5 C NAG 401 ? ? 2.16 
10 1 CG  B ASN 213 ? ? C1 B NAG 404 ? ? 2.17 
11 1 ND2 A ASN 113 ? ? C2 A NAG 402 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 49  ? ? -93.78  -63.57  
2  1 VAL A 52  ? ? -135.58 -47.97  
3  1 GLU A 84  ? ? -37.95  135.56  
4  1 VAL A 89  ? ? -32.60  -31.22  
5  1 ALA A 90  ? ? -54.78  -72.48  
6  1 PRO A 96  ? ? -101.30 -149.65 
7  1 ASP A 99  ? ? -69.00  -90.96  
8  1 CYS A 119 ? ? 174.75  172.58  
9  1 SER A 131 ? ? -172.06 -177.16 
10 1 SER A 166 ? ? 172.30  -173.24 
11 1 LEU A 182 ? ? -86.18  48.52   
12 1 ASN A 202 ? ? 34.66   51.38   
13 1 ASN A 211 ? ? -82.76  47.14   
14 1 HIS A 219 ? ? -151.27 1.62    
15 1 LYS A 225 ? ? -67.99  -82.69  
16 1 ALA A 250 ? ? -53.98  -2.20   
17 1 ASN A 290 ? ? -176.44 -178.46 
18 1 TYR B 49  ? ? -94.30  -63.15  
19 1 VAL B 52  ? ? -135.80 -48.24  
20 1 VAL B 89  ? ? -31.71  -31.94  
21 1 ALA B 90  ? ? -54.91  -71.46  
22 1 PRO B 96  ? ? -101.02 -150.23 
23 1 ASP B 99  ? ? -67.98  -91.24  
24 1 SER B 131 ? ? -171.06 -176.79 
25 1 SER B 166 ? ? 173.56  -173.14 
26 1 LEU B 182 ? ? -83.96  48.41   
27 1 ASN B 202 ? ? 35.10   52.22   
28 1 ASN B 211 ? ? -83.21  46.55   
29 1 HIS B 219 ? ? -151.01 1.64    
30 1 LYS B 225 ? ? -68.26  -82.05  
31 1 ALA B 250 ? ? -55.03  -2.14   
32 1 ASN B 290 ? ? -176.30 -178.50 
33 1 TYR C 49  ? ? -94.12  -62.81  
34 1 VAL C 52  ? ? -136.58 -47.85  
35 1 VAL C 89  ? ? -31.46  -32.34  
36 1 ALA C 90  ? ? -54.20  -72.18  
37 1 PRO C 96  ? ? -100.82 -149.16 
38 1 ASP C 99  ? ? -67.92  -91.22  
39 1 SER C 131 ? ? -171.26 -176.75 
40 1 SER C 166 ? ? 173.69  -173.36 
41 1 LEU C 182 ? ? -85.03  48.05   
42 1 ASN C 202 ? ? 36.25   51.80   
43 1 ASN C 211 ? ? -83.15  46.75   
44 1 HIS C 219 ? ? -151.87 1.29    
45 1 LYS C 225 ? ? -67.49  -82.02  
46 1 ALA C 250 ? ? -54.93  -2.25   
47 1 ASN C 290 ? ? -176.33 -178.52 
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? E NAG 1   ? PLANAR . 
2 1 C1 ? E NAG 2   ? PLANAR . 
3 1 C1 ? C NAG 402 ? PLANAR . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 36  ? CG  ? A ARG 11  CG  
2   1 Y 1 A ARG 36  ? CD  ? A ARG 11  CD  
3   1 Y 1 A ARG 36  ? NE  ? A ARG 11  NE  
4   1 Y 1 A ARG 36  ? CZ  ? A ARG 11  CZ  
5   1 Y 1 A ARG 36  ? NH1 ? A ARG 11  NH1 
6   1 Y 1 A ARG 36  ? NH2 ? A ARG 11  NH2 
7   1 Y 1 A PHE 37  ? CG  ? A PHE 12  CG  
8   1 Y 1 A PHE 37  ? CD1 ? A PHE 12  CD1 
9   1 Y 1 A PHE 37  ? CD2 ? A PHE 12  CD2 
10  1 Y 1 A PHE 37  ? CE1 ? A PHE 12  CE1 
11  1 Y 1 A PHE 37  ? CE2 ? A PHE 12  CE2 
12  1 Y 1 A PHE 37  ? CZ  ? A PHE 12  CZ  
13  1 Y 1 A GLN 39  ? CG  ? A GLN 14  CG  
14  1 Y 1 A GLN 39  ? CD  ? A GLN 14  CD  
15  1 Y 1 A GLN 39  ? OE1 ? A GLN 14  OE1 
16  1 Y 1 A GLN 39  ? NE2 ? A GLN 14  NE2 
17  1 Y 1 A ASN 54  ? CG  ? A ASN 29  CG  
18  1 Y 1 A ASN 54  ? OD1 ? A ASN 29  OD1 
19  1 Y 1 A ASN 54  ? ND2 ? A ASN 29  ND2 
20  1 Y 1 A LYS 55  ? CG  ? A LYS 30  CG  
21  1 Y 1 A LYS 55  ? CD  ? A LYS 30  CD  
22  1 Y 1 A LYS 55  ? CE  ? A LYS 30  CE  
23  1 Y 1 A LYS 55  ? NZ  ? A LYS 30  NZ  
24  1 Y 1 A GLN 58  ? CG  ? A GLN 33  CG  
25  1 Y 1 A GLN 58  ? CD  ? A GLN 33  CD  
26  1 Y 1 A GLN 58  ? OE1 ? A GLN 33  OE1 
27  1 Y 1 A GLN 58  ? NE2 ? A GLN 33  NE2 
28  1 Y 1 A ASP 59  ? CG  ? A ASP 34  CG  
29  1 Y 1 A ASP 59  ? OD1 ? A ASP 34  OD1 
30  1 Y 1 A ASP 59  ? OD2 ? A ASP 34  OD2 
31  1 Y 1 A THR 60  ? OG1 ? A THR 35  OG1 
32  1 Y 1 A THR 60  ? CG2 ? A THR 35  CG2 
33  1 Y 1 A LEU 64  ? CG  ? A LEU 39  CG  
34  1 Y 1 A LEU 64  ? CD1 ? A LEU 39  CD1 
35  1 Y 1 A LEU 64  ? CD2 ? A LEU 39  CD2 
36  1 Y 1 A LYS 70  ? CG  ? A LYS 45  CG  
37  1 Y 1 A LYS 70  ? CD  ? A LYS 45  CD  
38  1 Y 1 A LYS 70  ? CE  ? A LYS 45  CE  
39  1 Y 1 A LYS 70  ? NZ  ? A LYS 45  NZ  
40  1 Y 1 A LYS 72  ? CG  ? A LYS 47  CG  
41  1 Y 1 A LYS 72  ? CD  ? A LYS 47  CD  
42  1 Y 1 A LYS 72  ? CE  ? A LYS 47  CE  
43  1 Y 1 A LYS 72  ? NZ  ? A LYS 47  NZ  
44  1 Y 1 A LEU 76  ? CG  ? A LEU 51  CG  
