data_3I5Y
# 
_entry.id   3I5Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I5Y         
NDB   NA0087       
RCSB  RCSB054005   
WWPDB D_1000054005 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3I5X . unspecified 
PDB 3I61 . unspecified 
PDB 3I62 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I5Y 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Del Campo, M.'   1 
'Lambowitz, A.M.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Yeast DEAD box protein Mss116p reveals two wedges that crimp RNA' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            35 
_citation.page_first                598 
_citation.page_last                 609 
_citation.year                      2009 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19748356 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2009.07.032 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Del Campo, M.'   1 
primary 'Lambowitz, A.M.' 2 
# 
_cell.entry_id           3I5Y 
_cell.length_a           89.190 
_cell.length_b           126.352 
_cell.length_c           55.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         3I5Y 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-dependent RNA helicase MSS116'           64483.715 1  3.6.1.- ? 'UNP residues 37 to 597' ? 
2 polymer     syn "5'-R(*UP*UP*UP*(5BU)P*UP*UP*UP*UP*UP*U)-3'"  3095.596  1  ?       ? ?                        ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   1  ?       ? ?                        ? 
4 non-polymer syn 'MAGNESIUM ION'                               24.305    1  ?       ? ?                        ? 
5 water       nat water                                         18.015    85 ?       ? ?                        ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no  
;GSLYNDGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDNSKEVTLDSLLEEGVLD
KEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLAL
QIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLE
IGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFAN
SIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTD
VGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSE
VLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEI
RDY
;
;GSLYNDGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDNSKEVTLDSLLEEGVLD
KEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLAL
QIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLE
IGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFAN
SIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTD
VGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSE
VLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEI
RDY
;
A ? 
2 polyribonucleotide no yes 'UUU(5BU)UUUUUU' UUUUUUUUUU B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LEU n 
1 4   TYR n 
1 5   ASN n 
1 6   ASP n 
1 7   GLY n 
1 8   ASN n 
1 9   ARG n 
1 10  ASP n 
1 11  GLN n 
1 12  ARG n 
1 13  ASN n 
1 14  PHE n 
1 15  GLY n 
1 16  ARG n 
1 17  ASN n 
1 18  GLN n 
1 19  ARG n 
1 20  ASN n 
1 21  ASN n 
1 22  ASN n 
1 23  SER n 
1 24  ASN n 
1 25  ARG n 
1 26  TYR n 
1 27  ARG n 
1 28  ASN n 
1 29  SER n 
1 30  ARG n 
1 31  PHE n 
1 32  ASN n 
1 33  SER n 
1 34  ARG n 
1 35  PRO n 
1 36  ARG n 
1 37  THR n 
1 38  ARG n 
1 39  SER n 
1 40  ARG n 
1 41  GLU n 
1 42  ASP n 
1 43  ASP n 
1 44  ASP n 
1 45  GLU n 
1 46  VAL n 
1 47  HIS n 
1 48  PHE n 
1 49  ASP n 
1 50  LYS n 
1 51  THR n 
1 52  THR n 
1 53  PHE n 
1 54  SER n 
1 55  LYS n 
1 56  LEU n 
1 57  ILE n 
1 58  HIS n 
1 59  VAL n 
1 60  PRO n 
1 61  LYS n 
1 62  GLU n 
1 63  ASP n 
1 64  ASN n 
1 65  SER n 
1 66  LYS n 
1 67  GLU n 
1 68  VAL n 
1 69  THR n 
1 70  LEU n 
1 71  ASP n 
1 72  SER n 
1 73  LEU n 
1 74  LEU n 
1 75  GLU n 
1 76  GLU n 
1 77  GLY n 
1 78  VAL n 
1 79  LEU n 
1 80  ASP n 
1 81  LYS n 
1 82  GLU n 
1 83  ILE n 
1 84  HIS n 
1 85  LYS n 
1 86  ALA n 
1 87  ILE n 
1 88  THR n 
1 89  ARG n 
1 90  MET n 
1 91  GLU n 
1 92  PHE n 
1 93  PRO n 
1 94  GLY n 
1 95  LEU n 
1 96  THR n 
1 97  PRO n 
1 98  VAL n 
1 99  GLN n 
1 100 GLN n 
1 101 LYS n 
1 102 THR n 
1 103 ILE n 
1 104 LYS n 
1 105 PRO n 
1 106 ILE n 
1 107 LEU n 
1 108 SER n 
1 109 SER n 
1 110 GLU n 
1 111 ASP n 
1 112 HIS n 
1 113 ASP n 
1 114 VAL n 
1 115 ILE n 
1 116 ALA n 
1 117 ARG n 
1 118 ALA n 
1 119 LYS n 
1 120 THR n 
1 121 GLY n 
1 122 THR n 
1 123 GLY n 
1 124 LYS n 
1 125 THR n 
1 126 PHE n 
1 127 ALA n 
1 128 PHE n 
1 129 LEU n 
1 130 ILE n 
1 131 PRO n 
1 132 ILE n 
1 133 PHE n 
1 134 GLN n 
1 135 HIS n 
1 136 LEU n 
1 137 ILE n 
1 138 ASN n 
1 139 THR n 
1 140 LYS n 
1 141 PHE n 
1 142 ASP n 
1 143 SER n 
1 144 GLN n 
1 145 TYR n 
1 146 MET n 
1 147 VAL n 
1 148 LYS n 
1 149 ALA n 
1 150 VAL n 
1 151 ILE n 
1 152 VAL n 
1 153 ALA n 
1 154 PRO n 
1 155 THR n 
1 156 ARG n 
1 157 ASP n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 GLN n 
1 162 ILE n 
1 163 GLU n 
1 164 ALA n 
1 165 GLU n 
1 166 VAL n 
1 167 LYS n 
1 168 LYS n 
1 169 ILE n 
1 170 HIS n 
1 171 ASP n 
1 172 MET n 
1 173 ASN n 
1 174 TYR n 
1 175 GLY n 
1 176 LEU n 
1 177 LYS n 
1 178 LYS n 
1 179 TYR n 
1 180 ALA n 
1 181 CYS n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 VAL n 
1 186 GLY n 
1 187 GLY n 
1 188 THR n 
1 189 ASP n 
1 190 PHE n 
1 191 ARG n 
1 192 ALA n 
1 193 ALA n 
1 194 MET n 
1 195 ASN n 
1 196 LYS n 
1 197 MET n 
1 198 ASN n 
1 199 LYS n 
1 200 LEU n 
1 201 ARG n 
1 202 PRO n 
1 203 ASN n 
1 204 ILE n 
1 205 VAL n 
1 206 ILE n 
1 207 ALA n 
1 208 THR n 
1 209 PRO n 
1 210 GLY n 
1 211 ARG n 
1 212 LEU n 
1 213 ILE n 
1 214 ASP n 
1 215 VAL n 
1 216 LEU n 
1 217 GLU n 
1 218 LYS n 
1 219 TYR n 
1 220 SER n 
1 221 ASN n 
1 222 LYS n 
1 223 PHE n 
1 224 PHE n 
1 225 ARG n 
1 226 PHE n 
1 227 VAL n 
1 228 ASP n 
1 229 TYR n 
1 230 LYS n 
1 231 VAL n 
1 232 LEU n 
1 233 ASP n 
1 234 GLU n 
1 235 ALA n 
1 236 ASP n 
1 237 ARG n 
1 238 LEU n 
1 239 LEU n 
1 240 GLU n 
1 241 ILE n 
1 242 GLY n 
1 243 PHE n 
1 244 ARG n 
1 245 ASP n 
1 246 ASP n 
1 247 LEU n 
1 248 GLU n 
1 249 THR n 
1 250 ILE n 
1 251 SER n 
1 252 GLY n 
1 253 ILE n 
1 254 LEU n 
1 255 ASN n 
1 256 GLU n 
1 257 LYS n 
1 258 ASN n 
1 259 SER n 
1 260 LYS n 
1 261 SER n 
1 262 ALA n 
1 263 ASP n 
1 264 ASN n 
1 265 ILE n 
1 266 LYS n 
1 267 THR n 
1 268 LEU n 
1 269 LEU n 
1 270 PHE n 
1 271 SER n 
1 272 ALA n 
1 273 THR n 
1 274 LEU n 
1 275 ASP n 
1 276 ASP n 
1 277 LYS n 
1 278 VAL n 
1 279 GLN n 
1 280 LYS n 
1 281 LEU n 
1 282 ALA n 
1 283 ASN n 
1 284 ASN n 
1 285 ILE n 
1 286 MET n 
1 287 ASN n 
1 288 LYS n 
1 289 LYS n 
1 290 GLU n 
1 291 CYS n 
1 292 LEU n 
1 293 PHE n 
1 294 LEU n 
1 295 ASP n 
1 296 THR n 
1 297 VAL n 
1 298 ASP n 
1 299 LYS n 
1 300 ASN n 
1 301 GLU n 
1 302 PRO n 
1 303 GLU n 
1 304 ALA n 
1 305 HIS n 
1 306 GLU n 
1 307 ARG n 
1 308 ILE n 
1 309 ASP n 
1 310 GLN n 
1 311 SER n 
1 312 VAL n 
1 313 VAL n 
1 314 ILE n 
1 315 SER n 
1 316 GLU n 
1 317 LYS n 
1 318 PHE n 
1 319 ALA n 
1 320 ASN n 
1 321 SER n 
1 322 ILE n 
1 323 PHE n 
1 324 ALA n 
1 325 ALA n 
1 326 VAL n 
1 327 GLU n 
1 328 HIS n 
1 329 ILE n 
1 330 LYS n 
1 331 LYS n 
1 332 GLN n 
1 333 ILE n 
1 334 LYS n 
1 335 GLU n 
1 336 ARG n 
1 337 ASP n 
1 338 SER n 
1 339 ASN n 
1 340 TYR n 
1 341 LYS n 
1 342 ALA n 
1 343 ILE n 
1 344 ILE n 
1 345 PHE n 
1 346 ALA n 
1 347 PRO n 
1 348 THR n 
1 349 VAL n 
1 350 LYS n 
1 351 PHE n 
1 352 THR n 
1 353 SER n 
1 354 PHE n 
1 355 LEU n 
1 356 CYS n 
1 357 SER n 
1 358 ILE n 
1 359 LEU n 
1 360 LYS n 
1 361 ASN n 
1 362 GLU n 
1 363 PHE n 
1 364 LYS n 
1 365 LYS n 
1 366 ASP n 
1 367 LEU n 
1 368 PRO n 
1 369 ILE n 
1 370 LEU n 
1 371 GLU n 
1 372 PHE n 
1 373 HIS n 
1 374 GLY n 
1 375 LYS n 
1 376 ILE n 
1 377 THR n 
1 378 GLN n 
1 379 ASN n 
1 380 LYS n 
1 381 ARG n 
1 382 THR n 
1 383 SER n 
1 384 LEU n 
1 385 VAL n 
1 386 LYS n 
1 387 ARG n 
1 388 PHE n 
1 389 LYS n 
1 390 LYS n 
1 391 ASP n 
1 392 GLU n 
1 393 SER n 
1 394 GLY n 
1 395 ILE n 
1 396 LEU n 
1 397 VAL n 
1 398 CYS n 
1 399 THR n 
1 400 ASP n 
1 401 VAL n 
1 402 GLY n 
1 403 ALA n 
1 404 ARG n 
1 405 GLY n 
1 406 MET n 
1 407 ASP n 
1 408 PHE n 
1 409 PRO n 
1 410 ASN n 
1 411 VAL n 
1 412 HIS n 
1 413 GLU n 
1 414 VAL n 
1 415 LEU n 
1 416 GLN n 
1 417 ILE n 
1 418 GLY n 
1 419 VAL n 
1 420 PRO n 
1 421 SER n 
1 422 GLU n 
1 423 LEU n 
1 424 ALA n 
1 425 ASN n 
1 426 TYR n 
1 427 ILE n 
1 428 HIS n 
1 429 ARG n 
1 430 ILE n 
1 431 GLY n 
1 432 ARG n 
1 433 THR n 
1 434 ALA n 
1 435 ARG n 
1 436 SER n 
1 437 GLY n 
1 438 LYS n 
1 439 GLU n 
1 440 GLY n 
1 441 SER n 
1 442 SER n 
1 443 VAL n 
1 444 LEU n 
1 445 PHE n 
1 446 ILE n 
1 447 CYS n 
1 448 LYS n 
1 449 ASP n 
1 450 GLU n 
1 451 LEU n 
1 452 PRO n 
1 453 PHE n 
1 454 VAL n 
1 455 ARG n 
1 456 GLU n 
1 457 LEU n 
1 458 GLU n 
1 459 ASP n 
1 460 ALA n 
1 461 LYS n 
1 462 ASN n 
1 463 ILE n 
1 464 VAL n 
1 465 ILE n 
1 466 ALA n 
1 467 LYS n 
1 468 GLN n 
1 469 GLU n 
1 470 LYS n 
1 471 TYR n 
1 472 GLU n 
1 473 PRO n 
1 474 SER n 
1 475 GLU n 
1 476 GLU n 
1 477 ILE n 
1 478 LYS n 
1 479 SER n 
1 480 GLU n 
1 481 VAL n 
1 482 LEU n 
1 483 GLU n 
1 484 ALA n 
1 485 VAL n 
1 486 THR n 
1 487 GLU n 
1 488 GLU n 
1 489 PRO n 
1 490 GLU n 
1 491 ASP n 
1 492 ILE n 
1 493 SER n 
1 494 ASP n 
1 495 ILE n 
1 496 VAL n 
1 497 ILE n 
1 498 SER n 
1 499 LEU n 
1 500 ILE n 
1 501 SER n 
1 502 SER n 
1 503 TYR n 
1 504 ARG n 
1 505 SER n 
1 506 CYS n 
1 507 ILE n 
1 508 LYS n 
1 509 GLU n 
1 510 TYR n 
1 511 ARG n 
1 512 PHE n 
1 513 SER n 
1 514 GLU n 
1 515 ARG n 
1 516 ARG n 
1 517 ILE n 
1 518 LEU n 
1 519 PRO n 
1 520 GLU n 
1 521 ILE n 
1 522 ALA n 
1 523 SER n 
1 524 THR n 
1 525 TYR n 
1 526 GLY n 
1 527 VAL n 
1 528 LEU n 
1 529 LEU n 
1 530 ASN n 
1 531 ASP n 
1 532 PRO n 
1 533 GLN n 
1 534 LEU n 
1 535 LYS n 
1 536 ILE n 
1 537 PRO n 
1 538 VAL n 
1 539 SER n 
1 540 ARG n 
1 541 ARG n 
1 542 PHE n 
1 543 LEU n 
1 544 ASP n 
1 545 LYS n 
1 546 LEU n 
1 547 GLY n 
1 548 LEU n 
1 549 SER n 
1 550 ARG n 
1 551 SER n 
1 552 PRO n 
1 553 ILE n 
1 554 GLY n 
1 555 LYS n 
1 556 ALA n 
1 557 MET n 
1 558 PHE n 
1 559 GLU n 
1 560 ILE n 
1 561 ARG n 
1 562 ASP n 
1 563 TYR n 
2 1   U   n 
2 2   U   n 
2 3   U   n 
2 4   5BU n 
2 5   U   n 
2 6   U   n 
2 7   U   n 
2 8   U   n 
2 9   U   n 
2 10  U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               yeast 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MSS116, YD9346.05C, YDR194C' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosetta2 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMAL 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'RNA fragment commercially available' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP MS116_YEAST P15424 1 
;LYNDGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDNSKEVTLDSLLEEGVLDKE
IHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQI
EAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIG
FRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSI
FAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVG
ARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVL
EAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Y
;
37 ? 
2 PDB 3I5Y        3I5Y   2 UUUUUUUUUU 1  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I5Y A 3 ? 563 ? P15424 37 ? 597 ? 37 597 
2 2 3I5Y B 1 ? 10  ? 3I5Y   1  ? 10  ? 1  10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I5Y GLY A 1 ? UNP P15424 ? ? 'EXPRESSION TAG' 35 1 
1 3I5Y SER A 2 ? UNP P15424 ? ? 'EXPRESSION TAG' 36 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5BU 'RNA linking'       n "5-BROMO-URIDINE-5'-MONOPHOSPHATE"            ? 'C9 H12 Br N2 O9 P' 403.077 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                    ? 'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3I5Y 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.30 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '8% tacsimate, 15% PEG 3350, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2008-10-16 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91842 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.91842 
# 
_reflns.entry_id                     3I5Y 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             35 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   21524 
_reflns.number_all                   21524 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            0.098 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.56 
_reflns_shell.percent_possible_all   75.5 
_reflns_shell.Rmerge_I_obs           0.426 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3I5Y 
_refine.ls_number_reflns_obs                     20426 
_refine.ls_number_reflns_all                     21483 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.88 
_refine.ls_d_res_high                            2.49 
_refine.ls_percent_reflns_obs                    94.43 
_refine.ls_R_factor_obs                          0.20573 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20386 
_refine.ls_R_factor_R_free                       0.24206 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1057 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.916 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 3I5X' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             TLS 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.603 
_refine.pdbx_overall_ESU_R_Free                  0.287 
_refine.overall_SU_ML                            0.195 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3979 
_refine_hist.pdbx_number_atoms_nucleic_acid   191 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             85 
_refine_hist.number_atoms_total               4287 
_refine_hist.d_res_high                       2.49 
_refine_hist.d_res_low                        34.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.022  ? 4287 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 2885 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.073  2.043  ? 5836 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.809  3.000  ? 7094 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.588  5.000  ? 508  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.392 24.678 ? 171  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.347 15.000 ? 756  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.255 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 4522 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 803  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.494 
_refine_ls_shell.d_res_low                        2.559 
_refine_ls_shell.number_reflns_R_work             1204 
_refine_ls_shell.R_factor_R_work                  0.277 
_refine_ls_shell.percent_reflns_obs               75.60 
_refine_ls_shell.R_factor_R_free                  0.328 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3I5Y 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3I5Y 
_struct.title                     'Structure of Mss116p bound to ssRNA containing a single 5-BrU and AMP-PNP' 
_struct.pdbx_descriptor           'ATP-dependent RNA helicase MSS116 (E.C.3.6.1.-)/RNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I5Y 
_struct_keywords.pdbx_keywords   Hydrolase/RNA 
_struct_keywords.text            
;Protein-RNA complex, RNA helicase, DEAD-box, ATP-binding, Helicase, Hydrolase, Mitochondrion, mRNA processing, mRNA splicing, Nucleotide-binding, RNA-binding, Transit peptide, Translation regulation, Hydrolase-RNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 69  ? GLU A 76  ? THR A 103 GLU A 110 1 ? 8  
HELX_P HELX_P2  2  ASP A 80  ? ARG A 89  ? ASP A 114 ARG A 123 1 ? 10 
HELX_P HELX_P3  3  THR A 96  ? SER A 108 ? THR A 130 SER A 142 1 ? 13 
HELX_P HELX_P4  4  GLY A 123 ? THR A 139 ? GLY A 157 THR A 173 1 ? 17 
HELX_P HELX_P5  5  THR A 155 ? MET A 172 ? THR A 189 MET A 206 1 ? 18 
HELX_P HELX_P6  6  ASN A 173 ? TYR A 179 ? ASN A 207 TYR A 213 5 ? 7  
HELX_P HELX_P7  7  ASP A 189 ? ARG A 201 ? ASP A 223 ARG A 235 1 ? 13 
HELX_P HELX_P8  8  THR A 208 ? PHE A 224 ? THR A 242 PHE A 258 1 ? 17 
HELX_P HELX_P9  9  GLU A 234 ? LEU A 239 ? GLU A 268 LEU A 273 1 ? 6  
HELX_P HELX_P10 10 PHE A 243 ? ASN A 258 ? PHE A 277 ASN A 292 1 ? 16 
HELX_P HELX_P11 11 ASP A 276 ? ALA A 282 ? ASP A 310 ALA A 316 1 ? 7  
HELX_P HELX_P12 12 ASN A 283 ? MET A 286 ? ASN A 317 MET A 320 5 ? 4  
HELX_P HELX_P13 13 ALA A 319 ? ARG A 336 ? ALA A 353 ARG A 370 1 ? 18 
HELX_P HELX_P14 14 THR A 348 ? LYS A 364 ? THR A 382 LYS A 398 1 ? 17 
HELX_P HELX_P15 15 THR A 377 ? ASP A 391 ? THR A 411 ASP A 425 1 ? 15 
HELX_P HELX_P16 16 ASP A 400 ? ALA A 403 ? ASP A 434 ALA A 437 5 ? 4  
HELX_P HELX_P17 17 LEU A 423 ? GLY A 431 ? LEU A 457 GLY A 465 1 ? 9  
HELX_P HELX_P18 18 GLU A 450 ? ASN A 462 ? GLU A 484 ASN A 496 1 ? 13 
HELX_P HELX_P19 19 SER A 474 ? VAL A 485 ? SER A 508 VAL A 519 1 ? 12 
HELX_P HELX_P20 20 GLU A 488 ? CYS A 506 ? GLU A 522 CYS A 540 1 ? 19 
HELX_P HELX_P21 21 SER A 513 ? SER A 523 ? SER A 547 SER A 557 1 ? 11 
HELX_P HELX_P22 22 SER A 523 ? LEU A 529 ? SER A 557 LEU A 563 1 ? 7  
HELX_P HELX_P23 23 SER A 539 ? GLY A 547 ? SER A 573 GLY A 581 1 ? 9  
HELX_P HELX_P24 24 SER A 551 ? MET A 557 ? SER A 585 MET A 591 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B U   3 "O3'" ? ? ? 1_555 B 5BU 4 P  ? ? B U   3    B 5BU 4    1_555 ? ? ? ? ? ? ? 1.592 ? 
covale2 covale ? ? B 5BU 4 "O3'" ? ? ? 1_555 B U   5 P  ? ? B 5BU 4    B U   5    1_555 ? ? ? ? ? ? ? 1.585 ? 
metalc1 metalc ? ? C ANP . O3G   ? ? ? 1_555 D MG  . MG ? ? A ANP 1000 A MG  900  1_555 ? ? ? ? ? ? ? 1.925 ? 
metalc2 metalc ? ? C ANP . O1B   ? ? ? 1_555 D MG  . MG ? ? A ANP 1000 A MG  900  1_555 ? ? ? ? ? ? ? 1.834 ? 
metalc3 metalc ? ? D MG  . MG    ? ? ? 1_555 E HOH . O  ? ? A MG  900  A HOH 1048 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc4 metalc ? ? D MG  . MG    ? ? ? 1_555 E HOH . O  ? ? A MG  900  A HOH 1045 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc5 metalc ? ? D MG  . MG    ? ? ? 1_555 E HOH . O  ? ? A MG  900  A HOH 1074 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc6 metalc ? ? D MG  . MG    ? ? ? 1_555 E HOH . O  ? ? A MG  900  A HOH 1008 1_555 ? ? ? ? ? ? ? 2.157 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
C 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 55  ? VAL A 59  ? LYS A 89  VAL A 93  
A 2 GLU A 290 ? ASP A 295 ? GLU A 324 ASP A 329 
A 3 HIS A 112 ? ARG A 117 ? HIS A 146 ARG A 151 
A 4 LYS A 266 ? SER A 271 ? LYS A 300 SER A 305 
A 5 TYR A 229 ? ASP A 233 ? TYR A 263 ASP A 267 
A 6 ALA A 149 ? VAL A 152 ? ALA A 183 VAL A 186 
A 7 ILE A 204 ? ALA A 207 ? ILE A 238 ALA A 241 
A 8 CYS A 181 ? LEU A 184 ? CYS A 215 LEU A 218 
B 1 ILE A 369 ? PHE A 372 ? ILE A 403 PHE A 406 
B 2 GLY A 394 ? CYS A 398 ? GLY A 428 CYS A 432 
B 3 LYS A 341 ? PHE A 345 ? LYS A 375 PHE A 379 
B 4 GLU A 413 ? ILE A 417 ? GLU A 447 ILE A 451 
B 5 GLY A 440 ? CYS A 447 ? GLY A 474 CYS A 481 
B 6 ILE A 308 ? SER A 315 ? ILE A 342 SER A 349 
B 7 LYS A 467 ? TYR A 471 ? LYS A 501 TYR A 505 
C 1 ILE A 536 ? VAL A 538 ? ILE A 570 VAL A 572 
C 2 PHE A 558 ? ILE A 560 ? PHE A 592 ILE A 594 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 57  ? N ILE A 91  O PHE A 293 ? O PHE A 327 
A 2 3 O LEU A 294 ? O LEU A 328 N ILE A 115 ? N ILE A 149 
A 3 4 N VAL A 114 ? N VAL A 148 O LEU A 269 ? O LEU A 303 
A 4 5 O LEU A 268 ? O LEU A 302 N LEU A 232 ? N LEU A 266 
A 5 6 O VAL A 231 ? O VAL A 265 N VAL A 152 ? N VAL A 186 
A 6 7 N ILE A 151 ? N ILE A 185 O ALA A 207 ? O ALA A 241 
A 7 8 O ILE A 206 ? O ILE A 240 N LEU A 184 ? N LEU A 218 
B 1 2 N LEU A 370 ? N LEU A 404 O VAL A 397 ? O VAL A 431 
B 2 3 O LEU A 396 ? O LEU A 430 N ILE A 344 ? N ILE A 378 
B 3 4 N ILE A 343 ? N ILE A 377 O LEU A 415 ? O LEU A 449 
B 4 5 N GLN A 416 ? N GLN A 450 O PHE A 445 ? O PHE A 479 
B 5 6 O ILE A 446 ? O ILE A 480 N SER A 315 ? N SER A 349 
B 6 7 N ILE A 314 ? N ILE A 348 O GLU A 469 ? O GLU A 503 
C 1 2 N VAL A 538 ? N VAL A 572 O GLU A 559 ? O GLU A 593 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE ANP A 1000' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 900'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 28 PHE A 92  ? PHE A 126  . ? 1_555 ? 
2  AC1 28 GLY A 94  ? GLY A 128  . ? 1_555 ? 
3  AC1 28 LEU A 95  ? LEU A 129  . ? 1_555 ? 
4  AC1 28 THR A 96  ? THR A 130  . ? 1_555 ? 
5  AC1 28 GLN A 99  ? GLN A 133  . ? 1_555 ? 
6  AC1 28 LYS A 119 ? LYS A 153  . ? 1_555 ? 
7  AC1 28 THR A 120 ? THR A 154  . ? 1_555 ? 
8  AC1 28 GLY A 121 ? GLY A 155  . ? 1_555 ? 
9  AC1 28 THR A 122 ? THR A 156  . ? 1_555 ? 
10 AC1 28 GLY A 123 ? GLY A 157  . ? 1_555 ? 
11 AC1 28 LYS A 124 ? LYS A 158  . ? 1_555 ? 
12 AC1 28 THR A 125 ? THR A 159  . ? 1_555 ? 
13 AC1 28 PHE A 126 ? PHE A 160  . ? 1_555 ? 
14 AC1 28 GLU A 234 ? GLU A 268  . ? 1_555 ? 
15 AC1 28 GLY A 405 ? GLY A 439  . ? 1_555 ? 
16 AC1 28 ASP A 407 ? ASP A 441  . ? 1_555 ? 
17 AC1 28 ARG A 432 ? ARG A 466  . ? 1_555 ? 
18 AC1 28 ARG A 435 ? ARG A 469  . ? 1_555 ? 
19 AC1 28 SER A 436 ? SER A 470  . ? 1_555 ? 
20 AC1 28 MG  D .   ? MG  A 900  . ? 1_555 ? 
21 AC1 28 HOH E .   ? HOH A 1008 . ? 1_555 ? 
22 AC1 28 HOH E .   ? HOH A 1010 . ? 1_555 ? 
23 AC1 28 HOH E .   ? HOH A 1045 . ? 1_555 ? 
24 AC1 28 HOH E .   ? HOH A 1048 . ? 1_555 ? 
25 AC1 28 HOH E .   ? HOH A 1073 . ? 1_555 ? 
26 AC1 28 HOH E .   ? HOH A 1074 . ? 1_555 ? 
27 AC1 28 HOH E .   ? HOH A 1075 . ? 1_555 ? 
28 AC1 28 HOH E .   ? HOH A 1080 . ? 1_555 ? 
29 AC2 5  ANP C .   ? ANP A 1000 . ? 1_555 ? 
30 AC2 5  HOH E .   ? HOH A 1008 . ? 1_555 ? 
31 AC2 5  HOH E .   ? HOH A 1045 . ? 1_555 ? 
32 AC2 5  HOH E .   ? HOH A 1048 . ? 1_555 ? 
33 AC2 5  HOH E .   ? HOH A 1074 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3I5Y 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I5Y 
_atom_sites.fract_transf_matrix[1][1]   0.011212 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007914 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017860 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 54  ? 96.829  32.990  24.964  1.00 42.77 ? 88   SER A N     1 
ATOM   2    C  CA    . SER A 1 54  ? 96.606  34.376  25.473  1.00 42.91 ? 88   SER A CA    1 
ATOM   3    C  C     . SER A 1 54  ? 95.555  34.405  26.591  1.00 42.93 ? 88   SER A C     1 
ATOM   4    O  O     . SER A 1 54  ? 94.983  33.370  26.948  1.00 43.09 ? 88   SER A O     1 
ATOM   5    C  CB    . SER A 1 54  ? 96.194  35.302  24.325  1.00 42.87 ? 88   SER A CB    1 
ATOM   6    O  OG    . SER A 1 54  ? 94.828  35.143  23.998  1.00 42.86 ? 88   SER A OG    1 
ATOM   7    N  N     . LYS A 1 55  ? 95.298  35.593  27.133  1.00 42.80 ? 89   LYS A N     1 
ATOM   8    C  CA    . LYS A 1 55  ? 94.453  35.731  28.320  1.00 42.81 ? 89   LYS A CA    1 
ATOM   9    C  C     . LYS A 1 55  ? 92.970  35.576  27.987  1.00 42.70 ? 89   LYS A C     1 
ATOM   10   O  O     . LYS A 1 55  ? 92.457  36.235  27.081  1.00 42.68 ? 89   LYS A O     1 
ATOM   11   C  CB    . LYS A 1 55  ? 94.701  37.083  29.006  1.00 42.89 ? 89   LYS A CB    1 
ATOM   12   C  CG    . LYS A 1 55  ? 94.196  37.164  30.453  1.00 43.00 ? 89   LYS A CG    1 
ATOM   13   C  CD    . LYS A 1 55  ? 94.315  38.581  31.014  1.00 42.96 ? 89   LYS A CD    1 
ATOM   14   C  CE    . LYS A 1 55  ? 93.612  38.723  32.356  1.00 42.80 ? 89   LYS A CE    1 
ATOM   15   N  NZ    . LYS A 1 55  ? 93.377  40.152  32.700  1.00 42.77 ? 89   LYS A NZ    1 
ATOM   16   N  N     . LEU A 1 56  ? 92.295  34.711  28.744  1.00 42.56 ? 90   LEU A N     1 
ATOM   17   C  CA    . LEU A 1 56  ? 90.874  34.431  28.562  1.00 42.46 ? 90   LEU A CA    1 
ATOM   18   C  C     . LEU A 1 56  ? 90.075  34.947  29.762  1.00 42.36 ? 90   LEU A C     1 
ATOM   19   O  O     . LEU A 1 56  ? 90.182  34.408  30.863  1.00 42.38 ? 90   LEU A O     1 
ATOM   20   C  CB    . LEU A 1 56  ? 90.673  32.924  28.396  1.00 42.52 ? 90   LEU A CB    1 
ATOM   21   C  CG    . LEU A 1 56  ? 89.268  32.406  28.089  1.00 42.52 ? 90   LEU A CG    1 
ATOM   22   C  CD1   . LEU A 1 56  ? 88.765  32.954  26.770  1.00 42.47 ? 90   LEU A CD1   1 
ATOM   23   C  CD2   . LEU A 1 56  ? 89.285  30.886  28.067  1.00 42.84 ? 90   LEU A CD2   1 
ATOM   24   N  N     . ILE A 1 57  ? 89.278  35.991  29.542  1.00 42.28 ? 91   ILE A N     1 
ATOM   25   C  CA    . ILE A 1 57  ? 88.485  36.613  30.603  1.00 42.13 ? 91   ILE A CA    1 
ATOM   26   C  C     . ILE A 1 57  ? 87.075  36.023  30.633  1.00 42.17 ? 91   ILE A C     1 
ATOM   27   O  O     . ILE A 1 57  ? 86.263  36.294  29.747  1.00 42.14 ? 91   ILE A O     1 
ATOM   28   C  CB    . ILE A 1 57  ? 88.381  38.146  30.412  1.00 42.06 ? 91   ILE A CB    1 
ATOM   29   C  CG1   . ILE A 1 57  ? 89.768  38.778  30.295  1.00 41.93 ? 91   ILE A CG1   1 
ATOM   30   C  CG2   . ILE A 1 57  ? 87.627  38.782  31.573  1.00 41.88 ? 91   ILE A CG2   1 
ATOM   31   C  CD1   . ILE A 1 57  ? 89.725  40.259  29.968  1.00 41.86 ? 91   ILE A CD1   1 
ATOM   32   N  N     . HIS A 1 58  ? 86.789  35.219  31.654  1.00 42.30 ? 92   HIS A N     1 
ATOM   33   C  CA    . HIS A 1 58  ? 85.443  34.672  31.857  1.00 42.42 ? 92   HIS A CA    1 
ATOM   34   C  C     . HIS A 1 58  ? 84.455  35.758  32.263  1.00 42.15 ? 92   HIS A C     1 
ATOM   35   O  O     . HIS A 1 58  ? 84.733  36.544  33.165  1.00 42.26 ? 92   HIS A O     1 
ATOM   36   C  CB    . HIS A 1 58  ? 85.447  33.598  32.946  1.00 42.51 ? 92   HIS A CB    1 
ATOM   37   C  CG    . HIS A 1 58  ? 85.819  32.236  32.454  1.00 43.37 ? 92   HIS A CG    1 
ATOM   38   N  ND1   . HIS A 1 58  ? 84.879  31.264  32.181  1.00 44.26 ? 92   HIS A ND1   1 
ATOM   39   C  CD2   . HIS A 1 58  ? 87.025  31.679  32.194  1.00 44.06 ? 92   HIS A CD2   1 
ATOM   40   C  CE1   . HIS A 1 58  ? 85.492  30.167  31.773  1.00 44.71 ? 92   HIS A CE1   1 
ATOM   41   N  NE2   . HIS A 1 58  ? 86.795  30.392  31.771  1.00 44.63 ? 92   HIS A NE2   1 
ATOM   42   N  N     . VAL A 1 59  ? 83.307  35.790  31.594  1.00 41.79 ? 93   VAL A N     1 
ATOM   43   C  CA    . VAL A 1 59  ? 82.186  36.628  32.008  1.00 41.59 ? 93   VAL A CA    1 
ATOM   44   C  C     . VAL A 1 59  ? 80.952  35.720  32.122  1.00 41.60 ? 93   VAL A C     1 
ATOM   45   O  O     . VAL A 1 59  ? 80.155  35.613  31.185  1.00 41.33 ? 93   VAL A O     1 
ATOM   46   C  CB    . VAL A 1 59  ? 81.953  37.800  31.027  1.00 41.56 ? 93   VAL A CB    1 
ATOM   47   C  CG1   . VAL A 1 59  ? 80.741  38.621  31.439  1.00 41.28 ? 93   VAL A CG1   1 
ATOM   48   C  CG2   . VAL A 1 59  ? 83.187  38.689  30.961  1.00 41.26 ? 93   VAL A CG2   1 
ATOM   49   N  N     . PRO A 1 60  ? 80.802  35.045  33.278  1.00 41.58 ? 94   PRO A N     1 
ATOM   50   C  CA    . PRO A 1 60  ? 79.729  34.069  33.460  1.00 41.56 ? 94   PRO A CA    1 
ATOM   51   C  C     . PRO A 1 60  ? 78.340  34.690  33.639  1.00 41.55 ? 94   PRO A C     1 
ATOM   52   O  O     . PRO A 1 60  ? 78.197  35.912  33.718  1.00 41.48 ? 94   PRO A O     1 
ATOM   53   C  CB    . PRO A 1 60  ? 80.158  33.310  34.718  1.00 41.53 ? 94   PRO A CB    1 
ATOM   54   C  CG    . PRO A 1 60  ? 80.974  34.269  35.480  1.00 41.65 ? 94   PRO A CG    1 
ATOM   55   C  CD    . PRO A 1 60  ? 81.651  35.157  34.477  1.00 41.56 ? 94   PRO A CD    1 
ATOM   56   N  N     . LYS A 1 61  ? 77.331  33.827  33.700  1.00 41.60 ? 95   LYS A N     1 
ATOM   57   C  CA    . LYS A 1 61  ? 75.934  34.247  33.712  1.00 41.66 ? 95   LYS A CA    1 
ATOM   58   C  C     . LYS A 1 61  ? 75.567  34.967  35.017  1.00 41.65 ? 95   LYS A C     1 
ATOM   59   O  O     . LYS A 1 61  ? 75.792  34.444  36.117  1.00 41.68 ? 95   LYS A O     1 
ATOM   60   C  CB    . LYS A 1 61  ? 75.035  33.020  33.502  1.00 41.67 ? 95   LYS A CB    1 
ATOM   61   C  CG    . LYS A 1 61  ? 73.575  33.321  33.180  1.00 41.80 ? 95   LYS A CG    1 
ATOM   62   C  CD    . LYS A 1 61  ? 72.744  32.046  33.243  1.00 41.81 ? 95   LYS A CD    1 
ATOM   63   C  CE    . LYS A 1 61  ? 71.270  32.305  32.993  1.00 41.87 ? 95   LYS A CE    1 
ATOM   64   N  NZ    . LYS A 1 61  ? 70.486  31.038  33.021  1.00 41.83 ? 95   LYS A NZ    1 
ATOM   65   N  N     . GLU A 1 62  ? 75.019  36.175  34.881  1.00 41.60 ? 96   GLU A N     1 
ATOM   66   C  CA    . GLU A 1 62  ? 74.484  36.934  36.014  1.00 41.63 ? 96   GLU A CA    1 
ATOM   67   C  C     . GLU A 1 62  ? 72.957  36.938  35.919  1.00 41.52 ? 96   GLU A C     1 
ATOM   68   O  O     . GLU A 1 62  ? 72.405  37.096  34.826  1.00 41.35 ? 96   GLU A O     1 
ATOM   69   C  CB    . GLU A 1 62  ? 75.028  38.367  36.006  1.00 41.65 ? 96   GLU A CB    1 
ATOM   70   N  N     . ASP A 1 63  ? 72.282  36.761  37.058  1.00 41.30 ? 97   ASP A N     1 
ATOM   71   C  CA    . ASP A 1 63  ? 70.815  36.627  37.093  1.00 41.19 ? 97   ASP A CA    1 
ATOM   72   C  C     . ASP A 1 63  ? 70.082  37.855  37.662  1.00 41.09 ? 97   ASP A C     1 
ATOM   73   O  O     . ASP A 1 63  ? 68.860  37.824  37.829  1.00 41.01 ? 97   ASP A O     1 
ATOM   74   C  CB    . ASP A 1 63  ? 70.426  35.380  37.897  1.00 41.09 ? 97   ASP A CB    1 
ATOM   75   N  N     . ASN A 1 64  ? 70.824  38.923  37.959  1.00 40.96 ? 98   ASN A N     1 
ATOM   76   C  CA    . ASN A 1 64  ? 70.242  40.159  38.507  1.00 40.82 ? 98   ASN A CA    1 
ATOM   77   C  C     . ASN A 1 64  ? 70.693  41.444  37.791  1.00 40.59 ? 98   ASN A C     1 
ATOM   78   O  O     . ASN A 1 64  ? 70.365  42.549  38.235  1.00 40.66 ? 98   ASN A O     1 
ATOM   79   C  CB    . ASN A 1 64  ? 70.565  40.266  40.003  1.00 40.74 ? 98   ASN A CB    1 
ATOM   80   N  N     . SER A 1 65  ? 71.426  41.303  36.687  1.00 40.21 ? 99   SER A N     1 
ATOM   81   C  CA    . SER A 1 65  ? 71.961  42.454  35.951  1.00 39.89 ? 99   SER A CA    1 
ATOM   82   C  C     . SER A 1 65  ? 70.870  43.200  35.168  1.00 39.53 ? 99   SER A C     1 
ATOM   83   O  O     . SER A 1 65  ? 69.782  42.664  34.940  1.00 39.46 ? 99   SER A O     1 
ATOM   84   C  CB    . SER A 1 65  ? 73.098  42.008  35.023  1.00 39.89 ? 99   SER A CB    1 
ATOM   85   O  OG    . SER A 1 65  ? 72.991  40.629  34.718  1.00 39.80 ? 99   SER A OG    1 
ATOM   86   N  N     . LYS A 1 66  ? 71.176  44.436  34.768  1.00 39.03 ? 100  LYS A N     1 
ATOM   87   C  CA    . LYS A 1 66  ? 70.177  45.351  34.195  1.00 38.58 ? 100  LYS A CA    1 
ATOM   88   C  C     . LYS A 1 66  ? 69.891  45.048  32.722  1.00 38.02 ? 100  LYS A C     1 
ATOM   89   O  O     . LYS A 1 66  ? 70.813  44.916  31.921  1.00 37.90 ? 100  LYS A O     1 
ATOM   90   C  CB    . LYS A 1 66  ? 70.629  46.809  34.355  1.00 38.50 ? 100  LYS A CB    1 
ATOM   91   N  N     . GLU A 1 67  ? 68.605  44.959  32.382  1.00 37.42 ? 101  GLU A N     1 
ATOM   92   C  CA    . GLU A 1 67  ? 68.165  44.585  31.038  1.00 36.99 ? 101  GLU A CA    1 
ATOM   93   C  C     . GLU A 1 67  ? 68.588  45.625  29.998  1.00 36.29 ? 101  GLU A C     1 
ATOM   94   O  O     . GLU A 1 67  ? 68.091  46.749  30.004  1.00 36.25 ? 101  GLU A O     1 
ATOM   95   C  CB    . GLU A 1 67  ? 66.636  44.405  31.000  1.00 37.04 ? 101  GLU A CB    1 
ATOM   96   C  CG    . GLU A 1 67  ? 66.108  43.753  29.705  1.00 37.49 ? 101  GLU A CG    1 
ATOM   97   C  CD    . GLU A 1 67  ? 64.687  44.176  29.319  1.00 37.92 ? 101  GLU A CD    1 
ATOM   98   O  OE1   . GLU A 1 67  ? 64.170  45.172  29.866  1.00 38.56 ? 101  GLU A OE1   1 
ATOM   99   O  OE2   . GLU A 1 67  ? 64.086  43.510  28.445  1.00 37.86 ? 101  GLU A OE2   1 
ATOM   100  N  N     . VAL A 1 68  ? 69.505  45.239  29.109  1.00 35.48 ? 102  VAL A N     1 
ATOM   101  C  CA    . VAL A 1 68  ? 69.917  46.087  27.984  1.00 34.77 ? 102  VAL A CA    1 
ATOM   102  C  C     . VAL A 1 68  ? 68.845  46.043  26.893  1.00 34.16 ? 102  VAL A C     1 
ATOM   103  O  O     . VAL A 1 68  ? 68.147  45.042  26.741  1.00 34.03 ? 102  VAL A O     1 
ATOM   104  C  CB    . VAL A 1 68  ? 71.283  45.641  27.413  1.00 34.73 ? 102  VAL A CB    1 
ATOM   105  C  CG1   . VAL A 1 68  ? 71.734  46.558  26.285  1.00 34.33 ? 102  VAL A CG1   1 
ATOM   106  C  CG2   . VAL A 1 68  ? 72.326  45.607  28.518  1.00 34.94 ? 102  VAL A CG2   1 
ATOM   107  N  N     . THR A 1 69  ? 68.706  47.138  26.150  1.00 33.59 ? 103  THR A N     1 
ATOM   108  C  CA    . THR A 1 69  ? 67.647  47.271  25.149  1.00 33.18 ? 103  THR A CA    1 
ATOM   109  C  C     . THR A 1 69  ? 68.122  48.068  23.945  1.00 32.84 ? 103  THR A C     1 
ATOM   110  O  O     . THR A 1 69  ? 69.144  48.744  24.010  1.00 32.73 ? 103  THR A O     1 
ATOM   111  C  CB    . THR A 1 69  ? 66.422  48.009  25.732  1.00 33.19 ? 103  THR A CB    1 
ATOM   112  O  OG1   . THR A 1 69  ? 66.812  49.320  26.157  1.00 33.08 ? 103  THR A OG1   1 
ATOM   113  C  CG2   . THR A 1 69  ? 65.837  47.255  26.912  1.00 32.83 ? 103  THR A CG2   1 
ATOM   114  N  N     . LEU A 1 70  ? 67.364  47.991  22.855  1.00 32.74 ? 104  LEU A N     1 
ATOM   115  C  CA    . LEU A 1 70  ? 67.650  48.774  21.650  1.00 32.74 ? 104  LEU A CA    1 
ATOM   116  C  C     . LEU A 1 70  ? 67.651  50.273  21.966  1.00 32.82 ? 104  LEU A C     1 
ATOM   117  O  O     . LEU A 1 70  ? 68.594  50.986  21.612  1.00 32.67 ? 104  LEU A O     1 
ATOM   118  C  CB    . LEU A 1 70  ? 66.625  48.480  20.540  1.00 32.75 ? 104  LEU A CB    1 
ATOM   119  C  CG    . LEU A 1 70  ? 66.732  47.169  19.745  1.00 32.91 ? 104  LEU A CG    1 
ATOM   120  C  CD1   . LEU A 1 70  ? 65.486  46.955  18.886  1.00 32.53 ? 104  LEU A CD1   1 
ATOM   121  C  CD2   . LEU A 1 70  ? 67.990  47.140  18.875  1.00 32.64 ? 104  LEU A CD2   1 
ATOM   122  N  N     . ASP A 1 71  ? 66.591  50.740  22.632  1.00 32.85 ? 105  ASP A N     1 
ATOM   123  C  CA    . ASP A 1 71  ? 66.476  52.145  23.030  1.00 32.80 ? 105  ASP A CA    1 
ATOM   124  C  C     . ASP A 1 71  ? 67.703  52.578  23.838  1.00 32.74 ? 105  ASP A C     1 
ATOM   125  O  O     . ASP A 1 71  ? 68.352  53.573  23.500  1.00 32.77 ? 105  ASP A O     1 
ATOM   126  C  CB    . ASP A 1 71  ? 65.193  52.396  23.849  1.00 32.87 ? 105  ASP A CB    1 
ATOM   127  C  CG    . ASP A 1 71  ? 63.911  52.380  22.996  1.00 33.02 ? 105  ASP A CG    1 
ATOM   128  O  OD1   . ASP A 1 71  ? 63.974  52.569  21.760  1.00 32.92 ? 105  ASP A OD1   1 
ATOM   129  O  OD2   . ASP A 1 71  ? 62.823  52.188  23.581  1.00 32.79 ? 105  ASP A OD2   1 
ATOM   130  N  N     . SER A 1 72  ? 68.035  51.825  24.887  1.00 32.52 ? 106  SER A N     1 
ATOM   131  C  CA    . SER A 1 72  ? 69.156  52.202  25.752  1.00 32.41 ? 106  SER A CA    1 
ATOM   132  C  C     . SER A 1 72  ? 70.467  52.251  24.970  1.00 32.34 ? 106  SER A C     1 
ATOM   133  O  O     . SER A 1 72  ? 71.236  53.196  25.127  1.00 32.42 ? 106  SER A O     1 
ATOM   134  C  CB    . SER A 1 72  ? 69.276  51.282  26.974  1.00 32.24 ? 106  SER A CB    1 
ATOM   135  O  OG    . SER A 1 72  ? 69.663  49.974  26.615  1.00 32.85 ? 106  SER A OG    1 
ATOM   136  N  N     . LEU A 1 73  ? 70.708  51.262  24.110  1.00 32.13 ? 107  LEU A N     1 
ATOM   137  C  CA    . LEU A 1 73  ? 71.928  51.258  23.296  1.00 32.02 ? 107  LEU A CA    1 
ATOM   138  C  C     . LEU A 1 73  ? 72.002  52.458  22.342  1.00 31.93 ? 107  LEU A C     1 
ATOM   139  O  O     . LEU A 1 73  ? 73.093  52.956  22.069  1.00 31.99 ? 107  LEU A O     1 
ATOM   140  C  CB    . LEU A 1 73  ? 72.079  49.945  22.513  1.00 32.01 ? 107  LEU A CB    1 
ATOM   141  C  CG    . LEU A 1 73  ? 72.444  48.684  23.309  1.00 31.95 ? 107  LEU A CG    1 
ATOM   142  C  CD1   . LEU A 1 73  ? 72.420  47.467  22.397  1.00 31.57 ? 107  LEU A CD1   1 
ATOM   143  C  CD2   . LEU A 1 73  ? 73.800  48.802  23.998  1.00 31.36 ? 107  LEU A CD2   1 
ATOM   144  N  N     . LEU A 1 74  ? 70.854  52.925  21.847  1.00 31.88 ? 108  LEU A N     1 
ATOM   145  C  CA    . LEU A 1 74  ? 70.814  54.104  20.965  1.00 31.80 ? 108  LEU A CA    1 
ATOM   146  C  C     . LEU A 1 74  ? 71.248  55.360  21.706  1.00 31.71 ? 108  LEU A C     1 
ATOM   147  O  O     . LEU A 1 74  ? 72.177  56.045  21.280  1.00 31.66 ? 108  LEU A O     1 
ATOM   148  C  CB    . LEU A 1 74  ? 69.409  54.320  20.375  1.00 31.77 ? 108  LEU A CB    1 
ATOM   149  C  CG    . LEU A 1 74  ? 69.185  55.528  19.445  1.00 31.48 ? 108  LEU A CG    1 
ATOM   150  C  CD1   . LEU A 1 74  ? 70.101  55.504  18.228  1.00 31.05 ? 108  LEU A CD1   1 
ATOM   151  C  CD2   . LEU A 1 74  ? 67.732  55.592  19.003  1.00 31.18 ? 108  LEU A CD2   1 
ATOM   152  N  N     . GLU A 1 75  ? 70.572  55.645  22.816  1.00 31.71 ? 109  GLU A N     1 
ATOM   153  C  CA    . GLU A 1 75  ? 70.834  56.855  23.608  1.00 31.74 ? 109  GLU A CA    1 
ATOM   154  C  C     . GLU A 1 75  ? 72.241  56.835  24.209  1.00 31.63 ? 109  GLU A C     1 
ATOM   155  O  O     . GLU A 1 75  ? 72.857  57.887  24.386  1.00 31.70 ? 109  GLU A O     1 
ATOM   156  C  CB    . GLU A 1 75  ? 69.784  57.013  24.720  1.00 31.69 ? 109  GLU A CB    1 
ATOM   157  C  CG    . GLU A 1 75  ? 69.854  58.340  25.467  1.00 32.05 ? 109  GLU A CG    1 
ATOM   158  N  N     . GLU A 1 76  ? 72.737  55.634  24.503  1.00 31.44 ? 110  GLU A N     1 
ATOM   159  C  CA    . GLU A 1 76  ? 74.061  55.432  25.096  1.00 31.40 ? 110  GLU A CA    1 
ATOM   160  C  C     . GLU A 1 76  ? 75.221  55.684  24.110  1.00 31.10 ? 110  GLU A C     1 
ATOM   161  O  O     . GLU A 1 76  ? 76.355  55.905  24.537  1.00 31.20 ? 110  GLU A O     1 
ATOM   162  C  CB    . GLU A 1 76  ? 74.130  54.010  25.669  1.00 31.55 ? 110  GLU A CB    1 
ATOM   163  C  CG    . GLU A 1 76  ? 75.427  53.600  26.366  1.00 32.31 ? 110  GLU A CG    1 
ATOM   164  C  CD    . GLU A 1 76  ? 75.428  52.121  26.753  1.00 33.43 ? 110  GLU A CD    1 
ATOM   165  O  OE1   . GLU A 1 76  ? 76.496  51.601  27.150  1.00 33.74 ? 110  GLU A OE1   1 
ATOM   166  O  OE2   . GLU A 1 76  ? 74.358  51.475  26.655  1.00 34.29 ? 110  GLU A OE2   1 
ATOM   167  N  N     . GLY A 1 77  ? 74.943  55.650  22.806  1.00 30.74 ? 111  GLY A N     1 
ATOM   168  C  CA    . GLY A 1 77  ? 75.960  55.924  21.776  1.00 30.51 ? 111  GLY A CA    1 
ATOM   169  C  C     . GLY A 1 77  ? 76.550  54.709  21.062  1.00 30.34 ? 111  GLY A C     1 
ATOM   170  O  O     . GLY A 1 77  ? 77.369  54.862  20.156  1.00 30.29 ? 111  GLY A O     1 
ATOM   171  N  N     . VAL A 1 78  ? 76.138  53.507  21.460  1.00 30.10 ? 112  VAL A N     1 
ATOM   172  C  CA    . VAL A 1 78  ? 76.657  52.269  20.881  1.00 29.91 ? 112  VAL A CA    1 
ATOM   173  C  C     . VAL A 1 78  ? 76.020  51.972  19.519  1.00 30.05 ? 112  VAL A C     1 
ATOM   174  O  O     . VAL A 1 78  ? 76.720  51.639  18.553  1.00 29.86 ? 112  VAL A O     1 
ATOM   175  C  CB    . VAL A 1 78  ? 76.423  51.073  21.825  1.00 29.98 ? 112  VAL A CB    1 
ATOM   176  C  CG1   . VAL A 1 78  ? 76.840  49.764  21.155  1.00 29.10 ? 112  VAL A CG1   1 
ATOM   177  C  CG2   . VAL A 1 78  ? 77.177  51.289  23.139  1.00 29.28 ? 112  VAL A CG2   1 
ATOM   178  N  N     . LEU A 1 79  ? 74.697  52.099  19.451  1.00 29.91 ? 113  LEU A N     1 
ATOM   179  C  CA    . LEU A 1 79  ? 73.955  51.879  18.211  1.00 29.89 ? 113  LEU A CA    1 
ATOM   180  C  C     . LEU A 1 79  ? 73.564  53.200  17.543  1.00 30.08 ? 113  LEU A C     1 
ATOM   181  O  O     . LEU A 1 79  ? 73.167  54.153  18.205  1.00 30.02 ? 113  LEU A O     1 
ATOM   182  C  CB    . LEU A 1 79  ? 72.704  51.028  18.478  1.00 29.80 ? 113  LEU A CB    1 
ATOM   183  C  CG    . LEU A 1 79  ? 72.770  49.519  18.194  1.00 29.47 ? 113  LEU A CG    1 
ATOM   184  C  CD1   . LEU A 1 79  ? 74.110  48.894  18.547  1.00 28.67 ? 113  LEU A CD1   1 
ATOM   185  C  CD2   . LEU A 1 79  ? 71.647  48.808  18.924  1.00 29.51 ? 113  LEU A CD2   1 
ATOM   186  N  N     . ASP A 1 80  ? 73.680  53.231  16.221  1.00 30.45 ? 114  ASP A N     1 
ATOM   187  C  CA    . ASP A 1 80  ? 73.291  54.378  15.415  1.00 30.68 ? 114  ASP A CA    1 
ATOM   188  C  C     . ASP A 1 80  ? 71.792  54.299  15.131  1.00 30.77 ? 114  ASP A C     1 
ATOM   189  O  O     . ASP A 1 80  ? 71.199  53.223  15.198  1.00 30.88 ? 114  ASP A O     1 
ATOM   190  C  CB    . ASP A 1 80  ? 74.084  54.371  14.106  1.00 30.81 ? 114  ASP A CB    1 
ATOM   191  C  CG    . ASP A 1 80  ? 73.831  55.601  13.254  1.00 31.56 ? 114  ASP A CG    1 
ATOM   192  O  OD1   . ASP A 1 80  ? 74.464  56.656  13.517  1.00 31.65 ? 114  ASP A OD1   1 
ATOM   193  O  OD2   . ASP A 1 80  ? 73.001  55.500  12.319  1.00 32.13 ? 114  ASP A OD2   1 
ATOM   194  N  N     . LYS A 1 81  ? 71.181  55.439  14.816  1.00 30.98 ? 115  LYS A N     1 
ATOM   195  C  CA    . LYS A 1 81  ? 69.739  55.502  14.553  1.00 30.95 ? 115  LYS A CA    1 
ATOM   196  C  C     . LYS A 1 81  ? 69.292  54.522  13.461  1.00 30.80 ? 115  LYS A C     1 
ATOM   197  O  O     . LYS A 1 81  ? 68.235  53.919  13.587  1.00 30.55 ? 115  LYS A O     1 
ATOM   198  C  CB    . LYS A 1 81  ? 69.310  56.932  14.182  1.00 30.70 ? 115  LYS A CB    1 
ATOM   199  N  N     . GLU A 1 82  ? 70.094  54.358  12.407  1.00 30.89 ? 116  GLU A N     1 
ATOM   200  C  CA    . GLU A 1 82  ? 69.683  53.544  11.251  1.00 31.04 ? 116  GLU A CA    1 
ATOM   201  C  C     . GLU A 1 82  ? 69.619  52.027  11.539  1.00 30.84 ? 116  GLU A C     1 
ATOM   202  O  O     . GLU A 1 82  ? 68.776  51.325  10.971  1.00 30.54 ? 116  GLU A O     1 
ATOM   203  C  CB    . GLU A 1 82  ? 70.576  53.812  10.025  1.00 31.13 ? 116  GLU A CB    1 
ATOM   204  C  CG    . GLU A 1 82  ? 70.541  55.257  9.468   1.00 32.13 ? 116  GLU A CG    1 
ATOM   205  C  CD    . GLU A 1 82  ? 69.136  55.776  9.070   1.00 33.79 ? 116  GLU A CD    1 
ATOM   206  O  OE1   . GLU A 1 82  ? 68.407  55.107  8.298   1.00 33.85 ? 116  GLU A OE1   1 
ATOM   207  O  OE2   . GLU A 1 82  ? 68.773  56.891  9.518   1.00 35.16 ? 116  GLU A OE2   1 
ATOM   208  N  N     . ILE A 1 83  ? 70.487  51.524  12.414  1.00 30.61 ? 117  ILE A N     1 
ATOM   209  C  CA    . ILE A 1 83  ? 70.458  50.098  12.766  1.00 30.47 ? 117  ILE A CA    1 
ATOM   210  C  C     . ILE A 1 83  ? 69.388  49.831  13.833  1.00 30.24 ? 117  ILE A C     1 
ATOM   211  O  O     . ILE A 1 83  ? 68.719  48.803  13.796  1.00 30.44 ? 117  ILE A O     1 
ATOM   212  C  CB    . ILE A 1 83  ? 71.864  49.559  13.183  1.00 30.29 ? 117  ILE A CB    1 
ATOM   213  C  CG1   . ILE A 1 83  ? 71.858  48.032  13.290  1.00 30.63 ? 117  ILE A CG1   1 
ATOM   214  C  CG2   . ILE A 1 83  ? 72.321  50.160  14.496  1.00 30.79 ? 117  ILE A CG2   1 
ATOM   215  C  CD1   . ILE A 1 83  ? 71.488  47.318  12.017  1.00 30.33 ? 117  ILE A CD1   1 
ATOM   216  N  N     . HIS A 1 84  ? 69.217  50.767  14.764  1.00 30.07 ? 118  HIS A N     1 
ATOM   217  C  CA    . HIS A 1 84  ? 68.106  50.741  15.734  1.00 29.84 ? 118  HIS A CA    1 
ATOM   218  C  C     . HIS A 1 84  ? 66.742  50.685  15.034  1.00 29.77 ? 118  HIS A C     1 
ATOM   219  O  O     . HIS A 1 84  ? 65.807  50.023  15.494  1.00 29.89 ? 118  HIS A O     1 
ATOM   220  C  CB    . HIS A 1 84  ? 68.171  51.993  16.619  1.00 29.69 ? 118  HIS A CB    1 
ATOM   221  C  CG    . HIS A 1 84  ? 67.028  52.127  17.577  1.00 29.61 ? 118  HIS A CG    1 
ATOM   222  N  ND1   . HIS A 1 84  ? 65.810  52.664  17.218  1.00 30.20 ? 118  HIS A ND1   1 
ATOM   223  C  CD2   . HIS A 1 84  ? 66.927  51.813  18.890  1.00 29.25 ? 118  HIS A CD2   1 
ATOM   224  C  CE1   . HIS A 1 84  ? 65.002  52.660  18.264  1.00 29.71 ? 118  HIS A CE1   1 
ATOM   225  N  NE2   . HIS A 1 84  ? 65.655  52.147  19.291  1.00 29.46 ? 118  HIS A NE2   1 
ATOM   226  N  N     . LYS A 1 85  ? 66.643  51.409  13.928  1.00 29.57 ? 119  LYS A N     1 