45  1 Y 1 A LEU 76  ? CD1 ? A LEU 51  CD1 
46  1 Y 1 A LEU 76  ? CD2 ? A LEU 51  CD2 
47  1 Y 1 A GLU 84  ? CG  ? A GLU 59  CG  
48  1 Y 1 A GLU 84  ? CD  ? A GLU 59  CD  
49  1 Y 1 A GLU 84  ? OE1 ? A GLU 59  OE1 
50  1 Y 1 A GLU 84  ? OE2 ? A GLU 59  OE2 
51  1 Y 1 A ASP 91  ? CG  ? A ASP 66  CG  
52  1 Y 1 A ASP 91  ? OD1 ? A ASP 66  OD1 
53  1 Y 1 A ASP 91  ? OD2 ? A ASP 66  OD2 
54  1 Y 1 A GLU 98  ? CG  ? A GLU 73  CG  
55  1 Y 1 A GLU 98  ? CD  ? A GLU 73  CD  
56  1 Y 1 A GLU 98  ? OE1 ? A GLU 73  OE1 
57  1 Y 1 A GLU 98  ? OE2 ? A GLU 73  OE2 
58  1 Y 1 A LYS 118 ? CG  ? A LYS 93  CG  
59  1 Y 1 A LYS 118 ? CD  ? A LYS 93  CD  
60  1 Y 1 A LYS 118 ? CE  ? A LYS 93  CE  
61  1 Y 1 A LYS 118 ? NZ  ? A LYS 93  NZ  
62  1 Y 1 A ARG 133 ? CG  ? A ARG 108 CG  
63  1 Y 1 A ARG 133 ? CD  ? A ARG 108 CD  
64  1 Y 1 A ARG 133 ? NE  ? A ARG 108 NE  
65  1 Y 1 A ARG 133 ? CZ  ? A ARG 108 CZ  
66  1 Y 1 A ARG 133 ? NH1 ? A ARG 108 NH1 
67  1 Y 1 A ARG 133 ? NH2 ? A ARG 108 NH2 
68  1 Y 1 A PHE 139 ? CG  ? A PHE 114 CG  
69  1 Y 1 A PHE 139 ? CD1 ? A PHE 114 CD1 
70  1 Y 1 A PHE 139 ? CD2 ? A PHE 114 CD2 
71  1 Y 1 A PHE 139 ? CE1 ? A PHE 114 CE1 
72  1 Y 1 A PHE 139 ? CE2 ? A PHE 114 CE2 
73  1 Y 1 A PHE 139 ? CZ  ? A PHE 114 CZ  
74  1 Y 1 A ASN 140 ? CG  ? A ASN 115 CG  
75  1 Y 1 A ASN 140 ? OD1 ? A ASN 115 OD1 
76  1 Y 1 A ASN 140 ? ND2 ? A ASN 115 ND2 
77  1 Y 1 A ASP 141 ? CG  ? A ASP 116 CG  
78  1 Y 1 A ASP 141 ? OD1 ? A ASP 116 OD1 
79  1 Y 1 A ASP 141 ? OD2 ? A ASP 116 OD2 
80  1 Y 1 A ARG 143 ? CG  ? A ARG 118 CG  
81  1 Y 1 A ARG 143 ? CD  ? A ARG 118 CD  
82  1 Y 1 A ARG 143 ? NE  ? A ARG 118 NE  
83  1 Y 1 A ARG 143 ? CZ  ? A ARG 118 CZ  
84  1 Y 1 A ARG 143 ? NH1 ? A ARG 118 NH1 
85  1 Y 1 A ARG 143 ? NH2 ? A ARG 118 NH2 
86  1 Y 1 A ASP 145 ? CG  ? A ASP 120 CG  
87  1 Y 1 A ASP 145 ? OD1 ? A ASP 120 OD1 
88  1 Y 1 A ASP 145 ? OD2 ? A ASP 120 OD2 
89  1 Y 1 A ARG 151 ? CG  ? A ARG 126 CG  
90  1 Y 1 A ARG 151 ? CD  ? A ARG 126 CD  
91  1 Y 1 A ARG 151 ? NE  ? A ARG 126 NE  
92  1 Y 1 A ARG 151 ? CZ  ? A ARG 126 CZ  
93  1 Y 1 A ARG 151 ? NH1 ? A ARG 126 NH1 
94  1 Y 1 A ARG 151 ? NH2 ? A ARG 126 NH2 
95  1 Y 1 A LYS 160 ? CG  ? A LYS 135 CG  
96  1 Y 1 A LYS 160 ? CD  ? A LYS 135 CD  
97  1 Y 1 A LYS 160 ? CE  ? A LYS 135 CE  
98  1 Y 1 A LYS 160 ? NZ  ? A LYS 135 NZ  
99  1 Y 1 A LYS 172 ? CG  ? A LYS 147 CG  
100 1 Y 1 A LYS 172 ? CD  ? A LYS 147 CD  
101 1 Y 1 A LYS 172 ? CE  ? A LYS 147 CE  
102 1 Y 1 A LYS 172 ? NZ  ? A LYS 147 NZ  
103 1 Y 1 A GLU 186 ? CG  ? A GLU 161 CG  
104 1 Y 1 A GLU 186 ? CD  ? A GLU 161 CD  
105 1 Y 1 A GLU 186 ? OE1 ? A GLU 161 OE1 
106 1 Y 1 A GLU 186 ? OE2 ? A GLU 161 OE2 
107 1 Y 1 A ARG 197 ? CG  ? A ARG 172 CG  
108 1 Y 1 A ARG 197 ? CD  ? A ARG 172 CD  
109 1 Y 1 A ARG 197 ? NE  ? A ARG 172 NE  
110 1 Y 1 A ARG 197 ? CZ  ? A ARG 172 CZ  
111 1 Y 1 A ARG 197 ? NH1 ? A ARG 172 NH1 
112 1 Y 1 A ARG 197 ? NH2 ? A ARG 172 NH2 
113 1 Y 1 A LYS 200 ? CG  ? A LYS 175 CG  
114 1 Y 1 A LYS 200 ? CD  ? A LYS 175 CD  
115 1 Y 1 A LYS 200 ? CE  ? A LYS 175 CE  
116 1 Y 1 A LYS 200 ? NZ  ? A LYS 175 NZ  
117 1 Y 1 A LYS 205 ? CG  ? A LYS 180 CG  
118 1 Y 1 A LYS 205 ? CD  ? A LYS 180 CD  
119 1 Y 1 A LYS 205 ? CE  ? A LYS 180 CE  
120 1 Y 1 A LYS 205 ? NZ  ? A LYS 180 NZ  
121 1 Y 1 A ASN 211 ? CG  ? A ASN 186 CG  
122 1 Y 1 A ASN 211 ? OD1 ? A ASN 186 OD1 
123 1 Y 1 A ASN 211 ? ND2 ? A ASN 186 ND2 
124 1 Y 1 A LYS 225 ? CG  ? A LYS 200 CG  
125 1 Y 1 A LYS 225 ? CD  ? A LYS 200 CD  
126 1 Y 1 A LYS 225 ? CE  ? A LYS 200 CE  
127 1 Y 1 A LYS 225 ? NZ  ? A LYS 200 NZ  
128 1 Y 1 A ARG 234 ? CG  ? A ARG 209 CG  
129 1 Y 1 A ARG 234 ? CD  ? A ARG 209 CD  
130 1 Y 1 A ARG 234 ? NE  ? A ARG 209 NE  
131 1 Y 1 A ARG 234 ? CZ  ? A ARG 209 CZ  
132 1 Y 1 A ARG 234 ? NH1 ? A ARG 209 NH1 
133 1 Y 1 A ARG 234 ? NH2 ? A ARG 209 NH2 
134 1 Y 1 A GLN 270 ? CG  ? A GLN 245 CG  
135 1 Y 1 A GLN 270 ? CD  ? A GLN 245 CD  
136 1 Y 1 A GLN 270 ? OE1 ? A GLN 245 OE1 
137 1 Y 1 A GLN 270 ? NE2 ? A GLN 245 NE2 
138 1 Y 1 A ARG 276 ? CG  ? A ARG 251 CG  
139 1 Y 1 A ARG 276 ? CD  ? A ARG 251 CD  
140 1 Y 1 A ARG 276 ? NE  ? A ARG 251 NE  
141 1 Y 1 A ARG 276 ? CZ  ? A ARG 251 CZ  
142 1 Y 1 A ARG 276 ? NH1 ? A ARG 251 NH1 
143 1 Y 1 A ARG 276 ? NH2 ? A ARG 251 NH2 
144 1 Y 1 A LYS 285 ? CG  ? A LYS 260 CG  
145 1 Y 1 A LYS 285 ? CD  ? A LYS 260 CD  
146 1 Y 1 A LYS 285 ? CE  ? A LYS 260 CE  
147 1 Y 1 A LYS 285 ? NZ  ? A LYS 260 NZ  
148 1 Y 1 A LYS 304 ? CG  ? A LYS 279 CG  
149 1 Y 1 A LYS 304 ? CD  ? A LYS 279 CD  
150 1 Y 1 A LYS 304 ? CE  ? A LYS 279 CE  
151 1 Y 1 A LYS 304 ? NZ  ? A LYS 279 NZ  
152 1 Y 1 A GLN 329 ? CG  ? A GLN 304 CG  
153 1 Y 1 A GLN 329 ? CD  ? A GLN 304 CD  
154 1 Y 1 A GLN 329 ? OE1 ? A GLN 304 OE1 
155 1 Y 1 A GLN 329 ? NE2 ? A GLN 304 NE2 
156 1 Y 1 A LYS 332 ? CG  ? A LYS 307 CG  
157 1 Y 1 A LYS 332 ? CD  ? A LYS 307 CD  
158 1 Y 1 A LYS 332 ? CE  ? A LYS 307 CE  
159 1 Y 1 A LYS 332 ? NZ  ? A LYS 307 NZ  
160 1 Y 1 A ILE 335 ? CG1 ? A ILE 310 CG1 
161 1 Y 1 A ILE 335 ? CG2 ? A ILE 310 CG2 
162 1 Y 1 A ILE 335 ? CD1 ? A ILE 310 CD1 
163 1 Y 1 A ILE 336 ? CG1 ? A ILE 311 CG1 
164 1 Y 1 A ILE 336 ? CG2 ? A ILE 311 CG2 
165 1 Y 1 A ILE 336 ? CD1 ? A ILE 311 CD1 
166 1 Y 1 A LEU 348 ? CG  ? A LEU 323 CG  
167 1 Y 1 A LEU 348 ? CD1 ? A LEU 323 CD1 
168 1 Y 1 A LEU 348 ? CD2 ? A LEU 323 CD2 
169 1 Y 1 A LEU 351 ? CG  ? A LEU 326 CG  
170 1 Y 1 A LEU 351 ? CD1 ? A LEU 326 CD1 
171 1 Y 1 A LEU 351 ? CD2 ? A LEU 326 CD2 
172 1 Y 1 A VAL 352 ? CG1 ? A VAL 327 CG1 
173 1 Y 1 A VAL 352 ? CG2 ? A VAL 327 CG2 
174 1 Y 1 A ASN 353 ? CG  ? A ASN 328 CG  
175 1 Y 1 A ASN 353 ? OD1 ? A ASN 328 OD1 
176 1 Y 1 A ASN 353 ? ND2 ? A ASN 328 ND2 
177 1 Y 1 A VAL 354 ? CG1 ? A VAL 329 CG1 
178 1 Y 1 A VAL 354 ? CG2 ? A VAL 329 CG2 
179 1 Y 1 A ILE 355 ? CG1 ? A ILE 330 CG1 
180 1 Y 1 A ILE 355 ? CG2 ? A ILE 330 CG2 
181 1 Y 1 A ILE 355 ? CD1 ? A ILE 330 CD1 
182 1 Y 1 A ASP 357 ? CG  ? A ASP 332 CG  
183 1 Y 1 A ASP 357 ? OD1 ? A ASP 332 OD1 
184 1 Y 1 A ASP 357 ? OD2 ? A ASP 332 OD2 
185 1 Y 1 A TRP 358 ? CG  ? A TRP 333 CG  
186 1 Y 1 A TRP 358 ? CD1 ? A TRP 333 CD1 
187 1 Y 1 A TRP 358 ? CD2 ? A TRP 333 CD2 
188 1 Y 1 A TRP 358 ? NE1 ? A TRP 333 NE1 
189 1 Y 1 A TRP 358 ? CE2 ? A TRP 333 CE2 
190 1 Y 1 A TRP 358 ? CE3 ? A TRP 333 CE3 
191 1 Y 1 A TRP 358 ? CZ2 ? A TRP 333 CZ2 
192 1 Y 1 A TRP 358 ? CZ3 ? A TRP 333 CZ3 
193 1 Y 1 A TRP 358 ? CH2 ? A TRP 333 CH2 
194 1 Y 1 A ILE 359 ? CG1 ? A ILE 334 CG1 
195 1 Y 1 A ILE 359 ? CG2 ? A ILE 334 CG2 
196 1 Y 1 A ILE 359 ? CD1 ? A ILE 334 CD1 
197 1 Y 1 B LEU 34  ? CG  ? B LEU 9   CG  
198 1 Y 1 B LEU 34  ? CD1 ? B LEU 9   CD1 
199 1 Y 1 B LEU 34  ? CD2 ? B LEU 9   CD2 
200 1 Y 1 B ASN 35  ? CG  ? B ASN 10  CG  
201 1 Y 1 B ASN 35  ? OD1 ? B ASN 10  OD1 
202 1 Y 1 B ASN 35  ? ND2 ? B ASN 10  ND2 
203 1 Y 1 B ARG 36  ? CG  ? B ARG 11  CG  
204 1 Y 1 B ARG 36  ? CD  ? B ARG 11  CD  
205 1 Y 1 B ARG 36  ? NE  ? B ARG 11  NE  
206 1 Y 1 B ARG 36  ? CZ  ? B ARG 11  CZ  
207 1 Y 1 B ARG 36  ? NH1 ? B ARG 11  NH1 
208 1 Y 1 B ARG 36  ? NH2 ? B ARG 11  NH2 
209 1 Y 1 B GLN 39  ? CG  ? B GLN 14  CG  
210 1 Y 1 B GLN 39  ? CD  ? B GLN 14  CD  
211 1 Y 1 B GLN 39  ? OE1 ? B GLN 14  OE1 
212 1 Y 1 B GLN 39  ? NE2 ? B GLN 14  NE2 
213 1 Y 1 B ILE 43  ? CG1 ? B ILE 18  CG1 
214 1 Y 1 B ILE 43  ? CG2 ? B ILE 18  CG2 
215 1 Y 1 B ILE 43  ? CD1 ? B ILE 18  CD1 
216 1 Y 1 B ASN 54  ? CG  ? B ASN 29  CG  
217 1 Y 1 B ASN 54  ? OD1 ? B ASN 29  OD1 
218 1 Y 1 B ASN 54  ? ND2 ? B ASN 29  ND2 
219 1 Y 1 B LYS 55  ? CG  ? B LYS 30  CG  
220 1 Y 1 B LYS 55  ? CD  ? B LYS 30  CD  
221 1 Y 1 B LYS 55  ? CE  ? B LYS 30  CE  
222 1 Y 1 B LYS 55  ? NZ  ? B LYS 30  NZ  
223 1 Y 1 B ASP 59  ? CG  ? B ASP 34  CG  
224 1 Y 1 B ASP 59  ? OD1 ? B ASP 34  OD1 
225 1 Y 1 B ASP 59  ? OD2 ? B ASP 34  OD2 