ATOM   227  C  CA    . LYS A 1 85  ? 65.418  51.504  13.146  1.00 29.51 ? 119  LYS A CA    1 
ATOM   228  C  C     . LYS A 1 85  ? 65.082  50.162  12.500  1.00 29.15 ? 119  LYS A C     1 
ATOM   229  O  O     . LYS A 1 85  ? 63.929  49.750  12.474  1.00 29.31 ? 119  LYS A O     1 
ATOM   230  C  CB    . LYS A 1 85  ? 65.600  52.585  12.073  1.00 29.52 ? 119  LYS A CB    1 
ATOM   231  C  CG    . LYS A 1 85  ? 64.344  53.069  11.387  1.00 30.02 ? 119  LYS A CG    1 
ATOM   232  C  CD    . LYS A 1 85  ? 64.587  54.457  10.761  1.00 31.20 ? 119  LYS A CD    1 
ATOM   233  C  CE    . LYS A 1 85  ? 63.316  55.029  10.141  1.00 32.04 ? 119  LYS A CE    1 
ATOM   234  N  NZ    . LYS A 1 85  ? 63.259  56.523  10.135  1.00 31.83 ? 119  LYS A NZ    1 
ATOM   235  N  N     . ALA A 1 86  ? 66.102  49.485  11.988  1.00 28.98 ? 120  ALA A N     1 
ATOM   236  C  CA    . ALA A 1 86  ? 65.928  48.235  11.259  1.00 28.89 ? 120  ALA A CA    1 
ATOM   237  C  C     . ALA A 1 86  ? 65.490  47.069  12.150  1.00 28.77 ? 120  ALA A C     1 
ATOM   238  O  O     . ALA A 1 86  ? 64.721  46.214  11.705  1.00 28.72 ? 120  ALA A O     1 
ATOM   239  C  CB    . ALA A 1 86  ? 67.225  47.878  10.531  1.00 29.06 ? 120  ALA A CB    1 
ATOM   240  N  N     . ILE A 1 87  ? 65.988  47.041  13.390  1.00 28.58 ? 121  ILE A N     1 
ATOM   241  C  CA    . ILE A 1 87  ? 65.707  45.961  14.345  1.00 28.49 ? 121  ILE A CA    1 
ATOM   242  C  C     . ILE A 1 87  ? 64.418  46.215  15.128  1.00 28.73 ? 121  ILE A C     1 
ATOM   243  O  O     . ILE A 1 87  ? 63.706  45.271  15.479  1.00 28.93 ? 121  ILE A O     1 
ATOM   244  C  CB    . ILE A 1 87  ? 66.881  45.764  15.356  1.00 28.39 ? 121  ILE A CB    1 
ATOM   245  C  CG1   . ILE A 1 87  ? 68.207  45.521  14.629  1.00 28.26 ? 121  ILE A CG1   1 
ATOM   246  C  CG2   . ILE A 1 87  ? 66.610  44.602  16.292  1.00 27.83 ? 121  ILE A CG2   1 
ATOM   247  C  CD1   . ILE A 1 87  ? 68.204  44.311  13.704  1.00 28.27 ? 121  ILE A CD1   1 
ATOM   248  N  N     . THR A 1 88  ? 64.123  47.482  15.419  1.00 28.93 ? 122  THR A N     1 
ATOM   249  C  CA    . THR A 1 88  ? 62.869  47.845  16.086  1.00 28.89 ? 122  THR A CA    1 
ATOM   250  C  C     . THR A 1 88  ? 61.676  47.447  15.215  1.00 28.79 ? 122  THR A C     1 
ATOM   251  O  O     . THR A 1 88  ? 60.692  46.916  15.720  1.00 28.54 ? 122  THR A O     1 
ATOM   252  C  CB    . THR A 1 88  ? 62.818  49.359  16.445  1.00 28.94 ? 122  THR A CB    1 
ATOM   253  O  OG1   . THR A 1 88  ? 63.715  49.621  17.530  1.00 29.58 ? 122  THR A OG1   1 
ATOM   254  C  CG2   . THR A 1 88  ? 61.414  49.799  16.868  1.00 28.67 ? 122  THR A CG2   1 
ATOM   255  N  N     . ARG A 1 89  ? 61.789  47.671  13.906  1.00 28.95 ? 123  ARG A N     1 
ATOM   256  C  CA    . ARG A 1 89  ? 60.721  47.323  12.957  1.00 29.20 ? 123  ARG A CA    1 
ATOM   257  C  C     . ARG A 1 89  ? 60.394  45.828  12.878  1.00 29.17 ? 123  ARG A C     1 
ATOM   258  O  O     . ARG A 1 89  ? 59.324  45.467  12.400  1.00 29.22 ? 123  ARG A O     1 
ATOM   259  C  CB    . ARG A 1 89  ? 61.039  47.854  11.552  1.00 29.38 ? 123  ARG A CB    1 
ATOM   260  C  CG    . ARG A 1 89  ? 60.538  49.270  11.306  1.00 30.00 ? 123  ARG A CG    1 
ATOM   261  C  CD    . ARG A 1 89  ? 61.214  49.895  10.099  1.00 31.01 ? 123  ARG A CD    1 
ATOM   262  N  NE    . ARG A 1 89  ? 60.841  51.298  9.900   1.00 31.34 ? 123  ARG A NE    1 
ATOM   263  C  CZ    . ARG A 1 89  ? 61.409  52.113  9.010   1.00 31.97 ? 123  ARG A CZ    1 
ATOM   264  N  NH1   . ARG A 1 89  ? 62.389  51.680  8.215   1.00 31.90 ? 123  ARG A NH1   1 
ATOM   265  N  NH2   . ARG A 1 89  ? 60.996  53.375  8.911   1.00 32.20 ? 123  ARG A NH2   1 
ATOM   266  N  N     . MET A 1 90  ? 61.299  44.968  13.345  1.00 29.21 ? 124  MET A N     1 
ATOM   267  C  CA    . MET A 1 90  ? 61.029  43.528  13.419  1.00 29.28 ? 124  MET A CA    1 
ATOM   268  C  C     . MET A 1 90  ? 60.071  43.156  14.559  1.00 29.32 ? 124  MET A C     1 
ATOM   269  O  O     . MET A 1 90  ? 59.537  42.049  14.576  1.00 29.44 ? 124  MET A O     1 
ATOM   270  C  CB    . MET A 1 90  ? 62.338  42.748  13.562  1.00 29.26 ? 124  MET A CB    1 
ATOM   271  C  CG    . MET A 1 90  ? 63.237  42.863  12.349  1.00 29.03 ? 124  MET A CG    1 
ATOM   272  S  SD    . MET A 1 90  ? 64.883  42.176  12.593  1.00 28.90 ? 124  MET A SD    1 
ATOM   273  C  CE    . MET A 1 90  ? 65.516  42.411  10.932  1.00 28.01 ? 124  MET A CE    1 
ATOM   274  N  N     . GLU A 1 91  ? 59.882  44.072  15.508  1.00 29.25 ? 125  GLU A N     1 
ATOM   275  C  CA    . GLU A 1 91  ? 58.916  43.917  16.598  1.00 29.36 ? 125  GLU A CA    1 
ATOM   276  C  C     . GLU A 1 91  ? 59.190  42.710  17.508  1.00 29.24 ? 125  GLU A C     1 
ATOM   277  O  O     . GLU A 1 91  ? 58.293  41.917  17.806  1.00 29.13 ? 125  GLU A O     1 
ATOM   278  C  CB    . GLU A 1 91  ? 57.479  43.889  16.049  1.00 29.48 ? 125  GLU A CB    1 
ATOM   279  C  CG    . GLU A 1 91  ? 57.067  45.179  15.341  1.00 29.73 ? 125  GLU A CG    1 
ATOM   280  N  N     . PHE A 1 92  ? 60.435  42.588  17.961  1.00 29.19 ? 126  PHE A N     1 
ATOM   281  C  CA    . PHE A 1 92  ? 60.793  41.581  18.957  1.00 29.06 ? 126  PHE A CA    1 
ATOM   282  C  C     . PHE A 1 92  ? 60.520  42.150  20.349  1.00 28.77 ? 126  PHE A C     1 
ATOM   283  O  O     . PHE A 1 92  ? 60.836  43.305  20.606  1.00 28.52 ? 126  PHE A O     1 
ATOM   284  C  CB    . PHE A 1 92  ? 62.274  41.199  18.852  1.00 29.11 ? 126  PHE A CB    1 
ATOM   285  C  CG    . PHE A 1 92  ? 62.653  40.538  17.553  1.00 29.39 ? 126  PHE A CG    1 
ATOM   286  C  CD1   . PHE A 1 92  ? 61.860  39.535  16.996  1.00 29.61 ? 126  PHE A CD1   1 
ATOM   287  C  CD2   . PHE A 1 92  ? 63.830  40.897  16.902  1.00 29.99 ? 126  PHE A CD2   1 
ATOM   288  C  CE1   . PHE A 1 92  ? 62.217  38.922  15.802  1.00 29.29 ? 126  PHE A CE1   1 
ATOM   289  C  CE2   . PHE A 1 92  ? 64.197  40.286  15.709  1.00 29.91 ? 126  PHE A CE2   1 
ATOM   290  C  CZ    . PHE A 1 92  ? 63.389  39.297  15.158  1.00 29.88 ? 126  PHE A CZ    1 
ATOM   291  N  N     . PRO A 1 93  ? 59.948  41.335  21.256  1.00 28.64 ? 127  PRO A N     1 
ATOM   292  C  CA    . PRO A 1 93  ? 59.663  41.765  22.634  1.00 28.41 ? 127  PRO A CA    1 
ATOM   293  C  C     . PRO A 1 93  ? 60.805  42.562  23.261  1.00 28.05 ? 127  PRO A C     1 
ATOM   294  O  O     . PRO A 1 93  ? 60.578  43.612  23.856  1.00 28.18 ? 127  PRO A O     1 
ATOM   295  C  CB    . PRO A 1 93  ? 59.474  40.442  23.375  1.00 28.40 ? 127  PRO A CB    1 
ATOM   296  C  CG    . PRO A 1 93  ? 58.917  39.528  22.353  1.00 28.77 ? 127  PRO A CG    1 
ATOM   297  C  CD    . PRO A 1 93  ? 59.520  39.942  21.026  1.00 28.82 ? 127  PRO A CD    1 
ATOM   298  N  N     . GLY A 1 94  ? 62.017  42.043  23.124  1.00 27.53 ? 128  GLY A N     1 
ATOM   299  C  CA    . GLY A 1 94  ? 63.226  42.750  23.512  1.00 27.19 ? 128  GLY A CA    1 
ATOM   300  C  C     . GLY A 1 94  ? 64.407  42.113  22.802  1.00 26.83 ? 128  GLY A C     1 
ATOM   301  O  O     . GLY A 1 94  ? 64.224  41.380  21.829  1.00 27.07 ? 128  GLY A O     1 
ATOM   302  N  N     . LEU A 1 95  ? 65.613  42.406  23.276  1.00 26.22 ? 129  LEU A N     1 
ATOM   303  C  CA    . LEU A 1 95  ? 66.814  41.733  22.802  1.00 25.70 ? 129  LEU A CA    1 
ATOM   304  C  C     . LEU A 1 95  ? 67.032  40.492  23.661  1.00 25.44 ? 129  LEU A C     1 
ATOM   305  O  O     . LEU A 1 95  ? 66.775  40.520  24.870  1.00 25.14 ? 129  LEU A O     1 
ATOM   306  C  CB    . LEU A 1 95  ? 68.029  42.662  22.887  1.00 25.74 ? 129  LEU A CB    1 
ATOM   307  C  CG    . LEU A 1 95  ? 67.993  43.924  22.014  1.00 25.37 ? 129  LEU A CG    1 
ATOM   308  C  CD1   . LEU A 1 95  ? 69.198  44.814  22.289  1.00 25.12 ? 129  LEU A CD1   1 
ATOM   309  C  CD2   . LEU A 1 95  ? 67.927  43.570  20.539  1.00 25.74 ? 129  LEU A CD2   1 
ATOM   310  N  N     . THR A 1 96  ? 67.504  39.409  23.040  1.00 24.93 ? 130  THR A N     1 
ATOM   311  C  CA    . THR A 1 96  ? 67.740  38.148  23.756  1.00 24.72 ? 130  THR A CA    1 
ATOM   312  C  C     . THR A 1 96  ? 68.921  38.272  24.725  1.00 24.66 ? 130  THR A C     1 
ATOM   313  O  O     . THR A 1 96  ? 69.703  39.220  24.625  1.00 24.40 ? 130  THR A O     1 
ATOM   314  C  CB    . THR A 1 96  ? 68.024  36.974  22.782  1.00 24.72 ? 130  THR A CB    1 
ATOM   315  O  OG1   . THR A 1 96  ? 69.299  37.164  22.155  1.00 23.55 ? 130  THR A OG1   1 
ATOM   316  C  CG2   . THR A 1 96  ? 66.917  36.852  21.724  1.00 24.46 ? 130  THR A CG2   1 
ATOM   317  N  N     . PRO A 1 97  ? 69.064  37.311  25.660  1.00 24.68 ? 131  PRO A N     1 
ATOM   318  C  CA    . PRO A 1 97  ? 70.183  37.396  26.604  1.00 24.90 ? 131  PRO A CA    1 
ATOM   319  C  C     . PRO A 1 97  ? 71.556  37.492  25.929  1.00 25.15 ? 131  PRO A C     1 
ATOM   320  O  O     . PRO A 1 97  ? 72.376  38.322  26.325  1.00 25.34 ? 131  PRO A O     1 
ATOM   321  C  CB    . PRO A 1 97  ? 70.061  36.102  27.418  1.00 24.79 ? 131  PRO A CB    1 
ATOM   322  C  CG    . PRO A 1 97  ? 68.620  35.750  27.352  1.00 24.68 ? 131  PRO A CG    1 
ATOM   323  C  CD    . PRO A 1 97  ? 68.162  36.189  25.985  1.00 24.73 ? 131  PRO A CD    1 
ATOM   324  N  N     . VAL A 1 98  ? 71.798  36.661  24.921  1.00 25.32 ? 132  VAL A N     1 
ATOM   325  C  CA    . VAL A 1 98  ? 73.074  36.694  24.208  1.00 25.42 ? 132  VAL A CA    1 
ATOM   326  C  C     . VAL A 1 98  ? 73.247  38.013  23.458  1.00 25.80 ? 132  VAL A C     1 
ATOM   327  O  O     . VAL A 1 98  ? 74.337  38.582  23.455  1.00 25.90 ? 132  VAL A O     1 
ATOM   328  C  CB    . VAL A 1 98  ? 73.241  35.485  23.245  1.00 25.36 ? 132  VAL A CB    1 
ATOM   329  C  CG1   . VAL A 1 98  ? 72.127  35.430  22.217  1.00 24.86 ? 132  VAL A CG1   1 
ATOM   330  C  CG2   . VAL A 1 98  ? 74.597  35.522  22.569  1.00 24.73 ? 132  VAL A CG2   1 
ATOM   331  N  N     . GLN A 1 99  ? 72.173  38.496  22.839  1.00 26.15 ? 133  GLN A N     1 
ATOM   332  C  CA    . GLN A 1 99  ? 72.184  39.794  22.163  1.00 26.59 ? 133  GLN A CA    1 
ATOM   333  C  C     . GLN A 1 99  ? 72.531  40.943  23.125  1.00 27.20 ? 133  GLN A C     1 
ATOM   334  O  O     . GLN A 1 99  ? 73.376  41.788  22.806  1.00 27.25 ? 133  GLN A O     1 
ATOM   335  C  CB    . GLN A 1 99  ? 70.838  40.054  21.472  1.00 26.54 ? 133  GLN A CB    1 
ATOM   336  C  CG    . GLN A 1 99  ? 70.629  39.199  20.216  1.00 26.85 ? 133  GLN A CG    1 
ATOM   337  C  CD    . GLN A 1 99  ? 69.205  39.230  19.679  1.00 26.87 ? 133  GLN A CD    1 
ATOM   338  O  OE1   . GLN A 1 99  ? 68.326  39.896  20.227  1.00 27.78 ? 133  GLN A OE1   1 
ATOM   339  N  NE2   . GLN A 1 99  ? 68.973  38.507  18.595  1.00 27.56 ? 133  GLN A NE2   1 
ATOM   340  N  N     . GLN A 1 100 ? 71.901  40.963  24.300  1.00 27.67 ? 134  GLN A N     1 
ATOM   341  C  CA    . GLN A 1 100 ? 72.183  41.991  25.302  1.00 28.27 ? 134  GLN A CA    1 
ATOM   342  C  C     . GLN A 1 100 ? 73.637  41.942  25.749  1.00 28.52 ? 134  GLN A C     1 
ATOM   343  O  O     . GLN A 1 100 ? 74.278  42.980  25.924  1.00 28.72 ? 134  GLN A O     1 
ATOM   344  C  CB    . GLN A 1 100 ? 71.272  41.835  26.531  1.00 28.43 ? 134  GLN A CB    1 
ATOM   345  C  CG    . GLN A 1 100 ? 69.812  42.160  26.260  1.00 29.17 ? 134  GLN A CG    1 
ATOM   346  C  CD    . GLN A 1 100 ? 68.943  42.068  27.498  1.00 29.53 ? 134  GLN A CD    1 
ATOM   347  O  OE1   . GLN A 1 100 ? 69.218  42.707  28.510  1.00 31.26 ? 134  GLN A OE1   1 
ATOM   348  N  NE2   . GLN A 1 100 ? 67.876  41.285  27.418  1.00 29.66 ? 134  GLN A NE2   1 
ATOM   349  N  N     . LYS A 1 101 ? 74.152  40.731  25.919  1.00 28.78 ? 135  LYS A N     1 
ATOM   350  C  CA    . LYS A 1 101 ? 75.470  40.523  26.508  1.00 28.93 ? 135  LYS A CA    1 
ATOM   351  C  C     . LYS A 1 101 ? 76.628  40.778  25.536  1.00 29.12 ? 135  LYS A C     1 
ATOM   352  O  O     . LYS A 1 101 ? 77.727  41.114  25.976  1.00 29.59 ? 135  LYS A O     1 
ATOM   353  C  CB    . LYS A 1 101 ? 75.562  39.097  27.064  1.00 28.79 ? 135  LYS A CB    1 
ATOM   354  C  CG    . LYS A 1 101 ? 76.750  38.849  27.982  1.00 29.09 ? 135  LYS A CG    1 
ATOM   355  C  CD    . LYS A 1 101 ? 76.465  37.724  28.987  1.00 28.92 ? 135  LYS A CD    1 
ATOM   356  C  CE    . LYS A 1 101 ? 77.557  37.597  30.033  1.00 28.29 ? 135  LYS A CE    1 
ATOM   357  N  NZ    . LYS A 1 101 ? 77.148  36.694  31.147  1.00 28.48 ? 135  LYS A NZ    1 
ATOM   358  N  N     . THR A 1 102 ? 76.398  40.631  24.233  1.00 29.09 ? 136  THR A N     1 
ATOM   359  C  CA    . THR A 1 102 ? 77.505  40.642  23.267  1.00 29.16 ? 136  THR A CA    1 
ATOM   360  C  C     . THR A 1 102 ? 77.667  41.935  22.456  1.00 29.42 ? 136  THR A C     1 
ATOM   361  O  O     . THR A 1 102 ? 78.780  42.263  22.053  1.00 29.47 ? 136  THR A O     1 
ATOM   362  C  CB    . THR A 1 102 ? 77.407  39.448  22.276  1.00 29.02 ? 136  THR A CB    1 
ATOM   363  O  OG1   . THR A 1 102 ? 76.254  39.593  21.441  1.00 28.81 ? 136  THR A OG1   1 
ATOM   364  C  CG2   . THR A 1 102 ? 77.323  38.134  23.026  1.00 28.77 ? 136  THR A CG2   1 
ATOM   365  N  N     . ILE A 1 103 ? 76.580  42.667  22.219  1.00 29.76 ? 137  ILE A N     1 
ATOM   366  C  CA    . ILE A 1 103 ? 76.608  43.764  21.237  1.00 29.81 ? 137  ILE A CA    1 
ATOM   367  C  C     . ILE A 1 103 ? 77.608  44.861  21.598  1.00 30.33 ? 137  ILE A C     1 
ATOM   368  O  O     . ILE A 1 103 ? 78.400  45.276  20.748  1.00 30.32 ? 137  ILE A O     1 
ATOM   369  C  CB    . ILE A 1 103 ? 75.209  44.373  21.002  1.00 29.73 ? 137  ILE A CB    1 
ATOM   370  C  CG1   . ILE A 1 103 ? 74.300  43.355  20.311  1.00 29.29 ? 137  ILE A CG1   1 
ATOM   371  C  CG2   . ILE A 1 103 ? 75.299  45.613  20.134  1.00 29.11 ? 137  ILE A CG2   1 
ATOM   372  C  CD1   . ILE A 1 103 ? 72.840  43.720  20.329  1.00 28.60 ? 137  ILE A CD1   1 
ATOM   373  N  N     . LYS A 1 104 ? 77.594  45.317  22.848  1.00 30.77 ? 138  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 104 ? 78.510  46.388  23.263  1.00 31.25 ? 138  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 104 ? 79.973  45.911  23.303  1.00 31.56 ? 138  LYS A C     1 
ATOM   376  O  O     . LYS A 1 104 ? 80.849  46.562  22.719  1.00 31.61 ? 138  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 104 ? 78.068  47.034  24.588  1.00 31.32 ? 138  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 104 ? 79.106  47.959  25.227  1.00 31.76 ? 138  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 104 ? 78.502  48.803  26.356  1.00 32.05 ? 138  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 104 ? 79.562  49.653  27.060  1.00 32.00 ? 138  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 104 ? 79.011  50.368  28.255  1.00 32.15 ? 138  LYS A NZ    1 
ATOM   382  N  N     . PRO A 1 105 ? 80.247  44.781  23.981  1.00 31.87 ? 139  PRO A N     1 
ATOM   383  C  CA    . PRO A 1 105 ? 81.597  44.227  23.936  1.00 32.17 ? 139  PRO A CA    1 
ATOM   384  C  C     . PRO A 1 105 ? 82.161  44.003  22.531  1.00 32.61 ? 139  PRO A C     1 
ATOM   385  O  O     . PRO A 1 105 ? 83.285  44.402  22.258  1.00 32.72 ? 139  PRO A O     1 
ATOM   386  C  CB    . PRO A 1 105 ? 81.441  42.906  24.678  1.00 32.11 ? 139  PRO A CB    1 
ATOM   387  C  CG    . PRO A 1 105 ? 80.434  43.210  25.706  1.00 31.85 ? 139  PRO A CG    1 
ATOM   388  C  CD    . PRO A 1 105 ? 79.451  44.144  25.047  1.00 31.90 ? 139  PRO A CD    1 
ATOM   389  N  N     . ILE A 1 106 ? 81.395  43.395  21.634  1.00 33.11 ? 140  ILE A N     1 
ATOM   390  C  CA    . ILE A 1 106 ? 81.884  43.194  20.272  1.00 33.50 ? 140  ILE A CA    1 
ATOM   391  C  C     . ILE A 1 106 ? 82.319  44.535  19.652  1.00 33.95 ? 140  ILE A C     1 
ATOM   392  O  O     . ILE A 1 106 ? 83.342  44.604  18.968  1.00 34.14 ? 140  ILE A O     1 
ATOM   393  C  CB    . ILE A 1 106 ? 80.830  42.499  19.373  1.00 33.63 ? 140  ILE A CB    1 
ATOM   394  C  CG1   . ILE A 1 106 ? 80.587  41.059  19.838  1.00 33.83 ? 140  ILE A CG1   1 
ATOM   395  C  CG2   . ILE A 1 106 ? 81.277  42.488  17.925  1.00 32.87 ? 140  ILE A CG2   1 
ATOM   396  C  CD1   . ILE A 1 106 ? 79.279  40.494  19.350  1.00 33.72 ? 140  ILE A CD1   1 
ATOM   397  N  N     . LEU A 1 107 ? 81.556  45.596  19.912  1.00 34.30 ? 141  LEU A N     1 
ATOM   398  C  CA    . LEU A 1 107 ? 81.851  46.919  19.346  1.00 34.51 ? 141  LEU A CA    1 
ATOM   399  C  C     . LEU A 1 107 ? 82.877  47.713  20.157  1.00 34.84 ? 141  LEU A C     1 
ATOM   400  O  O     . LEU A 1 107 ? 83.403  48.713  19.672  1.00 35.01 ? 141  LEU A O     1 
ATOM   401  C  CB    . LEU A 1 107 ? 80.565  47.738  19.194  1.00 34.31 ? 141  LEU A CB    1 
ATOM   402  C  CG    . LEU A 1 107 ? 79.720  47.355  17.980  1.00 34.12 ? 141  LEU A CG    1 
ATOM   403  C  CD1   . LEU A 1 107 ? 78.325  47.967  18.073  1.00 33.40 ? 141  LEU A CD1   1 
ATOM   404  C  CD2   . LEU A 1 107 ? 80.415  47.762  16.678  1.00 33.52 ? 141  LEU A CD2   1 
ATOM   405  N  N     . SER A 1 108 ? 83.165  47.268  21.377  1.00 35.13 ? 142  SER A N     1 
ATOM   406  C  CA    . SER A 1 108 ? 84.097  47.970  22.256  1.00 35.23 ? 142  SER A CA    1 
ATOM   407  C  C     . SER A 1 108 ? 85.455  48.159  21.594  1.00 35.30 ? 142  SER A C     1 
ATOM   408  O  O     . SER A 1 108 ? 85.989  47.225  20.997  1.00 35.35 ? 142  SER A O     1 
ATOM   409  C  CB    . SER A 1 108 ? 84.275  47.207  23.568  1.00 35.20 ? 142  SER A CB    1 
ATOM   410  O  OG    . SER A 1 108 ? 85.140  47.910  24.442  1.00 35.85 ? 142  SER A OG    1 
ATOM   411  N  N     . SER A 1 109 ? 86.014  49.365  21.724  1.00 35.45 ? 143  SER A N     1 
ATOM   412  C  CA    . SER A 1 109 ? 87.312  49.704  21.119  1.00 35.48 ? 143  SER A CA    1 
ATOM   413  C  C     . SER A 1 109 ? 88.499  49.076  21.862  1.00 35.38 ? 143  SER A C     1 
ATOM   414  O  O     . SER A 1 109 ? 89.654  49.303  21.488  1.00 35.16 ? 143  SER A O     1 
ATOM   415  C  CB    . SER A 1 109 ? 87.493  51.228  21.022  1.00 35.52 ? 143  SER A CB    1 
ATOM   416  O  OG    . SER A 1 109 ? 87.613  51.827  22.303  1.00 35.57 ? 143  SER A OG    1 
ATOM   417  N  N     . GLU A 1 110 ? 88.210  48.316  22.923  1.00 35.34 ? 144  GLU A N     1 
ATOM   418  C  CA    . GLU A 1 110 ? 89.195  47.435  23.550  1.00 35.20 ? 144  GLU A CA    1 
ATOM   419  C  C     . GLU A 1 110 ? 89.629  46.372  22.544  1.00 34.63 ? 144  GLU A C     1 
ATOM   420  O  O     . GLU A 1 110 ? 88.814  45.857  21.771  1.00 34.60 ? 144  GLU A O     1 
ATOM   421  C  CB    . GLU A 1 110 ? 88.620  46.764  24.801  1.00 35.36 ? 144  GLU A CB    1 
ATOM   422  C  CG    . GLU A 1 110 ? 88.455  47.709  25.994  1.00 36.43 ? 144  GLU A CG    1 
ATOM   423  C  CD    . GLU A 1 110 ? 87.484  47.181  27.055  1.00 37.70 ? 144  GLU A CD    1 
ATOM   424  O  OE1   . GLU A 1 110 ? 87.240  45.951  27.114  1.00 37.63 ? 144  GLU A OE1   1 
ATOM   425  O  OE2   . GLU A 1 110 ? 86.961  48.010  27.834  1.00 38.62 ? 144  GLU A OE2   1 
ATOM   426  N  N     . ASP A 1 111 ? 90.915  46.048  22.577  1.00 33.86 ? 145  ASP A N     1 
ATOM   427  C  CA    . ASP A 1 111 ? 91.538  45.214  21.564  1.00 33.33 ? 145  ASP A CA    1 
ATOM   428  C  C     . ASP A 1 111 ? 91.419  43.733  21.964  1.00 32.52 ? 145  ASP A C     1 
ATOM   429  O  O     . ASP A 1 111 ? 92.387  43.118  22.431  1.00 32.34 ? 145  ASP A O     1 
ATOM   430  C  CB    . ASP A 1 111 ? 93.007  45.648  21.403  1.00 33.57 ? 145  ASP A CB    1 
ATOM   431  C  CG    . ASP A 1 111 ? 93.556  45.392  20.010  1.00 34.45 ? 145  ASP A CG    1 
ATOM   432  O  OD1   . ASP A 1 111 ? 92.767  45.049  19.097  1.00 36.01 ? 145  ASP A OD1   1 
ATOM   433  O  OD2   . ASP A 1 111 ? 94.786  45.543  19.833  1.00 34.44 ? 145  ASP A OD2   1 
ATOM   434  N  N     . HIS A 1 112 ? 90.221  43.173  21.787  1.00 31.36 ? 146  HIS A N     1 
ATOM   435  C  CA    . HIS A 1 112 ? 89.935  41.803  22.223  1.00 30.60 ? 146  HIS A CA    1 
ATOM   436  C  C     . HIS A 1 112 ? 89.110  40.999  21.220  1.00 29.37 ? 146  HIS A C     1 
ATOM   437  O  O     . HIS A 1 112 ? 88.348  41.552  20.429  1.00 29.39 ? 146  HIS A O     1 
ATOM   438  C  CB    . HIS A 1 112 ? 89.211  41.814  23.577  1.00 30.81 ? 146  HIS A CB    1 
ATOM   439  C  CG    . HIS A 1 112 ? 87.938  42.601  23.580  1.00 32.01 ? 146  HIS A CG    1 
ATOM   440  N  ND1   . HIS A 1 112 ? 87.139  42.726  22.464  1.00 34.13 ? 146  HIS A ND1   1 
ATOM   441  C  CD2   . HIS A 1 112 ? 87.314  43.290  24.565  1.00 33.55 ? 146  HIS A CD2   1 
ATOM   442  C  CE1   . HIS A 1 112 ? 86.087  43.468  22.755  1.00 34.26 ? 146  HIS A CE1   1 
ATOM   443  N  NE2   . HIS A 1 112 ? 86.167  43.822  24.026  1.00 34.20 ? 146  HIS A NE2   1 
ATOM   444  N  N     . ASP A 1 113 ? 89.279  39.683  21.269  1.00 28.05 ? 147  ASP A N     1 
ATOM   445  C  CA    . ASP A 1 113 ? 88.420  38.756  20.548  1.00 26.98 ? 147  ASP A CA    1 
ATOM   446  C  C     . ASP A 1 113 ? 87.241  38.413  21.454  1.00 26.22 ? 147  ASP A C     1 
ATOM   447  O  O     . ASP A 1 113 ? 87.267  38.705  22.651  1.00 26.06 ? 147  ASP A O     1 
ATOM   448  C  CB    . ASP A 1 113 ? 89.177  37.473  20.196  1.00 26.89 ? 147  ASP A CB    1 
ATOM   449  C  CG    . ASP A 1 113 ? 90.331  37.707  19.237  1.00 26.07 ? 147  ASP A CG    1 
ATOM   450  O  OD1   . ASP A 1 113 ? 90.117  38.303  18.158  1.00 25.79 ? 147  ASP A OD1   1 
ATOM   451  O  OD2   . ASP A 1 113 ? 91.452  37.256  19.548  1.00 24.66 ? 147  ASP A OD2   1 
ATOM   452  N  N     . VAL A 1 114 ? 86.216  37.786  20.886  1.00 25.28 ? 148  VAL A N     1 
ATOM   453  C  CA    . VAL A 1 114 ? 85.025  37.420  21.646  1.00 24.60 ? 148  VAL A CA    1 
ATOM   454  C  C     . VAL A 1 114 ? 84.624  35.967  21.396  1.00 24.04 ? 148  VAL A C     1 
ATOM   455  O  O     . VAL A 1 114 ? 84.525  35.537  20.263  1.00 23.43 ? 148  VAL A O     1 
ATOM   456  C  CB    . VAL A 1 114 ? 83.834  38.343  21.289  1.00 24.56 ? 148  VAL A CB    1 
ATOM   457  C  CG1   . VAL A 1 114 ? 82.560  37.898  22.008  1.00 24.68 ? 148  VAL A CG1   1 
ATOM   458  C  CG2   . VAL A 1 114 ? 84.167  39.785  21.615  1.00 23.75 ? 148  VAL A CG2   1 
ATOM   459  N  N     . ILE A 1 115 ? 84.417  35.213  22.471  1.00 23.76 ? 149  ILE A N     1 
ATOM   460  C  CA    . ILE A 1 115 ? 83.747  33.925  22.382  1.00 23.55 ? 149  ILE A CA    1 
ATOM   461  C  C     . ILE A 1 115 ? 82.415  34.078  23.081  1.00 23.31 ? 149  ILE A C     1 
ATOM   462  O  O     . ILE A 1 115 ? 82.337  34.761  24.096  1.00 23.74 ? 149  ILE A O     1 
ATOM   463  C  CB    . ILE A 1 115 ? 84.523  32.803  23.055  1.00 23.38 ? 149  ILE A CB    1 
ATOM   464  C  CG1   . ILE A 1 115 ? 85.940  32.723  22.505  1.00 23.46 ? 149  ILE A CG1   1 
ATOM   465  C  CG2   . ILE A 1 115 ? 83.826  31.479  22.815  1.00 23.40 ? 149  ILE A CG2   1 
ATOM   466  C  CD1   . ILE A 1 115 ? 86.795  31.702  23.229  1.00 23.22 ? 149  ILE A CD1   1 
ATOM   467  N  N     . ALA A 1 116 ? 81.376  33.449  22.535  1.00 22.84 ? 150  ALA A N     1 
ATOM   468  C  CA    . ALA A 1 116 ? 80.028  33.562  23.079  1.00 22.44 ? 150  ALA A CA    1 
ATOM   469  C  C     . ALA A 1 116 ? 79.272  32.245  22.955  1.00 22.25 ? 150  ALA A C     1 
ATOM   470  O  O     . ALA A 1 116 ? 79.186  31.668  21.867  1.00 21.79 ? 150  ALA A O     1 
ATOM   471  C  CB    . ALA A 1 116 ? 79.267  34.662  22.365  1.00 22.51 ? 150  ALA A CB    1 
ATOM   472  N  N     . ARG A 1 117 ? 78.728  31.785  24.077  1.00 21.89 ? 151  ARG A N     1 
ATOM   473  C  CA    . ARG A 1 117 ? 77.898  30.598  24.114  1.00 21.80 ? 151  ARG A CA    1 
ATOM   474  C  C     . ARG A 1 117 ? 76.483  30.973  24.521  1.00 21.59 ? 151  ARG A C     1 
ATOM   475  O  O     . ARG A 1 117 ? 76.262  31.572  25.591  1.00 21.90 ? 151  ARG A O     1 
ATOM   476  C  CB    . ARG A 1 117 ? 78.452  29.575  25.109  1.00 21.97 ? 151  ARG A CB    1 
ATOM   477  C  CG    . ARG A 1 117 ? 77.678  28.265  25.119  1.00 22.63 ? 151  ARG A CG    1 
ATOM   478  C  CD    . ARG A 1 117 ? 78.299  27.214  26.031  1.00 23.32 ? 151  ARG A CD    1 
ATOM   479  N  NE    . ARG A 1 117 ? 78.141  27.539  27.447  1.00 23.14 ? 151  ARG A NE    1 
ATOM   480  C  CZ    . ARG A 1 117 ? 78.275  26.677  28.455  1.00 22.21 ? 151  ARG A CZ    1 
ATOM   481  N  NH1   . ARG A 1 117 ? 78.566  25.401  28.233  1.00 22.07 ? 151  ARG A NH1   1 
ATOM   482  N  NH2   . ARG A 1 117 ? 78.103  27.097  29.704  1.00 22.08 ? 151  ARG A NH2   1 
ATOM   483  N  N     . ALA A 1 118 ? 75.530  30.604  23.673  1.00 20.79 ? 152  ALA A N     1 
ATOM   484  C  CA    . ALA A 1 118 ? 74.120  30.737  23.990  1.00 20.47 ? 152  ALA A CA    1 
ATOM   485  C  C     . ALA A 1 118 ? 73.348  29.583  23.362  1.00 20.22 ? 152  ALA A C     1 
ATOM   486  O  O     . ALA A 1 118 ? 73.804  28.974  22.398  1.00 20.24 ? 152  ALA A O     1 
ATOM   487  C  CB    . ALA A 1 118 ? 73.588  32.077  23.513  1.00 20.23 ? 152  ALA A CB    1 
ATOM   488  N  N     . LYS A 1 119 ? 72.168  29.300  23.904  1.00 20.13 ? 153  LYS A N     1 
ATOM   489  C  CA    . LYS A 1 119 ? 71.454  28.077  23.574  1.00 19.94 ? 153  LYS A CA    1 
ATOM   490  C  C     . LYS A 1 119 ? 70.862  28.133  22.181  1.00 20.10 ? 153  LYS A C     1 
ATOM   491  O  O     . LYS A 1 119 ? 70.709  29.203  21.590  1.00 20.04 ? 153  LYS A O     1 
ATOM   492  C  CB    . LYS A 1 119 ? 70.343  27.801  24.587  1.00 20.21 ? 153  LYS A CB    1 
ATOM   493  C  CG    . LYS A 1 119 ? 70.820  27.645  26.027  1.00 20.01 ? 153  LYS A CG    1 
ATOM   494  C  CD    . LYS A 1 119 ? 69.919  26.704  26.798  1.00 20.10 ? 153  LYS A CD    1 
ATOM   495  C  CE    . LYS A 1 119 ? 70.387  26.510  28.238  1.00 19.88 ? 153  LYS A CE    1 
ATOM   496  N  NZ    . LYS A 1 119 ? 69.862  25.238  28.837  1.00 20.43 ? 153  LYS A NZ    1 
ATOM   497  N  N     . THR A 1 120 ? 70.536  26.960  21.655  1.00 19.97 ? 154  THR A N     1 
ATOM   498  C  CA    . THR A 1 120 ? 69.850  26.881  20.392  1.00 19.71 ? 154  THR A CA    1 
ATOM   499  C  C     . THR A 1 120 ? 68.577  27.746  20.436  1.00 19.65 ? 154  THR A C     1 
ATOM   500  O  O     . THR A 1 120 ? 67.791  27.683  21.382  1.00 19.88 ? 154  THR A O     1 
ATOM   501  C  CB    . THR A 1 120 ? 69.531  25.421  20.020  1.00 19.68 ? 154  THR A CB    1 
ATOM   502  O  OG1   . THR A 1 120 ? 68.704  24.826  21.023  1.00 18.55 ? 154  THR A OG1   1 
ATOM   503  C  CG2   . THR A 1 120 ? 70.821  24.618  19.883  1.00 19.75 ? 154  THR A CG2   1 
ATOM   504  N  N     . GLY A 1 121 ? 68.447  28.610  19.439  1.00 19.58 ? 155  GLY A N     1 
ATOM   505  C  CA    . GLY A 1 121 ? 67.219  29.350  19.155  1.00 19.55 ? 155  GLY A CA    1 
ATOM   506  C  C     . GLY A 1 121 ? 67.123  30.730  19.782  1.00 19.40 ? 155  GLY A C     1 
ATOM   507  O  O     . GLY A 1 121 ? 66.070  31.355  19.739  1.00 19.13 ? 155  GLY A O     1 
ATOM   508  N  N     . THR A 1 122 ? 68.209  31.221  20.365  1.00 19.46 ? 156  THR A N     1 
ATOM   509  C  CA    . THR A 1 122 ? 68.118  32.436  21.162  1.00 19.77 ? 156  THR A CA    1 
ATOM   510  C  C     . THR A 1 122 ? 68.784  33.630  20.478  1.00 20.02 ? 156  THR A C     1 
ATOM   511  O  O     . THR A 1 122 ? 69.159  34.597  21.131  1.00 20.35 ? 156  THR A O     1 
ATOM   512  C  CB    . THR A 1 122 ? 68.662  32.200  22.590  1.00 19.75 ? 156  THR A CB    1 
ATOM   513  O  OG1   . THR A 1 122 ? 70.087  32.020  22.557  1.00 19.89 ? 156  THR A OG1   1 
ATOM   514  C  CG2   . THR A 1 122 ? 68.002  30.970  23.191  1.00 17.90 ? 156  THR A CG2   1 
ATOM   515  N  N     . GLY A 1 123 ? 68.914  33.558  19.159  1.00 20.43 ? 157  GLY A N     1 
ATOM   516  C  CA    . GLY A 1 123 ? 69.207  34.740  18.345  1.00 20.77 ? 157  GLY A CA    1 
ATOM   517  C  C     . GLY A 1 123 ? 70.665  35.131  18.233  1.00 20.88 ? 157  GLY A C     1 
ATOM   518  O  O     . GLY A 1 123 ? 70.978  36.303  18.016  1.00 21.09 ? 157  GLY A O     1 
ATOM   519  N  N     . LYS A 1 124 ? 71.561  34.158  18.360  1.00 20.80 ? 158  LYS A N     1 
ATOM   520  C  CA    . LYS A 1 124 ? 72.986  34.411  18.154  1.00 20.83 ? 158  LYS A CA    1 
ATOM   521  C  C     . LYS A 1 124 ? 73.284  35.123  16.829  1.00 20.52 ? 158  LYS A C     1 
ATOM   522  O  O     . LYS A 1 124 ? 74.211  35.920  16.767  1.00 20.60 ? 158  LYS A O     1 
ATOM   523  C  CB    . LYS A 1 124 ? 73.787  33.108  18.231  1.00 20.89 ? 158  LYS A CB    1 
ATOM   524  C  CG    . LYS A 1 124 ? 73.892  32.530  19.643  1.00 21.04 ? 158  LYS A CG    1 
ATOM   525  C  CD    . LYS A 1 124 ? 74.766  31.285  19.676  1.00 21.72 ? 158  LYS A CD    1 
ATOM   526  C  CE    . LYS A 1 124 ? 74.061  30.057  19.123  1.00 21.43 ? 158  LYS A CE    1 
ATOM   527  N  NZ    . LYS A 1 124 ? 73.013  29.565  20.069  1.00 21.94 ? 158  LYS A NZ    1 
ATOM   528  N  N     . THR A 1 125 ? 72.508  34.841  15.781  1.00 20.38 ? 159  THR A N     1 
ATOM   529  C  CA    . THR A 1 125 ? 72.750  35.440  14.472  1.00 20.28 ? 159  THR A CA    1 
ATOM   530  C  C     . THR A 1 125 ? 72.804  36.967  14.578  1.00 20.36 ? 159  THR A C     1 
ATOM   531  O  O     . THR A 1 125 ? 73.820  37.566  14.239  1.00 20.17 ? 159  THR A O     1 
ATOM   532  C  CB    . THR A 1 125 ? 71.686  35.012  13.403  1.00 20.53 ? 159  THR A CB    1 
ATOM   533  O  OG1   . THR A 1 125 ? 71.580  33.582  13.344  1.00 20.01 ? 159  THR A OG1   1 
ATOM   534  C  CG2   . THR A 1 125 ? 72.067  35.529  12.032  1.00 19.70 ? 159  THR A CG2   1 
ATOM   535  N  N     . PHE A 1 126 ? 71.727  37.593  15.056  1.00 20.44 ? 160  PHE A N     1 
ATOM   536  C  CA    . PHE A 1 126 ? 71.709  39.063  15.206  1.00 20.57 ? 160  PHE A CA    1 
ATOM   537  C  C     . PHE A 1 126 ? 72.636  39.536  16.332  1.00 20.62 ? 160  PHE A C     1 
ATOM   538  O  O     . PHE A 1 126 ? 73.048  40.693  16.353  1.00 20.85 ? 160  PHE A O     1 
ATOM   539  C  CB    . PHE A 1 126 ? 70.294  39.605  15.439  1.00 20.38 ? 160  PHE A CB    1 
ATOM   540  C  CG    . PHE A 1 126 ? 69.375  39.476  14.251  1.00 20.03 ? 160  PHE A CG    1 
ATOM   541  C  CD1   . PHE A 1 126 ? 69.764  39.902  12.989  1.00 20.19 ? 160  PHE A CD1   1 
ATOM   542  C  CD2   . PHE A 1 126 ? 68.097  38.960  14.404  1.00 19.57 ? 160  PHE A CD2   1 
ATOM   543  C  CE1   . PHE A 1 126 ? 68.897  39.789  11.905  1.00 20.55 ? 160  PHE A CE1   1 
ATOM   544  C  CE2   . PHE A 1 126 ? 67.234  38.848  13.324  1.00 19.48 ? 160  PHE A CE2   1 
ATOM   545  C  CZ    . PHE A 1 126 ? 67.630  39.258  12.078  1.00 18.73 ? 160  PHE A CZ    1 
ATOM   546  N  N     . ALA A 1 127 ? 72.962  38.645  17.262  1.00 20.49 ? 161  ALA A N     1 
ATOM   547  C  CA    . ALA A 1 127 ? 74.018  38.914  18.226  1.00 20.48 ? 161  ALA A CA    1 
ATOM   548  C  C     . ALA A 1 127 ? 75.337  39.311  17.547  1.00 20.79 ? 161  ALA A C     1 
ATOM   549  O  O     . ALA A 1 127 ? 76.123  40.042  18.157  1.00 21.38 ? 161  ALA A O     1 
ATOM   550  C  CB    . ALA A 1 127 ? 74.232  37.716  19.127  1.00 20.20 ? 161  ALA A CB    1 
ATOM   551  N  N     . PHE A 1 128 ? 75.594  38.845  16.315  1.00 20.62 ? 162  PHE A N     1 
ATOM   552  C  CA    . PHE A 1 128 ? 76.760  39.333  15.544  1.00 20.62 ? 162  PHE A CA    1 
ATOM   553  C  C     . PHE A 1 128 ? 76.458  40.246  14.343  1.00 20.93 ? 162  PHE A C     1 
ATOM   554  O  O     . PHE A 1 128 ? 77.284  41.085  14.002  1.00 21.47 ? 162  PHE A O     1 
ATOM   555  C  CB    . PHE A 1 128 ? 77.756  38.210  15.146  1.00 20.72 ? 162  PHE A CB    1 
ATOM   556  C  CG    . PHE A 1 128 ? 77.202  37.126  14.234  1.00 19.45 ? 162  PHE A CG    1 
ATOM   557  C  CD1   . PHE A 1 128 ? 77.096  37.326  12.875  1.00 20.04 ? 162  PHE A CD1   1 
ATOM   558  C  CD2   . PHE A 1 128 ? 76.879  35.868  14.745  1.00 19.19 ? 162  PHE A CD2   1 
ATOM   559  C  CE1   . PHE A 1 128 ? 76.624  36.313  12.036  1.00 20.60 ? 162  PHE A CE1   1 
ATOM   560  C  CE2   . PHE A 1 128 ? 76.413  34.856  13.933  1.00 18.73 ? 162  PHE A CE2   1 
ATOM   561  C  CZ    . PHE A 1 128 ? 76.284  35.070  12.570  1.00 20.26 ? 162  PHE A CZ    1 
ATOM   562  N  N     . LEU A 1 129 ? 75.306  40.096  13.699  1.00 21.07 ? 163  LEU A N     1 
ATOM   563  C  CA    . LEU A 1 129 ? 74.984  40.948  12.553  1.00 20.91 ? 163  LEU A CA    1 
ATOM   564  C  C     . LEU A 1 129 ? 74.750  42.401  12.977  1.00 21.07 ? 163  LEU A C     1 
ATOM   565  O  O     . LEU A 1 129 ? 75.054  43.323  12.225  1.00 20.72 ? 163  LEU A O     1 
ATOM   566  C  CB    . LEU A 1 129 ? 73.768  40.419  11.781  1.00 20.78 ? 163  LEU A CB    1 
ATOM   567  C  CG    . LEU A 1 129 ? 74.004  39.217  10.853  1.00 20.89 ? 163  LEU A CG    1 
ATOM   568  C  CD1   . LEU A 1 129 ? 72.729  38.863  10.082  1.00 18.44 ? 163  LEU A CD1   1 
ATOM   569  C  CD2   . LEU A 1 129 ? 75.163  39.470  9.881   1.00 19.34 ? 163  LEU A CD2   1 
ATOM   570  N  N     . ILE A 1 130 ? 74.202  42.602  14.174  1.00 21.26 ? 164  ILE A N     1 
ATOM   571  C  CA    . ILE A 1 130 ? 73.917  43.951  14.667  1.00 21.14 ? 164  ILE A CA    1 
ATOM   572  C  C     . ILE A 1 130 ? 75.205  44.741  14.908  1.00 21.54 ? 164  ILE A C     1 
ATOM   573  O  O     . ILE A 1 130 ? 75.342  45.862  14.410  1.00 21.46 ? 164  ILE A O     1 
ATOM   574  C  CB    . ILE A 1 130 ? 73.034  43.929  15.942  1.00 21.18 ? 164  ILE A CB    1 
ATOM   575  C  CG1   . ILE A 1 130 ? 71.585  43.600  15.566  1.00 20.93 ? 164  ILE A CG1   1 
ATOM   576  C  CG2   . ILE A 1 130 ? 73.101  45.262  16.679  1.00 20.54 ? 164  ILE A CG2   1 
ATOM   577  C  CD1   . ILE A 1 130 ? 70.678  43.347  16.775  1.00 19.61 ? 164  ILE A CD1   1 
ATOM   578  N  N     . PRO A 1 131 ? 76.151  44.170  15.673  1.00 21.88 ? 165  PRO A N     1 
ATOM   579  C  CA    . PRO A 1 131 ? 77.424  44.874  15.838  1.00 22.16 ? 165  PRO A CA    1 
ATOM   580  C  C     . PRO A 1 131 ? 78.210  45.053  14.549  1.00 22.12 ? 165  PRO A C     1 
ATOM   581  O  O     . PRO A 1 131 ? 78.913  46.044  14.404  1.00 22.49 ? 165  PRO A O     1 
ATOM   582  C  CB    . PRO A 1 131 ? 78.211  43.988  16.816  1.00 22.33 ? 165  PRO A CB    1 
ATOM   583  C  CG    . PRO A 1 131 ? 77.363  42.782  17.064  1.00 22.53 ? 165  PRO A CG    1 
ATOM   584  C  CD    . PRO A 1 131 ? 75.973  43.132  16.695  1.00 21.94 ? 165  PRO A CD    1 
ATOM   585  N  N     . ILE A 1 132 ? 78.103  44.104  13.623  1.00 22.01 ? 166  ILE A N     1 
ATOM   586  C  CA    . ILE A 1 132 ? 78.817  44.220  12.359  1.00 21.49 ? 166  ILE A CA    1 
ATOM   587  C  C     . ILE A 1 132 ? 78.300  45.434  11.579  1.00 21.48 ? 166  ILE A C     1 
ATOM   588  O  O     . ILE A 1 132 ? 79.096  46.245  11.108  1.00 21.58 ? 166  ILE A O     1 
ATOM   589  C  CB    . ILE A 1 132 ? 78.732  42.925  11.528  1.00 21.19 ? 166  ILE A CB    1 
ATOM   590  C  CG1   . ILE A 1 132 ? 79.719  41.898  12.087  1.00 22.06 ? 166  ILE A CG1   1 
ATOM   591  C  CG2   . ILE A 1 132 ? 79.056  43.183  10.069  1.00 20.43 ? 166  ILE A CG2   1 
ATOM   592  C  CD1   . ILE A 1 132 ? 79.632  40.521  11.430  1.00 21.44 ? 166  ILE A CD1   1 
ATOM   593  N  N     . PHE A 1 133 ? 76.979  45.562  11.451  1.00 21.23 ? 167  PHE A N     1 
ATOM   594  C  CA    . PHE A 1 133 ? 76.391  46.720  10.767  1.00 21.10 ? 167  PHE A CA    1 
ATOM   595  C  C     . PHE A 1 133 ? 76.854  48.039  11.396  1.00 21.05 ? 167  PHE A C     1 
ATOM   596  O  O     . PHE A 1 133 ? 77.219  48.966  10.681  1.00 20.98 ? 167  PHE A O     1 
ATOM   597  C  CB    . PHE A 1 133 ? 74.856  46.648  10.735  1.00 20.96 ? 167  PHE A CB    1 
ATOM   598  C  CG    . PHE A 1 133 ? 74.314  46.020  9.489   1.00 20.35 ? 167  PHE A CG    1 
ATOM   599  C  CD1   . PHE A 1 133 ? 74.145  46.773  8.342   1.00 20.51 ? 167  PHE A CD1   1 
ATOM   600  C  CD2   . PHE A 1 133 ? 73.995  44.673  9.452   1.00 19.39 ? 167  PHE A CD2   1 
ATOM   601  C  CE1   . PHE A 1 133 ? 73.656  46.194  7.176   1.00 20.52 ? 167  PHE A CE1   1 
ATOM   602  C  CE2   . PHE A 1 133 ? 73.512  44.091  8.300   1.00 19.75 ? 167  PHE A CE2   1 
ATOM   603  C  CZ    . PHE A 1 133 ? 73.336  44.848  7.161   1.00 19.89 ? 167  PHE A CZ    1 
ATOM   604  N  N     . GLN A 1 134 ? 76.865  48.107  12.723  1.00 20.95 ? 168  GLN A N     1 
ATOM   605  C  CA    . GLN A 1 134 ? 77.306  49.310  13.413  1.00 21.16 ? 168  GLN A CA    1 
ATOM   606  C  C     . GLN A 1 134 ? 78.737  49.693  13.034  1.00 21.50 ? 168  GLN A C     1 
ATOM   607  O  O     . GLN A 1 134 ? 79.043  50.869  12.830  1.00 21.71 ? 168  GLN A O     1 
ATOM   608  C  CB    . GLN A 1 134 ? 77.206  49.126  14.925  1.00 21.06 ? 168  GLN A CB    1 
ATOM   609  C  CG    . GLN A 1 134 ? 77.512  50.388  15.718  1.00 21.28 ? 168  GLN A CG    1 
ATOM   610  C  CD    . GLN A 1 134 ? 76.644  51.567  15.315  1.00 21.15 ? 168  GLN A CD    1 
ATOM   611  O  OE1   . GLN A 1 134 ? 75.433  51.425  15.128  1.00 21.58 ? 168  GLN A OE1   1 
ATOM   612  N  NE2   . GLN A 1 134 ? 77.260  52.737  15.169  1.00 20.18 ? 168  GLN A NE2   1 
ATOM   613  N  N     . HIS A 1 135 ? 79.612  48.698  12.942  1.00 21.75 ? 169  HIS A N     1 
ATOM   614  C  CA    . HIS A 1 135 ? 80.993  48.944  12.572  1.00 21.80 ? 169  HIS A CA    1 
ATOM   615  C  C     . HIS A 1 135 ? 81.090  49.470  11.143  1.00 21.93 ? 169  HIS A C     1 
ATOM   616  O  O     . HIS A 1 135 ? 81.930  50.327  10.847  1.00 22.39 ? 169  HIS A O     1 
ATOM   617  C  CB    . HIS A 1 135 ? 81.821  47.675  12.726  1.00 21.84 ? 169  HIS A CB    1 
ATOM   618  C  CG    . HIS A 1 135 ? 83.253  47.840  12.318  1.00 22.54 ? 169  HIS A CG    1 
ATOM   619  N  ND1   . HIS A 1 135 ? 84.200  48.415  13.141  1.00 22.66 ? 169  HIS A ND1   1 
ATOM   620  C  CD2   . HIS A 1 135 ? 83.894  47.515  11.171  1.00 22.31 ? 169  HIS A CD2   1 
ATOM   621  C  CE1   . HIS A 1 135 ? 85.365  48.426  12.521  1.00 23.06 ? 169  HIS A CE1   1 
ATOM   622  N  NE2   . HIS A 1 135 ? 85.208  47.884  11.325  1.00 23.34 ? 169  HIS A NE2   1 
ATOM   623  N  N     . LEU A 1 136 ? 80.230  48.973  10.261  1.00 21.74 ? 170  LEU A N     1 
ATOM   624  C  CA    . LEU A 1 136 ? 80.184  49.476  8.886   1.00 21.89 ? 170  LEU A CA    1 
ATOM   625  C  C     . LEU A 1 136 ? 79.710  50.936  8.842   1.00 22.18 ? 170  LEU A C     1 
ATOM   626  O  O     . LEU A 1 136 ? 80.152  51.726  7.996   1.00 21.82 ? 170  LEU A O     1 
ATOM   627  C  CB    . LEU A 1 136 ? 79.285  48.598  8.018   1.00 21.67 ? 170  LEU A CB    1 
ATOM   628  C  CG    . LEU A 1 136 ? 79.679  47.117  7.974   1.00 21.66 ? 170  LEU A CG    1 
ATOM   629  C  CD1   . LEU A 1 136 ? 78.706  46.294  7.120   1.00 20.28 ? 170  LEU A CD1   1 
ATOM   630  C  CD2   . LEU A 1 136 ? 81.106  46.979  7.475   1.00 20.89 ? 170  LEU A CD2   1 
ATOM   631  N  N     . ILE A 1 137 ? 78.820  51.292  9.765   1.00 22.52 ? 171  ILE A N     1 
ATOM   632  C  CA    . ILE A 1 137 ? 78.332  52.661  9.855   1.00 22.69 ? 171  ILE A CA    1 
ATOM   633  C  C     . ILE A 1 137 ? 79.443  53.550  10.427  1.00 22.94 ? 171  ILE A C     1 
ATOM   634  O  O     . ILE A 1 137 ? 79.833  54.541  9.804   1.00 22.84 ? 171  ILE A O     1 
ATOM   635  C  CB    . ILE A 1 137 ? 77.042  52.745  10.682  1.00 22.60 ? 171  ILE A CB    1 
ATOM   636  C  CG1   . ILE A 1 137 ? 75.918  51.967  9.973   1.00 22.62 ? 171  ILE A CG1   1 
ATOM   637  C  CG2   . ILE A 1 137 ? 76.633  54.196  10.875  1.00 22.35 ? 171  ILE A CG2   1 
ATOM   638  C  CD1   . ILE A 1 137 ? 74.659  51.736  10.823  1.00 21.51 ? 171  ILE A CD1   1 
ATOM   639  N  N     . ASN A 1 138 ? 79.975  53.158  11.585  1.00 23.22 ? 172  ASN A N     1 
ATOM   640  C  CA    . ASN A 1 138 ? 81.124  53.834  12.208  1.00 23.24 ? 172  ASN A CA    1 
ATOM   641  C  C     . ASN A 1 138 ? 82.240  54.209  11.237  1.00 23.36 ? 172  ASN A C     1 
ATOM   642  O  O     . ASN A 1 138 ? 82.824  55.281  11.354  1.00 23.84 ? 172  ASN A O     1 
ATOM   643  C  CB    . ASN A 1 138 ? 81.735  52.946  13.300  1.00 23.38 ? 172  ASN A CB    1 
ATOM   644  C  CG    . ASN A 1 138 ? 80.883  52.867  14.553  1.00 23.14 ? 172  ASN A CG    1 
ATOM   645  O  OD1   . ASN A 1 138 ? 79.846  53.512  14.664  1.00 23.31 ? 172  ASN A OD1   1 
ATOM   646  N  ND2   . ASN A 1 138 ? 81.327  52.067  15.507  1.00 23.79 ? 172  ASN A ND2   1 
ATOM   647  N  N     . THR A 1 139 ? 82.538  53.316  10.294  1.00 23.54 ? 173  THR A N     1 
ATOM   648  C  CA    . THR A 1 139 ? 83.642  53.486  9.353   1.00 23.36 ? 173  THR A CA    1 
ATOM   649  C  C     . THR A 1 139 ? 83.164  53.616  7.895   1.00 23.79 ? 173  THR A C     1 
ATOM   650  O  O     . THR A 1 139 ? 83.853  53.192  6.966   1.00 23.34 ? 173  THR A O     1 
ATOM   651  C  CB    . THR A 1 139 ? 84.617  52.299  9.464   1.00 23.34 ? 173  THR A CB    1 
ATOM   652  O  OG1   . THR A 1 139 ? 83.956  51.096  9.051   1.00 23.15 ? 173  THR A OG1   1 
ATOM   653  C  CG2   . THR A 1 139 ? 85.118  52.141  10.900  1.00 22.73 ? 173  THR A CG2   1 
ATOM   654  N  N     . LYS A 1 140 ? 82.001  54.232  7.693   1.00 24.59 ? 174  LYS A N     1 
ATOM   655  C  CA    . LYS A 1 140 ? 81.366  54.254  6.364   1.00 25.22 ? 174  LYS A CA    1 
ATOM   656  C  C     . LYS A 1 140 ? 82.193  54.914  5.246   1.00 25.98 ? 174  LYS A C     1 
ATOM   657  O  O     . LYS A 1 140 ? 82.095  54.487  4.094   1.00 26.09 ? 174  LYS A O     1 
ATOM   658  C  CB    . LYS A 1 140 ? 79.956  54.863  6.424   1.00 25.24 ? 174  LYS A CB    1 
ATOM   659  C  CG    . LYS A 1 140 ? 79.881  56.322  6.864   1.00 25.76 ? 174  LYS A CG    1 
ATOM   660  C  CD    . LYS A 1 140 ? 78.436  56.790  7.093   1.00 26.14 ? 174  LYS A CD    1 
ATOM   661  C  CE    . LYS A 1 140 ? 77.655  56.958  5.784   1.00 26.05 ? 174  LYS A CE    1 
ATOM   662  N  NZ    . LYS A 1 140 ? 76.204  57.270  6.025   1.00 25.64 ? 174  LYS A NZ    1 
ATOM   663  N  N     . PHE A 1 141 ? 82.999  55.934  5.572   1.00 26.58 ? 175  PHE A N     1 
ATOM   664  C  CA    . PHE A 1 141 ? 83.788  56.654  4.547   1.00 27.12 ? 175  PHE A CA    1 
ATOM   665  C  C     . PHE A 1 141 ? 85.144  56.002  4.240   1.00 27.34 ? 175  PHE A C     1 
ATOM   666  O  O     . PHE A 1 141 ? 85.807  56.384  3.275   1.00 27.56 ? 175  PHE A O     1 
ATOM   667  C  CB    . PHE A 1 141 ? 84.002  58.133  4.930   1.00 27.24 ? 175  PHE A CB    1 
ATOM   668  C  CG    . PHE A 1 141 ? 82.722  58.879  5.217   1.00 27.72 ? 175  PHE A CG    1 
ATOM   669  C  CD1   . PHE A 1 141 ? 81.829  59.178  4.190   1.00 28.13 ? 175  PHE A CD1   1 
ATOM   670  C  CD2   . PHE A 1 141 ? 82.405  59.273  6.517   1.00 28.18 ? 175  PHE A CD2   1 
ATOM   671  C  CE1   . PHE A 1 141 ? 80.636  59.857  4.454   1.00 28.30 ? 175  PHE A CE1   1 
ATOM   672  C  CE2   . PHE A 1 141 ? 81.215  59.949  6.789   1.00 28.42 ? 175  PHE A CE2   1 
ATOM   673  C  CZ    . PHE A 1 141 ? 80.332  60.244  5.755   1.00 28.31 ? 175  PHE A CZ    1 
ATOM   674  N  N     . ASP A 1 142 ? 85.549  55.026  5.051   1.00 27.48 ? 176  ASP A N     1 
ATOM   675  C  CA    . ASP A 1 142 ? 86.844  54.360  4.890   1.00 27.49 ? 176  ASP A CA    1 
ATOM   676  C  C     . ASP A 1 142 ? 86.675  53.038  4.160   1.00 26.85 ? 176  ASP A C     1 
ATOM   677  O  O     . ASP A 1 142 ? 85.904  52.187  4.598   1.00 26.52 ? 176  ASP A O     1 
ATOM   678  C  CB    . ASP A 1 142 ? 87.480  54.100  6.257   1.00 27.73 ? 176  ASP A CB    1 
ATOM   679  C  CG    . ASP A 1 142 ? 87.591  55.357  7.094   1.00 29.32 ? 176  ASP A CG    1 
ATOM   680  O  OD1   . ASP A 1 142 ? 88.276  56.307  6.651   1.00 30.76 ? 176  ASP A OD1   1 
ATOM   681  O  OD2   . ASP A 1 142 ? 86.992  55.396  8.195   1.00 31.87 ? 176  ASP A OD2   1 
ATOM   682  N  N     . SER A 1 143 ? 87.386  52.883  3.043   1.00 26.40 ? 177  SER A N     1 
ATOM   683  C  CA    . SER A 1 143 ? 87.450  51.617  2.314   1.00 26.09 ? 177  SER A CA    1 
ATOM   684  C  C     . SER A 1 143 ? 86.054  51.094  1.962   1.00 25.88 ? 177  SER A C     1 