226 1 Y 1 B THR 60  ? OG1 ? B THR 35  OG1 
227 1 Y 1 B THR 60  ? CG2 ? B THR 35  CG2 
228 1 Y 1 B LEU 64  ? CG  ? B LEU 39  CG  
229 1 Y 1 B LEU 64  ? CD1 ? B LEU 39  CD1 
230 1 Y 1 B LEU 64  ? CD2 ? B LEU 39  CD2 
231 1 Y 1 B LYS 70  ? CG  ? B LYS 45  CG  
232 1 Y 1 B LYS 70  ? CD  ? B LYS 45  CD  
233 1 Y 1 B LYS 70  ? CE  ? B LYS 45  CE  
234 1 Y 1 B LYS 70  ? NZ  ? B LYS 45  NZ  
235 1 Y 1 B LYS 72  ? CG  ? B LYS 47  CG  
236 1 Y 1 B LYS 72  ? CD  ? B LYS 47  CD  
237 1 Y 1 B LYS 72  ? CE  ? B LYS 47  CE  
238 1 Y 1 B LYS 72  ? NZ  ? B LYS 47  NZ  
239 1 Y 1 B GLU 81  ? CG  ? B GLU 56  CG  
240 1 Y 1 B GLU 81  ? CD  ? B GLU 56  CD  
241 1 Y 1 B GLU 81  ? OE1 ? B GLU 56  OE1 
242 1 Y 1 B GLU 81  ? OE2 ? B GLU 56  OE2 
243 1 Y 1 B ASP 91  ? CG  ? B ASP 66  CG  
244 1 Y 1 B ASP 91  ? OD1 ? B ASP 66  OD1 
245 1 Y 1 B ASP 91  ? OD2 ? B ASP 66  OD2 
246 1 Y 1 B GLU 98  ? CG  ? B GLU 73  CG  
247 1 Y 1 B GLU 98  ? CD  ? B GLU 73  CD  
248 1 Y 1 B GLU 98  ? OE1 ? B GLU 73  OE1 
249 1 Y 1 B GLU 98  ? OE2 ? B GLU 73  OE2 
250 1 Y 1 B ARG 133 ? CG  ? B ARG 108 CG  
251 1 Y 1 B ARG 133 ? CD  ? B ARG 108 CD  
252 1 Y 1 B ARG 133 ? NE  ? B ARG 108 NE  
253 1 Y 1 B ARG 133 ? CZ  ? B ARG 108 CZ  
254 1 Y 1 B ARG 133 ? NH1 ? B ARG 108 NH1 
255 1 Y 1 B ARG 133 ? NH2 ? B ARG 108 NH2 
256 1 Y 1 B LYS 136 ? CG  ? B LYS 111 CG  
257 1 Y 1 B LYS 136 ? CD  ? B LYS 111 CD  
258 1 Y 1 B LYS 136 ? CE  ? B LYS 111 CE  
259 1 Y 1 B LYS 136 ? NZ  ? B LYS 111 NZ  
260 1 Y 1 B ARG 137 ? CG  ? B ARG 112 CG  
261 1 Y 1 B ARG 137 ? CD  ? B ARG 112 CD  
262 1 Y 1 B ARG 137 ? NE  ? B ARG 112 NE  
263 1 Y 1 B ARG 137 ? CZ  ? B ARG 112 CZ  
264 1 Y 1 B ARG 137 ? NH1 ? B ARG 112 NH1 
265 1 Y 1 B ARG 137 ? NH2 ? B ARG 112 NH2 
266 1 Y 1 B PHE 139 ? CG  ? B PHE 114 CG  
267 1 Y 1 B PHE 139 ? CD1 ? B PHE 114 CD1 
268 1 Y 1 B PHE 139 ? CD2 ? B PHE 114 CD2 
269 1 Y 1 B PHE 139 ? CE1 ? B PHE 114 CE1 
270 1 Y 1 B PHE 139 ? CE2 ? B PHE 114 CE2 
271 1 Y 1 B PHE 139 ? CZ  ? B PHE 114 CZ  
272 1 Y 1 B ASN 140 ? CG  ? B ASN 115 CG  
273 1 Y 1 B ASN 140 ? OD1 ? B ASN 115 OD1 
274 1 Y 1 B ASN 140 ? ND2 ? B ASN 115 ND2 
275 1 Y 1 B ASP 141 ? CG  ? B ASP 116 CG  
276 1 Y 1 B ASP 141 ? OD1 ? B ASP 116 OD1 
277 1 Y 1 B ASP 141 ? OD2 ? B ASP 116 OD2 
278 1 Y 1 B ARG 143 ? CG  ? B ARG 118 CG  
279 1 Y 1 B ARG 143 ? CD  ? B ARG 118 CD  
280 1 Y 1 B ARG 143 ? NE  ? B ARG 118 NE  
281 1 Y 1 B ARG 143 ? CZ  ? B ARG 118 CZ  
282 1 Y 1 B ARG 143 ? NH1 ? B ARG 118 NH1 
283 1 Y 1 B ARG 143 ? NH2 ? B ARG 118 NH2 
284 1 Y 1 B ASP 145 ? CG  ? B ASP 120 CG  
285 1 Y 1 B ASP 145 ? OD1 ? B ASP 120 OD1 
286 1 Y 1 B ASP 145 ? OD2 ? B ASP 120 OD2 
287 1 Y 1 B ARG 148 ? CG  ? B ARG 123 CG  
288 1 Y 1 B ARG 148 ? CD  ? B ARG 123 CD  
289 1 Y 1 B ARG 148 ? NE  ? B ARG 123 NE  
290 1 Y 1 B ARG 148 ? CZ  ? B ARG 123 CZ  
291 1 Y 1 B ARG 148 ? NH1 ? B ARG 123 NH1 
292 1 Y 1 B ARG 148 ? NH2 ? B ARG 123 NH2 
293 1 Y 1 B LYS 160 ? CG  ? B LYS 135 CG  
294 1 Y 1 B LYS 160 ? CD  ? B LYS 135 CD  
295 1 Y 1 B LYS 160 ? CE  ? B LYS 135 CE  
296 1 Y 1 B LYS 160 ? NZ  ? B LYS 135 NZ  
297 1 Y 1 B LYS 172 ? CG  ? B LYS 147 CG  
298 1 Y 1 B LYS 172 ? CD  ? B LYS 147 CD  
299 1 Y 1 B LYS 172 ? CE  ? B LYS 147 CE  
300 1 Y 1 B LYS 172 ? NZ  ? B LYS 147 NZ  
301 1 Y 1 B ASP 175 ? CG  ? B ASP 150 CG  
302 1 Y 1 B ASP 175 ? OD1 ? B ASP 150 OD1 
303 1 Y 1 B ASP 175 ? OD2 ? B ASP 150 OD2 
304 1 Y 1 B LYS 193 ? CG  ? B LYS 168 CG  
305 1 Y 1 B LYS 193 ? CD  ? B LYS 168 CD  
306 1 Y 1 B LYS 193 ? CE  ? B LYS 168 CE  
307 1 Y 1 B LYS 193 ? NZ  ? B LYS 168 NZ  
308 1 Y 1 B LYS 200 ? CG  ? B LYS 175 CG  
309 1 Y 1 B LYS 200 ? CD  ? B LYS 175 CD  
310 1 Y 1 B LYS 200 ? CE  ? B LYS 175 CE  
311 1 Y 1 B LYS 200 ? NZ  ? B LYS 175 NZ  
312 1 Y 1 B ASN 211 ? CG  ? B ASN 186 CG  
313 1 Y 1 B ASN 211 ? OD1 ? B ASN 186 OD1 
314 1 Y 1 B ASN 211 ? ND2 ? B ASN 186 ND2 
315 1 Y 1 B LYS 225 ? CG  ? B LYS 200 CG  
316 1 Y 1 B LYS 225 ? CD  ? B LYS 200 CD  
317 1 Y 1 B LYS 225 ? CE  ? B LYS 200 CE  
318 1 Y 1 B LYS 225 ? NZ  ? B LYS 200 NZ  
319 1 Y 1 B GLN 270 ? CG  ? B GLN 245 CG  
320 1 Y 1 B GLN 270 ? CD  ? B GLN 245 CD  
321 1 Y 1 B GLN 270 ? OE1 ? B GLN 245 OE1 
322 1 Y 1 B GLN 270 ? NE2 ? B GLN 245 NE2 
323 1 Y 1 B ARG 280 ? CG  ? B ARG 255 CG  
324 1 Y 1 B ARG 280 ? CD  ? B ARG 255 CD  
325 1 Y 1 B ARG 280 ? NE  ? B ARG 255 NE  
326 1 Y 1 B ARG 280 ? CZ  ? B ARG 255 CZ  
327 1 Y 1 B ARG 280 ? NH1 ? B ARG 255 NH1 
328 1 Y 1 B ARG 280 ? NH2 ? B ARG 255 NH2 
329 1 Y 1 B LYS 304 ? CG  ? B LYS 279 CG  
330 1 Y 1 B LYS 304 ? CD  ? B LYS 279 CD  
331 1 Y 1 B LYS 304 ? CE  ? B LYS 279 CE  
332 1 Y 1 B LYS 304 ? NZ  ? B LYS 279 NZ  
333 1 Y 1 B LYS 316 ? CG  ? B LYS 291 CG  
334 1 Y 1 B LYS 316 ? CD  ? B LYS 291 CD  
335 1 Y 1 B LYS 316 ? CE  ? B LYS 291 CE  
336 1 Y 1 B LYS 316 ? NZ  ? B LYS 291 NZ  
337 1 Y 1 B GLN 329 ? CG  ? B GLN 304 CG  
338 1 Y 1 B GLN 329 ? CD  ? B GLN 304 CD  
339 1 Y 1 B GLN 329 ? OE1 ? B GLN 304 OE1 
340 1 Y 1 B GLN 329 ? NE2 ? B GLN 304 NE2 
341 1 Y 1 B LYS 332 ? CG  ? B LYS 307 CG  
342 1 Y 1 B LYS 332 ? CD  ? B LYS 307 CD  
343 1 Y 1 B LYS 332 ? CE  ? B LYS 307 CE  
344 1 Y 1 B LYS 332 ? NZ  ? B LYS 307 NZ  
345 1 Y 1 B ILE 335 ? CG1 ? B ILE 310 CG1 
346 1 Y 1 B ILE 335 ? CG2 ? B ILE 310 CG2 
347 1 Y 1 B ILE 335 ? CD1 ? B ILE 310 CD1 
348 1 Y 1 B ILE 336 ? CG1 ? B ILE 311 CG1 
349 1 Y 1 B ILE 336 ? CG2 ? B ILE 311 CG2 
350 1 Y 1 B ILE 336 ? CD1 ? B ILE 311 CD1 
351 1 Y 1 B LEU 346 ? CG  ? B LEU 321 CG  
352 1 Y 1 B LEU 346 ? CD1 ? B LEU 321 CD1 
353 1 Y 1 B LEU 346 ? CD2 ? B LEU 321 CD2 
354 1 Y 1 B LEU 348 ? CG  ? B LEU 323 CG  
355 1 Y 1 B LEU 348 ? CD1 ? B LEU 323 CD1 
356 1 Y 1 B LEU 348 ? CD2 ? B LEU 323 CD2 
357 1 Y 1 B LEU 349 ? CG  ? B LEU 324 CG  
358 1 Y 1 B LEU 349 ? CD1 ? B LEU 324 CD1 
359 1 Y 1 B LEU 349 ? CD2 ? B LEU 324 CD2 
360 1 Y 1 B LEU 351 ? CG  ? B LEU 326 CG  
361 1 Y 1 B LEU 351 ? CD1 ? B LEU 326 CD1 
362 1 Y 1 B LEU 351 ? CD2 ? B LEU 326 CD2 
363 1 Y 1 B VAL 352 ? CG1 ? B VAL 327 CG1 
364 1 Y 1 B VAL 352 ? CG2 ? B VAL 327 CG2 
365 1 Y 1 B VAL 354 ? CG1 ? B VAL 329 CG1 
366 1 Y 1 B VAL 354 ? CG2 ? B VAL 329 CG2 
367 1 Y 1 B ILE 355 ? CG1 ? B ILE 330 CG1 
368 1 Y 1 B ILE 355 ? CG2 ? B ILE 330 CG2 
369 1 Y 1 B ILE 355 ? CD1 ? B ILE 330 CD1 
370 1 Y 1 B ASP 357 ? CG  ? B ASP 332 CG  
371 1 Y 1 B ASP 357 ? OD1 ? B ASP 332 OD1 
372 1 Y 1 B ASP 357 ? OD2 ? B ASP 332 OD2 
373 1 Y 1 B TRP 358 ? CG  ? B TRP 333 CG  
374 1 Y 1 B TRP 358 ? CD1 ? B TRP 333 CD1 
375 1 Y 1 B TRP 358 ? CD2 ? B TRP 333 CD2 
376 1 Y 1 B TRP 358 ? NE1 ? B TRP 333 NE1 
377 1 Y 1 B TRP 358 ? CE2 ? B TRP 333 CE2 
378 1 Y 1 B TRP 358 ? CE3 ? B TRP 333 CE3 
379 1 Y 1 B TRP 358 ? CZ2 ? B TRP 333 CZ2 
380 1 Y 1 B TRP 358 ? CZ3 ? B TRP 333 CZ3 
381 1 Y 1 B TRP 358 ? CH2 ? B TRP 333 CH2 
382 1 Y 1 B ILE 359 ? CG1 ? B ILE 334 CG1 
383 1 Y 1 B ILE 359 ? CG2 ? B ILE 334 CG2 
384 1 Y 1 B ILE 359 ? CD1 ? B ILE 334 CD1 
385 1 Y 1 B VAL 360 ? CG1 ? B VAL 335 CG1 
386 1 Y 1 B VAL 360 ? CG2 ? B VAL 335 CG2 
387 1 Y 1 B LEU 361 ? CG  ? B LEU 336 CG  
388 1 Y 1 B LEU 361 ? CD1 ? B LEU 336 CD1 
389 1 Y 1 B LEU 361 ? CD2 ? B LEU 336 CD2 
390 1 Y 1 C LEU 34  ? CG  ? C LEU 9   CG  
391 1 Y 1 C LEU 34  ? CD1 ? C LEU 9   CD1 
392 1 Y 1 C LEU 34  ? CD2 ? C LEU 9   CD2 
393 1 Y 1 C ASN 35  ? CG  ? C ASN 10  CG  
394 1 Y 1 C ASN 35  ? OD1 ? C ASN 10  OD1 
395 1 Y 1 C ASN 35  ? ND2 ? C ASN 10  ND2 
396 1 Y 1 C ARG 36  ? CG  ? C ARG 11  CG  
397 1 Y 1 C ARG 36  ? CD  ? C ARG 11  CD  
398 1 Y 1 C ARG 36  ? NE  ? C ARG 11  NE  
399 1 Y 1 C ARG 36  ? CZ  ? C ARG 11  CZ  
400 1 Y 1 C ARG 36  ? NH1 ? C ARG 11  NH1 
401 1 Y 1 C ARG 36  ? NH2 ? C ARG 11  NH2 
402 1 Y 1 C GLN 39  ? CG  ? C GLN 14  CG  
403 1 Y 1 C GLN 39  ? CD  ? C GLN 14  CD  
404 1 Y 1 C GLN 39  ? OE1 ? C GLN 14  OE1 
405 1 Y 1 C GLN 39  ? NE2 ? C GLN 14  NE2 
406 1 Y 1 C ASN 54  ? CG  ? C ASN 29  CG  