ATOM   685  O  O     . SER A 1 143 ? 85.770  49.901  2.103   1.00 25.78 ? 177  SER A O     1 
ATOM   686  C  CB    . SER A 1 143 ? 88.213  50.580  3.157   1.00 26.10 ? 177  SER A CB    1 
ATOM   687  O  OG    . SER A 1 143 ? 89.397  51.138  3.707   1.00 25.66 ? 177  SER A OG    1 
ATOM   688  N  N     . GLN A 1 144 ? 85.188  51.994  1.499   1.00 25.51 ? 178  GLN A N     1 
ATOM   689  C  CA    . GLN A 1 144 ? 83.760  51.686  1.362   1.00 25.47 ? 178  GLN A CA    1 
ATOM   690  C  C     . GLN A 1 144 ? 83.414  50.595  0.328   1.00 24.88 ? 178  GLN A C     1 
ATOM   691  O  O     . GLN A 1 144 ? 82.313  50.041  0.360   1.00 25.07 ? 178  GLN A O     1 
ATOM   692  C  CB    . GLN A 1 144 ? 82.937  52.960  1.094   1.00 25.68 ? 178  GLN A CB    1 
ATOM   693  C  CG    . GLN A 1 144 ? 83.227  53.690  -0.225  1.00 26.79 ? 178  GLN A CG    1 
ATOM   694  C  CD    . GLN A 1 144 ? 84.308  54.759  -0.097  1.00 27.82 ? 178  GLN A CD    1 
ATOM   695  O  OE1   . GLN A 1 144 ? 85.236  54.637  0.713   1.00 28.12 ? 178  GLN A OE1   1 
ATOM   696  N  NE2   . GLN A 1 144 ? 84.194  55.810  -0.906  1.00 27.26 ? 178  GLN A NE2   1 
ATOM   697  N  N     . TYR A 1 145 ? 84.337  50.291  -0.578  1.00 24.02 ? 179  TYR A N     1 
ATOM   698  C  CA    . TYR A 1 145 ? 84.129  49.223  -1.546  1.00 23.53 ? 179  TYR A CA    1 
ATOM   699  C  C     . TYR A 1 145 ? 84.821  47.930  -1.121  1.00 22.73 ? 179  TYR A C     1 
ATOM   700  O  O     . TYR A 1 145 ? 85.045  47.058  -1.964  1.00 22.61 ? 179  TYR A O     1 
ATOM   701  C  CB    . TYR A 1 145 ? 84.657  49.631  -2.922  1.00 23.63 ? 179  TYR A CB    1 
ATOM   702  C  CG    . TYR A 1 145 ? 84.194  50.989  -3.387  1.00 24.59 ? 179  TYR A CG    1 
ATOM   703  C  CD1   . TYR A 1 145 ? 82.837  51.257  -3.577  1.00 25.64 ? 179  TYR A CD1   1 
ATOM   704  C  CD2   . TYR A 1 145 ? 85.112  52.001  -3.656  1.00 24.76 ? 179  TYR A CD2   1 
ATOM   705  C  CE1   . TYR A 1 145 ? 82.405  52.504  -4.012  1.00 26.18 ? 179  TYR A CE1   1 
ATOM   706  C  CE2   . TYR A 1 145 ? 84.691  53.250  -4.091  1.00 25.85 ? 179  TYR A CE2   1 
ATOM   707  C  CZ    . TYR A 1 145 ? 83.339  53.496  -4.263  1.00 26.40 ? 179  TYR A CZ    1 
ATOM   708  O  OH    . TYR A 1 145 ? 82.928  54.731  -4.696  1.00 28.17 ? 179  TYR A OH    1 
ATOM   709  N  N     . MET A 1 146 ? 85.147  47.797  0.165   1.00 21.67 ? 180  MET A N     1 
ATOM   710  C  CA    . MET A 1 146 ? 85.939  46.659  0.634   1.00 21.30 ? 180  MET A CA    1 
ATOM   711  C  C     . MET A 1 146 ? 85.221  45.795  1.671   1.00 20.95 ? 180  MET A C     1 
ATOM   712  O  O     . MET A 1 146 ? 84.447  46.296  2.496   1.00 21.17 ? 180  MET A O     1 
ATOM   713  C  CB    . MET A 1 146 ? 87.278  47.137  1.202   1.00 21.09 ? 180  MET A CB    1 
ATOM   714  C  CG    . MET A 1 146 ? 88.132  47.903  0.209   1.00 20.39 ? 180  MET A CG    1 
ATOM   715  S  SD    . MET A 1 146 ? 88.592  46.964  -1.261  1.00 19.70 ? 180  MET A SD    1 
ATOM   716  C  CE    . MET A 1 146 ? 89.415  48.252  -2.189  1.00 16.69 ? 180  MET A CE    1 
ATOM   717  N  N     . VAL A 1 147 ? 85.492  44.492  1.620   1.00 20.25 ? 181  VAL A N     1 
ATOM   718  C  CA    . VAL A 1 147 ? 84.940  43.547  2.591   1.00 19.51 ? 181  VAL A CA    1 
ATOM   719  C  C     . VAL A 1 147 ? 85.525  43.848  3.956   1.00 19.41 ? 181  VAL A C     1 
ATOM   720  O  O     . VAL A 1 147 ? 86.729  43.754  4.145   1.00 19.75 ? 181  VAL A O     1 
ATOM   721  C  CB    . VAL A 1 147 ? 85.258  42.081  2.222   1.00 19.27 ? 181  VAL A CB    1 
ATOM   722  C  CG1   . VAL A 1 147 ? 84.705  41.133  3.272   1.00 18.77 ? 181  VAL A CG1   1 
ATOM   723  C  CG2   . VAL A 1 147 ? 84.713  41.735  0.842   1.00 17.22 ? 181  VAL A CG2   1 
ATOM   724  N  N     . LYS A 1 148 ? 84.670  44.225  4.901   1.00 19.65 ? 182  LYS A N     1 
ATOM   725  C  CA    . LYS A 1 148 ? 85.088  44.504  6.273   1.00 19.67 ? 182  LYS A CA    1 
ATOM   726  C  C     . LYS A 1 148 ? 84.715  43.406  7.274   1.00 19.38 ? 182  LYS A C     1 
ATOM   727  O  O     . LYS A 1 148 ? 85.254  43.374  8.374   1.00 19.51 ? 182  LYS A O     1 
ATOM   728  C  CB    . LYS A 1 148 ? 84.459  45.810  6.746   1.00 19.93 ? 182  LYS A CB    1 
ATOM   729  C  CG    . LYS A 1 148 ? 84.721  47.006  5.850   1.00 20.64 ? 182  LYS A CG    1 
ATOM   730  C  CD    . LYS A 1 148 ? 84.440  48.292  6.604   1.00 21.16 ? 182  LYS A CD    1 
ATOM   731  C  CE    . LYS A 1 148 ? 84.541  49.509  5.715   1.00 21.28 ? 182  LYS A CE    1 
ATOM   732  N  NZ    . LYS A 1 148 ? 84.298  50.723  6.530   1.00 21.97 ? 182  LYS A NZ    1 
ATOM   733  N  N     . ALA A 1 149 ? 83.773  42.537  6.915   1.00 18.97 ? 183  ALA A N     1 
ATOM   734  C  CA    . ALA A 1 149 ? 83.329  41.454  7.809   1.00 18.46 ? 183  ALA A CA    1 
ATOM   735  C  C     . ALA A 1 149 ? 83.184  40.159  7.010   1.00 18.21 ? 183  ALA A C     1 
ATOM   736  O  O     . ALA A 1 149 ? 82.519  40.141  5.962   1.00 18.31 ? 183  ALA A O     1 
ATOM   737  C  CB    . ALA A 1 149 ? 82.018  41.810  8.458   1.00 18.08 ? 183  ALA A CB    1 
ATOM   738  N  N     . VAL A 1 150 ? 83.817  39.091  7.493   1.00 17.42 ? 184  VAL A N     1 
ATOM   739  C  CA    . VAL A 1 150 ? 83.740  37.792  6.846   1.00 16.97 ? 184  VAL A CA    1 
ATOM   740  C  C     . VAL A 1 150 ? 83.147  36.785  7.819   1.00 16.64 ? 184  VAL A C     1 
ATOM   741  O  O     . VAL A 1 150 ? 83.761  36.463  8.821   1.00 15.99 ? 184  VAL A O     1 
ATOM   742  C  CB    . VAL A 1 150 ? 85.122  37.297  6.400   1.00 17.14 ? 184  VAL A CB    1 
ATOM   743  C  CG1   . VAL A 1 150 ? 85.027  35.866  5.876   1.00 16.67 ? 184  VAL A CG1   1 
ATOM   744  C  CG2   . VAL A 1 150 ? 85.710  38.236  5.356   1.00 16.31 ? 184  VAL A CG2   1 
ATOM   745  N  N     . ILE A 1 151 ? 81.945  36.309  7.502   1.00 16.67 ? 185  ILE A N     1 
ATOM   746  C  CA    . ILE A 1 151 ? 81.236  35.313  8.291   1.00 16.47 ? 185  ILE A CA    1 
ATOM   747  C  C     . ILE A 1 151 ? 81.391  33.947  7.619   1.00 16.43 ? 185  ILE A C     1 
ATOM   748  O  O     . ILE A 1 151 ? 81.053  33.777  6.428   1.00 15.92 ? 185  ILE A O     1 
ATOM   749  C  CB    . ILE A 1 151 ? 79.730  35.650  8.384   1.00 16.72 ? 185  ILE A CB    1 
ATOM   750  C  CG1   . ILE A 1 151 ? 79.533  37.123  8.767   1.00 17.38 ? 185  ILE A CG1   1 
ATOM   751  C  CG2   . ILE A 1 151 ? 79.029  34.736  9.372   1.00 15.87 ? 185  ILE A CG2   1 
ATOM   752  C  CD1   . ILE A 1 151 ? 78.063  37.543  8.882   1.00 17.64 ? 185  ILE A CD1   1 
ATOM   753  N  N     . VAL A 1 152 ? 81.909  32.978  8.375   1.00 16.17 ? 186  VAL A N     1 
ATOM   754  C  CA    . VAL A 1 152 ? 82.105  31.611  7.868   1.00 16.11 ? 186  VAL A CA    1 
ATOM   755  C  C     . VAL A 1 152 ? 81.145  30.665  8.579   1.00 15.86 ? 186  VAL A C     1 
ATOM   756  O  O     . VAL A 1 152 ? 80.878  30.849  9.761   1.00 16.50 ? 186  VAL A O     1 
ATOM   757  C  CB    . VAL A 1 152 ? 83.569  31.150  8.061   1.00 15.84 ? 186  VAL A CB    1 
ATOM   758  C  CG1   . VAL A 1 152 ? 83.785  29.764  7.486   1.00 15.27 ? 186  VAL A CG1   1 
ATOM   759  C  CG2   . VAL A 1 152 ? 84.512  32.147  7.404   1.00 15.68 ? 186  VAL A CG2   1 
ATOM   760  N  N     . ALA A 1 153 ? 80.616  29.673  7.861   1.00 15.60 ? 187  ALA A N     1 
ATOM   761  C  CA    . ALA A 1 153 ? 79.740  28.657  8.466   1.00 15.41 ? 187  ALA A CA    1 
ATOM   762  C  C     . ALA A 1 153 ? 80.018  27.267  7.908   1.00 15.11 ? 187  ALA A C     1 
ATOM   763  O  O     . ALA A 1 153 ? 80.549  27.148  6.805   1.00 15.11 ? 187  ALA A O     1 
ATOM   764  C  CB    . ALA A 1 153 ? 78.280  29.021  8.259   1.00 15.46 ? 187  ALA A CB    1 
ATOM   765  N  N     . PRO A 1 154 ? 79.649  26.209  8.662   1.00 14.74 ? 188  PRO A N     1 
ATOM   766  C  CA    . PRO A 1 154 ? 79.992  24.835  8.292   1.00 14.65 ? 188  PRO A CA    1 
ATOM   767  C  C     . PRO A 1 154 ? 79.184  24.203  7.171   1.00 14.59 ? 188  PRO A C     1 
ATOM   768  O  O     . PRO A 1 154 ? 79.629  23.197  6.609   1.00 14.69 ? 188  PRO A O     1 
ATOM   769  C  CB    . PRO A 1 154 ? 79.753  24.062  9.580   1.00 14.65 ? 188  PRO A CB    1 
ATOM   770  C  CG    . PRO A 1 154 ? 78.702  24.844  10.277  1.00 15.01 ? 188  PRO A CG    1 
ATOM   771  C  CD    . PRO A 1 154 ? 79.019  26.263  9.990   1.00 14.75 ? 188  PRO A CD    1 
ATOM   772  N  N     . THR A 1 155 ? 78.007  24.752  6.872   1.00 14.67 ? 189  THR A N     1 
ATOM   773  C  CA    . THR A 1 155 ? 77.203  24.294  5.739   1.00 14.45 ? 189  THR A CA    1 
ATOM   774  C  C     . THR A 1 155 ? 76.748  25.471  4.893   1.00 14.59 ? 189  THR A C     1 
ATOM   775  O  O     . THR A 1 155 ? 76.661  26.612  5.377   1.00 14.58 ? 189  THR A O     1 
ATOM   776  C  CB    . THR A 1 155 ? 75.957  23.478  6.169   1.00 14.72 ? 189  THR A CB    1 
ATOM   777  O  OG1   . THR A 1 155 ? 74.919  24.367  6.611   1.00 14.10 ? 189  THR A OG1   1 
ATOM   778  C  CG2   . THR A 1 155 ? 76.307  22.441  7.287   1.00 13.93 ? 189  THR A CG2   1 
ATOM   779  N  N     . ARG A 1 156 ? 76.459  25.170  3.629   1.00 14.21 ? 190  ARG A N     1 
ATOM   780  C  CA    . ARG A 1 156 ? 76.104  26.168  2.646   1.00 14.53 ? 190  ARG A CA    1 
ATOM   781  C  C     . ARG A 1 156 ? 74.792  26.799  3.017   1.00 14.96 ? 190  ARG A C     1 
ATOM   782  O  O     . ARG A 1 156 ? 74.652  28.019  2.983   1.00 14.97 ? 190  ARG A O     1 
ATOM   783  C  CB    . ARG A 1 156 ? 75.942  25.529  1.262   1.00 14.48 ? 190  ARG A CB    1 
ATOM   784  C  CG    . ARG A 1 156 ? 77.182  24.895  0.702   1.00 14.42 ? 190  ARG A CG    1 
ATOM   785  C  CD    . ARG A 1 156 ? 76.803  23.909  -0.394  1.00 15.91 ? 190  ARG A CD    1 
ATOM   786  N  NE    . ARG A 1 156 ? 77.969  23.359  -1.080  1.00 15.62 ? 190  ARG A NE    1 
ATOM   787  C  CZ    . ARG A 1 156 ? 77.914  22.549  -2.132  1.00 14.88 ? 190  ARG A CZ    1 
ATOM   788  N  NH1   . ARG A 1 156 ? 76.749  22.177  -2.639  1.00 14.98 ? 190  ARG A NH1   1 
ATOM   789  N  NH2   . ARG A 1 156 ? 79.039  22.113  -2.684  1.00 14.17 ? 190  ARG A NH2   1 
ATOM   790  N  N     . ASP A 1 157 ? 73.832  25.946  3.370   1.00 15.53 ? 191  ASP A N     1 
ATOM   791  C  CA    . ASP A 1 157 ? 72.495  26.385  3.736   1.00 16.01 ? 191  ASP A CA    1 
ATOM   792  C  C     . ASP A 1 157 ? 72.485  27.285  4.957   1.00 15.98 ? 191  ASP A C     1 
ATOM   793  O  O     . ASP A 1 157 ? 71.586  28.103  5.094   1.00 16.63 ? 191  ASP A O     1 
ATOM   794  C  CB    . ASP A 1 157 ? 71.582  25.196  3.993   1.00 16.35 ? 191  ASP A CB    1 
ATOM   795  C  CG    . ASP A 1 157 ? 71.735  24.115  2.951   1.00 17.56 ? 191  ASP A CG    1 
ATOM   796  O  OD1   . ASP A 1 157 ? 71.321  24.348  1.790   1.00 19.73 ? 191  ASP A OD1   1 
ATOM   797  O  OD2   . ASP A 1 157 ? 72.284  23.037  3.305   1.00 17.35 ? 191  ASP A OD2   1 
ATOM   798  N  N     . LEU A 1 158 ? 73.454  27.148  5.848   1.00 16.08 ? 192  LEU A N     1 
ATOM   799  C  CA    . LEU A 1 158 ? 73.536  28.073  6.989   1.00 16.83 ? 192  LEU A CA    1 
ATOM   800  C  C     . LEU A 1 158 ? 74.169  29.407  6.528   1.00 17.19 ? 192  LEU A C     1 
ATOM   801  O  O     . LEU A 1 158 ? 73.799  30.471  7.006   1.00 17.86 ? 192  LEU A O     1 
ATOM   802  C  CB    . LEU A 1 158 ? 74.296  27.450  8.167   1.00 16.23 ? 192  LEU A CB    1 
ATOM   803  C  CG    . LEU A 1 158 ? 74.407  28.265  9.464   1.00 17.20 ? 192  LEU A CG    1 
ATOM   804  C  CD1   . LEU A 1 158 ? 73.044  28.688  10.048  1.00 15.20 ? 192  LEU A CD1   1 
ATOM   805  C  CD2   . LEU A 1 158 ? 75.215  27.491  10.518  1.00 15.52 ? 192  LEU A CD2   1 
ATOM   806  N  N     . ALA A 1 159 ? 75.108  29.347  5.588   1.00 17.20 ? 193  ALA A N     1 
ATOM   807  C  CA    . ALA A 1 159 ? 75.660  30.558  4.985   1.00 16.81 ? 193  ALA A CA    1 
ATOM   808  C  C     . ALA A 1 159 ? 74.541  31.322  4.276   1.00 16.77 ? 193  ALA A C     1 
ATOM   809  O  O     . ALA A 1 159 ? 74.422  32.543  4.408   1.00 16.48 ? 193  ALA A O     1 
ATOM   810  C  CB    . ALA A 1 159 ? 76.756  30.210  4.007   1.00 16.31 ? 193  ALA A CB    1 
ATOM   811  N  N     . LEU A 1 160 ? 73.724  30.594  3.522   1.00 16.66 ? 194  LEU A N     1 
ATOM   812  C  CA    . LEU A 1 160 ? 72.622  31.209  2.799   1.00 16.57 ? 194  LEU A CA    1 
ATOM   813  C  C     . LEU A 1 160 ? 71.526  31.712  3.747   1.00 16.86 ? 194  LEU A C     1 
ATOM   814  O  O     . LEU A 1 160 ? 70.853  32.685  3.442   1.00 17.43 ? 194  LEU A O     1 
ATOM   815  C  CB    . LEU A 1 160 ? 72.063  30.260  1.746   1.00 16.10 ? 194  LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 160 ? 73.026  29.891  0.615   1.00 15.40 ? 194  LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 160 ? 72.385  28.860  -0.315  1.00 14.65 ? 194  LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 160 ? 73.486  31.106  -0.189  1.00 13.40 ? 194  LEU A CD2   1 
ATOM   819  N  N     . GLN A 1 161 ? 71.370  31.086  4.910   1.00 17.33 ? 195  GLN A N     1 
ATOM   820  C  CA    . GLN A 1 161 ? 70.429  31.589  5.916   1.00 17.39 ? 195  GLN A CA    1 
ATOM   821  C  C     . GLN A 1 161 ? 70.907  32.909  6.527   1.00 17.78 ? 195  GLN A C     1 
ATOM   822  O  O     . GLN A 1 161 ? 70.099  33.787  6.794   1.00 17.97 ? 195  GLN A O     1 
ATOM   823  C  CB    . GLN A 1 161 ? 70.208  30.561  7.030   1.00 17.27 ? 195  GLN A CB    1 
ATOM   824  C  CG    . GLN A 1 161 ? 69.292  31.048  8.139   1.00 16.62 ? 195  GLN A CG    1 
ATOM   825  C  CD    . GLN A 1 161 ? 69.034  30.008  9.192   1.00 16.97 ? 195  GLN A CD    1 
ATOM   826  O  OE1   . GLN A 1 161 ? 68.124  29.195  9.054   1.00 18.85 ? 195  GLN A OE1   1 
ATOM   827  N  NE2   . GLN A 1 161 ? 69.808  30.044  10.273  1.00 17.61 ? 195  GLN A NE2   1 
ATOM   828  N  N     . ILE A 1 162 ? 72.206  33.038  6.775   1.00 18.18 ? 196  ILE A N     1 
ATOM   829  C  CA    . ILE A 1 162 ? 72.731  34.240  7.416   1.00 18.65 ? 196  ILE A CA    1 
ATOM   830  C  C     . ILE A 1 162 ? 72.611  35.416  6.455   1.00 19.15 ? 196  ILE A C     1 
ATOM   831  O  O     . ILE A 1 162 ? 72.124  36.479  6.834   1.00 19.24 ? 196  ILE A O     1 
ATOM   832  C  CB    . ILE A 1 162 ? 74.182  34.056  7.932   1.00 18.95 ? 196  ILE A CB    1 
ATOM   833  C  CG1   . ILE A 1 162 ? 74.239  32.942  8.995   1.00 18.48 ? 196  ILE A CG1   1 
ATOM   834  C  CG2   . ILE A 1 162 ? 74.695  35.341  8.579   1.00 18.44 ? 196  ILE A CG2   1 
ATOM   835  C  CD1   . ILE A 1 162 ? 75.629  32.357  9.205   1.00 17.41 ? 196  ILE A CD1   1 
ATOM   836  N  N     . GLU A 1 163 ? 73.005  35.215  5.200   1.00 19.78 ? 197  GLU A N     1 
ATOM   837  C  CA    . GLU A 1 163 ? 72.772  36.211  4.162   1.00 19.86 ? 197  GLU A CA    1 
ATOM   838  C  C     . GLU A 1 163 ? 71.324  36.657  4.198   1.00 20.17 ? 197  GLU A C     1 
ATOM   839  O  O     . GLU A 1 163 ? 71.038  37.850  4.118   1.00 20.98 ? 197  GLU A O     1 
ATOM   840  C  CB    . GLU A 1 163 ? 73.086  35.645  2.775   1.00 20.06 ? 197  GLU A CB    1 
ATOM   841  C  CG    . GLU A 1 163 ? 73.013  36.680  1.646   1.00 20.08 ? 197  GLU A CG    1 
ATOM   842  C  CD    . GLU A 1 163 ? 73.154  36.086  0.249   1.00 20.45 ? 197  GLU A CD    1 
ATOM   843  O  OE1   . GLU A 1 163 ? 72.895  34.887  0.051   1.00 21.80 ? 197  GLU A OE1   1 
ATOM   844  O  OE2   . GLU A 1 163 ? 73.527  36.829  -0.671  1.00 22.47 ? 197  GLU A OE2   1 
ATOM   845  N  N     . ALA A 1 164 ? 70.410  35.701  4.318   1.00 20.30 ? 198  ALA A N     1 
ATOM   846  C  CA    . ALA A 1 164 ? 68.981  36.000  4.261   1.00 20.34 ? 198  ALA A CA    1 
ATOM   847  C  C     . ALA A 1 164 ? 68.595  36.953  5.373   1.00 20.65 ? 198  ALA A C     1 
ATOM   848  O  O     . ALA A 1 164 ? 67.780  37.855  5.157   1.00 20.65 ? 198  ALA A O     1 
ATOM   849  C  CB    . ALA A 1 164 ? 68.151  34.723  4.348   1.00 19.87 ? 198  ALA A CB    1 
ATOM   850  N  N     . GLU A 1 165 ? 69.175  36.733  6.559   1.00 20.77 ? 199  GLU A N     1 
ATOM   851  C  CA    . GLU A 1 165 ? 68.918  37.569  7.713   1.00 20.93 ? 199  GLU A CA    1 
ATOM   852  C  C     . GLU A 1 165 ? 69.481  38.964  7.469   1.00 21.23 ? 199  GLU A C     1 
ATOM   853  O  O     . GLU A 1 165 ? 68.816  39.960  7.764   1.00 21.77 ? 199  GLU A O     1 
ATOM   854  C  CB    . GLU A 1 165 ? 69.537  36.966  8.984   1.00 21.14 ? 199  GLU A CB    1 
ATOM   855  C  CG    . GLU A 1 165 ? 68.954  35.617  9.404   1.00 21.44 ? 199  GLU A CG    1 
ATOM   856  C  CD    . GLU A 1 165 ? 67.463  35.677  9.715   1.00 21.28 ? 199  GLU A CD    1 
ATOM   857  O  OE1   . GLU A 1 165 ? 67.054  36.551  10.508  1.00 22.30 ? 199  GLU A OE1   1 
ATOM   858  O  OE2   . GLU A 1 165 ? 66.702  34.858  9.153   1.00 21.34 ? 199  GLU A OE2   1 
ATOM   859  N  N     . VAL A 1 166 ? 70.696  39.040  6.928   1.00 20.81 ? 200  VAL A N     1 
ATOM   860  C  CA    . VAL A 1 166 ? 71.234  40.314  6.499   1.00 20.72 ? 200  VAL A CA    1 
ATOM   861  C  C     . VAL A 1 166 ? 70.274  41.005  5.511   1.00 21.18 ? 200  VAL A C     1 
ATOM   862  O  O     . VAL A 1 166 ? 70.084  42.211  5.594   1.00 20.99 ? 200  VAL A O     1 
ATOM   863  C  CB    . VAL A 1 166 ? 72.645  40.179  5.881   1.00 20.53 ? 200  VAL A CB    1 
ATOM   864  C  CG1   . VAL A 1 166 ? 73.003  41.425  5.045   1.00 19.58 ? 200  VAL A CG1   1 
ATOM   865  C  CG2   . VAL A 1 166 ? 73.672  39.937  6.969   1.00 19.73 ? 200  VAL A CG2   1 
ATOM   866  N  N     . LYS A 1 167 ? 69.670  40.256  4.592   1.00 21.51 ? 201  LYS A N     1 
ATOM   867  C  CA    . LYS A 1 167 ? 68.702  40.863  3.667   1.00 22.26 ? 201  LYS A CA    1 
ATOM   868  C  C     . LYS A 1 167 ? 67.439  41.337  4.388   1.00 22.25 ? 201  LYS A C     1 
ATOM   869  O  O     . LYS A 1 167 ? 66.839  42.331  3.978   1.00 22.25 ? 201  LYS A O     1 
ATOM   870  C  CB    . LYS A 1 167 ? 68.337  39.929  2.505   1.00 22.56 ? 201  LYS A CB    1 
ATOM   871  C  CG    . LYS A 1 167 ? 69.524  39.560  1.606   1.00 24.61 ? 201  LYS A CG    1 
ATOM   872  C  CD    . LYS A 1 167 ? 69.107  39.329  0.142   1.00 27.27 ? 201  LYS A CD    1 
ATOM   873  C  CE    . LYS A 1 167 ? 70.228  38.660  -0.681  1.00 28.75 ? 201  LYS A CE    1 
ATOM   874  N  NZ    . LYS A 1 167 ? 69.916  38.625  -2.160  1.00 30.57 ? 201  LYS A NZ    1 
ATOM   875  N  N     . LYS A 1 168 ? 67.045  40.640  5.457   1.00 22.47 ? 202  LYS A N     1 
ATOM   876  C  CA    . LYS A 1 168 ? 65.922  41.083  6.302   1.00 22.62 ? 202  LYS A CA    1 
ATOM   877  C  C     . LYS A 1 168 ? 66.206  42.423  7.014   1.00 22.82 ? 202  LYS A C     1 
ATOM   878  O  O     . LYS A 1 168 ? 65.302  43.246  7.169   1.00 22.51 ? 202  LYS A O     1 
ATOM   879  C  CB    . LYS A 1 168 ? 65.542  40.018  7.334   1.00 22.50 ? 202  LYS A CB    1 
ATOM   880  C  CG    . LYS A 1 168 ? 64.723  38.856  6.770   1.00 22.80 ? 202  LYS A CG    1 
ATOM   881  C  CD    . LYS A 1 168 ? 64.525  37.767  7.827   1.00 23.07 ? 202  LYS A CD    1 
ATOM   882  C  CE    . LYS A 1 168 ? 64.056  36.464  7.209   1.00 23.28 ? 202  LYS A CE    1 
ATOM   883  N  NZ    . LYS A 1 168 ? 63.935  35.379  8.217   1.00 22.08 ? 202  LYS A NZ    1 
ATOM   884  N  N     . ILE A 1 169 ? 67.449  42.628  7.451   1.00 22.92 ? 203  ILE A N     1 
ATOM   885  C  CA    . ILE A 1 169 ? 67.866  43.915  8.010   1.00 23.05 ? 203  ILE A CA    1 
ATOM   886  C  C     . ILE A 1 169 ? 67.767  45.003  6.934   1.00 23.03 ? 203  ILE A C     1 
ATOM   887  O  O     . ILE A 1 169 ? 67.259  46.097  7.187   1.00 22.75 ? 203  ILE A O     1 
ATOM   888  C  CB    . ILE A 1 169 ? 69.290  43.846  8.587   1.00 23.24 ? 203  ILE A CB    1 
ATOM   889  C  CG1   . ILE A 1 169 ? 69.294  42.987  9.847   1.00 23.60 ? 203  ILE A CG1   1 
ATOM   890  C  CG2   . ILE A 1 169 ? 69.821  45.232  8.926   1.00 23.04 ? 203  ILE A CG2   1 
ATOM   891  C  CD1   . ILE A 1 169 ? 70.679  42.802  10.453  1.00 24.50 ? 203  ILE A CD1   1 
ATOM   892  N  N     . HIS A 1 170 ? 68.209  44.676  5.726   1.00 23.13 ? 204  HIS A N     1 
ATOM   893  C  CA    . HIS A 1 170 ? 68.093  45.590  4.593   1.00 23.29 ? 204  HIS A CA    1 
ATOM   894  C  C     . HIS A 1 170 ? 66.650  46.010  4.286   1.00 23.66 ? 204  HIS A C     1 
ATOM   895  O  O     . HIS A 1 170 ? 66.404  47.175  3.999   1.00 23.82 ? 204  HIS A O     1 
ATOM   896  C  CB    . HIS A 1 170 ? 68.727  44.996  3.327   1.00 22.82 ? 204  HIS A CB    1 
ATOM   897  C  CG    . HIS A 1 170 ? 70.224  45.002  3.333   1.00 22.82 ? 204  HIS A CG    1 
ATOM   898  N  ND1   . HIS A 1 170 ? 70.972  44.298  2.411   1.00 22.00 ? 204  HIS A ND1   1 
ATOM   899  C  CD2   . HIS A 1 170 ? 71.113  45.617  4.150   1.00 21.78 ? 204  HIS A CD2   1 
ATOM   900  C  CE1   . HIS A 1 170 ? 72.256  44.488  2.656   1.00 22.14 ? 204  HIS A CE1   1 
ATOM   901  N  NE2   . HIS A 1 170 ? 72.370  45.278  3.710   1.00 21.77 ? 204  HIS A NE2   1 
ATOM   902  N  N     . ASP A 1 171 ? 65.712  45.069  4.325   1.00 24.32 ? 205  ASP A N     1 
ATOM   903  C  CA    . ASP A 1 171 ? 64.336  45.350  3.908   1.00 25.01 ? 205  ASP A CA    1 
ATOM   904  C  C     . ASP A 1 171 ? 63.537  46.127  4.956   1.00 24.59 ? 205  ASP A C     1 
ATOM   905  O  O     . ASP A 1 171 ? 62.512  46.723  4.631   1.00 24.23 ? 205  ASP A O     1 
ATOM   906  C  CB    . ASP A 1 171 ? 63.594  44.057  3.512   1.00 25.65 ? 205  ASP A CB    1 
ATOM   907  C  CG    . ASP A 1 171 ? 63.778  43.706  2.029   1.00 27.97 ? 205  ASP A CG    1 
ATOM   908  O  OD1   . ASP A 1 171 ? 63.446  44.560  1.158   1.00 29.54 ? 205  ASP A OD1   1 
ATOM   909  O  OD2   . ASP A 1 171 ? 64.250  42.578  1.740   1.00 30.50 ? 205  ASP A OD2   1 
ATOM   910  N  N     . MET A 1 172 ? 64.011  46.102  6.202   1.00 24.27 ? 206  MET A N     1 
ATOM   911  C  CA    . MET A 1 172 ? 63.448  46.909  7.277   1.00 23.99 ? 206  MET A CA    1 
ATOM   912  C  C     . MET A 1 172 ? 64.052  48.314  7.322   1.00 23.81 ? 206  MET A C     1 
ATOM   913  O  O     . MET A 1 172 ? 63.621  49.136  8.124   1.00 23.75 ? 206  MET A O     1 
ATOM   914  C  CB    . MET A 1 172 ? 63.684  46.231  8.629   1.00 24.03 ? 206  MET A CB    1 
ATOM   915  C  CG    . MET A 1 172 ? 62.975  44.906  8.806   1.00 24.05 ? 206  MET A CG    1 
ATOM   916  S  SD    . MET A 1 172 ? 61.191  45.035  8.770   1.00 24.17 ? 206  MET A SD    1 
ATOM   917  C  CE    . MET A 1 172 ? 60.811  44.392  7.136   1.00 24.40 ? 206  MET A CE    1 
ATOM   918  N  N     . ASN A 1 173 ? 65.059  48.579  6.487   1.00 23.69 ? 207  ASN A N     1 
ATOM   919  C  CA    . ASN A 1 173 ? 65.628  49.923  6.351   1.00 23.60 ? 207  ASN A CA    1 
ATOM   920  C  C     . ASN A 1 173 ? 66.452  50.062  5.076   1.00 23.57 ? 207  ASN A C     1 
ATOM   921  O  O     . ASN A 1 173 ? 67.636  49.740  5.068   1.00 23.56 ? 207  ASN A O     1 
ATOM   922  C  CB    . ASN A 1 173 ? 66.494  50.269  7.564   1.00 23.58 ? 207  ASN A CB    1 
ATOM   923  C  CG    . ASN A 1 173 ? 66.969  51.712  7.554   1.00 23.49 ? 207  ASN A CG    1 
ATOM   924  O  OD1   . ASN A 1 173 ? 66.798  52.433  6.574   1.00 23.18 ? 207  ASN A OD1   1 
ATOM   925  N  ND2   . ASN A 1 173 ? 67.582  52.135  8.653   1.00 23.29 ? 207  ASN A ND2   1 
ATOM   926  N  N     . TYR A 1 174 ? 65.832  50.563  4.005   1.00 23.57 ? 208  TYR A N     1 
ATOM   927  C  CA    . TYR A 1 174 ? 66.514  50.674  2.707   1.00 23.54 ? 208  TYR A CA    1 
ATOM   928  C  C     . TYR A 1 174 ? 67.808  51.489  2.786   1.00 23.77 ? 208  TYR A C     1 
ATOM   929  O  O     . TYR A 1 174 ? 68.648  51.417  1.887   1.00 23.70 ? 208  TYR A O     1 
ATOM   930  C  CB    . TYR A 1 174 ? 65.597  51.274  1.633   1.00 23.37 ? 208  TYR A CB    1 
ATOM   931  C  CG    . TYR A 1 174 ? 64.362  50.465  1.257   1.00 22.94 ? 208  TYR A CG    1 
ATOM   932  C  CD1   . TYR A 1 174 ? 64.194  49.143  1.664   1.00 22.48 ? 208  TYR A CD1   1 
ATOM   933  C  CD2   . TYR A 1 174 ? 63.372  51.027  0.452   1.00 22.99 ? 208  TYR A CD2   1 
ATOM   934  C  CE1   . TYR A 1 174 ? 63.067  48.417  1.302   1.00 22.04 ? 208  TYR A CE1   1 
ATOM   935  C  CE2   . TYR A 1 174 ? 62.243  50.304  0.082   1.00 22.87 ? 208  TYR A CE2   1 
ATOM   936  C  CZ    . TYR A 1 174 ? 62.098  49.000  0.514   1.00 22.39 ? 208  TYR A CZ    1 
ATOM   937  O  OH    . TYR A 1 174 ? 60.988  48.276  0.154   1.00 22.23 ? 208  TYR A OH    1 
ATOM   938  N  N     . GLY A 1 175 ? 67.965  52.262  3.859   1.00 24.11 ? 209  GLY A N     1 
ATOM   939  C  CA    . GLY A 1 175 ? 69.190  53.021  4.099   1.00 24.18 ? 209  GLY A CA    1 
ATOM   940  C  C     . GLY A 1 175 ? 70.426  52.172  4.337   1.00 24.40 ? 209  GLY A C     1 
ATOM   941  O  O     . GLY A 1 175 ? 71.544  52.613  4.052   1.00 24.39 ? 209  GLY A O     1 
ATOM   942  N  N     . LEU A 1 176 ? 70.232  50.961  4.868   1.00 24.35 ? 210  LEU A N     1 
ATOM   943  C  CA    . LEU A 1 176 ? 71.345  50.060  5.176   1.00 24.10 ? 210  LEU A CA    1 
ATOM   944  C  C     . LEU A 1 176 ? 71.787  49.217  3.976   1.00 24.14 ? 210  LEU A C     1 
ATOM   945  O  O     . LEU A 1 176 ? 72.798  48.521  4.055   1.00 23.97 ? 210  LEU A O     1 
ATOM   946  C  CB    . LEU A 1 176 ? 70.987  49.146  6.354   1.00 24.06 ? 210  LEU A CB    1 
ATOM   947  C  CG    . LEU A 1 176 ? 70.753  49.831  7.706   1.00 23.71 ? 210  LEU A CG    1 
ATOM   948  C  CD1   . LEU A 1 176 ? 70.223  48.836  8.737   1.00 22.88 ? 210  LEU A CD1   1 
ATOM   949  C  CD2   . LEU A 1 176 ? 72.027  50.511  8.208   1.00 22.40 ? 210  LEU A CD2   1 
ATOM   950  N  N     . LYS A 1 177 ? 71.042  49.283  2.874   1.00 24.43 ? 211  LYS A N     1 
ATOM   951  C  CA    . LYS A 1 177 ? 71.389  48.540  1.650   1.00 24.95 ? 211  LYS A CA    1 
ATOM   952  C  C     . LYS A 1 177 ? 72.776  48.876  1.077   1.00 25.01 ? 211  LYS A C     1 
ATOM   953  O  O     . LYS A 1 177 ? 73.410  48.023  0.448   1.00 25.26 ? 211  LYS A O     1 
ATOM   954  C  CB    . LYS A 1 177 ? 70.329  48.749  0.561   1.00 25.14 ? 211  LYS A CB    1 
ATOM   955  C  CG    . LYS A 1 177 ? 69.080  47.881  0.708   1.00 25.92 ? 211  LYS A CG    1 
ATOM   956  C  CD    . LYS A 1 177 ? 67.964  48.365  -0.211  1.00 27.60 ? 211  LYS A CD    1 
ATOM   957  C  CE    . LYS A 1 177 ? 66.849  47.336  -0.348  1.00 29.09 ? 211  LYS A CE    1 
ATOM   958  N  NZ    . LYS A 1 177 ? 67.232  46.228  -1.275  1.00 29.50 ? 211  LYS A NZ    1 
ATOM   959  N  N     . LYS A 1 178 ? 73.239  50.109  1.285   1.00 24.94 ? 212  LYS A N     1 
ATOM   960  C  CA    . LYS A 1 178 ? 74.587  50.521  0.856   1.00 24.81 ? 212  LYS A CA    1 
ATOM   961  C  C     . LYS A 1 178 ? 75.689  49.618  1.432   1.00 24.37 ? 212  LYS A C     1 
ATOM   962  O  O     . LYS A 1 178 ? 76.759  49.482  0.826   1.00 24.07 ? 212  LYS A O     1 
ATOM   963  C  CB    . LYS A 1 178 ? 74.867  51.994  1.224   1.00 24.81 ? 212  LYS A CB    1 
ATOM   964  C  CG    . LYS A 1 178 ? 74.668  52.331  2.703   1.00 25.22 ? 212  LYS A CG    1 
ATOM   965  C  CD    . LYS A 1 178 ? 75.416  53.591  3.125   1.00 25.57 ? 212  LYS A CD    1 
ATOM   966  C  CE    . LYS A 1 178 ? 74.961  54.805  2.357   1.00 26.61 ? 212  LYS A CE    1 
ATOM   967  N  NZ    . LYS A 1 178 ? 75.651  56.038  2.838   1.00 28.22 ? 212  LYS A NZ    1 
ATOM   968  N  N     . TYR A 1 179 ? 75.413  49.029  2.601   1.00 23.96 ? 213  TYR A N     1 
ATOM   969  C  CA    . TYR A 1 179 ? 76.286  48.039  3.241   1.00 23.71 ? 213  TYR A CA    1 
ATOM   970  C  C     . TYR A 1 179 ? 75.959  46.653  2.683   1.00 23.56 ? 213  TYR A C     1 
ATOM   971  O  O     . TYR A 1 179 ? 75.262  45.855  3.307   1.00 23.47 ? 213  TYR A O     1 
ATOM   972  C  CB    . TYR A 1 179 ? 76.109  48.098  4.763   1.00 23.68 ? 213  TYR A CB    1 
ATOM   973  C  CG    . TYR A 1 179 ? 76.242  49.508  5.300   1.00 23.88 ? 213  TYR A CG    1 
ATOM   974  C  CD1   . TYR A 1 179 ? 77.396  50.251  5.054   1.00 24.45 ? 213  TYR A CD1   1 
ATOM   975  C  CD2   . TYR A 1 179 ? 75.214  50.112  6.020   1.00 24.20 ? 213  TYR A CD2   1 
ATOM   976  C  CE1   . TYR A 1 179 ? 77.532  51.550  5.517   1.00 24.71 ? 213  TYR A CE1   1 
ATOM   977  C  CE2   . TYR A 1 179 ? 75.343  51.420  6.500   1.00 24.32 ? 213  TYR A CE2   1 
ATOM   978  C  CZ    . TYR A 1 179 ? 76.508  52.132  6.242   1.00 25.09 ? 213  TYR A CZ    1 
ATOM   979  O  OH    . TYR A 1 179 ? 76.672  53.422  6.699   1.00 25.53 ? 213  TYR A OH    1 
ATOM   980  N  N     . ALA A 1 180 ? 76.453  46.393  1.479   1.00 23.47 ? 214  ALA A N     1 
ATOM   981  C  CA    . ALA A 1 180 ? 76.050  45.228  0.718   1.00 23.48 ? 214  ALA A CA    1 
ATOM   982  C  C     . ALA A 1 180 ? 76.648  43.929  1.272   1.00 23.84 ? 214  ALA A C     1 
ATOM   983  O  O     . ALA A 1 180 ? 77.597  43.938  2.065   1.00 23.70 ? 214  ALA A O     1 
ATOM   984  C  CB    . ALA A 1 180 ? 76.413  45.403  -0.740  1.00 23.15 ? 214  ALA A CB    1 
ATOM   985  N  N     . CYS A 1 181 ? 76.068  42.819  0.830   1.00 24.12 ? 215  CYS A N     1 
ATOM   986  C  CA    . CYS A 1 181 ? 76.409  41.496  1.321   1.00 24.59 ? 215  CYS A CA    1 
ATOM   987  C  C     . CYS A 1 181 ? 76.366  40.517  0.157   1.00 23.88 ? 215  CYS A C     1 
ATOM   988  O  O     . CYS A 1 181 ? 75.424  40.553  -0.648  1.00 23.67 ? 215  CYS A O     1 
ATOM   989  C  CB    . CYS A 1 181 ? 75.408  41.063  2.390   1.00 24.75 ? 215  CYS A CB    1 
ATOM   990  S  SG    . CYS A 1 181 ? 75.623  39.361  2.976   1.00 29.19 ? 215  CYS A SG    1 
ATOM   991  N  N     . VAL A 1 182 ? 77.379  39.652  0.076   1.00 22.91 ? 216  VAL A N     1 
ATOM   992  C  CA    . VAL A 1 182 ? 77.444  38.597  -0.933  1.00 22.30 ? 216  VAL A CA    1 
ATOM   993  C  C     . VAL A 1 182 ? 77.816  37.260  -0.278  1.00 22.06 ? 216  VAL A C     1 
ATOM   994  O  O     . VAL A 1 182 ? 78.655  37.208  0.619   1.00 21.75 ? 216  VAL A O     1 
ATOM   995  C  CB    . VAL A 1 182 ? 78.452  38.949  -2.037  1.00 22.04 ? 216  VAL A CB    1 
ATOM   996  C  CG1   . VAL A 1 182 ? 78.615  37.801  -3.014  1.00 21.83 ? 216  VAL A CG1   1 
ATOM   997  C  CG2   . VAL A 1 182 ? 77.997  40.185  -2.773  1.00 22.04 ? 216  VAL A CG2   1 
ATOM   998  N  N     . SER A 1 183 ? 77.170  36.185  -0.715  1.00 21.88 ? 217  SER A N     1 
ATOM   999  C  CA    . SER A 1 183 ? 77.437  34.862  -0.170  1.00 21.50 ? 217  SER A CA    1 
ATOM   1000 C  C     . SER A 1 183 ? 78.310  34.098  -1.152  1.00 21.54 ? 217  SER A C     1 
ATOM   1001 O  O     . SER A 1 183 ? 78.020  34.064  -2.340  1.00 21.96 ? 217  SER A O     1 
ATOM   1002 C  CB    . SER A 1 183 ? 76.133  34.106  0.117   1.00 21.33 ? 217  SER A CB    1 
ATOM   1003 O  OG    . SER A 1 183 ? 75.397  33.844  -1.066  1.00 20.44 ? 217  SER A OG    1 
ATOM   1004 N  N     . LEU A 1 184 ? 79.398  33.518  -0.660  1.00 21.54 ? 218  LEU A N     1 
ATOM   1005 C  CA    . LEU A 1 184 ? 80.289  32.701  -1.490  1.00 21.68 ? 218  LEU A CA    1 
ATOM   1006 C  C     . LEU A 1 184 ? 80.264  31.277  -0.951  1.00 21.61 ? 218  LEU A C     1 
ATOM   1007 O  O     . LEU A 1 184 ? 80.890  30.982  0.062   1.00 21.81 ? 218  LEU A O     1 
ATOM   1008 C  CB    . LEU A 1 184 ? 81.717  33.247  -1.452  1.00 21.63 ? 218  LEU A CB    1 
ATOM   1009 C  CG    . LEU A 1 184 ? 81.888  34.718  -1.812  1.00 21.65 ? 218  LEU A CG    1 
ATOM   1010 C  CD1   . LEU A 1 184 ? 83.331  35.163  -1.537  1.00 21.63 ? 218  LEU A CD1   1 
ATOM   1011 C  CD2   . LEU A 1 184 ? 81.504  34.948  -3.267  1.00 22.57 ? 218  LEU A CD2   1 
ATOM   1012 N  N     . VAL A 1 185 ? 79.505  30.417  -1.612  1.00 21.89 ? 219  VAL A N     1 
ATOM   1013 C  CA    . VAL A 1 185 ? 79.315  29.037  -1.176  1.00 22.19 ? 219  VAL A CA    1 
ATOM   1014 C  C     . VAL A 1 185 ? 79.395  28.092  -2.361  1.00 22.74 ? 219  VAL A C     1 
ATOM   1015 O  O     . VAL A 1 185 ? 79.152  28.492  -3.499  1.00 22.21 ? 219  VAL A O     1 
ATOM   1016 C  CB    . VAL A 1 185 ? 77.948  28.843  -0.500  1.00 22.20 ? 219  VAL A CB    1 
ATOM   1017 C  CG1   . VAL A 1 185 ? 77.797  29.806  0.688   1.00 21.49 ? 219  VAL A CG1   1 
ATOM   1018 C  CG2   . VAL A 1 185 ? 76.820  29.021  -1.511  1.00 21.40 ? 219  VAL A CG2   1 
ATOM   1019 N  N     . GLY A 1 186 ? 79.729  26.836  -2.083  1.00 23.52 ? 220  GLY A N     1 
ATOM   1020 C  CA    . GLY A 1 186 ? 79.818  25.822  -3.127  1.00 24.04 ? 220  GLY A CA    1 
ATOM   1021 C  C     . GLY A 1 186 ? 78.450  25.457  -3.669  1.00 24.62 ? 220  GLY A C     1 
ATOM   1022 O  O     . GLY A 1 186 ? 77.437  25.659  -2.997  1.00 24.86 ? 220  GLY A O     1 
ATOM   1023 N  N     . GLY A 1 187 ? 78.429  24.920  -4.886  1.00 25.20 ? 221  GLY A N     1 
ATOM   1024 C  CA    . GLY A 1 187 ? 77.187  24.514  -5.550  1.00 25.86 ? 221  GLY A CA    1 
ATOM   1025 C  C     . GLY A 1 187 ? 76.519  25.605  -6.378  1.00 26.38 ? 221  GLY A C     1 
ATOM   1026 O  O     . GLY A 1 187 ? 75.449  25.389  -6.957  1.00 26.24 ? 221  GLY A O     1 
ATOM   1027 N  N     . THR A 1 188 ? 77.154  26.776  -6.434  1.00 27.01 ? 222  THR A N     1 
ATOM   1028 C  CA    . THR A 1 188 ? 76.622  27.942  -7.135  1.00 27.04 ? 222  THR A CA    1 
ATOM   1029 C  C     . THR A 1 188 ? 77.611  28.363  -8.207  1.00 27.48 ? 222  THR A C     1 
ATOM   1030 O  O     . THR A 1 188 ? 78.780  27.970  -8.161  1.00 27.97 ? 222  THR A O     1 
ATOM   1031 C  CB    . THR A 1 188 ? 76.457  29.112  -6.173  1.00 27.01 ? 222  THR A CB    1 
ATOM   1032 O  OG1   . THR A 1 188 ? 77.746  29.487  -5.677  1.00 26.40 ? 222  THR A OG1   1 
ATOM   1033 C  CG2   . THR A 1 188 ? 75.546  28.730  -5.000  1.00 26.39 ? 222  THR A CG2   1 
ATOM   1034 N  N     . ASP A 1 189 ? 77.161  29.176  -9.157  1.00 27.62 ? 223  ASP A N     1 
ATOM   1035 C  CA    . ASP A 1 189 ? 78.032  29.610  -10.247 1.00 27.85 ? 223  ASP A CA    1 
ATOM   1036 C  C     . ASP A 1 189 ? 79.099  30.553  -9.695  1.00 27.44 ? 223  ASP A C     1 
ATOM   1037 O  O     . ASP A 1 189 ? 78.777  31.597  -9.135  1.00 27.34 ? 223  ASP A O     1 
ATOM   1038 C  CB    . ASP A 1 189 ? 77.231  30.282  -11.375 1.00 27.95 ? 223  ASP A CB    1 
ATOM   1039 C  CG    . ASP A 1 189 ? 78.070  30.529  -12.625 1.00 29.64 ? 223  ASP A CG    1 
ATOM   1040 O  OD1   . ASP A 1 189 ? 79.318  30.540  -12.523 1.00 31.41 ? 223  ASP A OD1   1 
ATOM   1041 O  OD2   . ASP A 1 189 ? 77.487  30.718  -13.716 1.00 31.23 ? 223  ASP A OD2   1 
ATOM   1042 N  N     . PHE A 1 190 ? 80.362  30.157  -9.852  1.00 27.22 ? 224  PHE A N     1 
ATOM   1043 C  CA    . PHE A 1 190 ? 81.505  30.938  -9.385  1.00 27.00 ? 224  PHE A CA    1 
ATOM   1044 C  C     . PHE A 1 190 ? 81.584  32.305  -10.062 1.00 27.16 ? 224  PHE A C     1 
ATOM   1045 O  O     . PHE A 1 190 ? 81.721  33.329  -9.399  1.00 26.78 ? 224  PHE A O     1 
ATOM   1046 C  CB    . PHE A 1 190 ? 82.815  30.180  -9.638  1.00 26.85 ? 224  PHE A CB    1 
ATOM   1047 C  CG    . PHE A 1 190 ? 84.010  30.785  -8.946  1.00 25.89 ? 224  PHE A CG    1 
ATOM   1048 C  CD1   . PHE A 1 190 ? 84.469  30.268  -7.743  1.00 24.74 ? 224  PHE A CD1   1 
ATOM   1049 C  CD2   . PHE A 1 190 ? 84.664  31.884  -9.486  1.00 24.78 ? 224  PHE A CD2   1 
ATOM   1050 C  CE1   . PHE A 1 190 ? 85.572  30.829  -7.102  1.00 24.48 ? 224  PHE A CE1   1 
ATOM   1051 C  CE2   . PHE A 1 190 ? 85.759  32.450  -8.842  1.00 24.61 ? 224  PHE A CE2   1 
ATOM   1052 C  CZ    . PHE A 1 190 ? 86.209  31.920  -7.647  1.00 23.53 ? 224  PHE A CZ    1 
ATOM   1053 N  N     . ARG A 1 191 ? 81.512  32.302  -11.386 1.00 27.59 ? 225  ARG A N     1 
ATOM   1054 C  CA    . ARG A 1 191 ? 81.600  33.528  -12.170 1.00 28.02 ? 225  ARG A CA    1 
ATOM   1055 C  C     . ARG A 1 191 ? 80.519  34.520  -11.742 1.00 27.67 ? 225  ARG A C     1 
ATOM   1056 O  O     . ARG A 1 191 ? 80.792  35.717  -11.578 1.00 27.59 ? 225  ARG A O     1 
ATOM   1057 C  CB    . ARG A 1 191 ? 81.469  33.193  -13.662 1.00 28.57 ? 225  ARG A CB    1 
ATOM   1058 C  CG    . ARG A 1 191 ? 81.674  34.363  -14.624 1.00 30.64 ? 225  ARG A CG    1 
ATOM   1059 C  CD    . ARG A 1 191 ? 81.614  33.912  -16.102 1.00 33.37 ? 225  ARG A CD    1 
ATOM   1060 N  NE    . ARG A 1 191 ? 80.516  32.973  -16.376 1.00 35.44 ? 225  ARG A NE    1 
ATOM   1061 C  CZ    . ARG A 1 191 ? 79.243  33.306  -16.620 1.00 37.40 ? 225  ARG A CZ    1 
ATOM   1062 N  NH1   . ARG A 1 191 ? 78.850  34.580  -16.634 1.00 38.44 ? 225  ARG A NH1   1 
ATOM   1063 N  NH2   . ARG A 1 191 ? 78.345  32.351  -16.845 1.00 37.53 ? 225  ARG A NH2   1 
ATOM   1064 N  N     . ALA A 1 192 ? 79.302  34.011  -11.543 1.00 27.15 ? 226  ALA A N     1 
ATOM   1065 C  CA    . ALA A 1 192 ? 78.153  34.851  -11.221 1.00 26.91 ? 226  ALA A CA    1 
ATOM   1066 C  C     . ALA A 1 192 ? 78.282  35.499  -9.841  1.00 26.72 ? 226  ALA A C     1 
ATOM   1067 O  O     . ALA A 1 192 ? 77.905  36.654  -9.651  1.00 26.58 ? 226  ALA A O     1 
ATOM   1068 C  CB    . ALA A 1 192 ? 76.869  34.045  -11.317 1.00 26.75 ? 226  ALA A CB    1 
ATOM   1069 N  N     . ALA A 1 193 ? 78.812  34.745  -8.882  1.00 26.63 ? 227  ALA A N     1 
ATOM   1070 C  CA    . ALA A 1 193 ? 79.085  35.266  -7.545  1.00 26.37 ? 227  ALA A CA    1 
ATOM   1071 C  C     . ALA A 1 193 ? 80.157  36.354  -7.611  1.00 26.41 ? 227  ALA A C     1 
ATOM   1072 O  O     . ALA A 1 193 ? 80.093  37.343  -6.885  1.00 25.91 ? 227  ALA A O     1 
ATOM   1073 C  CB    . ALA A 1 193 ? 79.520  34.139  -6.621  1.00 26.11 ? 227  ALA A CB    1 
ATOM   1074 N  N     . MET A 1 194 ? 81.130  36.171  -8.504  1.00 26.47 ? 228  MET A N     1 
ATOM   1075 C  CA    . MET A 1 194 ? 82.218  37.128  -8.644  1.00 26.62 ? 228  MET A CA    1 
ATOM   1076 C  C     . MET A 1 194 ? 81.736  38.403  -9.336  1.00 26.07 ? 228  MET A C     1 
ATOM   1077 O  O     . MET A 1 194 ? 82.197  39.498  -9.018  1.00 25.53 ? 228  MET A O     1 
ATOM   1078 C  CB    . MET A 1 194 ? 83.403  36.512  -9.402  1.00 26.86 ? 228  MET A CB    1 
ATOM   1079 C  CG    . MET A 1 194 ? 84.754  36.884  -8.797  1.00 28.23 ? 228  MET A CG    1 
ATOM   1080 S  SD    . MET A 1 194 ? 84.825  36.430  -7.041  1.00 30.37 ? 228  MET A SD    1 
ATOM   1081 C  CE    . MET A 1 194 ? 84.468  34.692  -7.132  1.00 30.43 ? 228  MET A CE    1 
ATOM   1082 N  N     . ASN A 1 195 ? 80.807  38.250  -10.277 1.00 25.96 ? 229  ASN A N     1 
ATOM   1083 C  CA    . ASN A 1 195 ? 80.135  39.400  -10.880 1.00 25.76 ? 229  ASN A CA    1 
ATOM   1084 C  C     . ASN A 1 195 ? 79.423  40.188  -9.802  1.00 25.36 ? 229  ASN A C     1 
ATOM   1085 O  O     . ASN A 1 195 ? 79.469  41.414  -9.786  1.00 25.34 ? 229  ASN A O     1 
ATOM   1086 C  CB    . ASN A 1 195 ? 79.143  38.956  -11.954 1.00 25.73 ? 229  ASN A CB    1 
ATOM   1087 C  CG    . ASN A 1 195 ? 79.832  38.473  -13.220 1.00 26.16 ? 229  ASN A CG    1 
ATOM   1088 O  OD1   . ASN A 1 195 ? 81.031  38.669  -13.399 1.00 27.58 ? 229  ASN A OD1   1 
ATOM   1089 N  ND2   . ASN A 1 195 ? 79.073  37.845  -14.104 1.00 25.47 ? 229  ASN A ND2   1 
ATOM   1090 N  N     . LYS A 1 196 ? 78.792  39.470  -8.883  1.00 25.19 ? 230  LYS A N     1 
ATOM   1091 C  CA    . LYS A 1 196 ? 78.097  40.091  -7.769  1.00 25.23 ? 230  LYS A CA    1 
ATOM   1092 C  C     . LYS A 1 196 ? 79.063  40.802  -6.814  1.00 25.00 ? 230  LYS A C     1 
ATOM   1093 O  O     . LYS A 1 196 ? 78.729  41.866  -6.300  1.00 24.72 ? 230  LYS A O     1 
ATOM   1094 C  CB    . LYS A 1 196 ? 77.255  39.054  -7.020  1.00 25.40 ? 230  LYS A CB    1 
ATOM   1095 C  CG    . LYS A 1 196 ? 76.144  39.650  -6.164  1.00 26.31 ? 230  LYS A CG    1 
ATOM   1096 C  CD    . LYS A 1 196 ? 75.127  38.586  -5.756  1.00 27.74 ? 230  LYS A CD    1 
ATOM   1097 C  CE    . LYS A 1 196 ? 73.992  39.178  -4.899  1.00 28.97 ? 230  LYS A CE    1 
ATOM   1098 N  NZ    . LYS A 1 196 ? 74.425  39.485  -3.482  1.00 28.93 ? 230  LYS A NZ    1 
ATOM   1099 N  N     . MET A 1 197 ? 80.247  40.226  -6.577  1.00 24.91 ? 231  MET A N     1 
ATOM   1100 C  CA    . MET A 1 197 ? 81.274  40.886  -5.752  1.00 25.01 ? 231  MET A CA    1 
ATOM   1101 C  C     . MET A 1 197 ? 81.728  42.195  -6.402  1.00 24.81 ? 231  MET A C     1 
ATOM   1102 O  O     . MET A 1 197 ? 81.917  43.195  -5.717  1.00 24.85 ? 231  MET A O     1 
ATOM   1103 C  CB    . MET A 1 197 ? 82.500  39.987  -5.526  1.00 25.35 ? 231  MET A CB    1 
ATOM   1104 C  CG    . MET A 1 197 ? 82.275  38.761  -4.631  1.00 25.69 ? 231  MET A CG    1 
ATOM   1105 S  SD    . MET A 1 197 ? 82.182  39.130  -2.873  1.00 28.04 ? 231  MET A SD    1 
ATOM   1106 C  CE    . MET A 1 197 ? 83.872  39.660  -2.536  1.00 26.12 ? 231  MET A CE    1 
ATOM   1107 N  N     . ASN A 1 198 ? 81.896  42.178  -7.720  1.00 24.63 ? 232  ASN A N     1 
ATOM   1108 C  CA    . ASN A 1 198 ? 82.330  43.360  -8.472  1.00 24.80 ? 232  ASN A CA    1 
ATOM   1109 C  C     . ASN A 1 198 ? 81.273  44.454  -8.594  1.00 24.89 ? 232  ASN A C     1 
ATOM   1110 O  O     . ASN A 1 198 ? 81.578  45.645  -8.484  1.00 25.06 ? 232  ASN A O     1 
ATOM   1111 C  CB    . ASN A 1 198 ? 82.767  42.954  -9.879  1.00 24.67 ? 232  ASN A CB    1 
ATOM   1112 C  CG    . ASN A 1 198 ? 84.073  42.205  -9.883  1.00 24.58 ? 232  ASN A CG    1 
ATOM   1113 O  OD1   . ASN A 1 198 ? 85.098  42.733  -9.463  1.00 25.31 ? 232  ASN A OD1   1 
ATOM   1114 N  ND2   . ASN A 1 198 ? 84.051  40.975  -10.365 1.00 24.07 ? 232  ASN A ND2   1 
ATOM   1115 N  N     . LYS A 1 199 ? 80.040  44.038  -8.854  1.00 24.87 ? 233  LYS A N     1 
ATOM   1116 C  CA    . LYS A 1 199 ? 78.940  44.960  -9.098  1.00 24.90 ? 233  LYS A CA    1 
ATOM   1117 C  C     . LYS A 1 199 ? 78.476  45.600  -7.794  1.00 24.26 ? 233  LYS A C     1 
ATOM   1118 O  O     . LYS A 1 199 ? 78.189  46.789  -7.760  1.00 24.47 ? 233  LYS A O     1 
ATOM   1119 C  CB    . LYS A 1 199 ? 77.785  44.225  -9.789  1.00 25.16 ? 233  LYS A CB    1 
ATOM   1120 C  CG    . LYS A 1 199 ? 76.520  45.055  -10.007 1.00 26.50 ? 233  LYS A CG    1 
ATOM   1121 C  CD    . LYS A 1 199 ? 75.377  44.172  -10.517 1.00 28.23 ? 233  LYS A CD    1 
ATOM   1122 C  CE    . LYS A 1 199 ? 74.022  44.870  -10.435 1.00 29.08 ? 233  LYS A CE    1 
ATOM   1123 N  NZ    . LYS A 1 199 ? 72.884  43.916  -10.653 1.00 29.46 ? 233  LYS A NZ    1 
ATOM   1124 N  N     . LEU A 1 200 ? 78.415  44.814  -6.724  1.00 23.76 ? 234  LEU A N     1 
ATOM   1125 C  CA    . LEU A 1 200 ? 77.954  45.307  -5.422  1.00 23.19 ? 234  LEU A CA    1 
ATOM   1126 C  C     . LEU A 1 200 ? 79.067  45.823  -4.498  1.00 22.86 ? 234  LEU A C     1 
ATOM   1127 O  O     . LEU A 1 200 ? 78.799  46.664  -3.645  1.00 23.19 ? 234  LEU A O     1 
ATOM   1128 C  CB    . LEU A 1 200 ? 77.163  44.216  -4.690  1.00 23.17 ? 234  LEU A CB    1 
ATOM   1129 C  CG    . LEU A 1 200 ? 75.895  43.664  -5.354  1.00 22.77 ? 234  LEU A CG    1 
ATOM   1130 C  CD1   . LEU A 1 200 ? 75.220  42.690  -4.403  1.00 22.17 ? 234  LEU A CD1   1 
ATOM   1131 C  CD2   . LEU A 1 200 ? 74.935  44.783  -5.742  1.00 21.95 ? 234  LEU A CD2   1 
ATOM   1132 N  N     . ARG A 1 201 ? 80.295  45.314  -4.644  1.00 22.41 ? 235  ARG A N     1 
ATOM   1133 C  CA    . ARG A 1 201 ? 81.420  45.683  -3.758  1.00 21.88 ? 235  ARG A CA    1 
ATOM   1134 C  C     . ARG A 1 201 ? 81.004  45.578  -2.288  1.00 21.36 ? 235  ARG A C     1 
ATOM   1135 O  O     . ARG A 1 201 ? 81.011  46.568  -1.555  1.00 21.27 ? 235  ARG A O     1 
ATOM   1136 C  CB    . ARG A 1 201 ? 81.926  47.101  -4.064  1.00 21.90 ? 235  ARG A CB    1 
ATOM   1137 C  CG    . ARG A 1 201 ? 82.389  47.336  -5.501  1.00 22.07 ? 235  ARG A CG    1 
ATOM   1138 C  CD    . ARG A 1 201 ? 83.590  46.497  -5.921  1.00 23.08 ? 235  ARG A CD    1 
ATOM   1139 N  NE    . ARG A 1 201 ? 84.638  46.444  -4.893  1.00 24.87 ? 235  ARG A NE    1 
ATOM   1140 C  CZ    . ARG A 1 201 ? 85.942  46.290  -5.129  1.00 24.48 ? 235  ARG A CZ    1 
ATOM   1141 N  NH1   . ARG A 1 201 ? 86.413  46.159  -6.367  1.00 24.13 ? 235  ARG A NH1   1 
ATOM   1142 N  NH2   . ARG A 1 201 ? 86.786  46.260  -4.102  1.00 24.83 ? 235  ARG A NH2   1 
ATOM   1143 N  N     . PRO A 1 202 ? 80.631  44.368  -1.851  1.00 20.85 ? 236  PRO A N     1 
ATOM   1144 C  CA    . PRO A 1 202 ? 80.038  44.211  -0.533  1.00 20.49 ? 236  PRO A CA    1 
ATOM   1145 C  C     . PRO A 1 202 ? 81.007  44.501  0.584   1.00 20.06 ? 236  PRO A C     1 
ATOM   1146 O  O     . PRO A 1 202 ? 82.213  44.308  0.426   1.00 19.88 ? 236  PRO A O     1 
ATOM   1147 C  CB    . PRO A 1 202 ? 79.673  42.728  -0.499  1.00 20.54 ? 236  PRO A CB    1 
ATOM   1148 C  CG    . PRO A 1 202 ? 80.691  42.097  -1.364  1.00 20.59 ? 236  PRO A CG    1 
ATOM   1149 C  CD    . PRO A 1 202 ? 80.831  43.065  -2.502  1.00 20.88 ? 236  PRO A CD    1 
ATOM   1150 N  N     . ASN A 1 203 ? 80.456  44.938  1.712   1.00 19.77 ? 237  ASN A N     1 
ATOM   1151 C  CA    . ASN A 1 203 ? 81.204  45.093  2.949   1.00 19.26 ? 237  ASN A CA    1 
ATOM   1152 C  C     . ASN A 1 203 ? 81.104  43.858  3.844   1.00 19.21 ? 237  ASN A C     1 
ATOM   1153 O  O     . ASN A 1 203 ? 81.824  43.739  4.848   1.00 19.14 ? 237  ASN A O     1 
ATOM   1154 C  CB    . ASN A 1 203 ? 80.682  46.316  3.685   1.00 19.06 ? 237  ASN A CB    1 
ATOM   1155 C  CG    . ASN A 1 203 ? 80.778  47.575  2.845   1.00 19.39 ? 237  ASN A CG    1 
ATOM   1156 O  OD1   . ASN A 1 203 ? 79.767  48.220  2.549   1.00 19.50 ? 237  ASN A OD1   1 
ATOM   1157 N  ND2   . ASN A 1 203 ? 81.999  47.919  2.430   1.00 17.32 ? 237  ASN A ND2   1 
ATOM   1158 N  N     . ILE A 1 204 ? 80.185  42.955  3.503   1.00 18.91 ? 238  ILE A N     1 
ATOM   1159 C  CA    . ILE A 1 204 ? 79.967  41.752  4.288   1.00 18.85 ? 238  ILE A CA    1 
ATOM   1160 C  C     . ILE A 1 204 ? 79.990  40.574  3.349   1.00 18.67 ? 238  ILE A C     1 
ATOM   1161 O  O     . ILE A 1 204 ? 79.298  40.577  2.333   1.00 19.09 ? 238  ILE A O     1 
ATOM   1162 C  CB    . ILE A 1 204 ? 78.616  41.767  5.001   1.00 18.98 ? 238  ILE A CB    1 
ATOM   1163 C  CG1   . ILE A 1 204 ? 78.490  43.008  5.888   1.00 19.40 ? 238  ILE A CG1   1 
ATOM   1164 C  CG2   . ILE A 1 204 ? 78.439  40.499  5.824   1.00 19.05 ? 238  ILE A CG2   1 
ATOM   1165 C  CD1   . ILE A 1 204 ? 77.188  43.079  6.665   1.00 19.62 ? 238  ILE A CD1   1 
ATOM   1166 N  N     . VAL A 1 205 ? 80.795  39.572  3.677   1.00 18.05 ? 239  VAL A N     1 
ATOM   1167 C  CA    . VAL A 1 205 ? 80.807  38.331  2.918   1.00 17.45 ? 239  VAL A CA    1 
ATOM   1168 C  C     . VAL A 1 205 ? 80.383  37.194  3.836   1.00 16.94 ? 239  VAL A C     1 
ATOM   1169 O  O     . VAL A 1 205 ? 80.812  37.140  4.981   1.00 17.10 ? 239  VAL A O     1 
ATOM   1170 C  CB    . VAL A 1 205 ? 82.205  38.071  2.342   1.00 17.48 ? 239  VAL A CB    1 
ATOM   1171 C  CG1   . VAL A 1 205 ? 82.443  36.579  2.144   1.00 17.18 ? 239  VAL A CG1   1 
ATOM   1172 C  CG2   . VAL A 1 205 ? 82.393  38.864  1.028   1.00 16.63 ? 239  VAL A CG2   1 
ATOM   1173 N  N     . ILE A 1 206 ? 79.531  36.299  3.347   1.00 16.52 ? 240  ILE A N     1 
ATOM   1174 C  CA    . ILE A 1 206 ? 79.153  35.099  4.104   1.00 16.45 ? 240  ILE A CA    1 
ATOM   1175 C  C     . ILE A 1 206 ? 79.528  33.881  3.299   1.00 16.20 ? 240  ILE A C     1 
ATOM   1176 O  O     . ILE A 1 206 ? 79.215  33.806  2.121   1.00 17.11 ? 240  ILE A O     1 
ATOM   1177 C  CB    . ILE A 1 206 ? 77.648  35.042  4.445   1.00 16.46 ? 240  ILE A CB    1 
ATOM   1178 C  CG1   . ILE A 1 206 ? 77.157  36.423  4.894   1.00 17.03 ? 240  ILE A CG1   1 
ATOM   1179 C  CG2   . ILE A 1 206 ? 77.406  33.981  5.521   1.00 15.92 ? 240  ILE A CG2   1 
ATOM   1180 C  CD1   . ILE A 1 206 ? 75.987  36.401  5.845   1.00 18.43 ? 240  ILE A CD1   1 
ATOM   1181 N  N     . ALA A 1 207 ? 80.194  32.917  3.916   1.00 16.06 ? 241  ALA A N     1 
ATOM   1182 C  CA    . ALA A 1 207 ? 80.831  31.877  3.133   1.00 16.13 ? 241  ALA A CA    1 
ATOM   1183 C  C     . ALA A 1 207 ? 80.929  30.531  3.817   1.00 16.15 ? 241  ALA A C     1 
ATOM   1184 O  O     . ALA A 1 207 ? 80.842  30.426  5.035   1.00 16.17 ? 241  ALA A O     1 
ATOM   1185 C  CB    . ALA A 1 207 ? 82.224  32.340  2.734   1.00 16.09 ? 241  ALA A CB    1 
ATOM   1186 N  N     . THR A 1 208 ? 81.133  29.505  3.000   1.00 16.44 ? 242  THR A N     1 
ATOM   1187 C  CA    . THR A 1 208 ? 81.588  28.221  3.484   1.00 16.93 ? 242  THR A CA    1 
ATOM   1188 C  C     . THR A 1 208 ? 83.086  28.125  3.178   1.00 17.13 ? 242  THR A C     1 
ATOM   1189 O  O     . THR A 1 208 ? 83.564  28.748  2.225   1.00 17.50 ? 242  THR A O     1 
ATOM   1190 C  CB    . THR A 1 208 ? 80.828  27.075  2.825   1.00 17.16 ? 242  THR A CB    1 
ATOM   1191 O  OG1   . THR A 1 208 ? 80.595  27.388  1.448   1.00 17.21 ? 242  THR A OG1   1 
ATOM   1192 C  CG2   . THR A 1 208 ? 79.506  26.855  3.518   1.00 16.72 ? 242  THR A CG2   1 
ATOM   1193 N  N     . PRO A 1 209 ? 83.832  27.351  3.982   1.00 17.05 ? 243  PRO A N     1 
ATOM   1194 C  CA    . PRO A 1 209 ? 85.298  27.335  3.903   1.00 17.13 ? 243  PRO A CA    1 
ATOM   1195 C  C     . PRO A 1 209 ? 85.849  27.013  2.514   1.00 17.00 ? 243  PRO A C     1 
ATOM   1196 O  O     . PRO A 1 209 ? 86.667  27.762  1.992   1.00 16.98 ? 243  PRO A O     1 
ATOM   1197 C  CB    . PRO A 1 209 ? 85.697  26.248  4.901   1.00 16.87 ? 243  PRO A CB    1 
ATOM   1198 C  CG    . PRO A 1 209 ? 84.563  26.176  5.859   1.00 17.62 ? 243  PRO A CG    1 
ATOM   1199 C  CD    . PRO A 1 209 ? 83.334  26.447  5.030   1.00 17.32 ? 243  PRO A CD    1 
ATOM   1200 N  N     . GLY A 1 210 ? 85.398  25.911  1.929   1.00 17.12 ? 244  GLY A N     1 
ATOM   1201 C  CA    . GLY A 1 210 ? 85.862  25.492  0.610   1.00 17.22 ? 244  GLY A CA    1 
ATOM   1202 C  C     . GLY A 1 210 ? 85.849  26.600  -0.429  1.00 17.18 ? 244  GLY A C     1 
ATOM   1203 O  O     . GLY A 1 210 ? 86.879  26.904  -1.036  1.00 17.18 ? 244  GLY A O     1 
ATOM   1204 N  N     . ARG A 1 211 ? 84.686  27.203  -0.644  1.00 17.21 ? 245  ARG A N     1 
ATOM   1205 C  CA    . ARG A 1 211 ? 84.539  28.179  -1.737  1.00 17.40 ? 245  ARG A CA    1 
ATOM   1206 C  C     . ARG A 1 211 ? 85.248  29.485  -1.380  1.00 17.19 ? 245  ARG A C     1 
ATOM   1207 O  O     . ARG A 1 211 ? 85.732  30.189  -2.262  1.00 16.47 ? 245  ARG A O     1 
ATOM   1208 C  CB    . ARG A 1 211 ? 83.054  28.415  -2.074  1.00 17.27 ? 245  ARG A CB    1 
ATOM   1209 C  CG    . ARG A 1 211 ? 82.773  29.490  -3.131  1.00 17.40 ? 245  ARG A CG    1 
ATOM   1210 C  CD    . ARG A 1 211 ? 83.339  29.158  -4.509  1.00 17.53 ? 245  ARG A CD    1 
ATOM   1211 N  NE    . ARG A 1 211 ? 82.661  28.031  -5.154  1.00 16.87 ? 245  ARG A NE    1 
ATOM   1212 C  CZ    . ARG A 1 211 ? 81.557  28.119  -5.893  1.00 17.22 ? 245  ARG A CZ    1 
ATOM   1213 N  NH1   . ARG A 1 211 ? 80.958  29.292  -6.110  1.00 18.99 ? 245  ARG A NH1   1 
ATOM   1214 N  NH2   . ARG A 1 211 ? 81.037  27.022  -6.424  1.00 16.88 ? 245  ARG A NH2   1 
ATOM   1215 N  N     . LEU A 1 212 ? 85.311  29.800  -0.087  1.00 17.20 ? 246  LEU A N     1 
ATOM   1216 C  CA    . LEU A 1 212 ? 86.001  31.012  0.353   1.00 17.39 ? 246  LEU A CA    1 
ATOM   1217 C  C     . LEU A 1 212 ? 87.498  30.932  0.077   1.00 17.34 ? 246  LEU A C     1 
ATOM   1218 O  O     . LEU A 1 212 ? 88.107  31.921  -0.318  1.00 17.41 ? 246  LEU A O     1 
ATOM   1219 C  CB    . LEU A 1 212 ? 85.760  31.289  1.839   1.00 17.45 ? 246  LEU A CB    1 
ATOM   1220 C  CG    . LEU A 1 212 ? 86.458  32.539  2.390   1.00 17.72 ? 246  LEU A CG    1 
ATOM   1221 C  CD1   . LEU A 1 212 ? 86.196  33.772  1.499   1.00 17.03 ? 246  LEU A CD1   1 
ATOM   1222 C  CD2   . LEU A 1 212 ? 86.045  32.798  3.834   1.00 17.59 ? 246  LEU A CD2   1 
ATOM   1223 N  N     . ILE A 1 213 ? 88.086  29.760  0.297   1.00 17.61 ? 247  ILE A N     1 
ATOM   1224 C  CA    . ILE A 1 213 ? 89.502  29.548  0.029   1.00 17.80 ? 247  ILE A CA    1 
ATOM   1225 C  C     . ILE A 1 213 ? 89.739  29.714  -1.473  1.00 18.40 ? 247  ILE A C     1 
ATOM   1226 O  O     . ILE A 1 213 ? 90.638  30.442  -1.882  1.00 18.48 ? 247  ILE A O     1 
ATOM   1227 C  CB    . ILE A 1 213 ? 89.979  28.153  0.549   1.00 17.75 ? 247  ILE A CB    1 
ATOM   1228 C  CG1   . ILE A 1 213 ? 90.039  28.151  2.087   1.00 17.70 ? 247  ILE A CG1   1 
ATOM   1229 C  CG2   . ILE A 1 213 ? 91.350  27.793  -0.006  1.00 17.14 ? 247  ILE A CG2   1 
ATOM   1230 C  CD1   . ILE A 1 213 ? 90.454  26.821  2.707   1.00 15.47 ? 247  ILE A CD1   1 
ATOM   1231 N  N     . ASP A 1 214 ? 88.904  29.052  -2.274  1.00 18.98 ? 248  ASP A N     1 
ATOM   1232 C  CA    . ASP A 1 214 ? 88.915  29.161  -3.733  1.00 19.91 ? 248  ASP A CA    1 
ATOM   1233 C  C     . ASP A 1 214 ? 89.002  30.631  -4.177  1.00 20.54 ? 248  ASP A C     1 
ATOM   1234 O  O     . ASP A 1 214 ? 89.834  30.987  -5.016  1.00 20.59 ? 248  ASP A O     1 
ATOM   1235 C  CB    . ASP A 1 214 ? 87.642  28.502  -4.288  1.00 20.01 ? 248  ASP A CB    1 
ATOM   1236 C  CG    . ASP A 1 214 ? 87.683  28.241  -5.783  1.00 21.43 ? 248  ASP A CG    1 
ATOM   1237 O  OD1   . ASP A 1 214 ? 88.746  28.390  -6.427  1.00 24.99 ? 248  ASP A OD1   1 
ATOM   1238 O  OD2   . ASP A 1 214 ? 86.619  27.865  -6.330  1.00 22.91 ? 248  ASP A OD2   1 
ATOM   1239 N  N     . VAL A 1 215 ? 88.150  31.476  -3.594  1.00 21.09 ? 249  VAL A N     1 
ATOM   1240 C  CA    . VAL A 1 215 ? 88.084  32.884  -3.953  1.00 21.38 ? 249  VAL A CA    1 
ATOM   1241 C  C     . VAL A 1 215 ? 89.272  33.652  -3.366  1.00 21.79 ? 249  VAL A C     1 
ATOM   1242 O  O     . VAL A 1 215 ? 89.848  34.519  -4.025  1.00 21.85 ? 249  VAL A O     1 
ATOM   1243 C  CB    . VAL A 1 215 ? 86.752  33.534  -3.487  1.00 21.49 ? 249  VAL A CB    1 
ATOM   1244 C  CG1   . VAL A 1 215 ? 86.773  35.026  -3.743  1.00 21.40 ? 249  VAL A CG1   1 
ATOM   1245 C  CG2   . VAL A 1 215 ? 85.552  32.905  -4.205  1.00 20.97 ? 249  VAL A CG2   1 
ATOM   1246 N  N     . LEU A 1 216 ? 89.639  33.337  -2.133  1.00 22.23 ? 250  LEU A N     1 
ATOM   1247 C  CA    . LEU A 1 216 ? 90.724  34.047  -1.470  1.00 22.56 ? 250  LEU A CA    1 
ATOM   1248 C  C     . LEU A 1 216 ? 92.042  33.892  -2.218  1.00 23.21 ? 250  LEU A C     1 
ATOM   1249 O  O     . LEU A 1 216 ? 92.763  34.864  -2.407  1.00 23.65 ? 250  LEU A O     1 
ATOM   1250 C  CB    . LEU A 1 216 ? 90.877  33.592  -0.017  1.00 22.12 ? 250  LEU A CB    1 
ATOM   1251 C  CG    . LEU A 1 216 ? 89.895  34.208  0.972   1.00 21.49 ? 250  LEU A CG    1 
ATOM   1252 C  CD1   . LEU A 1 216 ? 90.245  33.758  2.369   1.00 20.41 ? 250  LEU A CD1   1 
ATOM   1253 C  CD2   . LEU A 1 216 ? 89.870  35.739  0.880   1.00 20.63 ? 250  LEU A CD2   1 
ATOM   1254 N  N     . GLU A 1 217 ? 92.342  32.687  -2.679  1.00 24.01 ? 251  GLU A N     1 
ATOM   1255 C  CA    . GLU A 1 217 ? 93.596  32.454  -3.395  1.00 25.00 ? 251  GLU A CA    1 
ATOM   1256 C  C     . GLU A 1 217 ? 93.727  33.270  -4.690  1.00 24.93 ? 251  GLU A C     1 
ATOM   1257 O  O     . GLU A 1 217 ? 94.841  33.483  -5.172  1.00 25.08 ? 251  GLU A O     1 
ATOM   1258 C  CB    . GLU A 1 217 ? 93.793  30.954  -3.672  1.00 25.52 ? 251  GLU A CB    1 
ATOM   1259 C  CG    . GLU A 1 217 ? 94.060  30.140  -2.384  1.00 27.30 ? 251  GLU A CG    1 
ATOM   1260 C  CD    . GLU A 1 217 ? 94.154  28.633  -2.617  1.00 30.79 ? 251  GLU A CD    1 
ATOM   1261 O  OE1   . GLU A 1 217 ? 93.416  28.103  -3.489  1.00 32.43 ? 251  GLU A OE1   1 
ATOM   1262 O  OE2   . GLU A 1 217 ? 94.964  27.975  -1.913  1.00 32.54 ? 251  GLU A OE2   1 
ATOM   1263 N  N     . LYS A 1 218 ? 92.609  33.741  -5.238  1.00 24.84 ? 252  LYS A N     1 
ATOM   1264 C  CA    . LYS A 1 218 ? 92.625  34.477  -6.506  1.00 24.93 ? 252  LYS A CA    1 
ATOM   1265 C  C     . LYS A 1 218 ? 92.274  35.969  -6.406  1.00 24.35 ? 252  LYS A C     1 
ATOM   1266 O  O     . LYS A 1 218 ? 92.684  36.756  -7.261  1.00 24.35 ? 252  LYS A O     1 
ATOM   1267 C  CB    . LYS A 1 218 ? 91.670  33.806  -7.486  1.00 25.16 ? 252  LYS A CB    1 
ATOM   1268 C  CG    . LYS A 1 218 ? 91.961  32.338  -7.677  1.00 26.51 ? 252  LYS A CG    1 
ATOM   1269 C  CD    . LYS A 1 218 ? 90.730  31.559  -8.101  1.00 28.48 ? 252  LYS A CD    1 
ATOM   1270 C  CE    . LYS A 1 218 ? 91.018  30.061  -8.096  1.00 29.72 ? 252  LYS A CE    1 
ATOM   1271 N  NZ    . LYS A 1 218 ? 91.124  29.495  -6.712  1.00 30.30 ? 252  LYS A NZ    1 
ATOM   1272 N  N     . TYR A 1 219 ? 91.508  36.360  -5.393  1.00 23.55 ? 253  TYR A N     1 
ATOM   1273 C  CA    . TYR A 1 219 ? 91.044  37.747  -5.297  1.00 23.34 ? 253  TYR A CA    1 
ATOM   1274 C  C     . TYR A 1 219 ? 91.141  38.331  -3.885  1.00 22.65 ? 253  TYR A C     1 
ATOM   1275 O  O     . TYR A 1 219 ? 90.425  39.279  -3.569  1.00 22.44 ? 253  TYR A O     1 
ATOM   1276 C  CB    . TYR A 1 219 ? 89.594  37.858  -5.790  1.00 23.47 ? 253  TYR A CB    1 
ATOM   1277 C  CG    . TYR A 1 219 ? 89.330  37.262  -7.160  1.00 24.62 ? 253  TYR A CG    1 
ATOM   1278 C  CD1   . TYR A 1 219 ? 89.621  37.973  -8.325  1.00 26.25 ? 253  TYR A CD1   1 
ATOM   1279 C  CD2   . TYR A 1 219 ? 88.775  35.993  -7.290  1.00 25.89 ? 253  TYR A CD2   1 
ATOM   1280 C  CE1   . TYR A 1 219 ? 89.371  37.425  -9.591  1.00 27.34 ? 253  TYR A CE1   1 
ATOM   1281 C  CE2   . TYR A 1 219 ? 88.527  35.433  -8.545  1.00 27.39 ? 253  TYR A CE2   1 
ATOM   1282 C  CZ    . TYR A 1 219 ? 88.820  36.153  -9.690  1.00 28.00 ? 253  TYR A CZ    1 
ATOM   1283 O  OH    . TYR A 1 219 ? 88.570  35.587  -10.923 1.00 29.57 ? 253  TYR A OH    1 
ATOM   1284 N  N     . SER A 1 220 ? 92.018  37.788  -3.039  1.00 21.91 ? 254  SER A N     1 
ATOM   1285 C  CA    . SER A 1 220 ? 92.184  38.350  -1.697  1.00 21.64 ? 254  SER A CA    1 
ATOM   1286 C  C     . SER A 1 220 ? 92.680  39.802  -1.753  1.00 21.39 ? 254  SER A C     1 
ATOM   1287 O  O     . SER A 1 220 ? 92.308  40.617  -0.914  1.00 21.04 ? 254  SER A O     1 
ATOM   1288 C  CB    . SER A 1 220 ? 93.104  37.488  -0.826  1.00 21.57 ? 254  SER A CB    1 
ATOM   1289 O  OG    . SER A 1 220 ? 94.418  37.394  -1.346  1.00 21.56 ? 254  SER A OG    1 
ATOM   1290 N  N     . ASN A 1 221 ? 93.490  40.130  -2.758  1.00 21.31 ? 255  ASN A N     1 
ATOM   1291 C  CA    . ASN A 1 221 ? 93.993  41.496  -2.907  1.00 21.25 ? 255  ASN A CA    1 
ATOM   1292 C  C     . ASN A 1 221 ? 92.910  42.472  -3.338  1.00 21.00 ? 255  ASN A C     1 
ATOM   1293 O  O     . ASN A 1 221 ? 92.912  43.628  -2.927  1.00 21.24 ? 255  ASN A O     1 
ATOM   1294 C  CB    . ASN A 1 221 ? 95.161  41.560  -3.905  1.00 21.32 ? 255  ASN A CB    1 
ATOM   1295 C  CG    . ASN A 1 221 ? 96.514  41.302  -3.258  1.00 21.40 ? 255  ASN A CG    1 
ATOM   1296 O  OD1   . ASN A 1 221 ? 96.646  41.287  -2.032  1.00 21.62 ? 255  ASN A OD1   1 
ATOM   1297 N  ND2   . ASN A 1 221 ? 97.538  41.129  -4.090  1.00 21.10 ? 255  ASN A ND2   1 
ATOM   1298 N  N     . LYS A 1 222 ? 91.992  42.011  -4.171  1.00 20.75 ? 256  LYS A N     1 
ATOM   1299 C  CA    . LYS A 1 222 ? 90.983  42.889  -4.749  1.00 20.57 ? 256  LYS A CA    1 
ATOM   1300 C  C     . LYS A 1 222 ? 89.917  43.302  -3.740  1.00 20.09 ? 256  LYS A C     1 
ATOM   1301 O  O     . LYS A 1 222 ? 89.497  44.456  -3.722  1.00 20.06 ? 256  LYS A O     1 
ATOM   1302 C  CB    . LYS A 1 222 ? 90.336  42.209  -5.954  1.00 20.77 ? 256  LYS A CB    1 
ATOM   1303 C  CG    . LYS A 1 222 ? 89.313  43.061  -6.682  1.00 22.26 ? 256  LYS A CG    1 
ATOM   1304 C  CD    . LYS A 1 222 ? 89.188  42.655  -8.142  1.00 23.64 ? 256  LYS A CD    1 
ATOM   1305 C  CE    . LYS A 1 222 ? 88.152  43.500  -8.852  1.00 24.52 ? 256  LYS A CE    1 
ATOM   1306 N  NZ    . LYS A 1 222 ? 88.044  43.125  -10.289 1.00 26.37 ? 256  LYS A NZ    1 
ATOM   1307 N  N     . PHE A 1 223 ? 89.484  42.362  -2.902  1.00 19.79 ? 257  PHE A N     1 
ATOM   1308 C  CA    . PHE A 1 223 ? 88.383  42.614  -1.969  1.00 19.11 ? 257  PHE A CA    1 
ATOM   1309 C  C     . PHE A 1 223 ? 88.717  42.512  -0.485  1.00 18.96 ? 257  PHE A C     1 
ATOM   1310 O  O     . PHE A 1 223 ? 87.989  43.074  0.334   1.00 19.18 ? 257  PHE A O     1 
ATOM   1311 C  CB    . PHE A 1 223 ? 87.240  41.649  -2.254  1.00 18.88 ? 257  PHE A CB    1 
ATOM   1312 C  CG    . PHE A 1 223 ? 86.773  41.656  -3.681  1.00 18.03 ? 257  PHE A CG    1 
ATOM   1313 C  CD1   . PHE A 1 223 ? 85.847  42.589  -4.119  1.00 16.59 ? 257  PHE A CD1   1 
ATOM   1314 C  CD2   . PHE A 1 223 ? 87.231  40.702  -4.577  1.00 17.82 ? 257  PHE A CD2   1 
ATOM   1315 C  CE1   . PHE A 1 223 ? 85.399  42.586  -5.427  1.00 17.13 ? 257  PHE A CE1   1 
ATOM   1316 C  CE2   . PHE A 1 223 ? 86.790  40.698  -5.903  1.00 17.98 ? 257  PHE A CE2   1 
ATOM   1317 C  CZ    . PHE A 1 223 ? 85.868  41.643  -6.322  1.00 17.09 ? 257  PHE A CZ    1 
ATOM   1318 N  N     . PHE A 1 224 ? 89.789  41.812  -0.116  1.00 18.82 ? 258  PHE A N     1 
ATOM   1319 C  CA    . PHE A 1 224 ? 89.942  41.368  1.286   1.00 18.79 ? 258  PHE A CA    1 
ATOM   1320 C  C     . PHE A 1 224 ? 91.088  41.958  2.114   1.00 18.47 ? 258  PHE A C     1 
ATOM   1321 O  O     . PHE A 1 224 ? 91.397  41.435  3.194   1.00 18.85 ? 258  PHE A O     1 
ATOM   1322 C  CB    . PHE A 1 224 ? 90.005  39.829  1.330   1.00 19.00 ? 258  PHE A CB    1 
ATOM   1323 C  CG    . PHE A 1 224 ? 88.729  39.156  0.886   1.00 19.48 ? 258  PHE A CG    1 
ATOM   1324 C  CD1   . PHE A 1 224 ? 87.753  38.814  1.808   1.00 19.82 ? 258  PHE A CD1   1 
ATOM   1325 C  CD2   . PHE A 1 224 ? 88.502  38.871  -0.452  1.00 19.65 ? 258  PHE A CD2   1 
ATOM   1326 C  CE1   . PHE A 1 224 ? 86.582  38.194  1.405   1.00 19.22 ? 258  PHE A CE1   1 
ATOM   1327 C  CE2   . PHE A 1 224 ? 87.327  38.246  -0.856  1.00 19.34 ? 258  PHE A CE2   1 
ATOM   1328 C  CZ    . PHE A 1 224 ? 86.369  37.914  0.080   1.00 18.97 ? 258  PHE A CZ    1 
ATOM   1329 N  N     . ARG A 1 225 ? 91.668  43.076  1.678   1.00 18.17 ? 259  ARG A N     1 
ATOM   1330 C  CA    . ARG A 1 225 ? 92.802  43.666  2.409   1.00 17.96 ? 259  ARG A CA    1 
ATOM   1331 C  C     . ARG A 1 225 ? 92.417  44.569  3.590   1.00 17.74 ? 259  ARG A C     1 
ATOM   1332 O  O     . ARG A 1 225 ? 93.296  45.077  4.281   1.00 17.48 ? 259  ARG A O     1 
ATOM   1333 C  CB    . ARG A 1 225 ? 93.728  44.424  1.459   1.00 17.84 ? 259  ARG A CB    1 
ATOM   1334 C  CG    . ARG A 1 225 ? 94.305  43.564  0.353   1.00 18.23 ? 259  ARG A CG    1 
ATOM   1335 C  CD    . ARG A 1 225 ? 94.809  44.410  -0.792  1.00 18.63 ? 259  ARG A CD    1 
ATOM   1336 N  NE    . ARG A 1 225 ? 95.797  45.357  -0.316  1.00 19.48 ? 259  ARG A NE    1 
ATOM   1337 C  CZ    . ARG A 1 225 ? 95.797  46.668  -0.539  1.00 20.65 ? 259  ARG A CZ    1 
ATOM   1338 N  NH1   . ARG A 1 225 ? 94.862  47.250  -1.286  1.00 21.25 ? 259  ARG A NH1   1 
ATOM   1339 N  NH2   . ARG A 1 225 ? 96.773  47.406  -0.012  1.00 21.34 ? 259  ARG A NH2   1 
ATOM   1340 N  N     . PHE A 1 226 ? 91.123  44.764  3.837   1.00 17.70 ? 260  PHE A N     1 
ATOM   1341 C  CA    . PHE A 1 226 ? 90.681  45.692  4.883   1.00 17.75 ? 260  PHE A CA    1 
ATOM   1342 C  C     . PHE A 1 226 ? 89.647  45.070  5.807   1.00 18.26 ? 260  PHE A C     1 
ATOM   1343 O  O     . PHE A 1 226 ? 88.842  45.780  6.419   1.00 18.57 ? 260  PHE A O     1 
ATOM   1344 C  CB    . PHE A 1 226 ? 90.114  46.974  4.252   1.00 17.53 ? 260  PHE A CB    1 
ATOM   1345 C  CG    . PHE A 1 226 ? 91.059  47.660  3.315   1.00 16.20 ? 260  PHE A CG    1 
ATOM   1346 C  CD1   . PHE A 1 226 ? 91.907  48.656  3.771   1.00 16.51 ? 260  PHE A CD1   1 
ATOM   1347 C  CD2   . PHE A 1 226 ? 91.103  47.307  1.973   1.00 15.41 ? 260  PHE A CD2   1 
ATOM   1348 C  CE1   . PHE A 1 226 ? 92.781  49.299  2.899   1.00 16.60 ? 260  PHE A CE1   1 
ATOM   1349 C  CE2   . PHE A 1 226 ? 91.966  47.936  1.099   1.00 15.30 ? 260  PHE A CE2   1 
ATOM   1350 C  CZ    . PHE A 1 226 ? 92.811  48.935  1.560   1.00 16.25 ? 260  PHE A CZ    1 
ATOM   1351 N  N     . VAL A 1 227 ? 89.684  43.745  5.922   1.00 18.53 ? 261  VAL A N     1 
ATOM   1352 C  CA    . VAL A 1 227 ? 88.772  43.020  6.782   1.00 18.31 ? 261  VAL A CA    1 
ATOM   1353 C  C     . VAL A 1 227 ? 89.075  43.379  8.231   1.00 18.77 ? 261  VAL A C     1 
ATOM   1354 O  O     . VAL A 1 227 ? 90.229  43.365  8.639   1.00 18.76 ? 261  VAL A O     1 
ATOM   1355 C  CB    . VAL A 1 227 ? 88.895  41.494  6.555   1.00 18.23 ? 261  VAL A CB    1 
ATOM   1356 C  CG1   . VAL A 1 227 ? 88.187  40.713  7.658   1.00 17.63 ? 261  VAL A CG1   1 
ATOM   1357 C  CG2   . VAL A 1 227 ? 88.339  41.127  5.194   1.00 17.39 ? 261  VAL A CG2   1 
ATOM   1358 N  N     . ASP A 1 228 ? 88.037  43.718  8.991   1.00 19.52 ? 262  ASP A N     1 
ATOM   1359 C  CA    . ASP A 1 228 ? 88.177  44.033  10.414  1.00 20.43 ? 262  ASP A CA    1 
ATOM   1360 C  C     . ASP A 1 228 ? 87.615  42.979  11.364  1.00 20.75 ? 262  ASP A C     1 
ATOM   1361 O  O     . ASP A 1 228 ? 88.053  42.898  12.504  1.00 20.90 ? 262  ASP A O     1 
ATOM   1362 C  CB    . ASP A 1 228 ? 87.528  45.384  10.713  1.00 20.76 ? 262  ASP A CB    1 
ATOM   1363 C  CG    . ASP A 1 228 ? 88.392  46.548  10.274  1.00 21.91 ? 262  ASP A CG    1 
ATOM   1364 O  OD1   . ASP A 1 228 ? 89.599  46.547  10.605  1.00 23.36 ? 262  ASP A OD1   1 
ATOM   1365 O  OD2   . ASP A 1 228 ? 87.864  47.460  9.608   1.00 23.38 ? 262  ASP A OD2   1 
ATOM   1366 N  N     . TYR A 1 229 ? 86.649  42.183  10.907  1.00 21.20 ? 263  TYR A N     1 
ATOM   1367 C  CA    . TYR A 1 229 ? 86.023  41.157  11.743  1.00 21.52 ? 263  TYR A CA    1 
ATOM   1368 C  C     . TYR A 1 229 ? 85.880  39.860  10.980  1.00 21.43 ? 263  TYR A C     1 
ATOM   1369 O  O     . TYR A 1 229 ? 85.432  39.875  9.853   1.00 22.25 ? 263  TYR A O     1 
ATOM   1370 C  CB    . TYR A 1 229 ? 84.616  41.586  12.144  1.00 21.69 ? 263  TYR A CB    1 
ATOM   1371 C  CG    . TYR A 1 229 ? 84.537  42.607  13.244  1.00 22.13 ? 263  TYR A CG    1 
ATOM   1372 C  CD1   . TYR A 1 229 ? 84.478  42.222  14.577  1.00 23.00 ? 263  TYR A CD1   1 
ATOM   1373 C  CD2   . TYR A 1 229 ? 84.480  43.963  12.949  1.00 22.94 ? 263  TYR A CD2   1 
ATOM   1374 C  CE1   . TYR A 1 229 ? 84.387  43.172  15.600  1.00 23.52 ? 263  TYR A CE1   1 
ATOM   1375 C  CE2   . TYR A 1 229 ? 84.384  44.910  13.952  1.00 23.67 ? 263  TYR A CE2   1 
ATOM   1376 C  CZ    . TYR A 1 229 ? 84.337  44.515  15.273  1.00 23.95 ? 263  TYR A CZ    1 
ATOM   1377 O  OH    . TYR A 1 229 ? 84.247  45.476  16.253  1.00 24.82 ? 263  TYR A OH    1 
ATOM   1378 N  N     . LYS A 1 230 ? 86.239  38.738  11.591  1.00 21.42 ? 264  LYS A N     1 
ATOM   1379 C  CA    . LYS A 1 230 ? 85.867  37.432  11.045  1.00 21.22 ? 264  LYS A CA    1 
ATOM   1380 C  C     . LYS A 1 230 ? 85.016  36.686  12.076  1.00 21.08 ? 264  LYS A C     1 
ATOM   1381 O  O     . LYS A 1 230 ? 85.338  36.671  13.262  1.00 20.83 ? 264  LYS A O     1 
ATOM   1382 C  CB    . LYS A 1 230 ? 87.096  36.620  10.597  1.00 21.41 ? 264  LYS A CB    1 
ATOM   1383 C  CG    . LYS A 1 230 ? 87.887  35.897  11.683  1.00 21.48 ? 264  LYS A CG    1 
ATOM   1384 C  CD    . LYS A 1 230 ? 89.027  35.083  11.064  1.00 21.56 ? 264  LYS A CD    1 
ATOM   1385 C  CE    . LYS A 1 230 ? 89.956  34.498  12.135  1.00 22.34 ? 264  LYS A CE    1 
ATOM   1386 N  NZ    . LYS A 1 230 ? 90.964  35.477  12.661  1.00 22.02 ? 264  LYS A NZ    1 
ATOM   1387 N  N     . VAL A 1 231 ? 83.903  36.115  11.618  1.00 20.71 ? 265  VAL A N     1 
ATOM   1388 C  CA    . VAL A 1 231 ? 82.978  35.409  12.493  1.00 20.33 ? 265  VAL A CA    1 
ATOM   1389 C  C     . VAL A 1 231 ? 82.928  33.924  12.142  1.00 20.13 ? 265  VAL A C     1 
ATOM   1390 O  O     . VAL A 1 231 ? 82.677  33.547  11.000  1.00 19.05 ? 265  VAL A O     1 
ATOM   1391 C  CB    . VAL A 1 231 ? 81.550  35.972  12.380  1.00 20.70 ? 265  VAL A CB    1 
ATOM   1392 C  CG1   . VAL A 1 231 ? 80.556  35.053  13.111  1.00 19.98 ? 265  VAL A CG1   1 
ATOM   1393 C  CG2   . VAL A 1 231 ? 81.492  37.404  12.917  1.00 19.73 ? 265  VAL A CG2   1 
ATOM   1394 N  N     . LEU A 1 232 ? 83.173  33.086  13.139  1.00 20.24 ? 266  LEU A N     1 
ATOM   1395 C  CA    . LEU A 1 232 ? 82.956  31.655  12.999  1.00 20.55 ? 266  LEU A CA    1 
ATOM   1396 C  C     . LEU A 1 232 ? 81.645  31.287  13.689  1.00 20.87 ? 266  LEU A C     1 
ATOM   1397 O  O     . LEU A 1 232 ? 81.579  31.232  14.916  1.00 20.80 ? 266  LEU A O     1 
ATOM   1398 C  CB    . LEU A 1 232 ? 84.132  30.871  13.585  1.00 20.22 ? 266  LEU A CB    1 
ATOM   1399 C  CG    . LEU A 1 232 ? 85.395  30.837  12.713  1.00 19.88 ? 266  LEU A CG    1 
ATOM   1400 C  CD1   . LEU A 1 232 ? 86.105  32.180  12.694  1.00 18.03 ? 266  LEU A CD1   1 
ATOM   1401 C  CD2   . LEU A 1 232 ? 86.335  29.732  13.189  1.00 19.49 ? 266  LEU A CD2   1 
ATOM   1402 N  N     . ASP A 1 233 ? 80.596  31.075  12.899  1.00 21.61 ? 267  ASP A N     1 
ATOM   1403 C  CA    . ASP A 1 233 ? 79.344  30.550  13.438  1.00 22.58 ? 267  ASP A CA    1 
ATOM   1404 C  C     . ASP A 1 233 ? 79.501  29.044  13.534  1.00 22.72 ? 267  ASP A C     1 
ATOM   1405 O  O     . ASP A 1 233 ? 80.228  28.439  12.747  1.00 23.46 ? 267  ASP A O     1 
ATOM   1406 C  CB    . ASP A 1 233 ? 78.139  30.918  12.568  1.00 22.74 ? 267  ASP A CB    1 
ATOM   1407 C  CG    . ASP A 1 233 ? 76.802  30.825  13.327  1.00 24.36 ? 267  ASP A CG    1 
ATOM   1408 O  OD1   . ASP A 1 233 ? 76.784  30.546  14.553  1.00 26.88 ? 267  ASP A OD1   1 
ATOM   1409 O  OD2   . ASP A 1 233 ? 75.751  31.042  12.689  1.00 26.80 ? 267  ASP A OD2   1 
ATOM   1410 N  N     . GLU A 1 234 ? 78.836  28.443  14.508  1.00 22.83 ? 268  GLU A N     1 
ATOM   1411 C  CA    . GLU A 1 234 ? 79.087  27.055  14.848  1.00 23.05 ? 268  GLU A CA    1 
ATOM   1412 C  C     . GLU A 1 234 ? 80.603  26.837  14.991  1.00 23.08 ? 268  GLU A C     1 
ATOM   1413 O  O     . GLU A 1 234 ? 81.167  25.929  14.390  1.00 23.14 ? 268  GLU A O     1 
ATOM   1414 C  CB    . GLU A 1 234 ? 78.482  26.125  13.794  1.00 23.10 ? 268  GLU A CB    1 
ATOM   1415 C  CG    . GLU A 1 234 ? 77.010  26.396  13.459  1.00 23.47 ? 268  GLU A CG    1 
ATOM   1416 C  CD    . GLU A 1 234 ? 76.054  26.249  14.647  1.00 24.79 ? 268  GLU A CD    1 
ATOM   1417 O  OE1   . GLU A 1 234 ? 76.390  25.562  15.642  1.00 23.90 ? 268  GLU A OE1   1 
ATOM   1418 O  OE2   . GLU A 1 234 ? 74.938  26.819  14.569  1.00 26.47 ? 268  GLU A OE2   1 
ATOM   1419 N  N     . ALA A 1 235 ? 81.241  27.679  15.806  1.00 22.96 ? 269  ALA A N     1 
ATOM   1420 C  CA    . ALA A 1 235 ? 82.702  27.726  15.909  1.00 22.88 ? 269  ALA A CA    1 
ATOM   1421 C  C     . ALA A 1 235 ? 83.303  26.373  16.233  1.00 22.76 ? 269  ALA A C     1 
ATOM   1422 O  O     . ALA A 1 235 ? 84.262  25.957  15.586  1.00 22.86 ? 269  ALA A O     1 
ATOM   1423 C  CB    . ALA A 1 235 ? 83.139  28.749  16.954  1.00 22.85 ? 269  ALA A CB    1 
ATOM   1424 N  N     . ASP A 1 236 ? 82.727  25.687  17.218  1.00 22.61 ? 270  ASP A N     1 
ATOM   1425 C  CA    . ASP A 1 236 ? 83.236  24.386  17.669  1.00 22.62 ? 270  ASP A CA    1 
ATOM   1426 C  C     . ASP A 1 236 ? 83.358  23.367  16.544  1.00 22.51 ? 270  ASP A C     1 
ATOM   1427 O  O     . ASP A 1 236 ? 84.291  22.579  16.543  1.00 22.70 ? 270  ASP A O     1 
ATOM   1428 C  CB    . ASP A 1 236 ? 82.379  23.818  18.811  1.00 22.73 ? 270  ASP A CB    1 
ATOM   1429 C  CG    . ASP A 1 236 ? 80.933  23.579  18.403  1.00 23.17 ? 270  ASP A CG    1 
ATOM   1430 O  OD1   . ASP A 1 236 ? 80.334  24.500  17.810  1.00 23.79 ? 270  ASP A OD1   1 
ATOM   1431 O  OD2   . ASP A 1 236 ? 80.392  22.481  18.680  1.00 22.16 ? 270  ASP A OD2   1 
ATOM   1432 N  N     . ARG A 1 237 ? 82.433  23.409  15.586  1.00 22.71 ? 271  ARG A N     1 
ATOM   1433 C  CA    . ARG A 1 237 ? 82.446  22.520  14.420  1.00 22.72 ? 271  ARG A CA    1 
ATOM   1434 C  C     . ARG A 1 237 ? 83.518  22.894  13.403  1.00 22.74 ? 271  ARG A C     1 
ATOM   1435 O  O     . ARG A 1 237 ? 84.199  22.021  12.855  1.00 23.03 ? 271  ARG A O     1 
ATOM   1436 C  CB    . ARG A 1 237 ? 81.091  22.558  13.720  1.00 22.90 ? 271  ARG A CB    1 
ATOM   1437 C  CG    . ARG A 1 237 ? 80.998  21.727  12.442  1.00 23.19 ? 271  ARG A CG    1 
ATOM   1438 C  CD    . ARG A 1 237 ? 80.870  20.271  12.775  1.00 24.75 ? 271  ARG A CD    1 
ATOM   1439 N  NE    . ARG A 1 237 ? 80.877  19.412  11.593  1.00 25.96 ? 271  ARG A NE    1 
ATOM   1440 C  CZ    . ARG A 1 237 ? 81.966  18.950  10.990  1.00 27.16 ? 271  ARG A CZ    1 
ATOM   1441 N  NH1   . ARG A 1 237 ? 83.174  19.272  11.439  1.00 29.74 ? 271  ARG A NH1   1 
ATOM   1442 N  NH2   . ARG A 1 237 ? 81.850  18.163  9.925   1.00 27.08 ? 271  ARG A NH2   1 
ATOM   1443 N  N     . LEU A 1 238 ? 83.630  24.186  13.111  1.00 22.33 ? 272  LEU A N     1 
ATOM   1444 C  CA    . LEU A 1 238 ? 84.666  24.686  12.209  1.00 21.85 ? 272  LEU A CA    1 
ATOM   1445 C  C     . LEU A 1 238 ? 86.098  24.459  12.737  1.00 21.76 ? 272  LEU A C     1 
ATOM   1446 O  O     . LEU A 1 238 ? 87.056  24.593  11.990  1.00 21.03 ? 272  LEU A O     1 
ATOM   1447 C  CB    . LEU A 1 238 ? 84.443  26.175  11.935  1.00 21.63 ? 272  LEU A CB    1 
ATOM   1448 C  CG    . LEU A 1 238 ? 83.201  26.523  11.112  1.00 20.88 ? 272  LEU A CG    1 
ATOM   1449 C  CD1   . LEU A 1 238 ? 82.938  28.021  11.157  1.00 19.62 ? 272  LEU A CD1   1 
ATOM   1450 C  CD2   . LEU A 1 238 ? 83.336  26.036  9.677   1.00 18.52 ? 272  LEU A CD2   1 
ATOM   1451 N  N     . LEU A 1 239 ? 86.234  24.132  14.022  1.00 22.02 ? 273  LEU A N     1 
ATOM   1452 C  CA    . LEU A 1 239 ? 87.535  23.826  14.611  1.00 22.33 ? 273  LEU A CA    1 
ATOM   1453 C  C     . LEU A 1 239 ? 87.777  22.324  14.841  1.00 22.83 ? 273  LEU A C     1 
ATOM   1454 O  O     . LEU A 1 239 ? 88.818  21.937  15.362  1.00 22.90 ? 273  LEU A O     1 
ATOM   1455 C  CB    . LEU A 1 239 ? 87.704  24.618  15.909  1.00 22.29 ? 273  LEU A CB    1 
ATOM   1456 C  CG    . LEU A 1 239 ? 87.736  26.145  15.714  1.00 21.57 ? 273  LEU A CG    1 
ATOM   1457 C  CD1   . LEU A 1 239 ? 87.800  26.836  17.055  1.00 21.10 ? 273  LEU A CD1   1 
ATOM   1458 C  CD2   . LEU A 1 239 ? 88.903  26.577  14.840  1.00 20.08 ? 273  LEU A CD2   1 
ATOM   1459 N  N     . GLU A 1 240 ? 86.825  21.481  14.448  1.00 23.60 ? 274  GLU A N     1 
ATOM   1460 C  CA    . GLU A 1 240 ? 87.035  20.034  14.438  1.00 24.31 ? 274  GLU A CA    1 
ATOM   1461 C  C     . GLU A 1 240 ? 87.920  19.678  13.257  1.00 24.59 ? 274  GLU A C     1 
ATOM   1462 O  O     . GLU A 1 240 ? 87.958  20.424  12.274  1.00 24.88 ? 274  GLU A O     1 
ATOM   1463 C  CB    . GLU A 1 240 ? 85.706  19.293  14.317  1.00 24.56 ? 274  GLU A CB    1 
ATOM   1464 C  CG    . GLU A 1 240 ? 84.782  19.469  15.520  1.00 26.18 ? 274  GLU A CG    1 
ATOM   1465 C  CD    . GLU A 1 240 ? 83.552  18.574  15.457  1.00 28.64 ? 274  GLU A CD    1 
ATOM   1466 O  OE1   . GLU A 1 240 ? 83.069  18.311  14.333  1.00 30.32 ? 274  GLU A OE1   1 
ATOM   1467 O  OE2   . GLU A 1 240 ? 83.069  18.125  16.526  1.00 30.63 ? 274  GLU A OE2   1 
ATOM   1468 N  N     . ILE A 1 241 ? 88.626  18.548  13.344  1.00 24.91 ? 275  ILE A N     1 
ATOM   1469 C  CA    . ILE A 1 241 ? 89.471  18.081  12.236  1.00 25.14 ? 275  ILE A CA    1 
ATOM   1470 C  C     . ILE A 1 241 ? 88.643  18.091  10.964  1.00 25.21 ? 275  ILE A C     1 
ATOM   1471 O  O     . ILE A 1 241 ? 87.460  17.740  10.989  1.00 25.53 ? 275  ILE A O     1 
ATOM   1472 C  CB    . ILE A 1 241 ? 90.003  16.633  12.440  1.00 25.65 ? 275  ILE A CB    1 
ATOM   1473 C  CG1   . ILE A 1 241 ? 90.859  16.508  13.713  1.00 26.07 ? 275  ILE A CG1   1 
ATOM   1474 C  CG2   . ILE A 1 241 ? 90.837  16.189  11.225  1.00 25.42 ? 275  ILE A CG2   1 
ATOM   1475 C  CD1   . ILE A 1 241 ? 92.131  17.358  13.697  1.00 26.73 ? 275  ILE A CD1   1 
ATOM   1476 N  N     . GLY A 1 242 ? 89.244  18.516  9.856   1.00 25.12 ? 276  GLY A N     1 
ATOM   1477 C  CA    . GLY A 1 242 ? 88.513  18.622  8.594   1.00 24.98 ? 276  GLY A CA    1 
ATOM   1478 C  C     . GLY A 1 242 ? 88.112  20.042  8.228   1.00 24.81 ? 276  GLY A C     1 
ATOM   1479 O  O     . GLY A 1 242 ? 88.140  20.391  7.043   1.00 25.18 ? 276  GLY A O     1 
ATOM   1480 N  N     . PHE A 1 243 ? 87.721  20.855  9.218   1.00 24.06 ? 277  PHE A N     1 
ATOM   1481 C  CA    . PHE A 1 243 ? 87.529  22.304  8.993   1.00 23.60 ? 277  PHE A CA    1 
ATOM   1482 C  C     . PHE A 1 243 ? 88.653  23.174  9.569   1.00 23.98 ? 277  PHE A C     1 
ATOM   1483 O  O     . PHE A 1 243 ? 88.867  24.295  9.108   1.00 23.52 ? 277  PHE A O     1 
ATOM   1484 C  CB    . PHE A 1 243 ? 86.208  22.802  9.587   1.00 23.06 ? 277  PHE A CB    1 
ATOM   1485 C  CG    . PHE A 1 243 ? 85.005  22.517  8.746   1.00 21.55 ? 277  PHE A CG    1 
ATOM   1486 C  CD1   . PHE A 1 243 ? 84.999  22.783  7.385   1.00 19.92 ? 277  PHE A CD1   1 
ATOM   1487 C  CD2   . PHE A 1 243 ? 83.855  22.003  9.324   1.00 20.40 ? 277  PHE A CD2   1 
ATOM   1488 C  CE1   . PHE A 1 243 ? 83.887  22.514  6.631   1.00 19.27 ? 277  PHE A CE1   1 
ATOM   1489 C  CE2   . PHE A 1 243 ? 82.739  21.744  8.565   1.00 19.31 ? 277  PHE A CE2   1 
ATOM   1490 C  CZ    . PHE A 1 243 ? 82.752  22.001  7.225   1.00 18.73 ? 277  PHE A CZ    1 
ATOM   1491 N  N     . ARG A 1 244 ? 89.350  22.669  10.582  1.00 24.50 ? 278  ARG A N     1 
ATOM   1492 C  CA    . ARG A 1 244 ? 90.321  23.471  11.305  1.00 25.05 ? 278  ARG A CA    1 
ATOM   1493 C  C     . ARG A 1 244 ? 91.442  23.966  10.397  1.00 25.12 ? 278  ARG A C     1 
ATOM   1494 O  O     . ARG A 1 244 ? 91.827  25.131  10.474  1.00 24.86 ? 278  ARG A O     1 
ATOM   1495 C  CB    . ARG A 1 244 ? 90.908  22.684  12.476  1.00 25.54 ? 278  ARG A CB    1 
ATOM   1496 C  CG    . ARG A 1 244 ? 91.759  23.543  13.386  1.00 26.99 ? 278  ARG A CG    1 
ATOM   1497 C  CD    . ARG A 1 244 ? 92.393  22.759  14.497  1.00 29.29 ? 278  ARG A CD    1 
ATOM   1498 N  NE    . ARG A 1 244 ? 93.510  23.513  15.060  1.00 31.95 ? 278  ARG A NE    1 
ATOM   1499 C  CZ    . ARG A 1 244 ? 94.417  23.018  15.899  1.00 34.08 ? 278  ARG A CZ    1 
ATOM   1500 N  NH1   . ARG A 1 244 ? 94.347  21.748  16.304  1.00 34.68 ? 278  ARG A NH1   1 
ATOM   1501 N  NH2   . ARG A 1 244 ? 95.400  23.803  16.341  1.00 34.50 ? 278  ARG A NH2   1 
ATOM   1502 N  N     . ASP A 1 245 ? 91.952  23.082  9.541   1.00 25.30 ? 279  ASP A N     1 
ATOM   1503 C  CA    . ASP A 1 245 ? 93.008  23.441  8.600   1.00 25.65 ? 279  ASP A CA    1 
ATOM   1504 C  C     . ASP A 1 245 ? 92.533  24.460  7.575   1.00 25.59 ? 279  ASP A C     1 
ATOM   1505 O  O     . ASP A 1 245 ? 93.292  25.355  7.199   1.00 25.78 ? 279  ASP A O     1 
ATOM   1506 C  CB    . ASP A 1 245 ? 93.571  22.201  7.893   1.00 25.86 ? 279  ASP A CB    1 
ATOM   1507 C  CG    . ASP A 1 245 ? 94.646  21.490  8.714   1.00 27.64 ? 279  ASP A CG    1 
ATOM   1508 O  OD1   . ASP A 1 245 ? 94.964  21.936  9.845   1.00 30.12 ? 279  ASP A OD1   1 
ATOM   1509 O  OD2   . ASP A 1 245 ? 95.186  20.473  8.227   1.00 30.51 ? 279  ASP A OD2   1 
ATOM   1510 N  N     . ASP A 1 246 ? 91.288  24.319  7.124   1.00 25.45 ? 280  ASP A N     1 
ATOM   1511 C  CA    . ASP A 1 246 ? 90.688  25.277  6.194   1.00 25.23 ? 280  ASP A CA    1 
ATOM   1512 C  C     . ASP A 1 246 ? 90.538  26.646  6.836   1.00 24.64 ? 280  ASP A C     1 
ATOM   1513 O  O     . ASP A 1 246 ? 90.750  27.664  6.179   1.00 24.63 ? 280  ASP A O     1 
ATOM   1514 C  CB    . ASP A 1 246 ? 89.310  24.806  5.722   1.00 25.50 ? 280  ASP A CB    1 
ATOM   1515 C  CG    . ASP A 1 246 ? 89.387  23.671  4.717   1.00 26.83 ? 280  ASP A CG    1 
ATOM   1516 O  OD1   . ASP A 1 246 ? 90.510  23.285  4.324   1.00 27.96 ? 280  ASP A OD1   1 
ATOM   1517 O  OD2   . ASP A 1 246 ? 88.310  23.169  4.317   1.00 29.51 ? 280  ASP A OD2   1 
ATOM   1518 N  N     . LEU A 1 247 ? 90.163  26.661  8.113   1.00 23.67 ? 281  LEU A N     1 
ATOM   1519 C  CA    . LEU A 1 247 ? 89.988  27.908  8.840   1.00 22.92 ? 281  LEU A CA    1 
ATOM   1520 C  C     . LEU A 1 247 ? 91.333  28.570  9.047   1.00 22.81 ? 281  LEU A C     1 
ATOM   1521 O  O     . LEU A 1 247 ? 91.455  29.790  8.926   1.00 23.05 ? 281  LEU A O     1 
ATOM   1522 C  CB    . LEU A 1 247 ? 89.286  27.683  10.188  1.00 22.65 ? 281  LEU A CB    1 
ATOM   1523 C  CG    . LEU A 1 247 ? 87.778  27.948  10.217  1.00 22.06 ? 281  LEU A CG    1 
ATOM   1524 C  CD1   . LEU A 1 247 ? 87.495  29.436  10.016  1.00 20.30 ? 281  LEU A CD1   1 
ATOM   1525 C  CD2   . LEU A 1 247 ? 87.045  27.110  9.168   1.00 21.34 ? 281  LEU A CD2   1 
ATOM   1526 N  N     . GLU A 1 248 ? 92.346  27.764  9.344   1.00 22.45 ? 282  GLU A N     1 
ATOM   1527 C  CA    . GLU A 1 248 ? 93.680  28.293  9.555   1.00 22.25 ? 282  GLU A CA    1 
ATOM   1528 C  C     . GLU A 1 248 ? 94.248  28.890  8.275   1.00 21.64 ? 282  GLU A C     1 
ATOM   1529 O  O     . GLU A 1 248 ? 94.935  29.901  8.326   1.00 21.77 ? 282  GLU A O     1 
ATOM   1530 C  CB    . GLU A 1 248 ? 94.607  27.227  10.138  1.00 22.52 ? 282  GLU A CB    1 
ATOM   1531 C  CG    . GLU A 1 248 ? 94.380  27.023  11.631  1.00 23.96 ? 282  GLU A CG    1 
ATOM   1532 C  CD    . GLU A 1 248 ? 95.267  25.964  12.242  1.00 25.64 ? 282  GLU A CD    1 
ATOM   1533 O  OE1   . GLU A 1 248 ? 96.244  25.544  11.588  1.00 27.78 ? 282  GLU A OE1   1 
ATOM   1534 O  OE2   . GLU A 1 248 ? 94.987  25.556  13.390  1.00 27.34 ? 282  GLU A OE2   1 
ATOM   1535 N  N     . THR A 1 249 ? 93.954  28.276  7.134   1.00 20.97 ? 283  THR A N     1 
ATOM   1536 C  CA    . THR A 1 249 ? 94.329  28.843  5.848   1.00 20.56 ? 283  THR A CA    1 
ATOM   1537 C  C     . THR A 1 249 ? 93.581  30.161  5.615   1.00 20.64 ? 283  THR A C     1 
ATOM   1538 O  O     . THR A 1 249 ? 94.177  31.165  5.241   1.00 20.89 ? 283  THR A O     1 
ATOM   1539 C  CB    . THR A 1 249 ? 94.007  27.875  4.694   1.00 20.59 ? 283  THR A CB    1 
ATOM   1540 O  OG1   . THR A 1 249 ? 94.705  26.636  4.888   1.00 20.67 ? 283  THR A OG1   1 
ATOM   1541 C  CG2   . THR A 1 249 ? 94.398  28.476  3.353   1.00 19.67 ? 283  THR A CG2   1 
ATOM   1542 N  N     . ILE A 1 250 ? 92.272  30.153  5.840   1.00 20.24 ? 284  ILE A N     1 
ATOM   1543 C  CA    . ILE A 1 250 ? 91.475  31.354  5.668   1.00 20.05 ? 284  ILE A CA    1 
ATOM   1544 C  C     . ILE A 1 250 ? 92.019  32.493  6.540   1.00 20.15 ? 284  ILE A C     1 
ATOM   1545 O  O     . ILE A 1 250 ? 92.227  33.610  6.059   1.00 20.01 ? 284  ILE A O     1 
ATOM   1546 C  CB    . ILE A 1 250 ? 89.989  31.087  5.997   1.00 20.03 ? 284  ILE A CB    1 
ATOM   1547 C  CG1   . ILE A 1 250 ? 89.350  30.250  4.883   1.00 19.08 ? 284  ILE A CG1   1 
ATOM   1548 C  CG2   . ILE A 1 250 ? 89.226  32.394  6.188   1.00 20.01 ? 284  ILE A CG2   1 
ATOM   1549 C  CD1   . ILE A 1 250 ? 88.096  29.522  5.294   1.00 16.30 ? 284  ILE A CD1   1 
ATOM   1550 N  N     . SER A 1 251 ? 92.259  32.191  7.810   1.00 20.06 ? 285  SER A N     1 
ATOM   1551 C  CA    . SER A 1 251 ? 92.740  33.174  8.766   1.00 20.19 ? 285  SER A CA    1 
ATOM   1552 C  C     . SER A 1 251 ? 94.130  33.680  8.419   1.00 20.48 ? 285  SER A C     1 
ATOM   1553 O  O     . SER A 1 251 ? 94.430  34.859  8.612   1.00 21.11 ? 285  SER A O     1 
ATOM   1554 C  CB    . SER A 1 251 ? 92.780  32.561  10.159  1.00 20.30 ? 285  SER A CB    1 
ATOM   1555 O  OG    . SER A 1 251 ? 93.314  33.477  11.089  1.00 20.67 ? 285  SER A OG    1 
ATOM   1556 N  N     . GLY A 1 252 ? 94.979  32.783  7.922   1.00 20.22 ? 286  GLY A N     1 
ATOM   1557 C  CA    . GLY A 1 252 ? 96.339  33.126  7.551   1.00 19.73 ? 286  GLY A CA    1 
ATOM   1558 C  C     . GLY A 1 252 ? 96.390  34.068  6.362   1.00 19.66 ? 286  GLY A C     1 
ATOM   1559 O  O     . GLY A 1 252 ? 97.216  34.993  6.329   1.00 19.86 ? 286  GLY A O     1 
ATOM   1560 N  N     . ILE A 1 253 ? 95.515  33.836  5.385   1.00 18.93 ? 287  ILE A N     1 
ATOM   1561 C  CA    . ILE A 1 253 ? 95.468  34.663  4.189   1.00 18.78 ? 287  ILE A CA    1 
ATOM   1562 C  C     . ILE A 1 253 ? 94.966  36.073  4.528   1.00 18.96 ? 287  ILE A C     1 
ATOM   1563 O  O     . ILE A 1 253 ? 95.586  37.061  4.162   1.00 18.88 ? 287  ILE A O     1 
ATOM   1564 C  CB    . ILE A 1 253 ? 94.569  34.036  3.099   1.00 18.61 ? 287  ILE A CB    1 
ATOM   1565 C  CG1   . ILE A 1 253 ? 95.220  32.777  2.534   1.00 18.31 ? 287  ILE A CG1   1 
ATOM   1566 C  CG2   . ILE A 1 253 ? 94.313  35.029  1.981   1.00 18.24 ? 287  ILE A CG2   1 
ATOM   1567 C  CD1   . ILE A 1 253 ? 94.426  32.105  1.417   1.00 18.80 ? 287  ILE A CD1   1 
ATOM   1568 N  N     . LEU A 1 254 ? 93.848  36.151  5.239   1.00 19.31 ? 288  LEU A N     1 
ATOM   1569 C  CA    . LEU A 1 254 ? 93.292  37.426  5.681   1.00 19.71 ? 288  LEU A CA    1 
ATOM   1570 C  C     . LEU A 1 254 ? 94.284  38.210  6.526   1.00 20.26 ? 288  LEU A C     1 
ATOM   1571 O  O     . LEU A 1 254 ? 94.319  39.432  6.473   1.00 20.04 ? 288  LEU A O     1 
ATOM   1572 C  CB    . LEU A 1 254 ? 92.006  37.211  6.492   1.00 19.54 ? 288  LEU A CB    1 
ATOM   1573 C  CG    . LEU A 1 254 ? 90.817  36.593  5.750   1.00 19.25 ? 288  LEU A CG    1 
ATOM   1574 C  CD1   . LEU A 1 254 ? 89.641  36.417  6.693   1.00 17.89 ? 288  LEU A CD1   1 
ATOM   1575 C  CD2   . LEU A 1 254 ? 90.438  37.421  4.540   1.00 17.88 ? 288  LEU A CD2   1 
ATOM   1576 N  N     . ASN A 1 255 ? 95.087  37.501  7.310   1.00 21.20 ? 289  ASN A N     1 
ATOM   1577 C  CA    . ASN A 1 255 ? 96.092  38.149  8.134   1.00 21.84 ? 289  ASN A CA    1 
ATOM   1578 C  C     . ASN A 1 255 ? 97.267  38.658  7.318   1.00 22.57 ? 289  ASN A C     1 
ATOM   1579 O  O     . ASN A 1 255 ? 97.746  39.754  7.561   1.00 22.87 ? 289  ASN A O     1 
ATOM   1580 C  CB    . ASN A 1 255 ? 96.578  37.208  9.236   1.00 21.67 ? 289  ASN A CB    1 
ATOM   1581 C  CG    . ASN A 1 255 ? 95.680  37.223  10.452  1.00 21.36 ? 289  ASN A CG    1 
ATOM   1582 O  OD1   . ASN A 1 255 ? 94.667  37.919  10.482  1.00 21.24 ? 289  ASN A OD1   1 
ATOM   1583 N  ND2   . ASN A 1 255 ? 96.062  36.470  11.477  1.00 21.22 ? 289  ASN A ND2   1 
ATOM   1584 N  N     . GLU A 1 256 ? 97.735  37.869  6.358   1.00 23.59 ? 290  GLU A N     1 
ATOM   1585 C  CA    . GLU A 1 256 ? 98.870  38.280  5.532   1.00 24.40 ? 290  GLU A CA    1 
ATOM   1586 C  C     . GLU A 1 256 ? 98.511  39.503  4.683   1.00 24.30 ? 290  GLU A C     1 
ATOM   1587 O  O     . GLU A 1 256 ? 99.329  40.411  4.509   1.00 24.45 ? 290  GLU A O     1 
ATOM   1588 C  CB    . GLU A 1 256 ? 99.358  37.128  4.627   1.00 24.90 ? 290  GLU A CB    1 
ATOM   1589 C  CG    . GLU A 1 256 ? 100.135 37.608  3.372   1.00 27.49 ? 290  GLU A CG    1 
ATOM   1590 C  CD    . GLU A 1 256 ? 100.976 36.528  2.692   1.00 30.76 ? 290  GLU A CD    1 
ATOM   1591 O  OE1   . GLU A 1 256 ? 101.693 35.772  3.400   1.00 32.10 ? 290  GLU A OE1   1 
ATOM   1592 O  OE2   . GLU A 1 256 ? 100.943 36.467  1.437   1.00 32.04 ? 290  GLU A OE2   1 
ATOM   1593 N  N     . LYS A 1 257 ? 97.288  39.516  4.162   1.00 24.12 ? 291  LYS A N     1 
ATOM   1594 C  CA    . LYS A 1 257 ? 96.892  40.467  3.125   1.00 24.12 ? 291  LYS A CA    1 
ATOM   1595 C  C     . LYS A 1 257 ? 96.330  41.766  3.685   1.00 23.75 ? 291  LYS A C     1 
ATOM   1596 O  O     . LYS A 1 257 ? 96.033  42.678  2.934   1.00 23.88 ? 291  LYS A O     1 
ATOM   1597 C  CB    . LYS A 1 257 ? 95.849  39.818  2.208   1.00 24.28 ? 291  LYS A CB    1 
ATOM   1598 C  CG    . LYS A 1 257 ? 96.344  38.562  1.498   1.00 24.78 ? 291  LYS A CG    1 
ATOM   1599 C  CD    . LYS A 1 257 ? 96.917  38.891  0.126   1.00 25.04 ? 291  LYS A CD    1 
ATOM   1600 C  CE    . LYS A 1 257 ? 97.500  37.676  -0.562  1.00 24.24 ? 291  LYS A CE    1 
ATOM   1601 N  NZ    . LYS A 1 257 ? 98.946  37.560  -0.270  1.00 25.02 ? 291  LYS A NZ    1 