407 1 Y 1 C ASN 54  ? OD1 ? C ASN 29  OD1 
408 1 Y 1 C ASN 54  ? ND2 ? C ASN 29  ND2 
409 1 Y 1 C LYS 55  ? CG  ? C LYS 30  CG  
410 1 Y 1 C LYS 55  ? CD  ? C LYS 30  CD  
411 1 Y 1 C LYS 55  ? CE  ? C LYS 30  CE  
412 1 Y 1 C LYS 55  ? NZ  ? C LYS 30  NZ  
413 1 Y 1 C ASP 59  ? CG  ? C ASP 34  CG  
414 1 Y 1 C ASP 59  ? OD1 ? C ASP 34  OD1 
415 1 Y 1 C ASP 59  ? OD2 ? C ASP 34  OD2 
416 1 Y 1 C THR 60  ? OG1 ? C THR 35  OG1 
417 1 Y 1 C THR 60  ? CG2 ? C THR 35  CG2 
418 1 Y 1 C LYS 70  ? CG  ? C LYS 45  CG  
419 1 Y 1 C LYS 70  ? CD  ? C LYS 45  CD  
420 1 Y 1 C LYS 70  ? CE  ? C LYS 45  CE  
421 1 Y 1 C LYS 70  ? NZ  ? C LYS 45  NZ  
422 1 Y 1 C LYS 72  ? CG  ? C LYS 47  CG  
423 1 Y 1 C LYS 72  ? CD  ? C LYS 47  CD  
424 1 Y 1 C LYS 72  ? CE  ? C LYS 47  CE  
425 1 Y 1 C LYS 72  ? NZ  ? C LYS 47  NZ  
426 1 Y 1 C GLU 81  ? CG  ? C GLU 56  CG  
427 1 Y 1 C GLU 81  ? CD  ? C GLU 56  CD  
428 1 Y 1 C GLU 81  ? OE1 ? C GLU 56  OE1 
429 1 Y 1 C GLU 81  ? OE2 ? C GLU 56  OE2 
430 1 Y 1 C ARG 85  ? CG  ? C ARG 60  CG  
431 1 Y 1 C ARG 85  ? CD  ? C ARG 60  CD  
432 1 Y 1 C ARG 85  ? NE  ? C ARG 60  NE  
433 1 Y 1 C ARG 85  ? CZ  ? C ARG 60  CZ  
434 1 Y 1 C ARG 85  ? NH1 ? C ARG 60  NH1 
435 1 Y 1 C ARG 85  ? NH2 ? C ARG 60  NH2 
436 1 Y 1 C ASP 91  ? CG  ? C ASP 66  CG  
437 1 Y 1 C ASP 91  ? OD1 ? C ASP 66  OD1 
438 1 Y 1 C ASP 91  ? OD2 ? C ASP 66  OD2 
439 1 Y 1 C GLU 98  ? CG  ? C GLU 73  CG  
440 1 Y 1 C GLU 98  ? CD  ? C GLU 73  CD  
441 1 Y 1 C GLU 98  ? OE1 ? C GLU 73  OE1 
442 1 Y 1 C GLU 98  ? OE2 ? C GLU 73  OE2 
443 1 Y 1 C LYS 118 ? CG  ? C LYS 93  CG  
444 1 Y 1 C LYS 118 ? CD  ? C LYS 93  CD  
445 1 Y 1 C LYS 118 ? CE  ? C LYS 93  CE  
446 1 Y 1 C LYS 118 ? NZ  ? C LYS 93  NZ  
447 1 Y 1 C ARG 133 ? CG  ? C ARG 108 CG  
448 1 Y 1 C ARG 133 ? CD  ? C ARG 108 CD  
449 1 Y 1 C ARG 133 ? NE  ? C ARG 108 NE  
450 1 Y 1 C ARG 133 ? CZ  ? C ARG 108 CZ  
451 1 Y 1 C ARG 133 ? NH1 ? C ARG 108 NH1 
452 1 Y 1 C ARG 133 ? NH2 ? C ARG 108 NH2 
453 1 Y 1 C LYS 136 ? CG  ? C LYS 111 CG  
454 1 Y 1 C LYS 136 ? CD  ? C LYS 111 CD  
455 1 Y 1 C LYS 136 ? CE  ? C LYS 111 CE  
456 1 Y 1 C LYS 136 ? NZ  ? C LYS 111 NZ  
457 1 Y 1 C ARG 137 ? CG  ? C ARG 112 CG  
458 1 Y 1 C ARG 137 ? CD  ? C ARG 112 CD  
459 1 Y 1 C ARG 137 ? NE  ? C ARG 112 NE  
460 1 Y 1 C ARG 137 ? CZ  ? C ARG 112 CZ  
461 1 Y 1 C ARG 137 ? NH1 ? C ARG 112 NH1 
462 1 Y 1 C ARG 137 ? NH2 ? C ARG 112 NH2 
463 1 Y 1 C PHE 139 ? CG  ? C PHE 114 CG  
464 1 Y 1 C PHE 139 ? CD1 ? C PHE 114 CD1 
465 1 Y 1 C PHE 139 ? CD2 ? C PHE 114 CD2 
466 1 Y 1 C PHE 139 ? CE1 ? C PHE 114 CE1 
467 1 Y 1 C PHE 139 ? CE2 ? C PHE 114 CE2 
468 1 Y 1 C PHE 139 ? CZ  ? C PHE 114 CZ  
469 1 Y 1 C ASN 140 ? CG  ? C ASN 115 CG  
470 1 Y 1 C ASN 140 ? OD1 ? C ASN 115 OD1 
471 1 Y 1 C ASN 140 ? ND2 ? C ASN 115 ND2 
472 1 Y 1 C ASP 141 ? CG  ? C ASP 116 CG  
473 1 Y 1 C ASP 141 ? OD1 ? C ASP 116 OD1 
474 1 Y 1 C ASP 141 ? OD2 ? C ASP 116 OD2 
475 1 Y 1 C ARG 143 ? CG  ? C ARG 118 CG  
476 1 Y 1 C ARG 143 ? CD  ? C ARG 118 CD  
477 1 Y 1 C ARG 143 ? NE  ? C ARG 118 NE  
478 1 Y 1 C ARG 143 ? CZ  ? C ARG 118 CZ  
479 1 Y 1 C ARG 143 ? NH1 ? C ARG 118 NH1 
480 1 Y 1 C ARG 143 ? NH2 ? C ARG 118 NH2 
481 1 Y 1 C ASP 145 ? CG  ? C ASP 120 CG  
482 1 Y 1 C ASP 145 ? OD1 ? C ASP 120 OD1 
483 1 Y 1 C ASP 145 ? OD2 ? C ASP 120 OD2 
484 1 Y 1 C VAL 147 ? CG1 ? C VAL 122 CG1 
485 1 Y 1 C VAL 147 ? CG2 ? C VAL 122 CG2 
486 1 Y 1 C ARG 148 ? CG  ? C ARG 123 CG  
487 1 Y 1 C ARG 148 ? CD  ? C ARG 123 CD  
488 1 Y 1 C ARG 148 ? NE  ? C ARG 123 NE  
489 1 Y 1 C ARG 148 ? CZ  ? C ARG 123 CZ  
490 1 Y 1 C ARG 148 ? NH1 ? C ARG 123 NH1 
491 1 Y 1 C ARG 148 ? NH2 ? C ARG 123 NH2 
492 1 Y 1 C ARG 151 ? CG  ? C ARG 126 CG  
493 1 Y 1 C ARG 151 ? CD  ? C ARG 126 CD  
494 1 Y 1 C ARG 151 ? NE  ? C ARG 126 NE  
495 1 Y 1 C ARG 151 ? CZ  ? C ARG 126 CZ  
496 1 Y 1 C ARG 151 ? NH1 ? C ARG 126 NH1 
497 1 Y 1 C ARG 151 ? NH2 ? C ARG 126 NH2 
498 1 Y 1 C LYS 160 ? CG  ? C LYS 135 CG  
499 1 Y 1 C LYS 160 ? CD  ? C LYS 135 CD  
500 1 Y 1 C LYS 160 ? CE  ? C LYS 135 CE  
501 1 Y 1 C LYS 160 ? NZ  ? C LYS 135 NZ  
502 1 Y 1 C LYS 200 ? CG  ? C LYS 175 CG  
503 1 Y 1 C LYS 200 ? CD  ? C LYS 175 CD  
504 1 Y 1 C LYS 200 ? CE  ? C LYS 175 CE  
505 1 Y 1 C LYS 200 ? NZ  ? C LYS 175 NZ  
506 1 Y 1 C ASN 211 ? CG  ? C ASN 186 CG  
507 1 Y 1 C ASN 211 ? OD1 ? C ASN 186 OD1 
508 1 Y 1 C ASN 211 ? ND2 ? C ASN 186 ND2 
509 1 Y 1 C LYS 225 ? CG  ? C LYS 200 CG  
510 1 Y 1 C LYS 225 ? CD  ? C LYS 200 CD  
511 1 Y 1 C LYS 225 ? CE  ? C LYS 200 CE  
512 1 Y 1 C LYS 225 ? NZ  ? C LYS 200 NZ  
513 1 Y 1 C ARG 234 ? CG  ? C ARG 209 CG  
514 1 Y 1 C ARG 234 ? CD  ? C ARG 209 CD  
515 1 Y 1 C ARG 234 ? NE  ? C ARG 209 NE  
516 1 Y 1 C ARG 234 ? CZ  ? C ARG 209 CZ  
517 1 Y 1 C ARG 234 ? NH1 ? C ARG 209 NH1 
518 1 Y 1 C ARG 234 ? NH2 ? C ARG 209 NH2 
519 1 Y 1 C ARG 252 ? CG  ? C ARG 227 CG  
520 1 Y 1 C ARG 252 ? CD  ? C ARG 227 CD  
521 1 Y 1 C ARG 252 ? NE  ? C ARG 227 NE  
522 1 Y 1 C ARG 252 ? CZ  ? C ARG 227 CZ  
523 1 Y 1 C ARG 252 ? NH1 ? C ARG 227 NH1 
524 1 Y 1 C ARG 252 ? NH2 ? C ARG 227 NH2 
525 1 Y 1 C LEU 266 ? CG  ? C LEU 241 CG  
526 1 Y 1 C LEU 266 ? CD1 ? C LEU 241 CD1 
527 1 Y 1 C LEU 266 ? CD2 ? C LEU 241 CD2 
528 1 Y 1 C GLN 270 ? CG  ? C GLN 245 CG  
529 1 Y 1 C GLN 270 ? CD  ? C GLN 245 CD  
530 1 Y 1 C GLN 270 ? OE1 ? C GLN 245 OE1 
531 1 Y 1 C GLN 270 ? NE2 ? C GLN 245 NE2 
532 1 Y 1 C ARG 276 ? CG  ? C ARG 251 CG  
533 1 Y 1 C ARG 276 ? CD  ? C ARG 251 CD  
534 1 Y 1 C ARG 276 ? NE  ? C ARG 251 NE  
535 1 Y 1 C ARG 276 ? CZ  ? C ARG 251 CZ  
536 1 Y 1 C ARG 276 ? NH1 ? C ARG 251 NH1 
537 1 Y 1 C ARG 276 ? NH2 ? C ARG 251 NH2 
538 1 Y 1 C LYS 285 ? CG  ? C LYS 260 CG  
539 1 Y 1 C LYS 285 ? CD  ? C LYS 260 CD  
540 1 Y 1 C LYS 285 ? CE  ? C LYS 260 CE  
541 1 Y 1 C LYS 285 ? NZ  ? C LYS 260 NZ  
542 1 Y 1 C ARG 298 ? CG  ? C ARG 273 CG  
543 1 Y 1 C ARG 298 ? CD  ? C ARG 273 CD  
544 1 Y 1 C ARG 298 ? NE  ? C ARG 273 NE  
545 1 Y 1 C ARG 298 ? CZ  ? C ARG 273 CZ  
546 1 Y 1 C ARG 298 ? NH1 ? C ARG 273 NH1 
547 1 Y 1 C ARG 298 ? NH2 ? C ARG 273 NH2 
548 1 Y 1 C LYS 304 ? CG  ? C LYS 279 CG  
549 1 Y 1 C LYS 304 ? CD  ? C LYS 279 CD  
550 1 Y 1 C LYS 304 ? CE  ? C LYS 279 CE  
551 1 Y 1 C LYS 304 ? NZ  ? C LYS 279 NZ  
552 1 Y 1 C GLN 329 ? CG  ? C GLN 304 CG  
553 1 Y 1 C GLN 329 ? CD  ? C GLN 304 CD  
554 1 Y 1 C GLN 329 ? OE1 ? C GLN 304 OE1 
555 1 Y 1 C GLN 329 ? NE2 ? C GLN 304 NE2 
556 1 Y 1 C LYS 332 ? CG  ? C LYS 307 CG  
557 1 Y 1 C LYS 332 ? CD  ? C LYS 307 CD  
558 1 Y 1 C LYS 332 ? CE  ? C LYS 307 CE  
559 1 Y 1 C LYS 332 ? NZ  ? C LYS 307 NZ  
560 1 Y 1 C ILE 335 ? CG1 ? C ILE 310 CG1 
561 1 Y 1 C ILE 335 ? CG2 ? C ILE 310 CG2 
562 1 Y 1 C ILE 335 ? CD1 ? C ILE 310 CD1 
563 1 Y 1 C ILE 336 ? CG1 ? C ILE 311 CG1 
564 1 Y 1 C ILE 336 ? CG2 ? C ILE 311 CG2 
565 1 Y 1 C ILE 336 ? CD1 ? C ILE 311 CD1 
566 1 Y 1 C LEU 340 ? CG  ? C LEU 315 CG  
567 1 Y 1 C LEU 340 ? CD1 ? C LEU 315 CD1 
568 1 Y 1 C LEU 340 ? CD2 ? C LEU 315 CD2 
569 1 Y 1 C LEU 348 ? CG  ? C LEU 323 CG  
570 1 Y 1 C LEU 348 ? CD1 ? C LEU 323 CD1 
571 1 Y 1 C LEU 348 ? CD2 ? C LEU 323 CD2 
572 1 Y 1 C VAL 352 ? CG1 ? C VAL 327 CG1 
573 1 Y 1 C VAL 352 ? CG2 ? C VAL 327 CG2 
574 1 Y 1 C ASN 353 ? CG  ? C ASN 328 CG  
575 1 Y 1 C ASN 353 ? OD1 ? C ASN 328 OD1 
576 1 Y 1 C ASN 353 ? ND2 ? C ASN 328 ND2 
577 1 Y 1 C VAL 354 ? CG1 ? C VAL 329 CG1 
578 1 Y 1 C VAL 354 ? CG2 ? C VAL 329 CG2 
579 1 Y 1 C ILE 355 ? CG1 ? C ILE 330 CG1 
580 1 Y 1 C ILE 355 ? CG2 ? C ILE 330 CG2 
581 1 Y 1 C ILE 355 ? CD1 ? C ILE 330 CD1 
582 1 Y 1 C CYS 356 ? SG  ? C CYS 331 SG  
583 1 Y 1 C ASP 357 ? CG  ? C ASP 332 CG  
584 1 Y 1 C ASP 357 ? OD1 ? C ASP 332 OD1 
585 1 Y 1 C ASP 357 ? OD2 ? C ASP 332 OD2 
586 1 Y 1 C TRP 358 ? CG  ? C TRP 333 CG  
587 1 Y 1 C TRP 358 ? CD1 ? C TRP 333 CD1 