ATOM   1602 N  N     . ASN A 1 258 ? 96.184  41.846  4.998   1.00 23.75 ? 292  ASN A N     1 
ATOM   1603 C  CA    . ASN A 1 258 ? 95.610  43.016  5.640   1.00 23.96 ? 292  ASN A CA    1 
ATOM   1604 C  C     . ASN A 1 258 ? 96.546  44.225  5.522   1.00 24.20 ? 292  ASN A C     1 
ATOM   1605 O  O     . ASN A 1 258 ? 97.757  44.109  5.728   1.00 24.34 ? 292  ASN A O     1 
ATOM   1606 C  CB    . ASN A 1 258 ? 95.322  42.706  7.111   1.00 23.90 ? 292  ASN A CB    1 
ATOM   1607 C  CG    . ASN A 1 258 ? 94.381  43.710  7.756   1.00 24.16 ? 292  ASN A CG    1 
ATOM   1608 O  OD1   . ASN A 1 258 ? 94.818  44.666  8.407   1.00 23.96 ? 292  ASN A OD1   1 
ATOM   1609 N  ND2   . ASN A 1 258 ? 93.077  43.485  7.596   1.00 23.97 ? 292  ASN A ND2   1 
ATOM   1610 N  N     . SER A 1 259 ? 95.978  45.382  5.203   1.00 24.36 ? 293  SER A N     1 
ATOM   1611 C  CA    . SER A 1 259 ? 96.762  46.592  4.957   1.00 24.48 ? 293  SER A CA    1 
ATOM   1612 C  C     . SER A 1 259 ? 97.262  47.303  6.214   1.00 24.74 ? 293  SER A C     1 
ATOM   1613 O  O     . SER A 1 259 ? 98.201  48.090  6.133   1.00 24.99 ? 293  SER A O     1 
ATOM   1614 C  CB    . SER A 1 259 ? 95.952  47.571  4.121   1.00 24.42 ? 293  SER A CB    1 
ATOM   1615 O  OG    . SER A 1 259 ? 94.749  47.894  4.778   1.00 24.75 ? 293  SER A OG    1 
ATOM   1616 N  N     . LYS A 1 260 ? 96.645  47.048  7.366   1.00 25.08 ? 294  LYS A N     1 
ATOM   1617 C  CA    . LYS A 1 260 ? 97.088  47.677  8.616   1.00 25.31 ? 294  LYS A CA    1 
ATOM   1618 C  C     . LYS A 1 260 ? 98.132  46.818  9.328   1.00 25.37 ? 294  LYS A C     1 
ATOM   1619 O  O     . LYS A 1 260 ? 99.244  47.274  9.565   1.00 25.97 ? 294  LYS A O     1 
ATOM   1620 C  CB    . LYS A 1 260 ? 95.895  47.988  9.529   1.00 25.48 ? 294  LYS A CB    1 
ATOM   1621 C  CG    . LYS A 1 260 ? 95.151  49.276  9.133   1.00 25.98 ? 294  LYS A CG    1 
ATOM   1622 C  CD    . LYS A 1 260 ? 93.641  49.171  9.311   1.00 26.21 ? 294  LYS A CD    1 
ATOM   1623 N  N     . SER A 1 261 ? 97.785  45.577  9.653   1.00 25.19 ? 295  SER A N     1 
ATOM   1624 C  CA    . SER A 1 261 ? 98.712  44.670  10.336  1.00 24.95 ? 295  SER A CA    1 
ATOM   1625 C  C     . SER A 1 261 ? 98.210  43.229  10.315  1.00 24.78 ? 295  SER A C     1 
ATOM   1626 O  O     . SER A 1 261 ? 97.060  42.973  9.986   1.00 24.74 ? 295  SER A O     1 
ATOM   1627 C  CB    . SER A 1 261 ? 98.901  45.102  11.789  1.00 24.84 ? 295  SER A CB    1 
ATOM   1628 O  OG    . SER A 1 261 ? 97.664  45.084  12.473  1.00 24.70 ? 295  SER A OG    1 
ATOM   1629 N  N     . ALA A 1 262 ? 99.076  42.299  10.705  1.00 24.82 ? 296  ALA A N     1 
ATOM   1630 C  CA    . ALA A 1 262 ? 98.724  40.879  10.762  1.00 24.75 ? 296  ALA A CA    1 
ATOM   1631 C  C     . ALA A 1 262 ? 97.791  40.545  11.928  1.00 24.82 ? 296  ALA A C     1 
ATOM   1632 O  O     . ALA A 1 262 ? 97.178  39.480  11.933  1.00 24.55 ? 296  ALA A O     1 
ATOM   1633 C  CB    . ALA A 1 262 ? 99.982  40.024  10.843  1.00 24.55 ? 296  ALA A CB    1 
ATOM   1634 N  N     . ASP A 1 263 ? 97.691  41.438  12.914  1.00 24.96 ? 297  ASP A N     1 
ATOM   1635 C  CA    . ASP A 1 263 ? 96.811  41.213  14.064  1.00 25.21 ? 297  ASP A CA    1 
ATOM   1636 C  C     . ASP A 1 263 ? 95.600  42.161  14.100  1.00 24.90 ? 297  ASP A C     1 
ATOM   1637 O  O     . ASP A 1 263 ? 94.990  42.354  15.147  1.00 24.89 ? 297  ASP A O     1 
ATOM   1638 C  CB    . ASP A 1 263 ? 97.614  41.289  15.372  1.00 25.59 ? 297  ASP A CB    1 
ATOM   1639 C  CG    . ASP A 1 263 ? 98.011  42.719  15.759  1.00 27.26 ? 297  ASP A CG    1 
ATOM   1640 O  OD1   . ASP A 1 263 ? 98.244  43.566  14.860  1.00 28.91 ? 297  ASP A OD1   1 
ATOM   1641 O  OD2   . ASP A 1 263 ? 98.099  42.985  16.981  1.00 28.78 ? 297  ASP A OD2   1 
ATOM   1642 N  N     . ASN A 1 264 ? 95.239  42.733  12.954  1.00 24.64 ? 298  ASN A N     1 
ATOM   1643 C  CA    . ASN A 1 264 ? 94.159  43.721  12.906  1.00 24.40 ? 298  ASN A CA    1 
ATOM   1644 C  C     . ASN A 1 264 ? 92.788  43.102  13.160  1.00 24.10 ? 298  ASN A C     1 
ATOM   1645 O  O     . ASN A 1 264 ? 91.994  43.609  13.965  1.00 24.20 ? 298  ASN A O     1 
ATOM   1646 C  CB    . ASN A 1 264 ? 94.139  44.425  11.549  1.00 24.45 ? 298  ASN A CB    1 
ATOM   1647 C  CG    . ASN A 1 264 ? 93.124  45.542  11.495  1.00 24.75 ? 298  ASN A CG    1 
ATOM   1648 O  OD1   . ASN A 1 264 ? 93.133  46.435  12.339  1.00 24.84 ? 298  ASN A OD1   1 
ATOM   1649 N  ND2   . ASN A 1 264 ? 92.236  45.496  10.506  1.00 25.71 ? 298  ASN A ND2   1 
ATOM   1650 N  N     . ILE A 1 265 ? 92.525  42.002  12.461  1.00 23.41 ? 299  ILE A N     1 
ATOM   1651 C  CA    . ILE A 1 265 ? 91.229  41.329  12.499  1.00 22.76 ? 299  ILE A CA    1 
ATOM   1652 C  C     . ILE A 1 265 ? 90.870  40.837  13.900  1.00 22.73 ? 299  ILE A C     1 
ATOM   1653 O  O     . ILE A 1 265 ? 91.682  40.182  14.549  1.00 22.54 ? 299  ILE A O     1 
ATOM   1654 C  CB    . ILE A 1 265 ? 91.217  40.142  11.529  1.00 22.40 ? 299  ILE A CB    1 
ATOM   1655 C  CG1   . ILE A 1 265 ? 91.222  40.661  10.084  1.00 21.86 ? 299  ILE A CG1   1 
ATOM   1656 C  CG2   . ILE A 1 265 ? 90.009  39.276  11.775  1.00 22.14 ? 299  ILE A CG2   1 
ATOM   1657 C  CD1   . ILE A 1 265 ? 91.702  39.682  9.088   1.00 20.81 ? 299  ILE A CD1   1 
ATOM   1658 N  N     . LYS A 1 266 ? 89.668  41.196  14.360  1.00 22.77 ? 300  LYS A N     1 
ATOM   1659 C  CA    . LYS A 1 266 ? 89.083  40.648  15.583  1.00 22.98 ? 300  LYS A CA    1 
ATOM   1660 C  C     . LYS A 1 266 ? 88.286  39.408  15.188  1.00 22.66 ? 300  LYS A C     1 
ATOM   1661 O  O     . LYS A 1 266 ? 87.734  39.343  14.083  1.00 22.48 ? 300  LYS A O     1 
ATOM   1662 C  CB    . LYS A 1 266 ? 88.186  41.682  16.296  1.00 23.40 ? 300  LYS A CB    1 
ATOM   1663 C  CG    . LYS A 1 266 ? 88.975  42.772  17.051  1.00 25.36 ? 300  LYS A CG    1 
ATOM   1664 C  CD    . LYS A 1 266 ? 88.095  43.819  17.759  1.00 27.35 ? 300  LYS A CD    1 
ATOM   1665 C  CE    . LYS A 1 266 ? 88.956  45.004  18.270  1.00 28.91 ? 300  LYS A CE    1 
ATOM   1666 N  NZ    . LYS A 1 266 ? 88.206  46.044  19.088  1.00 29.71 ? 300  LYS A NZ    1 
ATOM   1667 N  N     . THR A 1 267 ? 88.243  38.425  16.083  1.00 22.39 ? 301  THR A N     1 
ATOM   1668 C  CA    . THR A 1 267 ? 87.617  37.143  15.794  1.00 22.16 ? 301  THR A CA    1 
ATOM   1669 C  C     . THR A 1 267 ? 86.455  36.867  16.738  1.00 22.33 ? 301  THR A C     1 
ATOM   1670 O  O     . THR A 1 267 ? 86.578  37.016  17.962  1.00 22.58 ? 301  THR A O     1 
ATOM   1671 C  CB    . THR A 1 267 ? 88.633  36.001  15.883  1.00 22.09 ? 301  THR A CB    1 
ATOM   1672 O  OG1   . THR A 1 267 ? 89.611  36.164  14.848  1.00 21.53 ? 301  THR A OG1   1 
ATOM   1673 C  CG2   . THR A 1 267 ? 87.941  34.651  15.715  1.00 21.61 ? 301  THR A CG2   1 
ATOM   1674 N  N     . LEU A 1 268 ? 85.332  36.448  16.160  1.00 22.13 ? 302  LEU A N     1 
ATOM   1675 C  CA    . LEU A 1 268 ? 84.124  36.170  16.922  1.00 22.16 ? 302  LEU A CA    1 
ATOM   1676 C  C     . LEU A 1 268 ? 83.730  34.702  16.797  1.00 22.33 ? 302  LEU A C     1 
ATOM   1677 O  O     . LEU A 1 268 ? 83.450  34.229  15.708  1.00 22.46 ? 302  LEU A O     1 
ATOM   1678 C  CB    . LEU A 1 268 ? 82.990  37.060  16.419  1.00 21.92 ? 302  LEU A CB    1 
ATOM   1679 C  CG    . LEU A 1 268 ? 83.334  38.547  16.397  1.00 22.03 ? 302  LEU A CG    1 
ATOM   1680 C  CD1   . LEU A 1 268 ? 82.129  39.366  15.975  1.00 21.95 ? 302  LEU A CD1   1 
ATOM   1681 C  CD2   . LEU A 1 268 ? 83.834  38.996  17.770  1.00 22.32 ? 302  LEU A CD2   1 
ATOM   1682 N  N     . LEU A 1 269 ? 83.712  33.982  17.913  1.00 22.68 ? 303  LEU A N     1 
ATOM   1683 C  CA    . LEU A 1 269 ? 83.297  32.583  17.912  1.00 22.84 ? 303  LEU A CA    1 
ATOM   1684 C  C     . LEU A 1 269 ? 81.952  32.462  18.594  1.00 23.04 ? 303  LEU A C     1 
ATOM   1685 O  O     . LEU A 1 269 ? 81.771  32.958  19.701  1.00 23.13 ? 303  LEU A O     1 
ATOM   1686 C  CB    . LEU A 1 269 ? 84.330  31.704  18.619  1.00 22.79 ? 303  LEU A CB    1 
ATOM   1687 C  CG    . LEU A 1 269 ? 85.774  31.884  18.149  1.00 22.24 ? 303  LEU A CG    1 
ATOM   1688 C  CD1   . LEU A 1 269 ? 86.621  30.759  18.691  1.00 22.67 ? 303  LEU A CD1   1 
ATOM   1689 C  CD2   . LEU A 1 269 ? 85.863  31.935  16.642  1.00 22.01 ? 303  LEU A CD2   1 
ATOM   1690 N  N     . PHE A 1 270 ? 81.011  31.812  17.912  1.00 23.29 ? 304  PHE A N     1 
ATOM   1691 C  CA    . PHE A 1 270 ? 79.666  31.617  18.419  1.00 23.38 ? 304  PHE A CA    1 
ATOM   1692 C  C     . PHE A 1 270 ? 79.252  30.167  18.270  1.00 23.45 ? 304  PHE A C     1 
ATOM   1693 O  O     . PHE A 1 270 ? 79.451  29.568  17.211  1.00 23.27 ? 304  PHE A O     1 
ATOM   1694 C  CB    . PHE A 1 270 ? 78.676  32.488  17.646  1.00 23.49 ? 304  PHE A CB    1 
ATOM   1695 C  CG    . PHE A 1 270 ? 78.563  33.882  18.159  1.00 24.05 ? 304  PHE A CG    1 
ATOM   1696 C  CD1   . PHE A 1 270 ? 77.650  34.194  19.153  1.00 24.72 ? 304  PHE A CD1   1 
ATOM   1697 C  CD2   . PHE A 1 270 ? 79.348  34.894  17.633  1.00 25.63 ? 304  PHE A CD2   1 
ATOM   1698 C  CE1   . PHE A 1 270 ? 77.531  35.486  19.627  1.00 24.49 ? 304  PHE A CE1   1 
ATOM   1699 C  CE2   . PHE A 1 270 ? 79.237  36.192  18.106  1.00 25.70 ? 304  PHE A CE2   1 
ATOM   1700 C  CZ    . PHE A 1 270 ? 78.324  36.486  19.106  1.00 25.31 ? 304  PHE A CZ    1 
ATOM   1701 N  N     . SER A 1 271 ? 78.651  29.618  19.320  1.00 23.73 ? 305  SER A N     1 
ATOM   1702 C  CA    . SER A 1 271 ? 78.040  28.296  19.256  1.00 24.30 ? 305  SER A CA    1 
ATOM   1703 C  C     . SER A 1 271 ? 77.183  28.021  20.477  1.00 24.78 ? 305  SER A C     1 
ATOM   1704 O  O     . SER A 1 271 ? 77.319  28.687  21.492  1.00 24.66 ? 305  SER A O     1 
ATOM   1705 C  CB    . SER A 1 271 ? 79.109  27.208  19.155  1.00 24.26 ? 305  SER A CB    1 
ATOM   1706 O  OG    . SER A 1 271 ? 78.506  25.937  19.023  1.00 24.40 ? 305  SER A OG    1 
ATOM   1707 N  N     . ALA A 1 272 ? 76.308  27.025  20.369  1.00 25.55 ? 306  ALA A N     1 
ATOM   1708 C  CA    . ALA A 1 272 ? 75.559  26.520  21.519  1.00 25.96 ? 306  ALA A CA    1 
ATOM   1709 C  C     . ALA A 1 272 ? 76.378  25.522  22.329  1.00 26.57 ? 306  ALA A C     1 
ATOM   1710 O  O     . ALA A 1 272 ? 76.017  25.200  23.450  1.00 26.30 ? 306  ALA A O     1 
ATOM   1711 C  CB    . ALA A 1 272 ? 74.258  25.879  21.065  1.00 25.87 ? 306  ALA A CB    1 
ATOM   1712 N  N     . THR A 1 273 ? 77.471  25.027  21.755  1.00 27.70 ? 307  THR A N     1 
ATOM   1713 C  CA    . THR A 1 273 ? 78.336  24.076  22.445  1.00 28.80 ? 307  THR A CA    1 
ATOM   1714 C  C     . THR A 1 273 ? 79.801  24.478  22.329  1.00 30.03 ? 307  THR A C     1 
ATOM   1715 O  O     . THR A 1 273 ? 80.435  24.242  21.305  1.00 30.06 ? 307  THR A O     1 
ATOM   1716 C  CB    . THR A 1 273 ? 78.161  22.655  21.888  1.00 28.60 ? 307  THR A CB    1 
ATOM   1717 O  OG1   . THR A 1 273 ? 78.152  22.698  20.462  1.00 27.63 ? 307  THR A OG1   1 
ATOM   1718 C  CG2   . THR A 1 273 ? 76.858  22.060  22.366  1.00 28.76 ? 307  THR A CG2   1 
ATOM   1719 N  N     . LEU A 1 274 ? 80.323  25.107  23.379  1.00 31.59 ? 308  LEU A N     1 
ATOM   1720 C  CA    . LEU A 1 274 ? 81.755  25.363  23.486  1.00 32.86 ? 308  LEU A CA    1 
ATOM   1721 C  C     . LEU A 1 274 ? 82.172  25.614  24.933  1.00 34.06 ? 308  LEU A C     1 
ATOM   1722 O  O     . LEU A 1 274 ? 81.367  26.021  25.768  1.00 34.28 ? 308  LEU A O     1 
ATOM   1723 C  CB    . LEU A 1 274 ? 82.210  26.512  22.564  1.00 32.74 ? 308  LEU A CB    1 
ATOM   1724 C  CG    . LEU A 1 274 ? 81.505  27.870  22.584  1.00 33.13 ? 308  LEU A CG    1 
ATOM   1725 C  CD1   . LEU A 1 274 ? 81.778  28.622  23.879  1.00 34.09 ? 308  LEU A CD1   1 
ATOM   1726 C  CD2   . LEU A 1 274 ? 81.948  28.719  21.403  1.00 32.50 ? 308  LEU A CD2   1 
ATOM   1727 N  N     . ASP A 1 275 ? 83.445  25.340  25.209  1.00 35.54 ? 309  ASP A N     1 
ATOM   1728 C  CA    . ASP A 1 275 ? 84.047  25.538  26.529  1.00 36.45 ? 309  ASP A CA    1 
ATOM   1729 C  C     . ASP A 1 275 ? 85.428  26.195  26.360  1.00 37.10 ? 309  ASP A C     1 
ATOM   1730 O  O     . ASP A 1 275 ? 85.752  26.687  25.272  1.00 36.91 ? 309  ASP A O     1 
ATOM   1731 C  CB    . ASP A 1 275 ? 84.139  24.195  27.277  1.00 36.59 ? 309  ASP A CB    1 
ATOM   1732 C  CG    . ASP A 1 275 ? 84.888  23.114  26.491  1.00 37.33 ? 309  ASP A CG    1 
ATOM   1733 O  OD1   . ASP A 1 275 ? 85.154  23.286  25.273  1.00 37.61 ? 309  ASP A OD1   1 
ATOM   1734 O  OD2   . ASP A 1 275 ? 85.198  22.071  27.106  1.00 37.86 ? 309  ASP A OD2   1 
ATOM   1735 N  N     . ASP A 1 276 ? 86.227  26.215  27.429  1.00 37.83 ? 310  ASP A N     1 
ATOM   1736 C  CA    . ASP A 1 276 ? 87.609  26.718  27.364  1.00 38.37 ? 310  ASP A CA    1 
ATOM   1737 C  C     . ASP A 1 276 ? 88.478  25.889  26.402  1.00 38.47 ? 310  ASP A C     1 
ATOM   1738 O  O     . ASP A 1 276 ? 89.414  26.414  25.785  1.00 38.60 ? 310  ASP A O     1 
ATOM   1739 C  CB    . ASP A 1 276 ? 88.244  26.734  28.764  1.00 38.65 ? 310  ASP A CB    1 
ATOM   1740 C  CG    . ASP A 1 276 ? 87.506  27.652  29.738  1.00 39.40 ? 310  ASP A CG    1 
ATOM   1741 O  OD1   . ASP A 1 276 ? 86.542  28.326  29.308  1.00 40.94 ? 310  ASP A OD1   1 
ATOM   1742 O  OD2   . ASP A 1 276 ? 87.890  27.698  30.929  1.00 39.62 ? 310  ASP A OD2   1 
ATOM   1743 N  N     . LYS A 1 277 ? 88.157  24.601  26.273  1.00 38.47 ? 311  LYS A N     1 
ATOM   1744 C  CA    . LYS A 1 277 ? 88.863  23.706  25.356  1.00 38.38 ? 311  LYS A CA    1 
ATOM   1745 C  C     . LYS A 1 277 ? 88.949  24.257  23.927  1.00 38.33 ? 311  LYS A C     1 
ATOM   1746 O  O     . LYS A 1 277 ? 89.949  24.035  23.244  1.00 38.40 ? 311  LYS A O     1 
ATOM   1747 C  CB    . LYS A 1 277 ? 88.196  22.329  25.340  1.00 38.39 ? 311  LYS A CB    1 
ATOM   1748 N  N     . VAL A 1 278 ? 87.913  24.978  23.488  1.00 38.16 ? 312  VAL A N     1 
ATOM   1749 C  CA    . VAL A 1 278 ? 87.871  25.545  22.129  1.00 37.89 ? 312  VAL A CA    1 
ATOM   1750 C  C     . VAL A 1 278 ? 88.761  26.783  21.963  1.00 37.57 ? 312  VAL A C     1 
ATOM   1751 O  O     . VAL A 1 278 ? 89.142  27.129  20.843  1.00 37.42 ? 312  VAL A O     1 
ATOM   1752 C  CB    . VAL A 1 278 ? 86.434  25.931  21.693  1.00 38.02 ? 312  VAL A CB    1 
ATOM   1753 C  CG1   . VAL A 1 278 ? 85.437  24.790  21.976  1.00 38.24 ? 312  VAL A CG1   1 
ATOM   1754 C  CG2   . VAL A 1 278 ? 86.001  27.231  22.359  1.00 38.38 ? 312  VAL A CG2   1 
ATOM   1755 N  N     . GLN A 1 279 ? 89.066  27.457  23.072  1.00 37.28 ? 313  GLN A N     1 
ATOM   1756 C  CA    . GLN A 1 279 ? 90.005  28.582  23.066  1.00 36.86 ? 313  GLN A CA    1 
ATOM   1757 C  C     . GLN A 1 279 ? 91.431  28.111  22.772  1.00 36.45 ? 313  GLN A C     1 
ATOM   1758 O  O     . GLN A 1 279 ? 92.253  28.883  22.289  1.00 36.55 ? 313  GLN A O     1 
ATOM   1759 C  CB    . GLN A 1 279 ? 89.964  29.327  24.404  1.00 36.86 ? 313  GLN A CB    1 
ATOM   1760 N  N     . LYS A 1 280 ? 91.719  26.847  23.072  1.00 35.90 ? 314  LYS A N     1 
ATOM   1761 C  CA    . LYS A 1 280 ? 92.995  26.239  22.711  1.00 35.53 ? 314  LYS A CA    1 
ATOM   1762 C  C     . LYS A 1 280 ? 93.035  25.926  21.215  1.00 34.97 ? 314  LYS A C     1 
ATOM   1763 O  O     . LYS A 1 280 ? 94.037  26.175  20.555  1.00 34.77 ? 314  LYS A O     1 
ATOM   1764 C  CB    . LYS A 1 280 ? 93.235  24.962  23.533  1.00 35.65 ? 314  LYS A CB    1 
ATOM   1765 C  CG    . LYS A 1 280 ? 94.594  24.293  23.297  1.00 36.06 ? 314  LYS A CG    1 
ATOM   1766 C  CD    . LYS A 1 280 ? 94.872  23.186  24.321  1.00 36.66 ? 314  LYS A CD    1 
ATOM   1767 N  N     . LEU A 1 281 ? 91.942  25.380  20.686  1.00 34.50 ? 315  LEU A N     1 
ATOM   1768 C  CA    . LEU A 1 281 ? 91.869  25.016  19.267  1.00 34.18 ? 315  LEU A CA    1 
ATOM   1769 C  C     . LEU A 1 281 ? 91.846  26.222  18.331  1.00 33.89 ? 315  LEU A C     1 
ATOM   1770 O  O     . LEU A 1 281 ? 92.306  26.134  17.191  1.00 33.84 ? 315  LEU A O     1 
ATOM   1771 C  CB    . LEU A 1 281 ? 90.642  24.141  18.999  1.00 34.21 ? 315  LEU A CB    1 
ATOM   1772 C  CG    . LEU A 1 281 ? 90.710  22.721  19.558  1.00 34.12 ? 315  LEU A CG    1 
ATOM   1773 C  CD1   . LEU A 1 281 ? 89.329  22.076  19.543  1.00 34.07 ? 315  LEU A CD1   1 
ATOM   1774 C  CD2   . LEU A 1 281 ? 91.721  21.890  18.772  1.00 33.93 ? 315  LEU A CD2   1 
ATOM   1775 N  N     . ALA A 1 282 ? 91.309  27.343  18.804  1.00 33.77 ? 316  ALA A N     1 
ATOM   1776 C  CA    . ALA A 1 282 ? 91.267  28.567  18.003  1.00 33.74 ? 316  ALA A CA    1 
ATOM   1777 C  C     . ALA A 1 282 ? 92.586  29.345  18.071  1.00 33.74 ? 316  ALA A C     1 
ATOM   1778 O  O     . ALA A 1 282 ? 92.765  30.322  17.351  1.00 33.71 ? 316  ALA A O     1 
ATOM   1779 C  CB    . ALA A 1 282 ? 90.108  29.445  18.448  1.00 33.62 ? 316  ALA A CB    1 
ATOM   1780 N  N     . ASN A 1 283 ? 93.503  28.896  18.925  1.00 33.73 ? 317  ASN A N     1 
ATOM   1781 C  CA    . ASN A 1 283 ? 94.770  29.587  19.181  1.00 33.86 ? 317  ASN A CA    1 
ATOM   1782 C  C     . ASN A 1 283 ? 95.469  30.168  17.949  1.00 33.71 ? 317  ASN A C     1 
ATOM   1783 O  O     . ASN A 1 283 ? 95.886  31.326  17.963  1.00 33.74 ? 317  ASN A O     1 
ATOM   1784 C  CB    . ASN A 1 283 ? 95.731  28.646  19.919  1.00 33.97 ? 317  ASN A CB    1 
ATOM   1785 C  CG    . ASN A 1 283 ? 96.969  29.352  20.429  1.00 34.30 ? 317  ASN A CG    1 
ATOM   1786 O  OD1   . ASN A 1 283 ? 96.957  30.558  20.666  1.00 34.89 ? 317  ASN A OD1   1 
ATOM   1787 N  ND2   . ASN A 1 283 ? 98.046  28.595  20.615  1.00 34.21 ? 317  ASN A ND2   1 
ATOM   1788 N  N     . ASN A 1 284 ? 95.585  29.373  16.887  1.00 33.59 ? 318  ASN A N     1 
ATOM   1789 C  CA    . ASN A 1 284 ? 96.287  29.810  15.675  1.00 33.36 ? 318  ASN A CA    1 
ATOM   1790 C  C     . ASN A 1 284 ? 95.512  30.802  14.803  1.00 33.18 ? 318  ASN A C     1 
ATOM   1791 O  O     . ASN A 1 284 ? 96.053  31.288  13.818  1.00 33.33 ? 318  ASN A O     1 
ATOM   1792 C  CB    . ASN A 1 284 ? 96.693  28.602  14.822  1.00 33.37 ? 318  ASN A CB    1 
ATOM   1793 C  CG    . ASN A 1 284 ? 97.706  27.714  15.510  1.00 33.25 ? 318  ASN A CG    1 
ATOM   1794 O  OD1   . ASN A 1 284 ? 98.544  28.187  16.275  1.00 32.89 ? 318  ASN A OD1   1 
ATOM   1795 N  ND2   . ASN A 1 284 ? 97.640  26.415  15.231  1.00 32.95 ? 318  ASN A ND2   1 
ATOM   1796 N  N     . ILE A 1 285 ? 94.257  31.092  15.147  1.00 32.99 ? 319  ILE A N     1 
ATOM   1797 C  CA    . ILE A 1 285 ? 93.453  32.056  14.392  1.00 32.83 ? 319  ILE A CA    1 
ATOM   1798 C  C     . ILE A 1 285 ? 92.988  33.278  15.215  1.00 32.81 ? 319  ILE A C     1 
ATOM   1799 O  O     . ILE A 1 285 ? 92.259  34.125  14.702  1.00 33.05 ? 319  ILE A O     1 
ATOM   1800 C  CB    . ILE A 1 285 ? 92.236  31.365  13.728  1.00 32.77 ? 319  ILE A CB    1 
ATOM   1801 C  CG1   . ILE A 1 285 ? 91.199  30.931  14.769  1.00 32.72 ? 319  ILE A CG1   1 
ATOM   1802 C  CG2   . ILE A 1 285 ? 92.697  30.165  12.912  1.00 32.47 ? 319  ILE A CG2   1 
ATOM   1803 C  CD1   . ILE A 1 285 ? 89.803  30.742  14.194  1.00 32.85 ? 319  ILE A CD1   1 
ATOM   1804 N  N     . MET A 1 286 ? 93.419  33.372  16.471  1.00 32.76 ? 320  MET A N     1 
ATOM   1805 C  CA    . MET A 1 286 ? 93.048  34.485  17.348  1.00 32.77 ? 320  MET A CA    1 
ATOM   1806 C  C     . MET A 1 286 ? 94.248  35.415  17.520  1.00 32.51 ? 320  MET A C     1 
ATOM   1807 O  O     . MET A 1 286 ? 95.269  35.019  18.079  1.00 32.42 ? 320  MET A O     1 
ATOM   1808 C  CB    . MET A 1 286 ? 92.606  33.958  18.719  1.00 33.03 ? 320  MET A CB    1 
ATOM   1809 C  CG    . MET A 1 286 ? 91.516  32.894  18.669  1.00 33.54 ? 320  MET A CG    1 
ATOM   1810 S  SD    . MET A 1 286 ? 89.852  33.564  18.645  1.00 35.09 ? 320  MET A SD    1 
ATOM   1811 C  CE    . MET A 1 286 ? 89.393  33.357  20.362  1.00 34.19 ? 320  MET A CE    1 
ATOM   1812 N  N     . ASN A 1 287 ? 94.110  36.653  17.051  1.00 32.38 ? 321  ASN A N     1 
ATOM   1813 C  CA    . ASN A 1 287 ? 95.218  37.614  17.007  1.00 32.27 ? 321  ASN A CA    1 
ATOM   1814 C  C     . ASN A 1 287 ? 95.445  38.393  18.295  1.00 32.42 ? 321  ASN A C     1 
ATOM   1815 O  O     . ASN A 1 287 ? 96.584  38.644  18.679  1.00 32.49 ? 321  ASN A O     1 
ATOM   1816 C  CB    . ASN A 1 287 ? 94.982  38.617  15.881  1.00 32.21 ? 321  ASN A CB    1 
ATOM   1817 C  CG    . ASN A 1 287 ? 94.878  37.957  14.529  1.00 31.89 ? 321  ASN A CG    1 
ATOM   1818 O  OD1   . ASN A 1 287 ? 95.471  36.906  14.301  1.00 32.47 ? 321  ASN A OD1   1 
ATOM   1819 N  ND2   . ASN A 1 287 ? 94.129  38.570  13.620  1.00 30.64 ? 321  ASN A ND2   1 
ATOM   1820 N  N     . LYS A 1 288 ? 94.360  38.767  18.962  1.00 32.72 ? 322  LYS A N     1 
ATOM   1821 C  CA    . LYS A 1 288 ? 94.418  39.725  20.065  1.00 32.92 ? 322  LYS A CA    1 
ATOM   1822 C  C     . LYS A 1 288 ? 94.951  39.116  21.365  1.00 33.39 ? 322  LYS A C     1 
ATOM   1823 O  O     . LYS A 1 288 ? 94.999  37.894  21.524  1.00 33.45 ? 322  LYS A O     1 
ATOM   1824 C  CB    . LYS A 1 288 ? 93.034  40.340  20.306  1.00 32.79 ? 322  LYS A CB    1 
ATOM   1825 C  CG    . LYS A 1 288 ? 92.358  40.934  19.074  1.00 32.35 ? 322  LYS A CG    1 
ATOM   1826 C  CD    . LYS A 1 288 ? 93.236  41.947  18.341  1.00 31.93 ? 322  LYS A CD    1 
ATOM   1827 C  CE    . LYS A 1 288 ? 92.443  42.692  17.271  1.00 31.28 ? 322  LYS A CE    1 
ATOM   1828 N  NZ    . LYS A 1 288 ? 93.209  43.806  16.668  1.00 30.54 ? 322  LYS A NZ    1 
ATOM   1829 N  N     . LYS A 1 289 ? 95.348  39.983  22.292  1.00 33.86 ? 323  LYS A N     1 
ATOM   1830 C  CA    . LYS A 1 289 ? 95.959  39.550  23.546  1.00 34.39 ? 323  LYS A CA    1 
ATOM   1831 C  C     . LYS A 1 289 ? 94.903  39.177  24.593  1.00 34.59 ? 323  LYS A C     1 
ATOM   1832 O  O     . LYS A 1 289 ? 95.171  38.380  25.493  1.00 34.58 ? 323  LYS A O     1 
ATOM   1833 C  CB    . LYS A 1 289 ? 96.892  40.643  24.089  1.00 34.56 ? 323  LYS A CB    1 
ATOM   1834 C  CG    . LYS A 1 289 ? 97.979  41.102  23.108  1.00 34.99 ? 323  LYS A CG    1 
ATOM   1835 C  CD    . LYS A 1 289 ? 98.862  39.950  22.633  1.00 35.10 ? 323  LYS A CD    1 
ATOM   1836 N  N     . GLU A 1 290 ? 93.715  39.768  24.477  1.00 34.90 ? 324  GLU A N     1 
ATOM   1837 C  CA    . GLU A 1 290 ? 92.572  39.428  25.328  1.00 35.26 ? 324  GLU A CA    1 
ATOM   1838 C  C     . GLU A 1 290 ? 91.528  38.630  24.538  1.00 35.19 ? 324  GLU A C     1 
ATOM   1839 O  O     . GLU A 1 290 ? 91.375  38.805  23.323  1.00 35.05 ? 324  GLU A O     1 
ATOM   1840 C  CB    . GLU A 1 290 ? 91.903  40.697  25.879  1.00 35.53 ? 324  GLU A CB    1 
ATOM   1841 C  CG    . GLU A 1 290 ? 92.628  41.395  27.035  1.00 36.49 ? 324  GLU A CG    1 
ATOM   1842 C  CD    . GLU A 1 290 ? 91.789  42.522  27.651  1.00 38.07 ? 324  GLU A CD    1 
ATOM   1843 O  OE1   . GLU A 1 290 ? 91.063  43.216  26.894  1.00 39.08 ? 324  GLU A OE1   1 
ATOM   1844 O  OE2   . GLU A 1 290 ? 91.846  42.705  28.891  1.00 38.49 ? 324  GLU A OE2   1 
ATOM   1845 N  N     . CYS A 1 291 ? 90.806  37.761  25.240  1.00 35.20 ? 325  CYS A N     1 
ATOM   1846 C  CA    . CYS A 1 291 ? 89.634  37.102  24.678  1.00 35.11 ? 325  CYS A CA    1 
ATOM   1847 C  C     . CYS A 1 291 ? 88.519  37.071  25.717  1.00 34.60 ? 325  CYS A C     1 
ATOM   1848 O  O     . CYS A 1 291 ? 88.634  36.394  26.738  1.00 34.71 ? 325  CYS A O     1 
ATOM   1849 C  CB    . CYS A 1 291 ? 89.977  35.687  24.221  1.00 35.22 ? 325  CYS A CB    1 
ATOM   1850 S  SG    . CYS A 1 291 ? 88.717  34.958  23.130  1.00 37.37 ? 325  CYS A SG    1 
ATOM   1851 N  N     . LEU A 1 292 ? 87.459  37.837  25.471  1.00 34.09 ? 326  LEU A N     1 
ATOM   1852 C  CA    . LEU A 1 292 ? 86.268  37.802  26.319  1.00 33.78 ? 326  LEU A CA    1 
ATOM   1853 C  C     . LEU A 1 292 ? 85.496  36.514  26.070  1.00 33.45 ? 326  LEU A C     1 
ATOM   1854 O  O     . LEU A 1 292 ? 85.242  36.167  24.923  1.00 33.42 ? 326  LEU A O     1 
ATOM   1855 C  CB    . LEU A 1 292 ? 85.344  38.981  26.018  1.00 33.72 ? 326  LEU A CB    1 
ATOM   1856 C  CG    . LEU A 1 292 ? 85.549  40.288  26.771  1.00 33.86 ? 326  LEU A CG    1 
ATOM   1857 C  CD1   . LEU A 1 292 ? 86.953  40.829  26.597  1.00 34.35 ? 326  LEU A CD1   1 
ATOM   1858 C  CD2   . LEU A 1 292 ? 84.518  41.289  26.282  1.00 34.28 ? 326  LEU A CD2   1 
ATOM   1859 N  N     . PHE A 1 293 ? 85.125  35.816  27.140  1.00 33.19 ? 327  PHE A N     1 
ATOM   1860 C  CA    . PHE A 1 293 ? 84.224  34.673  27.037  1.00 32.97 ? 327  PHE A CA    1 
ATOM   1861 C  C     . PHE A 1 293 ? 82.862  35.088  27.576  1.00 32.79 ? 327  PHE A C     1 
ATOM   1862 O  O     . PHE A 1 293 ? 82.657  35.115  28.785  1.00 32.53 ? 327  PHE A O     1 
ATOM   1863 C  CB    . PHE A 1 293 ? 84.768  33.483  27.828  1.00 32.81 ? 327  PHE A CB    1 
ATOM   1864 C  CG    . PHE A 1 293 ? 84.113  32.165  27.488  1.00 32.89 ? 327  PHE A CG    1 
ATOM   1865 C  CD1   . PHE A 1 293 ? 84.887  31.039  27.261  1.00 33.54 ? 327  PHE A CD1   1 
ATOM   1866 C  CD2   . PHE A 1 293 ? 82.729  32.044  27.394  1.00 33.76 ? 327  PHE A CD2   1 
ATOM   1867 C  CE1   . PHE A 1 293 ? 84.299  29.818  26.954  1.00 33.74 ? 327  PHE A CE1   1 
ATOM   1868 C  CE2   . PHE A 1 293 ? 82.134  30.826  27.079  1.00 33.62 ? 327  PHE A CE2   1 
ATOM   1869 C  CZ    . PHE A 1 293 ? 82.919  29.715  26.862  1.00 33.85 ? 327  PHE A CZ    1 
ATOM   1870 N  N     . LEU A 1 294 ? 81.927  35.397  26.681  1.00 32.54 ? 328  LEU A N     1 
ATOM   1871 C  CA    . LEU A 1 294 ? 80.604  35.859  27.101  1.00 32.57 ? 328  LEU A CA    1 
ATOM   1872 C  C     . LEU A 1 294 ? 79.617  34.695  27.166  1.00 32.63 ? 328  LEU A C     1 
ATOM   1873 O  O     . LEU A 1 294 ? 79.180  34.199  26.140  1.00 32.53 ? 328  LEU A O     1 
ATOM   1874 C  CB    . LEU A 1 294 ? 80.104  36.949  26.152  1.00 32.47 ? 328  LEU A CB    1 
ATOM   1875 C  CG    . LEU A 1 294 ? 81.023  38.170  26.017  1.00 32.37 ? 328  LEU A CG    1 
ATOM   1876 C  CD1   . LEU A 1 294 ? 80.422  39.188  25.064  1.00 32.99 ? 328  LEU A CD1   1 
ATOM   1877 C  CD2   . LEU A 1 294 ? 81.290  38.810  27.364  1.00 32.65 ? 328  LEU A CD2   1 
ATOM   1878 N  N     . ASP A 1 295 ? 79.261  34.265  28.375  1.00 32.88 ? 329  ASP A N     1 
ATOM   1879 C  CA    . ASP A 1 295 ? 78.447  33.051  28.552  1.00 33.09 ? 329  ASP A CA    1 
ATOM   1880 C  C     . ASP A 1 295 ? 77.039  33.352  29.076  1.00 33.02 ? 329  ASP A C     1 
ATOM   1881 O  O     . ASP A 1 295 ? 76.885  34.038  30.084  1.00 33.42 ? 329  ASP A O     1 
ATOM   1882 C  CB    . ASP A 1 295 ? 79.166  32.079  29.497  1.00 33.16 ? 329  ASP A CB    1 
ATOM   1883 C  CG    . ASP A 1 295 ? 78.917  30.618  29.144  1.00 33.74 ? 329  ASP A CG    1 
ATOM   1884 O  OD1   . ASP A 1 295 ? 77.823  30.302  28.627  1.00 34.56 ? 329  ASP A OD1   1 
ATOM   1885 O  OD2   . ASP A 1 295 ? 79.818  29.784  29.386  1.00 33.96 ? 329  ASP A OD2   1 
ATOM   1886 N  N     . THR A 1 296 ? 76.019  32.844  28.386  1.00 33.13 ? 330  THR A N     1 
ATOM   1887 C  CA    . THR A 1 296 ? 74.623  32.981  28.826  1.00 33.23 ? 330  THR A CA    1 
ATOM   1888 C  C     . THR A 1 296 ? 74.086  31.684  29.428  1.00 33.31 ? 330  THR A C     1 
ATOM   1889 O  O     . THR A 1 296 ? 72.956  31.641  29.906  1.00 33.29 ? 330  THR A O     1 
ATOM   1890 C  CB    . THR A 1 296 ? 73.697  33.409  27.675  1.00 33.25 ? 330  THR A CB    1 
ATOM   1891 O  OG1   . THR A 1 296 ? 73.687  32.399  26.661  1.00 33.44 ? 330  THR A OG1   1 
ATOM   1892 C  CG2   . THR A 1 296 ? 74.156  34.739  27.073  1.00 33.28 ? 330  THR A CG2   1 
ATOM   1893 N  N     . VAL A 1 297 ? 74.908  30.637  29.398  1.00 33.56 ? 331  VAL A N     1 
ATOM   1894 C  CA    . VAL A 1 297 ? 74.604  29.355  30.022  1.00 33.78 ? 331  VAL A CA    1 
ATOM   1895 C  C     . VAL A 1 297 ? 75.540  29.197  31.225  1.00 33.93 ? 331  VAL A C     1 
ATOM   1896 O  O     . VAL A 1 297 ? 76.680  29.651  31.172  1.00 33.85 ? 331  VAL A O     1 
ATOM   1897 C  CB    . VAL A 1 297 ? 74.835  28.209  29.012  1.00 33.63 ? 331  VAL A CB    1 
ATOM   1898 C  CG1   . VAL A 1 297 ? 74.349  26.879  29.565  1.00 33.72 ? 331  VAL A CG1   1 
ATOM   1899 C  CG2   . VAL A 1 297 ? 74.153  28.525  27.700  1.00 33.54 ? 331  VAL A CG2   1 
ATOM   1900 N  N     . ASP A 1 298 ? 75.072  28.569  32.305  1.00 34.35 ? 332  ASP A N     1 
ATOM   1901 C  CA    . ASP A 1 298 ? 75.918  28.362  33.497  1.00 34.69 ? 332  ASP A CA    1 
ATOM   1902 C  C     . ASP A 1 298 ? 77.053  27.378  33.216  1.00 34.81 ? 332  ASP A C     1 
ATOM   1903 O  O     . ASP A 1 298 ? 76.962  26.554  32.308  1.00 34.87 ? 332  ASP A O     1 
ATOM   1904 C  CB    . ASP A 1 298 ? 75.104  27.851  34.693  1.00 34.92 ? 332  ASP A CB    1 
ATOM   1905 C  CG    . ASP A 1 298 ? 74.164  28.901  35.272  1.00 35.64 ? 332  ASP A CG    1 
ATOM   1906 O  OD1   . ASP A 1 298 ? 74.571  30.076  35.382  1.00 36.46 ? 332  ASP A OD1   1 
ATOM   1907 O  OD2   . ASP A 1 298 ? 73.023  28.538  35.646  1.00 36.46 ? 332  ASP A OD2   1 
ATOM   1908 N  N     . LYS A 1 299 ? 78.117  27.464  34.008  1.00 35.14 ? 333  LYS A N     1 
ATOM   1909 C  CA    . LYS A 1 299 ? 79.287  26.595  33.841  1.00 35.33 ? 333  LYS A CA    1 
ATOM   1910 C  C     . LYS A 1 299 ? 78.906  25.112  33.758  1.00 35.43 ? 333  LYS A C     1 
ATOM   1911 O  O     . LYS A 1 299 ? 79.357  24.408  32.850  1.00 35.41 ? 333  LYS A O     1 
ATOM   1912 C  CB    . LYS A 1 299 ? 80.281  26.810  34.985  1.00 35.32 ? 333  LYS A CB    1 
ATOM   1913 N  N     . ASN A 1 300 ? 78.067  24.659  34.694  1.00 35.43 ? 334  ASN A N     1 
ATOM   1914 C  CA    . ASN A 1 300 ? 77.631  23.253  34.757  1.00 35.52 ? 334  ASN A CA    1 
ATOM   1915 C  C     . ASN A 1 300 ? 76.280  22.946  34.093  1.00 35.36 ? 334  ASN A C     1 
ATOM   1916 O  O     . ASN A 1 300 ? 76.021  21.791  33.725  1.00 35.45 ? 334  ASN A O     1 
ATOM   1917 C  CB    . ASN A 1 300 ? 77.590  22.777  36.217  1.00 35.59 ? 334  ASN A CB    1 
ATOM   1918 C  CG    . ASN A 1 300 ? 78.978  22.556  36.803  1.00 36.08 ? 334  ASN A CG    1 
ATOM   1919 O  OD1   . ASN A 1 300 ? 79.201  22.785  37.992  1.00 36.41 ? 334  ASN A OD1   1 
ATOM   1920 N  ND2   . ASN A 1 300 ? 79.917  22.103  35.970  1.00 36.68 ? 334  ASN A ND2   1 
ATOM   1921 N  N     . GLU A 1 301 ? 75.423  23.961  33.960  1.00 34.95 ? 335  GLU A N     1 
ATOM   1922 C  CA    . GLU A 1 301 ? 74.097  23.800  33.349  1.00 34.60 ? 335  GLU A CA    1 
ATOM   1923 C  C     . GLU A 1 301 ? 74.221  23.099  31.996  1.00 34.16 ? 335  GLU A C     1 
ATOM   1924 O  O     . GLU A 1 301 ? 75.102  23.430  31.201  1.00 33.98 ? 335  GLU A O     1 
ATOM   1925 C  CB    . GLU A 1 301 ? 73.421  25.170  33.194  1.00 34.67 ? 335  GLU A CB    1 
ATOM   1926 C  CG    . GLU A 1 301 ? 72.110  25.202  32.400  1.00 35.47 ? 335  GLU A CG    1 
ATOM   1927 C  CD    . GLU A 1 301 ? 71.566  26.624  32.207  1.00 35.67 ? 335  GLU A CD    1 
ATOM   1928 O  OE1   . GLU A 1 301 ? 71.961  27.530  32.980  1.00 35.97 ? 335  GLU A OE1   1 
ATOM   1929 O  OE2   . GLU A 1 301 ? 70.736  26.830  31.289  1.00 34.20 ? 335  GLU A OE2   1 
ATOM   1930 N  N     . PRO A 1 302 ? 73.356  22.110  31.737  1.00 33.55 ? 336  PRO A N     1 
ATOM   1931 C  CA    . PRO A 1 302 ? 73.467  21.392  30.476  1.00 33.17 ? 336  PRO A CA    1 
ATOM   1932 C  C     . PRO A 1 302 ? 73.153  22.299  29.287  1.00 32.79 ? 336  PRO A C     1 
ATOM   1933 O  O     . PRO A 1 302 ? 72.309  23.187  29.397  1.00 32.83 ? 336  PRO A O     1 
ATOM   1934 C  CB    . PRO A 1 302 ? 72.440  20.263  30.616  1.00 33.14 ? 336  PRO A CB    1 
ATOM   1935 C  CG    . PRO A 1 302 ? 71.493  20.715  31.655  1.00 33.31 ? 336  PRO A CG    1 
ATOM   1936 C  CD    . PRO A 1 302 ? 72.270  21.587  32.585  1.00 33.61 ? 336  PRO A CD    1 
ATOM   1937 N  N     . GLU A 1 303 ? 73.843  22.075  28.171  1.00 32.24 ? 337  GLU A N     1 
ATOM   1938 C  CA    . GLU A 1 303 ? 73.754  22.963  27.006  1.00 31.86 ? 337  GLU A CA    1 
ATOM   1939 C  C     . GLU A 1 303 ? 72.417  22.845  26.269  1.00 31.53 ? 337  GLU A C     1 
ATOM   1940 O  O     . GLU A 1 303 ? 71.930  23.820  25.707  1.00 31.28 ? 337  GLU A O     1 
ATOM   1941 C  CB    . GLU A 1 303 ? 74.946  22.738  26.055  1.00 31.80 ? 337  GLU A CB    1 
ATOM   1942 C  CG    . GLU A 1 303 ? 76.221  23.480  26.497  1.00 31.76 ? 337  GLU A CG    1 
ATOM   1943 C  CD    . GLU A 1 303 ? 77.536  22.828  26.044  1.00 31.95 ? 337  GLU A CD    1 
ATOM   1944 O  OE1   . GLU A 1 303 ? 77.559  21.611  25.752  1.00 32.53 ? 337  GLU A OE1   1 
ATOM   1945 O  OE2   . GLU A 1 303 ? 78.565  23.542  26.002  1.00 31.96 ? 337  GLU A OE2   1 
ATOM   1946 N  N     . ALA A 1 304 ? 71.815  21.661  26.299  1.00 31.46 ? 338  ALA A N     1 
ATOM   1947 C  CA    . ALA A 1 304 ? 70.487  21.455  25.732  1.00 31.41 ? 338  ALA A CA    1 
ATOM   1948 C  C     . ALA A 1 304 ? 69.473  22.476  26.261  1.00 31.70 ? 338  ALA A C     1 
ATOM   1949 O  O     . ALA A 1 304 ? 69.528  22.890  27.429  1.00 31.72 ? 338  ALA A O     1 
ATOM   1950 C  CB    . ALA A 1 304 ? 70.011  20.055  26.024  1.00 31.37 ? 338  ALA A CB    1 
ATOM   1951 N  N     . HIS A 1 305 ? 68.549  22.875  25.391  1.00 31.91 ? 339  HIS A N     1 
ATOM   1952 C  CA    . HIS A 1 305 ? 67.537  23.857  25.740  1.00 31.97 ? 339  HIS A CA    1 
ATOM   1953 C  C     . HIS A 1 305 ? 66.498  23.208  26.644  1.00 32.18 ? 339  HIS A C     1 
ATOM   1954 O  O     . HIS A 1 305 ? 65.912  22.187  26.293  1.00 32.57 ? 339  HIS A O     1 
ATOM   1955 C  CB    . HIS A 1 305 ? 66.878  24.425  24.484  1.00 31.85 ? 339  HIS A CB    1 
ATOM   1956 C  CG    . HIS A 1 305 ? 66.184  25.729  24.715  1.00 31.84 ? 339  HIS A CG    1 
ATOM   1957 N  ND1   . HIS A 1 305 ? 64.834  25.817  24.971  1.00 31.44 ? 339  HIS A ND1   1 
ATOM   1958 C  CD2   . HIS A 1 305 ? 66.658  26.997  24.752  1.00 31.71 ? 339  HIS A CD2   1 
ATOM   1959 C  CE1   . HIS A 1 305 ? 64.506  27.084  25.148  1.00 31.81 ? 339  HIS A CE1   1 
ATOM   1960 N  NE2   . HIS A 1 305 ? 65.594  27.822  25.019  1.00 31.10 ? 339  HIS A NE2   1 
ATOM   1961 N  N     . GLU A 1 306 ? 66.282  23.817  27.803  1.00 32.40 ? 340  GLU A N     1 
ATOM   1962 C  CA    . GLU A 1 306 ? 65.468  23.236  28.877  1.00 32.46 ? 340  GLU A CA    1 
ATOM   1963 C  C     . GLU A 1 306 ? 63.989  23.063  28.518  1.00 32.58 ? 340  GLU A C     1 
ATOM   1964 O  O     . GLU A 1 306 ? 63.320  22.160  29.037  1.00 32.27 ? 340  GLU A O     1 
ATOM   1965 C  CB    . GLU A 1 306 ? 65.593  24.083  30.160  1.00 32.47 ? 340  GLU A CB    1 
ATOM   1966 C  CG    . GLU A 1 306 ? 65.142  25.560  30.035  1.00 32.67 ? 340  GLU A CG    1 
ATOM   1967 C  CD    . GLU A 1 306 ? 66.266  26.528  29.642  1.00 33.12 ? 340  GLU A CD    1 
ATOM   1968 O  OE1   . GLU A 1 306 ? 67.300  26.084  29.096  1.00 32.98 ? 340  GLU A OE1   1 
ATOM   1969 O  OE2   . GLU A 1 306 ? 66.102  27.746  29.873  1.00 33.35 ? 340  GLU A OE2   1 
ATOM   1970 N  N     . ARG A 1 307 ? 63.482  23.926  27.639  1.00 32.72 ? 341  ARG A N     1 
ATOM   1971 C  CA    . ARG A 1 307 ? 62.068  23.889  27.267  1.00 33.06 ? 341  ARG A CA    1 
ATOM   1972 C  C     . ARG A 1 307 ? 61.739  22.690  26.369  1.00 32.76 ? 341  ARG A C     1 
ATOM   1973 O  O     . ARG A 1 307 ? 60.579  22.285  26.285  1.00 33.15 ? 341  ARG A O     1 
ATOM   1974 C  CB    . ARG A 1 307 ? 61.640  25.199  26.593  1.00 33.29 ? 341  ARG A CB    1 
ATOM   1975 C  CG    . ARG A 1 307 ? 60.157  25.521  26.778  1.00 35.14 ? 341  ARG A CG    1 
ATOM   1976 C  CD    . ARG A 1 307 ? 59.731  26.841  26.109  1.00 37.36 ? 341  ARG A CD    1 
ATOM   1977 N  NE    . ARG A 1 307 ? 60.536  27.992  26.542  1.00 38.89 ? 341  ARG A NE    1 
ATOM   1978 C  CZ    . ARG A 1 307 ? 61.382  28.694  25.774  1.00 40.35 ? 341  ARG A CZ    1 
ATOM   1979 N  NH1   . ARG A 1 307 ? 61.578  28.400  24.480  1.00 40.27 ? 341  ARG A NH1   1 
ATOM   1980 N  NH2   . ARG A 1 307 ? 62.052  29.713  26.309  1.00 40.44 ? 341  ARG A NH2   1 
ATOM   1981 N  N     . ILE A 1 308 ? 62.749  22.122  25.710  1.00 32.15 ? 342  ILE A N     1 
ATOM   1982 C  CA    . ILE A 1 308 ? 62.551  20.931  24.880  1.00 31.75 ? 342  ILE A CA    1 
ATOM   1983 C  C     . ILE A 1 308 ? 62.221  19.714  25.755  1.00 31.48 ? 342  ILE A C     1 
ATOM   1984 O  O     . ILE A 1 308 ? 62.995  19.367  26.644  1.00 31.55 ? 342  ILE A O     1 
ATOM   1985 C  CB    . ILE A 1 308 ? 63.803  20.595  24.024  1.00 31.59 ? 342  ILE A CB    1 
ATOM   1986 C  CG1   . ILE A 1 308 ? 64.123  21.723  23.048  1.00 31.13 ? 342  ILE A CG1   1 
ATOM   1987 C  CG2   . ILE A 1 308 ? 63.585  19.302  23.240  1.00 31.14 ? 342  ILE A CG2   1 
ATOM   1988 C  CD1   . ILE A 1 308 ? 65.465  21.560  22.357  1.00 31.01 ? 342  ILE A CD1   1 
ATOM   1989 N  N     . ASP A 1 309 ? 61.078  19.081  25.487  1.00 31.11 ? 343  ASP A N     1 
ATOM   1990 C  CA    . ASP A 1 309 ? 60.634  17.886  26.209  1.00 30.92 ? 343  ASP A CA    1 
ATOM   1991 C  C     . ASP A 1 309 ? 61.262  16.647  25.576  1.00 30.56 ? 343  ASP A C     1 
ATOM   1992 O  O     . ASP A 1 309 ? 60.777  16.155  24.552  1.00 30.50 ? 343  ASP A O     1 
ATOM   1993 C  CB    . ASP A 1 309 ? 59.101  17.790  26.177  1.00 31.06 ? 343  ASP A CB    1 
ATOM   1994 C  CG    . ASP A 1 309 ? 58.566  16.560  26.906  1.00 31.97 ? 343  ASP A CG    1 
ATOM   1995 O  OD1   . ASP A 1 309 ? 58.526  16.570  28.155  1.00 32.57 ? 343  ASP A OD1   1 
ATOM   1996 O  OD2   . ASP A 1 309 ? 58.166  15.589  26.223  1.00 33.38 ? 343  ASP A OD2   1 
ATOM   1997 N  N     . GLN A 1 310 ? 62.342  16.152  26.184  1.00 30.13 ? 344  GLN A N     1 
ATOM   1998 C  CA    . GLN A 1 310 ? 63.142  15.074  25.597  1.00 29.84 ? 344  GLN A CA    1 
ATOM   1999 C  C     . GLN A 1 310 ? 62.652  13.685  26.016  1.00 29.72 ? 344  GLN A C     1 
ATOM   2000 O  O     . GLN A 1 310 ? 62.174  13.494  27.138  1.00 30.12 ? 344  GLN A O     1 
ATOM   2001 C  CB    . GLN A 1 310 ? 64.613  15.227  25.996  1.00 29.89 ? 344  GLN A CB    1 
ATOM   2002 C  CG    . GLN A 1 310 ? 65.299  16.485  25.468  1.00 29.62 ? 344  GLN A CG    1 
ATOM   2003 C  CD    . GLN A 1 310 ? 66.705  16.656  26.035  1.00 29.13 ? 344  GLN A CD    1 
ATOM   2004 O  OE1   . GLN A 1 310 ? 67.599  15.862  25.751  1.00 29.81 ? 344  GLN A OE1   1 
ATOM   2005 N  NE2   . GLN A 1 310 ? 66.901  17.688  26.842  1.00 27.69 ? 344  GLN A NE2   1 
ATOM   2006 N  N     . SER A 1 311 ? 62.771  12.723  25.103  1.00 29.33 ? 345  SER A N     1 
ATOM   2007 C  CA    . SER A 1 311 ? 62.481  11.323  25.396  1.00 29.01 ? 345  SER A CA    1 
ATOM   2008 C  C     . SER A 1 311 ? 63.283  10.407  24.467  1.00 28.97 ? 345  SER A C     1 
ATOM   2009 O  O     . SER A 1 311 ? 63.658  10.811  23.368  1.00 28.30 ? 345  SER A O     1 
ATOM   2010 C  CB    . SER A 1 311 ? 60.982  11.035  25.250  1.00 29.11 ? 345  SER A CB    1 
ATOM   2011 O  OG    . SER A 1 311 ? 60.604  10.931  23.885  1.00 28.82 ? 345  SER A OG    1 
ATOM   2012 N  N     . VAL A 1 312 ? 63.554  9.182   24.925  1.00 29.00 ? 346  VAL A N     1 
ATOM   2013 C  CA    . VAL A 1 312 ? 64.246  8.176   24.109  1.00 28.80 ? 346  VAL A CA    1 
ATOM   2014 C  C     . VAL A 1 312 ? 63.457  6.872   24.103  1.00 28.62 ? 346  VAL A C     1 
ATOM   2015 O  O     . VAL A 1 312 ? 62.950  6.449   25.132  1.00 28.73 ? 346  VAL A O     1 
ATOM   2016 C  CB    . VAL A 1 312 ? 65.693  7.913   24.601  1.00 28.76 ? 346  VAL A CB    1 
ATOM   2017 C  CG1   . VAL A 1 312 ? 65.716  7.640   26.068  1.00 29.17 ? 346  VAL A CG1   1 
ATOM   2018 C  CG2   . VAL A 1 312 ? 66.319  6.751   23.844  1.00 28.79 ? 346  VAL A CG2   1 
ATOM   2019 N  N     . VAL A 1 313 ? 63.366  6.254   22.931  1.00 28.47 ? 347  VAL A N     1 
ATOM   2020 C  CA    . VAL A 1 313 ? 62.621  5.028   22.727  1.00 28.22 ? 347  VAL A CA    1 
ATOM   2021 C  C     . VAL A 1 313 ? 63.614  3.942   22.321  1.00 28.40 ? 347  VAL A C     1 
ATOM   2022 O  O     . VAL A 1 313 ? 64.184  3.991   21.226  1.00 27.86 ? 347  VAL A O     1 
ATOM   2023 C  CB    . VAL A 1 313 ? 61.538  5.208   21.634  1.00 28.19 ? 347  VAL A CB    1 
ATOM   2024 C  CG1   . VAL A 1 313 ? 60.881  3.871   21.284  1.00 28.16 ? 347  VAL A CG1   1 
ATOM   2025 C  CG2   . VAL A 1 313 ? 60.493  6.210   22.086  1.00 27.61 ? 347  VAL A CG2   1 
ATOM   2026 N  N     . ILE A 1 314 ? 63.796  2.958   23.207  1.00 28.55 ? 348  ILE A N     1 
ATOM   2027 C  CA    . ILE A 1 314 ? 64.852  1.948   23.073  1.00 28.62 ? 348  ILE A CA    1 
ATOM   2028 C  C     . ILE A 1 314 ? 64.323  0.649   22.463  1.00 28.80 ? 348  ILE A C     1 
ATOM   2029 O  O     . ILE A 1 314 ? 63.580  -0.084  23.106  1.00 28.89 ? 348  ILE A O     1 
ATOM   2030 C  CB    . ILE A 1 314 ? 65.473  1.634   24.452  1.00 28.68 ? 348  ILE A CB    1 
ATOM   2031 C  CG1   . ILE A 1 314 ? 65.989  2.917   25.116  1.00 28.27 ? 348  ILE A CG1   1 
ATOM   2032 C  CG2   . ILE A 1 314 ? 66.597  0.597   24.321  1.00 28.55 ? 348  ILE A CG2   1 
ATOM   2033 C  CD1   . ILE A 1 314 ? 66.020  2.844   26.618  1.00 27.90 ? 348  ILE A CD1   1 
ATOM   2034 N  N     . SER A 1 315 ? 64.699  0.372   21.218  1.00 28.99 ? 349  SER A N     1 
ATOM   2035 C  CA    . SER A 1 315 ? 64.309  -0.873  20.558  1.00 29.28 ? 349  SER A CA    1 
ATOM   2036 C  C     . SER A 1 315 ? 65.332  -1.960  20.856  1.00 29.48 ? 349  SER A C     1 
ATOM   2037 O  O     . SER A 1 315 ? 66.394  -1.683  21.414  1.00 29.73 ? 349  SER A O     1 
ATOM   2038 C  CB    . SER A 1 315 ? 64.183  -0.679  19.047  1.00 29.43 ? 349  SER A CB    1 
ATOM   2039 O  OG    . SER A 1 315 ? 62.966  -0.035  18.700  1.00 29.77 ? 349  SER A OG    1 
ATOM   2040 N  N     . GLU A 1 316 ? 65.008  -3.198  20.493  1.00 29.58 ? 350  GLU A N     1 
ATOM   2041 C  CA    . GLU A 1 316 ? 65.907  -4.327  20.741  1.00 29.83 ? 350  GLU A CA    1 
ATOM   2042 C  C     . GLU A 1 316 ? 66.880  -4.479  19.553  1.00 29.42 ? 350  GLU A C     1 
ATOM   2043 O  O     . GLU A 1 316 ? 68.021  -4.923  19.725  1.00 29.29 ? 350  GLU A O     1 
ATOM   2044 C  CB    . GLU A 1 316 ? 65.110  -5.620  21.033  1.00 29.93 ? 350  GLU A CB    1 
ATOM   2045 C  CG    . GLU A 1 316 ? 65.745  -6.548  22.102  1.00 31.31 ? 350  GLU A CG    1 
ATOM   2046 C  CD    . GLU A 1 316 ? 65.342  -6.222  23.569  1.00 33.42 ? 350  GLU A CD    1 
ATOM   2047 O  OE1   . GLU A 1 316 ? 64.281  -6.709  24.037  1.00 33.94 ? 350  GLU A OE1   1 
ATOM   2048 O  OE2   . GLU A 1 316 ? 66.108  -5.513  24.271  1.00 33.91 ? 350  GLU A OE2   1 
ATOM   2049 N  N     . LYS A 1 317 ? 66.432  -4.080  18.364  1.00 28.87 ? 351  LYS A N     1 
ATOM   2050 C  CA    . LYS A 1 317 ? 67.277  -4.044  17.176  1.00 28.62 ? 351  LYS A CA    1 
ATOM   2051 C  C     . LYS A 1 317 ? 67.329  -2.631  16.577  1.00 28.36 ? 351  LYS A C     1 
ATOM   2052 O  O     . LYS A 1 317 ? 66.463  -1.795  16.857  1.00 28.30 ? 351  LYS A O     1 
ATOM   2053 C  CB    . LYS A 1 317 ? 66.743  -5.026  16.134  1.00 28.83 ? 351  LYS A CB    1 
ATOM   2054 C  CG    . LYS A 1 317 ? 66.828  -6.494  16.565  1.00 29.40 ? 351  LYS A CG    1 
ATOM   2055 C  CD    . LYS A 1 317 ? 66.539  -7.450  15.403  1.00 29.85 ? 351  LYS A CD    1 
ATOM   2056 C  CE    . LYS A 1 317 ? 67.680  -7.490  14.380  1.00 30.15 ? 351  LYS A CE    1 
ATOM   2057 N  NZ    . LYS A 1 317 ? 69.001  -7.775  15.012  1.00 29.70 ? 351  LYS A NZ    1 
ATOM   2058 N  N     . PHE A 1 318 ? 68.340  -2.366  15.748  1.00 27.86 ? 352  PHE A N     1 
ATOM   2059 C  CA    . PHE A 1 318 ? 68.469  -1.059  15.098  1.00 27.40 ? 352  PHE A CA    1 
ATOM   2060 C  C     . PHE A 1 318 ? 67.309  -0.795  14.139  1.00 26.70 ? 352  PHE A C     1 
ATOM   2061 O  O     . PHE A 1 318 ? 66.671  0.251   14.211  1.00 26.64 ? 352  PHE A O     1 
ATOM   2062 C  CB    . PHE A 1 318 ? 69.799  -0.912  14.348  1.00 27.48 ? 352  PHE A CB    1 
ATOM   2063 C  CG    . PHE A 1 318 ? 69.876  0.348   13.528  1.00 28.22 ? 352  PHE A CG    1 
ATOM   2064 C  CD1   . PHE A 1 318 ? 70.207  1.556   14.120  1.00 28.60 ? 352  PHE A CD1   1 
ATOM   2065 C  CD2   . PHE A 1 318 ? 69.553  0.333   12.172  1.00 28.79 ? 352  PHE A CD2   1 
ATOM   2066 C  CE1   . PHE A 1 318 ? 70.238  2.724   13.368  1.00 29.45 ? 352  PHE A CE1   1 
ATOM   2067 C  CE2   . PHE A 1 318 ? 69.580  1.495   11.419  1.00 29.07 ? 352  PHE A CE2   1 
ATOM   2068 C  CZ    . PHE A 1 318 ? 69.927  2.694   12.020  1.00 29.21 ? 352  PHE A CZ    1 
ATOM   2069 N  N     . ALA A 1 319 ? 67.059  -1.747  13.244  1.00 25.98 ? 353  ALA A N     1 
ATOM   2070 C  CA    . ALA A 1 319 ? 65.963  -1.668  12.277  1.00 25.39 ? 353  ALA A CA    1 
ATOM   2071 C  C     . ALA A 1 319 ? 64.599  -1.386  12.922  1.00 24.78 ? 353  ALA A C     1 
ATOM   2072 O  O     . ALA A 1 319 ? 63.765  -0.709  12.342  1.00 24.10 ? 353  ALA A O     1 
ATOM   2073 C  CB    . ALA A 1 319 ? 65.892  -2.962  11.470  1.00 25.57 ? 353  ALA A CB    1 
ATOM   2074 N  N     . ASN A 1 320 ? 64.374  -1.912  14.123  1.00 24.28 ? 354  ASN A N     1 
ATOM   2075 C  CA    . ASN A 1 320 ? 63.127  -1.646  14.839  1.00 23.70 ? 354  ASN A CA    1 
ATOM   2076 C  C     . ASN A 1 320 ? 62.830  -0.154  15.028  1.00 23.26 ? 354  ASN A C     1 
ATOM   2077 O  O     . ASN A 1 320 ? 61.664  0.241   15.103  1.00 23.43 ? 354  ASN A O     1 
ATOM   2078 C  CB    . ASN A 1 320 ? 63.117  -2.363  16.190  1.00 23.62 ? 354  ASN A CB    1 
ATOM   2079 C  CG    . ASN A 1 320 ? 62.919  -3.862  16.054  1.00 23.21 ? 354  ASN A CG    1 
ATOM   2080 O  OD1   . ASN A 1 320 ? 62.885  -4.401  14.944  1.00 21.44 ? 354  ASN A OD1   1 
ATOM   2081 N  ND2   . ASN A 1 320 ? 62.782  -4.543  17.188  1.00 21.44 ? 354  ASN A ND2   1 
ATOM   2082 N  N     . SER A 1 321 ? 63.872  0.669   15.096  1.00 22.60 ? 355  SER A N     1 
ATOM   2083 C  CA    . SER A 1 321 ? 63.704  2.124   15.208  1.00 22.33 ? 355  SER A CA    1 
ATOM   2084 C  C     . SER A 1 321 ? 63.012  2.747   13.983  1.00 21.76 ? 355  SER A C     1 
ATOM   2085 O  O     . SER A 1 321 ? 62.373  3.782   14.096  1.00 21.59 ? 355  SER A O     1 
ATOM   2086 C  CB    . SER A 1 321 ? 65.054  2.795   15.440  1.00 22.25 ? 355  SER A CB    1 
ATOM   2087 O  OG    . SER A 1 321 ? 65.645  2.310   16.631  1.00 23.37 ? 355  SER A OG    1 
ATOM   2088 N  N     . ILE A 1 322 ? 63.133  2.111   12.822  1.00 21.19 ? 356  ILE A N     1 
ATOM   2089 C  CA    . ILE A 1 322 ? 62.380  2.537   11.638  1.00 20.86 ? 356  ILE A CA    1 
ATOM   2090 C  C     . ILE A 1 322 ? 60.877  2.390   11.876  1.00 20.49 ? 356  ILE A C     1 
ATOM   2091 O  O     . ILE A 1 322 ? 60.093  3.268   11.494  1.00 20.34 ? 356  ILE A O     1 
ATOM   2092 C  CB    . ILE A 1 322 ? 62.756  1.713   10.393  1.00 20.70 ? 356  ILE A CB    1 
ATOM   2093 C  CG1   . ILE A 1 322 ? 64.206  1.978   9.990   1.00 21.42 ? 356  ILE A CG1   1 
ATOM   2094 C  CG2   . ILE A 1 322 ? 61.841  2.049   9.235   1.00 21.37 ? 356  ILE A CG2   1 
ATOM   2095 C  CD1   . ILE A 1 322 ? 64.688  1.112   8.821   1.00 21.99 ? 356  ILE A CD1   1 
ATOM   2096 N  N     . PHE A 1 323 ? 60.482  1.282   12.508  1.00 19.88 ? 357  PHE A N     1 
ATOM   2097 C  CA    . PHE A 1 323 ? 59.069  0.981   12.704  1.00 19.54 ? 357  PHE A CA    1 
ATOM   2098 C  C     . PHE A 1 323 ? 58.519  1.825   13.831  1.00 19.03 ? 357  PHE A C     1 
ATOM   2099 O  O     . PHE A 1 323 ? 57.426  2.356   13.725  1.00 18.76 ? 357  PHE A O     1 
ATOM   2100 C  CB    . PHE A 1 323 ? 58.843  -0.510  12.975  1.00 19.67 ? 357  PHE A CB    1 
ATOM   2101 C  CG    . PHE A 1 323 ? 59.454  -1.399  11.937  1.00 19.90 ? 357  PHE A CG    1 
ATOM   2102 C  CD1   . PHE A 1 323 ? 59.073  -1.294  10.606  1.00 20.68 ? 357  PHE A CD1   1 
ATOM   2103 C  CD2   . PHE A 1 323 ? 60.425  -2.326  12.285  1.00 20.05 ? 357  PHE A CD2   1 
ATOM   2104 C  CE1   . PHE A 1 323 ? 59.647  -2.107  9.640   1.00 20.53 ? 357  PHE A CE1   1 
ATOM   2105 C  CE2   . PHE A 1 323 ? 61.004  -3.138  11.331  1.00 20.00 ? 357  PHE A CE2   1 
ATOM   2106 C  CZ    . PHE A 1 323 ? 60.616  -3.031  10.005  1.00 20.87 ? 357  PHE A CZ    1 
ATOM   2107 N  N     . ALA A 1 324 ? 59.290  1.963   14.902  1.00 19.00 ? 358  ALA A N     1 
ATOM   2108 C  CA    . ALA A 1 324 ? 58.935  2.878   15.986  1.00 18.88 ? 358  ALA A CA    1 
ATOM   2109 C  C     . ALA A 1 324 ? 58.641  4.282   15.440  1.00 18.81 ? 358  ALA A C     1 
ATOM   2110 O  O     . ALA A 1 324 ? 57.615  4.866   15.754  1.00 18.46 ? 358  ALA A O     1 
ATOM   2111 C  CB    . ALA A 1 324 ? 60.049  2.934   17.019  1.00 18.54 ? 358  ALA A CB    1 
ATOM   2112 N  N     . ALA A 1 325 ? 59.530  4.793   14.591  1.00 19.11 ? 359  ALA A N     1 
ATOM   2113 C  CA    . ALA A 1 325 ? 59.394  6.152   14.060  1.00 19.29 ? 359  ALA A CA    1 
ATOM   2114 C  C     . ALA A 1 325 ? 58.147  6.277   13.198  1.00 19.56 ? 359  ALA A C     1 
ATOM   2115 O  O     . ALA A 1 325 ? 57.423  7.268   13.297  1.00 19.44 ? 359  ALA A O     1 
ATOM   2116 C  CB    . ALA A 1 325 ? 60.636  6.560   13.285  1.00 18.73 ? 359  ALA A CB    1 
ATOM   2117 N  N     . VAL A 1 326 ? 57.883  5.263   12.375  1.00 20.08 ? 360  VAL A N     1 
ATOM   2118 C  CA    . VAL A 1 326 ? 56.677  5.260   11.547  1.00 20.33 ? 360  VAL A CA    1 
ATOM   2119 C  C     . VAL A 1 326 ? 55.418  5.286   12.405  1.00 20.71 ? 360  VAL A C     1 
ATOM   2120 O  O     . VAL A 1 326 ? 54.501  6.061   12.146  1.00 20.84 ? 360  VAL A O     1 
ATOM   2121 C  CB    . VAL A 1 326 ? 56.600  4.046   10.599  1.00 20.22 ? 360  VAL A CB    1 
ATOM   2122 C  CG1   . VAL A 1 326 ? 55.221  3.974   9.944   1.00 19.44 ? 360  VAL A CG1   1 
ATOM   2123 C  CG2   . VAL A 1 326 ? 57.684  4.120   9.543   1.00 19.91 ? 360  VAL A CG2   1 
ATOM   2124 N  N     . GLU A 1 327 ? 55.368  4.451   13.431  1.00 21.20 ? 361  GLU A N     1 
ATOM   2125 C  CA    . GLU A 1 327 ? 54.170  4.400   14.274  1.00 21.61 ? 361  GLU A CA    1 
ATOM   2126 C  C     . GLU A 1 327 ? 53.977  5.714   15.008  1.00 21.62 ? 361  GLU A C     1 
ATOM   2127 O  O     . GLU A 1 327 ? 52.843  6.135   15.226  1.00 21.76 ? 361  GLU A O     1 
ATOM   2128 C  CB    . GLU A 1 327 ? 54.221  3.234   15.269  1.00 21.65 ? 361  GLU A CB    1 
ATOM   2129 C  CG    . GLU A 1 327 ? 53.993  1.884   14.616  1.00 22.67 ? 361  GLU A CG    1 
ATOM   2130 C  CD    . GLU A 1 327 ? 53.515  0.821   15.602  1.00 24.10 ? 361  GLU A CD    1 
ATOM   2131 O  OE1   . GLU A 1 327 ? 52.313  0.467   15.563  1.00 22.99 ? 361  GLU A OE1   1 
ATOM   2132 O  OE2   . GLU A 1 327 ? 54.347  0.355   16.416  1.00 24.61 ? 361  GLU A OE2   1 
ATOM   2133 N  N     . HIS A 1 328 ? 55.083  6.353   15.381  1.00 21.63 ? 362  HIS A N     1 
ATOM   2134 C  CA    . HIS A 1 328 ? 55.036  7.632   16.087  1.00 21.91 ? 362  HIS A CA    1 
ATOM   2135 C  C     . HIS A 1 328 ? 54.445  8.734   15.204  1.00 21.90 ? 362  HIS A C     1 
ATOM   2136 O  O     . HIS A 1 328 ? 53.495  9.403   15.590  1.00 21.42 ? 362  HIS A O     1 
ATOM   2137 C  CB    . HIS A 1 328 ? 56.440  8.039   16.550  1.00 21.90 ? 362  HIS A CB    1 
ATOM   2138 C  CG    . HIS A 1 328 ? 56.464  9.267   17.404  1.00 21.79 ? 362  HIS A CG    1 
ATOM   2139 N  ND1   . HIS A 1 328 ? 56.323  9.222   18.774  1.00 22.20 ? 362  HIS A ND1   1 
ATOM   2140 C  CD2   . HIS A 1 328 ? 56.618  10.573  17.083  1.00 21.65 ? 362  HIS A CD2   1 
ATOM   2141 C  CE1   . HIS A 1 328 ? 56.395  10.449  19.262  1.00 22.35 ? 362  HIS A CE1   1 
ATOM   2142 N  NE2   . HIS A 1 328 ? 56.570  11.286  18.256  1.00 22.17 ? 362  HIS A NE2   1 
ATOM   2143 N  N     . ILE A 1 329 ? 55.029  8.910   14.021  1.00 22.20 ? 363  ILE A N     1 
ATOM   2144 C  CA    . ILE A 1 329 ? 54.567  9.906   13.046  1.00 22.04 ? 363  ILE A CA    1 
ATOM   2145 C  C     . ILE A 1 329 ? 53.097  9.657   12.705  1.00 22.86 ? 363  ILE A C     1 
ATOM   2146 O  O     . ILE A 1 329 ? 52.296  10.592  12.622  1.00 22.96 ? 363  ILE A O     1 
ATOM   2147 C  CB    . ILE A 1 329 ? 55.416  9.847   11.766  1.00 21.76 ? 363  ILE A CB    1 
ATOM   2148 C  CG1   . ILE A 1 329 ? 56.845  10.345  12.053  1.00 20.91 ? 363  ILE A CG1   1 
ATOM   2149 C  CG2   . ILE A 1 329 ? 54.763  10.640  10.643  1.00 21.10 ? 363  ILE A CG2   1 
ATOM   2150 C  CD1   . ILE A 1 329 ? 57.838  10.000  10.980  1.00 17.88 ? 363  ILE A CD1   1 
ATOM   2151 N  N     . LYS A 1 330 ? 52.741  8.388   12.530  1.00 23.54 ? 364  LYS A N     1 
ATOM   2152 C  CA    . LYS A 1 330 ? 51.349  7.998   12.310  1.00 24.17 ? 364  LYS A CA    1 
ATOM   2153 C  C     . LYS A 1 330 ? 50.430  8.495   13.439  1.00 24.65 ? 364  LYS A C     1 
ATOM   2154 O  O     . LYS A 1 330 ? 49.351  9.023   13.180  1.00 25.21 ? 364  LYS A O     1 
ATOM   2155 C  CB    . LYS A 1 330 ? 51.256  6.478   12.172  1.00 24.09 ? 364  LYS A CB    1 
ATOM   2156 C  CG    . LYS A 1 330 ? 49.872  5.967   11.862  1.00 24.53 ? 364  LYS A CG    1 
ATOM   2157 C  CD    . LYS A 1 330 ? 49.887  4.472   11.558  1.00 25.34 ? 364  LYS A CD    1 
ATOM   2158 C  CE    . LYS A 1 330 ? 50.705  4.145   10.300  1.00 25.37 ? 364  LYS A CE    1 
ATOM   2159 N  NZ    . LYS A 1 330 ? 50.127  2.975   9.575   1.00 25.14 ? 364  LYS A NZ    1 
ATOM   2160 N  N     . LYS A 1 331 ? 50.873  8.335   14.679  1.00 24.90 ? 365  LYS A N     1 
ATOM   2161 C  CA    . LYS A 1 331 ? 50.103  8.754   15.849  1.00 25.39 ? 365  LYS A CA    1 
ATOM   2162 C  C     . LYS A 1 331 ? 50.009  10.272  15.988  1.00 25.40 ? 365  LYS A C     1 
ATOM   2163 O  O     . LYS A 1 331 ? 49.023  10.779  16.515  1.00 26.12 ? 365  LYS A O     1 
ATOM   2164 C  CB    . LYS A 1 331 ? 50.724  8.162   17.125  1.00 25.56 ? 365  LYS A CB    1 
ATOM   2165 C  CG    . LYS A 1 331 ? 49.926  8.411   18.403  1.00 26.91 ? 365  LYS A CG    1 
ATOM   2166 C  CD    . LYS A 1 331 ? 50.557  7.699   19.596  1.00 28.13 ? 365  LYS A CD    1 
ATOM   2167 C  CE    . LYS A 1 331 ? 49.689  7.841   20.840  1.00 30.10 ? 365  LYS A CE    1 
ATOM   2168 N  NZ    . LYS A 1 331 ? 50.121  6.938   21.956  1.00 31.01 ? 365  LYS A NZ    1 
ATOM   2169 N  N     . GLN A 1 332 ? 51.033  10.993  15.543  1.00 25.19 ? 366  GLN A N     1 
ATOM   2170 C  CA    . GLN A 1 332 ? 51.025  12.453  15.609  1.00 25.04 ? 366  GLN A CA    1 
ATOM   2171 C  C     . GLN A 1 332 ? 50.085  13.061  14.570  1.00 24.70 ? 366  GLN A C     1 
ATOM   2172 O  O     . GLN A 1 332 ? 49.368  14.015  14.858  1.00 24.61 ? 366  GLN A O     1 
ATOM   2173 C  CB    . GLN A 1 332 ? 52.443  13.007  15.420  1.00 25.11 ? 366  GLN A CB    1 
ATOM   2174 C  CG    . GLN A 1 332 ? 53.410  12.659  16.547  1.00 25.17 ? 366  GLN A CG    1 
ATOM   2175 C  CD    . GLN A 1 332 ? 53.026  13.269  17.879  1.00 25.11 ? 366  GLN A CD    1 
ATOM   2176 O  OE1   . GLN A 1 332 ? 52.581  14.408  17.954  1.00 25.26 ? 366  GLN A OE1   1 
ATOM   2177 N  NE2   . GLN A 1 332 ? 53.202  12.504  18.944  1.00 26.52 ? 366  GLN A NE2   1 
ATOM   2178 N  N     . ILE A 1 333 ? 50.105  12.505  13.364  1.00 24.66 ? 367  ILE A N     1 
ATOM   2179 C  CA    . ILE A 1 333 ? 49.218  12.930  12.279  1.00 24.51 ? 367  ILE A CA    1 
ATOM   2180 C  C     . ILE A 1 333 ? 47.742  12.792  12.655  1.00 24.85 ? 367  ILE A C     1 
ATOM   2181 O  O     . ILE A 1 333 ? 46.940  13.694  12.395  1.00 25.03 ? 367  ILE A O     1 
ATOM   2182 C  CB    . ILE A 1 333 ? 49.508  12.130  10.983  1.00 24.44 ? 367  ILE A CB    1 
ATOM   2183 C  CG1   . ILE A 1 333 ? 50.826  12.608  10.371  1.00 23.74 ? 367  ILE A CG1   1 
ATOM   2184 C  CG2   . ILE A 1 333 ? 48.362  12.259  9.966   1.00 23.56 ? 367  ILE A CG2   1 
ATOM   2185 C  CD1   . ILE A 1 333 ? 51.368  11.693  9.317   1.00 23.40 ? 367  ILE A CD1   1 
ATOM   2186 N  N     . LYS A 1 334 ? 47.388  11.670  13.273  1.00 25.05 ? 368  LYS A N     1 
ATOM   2187 C  CA    . LYS A 1 334 ? 46.021  11.457  13.735  1.00 25.14 ? 368  LYS A CA    1 
ATOM   2188 C  C     . LYS A 1 334 ? 45.659  12.444  14.843  1.00 25.26 ? 368  LYS A C     1 
ATOM   2189 O  O     . LYS A 1 334 ? 44.599  13.068  14.795  1.00 25.32 ? 368  LYS A O     1 
ATOM   2190 C  CB    . LYS A 1 334 ? 45.835  10.021  14.236  1.00 25.16 ? 368  LYS A CB    1 
ATOM   2191 C  CG    . LYS A 1 334 ? 44.390  9.655   14.553  1.00 24.97 ? 368  LYS A CG    1 
ATOM   2192 N  N     . GLU A 1 335 ? 46.543  12.585  15.829  1.00 25.27 ? 369  GLU A N     1 
ATOM   2193 C  CA    . GLU A 1 335 ? 46.238  13.365  17.031  1.00 25.38 ? 369  GLU A CA    1 
ATOM   2194 C  C     . GLU A 1 335 ? 46.206  14.861  16.775  1.00 24.98 ? 369  GLU A C     1 
ATOM   2195 O  O     . GLU A 1 335 ? 45.388  15.562  17.351  1.00 25.02 ? 369  GLU A O     1 
ATOM   2196 C  CB    . GLU A 1 335 ? 47.224  13.043  18.161  1.00 25.66 ? 369  GLU A CB    1 
ATOM   2197 C  CG    . GLU A 1 335 ? 46.922  11.712  18.867  1.00 26.89 ? 369  GLU A CG    1 
ATOM   2198 C  CD    . GLU A 1 335 ? 47.809  11.458  20.080  1.00 28.75 ? 369  GLU A CD    1 
ATOM   2199 O  OE1   . GLU A 1 335 ? 48.845  12.148  20.225  1.00 28.58 ? 369  GLU A OE1   1 
ATOM   2200 O  OE2   . GLU A 1 335 ? 47.465  10.559  20.888  1.00 30.13 ? 369  GLU A OE2   1 
ATOM   2201 N  N     . ARG A 1 336 ? 47.090  15.340  15.907  1.00 24.60 ? 370  ARG A N     1 
ATOM   2202 C  CA    . ARG A 1 336 ? 47.141  16.752  15.546  1.00 24.11 ? 370  ARG A CA    1 
ATOM   2203 C  C     . ARG A 1 336 ? 46.359  17.070  14.262  1.00 23.85 ? 370  ARG A C     1 
ATOM   2204 O  O     . ARG A 1 336 ? 46.475  18.179  13.735  1.00 23.80 ? 370  ARG A O     1 
ATOM   2205 C  CB    . ARG A 1 336 ? 48.597  17.184  15.350  1.00 24.06 ? 370  ARG A CB    1 
ATOM   2206 C  CG    . ARG A 1 336 ? 49.531  16.857  16.501  1.00 23.81 ? 370  ARG A CG    1 
ATOM   2207 C  CD    . ARG A 1 336 ? 50.989  17.070  16.078  1.00 23.94 ? 370  ARG A CD    1 
ATOM   2208 N  NE    . ARG A 1 336 ? 51.948  16.842  17.164  1.00 22.92 ? 370  ARG A NE    1 
ATOM   2209 C  CZ    . ARG A 1 336 ? 52.354  17.762  18.036  1.00 21.53 ? 370  ARG A CZ    1 
ATOM   2210 N  NH1   . ARG A 1 336 ? 51.898  19.010  17.978  1.00 21.75 ? 370  ARG A NH1   1 
ATOM   2211 N  NH2   . ARG A 1 336 ? 53.218  17.429  18.984  1.00 21.17 ? 370  ARG A NH2   1 
ATOM   2212 N  N     . ASP A 1 337 ? 45.579  16.114  13.753  1.00 23.52 ? 371  ASP A N     1 
ATOM   2213 C  CA    . ASP A 1 337 ? 44.813  16.297  12.504  1.00 23.46 ? 371  ASP A CA    1 
ATOM   2214 C  C     . ASP A 1 337 ? 45.697  16.879  11.394  1.00 23.02 ? 371  ASP A C     1 
ATOM   2215 O  O     . ASP A 1 337 ? 45.349  17.876  10.760  1.00 22.91 ? 371  ASP A O     1 
ATOM   2216 C  CB    . ASP A 1 337 ? 43.581  17.193  12.742  1.00 23.61 ? 371  ASP A CB    1 
ATOM   2217 C  CG    . ASP A 1 337 ? 42.563  17.141  11.584  1.00 24.70 ? 371  ASP A CG    1 
ATOM   2218 O  OD1   . ASP A 1 337 ? 42.509  16.116  10.857  1.00 25.13 ? 371  ASP A OD1   1 
ATOM   2219 O  OD2   . ASP A 1 337 ? 41.807  18.131  11.409  1.00 25.39 ? 371  ASP A OD2   1 
ATOM   2220 N  N     . SER A 1 338 ? 46.855  16.251  11.201  1.00 22.59 ? 372  SER A N     1 
ATOM   2221 C  CA    . SER A 1 338 ? 47.844  16.641  10.186  1.00 22.41 ? 372  SER A CA    1 
ATOM   2222 C  C     . SER A 1 338 ? 48.517  18.019  10.381  1.00 21.84 ? 372  SER A C     1 
ATOM   2223 O  O     . SER A 1 338 ? 49.250  18.464  9.500   1.00 21.72 ? 372  SER A O     1 
ATOM   2224 C  CB    . SER A 1 338 ? 47.235  16.546  8.782   1.00 22.54 ? 372  SER A CB    1 
ATOM   2225 O  OG    . SER A 1 338 ? 46.518  15.336  8.614   1.00 22.99 ? 372  SER A OG    1 
ATOM   2226 N  N     . ASN A 1 339 ? 48.263  18.679  11.514  1.00 21.35 ? 373  ASN A N     1 
ATOM   2227 C  CA    . ASN A 1 339 ? 48.926  19.931  11.870  1.00 21.04 ? 373  ASN A CA    1 
ATOM   2228 C  C     . ASN A 1 339 ? 50.252  19.590  12.559  1.00 20.21 ? 373  ASN A C     1 
ATOM   2229 O  O     . ASN A 1 339 ? 50.411  19.776  13.759  1.00 20.36 ? 373  ASN A O     1 
ATOM   2230 C  CB    . ASN A 1 339 ? 48.038  20.793  12.787  1.00 21.18 ? 373  ASN A CB    1 
ATOM   2231 C  CG    . ASN A 1 339 ? 46.623  21.042  12.205  1.00 23.42 ? 373  ASN A CG    1 
ATOM   2232 O  OD1   . ASN A 1 339 ? 46.460  21.293  11.001  1.00 26.05 ? 373  ASN A OD1   1 
ATOM   2233 N  ND2   . ASN A 1 339 ? 45.599  20.983  13.072  1.00 22.09 ? 373  ASN A ND2   1 
ATOM   2234 N  N     . TYR A 1 340 ? 51.203  19.081  11.789  1.00 19.27 ? 374  TYR A N     1 
ATOM   2235 C  CA    . TYR A 1 340 ? 52.424  18.502  12.351  1.00 18.43 ? 374  TYR A CA    1 
ATOM   2236 C  C     . TYR A 1 340 ? 53.610  18.882  11.497  1.00 17.70 ? 374  TYR A C     1 
ATOM   2237 O  O     . TYR A 1 340 ? 53.639  18.590  10.299  1.00 17.55 ? 374  TYR A O     1 
ATOM   2238 C  CB    . TYR A 1 340 ? 52.294  16.974  12.406  1.00 18.43 ? 374  TYR A CB    1 
ATOM   2239 C  CG    . TYR A 1 340 ? 53.431  16.221  13.085  1.00 18.05 ? 374  TYR A CG    1 
ATOM   2240 C  CD1   . TYR A 1 340 ? 53.831  16.533  14.380  1.00 17.61 ? 374  TYR A CD1   1 
ATOM   2241 C  CD2   . TYR A 1 340 ? 54.062  15.158  12.446  1.00 18.16 ? 374  TYR A CD2   1 
ATOM   2242 C  CE1   . TYR A 1 340 ? 54.841  15.823  15.013  1.00 18.23 ? 374  TYR A CE1   1 
ATOM   2243 C  CE2   . TYR A 1 340 ? 55.081  14.434  13.076  1.00 18.63 ? 374  TYR A CE2   1 
ATOM   2244 C  CZ    . TYR A 1 340 ? 55.462  14.773  14.357  1.00 18.97 ? 374  TYR A CZ    1 
ATOM   2245 O  OH    . TYR A 1 340 ? 56.468  14.069  14.981  1.00 19.42 ? 374  TYR A OH    1 
ATOM   2246 N  N     . LYS A 1 341 ? 54.583  19.534  12.120  1.00 17.10 ? 375  LYS A N     1 
ATOM   2247 C  CA    . LYS A 1 341 ? 55.825  19.917  11.456  1.00 16.77 ? 375  LYS A CA    1 
ATOM   2248 C  C     . LYS A 1 341 ? 56.958  19.259  12.226  1.00 16.47 ? 375  LYS A C     1 
ATOM   2249 O  O     . LYS A 1 341 ? 57.108  19.478  13.427  1.00 17.08 ? 375  LYS A O     1 
ATOM   2250 C  CB    . LYS A 1 341 ? 55.983  21.439  11.441  1.00 16.37 ? 375  LYS A CB    1 
ATOM   2251 C  CG    . LYS A 1 341 ? 56.964  21.952  10.409  1.00 15.77 ? 375  LYS A CG    1 
ATOM   2252 C  CD    . LYS A 1 341 ? 57.161  23.440  10.535  1.00 14.85 ? 375  LYS A CD    1 
ATOM   2253 C  CE    . LYS A 1 341 ? 58.068  23.974  9.439   1.00 14.49 ? 375  LYS A CE    1 
ATOM   2254 N  NZ    . LYS A 1 341 ? 58.268  25.458  9.529   1.00 12.07 ? 375  LYS A NZ    1 
ATOM   2255 N  N     . ALA A 1 342 ? 57.734  18.430  11.547  1.00 16.45 ? 376  ALA A N     1 
ATOM   2256 C  CA    . ALA A 1 342 ? 58.758  17.634  12.220  1.00 16.19 ? 376  ALA A CA    1 
ATOM   2257 C  C     . ALA A 1 342 ? 60.001  17.492  11.370  1.00 15.88 ? 376  ALA A C     1 
ATOM   2258 O  O     . ALA A 1 342 ? 59.932  17.496  10.148  1.00 15.66 ? 376  ALA A O     1 
ATOM   2259 C  CB    . ALA A 1 342 ? 58.208  16.256  12.574  1.00 16.04 ? 376  ALA A CB    1 
ATOM   2260 N  N     . ILE A 1 343 ? 61.139  17.382  12.043  1.00 15.90 ? 377  ILE A N     1 
ATOM   2261 C  CA    . ILE A 1 343 ? 62.399  17.079  11.405  1.00 15.53 ? 377  ILE A CA    1 
ATOM   2262 C  C     . ILE A 1 343 ? 62.847  15.722  11.909  1.00 15.90 ? 377  ILE A C     1 
ATOM   2263 O  O     . ILE A 1 343 ? 62.914  15.493  13.117  1.00 16.15 ? 377  ILE A O     1 
ATOM   2264 C  CB    . ILE A 1 343 ? 63.454  18.129  11.751  1.00 15.48 ? 377  ILE A CB    1 
ATOM   2265 C  CG1   . ILE A 1 343 ? 62.959  19.521  11.334  1.00 15.26 ? 377  ILE A CG1   1 
ATOM   2266 C  CG2   . ILE A 1 343 ? 64.796  17.783  11.092  1.00 14.28 ? 377  ILE A CG2   1 
ATOM   2267 C  CD1   . ILE A 1 343 ? 63.894  20.647  11.677  1.00 14.54 ? 377  ILE A CD1   1 
ATOM   2268 N  N     . ILE A 1 344 ? 63.143  14.817  10.984  1.00 16.25 ? 378  ILE A N     1 
ATOM   2269 C  CA    . ILE A 1 344 ? 63.679  13.506  11.331  1.00 16.35 ? 378  ILE A CA    1 
ATOM   2270 C  C     . ILE A 1 344 ? 65.094  13.369  10.782  1.00 16.67 ? 378  ILE A C     1 
ATOM   2271 O  O     . ILE A 1 344 ? 65.311  13.467  9.579   1.00 17.05 ? 378  ILE A O     1 
ATOM   2272 C  CB    . ILE A 1 344 ? 62.758  12.342  10.846  1.00 15.91 ? 378  ILE A CB    1 
ATOM   2273 C  CG1   . ILE A 1 344 ? 63.361  10.991  11.225  1.00 15.97 ? 378  ILE A CG1   1 
ATOM   2274 C  CG2   . ILE A 1 344 ? 62.532  12.390  9.357   1.00 16.33 ? 378  ILE A CG2   1 
ATOM   2275 C  CD1   . ILE A 1 344 ? 62.391  9.804   11.058  1.00 15.94 ? 378  ILE A CD1   1 
ATOM   2276 N  N     . PHE A 1 345 ? 66.052  13.137  11.673  1.00 17.54 ? 379  PHE A N     1 
ATOM   2277 C  CA    . PHE A 1 345 ? 67.456  12.944  11.289  1.00 18.15 ? 379  PHE A CA    1 
ATOM   2278 C  C     . PHE A 1 345 ? 67.832  11.459  11.093  1.00 18.44 ? 379  PHE A C     1 
ATOM   2279 O  O     . PHE A 1 345 ? 67.322  10.583  11.784  1.00 18.33 ? 379  PHE A O     1 
ATOM   2280 C  CB    . PHE A 1 345 ? 68.386  13.543  12.345  1.00 18.33 ? 379  PHE A CB    1 
ATOM   2281 C  CG    . PHE A 1 345 ? 68.324  15.044  12.453  1.00 18.34 ? 379  PHE A CG    1 
ATOM   2282 C  CD1   . PHE A 1 345 ? 69.037  15.844  11.569  1.00 19.43 ? 379  PHE A CD1   1 
ATOM   2283 C  CD2   . PHE A 1 345 ? 67.600  15.655  13.473  1.00 17.61 ? 379  PHE A CD2   1 
ATOM   2284 C  CE1   . PHE A 1 345 ? 69.007  17.250  11.677  1.00 19.60 ? 379  PHE A CE1   1 
ATOM   2285 C  CE2   . PHE A 1 345 ? 67.557  17.048  13.592  1.00 18.28 ? 379  PHE A CE2   1 
ATOM   2286 C  CZ    . PHE A 1 345 ? 68.264  17.848  12.692  1.00 19.07 ? 379  PHE A CZ    1 
ATOM   2287 N  N     . ALA A 1 346 ? 68.741  11.201  10.157  1.00 18.71 ? 380  ALA A N     1 
ATOM   2288 C  CA    . ALA A 1 346 ? 69.283  9.864   9.924   1.00 18.79 ? 380  ALA A CA    1 
ATOM   2289 C  C     . ALA A 1 346 ? 70.805  9.945   9.687   1.00 19.00 ? 380  ALA A C     1 
ATOM   2290 O  O     . ALA A 1 346 ? 71.301  10.982  9.265   1.00 18.62 ? 380  ALA A O     1 
ATOM   2291 C  CB    . ALA A 1 346 ? 68.591  9.227   8.746   1.00 18.55 ? 380  ALA A CB    1 
ATOM   2292 N  N     . PRO A 1 347 ? 71.544  8.842   9.929   1.00 19.16 ? 381  PRO A N     1 
ATOM   2293 C  CA    . PRO A 1 347 ? 73.018  8.862   9.947   1.00 19.13 ? 381  PRO A CA    1 
ATOM   2294 C  C     . PRO A 1 347 ? 73.740  9.079   8.618   1.00 19.19 ? 381  PRO A C     1 
ATOM   2295 O  O     . PRO A 1 347 ? 74.870  9.576   8.618   1.00 19.42 ? 381  PRO A O     1 
ATOM   2296 C  CB    . PRO A 1 347 ? 73.384  7.460   10.472  1.00 19.16 ? 381  PRO A CB    1 
ATOM   2297 C  CG    . PRO A 1 347 ? 72.137  6.880   10.990  1.00 19.45 ? 381  PRO A CG    1 
ATOM   2298 C  CD    . PRO A 1 347 ? 71.040  7.483   10.167  1.00 19.12 ? 381  PRO A CD    1 
ATOM   2299 N  N     . THR A 1 348 ? 73.127  8.670   7.510   1.00 19.03 ? 382  THR A N     1 
ATOM   2300 C  CA    . THR A 1 348 ? 73.800  8.687   6.219   1.00 18.82 ? 382  THR A CA    1 
ATOM   2301 C  C     . THR A 1 348 ? 72.902  9.143   5.072   1.00 18.47 ? 382  THR A C     1 
ATOM   2302 O  O     . THR A 1 348 ? 71.684  9.045   5.133   1.00 18.68 ? 382  THR A O     1 
ATOM   2303 C  CB    . THR A 1 348 ? 74.352  7.278   5.870   1.00 19.10 ? 382  THR A CB    1 
ATOM   2304 O  OG1   . THR A 1 348 ? 73.270  6.403   5.514   1.00 18.71 ? 382  THR A OG1   1 
ATOM   2305 C  CG2   . THR A 1 348 ? 75.138  6.693   7.048   1.00 18.27 ? 382  THR A CG2   1 
ATOM   2306 N  N     . VAL A 1 349 ? 73.526  9.616   4.006   1.00 18.38 ? 383  VAL A N     1 
ATOM   2307 C  CA    . VAL A 1 349 ? 72.806  10.038  2.811   1.00 18.02 ? 383  VAL A CA    1 
ATOM   2308 C  C     . VAL A 1 349 ? 71.937  8.924   2.269   1.00 18.56 ? 383  VAL A C     1 
ATOM   2309 O  O     . VAL A 1 349 ? 70.754  9.138   1.980   1.00 18.43 ? 383  VAL A O     1 
ATOM   2310 C  CB    . VAL A 1 349 ? 73.763  10.470  1.720   1.00 17.70 ? 383  VAL A CB    1 
ATOM   2311 C  CG1   . VAL A 1 349 ? 73.003  10.695  0.413   1.00 17.63 ? 383  VAL A CG1   1 
ATOM   2312 C  CG2   . VAL A 1 349 ? 74.516  11.728  2.156   1.00 17.17 ? 383  VAL A CG2   1 
ATOM   2313 N  N     . LYS A 1 350 ? 72.521  7.732   2.135   1.00 19.05 ? 384  LYS A N     1 
ATOM   2314 C  CA    . LYS A 1 350 ? 71.800  6.593   1.580   1.00 19.54 ? 384  LYS A CA    1 
ATOM   2315 C  C     . LYS A 1 350 ? 70.649  6.133   2.463   1.00 19.68 ? 384  LYS A C     1 
ATOM   2316 O  O     . LYS A 1 350 ? 69.591  5.767   1.954   1.00 19.64 ? 384  LYS A O     1 
ATOM   2317 C  CB    . LYS A 1 350 ? 72.745  5.432   1.278   1.00 19.91 ? 384  LYS A CB    1 
ATOM   2318 C  CG    . LYS A 1 350 ? 73.537  5.617   -0.027  1.00 20.80 ? 384  LYS A CG    1 
ATOM   2319 C  CD    . LYS A 1 350 ? 74.387  4.393   -0.338  1.00 22.28 ? 384  LYS A CD    1 
ATOM   2320 C  CE    . LYS A 1 350 ? 75.351  4.637   -1.488  1.00 22.76 ? 384  LYS A CE    1 
ATOM   2321 N  NZ    . LYS A 1 350 ? 76.563  5.355   -1.039  1.00 24.27 ? 384  LYS A NZ    1 
ATOM   2322 N  N     . PHE A 1 351 ? 70.836  6.163   3.777   1.00 20.03 ? 385  PHE A N     1 
ATOM   2323 C  CA    . PHE A 1 351 ? 69.771  5.749   4.677   1.00 20.58 ? 385  PHE A CA    1 
ATOM   2324 C  C     . PHE A 1 351 ? 68.679  6.802   4.749   1.00 20.83 ? 385  PHE A C     1 
ATOM   2325 O  O     . PHE A 1 351 ? 67.500  6.468   4.864   1.00 20.92 ? 385  PHE A O     1 
ATOM   2326 C  CB    . PHE A 1 351 ? 70.297  5.477   6.078   1.00 20.97 ? 385  PHE A CB    1 
ATOM   2327 C  CG    . PHE A 1 351 ? 69.252  4.948   7.008   1.00 21.68 ? 385  PHE A CG    1 
ATOM   2328 C  CD1   . PHE A 1 351 ? 68.761  3.663   6.852   1.00 22.44 ? 385  PHE A CD1   1 
ATOM   2329 C  CD2   . PHE A 1 351 ? 68.747  5.733   8.027   1.00 22.92 ? 385  PHE A CD2   1 
ATOM   2330 C  CE1   . PHE A 1 351 ? 67.789  3.162   7.708   1.00 22.71 ? 385  PHE A CE1   1 
ATOM   2331 C  CE2   . PHE A 1 351 ? 67.774  5.238   8.894   1.00 23.82 ? 385  PHE A CE2   1 
ATOM   2332 C  CZ    . PHE A 1 351 ? 67.294  3.949   8.728   1.00 23.22 ? 385  PHE A CZ    1 
ATOM   2333 N  N     . THR A 1 352 ? 69.082  8.068   4.695   1.00 21.01 ? 386  THR A N     1 
ATOM   2334 C  CA    . THR A 1 352 ? 68.142  9.185   4.630   1.00 21.15 ? 386  THR A CA    1 
ATOM   2335 C  C     . THR A 1 352 ? 67.227  9.030   3.427   1.00 21.32 ? 386  THR A C     1 
ATOM   2336 O  O     . THR A 1 352 ? 66.020  9.166   3.551   1.00 21.28 ? 386  THR A O     1 
ATOM   2337 C  CB    . THR A 1 352 ? 68.878  10.555  4.569   1.00 20.94 ? 386  THR A CB    1 
ATOM   2338 O  OG1   . THR A 1 352 ? 69.523  10.800  5.825   1.00 20.91 ? 386  THR A OG1   1 
ATOM   2339 C  CG2   . THR A 1 352 ? 67.898  11.685  4.289   1.00 20.40 ? 386  THR A CG2   1 
ATOM   2340 N  N     . SER A 1 353 ? 67.814  8.723   2.273   1.00 21.99 ? 387  SER A N     1 
ATOM   2341 C  CA    . SER A 1 353 ? 67.070  8.536   1.024   1.00 22.45 ? 387  SER A CA    1 
ATOM   2342 C  C     . SER A 1 353 ? 66.061  7.395   1.149   1.00 23.08 ? 387  SER A C     1 
ATOM   2343 O  O     . SER A 1 353 ? 64.893  7.532   0.781   1.00 23.22 ? 387  SER A O     1 
ATOM   2344 C  CB    . SER A 1 353 ? 68.049  8.240   -0.117  1.00 22.45 ? 387  SER A CB    1 
ATOM   2345 O  OG    . SER A 1 353 ? 67.618  8.818   -1.322  1.00 22.57 ? 387  SER A OG    1 
ATOM   2346 N  N     . PHE A 1 354 ? 66.533  6.271   1.679   1.00 24.02 ? 388  PHE A N     1 
ATOM   2347 C  CA    . PHE A 1 354 ? 65.692  5.117   1.995   1.00 24.53 ? 388  PHE A CA    1 
ATOM   2348 C  C     . PHE A 1 354 ? 64.566  5.492   2.954   1.00 24.81 ? 388  PHE A C     1 
ATOM   2349 O  O     . PHE A 1 354 ? 63.425  5.066   2.782   1.00 24.82 ? 388  PHE A O     1 
ATOM   2350 C  CB    . PHE A 1 354 ? 66.564  4.020   2.621   1.00 24.63 ? 388  PHE A CB    1 
ATOM   2351 C  CG    . PHE A 1 354 ? 65.812  2.772   3.017   1.00 25.24 ? 388  PHE A CG    1 
ATOM   2352 C  CD1   . PHE A 1 354 ? 65.160  2.000   2.060   1.00 26.49 ? 388  PHE A CD1   1 
ATOM   2353 C  CD2   . PHE A 1 354 ? 65.794  2.349   4.340   1.00 26.25 ? 388  PHE A CD2   1 
ATOM   2354 C  CE1   . PHE A 1 354 ? 64.481  0.836   2.419   1.00 26.91 ? 388  PHE A CE1   1 
ATOM   2355 C  CE2   . PHE A 1 354 ? 65.121  1.182   4.712   1.00 26.82 ? 388  PHE A CE2   1 
ATOM   2356 C  CZ    . PHE A 1 354 ? 64.464  0.427   3.753   1.00 27.42 ? 388  PHE A CZ    1 
ATOM   2357 N  N     . LEU A 1 355 ? 64.889  6.281   3.973   1.00 25.31 ? 389  LEU A N     1 
ATOM   2358 C  CA    . LEU A 1 355 ? 63.898  6.669   4.976   1.00 25.81 ? 389  LEU A CA    1 
ATOM   2359 C  C     . LEU A 1 355 ? 62.777  7.499   4.330   1.00 26.27 ? 389  LEU A C     1 
ATOM   2360 O  O     . LEU A 1 355 ? 61.604  7.343   4.673   1.00 26.46 ? 389  LEU A O     1 
ATOM   2361 C  CB    . LEU A 1 355 ? 64.565  7.434   6.111   1.00 25.53 ? 389  LEU A CB    1 
ATOM   2362 C  CG    . LEU A 1 355 ? 63.776  7.621   7.401   1.00 26.54 ? 389  LEU A CG    1 
ATOM   2363 C  CD1   . LEU A 1 355 ? 63.282  6.290   7.970   1.00 26.50 ? 389  LEU A CD1   1 
ATOM   2364 C  CD2   . LEU A 1 355 ? 64.647  8.360   8.431   1.00 26.59 ? 389  LEU A CD2   1 
ATOM   2365 N  N     . CYS A 1 356 ? 63.140  8.358   3.384   1.00 26.55 ? 390  CYS A N     1 
ATOM   2366 C  CA    . CYS A 1 356 ? 62.154  9.144   2.651   1.00 27.37 ? 390  CYS A CA    1 
ATOM   2367 C  C     . CYS A 1 356 ? 61.186  8.292   1.859   1.00 26.98 ? 390  CYS A C     1 
ATOM   2368 O  O     . CYS A 1 356 ? 59.990  8.579   1.857   1.00 27.03 ? 390  CYS A O     1 
ATOM   2369 C  CB    . CYS A 1 356 ? 62.829  10.120  1.689   1.00 27.58 ? 390  CYS A CB    1 
ATOM   2370 S  SG    . CYS A 1 356 ? 63.343  11.590  2.512   1.00 31.03 ? 390  CYS A SG    1 
ATOM   2371 N  N     . SER A 1 357 ? 61.711  7.289   1.151   1.00 26.61 ? 391  SER A N     1 
ATOM   2372 C  CA    . SER A 1 357 ? 60.865  6.309   0.457   1.00 26.43 ? 391  SER A CA    1 
ATOM   2373 C  C     . SER A 1 357 ? 59.797  5.738   1.380   1.00 25.81 ? 391  SER A C     1 
ATOM   2374 O  O     . SER A 1 357 ? 58.622  5.751   1.036   1.00 25.71 ? 391  SER A O     1 
ATOM   2375 C  CB    . SER A 1 357 ? 61.692  5.173   -0.155  1.00 26.57 ? 391  SER A CB    1 
ATOM   2376 O  OG    . SER A 1 357 ? 62.087  5.500   -1.486  1.00 27.57 ? 391  SER A OG    1 
ATOM   2377 N  N     . ILE A 1 358 ? 60.207  5.258   2.551   1.00 25.39 ? 392  ILE A N     1 
ATOM   2378 C  CA    . ILE A 1 358 ? 59.272  4.708   3.525   1.00 25.12 ? 392  ILE A CA    1 
ATOM   2379 C  C     . ILE A 1 358 ? 58.229  5.759   3.885   1.00 25.21 ? 392  ILE A C     1 
ATOM   2380 O  O     . ILE A 1 358 ? 57.029  5.516   3.762   1.00 24.89 ? 392  ILE A O     1 
ATOM   2381 C  CB    . ILE A 1 358 ? 59.988  4.248   4.828   1.00 25.00 ? 392  ILE A CB    1 
ATOM   2382 C  CG1   . ILE A 1 358 ? 60.842  3.008   4.572   1.00 25.54 ? 392  ILE A CG1   1 
ATOM   2383 C  CG2   . ILE A 1 358 ? 58.987  3.934   5.931   1.00 24.00 ? 392  ILE A CG2   1 
ATOM   2384 C  CD1   . ILE A 1 358 ? 61.667  2.587   5.785   1.00 25.41 ? 392  ILE A CD1   1 
ATOM   2385 N  N     . LEU A 1 359 ? 58.700  6.927   4.326   1.00 25.50 ? 393  LEU A N     1 
ATOM   2386 C  CA    . LEU A 1 359 ? 57.822  7.967   4.854   1.00 25.38 ? 393  LEU A CA    1 
ATOM   2387 C  C     . LEU A 1 359 ? 56.903  8.518   3.766   1.00 25.34 ? 393  LEU A C     1 
ATOM   2388 O  O     . LEU A 1 359 ? 55.757  8.824   4.043   1.00 25.32 ? 393  LEU A O     1 
ATOM   2389 C  CB    . LEU A 1 359 ? 58.629  9.090   5.514   1.00 25.39 ? 393  LEU A CB    1 
ATOM   2390 C  CG    . LEU A 1 359 ? 59.430  8.722   6.767   1.00 25.94 ? 393  LEU A CG    1 
ATOM   2391 C  CD1   . LEU A 1 359 ? 60.234  9.918   7.267   1.00 25.60 ? 393  LEU A CD1   1 
ATOM   2392 C  CD2   . LEU A 1 359 ? 58.524  8.202   7.879   1.00 26.29 ? 393  LEU A CD2   1 
ATOM   2393 N  N     . LYS A 1 360 ? 57.397  8.627   2.536   1.00 25.59 ? 394  LYS A N     1 
ATOM   2394 C  CA    . LYS A 1 360 ? 56.545  8.987   1.400   1.00 25.92 ? 394  LYS A CA    1 
ATOM   2395 C  C     . LYS A 1 360 ? 55.402  7.989   1.276   1.00 26.14 ? 394  LYS A C     1 
ATOM   2396 O  O     . LYS A 1 360 ? 54.235  8.365   1.332   1.00 26.10 ? 394  LYS A O     1 
ATOM   2397 C  CB    . LYS A 1 360 ? 57.344  9.064   0.091   1.00 26.02 ? 394  LYS A CB    1 
ATOM   2398 C  CG    . LYS A 1 360 ? 58.050  10.418  -0.120  1.00 27.56 ? 394  LYS A CG    1 
ATOM   2399 C  CD    . LYS A 1 360 ? 59.185  10.359  -1.169  1.00 29.22 ? 394  LYS A CD    1 
ATOM   2400 C  CE    . LYS A 1 360 ? 59.844  11.745  -1.373  1.00 30.06 ? 394  LYS A CE    1 
ATOM   2401 N  NZ    . LYS A 1 360 ? 61.338  11.704  -1.606  1.00 30.04 ? 394  LYS A NZ    1 
ATOM   2402 N  N     . ASN A 1 361 ? 55.740  6.709   1.150   1.00 26.38 ? 395  ASN A N     1 
ATOM   2403 C  CA    . ASN A 1 361 ? 54.730  5.663   1.013   1.00 26.53 ? 395  ASN A CA    1 
ATOM   2404 C  C     . ASN A 1 361 ? 53.680  5.685   2.118   1.00 26.21 ? 395  ASN A C     1 
ATOM   2405 O  O     . ASN A 1 361 ? 52.486  5.548   1.846   1.00 26.26 ? 395  ASN A O     1 
ATOM   2406 C  CB    . ASN A 1 361 ? 55.391  4.286   0.946   1.00 26.81 ? 395  ASN A CB    1 
ATOM   2407 C  CG    . ASN A 1 361 ? 56.187  4.093   -0.327  1.00 27.97 ? 395  ASN A CG    1 
ATOM   2408 O  OD1   . ASN A 1 361 ? 55.859  4.673   -1.370  1.00 29.65 ? 395  ASN A OD1   1 
ATOM   2409 N  ND2   . ASN A 1 361 ? 57.245  3.286   -0.251  1.00 28.73 ? 395  ASN A ND2   1 
ATOM   2410 N  N     . GLU A 1 362 ? 54.123  5.871   3.356   1.00 25.79 ? 396  GLU A N     1 
ATOM   2411 C  CA    . GLU A 1 362 ? 53.209  5.916   4.491   1.00 25.54 ? 396  GLU A CA    1 
ATOM   2412 C  C     . GLU A 1 362 ? 52.431  7.232   4.589   1.00 24.92 ? 396  GLU A C     1 
ATOM   2413 O  O     . GLU A 1 362 ? 51.244  7.221   4.877   1.00 24.76 ? 396  GLU A O     1 
ATOM   2414 C  CB    . GLU A 1 362 ? 53.975  5.685   5.800   1.00 25.73 ? 396  GLU A CB    1 
ATOM   2415 C  CG    . GLU A 1 362 ? 54.442  4.238   6.009   1.00 26.83 ? 396  GLU A CG    1 
ATOM   2416 C  CD    . GLU A 1 362 ? 53.353  3.317   6.549   1.00 27.67 ? 396  GLU A CD    1 
ATOM   2417 O  OE1   . GLU A 1 362 ? 52.196  3.755   6.696   1.00 28.34 ? 396  GLU A OE1   1 
ATOM   2418 O  OE2   . GLU A 1 362 ? 53.661  2.144   6.837   1.00 29.01 ? 396  GLU A OE2   1 
ATOM   2419 N  N     . PHE A 1 363 ? 53.097  8.358   4.347   1.00 24.44 ? 397  PHE A N     1 
ATOM   2420 C  CA    . PHE A 1 363 ? 52.602  9.653   4.831   1.00 23.96 ? 397  PHE A CA    1 
ATOM   2421 C  C     . PHE A 1 363 ? 52.412  10.769  3.807   1.00 24.15 ? 397  PHE A C     1 
ATOM   2422 O  O     . PHE A 1 363 ? 51.895  11.828  4.156   1.00 23.80 ? 397  PHE A O     1 
ATOM   2423 C  CB    . PHE A 1 363 ? 53.527  10.158  5.936   1.00 23.69 ? 397  PHE A CB    1 
ATOM   2424 C  CG    . PHE A 1 363 ? 53.603  9.249   7.122   1.00 22.00 ? 397  PHE A CG    1 
ATOM   2425 C  CD1   . PHE A 1 363 ? 52.458  8.917   7.828   1.00 21.39 ? 397  PHE A CD1   1 
ATOM   2426 C  CD2   . PHE A 1 363 ? 54.820  8.731   7.545   1.00 20.69 ? 397  PHE A CD2   1 
ATOM   2427 C  CE1   . PHE A 1 363 ? 52.524  8.082   8.948   1.00 21.07 ? 397  PHE A CE1   1 
ATOM   2428 C  CE2   . PHE A 1 363 ? 54.892  7.899   8.660   1.00 19.82 ? 397  PHE A CE2   1 
ATOM   2429 C  CZ    . PHE A 1 363 ? 53.743  7.573   9.356   1.00 19.88 ? 397  PHE A CZ    1 
ATOM   2430 N  N     . LYS A 1 364 ? 52.797  10.542  2.555   1.00 24.57 ? 398  LYS A N     1 
ATOM   2431 C  CA    . LYS A 1 364 ? 52.691  11.574  1.539   1.00 25.18 ? 398  LYS A CA    1 
ATOM   2432 C  C     . LYS A 1 364 ? 51.252  12.088  1.415   1.00 25.53 ? 398  LYS A C     1 
ATOM   2433 O  O     . LYS A 1 364 ? 51.033  13.282  1.175   1.00 25.87 ? 398  LYS A O     1 
ATOM   2434 C  CB    . LYS A 1 364 ? 53.199  11.063  0.191   1.00 25.42 ? 398  LYS A CB    1 
ATOM   2435 C  CG    . LYS A 1 364 ? 53.433  12.156  -0.847  1.00 26.96 ? 398  LYS A CG    1 
ATOM   2436 C  CD    . LYS A 1 364 ? 53.739  11.542  -2.222  1.00 28.55 ? 398  LYS A CD    1 
ATOM   2437 C  CE    . LYS A 1 364 ? 53.531  12.544  -3.350  1.00 29.27 ? 398  LYS A CE    1 
ATOM   2438 N  NZ    . LYS A 1 364 ? 54.656  13.509  -3.464  1.00 29.13 ? 398  LYS A NZ    1 
ATOM   2439 N  N     . LYS A 1 365 ? 50.278  11.194  1.589   1.00 25.67 ? 399  LYS A N     1 
ATOM   2440 C  CA    . LYS A 1 365 ? 48.864  11.568  1.524   1.00 25.65 ? 399  LYS A CA    1 
ATOM   2441 C  C     . LYS A 1 365 ? 48.446  12.493  2.667   1.00 25.55 ? 399  LYS A C     1 
ATOM   2442 O  O     . LYS A 1 365 ? 47.486  13.240  2.526   1.00 25.84 ? 399  LYS A O     1 
ATOM   2443 C  CB    . LYS A 1 365 ? 47.969  10.320  1.508   1.00 25.89 ? 399  LYS A CB    1 
ATOM   2444 C  CG    . LYS A 1 365 ? 47.978  9.504   2.807   1.00 27.00 ? 399  LYS A CG    1 
ATOM   2445 C  CD    . LYS A 1 365 ? 46.962  8.367   2.772   1.00 28.10 ? 399  LYS A CD    1 
ATOM   2446 C  CE    . LYS A 1 365 ? 47.259  7.315   3.848   1.00 28.68 ? 399  LYS A CE    1 
ATOM   2447 N  NZ    . LYS A 1 365 ? 47.170  7.866   5.232   1.00 28.80 ? 399  LYS A NZ    1 
ATOM   2448 N  N     . ASP A 1 366 ? 49.152  12.431  3.796   1.00 25.44 ? 400  ASP A N     1 
ATOM   2449 C  CA    . ASP A 1 366 ? 48.870  13.296  4.949   1.00 25.39 ? 400  ASP A CA    1 
ATOM   2450 C  C     . ASP A 1 366 ? 49.716  14.569  4.958   1.00 25.06 ? 400  ASP A C     1 
ATOM   2451 O  O     . ASP A 1 366 ? 49.303  15.578  5.516   1.00 25.65 ? 400  ASP A O     1 
ATOM   2452 C  CB    . ASP A 1 366 ? 49.130  12.553  6.266   1.00 25.54 ? 400  ASP A CB    1 
ATOM   2453 C  CG    . ASP A 1 366 ? 48.284  11.297  6.422   1.00 26.41 ? 400  ASP A CG    1 
ATOM   2454 O  OD1   . ASP A 1 366 ? 47.056  11.412  6.611   1.00 26.72 ? 400  ASP A OD1   1 
ATOM   2455 O  OD2   . ASP A 1 366 ? 48.856  10.187  6.380   1.00 28.86 ? 400  ASP A OD2   1 
ATOM   2456 N  N     . LEU A 1 367 ? 50.899  14.519  4.354   1.00 24.60 ? 401  LEU A N     1 
ATOM   2457 C  CA    . LEU A 1 367 ? 51.909  15.557  4.548   1.00 23.98 ? 401  LEU A CA    1 
ATOM   2458 C  C     . LEU A 1 367 ? 52.978  15.551  3.459   1.00 23.52 ? 401  LEU A C     1 
ATOM   2459 O  O     . LEU A 1 367 ? 53.262  14.507  2.866   1.00 23.21 ? 401  LEU A O     1 
ATOM   2460 C  CB    . LEU A 1 367 ? 52.633  15.317  5.867   1.00 24.03 ? 401  LEU A CB    1 
ATOM   2461 C  CG    . LEU A 1 367 ? 52.010  15.774  7.173   1.00 24.11 ? 401  LEU A CG    1 
ATOM   2462 C  CD1   . LEU A 1 367 ? 52.979  15.496  8.302   1.00 22.77 ? 401  LEU A CD1   1 
ATOM   2463 C  CD2   . LEU A 1 367 ? 51.670  17.256  7.091   1.00 24.59 ? 401  LEU A CD2   1 
ATOM   2464 N  N     . PRO A 1 368 ? 53.611  16.713  3.223   1.00 22.75 ? 402  PRO A N     1 
ATOM   2465 C  CA    . PRO A 1 368 ? 54.792  16.706  2.371   1.00 22.21 ? 402  PRO A CA    1 
ATOM   2466 C  C     . PRO A 1 368 ? 55.999  16.109  3.095   1.00 21.88 ? 402  PRO A C     1 
ATOM   2467 O  O     . PRO A 1 368 ? 56.182  16.329  4.302   1.00 21.93 ? 402  PRO A O     1 
ATOM   2468 C  CB    . PRO A 1 368 ? 55.001  18.184  2.025   1.00 22.11 ? 402  PRO A CB    1 
ATOM   2469 C  CG    . PRO A 1 368 ? 54.269  18.943  3.033   1.00 22.32 ? 402  PRO A CG    1 
ATOM   2470 C  CD    . PRO A 1 368 ? 53.185  18.077  3.581   1.00 22.72 ? 402  PRO A CD    1 
ATOM   2471 N  N     . ILE A 1 369 ? 56.784  15.329  2.356   1.00 21.28 ? 403  ILE A N     1 
ATOM   2472 C  CA    . ILE A 1 369 ? 57.997  14.705  2.863   1.00 20.95 ? 403  ILE A CA    1 
ATOM   2473 C  C     . ILE A 1 369 ? 59.160  15.254  2.043   1.00 20.61 ? 403  ILE A C     1 
ATOM   2474 O  O     . ILE A 1 369 ? 59.235  15.015  0.834   1.00 20.65 ? 403  ILE A O     1 
ATOM   2475 C  CB    . ILE A 1 369 ? 57.955  13.149  2.716   1.00 20.91 ? 403  ILE A CB    1 
ATOM   2476 C  CG1   . ILE A 1 369 ? 56.670  12.570  3.305   1.00 20.71 ? 403  ILE A CG1   1 
ATOM   2477 C  CG2   . ILE A 1 369 ? 59.161  12.513  3.384   1.00 20.39 ? 403  ILE A CG2   1 
ATOM   2478 C  CD1   . ILE A 1 369 ? 56.518  12.805  4.793   1.00 21.79 ? 403  ILE A CD1   1 
ATOM   2479 N  N     . LEU A 1 370 ? 60.062  15.983  2.692   1.00 20.41 ? 404  LEU A N     1 
ATOM   2480 C  CA    . LEU A 1 370 ? 61.195  16.607  1.997   1.00 20.26 ? 404  LEU A CA    1 
ATOM   2481 C  C     . LEU A 1 370 ? 62.517  15.880  2.294   1.00 19.89 ? 404  LEU A C     1 
ATOM   2482 O  O     . LEU A 1 370 ? 62.821  15.574  3.444   1.00 19.35 ? 404  LEU A O     1 
ATOM   2483 C  CB    . LEU A 1 370 ? 61.298  18.086  2.385   1.00 20.27 ? 404  LEU A CB    1 
ATOM   2484 C  CG    . LEU A 1 370 ? 60.027  18.933  2.211   1.00 20.88 ? 404  LEU A CG    1 
ATOM   2485 C  CD1   . LEU A 1 370 ? 60.201  20.333  2.838   1.00 21.74 ? 404  LEU A CD1   1 
ATOM   2486 C  CD2   . LEU A 1 370 ? 59.647  19.044  0.743   1.00 20.95 ? 404  LEU A CD2   1 
ATOM   2487 N  N     . GLU A 1 371 ? 63.291  15.607  1.246   1.00 19.74 ? 405  GLU A N     1 
ATOM   2488 C  CA    . GLU A 1 371 ? 64.589  14.929  1.376   1.00 19.86 ? 405  GLU A CA    1 
ATOM   2489 C  C     . GLU A 1 371 ? 65.746  15.946  1.323   1.00 19.41 ? 405  GLU A C     1 
ATOM   2490 O  O     . GLU A 1 371 ? 65.961  16.599  0.318   1.00 19.91 ? 405  GLU A O     1 
ATOM   2491 C  CB    . GLU A 1 371 ? 64.732  13.888  0.269   1.00 19.89 ? 405  GLU A CB    1 
ATOM   2492 C  CG    . GLU A 1 371 ? 65.897  12.921  0.425   1.00 21.39 ? 405  GLU A CG    1 
ATOM   2493 C  CD    . GLU A 1 371 ? 66.131  12.079  -0.820  1.00 23.31 ? 405  GLU A CD    1 
ATOM   2494 O  OE1   . GLU A 1 371 ? 65.192  11.928  -1.622  1.00 25.09 ? 405  GLU A OE1   1 
ATOM   2495 O  OE2   . GLU A 1 371 ? 67.259  11.568  -0.999  1.00 26.21 ? 405  GLU A OE2   1 
ATOM   2496 N  N     . PHE A 1 372 ? 66.489  16.063  2.412   1.00 19.09 ? 406  PHE A N     1 
ATOM   2497 C  CA    . PHE A 1 372 ? 67.512  17.094  2.567   1.00 18.64 ? 406  PHE A CA    1 
ATOM   2498 C  C     . PHE A 1 372 ? 68.856  16.458  2.959   1.00 18.14 ? 406  PHE A C     1 
ATOM   2499 O  O     . PHE A 1 372 ? 69.005  15.950  4.055   1.00 17.38 ? 406  PHE A O     1 
ATOM   2500 C  CB    . PHE A 1 372 ? 67.012  18.068  3.642   1.00 18.55 ? 406  PHE A CB    1 
ATOM   2501 C  CG    . PHE A 1 372 ? 67.942  19.223  3.958   1.00 19.11 ? 406  PHE A CG    1 
ATOM   2502 C  CD1   . PHE A 1 372 ? 68.588  19.930  2.963   1.00 19.80 ? 406  PHE A CD1   1 
ATOM   2503 C  CD2   . PHE A 1 372 ? 68.102  19.646  5.277   1.00 19.56 ? 406  PHE A CD2   1 
ATOM   2504 C  CE1   . PHE A 1 372 ? 69.414  21.006  3.281   1.00 20.60 ? 406  PHE A CE1   1 
ATOM   2505 C  CE2   . PHE A 1 372 ? 68.909  20.724  5.593   1.00 19.59 ? 406  PHE A CE2   1 
ATOM   2506 C  CZ    . PHE A 1 372 ? 69.564  21.405  4.600   1.00 20.54 ? 406  PHE A CZ    1 
ATOM   2507 N  N     . HIS A 1 373 ? 69.819  16.467  2.041   1.00 18.10 ? 407  HIS A N     1 
ATOM   2508 C  CA    . HIS A 1 373 ? 71.184  16.035  2.353   1.00 17.86 ? 407  HIS A CA    1 
ATOM   2509 C  C     . HIS A 1 373 ? 72.161  16.560  1.325   1.00 18.14 ? 407  HIS A C     1 
ATOM   2510 O  O     . HIS A 1 373 ? 71.761  17.160  0.324   1.00 18.18 ? 407  HIS A O     1 
ATOM   2511 C  CB    . HIS A 1 373 ? 71.279  14.510  2.444   1.00 18.08 ? 407  HIS A CB    1 
ATOM   2512 C  CG    . HIS A 1 373 ? 70.714  13.799  1.262   1.00 16.92 ? 407  HIS A CG    1 
ATOM   2513 N  ND1   . HIS A 1 373 ? 71.323  13.813  0.027   1.00 16.31 ? 407  HIS A ND1   1 
ATOM   2514 C  CD2   . HIS A 1 373 ? 69.594  13.056  1.122   1.00 16.85 ? 407  HIS A CD2   1 
ATOM   2515 C  CE1   . HIS A 1 373 ? 70.599  13.111  -0.826  1.00 16.39 ? 407  HIS A CE1   1 
ATOM   2516 N  NE2   . HIS A 1 373 ? 69.542  12.645  -0.188  1.00 17.27 ? 407  HIS A NE2   1 
ATOM   2517 N  N     . GLY A 1 374 ? 73.445  16.319  1.573   1.00 18.36 ? 408  GLY A N     1 
ATOM   2518 C  CA    . GLY A 1 374 ? 74.518  16.859  0.744   1.00 18.34 ? 408  GLY A CA    1 