588 1 Y 1 C TRP 358 ? CD2 ? C TRP 333 CD2 
589 1 Y 1 C TRP 358 ? NE1 ? C TRP 333 NE1 
590 1 Y 1 C TRP 358 ? CE2 ? C TRP 333 CE2 
591 1 Y 1 C TRP 358 ? CE3 ? C TRP 333 CE3 
592 1 Y 1 C TRP 358 ? CZ2 ? C TRP 333 CZ2 
593 1 Y 1 C TRP 358 ? CZ3 ? C TRP 333 CZ3 
594 1 Y 1 C TRP 358 ? CH2 ? C TRP 333 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 26  ? A GLY 1   
2  1 Y 1 A SER 27  ? A SER 2   
3  1 Y 1 A SER 28  ? A SER 3   
4  1 Y 1 A LYS 29  ? A LYS 4   
5  1 Y 1 A LYS 30  ? A LYS 5   
6  1 Y 1 A VAL 31  ? A VAL 6   
7  1 Y 1 A GLY 32  ? A GLY 7   
8  1 Y 1 A THR 33  ? A THR 8   
9  1 Y 1 A LEU 34  ? A LEU 9   
10 1 Y 1 A ASN 35  ? A ASN 10  
11 1 Y 1 A VAL 360 ? A VAL 335 
12 1 Y 1 A LEU 361 ? A LEU 336 
13 1 Y 1 A THR 362 ? A THR 337 
14 1 Y 1 A PHE 363 ? A PHE 338 
15 1 Y 1 A MET 364 ? A MET 339 
16 1 Y 1 A LYS 365 ? A LYS 340 
17 1 Y 1 A ARG 366 ? A ARG 341 
18 1 Y 1 A LYS 367 ? A LYS 342 
19 1 Y 1 A GLN 368 ? A GLN 343 
20 1 Y 1 A HIS 369 ? A HIS 344 
21 1 Y 1 A TYR 370 ? A TYR 345 
22 1 Y 1 A LYS 371 ? A LYS 346 
23 1 Y 1 A GLU 372 ? A GLU 347 
24 1 Y 1 A GLN 373 ? A GLN 348 
25 1 Y 1 A LYS 374 ? A LYS 349 
26 1 Y 1 A TYR 375 ? A TYR 350 
27 1 Y 1 A THR 376 ? A THR 351 
28 1 Y 1 A TYR 377 ? A TYR 352 
29 1 Y 1 A VAL 378 ? A VAL 353 
30 1 Y 1 A ASP 379 ? A ASP 354 
31 1 Y 1 A ASP 380 ? A ASP 355 
32 1 Y 1 A PHE 381 ? A PHE 356 
33 1 Y 1 B GLY 26  ? B GLY 1   
34 1 Y 1 B SER 27  ? B SER 2   
35 1 Y 1 B SER 28  ? B SER 3   
36 1 Y 1 B LYS 29  ? B LYS 4   
37 1 Y 1 B LYS 30  ? B LYS 5   
38 1 Y 1 B VAL 31  ? B VAL 6   
39 1 Y 1 B GLY 32  ? B GLY 7   
40 1 Y 1 B THR 33  ? B THR 8   
41 1 Y 1 B THR 362 ? B THR 337 
42 1 Y 1 B PHE 363 ? B PHE 338 
43 1 Y 1 B MET 364 ? B MET 339 
44 1 Y 1 B LYS 365 ? B LYS 340 
45 1 Y 1 B ARG 366 ? B ARG 341 
46 1 Y 1 B LYS 367 ? B LYS 342 
47 1 Y 1 B GLN 368 ? B GLN 343 
48 1 Y 1 B HIS 369 ? B HIS 344 
49 1 Y 1 B TYR 370 ? B TYR 345 
50 1 Y 1 B LYS 371 ? B LYS 346 
51 1 Y 1 B GLU 372 ? B GLU 347 
52 1 Y 1 B GLN 373 ? B GLN 348 
53 1 Y 1 B LYS 374 ? B LYS 349 
54 1 Y 1 B TYR 375 ? B TYR 350 
55 1 Y 1 B THR 376 ? B THR 351 
56 1 Y 1 B TYR 377 ? B TYR 352 
57 1 Y 1 B VAL 378 ? B VAL 353 
58 1 Y 1 B ASP 379 ? B ASP 354 
59 1 Y 1 B ASP 380 ? B ASP 355 
60 1 Y 1 B PHE 381 ? B PHE 356 
61 1 Y 1 C GLY 26  ? C GLY 1   
62 1 Y 1 C SER 27  ? C SER 2   
63 1 Y 1 C SER 28  ? C SER 3   
64 1 Y 1 C LYS 29  ? C LYS 4   
65 1 Y 1 C LYS 30  ? C LYS 5   
66 1 Y 1 C VAL 31  ? C VAL 6   
67 1 Y 1 C GLY 32  ? C GLY 7   
68 1 Y 1 C THR 33  ? C THR 8   
69 1 Y 1 C ILE 359 ? C ILE 334 
70 1 Y 1 C VAL 360 ? C VAL 335 
71 1 Y 1 C LEU 361 ? C LEU 336 
72 1 Y 1 C THR 362 ? C THR 337 
73 1 Y 1 C PHE 363 ? C PHE 338 
74 1 Y 1 C MET 364 ? C MET 339 
75 1 Y 1 C LYS 365 ? C LYS 340 
76 1 Y 1 C ARG 366 ? C ARG 341 
77 1 Y 1 C LYS 367 ? C LYS 342 
78 1 Y 1 C GLN 368 ? C GLN 343 
79 1 Y 1 C HIS 369 ? C HIS 344 
80 1 Y 1 C TYR 370 ? C TYR 345 
81 1 Y 1 C LYS 371 ? C LYS 346 
82 1 Y 1 C GLU 372 ? C GLU 347 
83 1 Y 1 C GLN 373 ? C GLN 348 
84 1 Y 1 C LYS 374 ? C LYS 349 
85 1 Y 1 C TYR 375 ? C TYR 350 
86 1 Y 1 C THR 376 ? C THR 351 
87 1 Y 1 C TYR 377 ? C TYR 352 
88 1 Y 1 C VAL 378 ? C VAL 353 
89 1 Y 1 C ASP 379 ? C ASP 354 
90 1 Y 1 C ASP 380 ? C ASP 355 
91 1 Y 1 C PHE 381 ? C PHE 356 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 2 NAG 1 D NAG 1 A NAG 404 n 
D 2 NAG 2 D NAG 2 A NAG 405 n 
E 2 NAG 1 E NAG 1 C NAG 404 n 
E 2 NAG 2 E NAG 2 C NAG 405 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAcb1-4DGlcpNAcb1-                               'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'    LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  NAG 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O4 
_pdbx_entity_branch_link.leaving_atom_id_2          HO4 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        2-acetamido-2-deoxy-beta-D-glucopyranose 
_pdbx_entity_nonpoly.comp_id     NAG 
#