ATOM   2519 C  C     . GLY A 1 374 ? 74.603  16.350  -0.675  1.00 18.72 ? 408  GLY A C     1 
ATOM   2520 O  O     . GLY A 1 374 ? 75.380  16.880  -1.453  1.00 19.27 ? 408  GLY A O     1 
ATOM   2521 N  N     . LYS A 1 375 ? 73.848  15.313  -1.027  1.00 19.28 ? 409  LYS A N     1 
ATOM   2522 C  CA    . LYS A 1 375 ? 73.792  14.849  -2.422  1.00 19.78 ? 409  LYS A CA    1 
ATOM   2523 C  C     . LYS A 1 375 ? 72.556  15.370  -3.162  1.00 19.97 ? 409  LYS A C     1 
ATOM   2524 O  O     . LYS A 1 375 ? 72.399  15.111  -4.343  1.00 20.52 ? 409  LYS A O     1 
ATOM   2525 C  CB    . LYS A 1 375 ? 73.862  13.318  -2.516  1.00 19.96 ? 409  LYS A CB    1 
ATOM   2526 C  CG    . LYS A 1 375 ? 75.188  12.713  -2.039  1.00 20.62 ? 409  LYS A CG    1 
ATOM   2527 C  CD    . LYS A 1 375 ? 76.360  13.039  -2.967  1.00 20.35 ? 409  LYS A CD    1 
ATOM   2528 N  N     . ILE A 1 376 ? 71.685  16.104  -2.479  1.00 20.14 ? 410  ILE A N     1 
ATOM   2529 C  CA    . ILE A 1 376 ? 70.655  16.875  -3.161  1.00 20.28 ? 410  ILE A CA    1 
ATOM   2530 C  C     . ILE A 1 376 ? 71.353  18.074  -3.786  1.00 20.33 ? 410  ILE A C     1 
ATOM   2531 O  O     . ILE A 1 376 ? 72.119  18.751  -3.105  1.00 20.36 ? 410  ILE A O     1 
ATOM   2532 C  CB    . ILE A 1 376 ? 69.565  17.373  -2.180  1.00 20.60 ? 410  ILE A CB    1 
ATOM   2533 C  CG1   . ILE A 1 376 ? 68.818  16.182  -1.560  1.00 21.06 ? 410  ILE A CG1   1 
ATOM   2534 C  CG2   . ILE A 1 376 ? 68.595  18.299  -2.888  1.00 20.26 ? 410  ILE A CG2   1 
ATOM   2535 C  CD1   . ILE A 1 376 ? 68.169  15.254  -2.599  1.00 20.95 ? 410  ILE A CD1   1 
ATOM   2536 N  N     . THR A 1 377 ? 71.108  18.326  -5.071  1.00 20.25 ? 411  THR A N     1 
ATOM   2537 C  CA    . THR A 1 377 ? 71.732  19.462  -5.757  1.00 20.38 ? 411  THR A CA    1 
ATOM   2538 C  C     . THR A 1 377 ? 71.417  20.745  -5.018  1.00 19.94 ? 411  THR A C     1 
ATOM   2539 O  O     . THR A 1 377 ? 70.372  20.860  -4.379  1.00 19.78 ? 411  THR A O     1 
ATOM   2540 C  CB    . THR A 1 377 ? 71.240  19.653  -7.212  1.00 20.24 ? 411  THR A CB    1 
ATOM   2541 O  OG1   . THR A 1 377 ? 69.866  20.063  -7.199  1.00 21.62 ? 411  THR A OG1   1 
ATOM   2542 C  CG2   . THR A 1 377 ? 71.396  18.375  -8.035  1.00 21.14 ? 411  THR A CG2   1 
ATOM   2543 N  N     . GLN A 1 378 ? 72.313  21.713  -5.150  1.00 19.88 ? 412  GLN A N     1 
ATOM   2544 C  CA    . GLN A 1 378 ? 72.248  22.958  -4.395  1.00 20.03 ? 412  GLN A CA    1 
ATOM   2545 C  C     . GLN A 1 378 ? 71.007  23.807  -4.672  1.00 20.38 ? 412  GLN A C     1 
ATOM   2546 O  O     . GLN A 1 378 ? 70.491  24.462  -3.769  1.00 20.75 ? 412  GLN A O     1 
ATOM   2547 C  CB    . GLN A 1 378 ? 73.515  23.794  -4.629  1.00 19.69 ? 412  GLN A CB    1 
ATOM   2548 C  CG    . GLN A 1 378 ? 73.668  24.935  -3.648  1.00 19.78 ? 412  GLN A CG    1 
ATOM   2549 C  CD    . GLN A 1 378 ? 73.533  24.464  -2.215  1.00 19.03 ? 412  GLN A CD    1 
ATOM   2550 O  OE1   . GLN A 1 378 ? 74.116  23.449  -1.831  1.00 18.45 ? 412  GLN A OE1   1 
ATOM   2551 N  NE2   . GLN A 1 378 ? 72.729  25.166  -1.433  1.00 18.22 ? 412  GLN A NE2   1 
ATOM   2552 N  N     . ASN A 1 379 ? 70.536  23.812  -5.911  1.00 21.07 ? 413  ASN A N     1 
ATOM   2553 C  CA    . ASN A 1 379 ? 69.281  24.488  -6.233  1.00 21.35 ? 413  ASN A CA    1 
ATOM   2554 C  C     . ASN A 1 379 ? 68.114  23.976  -5.396  1.00 21.11 ? 413  ASN A C     1 
ATOM   2555 O  O     . ASN A 1 379 ? 67.339  24.777  -4.881  1.00 21.57 ? 413  ASN A O     1 
ATOM   2556 C  CB    . ASN A 1 379 ? 68.946  24.337  -7.720  1.00 21.61 ? 413  ASN A CB    1 
ATOM   2557 C  CG    . ASN A 1 379 ? 69.711  25.313  -8.595  1.00 22.84 ? 413  ASN A CG    1 
ATOM   2558 O  OD1   . ASN A 1 379 ? 70.207  26.339  -8.121  1.00 23.86 ? 413  ASN A OD1   1 
ATOM   2559 N  ND2   . ASN A 1 379 ? 69.802  25.003  -9.885  1.00 24.46 ? 413  ASN A ND2   1 
ATOM   2560 N  N     . LYS A 1 380 ? 68.002  22.654  -5.258  1.00 20.78 ? 414  LYS A N     1 
ATOM   2561 C  CA    . LYS A 1 380 ? 66.879  22.036  -4.550  1.00 20.64 ? 414  LYS A CA    1 
ATOM   2562 C  C     . LYS A 1 380 ? 67.013  22.175  -3.050  1.00 19.97 ? 414  LYS A C     1 
ATOM   2563 O  O     . LYS A 1 380 ? 66.024  22.390  -2.358  1.00 19.86 ? 414  LYS A O     1 
ATOM   2564 C  CB    . LYS A 1 380 ? 66.725  20.560  -4.934  1.00 21.21 ? 414  LYS A CB    1 
ATOM   2565 C  CG    . LYS A 1 380 ? 66.556  20.361  -6.444  1.00 22.75 ? 414  LYS A CG    1 
ATOM   2566 C  CD    . LYS A 1 380 ? 65.659  19.177  -6.809  1.00 25.08 ? 414  LYS A CD    1 
ATOM   2567 C  CE    . LYS A 1 380 ? 65.395  19.150  -8.329  1.00 26.19 ? 414  LYS A CE    1 
ATOM   2568 N  NZ    . LYS A 1 380 ? 64.903  20.478  -8.849  1.00 26.43 ? 414  LYS A NZ    1 
ATOM   2569 N  N     . ARG A 1 381 ? 68.238  22.061  -2.555  1.00 19.50 ? 415  ARG A N     1 
ATOM   2570 C  CA    . ARG A 1 381 ? 68.532  22.335  -1.152  1.00 19.35 ? 415  ARG A CA    1 
ATOM   2571 C  C     . ARG A 1 381 ? 68.012  23.716  -0.720  1.00 18.77 ? 415  ARG A C     1 
ATOM   2572 O  O     . ARG A 1 381 ? 67.368  23.847  0.328   1.00 18.24 ? 415  ARG A O     1 
ATOM   2573 C  CB    . ARG A 1 381 ? 70.038  22.240  -0.898  1.00 19.59 ? 415  ARG A CB    1 
ATOM   2574 C  CG    . ARG A 1 381 ? 70.598  20.815  -0.923  1.00 19.69 ? 415  ARG A CG    1 
ATOM   2575 C  CD    . ARG A 1 381 ? 72.129  20.782  -0.796  1.00 19.44 ? 415  ARG A CD    1 
ATOM   2576 N  NE    . ARG A 1 381 ? 72.641  21.362  0.451   1.00 17.94 ? 415  ARG A NE    1 
ATOM   2577 C  CZ    . ARG A 1 381 ? 73.920  21.316  0.836   1.00 17.73 ? 415  ARG A CZ    1 
ATOM   2578 N  NH1   . ARG A 1 381 ? 74.834  20.711  0.084   1.00 16.92 ? 415  ARG A NH1   1 
ATOM   2579 N  NH2   . ARG A 1 381 ? 74.292  21.865  1.993   1.00 17.98 ? 415  ARG A NH2   1 
ATOM   2580 N  N     . THR A 1 382 ? 68.273  24.729  -1.548  1.00 18.28 ? 416  THR A N     1 
ATOM   2581 C  CA    . THR A 1 382 ? 67.854  26.099  -1.252  1.00 17.84 ? 416  THR A CA    1 
ATOM   2582 C  C     . THR A 1 382 ? 66.335  26.236  -1.289  1.00 17.78 ? 416  THR A C     1 
ATOM   2583 O  O     . THR A 1 382 ? 65.746  26.815  -0.391  1.00 17.26 ? 416  THR A O     1 
ATOM   2584 C  CB    . THR A 1 382 ? 68.482  27.119  -2.244  1.00 17.99 ? 416  THR A CB    1 
ATOM   2585 O  OG1   . THR A 1 382 ? 69.911  27.022  -2.194  1.00 17.27 ? 416  THR A OG1   1 
ATOM   2586 C  CG2   . THR A 1 382 ? 68.049  28.551  -1.914  1.00 15.94 ? 416  THR A CG2   1 
ATOM   2587 N  N     . SER A 1 383 ? 65.707  25.701  -2.329  1.00 17.98 ? 417  SER A N     1 
ATOM   2588 C  CA    . SER A 1 383 ? 64.265  25.846  -2.489  1.00 18.66 ? 417  SER A CA    1 
ATOM   2589 C  C     . SER A 1 383 ? 63.483  25.105  -1.415  1.00 18.88 ? 417  SER A C     1 
ATOM   2590 O  O     . SER A 1 383 ? 62.490  25.623  -0.909  1.00 19.50 ? 417  SER A O     1 
ATOM   2591 C  CB    . SER A 1 383 ? 63.827  25.372  -3.864  1.00 18.52 ? 417  SER A CB    1 
ATOM   2592 O  OG    . SER A 1 383 ? 64.330  24.082  -4.096  1.00 20.72 ? 417  SER A OG    1 
ATOM   2593 N  N     . LEU A 1 384 ? 63.931  23.911  -1.050  1.00 19.13 ? 418  LEU A N     1 
ATOM   2594 C  CA    . LEU A 1 384 ? 63.236  23.145  -0.031  1.00 19.63 ? 418  LEU A CA    1 
ATOM   2595 C  C     . LEU A 1 384 ? 63.449  23.704  1.370   1.00 19.74 ? 418  LEU A C     1 
ATOM   2596 O  O     . LEU A 1 384 ? 62.590  23.557  2.226   1.00 19.61 ? 418  LEU A O     1 
ATOM   2597 C  CB    . LEU A 1 384 ? 63.591  21.650  -0.115  1.00 19.72 ? 418  LEU A CB    1 
ATOM   2598 C  CG    . LEU A 1 384 ? 64.942  21.133  0.356   1.00 20.05 ? 418  LEU A CG    1 
ATOM   2599 C  CD1   . LEU A 1 384 ? 64.905  20.772  1.840   1.00 18.49 ? 418  LEU A CD1   1 
ATOM   2600 C  CD2   . LEU A 1 384 ? 65.338  19.921  -0.497  1.00 19.92 ? 418  LEU A CD2   1 
ATOM   2601 N  N     . VAL A 1 385 ? 64.579  24.364  1.594   1.00 20.47 ? 419  VAL A N     1 
ATOM   2602 C  CA    . VAL A 1 385 ? 64.792  25.118  2.833   1.00 20.78 ? 419  VAL A CA    1 
ATOM   2603 C  C     . VAL A 1 385 ? 63.842  26.304  2.871   1.00 21.11 ? 419  VAL A C     1 
ATOM   2604 O  O     . VAL A 1 385 ? 63.293  26.633  3.918   1.00 21.18 ? 419  VAL A O     1 
ATOM   2605 C  CB    . VAL A 1 385 ? 66.245  25.619  2.958   1.00 20.92 ? 419  VAL A CB    1 
ATOM   2606 C  CG1   . VAL A 1 385 ? 66.358  26.725  4.015   1.00 20.87 ? 419  VAL A CG1   1 
ATOM   2607 C  CG2   . VAL A 1 385 ? 67.165  24.457  3.286   1.00 20.37 ? 419  VAL A CG2   1 
ATOM   2608 N  N     . LYS A 1 386 ? 63.642  26.925  1.715   1.00 21.50 ? 420  LYS A N     1 
ATOM   2609 C  CA    . LYS A 1 386 ? 62.725  28.046  1.578   1.00 22.13 ? 420  LYS A CA    1 
ATOM   2610 C  C     . LYS A 1 386 ? 61.286  27.619  1.872   1.00 22.06 ? 420  LYS A C     1 
ATOM   2611 O  O     . LYS A 1 386 ? 60.551  28.337  2.529   1.00 22.06 ? 420  LYS A O     1 
ATOM   2612 C  CB    . LYS A 1 386 ? 62.836  28.628  0.169   1.00 22.53 ? 420  LYS A CB    1 
ATOM   2613 C  CG    . LYS A 1 386 ? 62.145  29.956  -0.037  1.00 24.84 ? 420  LYS A CG    1 
ATOM   2614 C  CD    . LYS A 1 386 ? 62.037  30.297  -1.534  1.00 27.48 ? 420  LYS A CD    1 
ATOM   2615 C  CE    . LYS A 1 386 ? 61.168  31.530  -1.777  1.00 28.69 ? 420  LYS A CE    1 
ATOM   2616 N  NZ    . LYS A 1 386 ? 61.223  31.971  -3.213  1.00 30.19 ? 420  LYS A NZ    1 
ATOM   2617 N  N     . ARG A 1 387 ? 60.897  26.441  1.396   1.00 22.39 ? 421  ARG A N     1 
ATOM   2618 C  CA    . ARG A 1 387 ? 59.556  25.915  1.627   1.00 22.51 ? 421  ARG A CA    1 
ATOM   2619 C  C     . ARG A 1 387 ? 59.322  25.500  3.086   1.00 22.85 ? 421  ARG A C     1 
ATOM   2620 O  O     . ARG A 1 387 ? 58.281  25.823  3.668   1.00 22.64 ? 421  ARG A O     1 
ATOM   2621 C  CB    . ARG A 1 387 ? 59.298  24.725  0.708   1.00 22.93 ? 421  ARG A CB    1 
ATOM   2622 C  CG    . ARG A 1 387 ? 58.079  23.910  1.091   1.00 23.87 ? 421  ARG A CG    1 
ATOM   2623 C  CD    . ARG A 1 387 ? 57.590  22.979  -0.014  1.00 24.58 ? 421  ARG A CD    1 
ATOM   2624 N  NE    . ARG A 1 387 ? 56.339  22.348  0.411   1.00 25.87 ? 421  ARG A NE    1 
ATOM   2625 C  CZ    . ARG A 1 387 ? 55.615  21.504  -0.313  1.00 26.39 ? 421  ARG A CZ    1 
ATOM   2626 N  NH1   . ARG A 1 387 ? 56.002  21.148  -1.531  1.00 26.81 ? 421  ARG A NH1   1 
ATOM   2627 N  NH2   . ARG A 1 387 ? 54.484  21.018  0.190   1.00 27.57 ? 421  ARG A NH2   1 
ATOM   2628 N  N     . PHE A 1 388 ? 60.277  24.786  3.683   1.00 22.70 ? 422  PHE A N     1 
ATOM   2629 C  CA    . PHE A 1 388 ? 60.056  24.237  5.009   1.00 22.67 ? 422  PHE A CA    1 
ATOM   2630 C  C     . PHE A 1 388 ? 60.142  25.327  6.054   1.00 23.14 ? 422  PHE A C     1 
ATOM   2631 O  O     . PHE A 1 388 ? 59.600  25.191  7.143   1.00 23.28 ? 422  PHE A O     1 
ATOM   2632 C  CB    . PHE A 1 388 ? 61.033  23.104  5.312   1.00 22.62 ? 422  PHE A CB    1 
ATOM   2633 C  CG    . PHE A 1 388 ? 60.662  22.285  6.522   1.00 21.21 ? 422  PHE A CG    1 
ATOM   2634 C  CD1   . PHE A 1 388 ? 59.569  21.442  6.495   1.00 21.67 ? 422  PHE A CD1   1 
ATOM   2635 C  CD2   . PHE A 1 388 ? 61.424  22.335  7.669   1.00 20.74 ? 422  PHE A CD2   1 
ATOM   2636 C  CE1   . PHE A 1 388 ? 59.235  20.670  7.602   1.00 22.23 ? 422  PHE A CE1   1 
ATOM   2637 C  CE2   . PHE A 1 388 ? 61.098  21.570  8.795   1.00 21.29 ? 422  PHE A CE2   1 
ATOM   2638 C  CZ    . PHE A 1 388 ? 60.003  20.737  8.760   1.00 21.61 ? 422  PHE A CZ    1 
ATOM   2639 N  N     . LYS A 1 389 ? 60.814  26.417  5.716   1.00 23.90 ? 423  LYS A N     1 
ATOM   2640 C  CA    . LYS A 1 389 ? 60.747  27.632  6.522   1.00 24.17 ? 423  LYS A CA    1 
ATOM   2641 C  C     . LYS A 1 389 ? 59.316  28.183  6.539   1.00 24.78 ? 423  LYS A C     1 
ATOM   2642 O  O     . LYS A 1 389 ? 58.814  28.554  7.590   1.00 24.89 ? 423  LYS A O     1 
ATOM   2643 C  CB    . LYS A 1 389 ? 61.731  28.692  5.996   1.00 24.01 ? 423  LYS A CB    1 
ATOM   2644 C  CG    . LYS A 1 389 ? 63.166  28.543  6.503   1.00 22.81 ? 423  LYS A CG    1 
ATOM   2645 C  CD    . LYS A 1 389 ? 64.075  29.584  5.842   1.00 22.10 ? 423  LYS A CD    1 
ATOM   2646 C  CE    . LYS A 1 389 ? 65.530  29.476  6.296   1.00 20.79 ? 423  LYS A CE    1 
ATOM   2647 N  NZ    . LYS A 1 389 ? 65.732  29.923  7.692   1.00 18.47 ? 423  LYS A NZ    1 
ATOM   2648 N  N     . LYS A 1 390 ? 58.663  28.212  5.376   1.00 25.68 ? 424  LYS A N     1 
ATOM   2649 C  CA    . LYS A 1 390 ? 57.308  28.768  5.254   1.00 26.62 ? 424  LYS A CA    1 
ATOM   2650 C  C     . LYS A 1 390 ? 56.196  27.836  5.751   1.00 26.79 ? 424  LYS A C     1 
ATOM   2651 O  O     . LYS A 1 390 ? 55.277  28.275  6.436   1.00 26.79 ? 424  LYS A O     1 
ATOM   2652 C  CB    . LYS A 1 390 ? 56.999  29.135  3.796   1.00 26.91 ? 424  LYS A CB    1 
ATOM   2653 C  CG    . LYS A 1 390 ? 57.721  30.364  3.279   1.00 28.83 ? 424  LYS A CG    1 
ATOM   2654 C  CD    . LYS A 1 390 ? 57.033  30.958  2.030   1.00 31.42 ? 424  LYS A CD    1 
ATOM   2655 C  CE    . LYS A 1 390 ? 57.128  30.042  0.796   1.00 32.06 ? 424  LYS A CE    1 
ATOM   2656 N  NZ    . LYS A 1 390 ? 56.438  30.628  -0.413  1.00 31.49 ? 424  LYS A NZ    1 
ATOM   2657 N  N     . ASP A 1 391 ? 56.264  26.563  5.373   1.00 26.89 ? 425  ASP A N     1 
ATOM   2658 C  CA    . ASP A 1 391 ? 55.172  25.617  5.630   1.00 26.89 ? 425  ASP A CA    1 
ATOM   2659 C  C     . ASP A 1 391 ? 54.786  25.461  7.103   1.00 26.42 ? 425  ASP A C     1 
ATOM   2660 O  O     . ASP A 1 391 ? 55.619  25.516  8.003   1.00 26.40 ? 425  ASP A O     1 
ATOM   2661 C  CB    . ASP A 1 391 ? 55.488  24.240  5.031   1.00 27.04 ? 425  ASP A CB    1 
ATOM   2662 C  CG    . ASP A 1 391 ? 55.322  24.205  3.517   1.00 28.14 ? 425  ASP A CG    1 
ATOM   2663 O  OD1   . ASP A 1 391 ? 54.940  25.237  2.926   1.00 29.43 ? 425  ASP A OD1   1 
ATOM   2664 O  OD2   . ASP A 1 391 ? 55.579  23.140  2.913   1.00 30.51 ? 425  ASP A OD2   1 
ATOM   2665 N  N     . GLU A 1 392 ? 53.490  25.268  7.309   1.00 25.91 ? 426  GLU A N     1 
ATOM   2666 C  CA    . GLU A 1 392 ? 52.896  25.092  8.629   1.00 25.46 ? 426  GLU A CA    1 
ATOM   2667 C  C     . GLU A 1 392 ? 53.090  23.657  9.144   1.00 24.62 ? 426  GLU A C     1 
ATOM   2668 O  O     . GLU A 1 392 ? 53.026  23.395  10.352  1.00 24.33 ? 426  GLU A O     1 
ATOM   2669 C  CB    . GLU A 1 392 ? 51.397  25.426  8.561   1.00 25.61 ? 426  GLU A CB    1 
ATOM   2670 C  CG    . GLU A 1 392 ? 50.519  24.421  7.748   1.00 26.96 ? 426  GLU A CG    1 
ATOM   2671 C  CD    . GLU A 1 392 ? 50.465  24.691  6.229   1.00 28.62 ? 426  GLU A CD    1 
ATOM   2672 O  OE1   . GLU A 1 392 ? 51.313  25.457  5.698   1.00 28.34 ? 426  GLU A OE1   1 
ATOM   2673 O  OE2   . GLU A 1 392 ? 49.559  24.119  5.572   1.00 29.48 ? 426  GLU A OE2   1 
ATOM   2674 N  N     . SER A 1 393 ? 53.325  22.743  8.209   1.00 23.57 ? 427  SER A N     1 
ATOM   2675 C  CA    . SER A 1 393 ? 53.356  21.327  8.485   1.00 22.90 ? 427  SER A CA    1 
ATOM   2676 C  C     . SER A 1 393 ? 54.244  20.645  7.472   1.00 22.18 ? 427  SER A C     1 
ATOM   2677 O  O     . SER A 1 393 ? 54.491  21.182  6.393   1.00 22.21 ? 427  SER A O     1 
ATOM   2678 C  CB    . SER A 1 393 ? 51.954  20.755  8.342   1.00 23.05 ? 427  SER A CB    1 
ATOM   2679 O  OG    . SER A 1 393 ? 51.479  20.971  7.019   1.00 23.60 ? 427  SER A OG    1 
ATOM   2680 N  N     . GLY A 1 394 ? 54.701  19.450  7.815   1.00 21.30 ? 428  GLY A N     1 
ATOM   2681 C  CA    . GLY A 1 394 ? 55.518  18.652  6.913   1.00 20.60 ? 428  GLY A CA    1 
ATOM   2682 C  C     . GLY A 1 394 ? 56.644  17.949  7.639   1.00 19.68 ? 428  GLY A C     1 
ATOM   2683 O  O     . GLY A 1 394 ? 56.955  18.276  8.791   1.00 19.56 ? 428  GLY A O     1 
ATOM   2684 N  N     . ILE A 1 395 ? 57.255  16.984  6.955   1.00 18.61 ? 429  ILE A N     1 
ATOM   2685 C  CA    . ILE A 1 395 ? 58.392  16.263  7.502   1.00 17.97 ? 429  ILE A CA    1 
ATOM   2686 C  C     . ILE A 1 395 ? 59.624  16.481  6.657   1.00 17.33 ? 429  ILE A C     1 
ATOM   2687 O  O     . ILE A 1 395 ? 59.651  16.163  5.463   1.00 17.17 ? 429  ILE A O     1 
ATOM   2688 C  CB    . ILE A 1 395 ? 58.116  14.769  7.614   1.00 18.17 ? 429  ILE A CB    1 
ATOM   2689 C  CG1   . ILE A 1 395 ? 56.868  14.547  8.473   1.00 18.70 ? 429  ILE A CG1   1 
ATOM   2690 C  CG2   . ILE A 1 395 ? 59.325  14.051  8.223   1.00 17.62 ? 429  ILE A CG2   1 
ATOM   2691 C  CD1   . ILE A 1 395 ? 56.429  13.110  8.530   1.00 20.57 ? 429  ILE A CD1   1 
ATOM   2692 N  N     . LEU A 1 396 ? 60.640  17.058  7.281   1.00 16.82 ? 430  LEU A N     1 
ATOM   2693 C  CA    . LEU A 1 396 ? 61.941  17.206  6.654   1.00 16.53 ? 430  LEU A CA    1 
ATOM   2694 C  C     . LEU A 1 396 ? 62.810  16.034  7.134   1.00 16.25 ? 430  LEU A C     1 
ATOM   2695 O  O     . LEU A 1 396 ? 62.972  15.811  8.343   1.00 15.73 ? 430  LEU A O     1 
ATOM   2696 C  CB    . LEU A 1 396 ? 62.551  18.556  7.033   1.00 16.38 ? 430  LEU A CB    1 
ATOM   2697 C  CG    . LEU A 1 396 ? 63.923  18.894  6.441   1.00 16.78 ? 430  LEU A CG    1 
ATOM   2698 C  CD1   . LEU A 1 396 ? 63.850  19.124  4.913   1.00 16.26 ? 430  LEU A CD1   1 
ATOM   2699 C  CD2   . LEU A 1 396 ? 64.481  20.110  7.148   1.00 15.44 ? 430  LEU A CD2   1 
ATOM   2700 N  N     . VAL A 1 397 ? 63.318  15.265  6.178   1.00 15.99 ? 431  VAL A N     1 
ATOM   2701 C  CA    . VAL A 1 397 ? 64.154  14.105  6.455   1.00 16.00 ? 431  VAL A CA    1 
ATOM   2702 C  C     . VAL A 1 397 ? 65.562  14.439  6.030   1.00 16.25 ? 431  VAL A C     1 
ATOM   2703 O  O     . VAL A 1 397 ? 65.812  14.676  4.852   1.00 16.69 ? 431  VAL A O     1 
ATOM   2704 C  CB    . VAL A 1 397 ? 63.667  12.883  5.671   1.00 15.98 ? 431  VAL A CB    1 
ATOM   2705 C  CG1   . VAL A 1 397 ? 64.479  11.660  6.038   1.00 15.71 ? 431  VAL A CG1   1 
ATOM   2706 C  CG2   . VAL A 1 397 ? 62.168  12.655  5.916   1.00 15.60 ? 431  VAL A CG2   1 
ATOM   2707 N  N     . CYS A 1 398 ? 66.490  14.465  6.973   1.00 16.96 ? 432  CYS A N     1 
ATOM   2708 C  CA    . CYS A 1 398 ? 67.838  14.906  6.655   1.00 17.71 ? 432  CYS A CA    1 
ATOM   2709 C  C     . CYS A 1 398 ? 68.955  14.250  7.451   1.00 18.08 ? 432  CYS A C     1 
ATOM   2710 O  O     . CYS A 1 398 ? 68.729  13.599  8.469   1.00 18.29 ? 432  CYS A O     1 
ATOM   2711 C  CB    . CYS A 1 398 ? 67.920  16.413  6.885   1.00 18.01 ? 432  CYS A CB    1 
ATOM   2712 S  SG    . CYS A 1 398 ? 67.594  16.850  8.592   1.00 17.95 ? 432  CYS A SG    1 
ATOM   2713 N  N     . THR A 1 399 ? 70.174  14.458  6.970   1.00 18.62 ? 433  THR A N     1 
ATOM   2714 C  CA    . THR A 1 399 ? 71.377  14.139  7.718   1.00 19.03 ? 433  THR A CA    1 
ATOM   2715 C  C     . THR A 1 399 ? 71.733  15.330  8.584   1.00 19.78 ? 433  THR A C     1 
ATOM   2716 O  O     . THR A 1 399 ? 70.978  16.316  8.653   1.00 20.43 ? 433  THR A O     1 
ATOM   2717 C  CB    . THR A 1 399 ? 72.544  13.864  6.773   1.00 19.17 ? 433  THR A CB    1 
ATOM   2718 O  OG1   . THR A 1 399 ? 72.652  14.939  5.824   1.00 18.97 ? 433  THR A OG1   1 
ATOM   2719 C  CG2   . THR A 1 399 ? 72.333  12.545  6.042   1.00 19.16 ? 433  THR A CG2   1 
ATOM   2720 N  N     . ASP A 1 400 ? 72.888  15.244  9.238   1.00 20.31 ? 434  ASP A N     1 
ATOM   2721 C  CA    . ASP A 1 400 ? 73.422  16.340  10.045  1.00 20.33 ? 434  ASP A CA    1 
ATOM   2722 C  C     . ASP A 1 400 ? 73.837  17.599  9.279   1.00 20.38 ? 434  ASP A C     1 
ATOM   2723 O  O     . ASP A 1 400 ? 74.320  18.554  9.895   1.00 21.15 ? 434  ASP A O     1 
ATOM   2724 C  CB    . ASP A 1 400 ? 74.593  15.839  10.891  1.00 20.40 ? 434  ASP A CB    1 
ATOM   2725 C  CG    . ASP A 1 400 ? 74.136  15.270  12.205  1.00 20.71 ? 434  ASP A CG    1 
ATOM   2726 O  OD1   . ASP A 1 400 ? 72.917  15.048  12.357  1.00 21.13 ? 434  ASP A OD1   1 
ATOM   2727 O  OD2   . ASP A 1 400 ? 74.980  15.051  13.084  1.00 21.63 ? 434  ASP A OD2   1 
ATOM   2728 N  N     . VAL A 1 401 ? 73.644  17.620  7.964   1.00 19.54 ? 435  VAL A N     1 
ATOM   2729 C  CA    . VAL A 1 401 ? 73.725  18.864  7.210   1.00 19.33 ? 435  VAL A CA    1 
ATOM   2730 C  C     . VAL A 1 401 ? 72.766  19.927  7.767   1.00 19.26 ? 435  VAL A C     1 
ATOM   2731 O  O     . VAL A 1 401 ? 73.080  21.111  7.751   1.00 19.65 ? 435  VAL A O     1 
ATOM   2732 C  CB    . VAL A 1 401 ? 73.435  18.641  5.696   1.00 19.19 ? 435  VAL A CB    1 
ATOM   2733 C  CG1   . VAL A 1 401 ? 71.987  18.245  5.471   1.00 18.22 ? 435  VAL A CG1   1 
ATOM   2734 C  CG2   . VAL A 1 401 ? 73.779  19.883  4.912   1.00 19.02 ? 435  VAL A CG2   1 
ATOM   2735 N  N     . GLY A 1 402 ? 71.605  19.496  8.255   1.00 19.21 ? 436  GLY A N     1 
ATOM   2736 C  CA    . GLY A 1 402 ? 70.625  20.388  8.882   1.00 18.91 ? 436  GLY A CA    1 
ATOM   2737 C  C     . GLY A 1 402 ? 70.594  20.303  10.404  1.00 18.68 ? 436  GLY A C     1 
ATOM   2738 O  O     . GLY A 1 402 ? 69.610  20.688  11.028  1.00 18.80 ? 436  GLY A O     1 
ATOM   2739 N  N     . ALA A 1 403 ? 71.667  19.811  11.010  1.00 18.56 ? 437  ALA A N     1 
ATOM   2740 C  CA    . ALA A 1 403 ? 71.732  19.685  12.476  1.00 18.65 ? 437  ALA A CA    1 
ATOM   2741 C  C     . ALA A 1 403 ? 71.987  21.022  13.146  1.00 18.43 ? 437  ALA A C     1 
ATOM   2742 O  O     . ALA A 1 403 ? 71.439  21.295  14.193  1.00 19.15 ? 437  ALA A O     1 
ATOM   2743 C  CB    . ALA A 1 403 ? 72.820  18.686  12.883  1.00 18.19 ? 437  ALA A CB    1 
ATOM   2744 N  N     . ARG A 1 404 ? 72.819  21.847  12.526  1.00 18.88 ? 438  ARG A N     1 
ATOM   2745 C  CA    . ARG A 1 404 ? 73.315  23.083  13.120  1.00 19.26 ? 438  ARG A CA    1 
ATOM   2746 C  C     . ARG A 1 404 ? 72.752  24.324  12.437  1.00 19.55 ? 438  ARG A C     1 
ATOM   2747 O  O     . ARG A 1 404 ? 72.783  24.437  11.206  1.00 19.66 ? 438  ARG A O     1 
ATOM   2748 C  CB    . ARG A 1 404 ? 74.848  23.119  13.016  1.00 19.25 ? 438  ARG A CB    1 
ATOM   2749 C  CG    . ARG A 1 404 ? 75.555  22.253  14.057  1.00 20.38 ? 438  ARG A CG    1 
ATOM   2750 C  CD    . ARG A 1 404 ? 77.062  22.254  13.884  1.00 21.13 ? 438  ARG A CD    1 
ATOM   2751 N  NE    . ARG A 1 404 ? 77.735  21.470  14.923  1.00 21.93 ? 438  ARG A NE    1 
ATOM   2752 C  CZ    . ARG A 1 404 ? 78.260  21.951  16.047  1.00 22.17 ? 438  ARG A CZ    1 
ATOM   2753 N  NH1   . ARG A 1 404 ? 78.209  23.249  16.329  1.00 23.12 ? 438  ARG A NH1   1 
ATOM   2754 N  NH2   . ARG A 1 404 ? 78.846  21.117  16.902  1.00 22.17 ? 438  ARG A NH2   1 
ATOM   2755 N  N     . GLY A 1 405 ? 72.228  25.246  13.240  1.00 19.79 ? 439  GLY A N     1 
ATOM   2756 C  CA    . GLY A 1 405 ? 71.938  26.604  12.786  1.00 19.87 ? 439  GLY A CA    1 
ATOM   2757 C  C     . GLY A 1 405 ? 70.621  26.835  12.080  1.00 19.86 ? 439  GLY A C     1 
ATOM   2758 O  O     . GLY A 1 405 ? 69.998  27.883  12.269  1.00 20.09 ? 439  GLY A O     1 
ATOM   2759 N  N     . MET A 1 406 ? 70.203  25.889  11.246  1.00 19.94 ? 440  MET A N     1 
ATOM   2760 C  CA    . MET A 1 406 ? 68.985  26.053  10.465  1.00 19.99 ? 440  MET A CA    1 
ATOM   2761 C  C     . MET A 1 406 ? 67.792  26.437  11.338  1.00 20.14 ? 440  MET A C     1 
ATOM   2762 O  O     . MET A 1 406 ? 67.537  25.838  12.388  1.00 20.24 ? 440  MET A O     1 
ATOM   2763 C  CB    . MET A 1 406 ? 68.670  24.799  9.649   1.00 19.99 ? 440  MET A CB    1 
ATOM   2764 C  CG    . MET A 1 406 ? 69.687  24.510  8.543   1.00 20.80 ? 440  MET A CG    1 
ATOM   2765 S  SD    . MET A 1 406 ? 70.374  25.975  7.720   1.00 21.25 ? 440  MET A SD    1 
ATOM   2766 C  CE    . MET A 1 406 ? 68.957  26.505  6.772   1.00 20.36 ? 440  MET A CE    1 
ATOM   2767 N  N     . ASP A 1 407 ? 67.089  27.468  10.890  1.00 20.30 ? 441  ASP A N     1 
ATOM   2768 C  CA    . ASP A 1 407 ? 65.997  28.070  11.636  1.00 20.66 ? 441  ASP A CA    1 
ATOM   2769 C  C     . ASP A 1 407 ? 64.727  27.856  10.820  1.00 20.51 ? 441  ASP A C     1 
ATOM   2770 O  O     . ASP A 1 407 ? 64.492  28.534  9.818   1.00 19.94 ? 441  ASP A O     1 
ATOM   2771 C  CB    . ASP A 1 407 ? 66.274  29.560  11.849  1.00 20.67 ? 441  ASP A CB    1 
ATOM   2772 C  CG    . ASP A 1 407 ? 65.125  30.274  12.512  1.00 21.52 ? 441  ASP A CG    1 
ATOM   2773 O  OD1   . ASP A 1 407 ? 64.775  29.887  13.658  1.00 23.50 ? 441  ASP A OD1   1 
ATOM   2774 O  OD2   . ASP A 1 407 ? 64.583  31.226  11.892  1.00 21.40 ? 441  ASP A OD2   1 
ATOM   2775 N  N     . PHE A 1 408 ? 63.955  26.856  11.227  1.00 20.58 ? 442  PHE A N     1 
ATOM   2776 C  CA    . PHE A 1 408 ? 62.695  26.532  10.598  1.00 20.61 ? 442  PHE A CA    1 
ATOM   2777 C  C     . PHE A 1 408 ? 61.642  26.809  11.647  1.00 20.58 ? 442  PHE A C     1 
ATOM   2778 O  O     . PHE A 1 408 ? 61.571  26.080  12.622  1.00 20.69 ? 442  PHE A O     1 
ATOM   2779 C  CB    . PHE A 1 408 ? 62.635  25.055  10.223  1.00 20.56 ? 442  PHE A CB    1 
ATOM   2780 C  CG    . PHE A 1 408 ? 63.657  24.626  9.215   1.00 20.11 ? 442  PHE A CG    1 
ATOM   2781 C  CD1   . PHE A 1 408 ? 63.610  25.100  7.913   1.00 20.29 ? 442  PHE A CD1   1 
ATOM   2782 C  CD2   . PHE A 1 408 ? 64.625  23.673  9.547   1.00 20.07 ? 442  PHE A CD2   1 
ATOM   2783 C  CE1   . PHE A 1 408 ? 64.543  24.661  6.966   1.00 20.45 ? 442  PHE A CE1   1 
ATOM   2784 C  CE2   . PHE A 1 408 ? 65.554  23.231  8.606   1.00 19.41 ? 442  PHE A CE2   1 
ATOM   2785 C  CZ    . PHE A 1 408 ? 65.515  23.723  7.317   1.00 19.01 ? 442  PHE A CZ    1 
ATOM   2786 N  N     . PRO A 1 409 ? 60.827  27.863  11.465  1.00 20.72 ? 443  PRO A N     1 
ATOM   2787 C  CA    . PRO A 1 409 ? 59.894  28.239  12.529  1.00 20.78 ? 443  PRO A CA    1 
ATOM   2788 C  C     . PRO A 1 409 ? 58.862  27.167  12.889  1.00 20.72 ? 443  PRO A C     1 
ATOM   2789 O  O     . PRO A 1 409 ? 58.385  26.435  12.022  1.00 19.82 ? 443  PRO A O     1 
ATOM   2790 C  CB    . PRO A 1 409 ? 59.187  29.481  11.961  1.00 20.87 ? 443  PRO A CB    1 
ATOM   2791 C  CG    . PRO A 1 409 ? 60.119  30.028  10.955  1.00 20.99 ? 443  PRO A CG    1 
ATOM   2792 C  CD    . PRO A 1 409 ? 60.800  28.830  10.354  1.00 20.94 ? 443  PRO A CD    1 
ATOM   2793 N  N     . ASN A 1 410 ? 58.552  27.084  14.182  1.00 21.09 ? 444  ASN A N     1 
ATOM   2794 C  CA    . ASN A 1 410 ? 57.431  26.296  14.678  1.00 21.13 ? 444  ASN A CA    1 
ATOM   2795 C  C     . ASN A 1 410 ? 57.498  24.843  14.235  1.00 21.72 ? 444  ASN A C     1 
ATOM   2796 O  O     . ASN A 1 410 ? 56.527  24.288  13.704  1.00 21.55 ? 444  ASN A O     1 
ATOM   2797 C  CB    . ASN A 1 410 ? 56.115  26.945  14.244  1.00 21.12 ? 444  ASN A CB    1 
ATOM   2798 C  CG    . ASN A 1 410 ? 56.016  28.400  14.673  1.00 20.55 ? 444  ASN A CG    1 
ATOM   2799 O  OD1   . ASN A 1 410 ? 56.325  28.746  15.810  1.00 21.33 ? 444  ASN A OD1   1 
ATOM   2800 N  ND2   . ASN A 1 410 ? 55.587  29.256  13.762  1.00 20.51 ? 444  ASN A ND2   1 
ATOM   2801 N  N     . VAL A 1 411 ? 58.673  24.246  14.426  1.00 22.23 ? 445  VAL A N     1 
ATOM   2802 C  CA    . VAL A 1 411 ? 58.835  22.813  14.299  1.00 22.49 ? 445  VAL A CA    1 
ATOM   2803 C  C     . VAL A 1 411 ? 58.319  22.234  15.610  1.00 23.02 ? 445  VAL A C     1 
ATOM   2804 O  O     . VAL A 1 411 ? 58.710  22.692  16.690  1.00 23.15 ? 445  VAL A O     1 
ATOM   2805 C  CB    . VAL A 1 411 ? 60.308  22.436  14.062  1.00 22.65 ? 445  VAL A CB    1 
ATOM   2806 C  CG1   . VAL A 1 411 ? 60.488  20.928  14.044  1.00 22.62 ? 445  VAL A CG1   1 
ATOM   2807 C  CG2   . VAL A 1 411 ? 60.809  23.036  12.745  1.00 22.81 ? 445  VAL A CG2   1 
ATOM   2808 N  N     . HIS A 1 412 ? 57.423  21.254  15.528  1.00 23.27 ? 446  HIS A N     1 
ATOM   2809 C  CA    . HIS A 1 412 ? 56.841  20.676  16.732  1.00 23.50 ? 446  HIS A CA    1 
ATOM   2810 C  C     . HIS A 1 412 ? 57.785  19.673  17.371  1.00 23.59 ? 446  HIS A C     1 
ATOM   2811 O  O     . HIS A 1 412 ? 57.938  19.661  18.590  1.00 24.03 ? 446  HIS A O     1 
ATOM   2812 C  CB    . HIS A 1 412 ? 55.495  20.010  16.429  1.00 23.54 ? 446  HIS A CB    1 
ATOM   2813 C  CG    . HIS A 1 412 ? 54.462  20.958  15.911  1.00 23.80 ? 446  HIS A CG    1 
ATOM   2814 N  ND1   . HIS A 1 412 ? 53.879  20.819  14.672  1.00 24.05 ? 446  HIS A ND1   1 
ATOM   2815 C  CD2   . HIS A 1 412 ? 53.933  22.082  16.451  1.00 23.47 ? 446  HIS A CD2   1 
ATOM   2816 C  CE1   . HIS A 1 412 ? 53.021  21.804  14.478  1.00 23.15 ? 446  HIS A CE1   1 
ATOM   2817 N  NE2   . HIS A 1 412 ? 53.038  22.586  15.542  1.00 22.23 ? 446  HIS A NE2   1 
ATOM   2818 N  N     . GLU A 1 413 ? 58.405  18.833  16.544  1.00 23.55 ? 447  GLU A N     1 
ATOM   2819 C  CA    . GLU A 1 413 ? 59.201  17.706  17.025  1.00 23.36 ? 447  GLU A CA    1 
ATOM   2820 C  C     . GLU A 1 413 ? 60.447  17.475  16.198  1.00 22.58 ? 447  GLU A C     1 
ATOM   2821 O  O     . GLU A 1 413 ? 60.428  17.602  14.974  1.00 22.02 ? 447  GLU A O     1 
ATOM   2822 C  CB    . GLU A 1 413 ? 58.393  16.409  16.970  1.00 23.78 ? 447  GLU A CB    1 
ATOM   2823 C  CG    . GLU A 1 413 ? 57.311  16.298  18.008  1.00 25.79 ? 447  GLU A CG    1 
ATOM   2824 C  CD    . GLU A 1 413 ? 56.932  14.852  18.313  1.00 27.70 ? 447  GLU A CD    1 
ATOM   2825 O  OE1   . GLU A 1 413 ? 56.596  14.563  19.486  1.00 29.99 ? 447  GLU A OE1   1 
ATOM   2826 O  OE2   . GLU A 1 413 ? 56.969  14.012  17.387  1.00 28.18 ? 447  GLU A OE2   1 
ATOM   2827 N  N     . VAL A 1 414 ? 61.518  17.100  16.885  1.00 21.99 ? 448  VAL A N     1 
ATOM   2828 C  CA    . VAL A 1 414 ? 62.707  16.581  16.242  1.00 21.67 ? 448  VAL A CA    1 
ATOM   2829 C  C     . VAL A 1 414 ? 62.776  15.088  16.563  1.00 21.51 ? 448  VAL A C     1 
ATOM   2830 O  O     . VAL A 1 414 ? 62.719  14.697  17.719  1.00 21.75 ? 448  VAL A O     1 
ATOM   2831 C  CB    . VAL A 1 414 ? 63.979  17.331  16.717  1.00 21.54 ? 448  VAL A CB    1 
ATOM   2832 C  CG1   . VAL A 1 414 ? 65.247  16.601  16.296  1.00 20.59 ? 448  VAL A CG1   1 
ATOM   2833 C  CG2   . VAL A 1 414 ? 63.977  18.751  16.170  1.00 21.26 ? 448  VAL A CG2   1 
ATOM   2834 N  N     . LEU A 1 415 ? 62.852  14.259  15.533  1.00 21.54 ? 449  LEU A N     1 
ATOM   2835 C  CA    . LEU A 1 415 ? 63.019  12.823  15.715  1.00 21.44 ? 449  LEU A CA    1 
ATOM   2836 C  C     . LEU A 1 415 ? 64.411  12.410  15.235  1.00 21.32 ? 449  LEU A C     1 
ATOM   2837 O  O     . LEU A 1 415 ? 64.947  12.984  14.278  1.00 21.27 ? 449  LEU A O     1 
ATOM   2838 C  CB    . LEU A 1 415 ? 61.957  12.048  14.935  1.00 21.39 ? 449  LEU A CB    1 
ATOM   2839 C  CG    . LEU A 1 415 ? 60.515  12.546  14.981  1.00 20.85 ? 449  LEU A CG    1 
ATOM   2840 C  CD1   . LEU A 1 415 ? 59.683  11.776  13.963  1.00 20.39 ? 449  LEU A CD1   1 
ATOM   2841 C  CD2   . LEU A 1 415 ? 59.945  12.418  16.360  1.00 19.23 ? 449  LEU A CD2   1 
ATOM   2842 N  N     . GLN A 1 416 ? 64.986  11.414  15.903  1.00 20.88 ? 450  GLN A N     1 
ATOM   2843 C  CA    . GLN A 1 416 ? 66.268  10.859  15.501  1.00 20.69 ? 450  GLN A CA    1 
ATOM   2844 C  C     . GLN A 1 416 ? 66.201  9.348   15.407  1.00 20.68 ? 450  GLN A C     1 
ATOM   2845 O  O     . GLN A 1 416 ? 65.872  8.679   16.377  1.00 19.99 ? 450  GLN A O     1 
ATOM   2846 C  CB    . GLN A 1 416 ? 67.342  11.222  16.505  1.00 20.50 ? 450  GLN A CB    1 
ATOM   2847 C  CG    . GLN A 1 416 ? 67.484  12.686  16.750  1.00 20.96 ? 450  GLN A CG    1 
ATOM   2848 C  CD    . GLN A 1 416 ? 68.644  12.969  17.658  1.00 22.61 ? 450  GLN A CD    1 
ATOM   2849 O  OE1   . GLN A 1 416 ? 69.794  12.622  17.333  1.00 23.72 ? 450  GLN A OE1   1 
ATOM   2850 N  NE2   . GLN A 1 416 ? 68.366  13.580  18.813  1.00 20.50 ? 450  GLN A NE2   1 
ATOM   2851 N  N     . ILE A 1 417 ? 66.507  8.824   14.228  1.00 21.12 ? 451  ILE A N     1 
ATOM   2852 C  CA    . ILE A 1 417 ? 66.782  7.411   14.068  1.00 21.65 ? 451  ILE A CA    1 
ATOM   2853 C  C     . ILE A 1 417 ? 68.294  7.238   14.055  1.00 21.93 ? 451  ILE A C     1 
ATOM   2854 O  O     . ILE A 1 417 ? 68.959  7.510   13.053  1.00 22.18 ? 451  ILE A O     1 
ATOM   2855 C  CB    . ILE A 1 417 ? 66.181  6.853   12.775  1.00 21.86 ? 451  ILE A CB    1 
ATOM   2856 C  CG1   . ILE A 1 417 ? 64.664  7.052   12.777  1.00 21.61 ? 451  ILE A CG1   1 
ATOM   2857 C  CG2   . ILE A 1 417 ? 66.546  5.368   12.629  1.00 21.80 ? 451  ILE A CG2   1 
ATOM   2858 C  CD1   . ILE A 1 417 ? 63.956  6.362   11.631  1.00 21.91 ? 451  ILE A CD1   1 
ATOM   2859 N  N     . GLY A 1 418 ? 68.831  6.791   15.180  1.00 22.26 ? 452  GLY A N     1 
ATOM   2860 C  CA    . GLY A 1 418 ? 70.258  6.559   15.312  1.00 22.40 ? 452  GLY A CA    1 
ATOM   2861 C  C     . GLY A 1 418 ? 70.938  7.666   16.088  1.00 22.60 ? 452  GLY A C     1 
ATOM   2862 O  O     . GLY A 1 418 ? 70.285  8.567   16.631  1.00 22.66 ? 452  GLY A O     1 
ATOM   2863 N  N     . VAL A 1 419 ? 72.259  7.575   16.155  1.00 22.61 ? 453  VAL A N     1 
ATOM   2864 C  CA    . VAL A 1 419 ? 73.073  8.559   16.845  1.00 22.69 ? 453  VAL A CA    1 
ATOM   2865 C  C     . VAL A 1 419 ? 73.511  9.642   15.867  1.00 22.89 ? 453  VAL A C     1 
ATOM   2866 O  O     . VAL A 1 419 ? 73.537  9.418   14.656  1.00 23.20 ? 453  VAL A O     1 
ATOM   2867 C  CB    . VAL A 1 419 ? 74.337  7.909   17.455  1.00 22.75 ? 453  VAL A CB    1 
ATOM   2868 C  CG1   . VAL A 1 419 ? 73.950  6.908   18.544  1.00 23.26 ? 453  VAL A CG1   1 
ATOM   2869 C  CG2   . VAL A 1 419 ? 75.171  7.249   16.380  1.00 21.53 ? 453  VAL A CG2   1 
ATOM   2870 N  N     . PRO A 1 420 ? 73.866  10.822  16.383  1.00 22.90 ? 454  PRO A N     1 
ATOM   2871 C  CA    . PRO A 1 420 ? 74.388  11.844  15.491  1.00 22.87 ? 454  PRO A CA    1 
ATOM   2872 C  C     . PRO A 1 420 ? 75.843  11.584  15.108  1.00 22.98 ? 454  PRO A C     1 
ATOM   2873 O  O     . PRO A 1 420 ? 76.510  10.736  15.703  1.00 22.56 ? 454  PRO A O     1 
ATOM   2874 C  CB    . PRO A 1 420 ? 74.262  13.128  16.317  1.00 22.95 ? 454  PRO A CB    1 
ATOM   2875 C  CG    . PRO A 1 420 ? 74.260  12.692  17.715  1.00 22.96 ? 454  PRO A CG    1 
ATOM   2876 C  CD    . PRO A 1 420 ? 73.661  11.324  17.750  1.00 22.81 ? 454  PRO A CD    1 
ATOM   2877 N  N     . SER A 1 421 ? 76.319  12.338  14.123  1.00 23.12 ? 455  SER A N     1 
ATOM   2878 C  CA    . SER A 1 421 ? 77.687  12.231  13.637  1.00 23.30 ? 455  SER A CA    1 
ATOM   2879 C  C     . SER A 1 421 ? 78.738  12.710  14.655  1.00 23.05 ? 455  SER A C     1 
ATOM   2880 O  O     . SER A 1 421 ? 79.920  12.459  14.479  1.00 23.45 ? 455  SER A O     1 
ATOM   2881 C  CB    . SER A 1 421 ? 77.817  13.027  12.338  1.00 23.59 ? 455  SER A CB    1 
ATOM   2882 O  OG    . SER A 1 421 ? 77.487  14.396  12.547  1.00 23.94 ? 455  SER A OG    1 
ATOM   2883 N  N     . GLU A 1 422 ? 78.306  13.420  15.694  1.00 22.75 ? 456  GLU A N     1 
ATOM   2884 C  CA    . GLU A 1 422 ? 79.168  13.748  16.840  1.00 22.38 ? 456  GLU A CA    1 
ATOM   2885 C  C     . GLU A 1 422 ? 78.306  14.056  18.074  1.00 22.08 ? 456  GLU A C     1 
ATOM   2886 O  O     . GLU A 1 422 ? 77.137  14.399  17.952  1.00 21.90 ? 456  GLU A O     1 
ATOM   2887 C  CB    . GLU A 1 422 ? 80.092  14.922  16.506  1.00 22.16 ? 456  GLU A CB    1 
ATOM   2888 N  N     . LEU A 1 423 ? 78.882  13.915  19.261  1.00 22.24 ? 457  LEU A N     1 
ATOM   2889 C  CA    . LEU A 1 423 ? 78.125  14.054  20.506  1.00 22.21 ? 457  LEU A CA    1 
ATOM   2890 C  C     . LEU A 1 423 ? 77.429  15.402  20.626  1.00 22.46 ? 457  LEU A C     1 
ATOM   2891 O  O     . LEU A 1 423 ? 76.260  15.464  20.986  1.00 22.99 ? 457  LEU A O     1 
ATOM   2892 C  CB    . LEU A 1 423 ? 79.035  13.854  21.721  1.00 22.31 ? 457  LEU A CB    1 
ATOM   2893 C  CG    . LEU A 1 423 ? 78.337  13.735  23.086  1.00 22.44 ? 457  LEU A CG    1 
ATOM   2894 C  CD1   . LEU A 1 423 ? 77.384  12.534  23.130  1.00 21.06 ? 457  LEU A CD1   1 
ATOM   2895 C  CD2   . LEU A 1 423 ? 79.365  13.646  24.203  1.00 22.01 ? 457  LEU A CD2   1 
ATOM   2896 N  N     . ALA A 1 424 ? 78.143  16.486  20.333  1.00 22.54 ? 458  ALA A N     1 
ATOM   2897 C  CA    . ALA A 1 424 ? 77.566  17.829  20.449  1.00 22.13 ? 458  ALA A CA    1 
ATOM   2898 C  C     . ALA A 1 424 ? 76.284  17.966  19.626  1.00 22.03 ? 458  ALA A C     1 
ATOM   2899 O  O     . ALA A 1 424 ? 75.353  18.669  20.039  1.00 22.18 ? 458  ALA A O     1 
ATOM   2900 C  CB    . ALA A 1 424 ? 78.582  18.888  20.035  1.00 22.01 ? 458  ALA A CB    1 
ATOM   2901 N  N     . ASN A 1 425 ? 76.232  17.283  18.481  1.00 21.55 ? 459  ASN A N     1 
ATOM   2902 C  CA    . ASN A 1 425 ? 75.101  17.405  17.558  1.00 21.34 ? 459  ASN A CA    1 
ATOM   2903 C  C     . ASN A 1 425 ? 73.776  16.884  18.111  1.00 21.32 ? 459  ASN A C     1 
ATOM   2904 O  O     . ASN A 1 425 ? 72.722  17.206  17.572  1.00 21.67 ? 459  ASN A O     1 
ATOM   2905 C  CB    . ASN A 1 425 ? 75.396  16.730  16.201  1.00 21.03 ? 459  ASN A CB    1 
ATOM   2906 C  CG    . ASN A 1 425 ? 76.161  17.634  15.234  1.00 20.55 ? 459  ASN A CG    1 
ATOM   2907 O  OD1   . ASN A 1 425 ? 76.642  18.710  15.595  1.00 18.36 ? 459  ASN A OD1   1 
ATOM   2908 N  ND2   . ASN A 1 425 ? 76.260  17.195  13.984  1.00 20.53 ? 459  ASN A ND2   1 
ATOM   2909 N  N     . TYR A 1 426 ? 73.802  16.083  19.168  1.00 21.27 ? 460  TYR A N     1 
ATOM   2910 C  CA    . TYR A 1 426 ? 72.550  15.738  19.815  1.00 21.26 ? 460  TYR A CA    1 
ATOM   2911 C  C     . TYR A 1 426 ? 71.848  17.045  20.177  1.00 21.31 ? 460  TYR A C     1 
ATOM   2912 O  O     . TYR A 1 426 ? 70.688  17.259  19.808  1.00 21.79 ? 460  TYR A O     1 
ATOM   2913 C  CB    . TYR A 1 426 ? 72.750  14.880  21.063  1.00 21.26 ? 460  TYR A CB    1 
ATOM   2914 C  CG    . TYR A 1 426 ? 71.456  14.691  21.826  1.00 21.36 ? 460  TYR A CG    1 
ATOM   2915 C  CD1   . TYR A 1 426 ? 70.451  13.855  21.335  1.00 21.28 ? 460  TYR A CD1   1 
ATOM   2916 C  CD2   . TYR A 1 426 ? 71.219  15.380  23.013  1.00 21.37 ? 460  TYR A CD2   1 
ATOM   2917 C  CE1   . TYR A 1 426 ? 69.244  13.702  22.013  1.00 21.30 ? 460  TYR A CE1   1 
ATOM   2918 C  CE2   . TYR A 1 426 ? 70.023  15.236  23.700  1.00 21.94 ? 460  TYR A CE2   1 
ATOM   2919 C  CZ    . TYR A 1 426 ? 69.036  14.396  23.195  1.00 22.18 ? 460  TYR A CZ    1 
ATOM   2920 O  OH    . TYR A 1 426 ? 67.855  14.247  23.882  1.00 21.85 ? 460  TYR A OH    1 
ATOM   2921 N  N     . ILE A 1 427 ? 72.589  17.925  20.846  1.00 20.87 ? 461  ILE A N     1 
ATOM   2922 C  CA    . ILE A 1 427 ? 72.090  19.215  21.312  1.00 20.69 ? 461  ILE A CA    1 
ATOM   2923 C  C     . ILE A 1 427 ? 71.552  20.107  20.184  1.00 20.52 ? 461  ILE A C     1 
ATOM   2924 O  O     . ILE A 1 427 ? 70.499  20.742  20.327  1.00 21.11 ? 461  ILE A O     1 
ATOM   2925 C  CB    . ILE A 1 427 ? 73.202  19.973  22.073  1.00 20.84 ? 461  ILE A CB    1 
ATOM   2926 C  CG1   . ILE A 1 427 ? 73.596  19.210  23.345  1.00 20.95 ? 461  ILE A CG1   1 
ATOM   2927 C  CG2   . ILE A 1 427 ? 72.752  21.370  22.451  1.00 21.04 ? 461  ILE A CG2   1 
ATOM   2928 C  CD1   . ILE A 1 427 ? 75.053  19.356  23.714  1.00 21.86 ? 461  ILE A CD1   1 
ATOM   2929 N  N     . HIS A 1 428 ? 72.267  20.144  19.066  1.00 19.80 ? 462  HIS A N     1 
ATOM   2930 C  CA    . HIS A 1 428 ? 71.903  21.007  17.957  1.00 19.22 ? 462  HIS A CA    1 
ATOM   2931 C  C     . HIS A 1 428 ? 70.700  20.463  17.180  1.00 19.43 ? 462  HIS A C     1 
ATOM   2932 O  O     . HIS A 1 428 ? 69.801  21.225  16.817  1.00 19.39 ? 462  HIS A O     1 
ATOM   2933 C  CB    . HIS A 1 428 ? 73.094  21.195  17.031  1.00 18.86 ? 462  HIS A CB    1 
ATOM   2934 C  CG    . HIS A 1 428 ? 74.256  21.888  17.676  1.00 17.50 ? 462  HIS A CG    1 
ATOM   2935 N  ND1   . HIS A 1 428 ? 74.275  23.246  17.912  1.00 15.49 ? 462  HIS A ND1   1 
ATOM   2936 C  CD2   . HIS A 1 428 ? 75.451  21.416  18.100  1.00 15.96 ? 462  HIS A CD2   1 
ATOM   2937 C  CE1   . HIS A 1 428 ? 75.425  23.576  18.469  1.00 15.60 ? 462  HIS A CE1   1 
ATOM   2938 N  NE2   . HIS A 1 428 ? 76.159  22.486  18.588  1.00 15.27 ? 462  HIS A NE2   1 
ATOM   2939 N  N     . ARG A 1 429 ? 70.698  19.153  16.930  1.00 19.21 ? 463  ARG A N     1 
ATOM   2940 C  CA    . ARG A 1 429 ? 69.555  18.464  16.338  1.00 18.91 ? 463  ARG A CA    1 
ATOM   2941 C  C     . ARG A 1 429 ? 68.237  18.841  17.022  1.00 19.07 ? 463  ARG A C     1 
ATOM   2942 O  O     . ARG A 1 429 ? 67.319  19.342  16.371  1.00 19.21 ? 463  ARG A O     1 
ATOM   2943 C  CB    . ARG A 1 429 ? 69.742  16.934  16.414  1.00 18.80 ? 463  ARG A CB    1 
ATOM   2944 C  CG    . ARG A 1 429 ? 70.715  16.347  15.403  1.00 18.11 ? 463  ARG A CG    1 
ATOM   2945 C  CD    . ARG A 1 429 ? 70.784  14.817  15.496  1.00 18.12 ? 463  ARG A CD    1 
ATOM   2946 N  NE    . ARG A 1 429 ? 71.406  14.221  14.308  1.00 17.35 ? 463  ARG A NE    1 
ATOM   2947 C  CZ    . ARG A 1 429 ? 71.304  12.945  13.932  1.00 16.71 ? 463  ARG A CZ    1 
ATOM   2948 N  NH1   . ARG A 1 429 ? 70.599  12.067  14.638  1.00 15.99 ? 463  ARG A NH1   1 
ATOM   2949 N  NH2   . ARG A 1 429 ? 71.907  12.546  12.811  1.00 17.60 ? 463  ARG A NH2   1 
ATOM   2950 N  N     . ILE A 1 430 ? 68.144  18.611  18.331  1.00 19.16 ? 464  ILE A N     1 
ATOM   2951 C  CA    . ILE A 1 430 ? 66.900  18.871  19.056  1.00 19.31 ? 464  ILE A CA    1 
ATOM   2952 C  C     . ILE A 1 430 ? 66.621  20.382  19.133  1.00 19.88 ? 464  ILE A C     1 
ATOM   2953 O  O     . ILE A 1 430 ? 65.478  20.815  19.352  1.00 20.16 ? 464  ILE A O     1 
ATOM   2954 C  CB    . ILE A 1 430 ? 66.888  18.220  20.478  1.00 19.56 ? 464  ILE A CB    1 
ATOM   2955 C  CG1   . ILE A 1 430 ? 67.914  18.859  21.414  1.00 19.46 ? 464  ILE A CG1   1 
ATOM   2956 C  CG2   . ILE A 1 430 ? 67.151  16.718  20.397  1.00 18.88 ? 464  ILE A CG2   1 
ATOM   2957 C  CD1   . ILE A 1 430 ? 67.739  18.420  22.856  1.00 19.73 ? 464  ILE A CD1   1 
ATOM   2958 N  N     . GLY A 1 431 ? 67.672  21.177  18.939  1.00 20.20 ? 465  GLY A N     1 
ATOM   2959 C  CA    . GLY A 1 431 ? 67.563  22.625  18.883  1.00 20.34 ? 465  GLY A CA    1 
ATOM   2960 C  C     . GLY A 1 431 ? 66.896  23.191  17.644  1.00 20.60 ? 465  GLY A C     1 
ATOM   2961 O  O     . GLY A 1 431 ? 66.701  24.396  17.560  1.00 20.84 ? 465  GLY A O     1 
ATOM   2962 N  N     . ARG A 1 432 ? 66.552  22.346  16.672  1.00 20.95 ? 466  ARG A N     1 
ATOM   2963 C  CA    . ARG A 1 432 ? 65.773  22.807  15.521  1.00 20.94 ? 466  ARG A CA    1 
ATOM   2964 C  C     . ARG A 1 432 ? 64.324  23.113  15.906  1.00 21.27 ? 466  ARG A C     1 
ATOM   2965 O  O     . ARG A 1 432 ? 63.622  23.810  15.164  1.00 21.69 ? 466  ARG A O     1 
ATOM   2966 C  CB    . ARG A 1 432 ? 65.799  21.791  14.378  1.00 20.75 ? 466  ARG A CB    1 
ATOM   2967 C  CG    . ARG A 1 432 ? 67.190  21.406  13.869  1.00 20.32 ? 466  ARG A CG    1 
ATOM   2968 C  CD    . ARG A 1 432 ? 68.094  22.600  13.609  1.00 19.72 ? 466  ARG A CD    1 
ATOM   2969 N  NE    . ARG A 1 432 ? 69.046  22.830  14.697  1.00 18.73 ? 466  ARG A NE    1 
ATOM   2970 C  CZ    . ARG A 1 432 ? 69.512  24.024  15.062  1.00 19.56 ? 466  ARG A CZ    1 
ATOM   2971 N  NH1   . ARG A 1 432 ? 69.112  25.130  14.449  1.00 20.90 ? 466  ARG A NH1   1 
ATOM   2972 N  NH2   . ARG A 1 432 ? 70.390  24.122  16.053  1.00 19.58 ? 466  ARG A NH2   1 
ATOM   2973 N  N     . THR A 1 433 ? 63.890  22.587  17.052  1.00 21.12 ? 467  THR A N     1 
ATOM   2974 C  CA    . THR A 1 433 ? 62.601  22.918  17.642  1.00 21.26 ? 467  THR A CA    1 
ATOM   2975 C  C     . THR A 1 433 ? 62.811  23.705  18.938  1.00 21.19 ? 467  THR A C     1 
ATOM   2976 O  O     . THR A 1 433 ? 63.915  23.767  19.455  1.00 20.82 ? 467  THR A O     1 
ATOM   2977 C  CB    . THR A 1 433 ? 61.769  21.633  17.941  1.00 21.59 ? 467  THR A CB    1 
ATOM   2978 O  OG1   . THR A 1 433 ? 60.462  22.001  18.397  1.00 22.34 ? 467  THR A OG1   1 
ATOM   2979 C  CG2   . THR A 1 433 ? 62.440  20.752  19.008  1.00 20.98 ? 467  THR A CG2   1 
ATOM   2980 N  N     . ALA A 1 434 ? 61.739  24.299  19.451  1.00 21.48 ? 468  ALA A N     1 
ATOM   2981 C  CA    . ALA A 1 434 ? 61.776  25.112  20.680  1.00 22.01 ? 468  ALA A CA    1 
ATOM   2982 C  C     . ALA A 1 434 ? 62.595  26.400  20.531  1.00 22.12 ? 468  ALA A C     1 
ATOM   2983 O  O     . ALA A 1 434 ? 63.373  26.763  21.419  1.00 21.92 ? 468  ALA A O     1 
ATOM   2984 C  CB    . ALA A 1 434 ? 62.286  24.280  21.883  1.00 21.76 ? 468  ALA A CB    1 
ATOM   2985 N  N     . ARG A 1 435 ? 62.375  27.097  19.422  1.00 22.42 ? 469  ARG A N     1 
ATOM   2986 C  CA    . ARG A 1 435 ? 63.139  28.293  19.070  1.00 22.84 ? 469  ARG A CA    1 
ATOM   2987 C  C     . ARG A 1 435 ? 62.348  29.580  19.333  1.00 23.36 ? 469  ARG A C     1 
ATOM   2988 O  O     . ARG A 1 435 ? 61.130  29.614  19.149  1.00 23.34 ? 469  ARG A O     1 
ATOM   2989 C  CB    . ARG A 1 435 ? 63.558  28.217  17.598  1.00 22.46 ? 469  ARG A CB    1 
ATOM   2990 C  CG    . ARG A 1 435 ? 64.444  27.022  17.307  1.00 22.52 ? 469  ARG A CG    1 
ATOM   2991 C  CD    . ARG A 1 435 ? 64.776  26.873  15.828  1.00 22.47 ? 469  ARG A CD    1 
ATOM   2992 N  NE    . ARG A 1 435 ? 65.739  27.860  15.349  1.00 21.48 ? 469  ARG A NE    1 
ATOM   2993 C  CZ    . ARG A 1 435 ? 67.045  27.838  15.610  1.00 20.38 ? 469  ARG A CZ    1 
ATOM   2994 N  NH1   . ARG A 1 435 ? 67.574  26.893  16.374  1.00 19.86 ? 469  ARG A NH1   1 
ATOM   2995 N  NH2   . ARG A 1 435 ? 67.828  28.781  15.102  1.00 19.95 ? 469  ARG A NH2   1 
ATOM   2996 N  N     . SER A 1 436 ? 63.064  30.630  19.746  1.00 24.01 ? 470  SER A N     1 
ATOM   2997 C  CA    . SER A 1 436 ? 62.484  31.933  20.128  1.00 24.69 ? 470  SER A CA    1 
ATOM   2998 C  C     . SER A 1 436 ? 61.198  31.806  20.926  1.00 24.93 ? 470  SER A C     1 
ATOM   2999 O  O     . SER A 1 436 ? 60.117  32.122  20.435  1.00 25.00 ? 470  SER A O     1 
ATOM   3000 C  CB    . SER A 1 436 ? 62.272  32.840  18.902  1.00 24.87 ? 470  SER A CB    1 
ATOM   3001 O  OG    . SER A 1 436 ? 61.719  32.125  17.810  1.00 25.95 ? 470  SER A OG    1 
ATOM   3002 N  N     . GLY A 1 437 ? 61.326  31.311  22.152  1.00 25.46 ? 471  GLY A N     1 
ATOM   3003 C  CA    . GLY A 1 437 ? 60.202  31.249  23.083  1.00 26.07 ? 471  GLY A CA    1 
ATOM   3004 C  C     . GLY A 1 437 ? 59.213  30.109  22.896  1.00 26.44 ? 471  GLY A C     1 
ATOM   3005 O  O     . GLY A 1 437 ? 58.437  29.832  23.807  1.00 26.63 ? 471  GLY A O     1 
ATOM   3006 N  N     . LYS A 1 438 ? 59.245  29.436  21.743  1.00 26.83 ? 472  LYS A N     1 
ATOM   3007 C  CA    . LYS A 1 438 ? 58.262  28.396  21.416  1.00 27.17 ? 472  LYS A CA    1 
ATOM   3008 C  C     . LYS A 1 438 ? 58.531  27.043  22.085  1.00 27.41 ? 472  LYS A C     1 
ATOM   3009 O  O     . LYS A 1 438 ? 59.621  26.785  22.596  1.00 27.13 ? 472  LYS A O     1 
ATOM   3010 C  CB    . LYS A 1 438 ? 58.171  28.205  19.896  1.00 27.20 ? 472  LYS A CB    1 
ATOM   3011 C  CG    . LYS A 1 438 ? 57.775  29.461  19.127  1.00 27.72 ? 472  LYS A CG    1 
ATOM   3012 C  CD    . LYS A 1 438 ? 56.395  29.991  19.528  1.00 28.61 ? 472  LYS A CD    1 
ATOM   3013 C  CE    . LYS A 1 438 ? 56.070  31.316  18.853  1.00 28.98 ? 472  LYS A CE    1 
ATOM   3014 N  NZ    . LYS A 1 438 ? 57.019  32.405  19.250  1.00 28.73 ? 472  LYS A NZ    1 
ATOM   3015 N  N     . GLU A 1 439 ? 57.506  26.192  22.064  1.00 27.99 ? 473  GLU A N     1 
ATOM   3016 C  CA    . GLU A 1 439 ? 57.557  24.852  22.651  1.00 28.56 ? 473  GLU A CA    1 
ATOM   3017 C  C     . GLU A 1 439 ? 58.164  23.861  21.667  1.00 28.30 ? 473  GLU A C     1 
ATOM   3018 O  O     . GLU A 1 439 ? 58.296  24.154  20.475  1.00 28.69 ? 473  GLU A O     1 
ATOM   3019 C  CB    . GLU A 1 439 ? 56.140  24.386  23.043  1.00 29.05 ? 473  GLU A CB    1 
ATOM   3020 C  CG    . GLU A 1 439 ? 55.251  23.976  21.837  1.00 30.84 ? 473  GLU A CG    1 
ATOM   3021 C  CD    . GLU A 1 439 ? 53.756  23.884  22.170  1.00 33.11 ? 473  GLU A CD    1 
ATOM   3022 O  OE1   . GLU A 1 439 ? 53.407  23.285  23.221  1.00 34.92 ? 473  GLU A OE1   1 
ATOM   3023 O  OE2   . GLU A 1 439 ? 52.929  24.395  21.370  1.00 32.94 ? 473  GLU A OE2   1 
ATOM   3024 N  N     . GLY A 1 440 ? 58.507  22.676  22.161  1.00 27.99 ? 474  GLY A N     1 
ATOM   3025 C  CA    . GLY A 1 440 ? 59.027  21.618  21.300  1.00 27.60 ? 474  GLY A CA    1 
ATOM   3026 C  C     . GLY A 1 440 ? 59.321  20.323  22.027  1.00 27.22 ? 474  GLY A C     1 
ATOM   3027 O  O     . GLY A 1 440 ? 59.602  20.323  23.218  1.00 27.12 ? 474  GLY A O     1 
ATOM   3028 N  N     . SER A 1 441 ? 59.256  19.215  21.297  1.00 27.01 ? 475  SER A N     1 
ATOM   3029 C  CA    . SER A 1 441 ? 59.574  17.899  21.837  1.00 26.96 ? 475  SER A CA    1 
ATOM   3030 C  C     . SER A 1 441 ? 60.641  17.223  20.984  1.00 26.59 ? 475  SER A C     1 
ATOM   3031 O  O     . SER A 1 441 ? 60.824  17.575  19.816  1.00 26.47 ? 475  SER A O     1 
ATOM   3032 C  CB    . SER A 1 441 ? 58.316  17.024  21.865  1.00 27.09 ? 475  SER A CB    1 
ATOM   3033 O  OG    . SER A 1 441 ? 57.262  17.662  22.568  1.00 27.72 ? 475  SER A OG    1 
ATOM   3034 N  N     . SER A 1 442 ? 61.345  16.256  21.571  1.00 26.13 ? 476  SER A N     1 
ATOM   3035 C  CA    . SER A 1 442 ? 62.265  15.408  20.813  1.00 25.75 ? 476  SER A CA    1 
ATOM   3036 C  C     . SER A 1 442 ? 62.220  13.956  21.275  1.00 25.35 ? 476  SER A C     1 
ATOM   3037 O  O     . SER A 1 442 ? 62.065  13.672  22.469  1.00 25.44 ? 476  SER A O     1 
ATOM   3038 C  CB    . SER A 1 442 ? 63.698  15.933  20.902  1.00 25.77 ? 476  SER A CB    1 
ATOM   3039 O  OG    . SER A 1 442 ? 64.256  15.717  22.181  1.00 26.07 ? 476  SER A OG    1 
ATOM   3040 N  N     . VAL A 1 443 ? 62.359  13.045  20.315  1.00 24.81 ? 477  VAL A N     1 
ATOM   3041 C  CA    . VAL A 1 443 ? 62.407  11.613  20.588  1.00 24.28 ? 477  VAL A CA    1 
ATOM   3042 C  C     . VAL A 1 443 ? 63.610  11.018  19.884  1.00 23.83 ? 477  VAL A C     1 
ATOM   3043 O  O     . VAL A 1 443 ? 63.763  11.170  18.674  1.00 23.37 ? 477  VAL A O     1 
ATOM   3044 C  CB    . VAL A 1 443 ? 61.133  10.893  20.104  1.00 24.48 ? 477  VAL A CB    1 
ATOM   3045 C  CG1   . VAL A 1 443 ? 61.171  9.417   20.495  1.00 23.74 ? 477  VAL A CG1   1 
ATOM   3046 C  CG2   . VAL A 1 443 ? 59.898  11.570  20.680  1.00 24.41 ? 477  VAL A CG2   1 
ATOM   3047 N  N     . LEU A 1 444 ? 64.471  10.367  20.657  1.00 23.66 ? 478  LEU A N     1 
ATOM   3048 C  CA    . LEU A 1 444 ? 65.619  9.630   20.129  1.00 23.69 ? 478  LEU A CA    1 
ATOM   3049 C  C     . LEU A 1 444 ? 65.256  8.133   19.996  1.00 23.75 ? 478  LEU A C     1 
ATOM   3050 O  O     . LEU A 1 444 ? 64.982  7.475   20.996  1.00 23.43 ? 478  LEU A O     1 
ATOM   3051 C  CB    . LEU A 1 444 ? 66.817  9.818   21.070  1.00 23.55 ? 478  LEU A CB    1 
ATOM   3052 C  CG    . LEU A 1 444 ? 68.092  9.017   20.772  1.00 23.57 ? 478  LEU A CG    1 
ATOM   3053 C  CD1   . LEU A 1 444 ? 68.611  9.325   19.380  1.00 22.58 ? 478  LEU A CD1   1 
ATOM   3054 C  CD2   . LEU A 1 444 ? 69.163  9.282   21.829  1.00 22.02 ? 478  LEU A CD2   1 
ATOM   3055 N  N     . PHE A 1 445 ? 65.231  7.619   18.767  1.00 23.89 ? 479  PHE A N     1 
ATOM   3056 C  CA    . PHE A 1 445 ? 64.953  6.205   18.505  1.00 24.21 ? 479  PHE A CA    1 
ATOM   3057 C  C     . PHE A 1 445 ? 66.262  5.450   18.312  1.00 24.50 ? 479  PHE A C     1 
ATOM   3058 O  O     . PHE A 1 445 ? 66.933  5.613   17.282  1.00 24.09 ? 479  PHE A O     1 
ATOM   3059 C  CB    . PHE A 1 445 ? 64.075  6.019   17.258  1.00 24.29 ? 479  PHE A CB    1 
ATOM   3060 C  CG    . PHE A 1 445 ? 62.722  6.670   17.358  1.00 24.91 ? 479  PHE A CG    1 
ATOM   3061 C  CD1   . PHE A 1 445 ? 61.681  6.032   18.020  1.00 24.49 ? 479  PHE A CD1   1 
ATOM   3062 C  CD2   . PHE A 1 445 ? 62.489  7.921   16.779  1.00 25.23 ? 479  PHE A CD2   1 
ATOM   3063 C  CE1   . PHE A 1 445 ? 60.432  6.625   18.117  1.00 25.27 ? 479  PHE A CE1   1 
ATOM   3064 C  CE2   . PHE A 1 445 ? 61.240  8.522   16.864  1.00 25.71 ? 479  PHE A CE2   1 
ATOM   3065 C  CZ    . PHE A 1 445 ? 60.207  7.878   17.539  1.00 25.97 ? 479  PHE A CZ    1 
ATOM   3066 N  N     . ILE A 1 446 ? 66.610  4.622   19.300  1.00 24.72 ? 480  ILE A N     1 
ATOM   3067 C  CA    . ILE A 1 446 ? 67.848  3.841   19.275  1.00 25.11 ? 480  ILE A CA    1 
ATOM   3068 C  C     . ILE A 1 446 ? 67.590  2.380   19.629  1.00 25.67 ? 480  ILE A C     1 
ATOM   3069 O  O     . ILE A 1 446 ? 66.506  2.027   20.092  1.00 25.86 ? 480  ILE A O     1 
ATOM   3070 C  CB    . ILE A 1 446 ? 68.885  4.405   20.272  1.00 25.02 ? 480  ILE A CB    1 
ATOM   3071 C  CG1   . ILE A 1 446 ? 68.312  4.445   21.695  1.00 24.53 ? 480  ILE A CG1   1 
ATOM   3072 C  CG2   . ILE A 1 446 ? 69.334  5.798   19.846  1.00 25.07 ? 480  ILE A CG2   1 
ATOM   3073 C  CD1   . ILE A 1 446 ? 69.309  4.844   22.740  1.00 23.78 ? 480  ILE A CD1   1 
ATOM   3074 N  N     . CYS A 1 447 ? 68.595  1.535   19.422  1.00 26.19 ? 481  CYS A N     1 
ATOM   3075 C  CA    . CYS A 1 447 ? 68.536  0.148   19.878  1.00 26.60 ? 481  CYS A CA    1 
ATOM   3076 C  C     . CYS A 1 447 ? 69.362  -0.043  21.144  1.00 26.82 ? 481  CYS A C     1 
ATOM   3077 O  O     . CYS A 1 447 ? 70.186  0.799   21.479  1.00 26.80 ? 481  CYS A O     1 
ATOM   3078 C  CB    . CYS A 1 447 ? 69.026  -0.786  18.784  1.00 26.69 ? 481  CYS A CB    1 
ATOM   3079 S  SG    . CYS A 1 447 ? 70.737  -0.532  18.322  1.00 27.53 ? 481  CYS A SG    1 
ATOM   3080 N  N     . LYS A 1 448 ? 69.128  -1.150  21.843  1.00 27.31 ? 482  LYS A N     1 
ATOM   3081 C  CA    . LYS A 1 448 ? 69.885  -1.504  23.055  1.00 27.76 ? 482  LYS A CA    1 
ATOM   3082 C  C     . LYS A 1 448 ? 71.393  -1.251  22.931  1.00 27.97 ? 482  LYS A C     1 
ATOM   3083 O  O     . LYS A 1 448 ? 72.007  -0.684  23.838  1.00 27.86 ? 482  LYS A O     1 
ATOM   3084 C  CB    . LYS A 1 448 ? 69.657  -2.980  23.426  1.00 27.78 ? 482  LYS A CB    1 
ATOM   3085 C  CG    . LYS A 1 448 ? 68.337  -3.257  24.132  1.00 28.46 ? 482  LYS A CG    1 
ATOM   3086 N  N     . ASP A 1 449 ? 71.975  -1.663  21.805  1.00 28.26 ? 483  ASP A N     1 
ATOM   3087 C  CA    . ASP A 1 449 ? 73.423  -1.580  21.607  1.00 28.71 ? 483  ASP A CA    1 
ATOM   3088 C  C     . ASP A 1 449 ? 73.956  -0.162  21.408  1.00 28.97 ? 483  ASP A C     1 
ATOM   3089 O  O     . ASP A 1 449 ? 75.174  0.039   21.409  1.00 28.94 ? 483  ASP A O     1 
ATOM   3090 C  CB    . ASP A 1 449 ? 73.854  -2.473  20.440  1.00 28.91 ? 483  ASP A CB    1 
ATOM   3091 C  CG    . ASP A 1 449 ? 73.702  -3.955  20.759  1.00 29.64 ? 483  ASP A CG    1 
ATOM   3092 O  OD1   . ASP A 1 449 ? 74.359  -4.428  21.714  1.00 30.49 ? 483  ASP A OD1   1 
ATOM   3093 O  OD2   . ASP A 1 449 ? 72.915  -4.643  20.070  1.00 30.82 ? 483  ASP A OD2   1 
ATOM   3094 N  N     . GLU A 1 450 ? 73.055  0.810   21.239  1.00 29.06 ? 484  GLU A N     1 
ATOM   3095 C  CA    . GLU A 1 450 ? 73.432  2.220   21.158  1.00 29.13 ? 484  GLU A CA    1 
ATOM   3096 C  C     . GLU A 1 450 ? 73.297  2.950   22.501  1.00 29.08 ? 484  GLU A C     1 
ATOM   3097 O  O     . GLU A 1 450 ? 73.575  4.145   22.579  1.00 28.82 ? 484  GLU A O     1 
ATOM   3098 C  CB    . GLU A 1 450 ? 72.574  2.949   20.121  1.00 29.29 ? 484  GLU A CB    1 
ATOM   3099 C  CG    . GLU A 1 450 ? 72.583  2.344   18.730  1.00 29.98 ? 484  GLU A CG    1 
ATOM   3100 C  CD    . GLU A 1 450 ? 71.630  3.070   17.785  1.00 30.04 ? 484  GLU A CD    1 
ATOM   3101 O  OE1   . GLU A 1 450 ? 70.476  2.611   17.611  1.00 29.84 ? 484  GLU A OE1   1 
ATOM   3102 O  OE2   . GLU A 1 450 ? 72.038  4.115   17.233  1.00 30.12 ? 484  GLU A OE2   1 
ATOM   3103 N  N     . LEU A 1 451 ? 72.887  2.246   23.558  1.00 29.06 ? 485  LEU A N     1 
ATOM   3104 C  CA    . LEU A 1 451 ? 72.702  2.885   24.870  1.00 29.02 ? 485  LEU A CA    1 
ATOM   3105 C  C     . LEU A 1 451 ? 73.955  3.566   25.440  1.00 29.00 ? 485  LEU A C     1 
ATOM   3106 O  O     . LEU A 1 451 ? 73.826  4.539   26.183  1.00 29.24 ? 485  LEU A O     1 
ATOM   3107 C  CB    . LEU A 1 451 ? 72.142  1.901   25.911  1.00 29.03 ? 485  LEU A CB    1 
ATOM   3108 C  CG    . LEU A 1 451 ? 70.628  1.642   25.942  1.00 29.15 ? 485  LEU A CG    1 
ATOM   3109 C  CD1   . LEU A 1 451 ? 70.297  0.708   27.099  1.00 29.04 ? 485  LEU A CD1   1 
ATOM   3110 C  CD2   . LEU A 1 451 ? 69.811  2.932   26.058  1.00 28.88 ? 485  LEU A CD2   1 
ATOM   3111 N  N     . PRO A 1 452 ? 75.164  3.062   25.118  1.00 28.93 ? 486  PRO A N     1 
ATOM   3112 C  CA    . PRO A 1 452 ? 76.354  3.759   25.620  1.00 29.04 ? 486  PRO A CA    1 
ATOM   3113 C  C     . PRO A 1 452 ? 76.403  5.243   25.240  1.00 29.13 ? 486  PRO A C     1 
ATOM   3114 O  O     . PRO A 1 452 ? 76.955  6.053   25.987  1.00 29.25 ? 486  PRO A O     1 
ATOM   3115 C  CB    . PRO A 1 452 ? 77.503  2.993   24.960  1.00 29.04 ? 486  PRO A CB    1 
ATOM   3116 C  CG    . PRO A 1 452 ? 76.970  1.619   24.775  1.00 28.78 ? 486  PRO A CG    1 
ATOM   3117 C  CD    . PRO A 1 452 ? 75.519  1.792   24.454  1.00 28.81 ? 486  PRO A CD    1 
ATOM   3118 N  N     . PHE A 1 453 ? 75.829  5.578   24.086  1.00 29.29 ? 487  PHE A N     1 
ATOM   3119 C  CA    . PHE A 1 453 ? 75.675  6.965   23.637  1.00 29.35 ? 487  PHE A CA    1 
ATOM   3120 C  C     . PHE A 1 453 ? 74.849  7.768   24.623  1.00 29.59 ? 487  PHE A C     1 
ATOM   3121 O  O     . PHE A 1 453 ? 75.222  8.883   24.998  1.00 29.89 ? 487  PHE A O     1 
ATOM   3122 C  CB    . PHE A 1 453 ? 75.012  7.011   22.255  1.00 29.21 ? 487  PHE A CB    1 
ATOM   3123 C  CG    . PHE A 1 453 ? 74.495  8.371   21.867  1.00 29.33 ? 487  PHE A CG    1 
ATOM   3124 C  CD1   . PHE A 1 453 ? 75.331  9.306   21.269  1.00 29.67 ? 487  PHE A CD1   1 
ATOM   3125 C  CD2   . PHE A 1 453 ? 73.169  8.712   22.086  1.00 28.28 ? 487  PHE A CD2   1 
ATOM   3126 C  CE1   . PHE A 1 453 ? 74.855  10.555  20.908  1.00 29.57 ? 487  PHE A CE1   1 
ATOM   3127 C  CE2   . PHE A 1 453 ? 72.691  9.964   21.737  1.00 28.30 ? 487  PHE A CE2   1 
ATOM   3128 C  CZ    . PHE A 1 453 ? 73.529  10.883  21.144  1.00 28.95 ? 487  PHE A CZ    1 
ATOM   3129 N  N     . VAL A 1 454 ? 73.722  7.201   25.039  1.00 29.92 ? 488  VAL A N     1 
ATOM   3130 C  CA    . VAL A 1 454 ? 72.860  7.863   26.007  1.00 30.25 ? 488  VAL A CA    1 
ATOM   3131 C  C     . VAL A 1 454 ? 73.613  8.092   27.313  1.00 30.78 ? 488  VAL A C     1 
ATOM   3132 O  O     . VAL A 1 454 ? 73.520  9.169   27.886  1.00 30.85 ? 488  VAL A O     1 
ATOM   3133 C  CB    . VAL A 1 454 ? 71.569  7.064   26.271  1.00 30.26 ? 488  VAL A CB    1 
ATOM   3134 C  CG1   . VAL A 1 454 ? 70.747  7.715   27.386  1.00 29.58 ? 488  VAL A CG1   1 
ATOM   3135 C  CG2   . VAL A 1 454 ? 70.758  6.952   24.994  1.00 29.57 ? 488  VAL A CG2   1 
ATOM   3136 N  N     . ARG A 1 455 ? 74.363  7.088   27.769  1.00 31.55 ? 489  ARG A N     1 
ATOM   3137 C  CA    . ARG A 1 455 ? 75.182  7.229   28.982  1.00 32.33 ? 489  ARG A CA    1 
ATOM   3138 C  C     . ARG A 1 455 ? 76.245  8.315   28.828  1.00 32.52 ? 489  ARG A C     1 
ATOM   3139 O  O     . ARG A 1 455 ? 76.457  9.106   29.739  1.00 32.43 ? 489  ARG A O     1 
ATOM   3140 C  CB    . ARG A 1 455 ? 75.859  5.906   29.363  1.00 32.58 ? 489  ARG A CB    1 
ATOM   3141 C  CG    . ARG A 1 455 ? 74.949  4.923   30.086  1.00 34.04 ? 489  ARG A CG    1 
ATOM   3142 C  CD    . ARG A 1 455 ? 75.731  3.730   30.656  1.00 36.08 ? 489  ARG A CD    1 
ATOM   3143 N  NE    . ARG A 1 455 ? 76.233  2.812   29.621  1.00 37.31 ? 489  ARG A NE    1 
ATOM   3144 C  CZ    . ARG A 1 455 ? 75.493  1.917   28.957  1.00 38.08 ? 489  ARG A CZ    1 
ATOM   3145 N  NH1   . ARG A 1 455 ? 74.184  1.797   29.184  1.00 37.98 ? 489  ARG A NH1   1 
ATOM   3146 N  NH2   . ARG A 1 455 ? 76.066  1.135   28.046  1.00 38.37 ? 489  ARG A NH2   1 
ATOM   3147 N  N     . GLU A 1 456 ? 76.907  8.351   27.677  1.00 32.93 ? 490  GLU A N     1 
ATOM   3148 C  CA    . GLU A 1 456 ? 77.940  9.355   27.419  1.00 33.42 ? 490  GLU A CA    1 
ATOM   3149 C  C     . GLU A 1 456 ? 77.371  10.788  27.432  1.00 33.70 ? 490  GLU A C     1 
ATOM   3150 O  O     . GLU A 1 456 ? 78.066  11.722  27.835  1.00 33.57 ? 490  GLU A O     1 
ATOM   3151 C  CB    . GLU A 1 456 ? 78.673  9.044   26.100  1.00 33.48 ? 490  GLU A CB    1 
ATOM   3152 C  CG    . GLU A 1 456 ? 79.862  9.956   25.759  1.00 33.98 ? 490  GLU A CG    1 
ATOM   3153 C  CD    . GLU A 1 456 ? 81.076  9.787   26.675  1.00 35.27 ? 490  GLU A CD    1 
ATOM   3154 O  OE1   . GLU A 1 456 ? 80.936  9.284   27.812  1.00 36.39 ? 490  GLU A OE1   1 
ATOM   3155 O  OE2   . GLU A 1 456 ? 82.190  10.177  26.254  1.00 35.84 ? 490  GLU A OE2   1 
ATOM   3156 N  N     . LEU A 1 457 ? 76.116  10.957  27.006  1.00 34.00 ? 491  LEU A N     1 
ATOM   3157 C  CA    . LEU A 1 457 ? 75.421  12.249  27.141  1.00 34.20 ? 491  LEU A CA    1 
ATOM   3158 C  C     . LEU A 1 457 ? 75.353  12.743  28.590  1.00 34.57 ? 491  LEU A C     1 
ATOM   3159 O  O     . LEU A 1 457 ? 75.462  13.944  28.842  1.00 34.45 ? 491  LEU A O     1 
ATOM   3160 C  CB    . LEU A 1 457 ? 74.004  12.185  26.560  1.00 34.10 ? 491  LEU A CB    1 
ATOM   3161 C  CG    . LEU A 1 457 ? 73.855  12.547  25.083  1.00 33.78 ? 491  LEU A CG    1 
ATOM   3162 C  CD1   . LEU A 1 457 ? 72.493  12.125  24.577  1.00 33.32 ? 491  LEU A CD1   1 
ATOM   3163 C  CD2   . LEU A 1 457 ? 74.067  14.042  24.879  1.00 33.92 ? 491  LEU A CD2   1 
ATOM   3164 N  N     . GLU A 1 458 ? 75.157  11.821  29.532  1.00 35.20 ? 492  GLU A N     1 
ATOM   3165 C  CA    . GLU A 1 458 ? 75.167  12.154  30.963  1.00 35.72 ? 492  GLU A CA    1 
ATOM   3166 C  C     . GLU A 1 458 ? 76.588  12.481  31.421  1.00 35.97 ? 492  GLU A C     1 
ATOM   3167 O  O     . GLU A 1 458 ? 76.830  13.517  32.036  1.00 35.98 ? 492  GLU A O     1 
ATOM   3168 C  CB    . GLU A 1 458 ? 74.623  10.994  31.810  1.00 35.81 ? 492  GLU A CB    1 
ATOM   3169 C  CG    . GLU A 1 458 ? 73.161  10.608  31.542  1.00 36.33 ? 492  GLU A CG    1 
ATOM   3170 C  CD    . GLU A 1 458 ? 72.774  9.265   32.166  1.00 36.74 ? 492  GLU A CD    1 
ATOM   3171 O  OE1   . GLU A 1 458 ? 73.604  8.675   32.893  1.00 37.00 ? 492  GLU A OE1   1 
ATOM   3172 O  OE2   . GLU A 1 458 ? 71.642  8.792   31.920  1.00 36.53 ? 492  GLU A OE2   1 
ATOM   3173 N  N     . ASP A 1 459 ? 77.520  11.586  31.104  1.00 36.30 ? 493  ASP A N     1 
ATOM   3174 C  CA    . ASP A 1 459 ? 78.907  11.700  31.557  1.00 36.63 ? 493  ASP A CA    1 
ATOM   3175 C  C     . ASP A 1 459 ? 79.628  12.930  30.984  1.00 36.55 ? 493  ASP A C     1 
ATOM   3176 O  O     . ASP A 1 459 ? 80.217  13.710  31.734  1.00 36.49 ? 493  ASP A O     1 
ATOM   3177 C  CB    . ASP A 1 459 ? 79.686  10.413  31.220  1.00 36.76 ? 493  ASP A CB    1 
ATOM   3178 C  CG    . ASP A 1 459 ? 79.190  9.187   32.011  1.00 37.63 ? 493  ASP A CG    1 
ATOM   3179 O  OD1   . ASP A 1 459 ? 78.134  9.273   32.682  1.00 38.35 ? 493  ASP A OD1   1 
ATOM   3180 O  OD2   . ASP A 1 459 ? 79.862  8.129   31.960  1.00 38.29 ? 493  ASP A OD2   1 
ATOM   3181 N  N     . ALA A 1 460 ? 79.557  13.109  29.668  1.00 36.61 ? 494  ALA A N     1 
ATOM   3182 C  CA    . ALA A 1 460 ? 80.336  14.145  28.980  1.00 36.78 ? 494  ALA A CA    1 
ATOM   3183 C  C     . ALA A 1 460 ? 79.626  15.496  28.853  1.00 36.93 ? 494  ALA A C     1 
ATOM   3184 O  O     . ALA A 1 460 ? 80.292  16.529  28.784  1.00 36.99 ? 494  ALA A O     1 
ATOM   3185 C  CB    . ALA A 1 460 ? 80.758  13.651  27.604  1.00 36.76 ? 494  ALA A CB    1 
ATOM   3186 N  N     . LYS A 1 461 ? 78.294  15.491  28.810  1.00 37.13 ? 495  LYS A N     1 
ATOM   3187 C  CA    . LYS A 1 461 ? 77.515  16.728  28.607  1.00 37.37 ? 495  LYS A CA    1 
ATOM   3188 C  C     . LYS A 1 461 ? 76.474  17.044  29.696  1.00 37.38 ? 495  LYS A C     1 
ATOM   3189 O  O     . LYS A 1 461 ? 75.841  18.096  29.643  1.00 37.45 ? 495  LYS A O     1 
ATOM   3190 C  CB    . LYS A 1 461 ? 76.821  16.693  27.236  1.00 37.31 ? 495  LYS A CB    1 
ATOM   3191 C  CG    . LYS A 1 461 ? 77.767  16.856  26.040  1.00 37.79 ? 495  LYS A CG    1 
ATOM   3192 C  CD    . LYS A 1 461 ? 78.122  18.318  25.797  1.00 38.08 ? 495  LYS A CD    1 
ATOM   3193 C  CE    . LYS A 1 461 ? 79.342  18.466  24.905  1.00 37.96 ? 495  LYS A CE    1 
ATOM   3194 N  NZ    . LYS A 1 461 ? 79.681  19.904  24.689  1.00 37.78 ? 495  LYS A NZ    1 
ATOM   3195 N  N     . ASN A 1 462 ? 76.289  16.152  30.666  1.00 37.47 ? 496  ASN A N     1 
ATOM   3196 C  CA    . ASN A 1 462 ? 75.336  16.385  31.763  1.00 37.72 ? 496  ASN A CA    1 
ATOM   3197 C  C     . ASN A 1 462 ? 73.880  16.420  31.274  1.00 37.63 ? 496  ASN A C     1 
ATOM   3198 O  O     . ASN A 1 462 ? 73.034  17.094  31.858  1.00 37.59 ? 496  ASN A O     1 
ATOM   3199 C  CB    . ASN A 1 462 ? 75.697  17.681  32.519  1.00 37.82 ? 496  ASN A CB    1 
ATOM   3200 C  CG    . ASN A 1 462 ? 75.111  17.742  33.925  1.00 38.57 ? 496  ASN A CG    1 
ATOM   3201 O  OD1   . ASN A 1 462 ? 74.465  16.801  34.391  1.00 39.80 ? 496  ASN A OD1   1 
ATOM   3202 N  ND2   . ASN A 1 462 ? 75.337  18.864  34.608  1.00 38.95 ? 496  ASN A ND2   1 
ATOM   3203 N  N     . ILE A 1 463 ? 73.594  15.680  30.205  1.00 37.66 ? 497  ILE A N     1 
ATOM   3204 C  CA    . ILE A 1 463 ? 72.250  15.632  29.631  1.00 37.71 ? 497  ILE A CA    1 
ATOM   3205 C  C     . ILE A 1 463 ? 71.551  14.334  30.034  1.00 37.81 ? 497  ILE A C     1 
ATOM   3206 O  O     . ILE A 1 463 ? 71.968  13.243  29.642  1.00 37.46 ? 497  ILE A O     1 
ATOM   3207 C  CB    . ILE A 1 463 ? 72.291  15.760  28.100  1.00 37.75 ? 497  ILE A CB    1 
ATOM   3208 C  CG1   . ILE A 1 463 ? 73.000  17.059  27.709  1.00 37.70 ? 497  ILE A CG1   1 
ATOM   3209 C  CG2   . ILE A 1 463 ? 70.881  15.729  27.520  1.00 37.61 ? 497  ILE A CG2   1 
ATOM   3210 C  CD1   . ILE A 1 463 ? 72.821  17.435  26.270  1.00 37.89 ? 497  ILE A CD1   1 
ATOM   3211 N  N     . VAL A 1 464 ? 70.488  14.472  30.823  1.00 38.12 ? 498  VAL A N     1 
ATOM   3212 C  CA    . VAL A 1 464 ? 69.781  13.336  31.409  1.00 38.26 ? 498  VAL A CA    1 
ATOM   3213 C  C     . VAL A 1 464 ? 68.355  13.275  30.870  1.00 38.38 ? 498  VAL A C     1 
ATOM   3214 O  O     . VAL A 1 464 ? 67.474  13.998  31.343  1.00 38.54 ? 498  VAL A O     1 
ATOM   3215 C  CB    . VAL A 1 464 ? 69.752  13.455  32.941  1.00 38.32 ? 498  VAL A CB    1 
ATOM   3216 C  CG1   . VAL A 1 464 ? 68.883  12.362  33.560  1.00 38.64 ? 498  VAL A CG1   1 
ATOM   3217 C  CG2   . VAL A 1 464 ? 71.171  13.408  33.494  1.00 38.22 ? 498  VAL A CG2   1 
ATOM   3218 N  N     . ILE A 1 465 ? 68.142  12.410  29.878  1.00 38.25 ? 499  ILE A N     1 
ATOM   3219 C  CA    . ILE A 1 465 ? 66.829  12.230  29.260  1.00 38.02 ? 499  ILE A CA    1 
ATOM   3220 C  C     . ILE A 1 465 ? 65.906  11.507  30.244  1.00 38.00 ? 499  ILE A C     1 
ATOM   3221 O  O     . ILE A 1 465 ? 66.131  10.343  30.582  1.00 38.08 ? 499  ILE A O     1 
ATOM   3222 C  CB    . ILE A 1 465 ? 66.922  11.422  27.942  1.00 38.04 ? 499  ILE A CB    1 
ATOM   3223 C  CG1   . ILE A 1 465 ? 67.898  12.080  26.959  1.00 37.52 ? 499  ILE A CG1   1 
ATOM   3224 C  CG2   . ILE A 1 465 ? 65.558  11.306  27.283  1.00 38.16 ? 499  ILE A CG2   1 
ATOM   3225 C  CD1   . ILE A 1 465 ? 68.224  11.213  25.762  1.00 37.74 ? 499  ILE A CD1   1 
ATOM   3226 N  N     . ALA A 1 466 ? 64.883  12.216  30.716  1.00 37.86 ? 500  ALA A N     1 
ATOM   3227 C  CA    . ALA A 1 466 ? 63.932  11.676  31.682  1.00 37.62 ? 500  ALA A CA    1 
ATOM   3228 C  C     . ALA A 1 466 ? 63.104  10.550  31.079  1.00 37.41 ? 500  ALA A C     1 
ATOM   3229 O  O     . ALA A 1 466 ? 63.172  9.410   31.532  1.00 37.35 ? 500  ALA A O     1 
ATOM   3230 C  CB    . ALA A 1 466 ? 63.013  12.783  32.187  1.00 37.78 ? 500  ALA A CB    1 
ATOM   3231 N  N     . LYS A 1 467 ? 62.337  10.877  30.043  1.00 37.24 ? 501  LYS A N     1 
ATOM   3232 C  CA    . LYS A 1 467 ? 61.402  9.925   29.444  1.00 37.11 ? 501  LYS A CA    1 
ATOM   3233 C  C     . LYS A 1 467 ? 62.100  8.834   28.624  1.00 36.68 ? 501  LYS A C     1 
ATOM   3234 O  O     . LYS A 1 467 ? 62.707  9.110   27.590  1.00 36.79 ? 501  LYS A O     1 
ATOM   3235 C  CB    . LYS A 1 467 ? 60.376  10.657  28.579  1.00 37.20 ? 501  LYS A CB    1 
ATOM   3236 C  CG    . LYS A 1 467 ? 59.388  11.508  29.373  1.00 37.90 ? 501  LYS A CG    1 
ATOM   3237 C  CD    . LYS A 1 467 ? 58.386  12.192  28.445  1.00 38.93 ? 501  LYS A CD    1 
ATOM   3238 C  CE    . LYS A 1 467 ? 57.337  12.994  29.204  1.00 39.26 ? 501  LYS A CE    1 
ATOM   3239 N  NZ    . LYS A 1 467 ? 56.342  13.608  28.272  1.00 39.45 ? 501  LYS A NZ    1 
ATOM   3240 N  N     . GLN A 1 468 ? 62.012  7.597   29.103  1.00 36.19 ? 502  GLN A N     1 
ATOM   3241 C  CA    . GLN A 1 468 ? 62.542  6.443   28.389  1.00 36.03 ? 502  GLN A CA    1 
ATOM   3242 C  C     . GLN A 1 468 ? 61.484  5.357   28.310  1.00 35.46 ? 502  GLN A C     1 
ATOM   3243 O  O     . GLN A 1 468 ? 60.652  5.233   29.195  1.00 35.44 ? 502  GLN A O     1 
ATOM   3244 C  CB    . GLN A 1 468 ? 63.798  5.912   29.079  1.00 36.21 ? 502  GLN A CB    1 
ATOM   3245 C  CG    . GLN A 1 468 ? 64.845  6.994   29.330  1.00 37.27 ? 502  GLN A CG    1 
ATOM   3246 C  CD    . GLN A 1 468 ? 66.278  6.475   29.381  1.00 38.71 ? 502  GLN A CD    1 
ATOM   3247 O  OE1   . GLN A 1 468 ? 66.524  5.265   29.448  1.00 40.14 ? 502  GLN A OE1   1 
ATOM   3248 N  NE2   . GLN A 1 468 ? 67.233  7.400   29.357  1.00 39.12 ? 502  GLN A NE2   1 
ATOM   3249 N  N     . GLU A 1 469 ? 61.504  4.580   27.237  1.00 34.98 ? 503  GLU A N     1 
ATOM   3250 C  CA    . GLU A 1 469 ? 60.558  3.478   27.097  1.00 34.64 ? 503  GLU A CA    1 
ATOM   3251 C  C     . GLU A 1 469 ? 61.046  2.477   26.067  1.00 33.70 ? 503  GLU A C     1 
ATOM   3252 O  O     . GLU A 1 469 ? 61.822  2.825   25.179  1.00 33.59 ? 503  GLU A O     1 
ATOM   3253 C  CB    . GLU A 1 469 ? 59.162  3.997   26.728  1.00 34.78 ? 503  GLU A CB    1 
ATOM   3254 C  CG    . GLU A 1 469 ? 59.130  4.848   25.481  1.00 36.04 ? 503  GLU A CG    1 
ATOM   3255 C  CD    . GLU A 1 469 ? 57.788  5.525   25.245  1.00 37.60 ? 503  GLU A CD    1 
ATOM   3256 O  OE1   . GLU A 1 469 ? 57.151  5.965   26.230  1.00 38.35 ? 503  GLU A OE1   1 
ATOM   3257 O  OE2   . GLU A 1 469 ? 57.381  5.635   24.063  1.00 37.92 ? 503  GLU A OE2   1 
ATOM   3258 N  N     . LYS A 1 470 ? 60.595  1.233   26.213  1.00 32.65 ? 504  LYS A N     1 
ATOM   3259 C  CA    . LYS A 1 470 ? 60.956  0.148   25.304  1.00 31.80 ? 504  LYS A CA    1 
ATOM   3260 C  C     . LYS A 1 470 ? 60.011  0.155   24.114  1.00 30.94 ? 504  LYS A C     1 
ATOM   3261 O  O     . LYS A 1 470 ? 58.946  0.754   24.175  1.00 30.96 ? 504  LYS A O     1 
ATOM   3262 C  CB    . LYS A 1 470 ? 60.869  -1.210  26.022  1.00 31.87 ? 504  LYS A CB    1 
ATOM   3263 C  CG    . LYS A 1 470 ? 61.837  -1.385  27.188  1.00 31.58 ? 504  LYS A CG    1 
ATOM   3264 N  N     . TYR A 1 471 ? 60.398  -0.510  23.031  1.00 30.08 ? 505  TYR A N     1 
ATOM   3265 C  CA    . TYR A 1 471 ? 59.525  -0.660  21.866  1.00 29.22 ? 505  TYR A CA    1 
ATOM   3266 C  C     . TYR A 1 471 ? 59.731  -2.011  21.186  1.00 29.29 ? 505  TYR A C     1 
ATOM   3267 O  O     . TYR A 1 471 ? 60.865  -2.461  21.018  1.00 29.17 ? 505  TYR A O     1 
ATOM   3268 C  CB    . TYR A 1 471 ? 59.778  0.459   20.848  1.00 28.75 ? 505  TYR A CB    1 
ATOM   3269 C  CG    . TYR A 1 471 ? 59.054  0.243   19.534  1.00 26.75 ? 505  TYR A CG    1 
ATOM   3270 C  CD1   . TYR A 1 471 ? 57.704  0.572   19.399  1.00 25.77 ? 505  TYR A CD1   1 
ATOM   3271 C  CD2   . TYR A 1 471 ? 59.708  -0.305  18.436  1.00 24.55 ? 505  TYR A CD2   1 
ATOM   3272 C  CE1   . TYR A 1 471 ? 57.024  0.360   18.203  1.00 25.11 ? 505  TYR A CE1   1 
ATOM   3273 C  CE2   . TYR A 1 471 ? 59.037  -0.522  17.230  1.00 24.68 ? 505  TYR A CE2   1 
ATOM   3274 C  CZ    . TYR A 1 471 ? 57.696  -0.186  17.123  1.00 24.39 ? 505  TYR A CZ    1 
ATOM   3275 O  OH    . TYR A 1 471 ? 57.036  -0.393  15.945  1.00 23.23 ? 505  TYR A OH    1 
ATOM   3276 N  N     . GLU A 1 472 ? 58.632  -2.636  20.770  1.00 29.30 ? 506  GLU A N     1 
ATOM   3277 C  CA    . GLU A 1 472 ? 58.698  -3.855  19.975  1.00 29.41 ? 506  GLU A CA    1 
ATOM   3278 C  C     . GLU A 1 472 ? 57.681  -3.792  18.834  1.00 29.21 ? 506  GLU A C     1 
ATOM   3279 O  O     . GLU A 1 472 ? 56.492  -3.615  19.080  1.00 29.43 ? 506  GLU A O     1 
ATOM   3280 C  CB    . GLU A 1 472 ? 58.427  -5.077  20.861  1.00 29.58 ? 506  GLU A CB    1 
ATOM   3281 C  CG    . GLU A 1 472 ? 58.995  -6.390  20.299  1.00 30.49 ? 506  GLU A CG    1 
ATOM   3282 C  CD    . GLU A 1 472 ? 60.523  -6.457  20.369  1.00 31.59 ? 506  GLU A CD    1 
ATOM   3283 O  OE1   . GLU A 1 472 ? 61.078  -6.284  21.479  1.00 33.25 ? 506  GLU A OE1   1 
ATOM   3284 O  OE2   . GLU A 1 472 ? 61.171  -6.688  19.322  1.00 31.21 ? 506  GLU A OE2   1 
ATOM   3285 N  N     . PRO A 1 473 ? 58.137  -3.947  17.581  1.00 28.97 ? 507  PRO A N     1 
ATOM   3286 C  CA    . PRO A 1 473 ? 57.209  -3.874  16.448  1.00 29.01 ? 507  PRO A CA    1 
ATOM   3287 C  C     . PRO A 1 473 ? 56.245  -5.055  16.342  1.00 29.16 ? 507  PRO A C     1 
ATOM   3288 O  O     . PRO A 1 473 ? 56.641  -6.199  16.539  1.00 29.18 ? 507  PRO A O     1 
ATOM   3289 C  CB    . PRO A 1 473 ? 58.139  -3.889  15.236  1.00 28.90 ? 507  PRO A CB    1 
ATOM   3290 C  CG    . PRO A 1 473 ? 59.329  -4.633  15.692  1.00 28.87 ? 507  PRO A CG    1 
ATOM   3291 C  CD    . PRO A 1 473 ? 59.507  -4.265  17.143  1.00 28.88 ? 507  PRO A CD    1 
ATOM   3292 N  N     . SER A 1 474 ? 54.993  -4.762  16.010  1.00 29.42 ? 508  SER A N     1 
ATOM   3293 C  CA    . SER A 1 474 ? 54.022  -5.780  15.640  1.00 29.61 ? 508  SER A CA    1 
ATOM   3294 C  C     . SER A 1 474 ? 54.363  -6.323  14.252  1.00 30.04 ? 508  SER A C     1 
ATOM   3295 O  O     . SER A 1 474 ? 55.048  -5.666  13.472  1.00 29.79 ? 508  SER A O     1 
ATOM   3296 C  CB    . SER A 1 474 ? 52.624  -5.172  15.613  1.00 29.45 ? 508  SER A CB    1 
ATOM   3297 O  OG    . SER A 1 474 ? 52.515  -4.223  14.563  1.00 29.00 ? 508  SER A OG    1 
ATOM   3298 N  N     . GLU A 1 475 ? 53.875  -7.519  13.937  1.00 30.65 ? 509  GLU A N     1 
ATOM   3299 C  CA    . GLU A 1 475 ? 54.113  -8.107  12.615  1.00 31.07 ? 509  GLU A CA    1 
ATOM   3300 C  C     . GLU A 1 475 ? 53.433  -7.291  11.507  1.00 30.92 ? 509  GLU A C     1 
ATOM   3301 O  O     . GLU A 1 475 ? 53.909  -7.258  10.373  1.00 30.84 ? 509  GLU A O     1 
ATOM   3302 C  CB    . GLU A 1 475 ? 53.642  -9.574  12.560  1.00 31.31 ? 509  GLU A CB    1 
ATOM   3303 C  CG    . GLU A 1 475 ? 54.473  -10.554 13.403  1.00 32.14 ? 509  GLU A CG    1 
ATOM   3304 C  CD    . GLU A 1 475 ? 55.953  -10.595 13.016  1.00 33.63 ? 509  GLU A CD    1 
ATOM   3305 O  OE1   . GLU A 1 475 ? 56.281  -10.505 11.809  1.00 34.61 ? 509  GLU A OE1   1 
ATOM   3306 O  OE2   . GLU A 1 475 ? 56.796  -10.722 13.930  1.00 34.67 ? 509  GLU A OE2   1 
ATOM   3307 N  N     . GLU A 1 476 ? 52.333  -6.623  11.848  1.00 30.81 ? 510  GLU A N     1 
ATOM   3308 C  CA    . GLU A 1 476 ? 51.553  -5.867  10.869  1.00 30.67 ? 510  GLU A CA    1 
ATOM   3309 C  C     . GLU A 1 476 ? 52.318  -4.639  10.386  1.00 30.29 ? 510  GLU A C     1 
ATOM   3310 O  O     . GLU A 1 476 ? 52.369  -4.370  9.182   1.00 30.18 ? 510  GLU A O     1 
ATOM   3311 C  CB    . GLU A 1 476 ? 50.194  -5.464  11.449  1.00 30.82 ? 510  GLU A CB    1 
ATOM   3312 C  CG    . GLU A 1 476 ? 49.215  -6.645  11.649  1.00 31.49 ? 510  GLU A CG    1 
ATOM   3313 C  CD    . GLU A 1 476 ? 49.484  -7.486  12.907  1.00 32.36 ? 510  GLU A CD    1 
ATOM   3314 O  OE1   . GLU A 1 476 ? 50.430  -7.174  13.667  1.00 32.82 ? 510  GLU A OE1   1 
ATOM   3315 O  OE2   . GLU A 1 476 ? 48.738  -8.468  13.134  1.00 32.83 ? 510  GLU A OE2   1 
ATOM   3316 N  N     . ILE A 1 477 ? 52.926  -3.907  11.317  1.00 29.89 ? 511  ILE A N     1 
ATOM   3317 C  CA    . ILE A 1 477 ? 53.716  -2.731  10.950  1.00 29.75 ? 511  ILE A CA    1 
ATOM   3318 C  C     . ILE A 1 477 ? 54.929  -3.135  10.111  1.00 29.58 ? 511  ILE A C     1 
ATOM   3319 O  O     . ILE A 1 477 ? 55.270  -2.460  9.135   1.00 29.31 ? 511  ILE A O     1 
ATOM   3320 C  CB    . ILE A 1 477 ? 54.163  -1.897  12.186  1.00 29.72 ? 511  ILE A CB    1 
ATOM   3321 C  CG1   . ILE A 1 477 ? 54.707  -0.528  11.747  1.00 29.89 ? 511  ILE A CG1   1 
ATOM   3322 C  CG2   . ILE A 1 477 ? 55.211  -2.629  13.004  1.00 29.14 ? 511  ILE A CG2   1 
ATOM   3323 C  CD1   . ILE A 1 477 ? 53.763  0.277   10.880  1.00 29.86 ? 511  ILE A CD1   1 
ATOM   3324 N  N     . LYS A 1 478 ? 55.556  -4.247  10.481  1.00 29.42 ? 512  LYS A N     1 
ATOM   3325 C  CA    . LYS A 1 478 ? 56.668  -4.784  9.715   1.00 29.45 ? 512  LYS A CA    1 
ATOM   3326 C  C     . LYS A 1 478 ? 56.231  -5.105  8.287   1.00 29.46 ? 512  LYS A C     1 
ATOM   3327 O  O     . LYS A 1 478 ? 56.932  -4.775  7.329   1.00 29.39 ? 512  LYS A O     1 
ATOM   3328 C  CB    . LYS A 1 478 ? 57.249  -6.019  10.407  1.00 29.49 ? 512  LYS A CB    1 
ATOM   3329 C  CG    . LYS A 1 478 ? 57.947  -5.693  11.721  1.00 29.79 ? 512  LYS A CG    1 
ATOM   3330 C  CD    . LYS A 1 478 ? 58.481  -6.933  12.412  1.00 30.62 ? 512  LYS A CD    1 
ATOM   3331 C  CE    . LYS A 1 478 ? 59.785  -7.410  11.789  1.00 31.45 ? 512  LYS A CE    1 
ATOM   3332 N  NZ    . LYS A 1 478 ? 60.319  -8.630  12.466  1.00 31.69 ? 512  LYS A NZ    1 
ATOM   3333 N  N     . SER A 1 479 ? 55.060  -5.721  8.147   1.00 29.47 ? 513  SER A N     1 
ATOM   3334 C  CA    . SER A 1 479 ? 54.516  -6.048  6.835   1.00 29.59 ? 513  SER A CA    1 
ATOM   3335 C  C     . SER A 1 479 ? 54.192  -4.792  6.038   1.00 29.54 ? 513  SER A C     1 
ATOM   3336 O  O     . SER A 1 479 ? 54.580  -4.667  4.880   1.00 29.17 ? 513  SER A O     1 
ATOM   3337 C  CB    . SER A 1 479 ? 53.253  -6.897  6.980   1.00 29.63 ? 513  SER A CB    1 
ATOM   3338 O  OG    . SER A 1 479 ? 53.512  -8.030  7.779   1.00 30.19 ? 513  SER A OG    1 
ATOM   3339 N  N     . GLU A 1 480 ? 53.478  -3.870  6.672   1.00 29.87 ? 514  GLU A N     1 
ATOM   3340 C  CA    . GLU A 1 480 ? 53.085  -2.612  6.042   1.00 30.48 ? 514  GLU A CA    1 
ATOM   3341 C  C     . GLU A 1 480 ? 54.289  -1.831  5.493   1.00 30.57 ? 514  GLU A C     1 
ATOM   3342 O  O     . GLU A 1 480 ? 54.268  -1.353  4.351   1.00 30.63 ? 514  GLU A O     1 
ATOM   3343 C  CB    . GLU A 1 480 ? 52.319  -1.758  7.053   1.00 30.76 ? 514  GLU A CB    1 
ATOM   3344 C  CG    . GLU A 1 480 ? 51.659  -0.530  6.460   1.00 32.19 ? 514  GLU A CG    1 
ATOM   3345 C  CD    . GLU A 1 480 ? 50.788  0.209   7.458   1.00 33.67 ? 514  GLU A CD    1 
ATOM   3346 O  OE1   . GLU A 1 480 ? 50.020  -0.444  8.203   1.00 35.57 ? 514  GLU A OE1   1 
ATOM   3347 O  OE2   . GLU A 1 480 ? 50.862  1.449   7.485   1.00 34.51 ? 514  GLU A OE2   1 
ATOM   3348 N  N     . VAL A 1 481 ? 55.341  -1.724  6.299   1.00 30.61 ? 515  VAL A N     1 
ATOM   3349 C  CA    . VAL A 1 481 ? 56.533  -0.990  5.895   1.00 30.99 ? 515  VAL A CA    1 
ATOM   3350 C  C     . VAL A 1 481 ? 57.348  -1.764  4.849   1.00 31.63 ? 515  VAL A C     1 
ATOM   3351 O  O     . VAL A 1 481 ? 57.687  -1.213  3.799   1.00 31.58 ? 515  VAL A O     1 
ATOM   3352 C  CB    . VAL A 1 481 ? 57.428  -0.634  7.115   1.00 30.98 ? 515  VAL A CB    1 
ATOM   3353 C  CG1   . VAL A 1 481 ? 58.677  0.101   6.671   1.00 30.21 ? 515  VAL A CG1   1 
ATOM   3354 C  CG2   . VAL A 1 481 ? 56.657  0.203   8.133   1.00 30.28 ? 515  VAL A CG2   1 
ATOM   3355 N  N     . LEU A 1 482 ? 57.645  -3.034  5.123   1.00 32.35 ? 516  LEU A N     1 
ATOM   3356 C  CA    . LEU A 1 482 ? 58.560  -3.816  4.268   1.00 33.05 ? 516  LEU A CA    1 
ATOM   3357 C  C     . LEU A 1 482 ? 58.007  -4.176  2.886   1.00 33.70 ? 516  LEU A C     1 
ATOM   3358 O  O     . LEU A 1 482 ? 58.775  -4.352  1.938   1.00 33.67 ? 516  LEU A O     1 
ATOM   3359 C  CB    . LEU A 1 482 ? 59.019  -5.107  4.972   1.00 33.03 ? 516  LEU A CB    1 
ATOM   3360 C  CG    . LEU A 1 482 ? 59.873  -4.961  6.239   1.00 32.99 ? 516  LEU A CG    1 
ATOM   3361 C  CD1   . LEU A 1 482 ? 60.292  -6.326  6.741   1.00 31.66 ? 516  LEU A CD1   1 
ATOM   3362 C  CD2   . LEU A 1 482 ? 61.088  -4.066  5.995   1.00 33.36 ? 516  LEU A CD2   1 
ATOM   3363 N  N     . GLU A 1 483 ? 56.690  -4.312  2.770   1.00 34.53 ? 517  GLU A N     1 
ATOM   3364 C  CA    . GLU A 1 483 ? 56.083  -4.705  1.497   1.00 35.18 ? 517  GLU A CA    1 
ATOM   3365 C  C     . GLU A 1 483 ? 56.030  -3.543  0.519   1.00 35.47 ? 517  GLU A C     1 
ATOM   3366 O  O     . GLU A 1 483 ? 56.040  -3.758  -0.694  1.00 35.72 ? 517  GLU A O     1 
ATOM   3367 C  CB    . GLU A 1 483 ? 54.679  -5.278  1.704   1.00 35.50 ? 517  GLU A CB    1 
ATOM   3368 C  CG    . GLU A 1 483 ? 54.664  -6.699  2.274   1.00 36.07 ? 517  GLU A CG    1 
ATOM   3369 C  CD    . GLU A 1 483 ? 53.285  -7.119  2.762   1.00 37.46 ? 517  GLU A CD    1 
ATOM   3370 O  OE1   . GLU A 1 483 ? 52.281  -6.517  2.317   1.00 38.30 ? 517  GLU A OE1   1 
ATOM   3371 O  OE2   . GLU A 1 483 ? 53.209  -8.050  3.595   1.00 38.81 ? 517  GLU A OE2   1 
ATOM   3372 N  N     . ALA A 1 484 ? 55.963  -2.324  1.054   1.00 35.66 ? 518  ALA A N     1 
ATOM   3373 C  CA    . ALA A 1 484 ? 55.973  -1.105  0.246   1.00 35.81 ? 518  ALA A CA    1 
ATOM   3374 C  C     . ALA A 1 484 ? 57.376  -0.756  -0.286  1.00 35.94 ? 518  ALA A C     1 
ATOM   3375 O  O     . ALA A 1 484 ? 57.499  -0.056  -1.303  1.00 36.17 ? 518  ALA A O     1 
ATOM   3376 C  CB    . ALA A 1 484 ? 55.409  0.063   1.057   1.00 35.87 ? 518  ALA A CB    1 
ATOM   3377 N  N     . VAL A 1 485 ? 58.420  -1.224  0.404   1.00 35.68 ? 519  VAL A N     1 
ATOM   3378 C  CA    . VAL A 1 485 ? 59.805  -1.029  -0.042  1.00 35.50 ? 519  VAL A CA    1 
ATOM   3379 C  C     . VAL A 1 485 ? 60.015  -1.551  -1.466  1.00 35.27 ? 519  VAL A C     1 
ATOM   3380 O  O     . VAL A 1 485 ? 59.669  -2.693  -1.762  1.00 35.47 ? 519  VAL A O     1 
ATOM   3381 C  CB    . VAL A 1 485 ? 60.795  -1.756  0.885   1.00 35.52 ? 519  VAL A CB    1 
ATOM   3382 C  CG1   . VAL A 1 485 ? 62.140  -1.952  0.193   1.00 35.75 ? 519  VAL A CG1   1 
ATOM   3383 C  CG2   . VAL A 1 485 ? 60.958  -0.992  2.191   1.00 35.57 ? 519  VAL A CG2   1 
ATOM   3384 N  N     . THR A 1 486 ? 60.585  -0.718  -2.336  1.00 34.83 ? 520  THR A N     1 
ATOM   3385 C  CA    . THR A 1 486 ? 60.832  -1.095  -3.732  1.00 34.72 ? 520  THR A CA    1 
ATOM   3386 C  C     . THR A 1 486 ? 62.313  -1.340  -4.046  1.00 34.58 ? 520  THR A C     1 
ATOM   3387 O  O     . THR A 1 486 ? 62.659  -1.686  -5.175  1.00 34.58 ? 520  THR A O     1 
ATOM   3388 C  CB    . THR A 1 486 ? 60.297  -0.016  -4.695  1.00 34.78 ? 520  THR A CB    1 
ATOM   3389 O  OG1   . THR A 1 486 ? 60.870  1.254   -4.354  1.00 35.09 ? 520  THR A OG1   1 
ATOM   3390 C  CG2   . THR A 1 486 ? 58.772  0.072   -4.615  1.00 34.41 ? 520  THR A CG2   1 
ATOM   3391 N  N     . GLU A 1 487 ? 63.181  -1.173  -3.051  1.00 34.39 ? 521  GLU A N     1 
ATOM   3392 C  CA    . GLU A 1 487 ? 64.622  -1.287  -3.254  1.00 34.21 ? 521  GLU A CA    1 
ATOM   3393 C  C     . GLU A 1 487 ? 65.064  -2.742  -3.427  1.00 33.89 ? 521  GLU A C     1 
ATOM   3394 O  O     . GLU A 1 487 ? 64.648  -3.620  -2.671  1.00 33.69 ? 521  GLU A O     1 
ATOM   3395 C  CB    . GLU A 1 487 ? 65.390  -0.639  -2.088  1.00 34.32 ? 521  GLU A CB    1 
ATOM   3396 C  CG    . GLU A 1 487 ? 65.661  0.880   -2.246  1.00 34.96 ? 521  GLU A CG    1 
ATOM   3397 C  CD    . GLU A 1 487 ? 64.436  1.772   -2.024  1.00 35.63 ? 521  GLU A CD    1 
ATOM   3398 O  OE1   . GLU A 1 487 ? 63.373  1.262   -1.603  1.00 36.07 ? 521  GLU A OE1   1 
ATOM   3399 O  OE2   . GLU A 1 487 ? 64.546  2.997   -2.268  1.00 36.08 ? 521  GLU A OE2   1 
ATOM   3400 N  N     . GLU A 1 488 ? 65.916  -2.977  -4.426  1.00 33.40 ? 522  GLU A N     1 
ATOM   3401 C  CA    . GLU A 1 488 ? 66.514  -4.286  -4.658  1.00 33.11 ? 522  GLU A CA    1 
ATOM   3402 C  C     . GLU A 1 488 ? 67.502  -4.625  -3.537  1.00 32.53 ? 522  GLU A C     1 
ATOM   3403 O  O     . GLU A 1 488 ? 67.978  -3.732  -2.832  1.00 32.40 ? 522  GLU A O     1 
ATOM   3404 C  CB    . GLU A 1 488 ? 67.268  -4.307  -5.991  1.00 33.41 ? 522  GLU A CB    1 
ATOM   3405 C  CG    . GLU A 1 488 ? 66.427  -4.038  -7.229  1.00 34.47 ? 522  GLU A CG    1 
ATOM   3406 C  CD    . GLU A 1 488 ? 67.271  -3.960  -8.499  1.00 36.12 ? 522  GLU A CD    1 
ATOM   3407 O  OE1   . GLU A 1 488 ? 67.042  -3.040  -9.319  1.00 37.68 ? 522  GLU A OE1   1 
ATOM   3408 O  OE2   . GLU A 1 488 ? 68.166  -4.815  -8.675  1.00 36.65 ? 522  GLU A OE2   1 
ATOM   3409 N  N     . PRO A 1 489 ? 67.834  -5.917  -3.375  1.00 31.82 ? 523  PRO A N     1 
ATOM   3410 C  CA    . PRO A 1 489 ? 68.800  -6.289  -2.336  1.00 31.38 ? 523  PRO A CA    1 
ATOM   3411 C  C     . PRO A 1 489 ? 70.161  -5.607  -2.493  1.00 30.84 ? 523  PRO A C     1 
ATOM   3412 O  O     . PRO A 1 489 ? 70.827  -5.345  -1.495  1.00 30.59 ? 523  PRO A O     1 
ATOM   3413 C  CB    . PRO A 1 489 ? 68.937  -7.806  -2.508  1.00 31.49 ? 523  PRO A CB    1 
ATOM   3414 C  CG    . PRO A 1 489 ? 67.690  -8.222  -3.216  1.00 31.85 ? 523  PRO A CG    1 
ATOM   3415 C  CD    . PRO A 1 489 ? 67.338  -7.091  -4.113  1.00 31.67 ? 523  PRO A CD    1 
ATOM   3416 N  N     . GLU A 1 490 ? 70.566  -5.332  -3.736  1.00 30.43 ? 524  GLU A N     1 
ATOM   3417 C  CA    . GLU A 1 490 ? 71.789  -4.568  -4.006  1.00 30.06 ? 524  GLU A CA    1 
ATOM   3418 C  C     . GLU A 1 490 ? 71.717  -3.173  -3.383  1.00 29.49 ? 524  GLU A C     1 
ATOM   3419 O  O     . GLU A 1 490 ? 72.679  -2.724  -2.758  1.00 29.41 ? 524  GLU A O     1 
ATOM   3420 C  CB    . GLU A 1 490 ? 72.059  -4.442  -5.511  1.00 30.26 ? 524  GLU A CB    1 
ATOM   3421 C  CG    . GLU A 1 490 ? 72.698  -5.676  -6.154  1.00 30.79 ? 524  GLU A CG    1 
ATOM   3422 C  CD    . GLU A 1 490 ? 71.693  -6.757  -6.537  1.00 31.42 ? 524  GLU A CD    1 
ATOM   3423 O  OE1   . GLU A 1 490 ? 70.508  -6.657  -6.137  1.00 31.69 ? 524  GLU A OE1   1 
ATOM   3424 O  OE2   . GLU A 1 490 ? 72.099  -7.713  -7.239  1.00 31.76 ? 524  GLU A OE2   1 
ATOM   3425 N  N     . ASP A 1 491 ? 70.576  -2.502  -3.546  1.00 28.73 ? 525  ASP A N     1 
ATOM   3426 C  CA    . ASP A 1 491 ? 70.374  -1.176  -2.951  1.00 28.30 ? 525  ASP A CA    1 
ATOM   3427 C  C     . ASP A 1 491 ? 70.397  -1.246  -1.429  1.00 27.64 ? 525  ASP A C     1 
ATOM   3428 O  O     . ASP A 1 491 ? 70.997  -0.389  -0.782  1.00 27.46 ? 525  ASP A O     1 
ATOM   3429 C  CB    . ASP A 1 491 ? 69.057  -0.550  -3.419  1.00 28.37 ? 525  ASP A CB    1 
ATOM   3430 C  CG    . ASP A 1 491 ? 68.985  -0.385  -4.927  1.00 28.83 ? 525  ASP A CG    1 
ATOM   3431 O  OD1   . ASP A 1 491 ? 70.035  -0.118  -5.553  1.00 29.63 ? 525  ASP A OD1   1 
ATOM   3432 O  OD2   . ASP A 1 491 ? 67.872  -0.521  -5.484  1.00 29.42 ? 525  ASP A OD2   1 
ATOM   3433 N  N     . ILE A 1 492 ? 69.759  -2.277  -0.872  1.00 26.97 ? 526  ILE A N     1 
ATOM   3434 C  CA    . ILE A 1 492 ? 69.671  -2.458  0.585   1.00 26.47 ? 526  ILE A CA    1 
ATOM   3435 C  C     . ILE A 1 492 ? 71.052  -2.721  1.190   1.00 26.19 ? 526  ILE A C     1 
ATOM   3436 O  O     . ILE A 1 492 ? 71.350  -2.262  2.298   1.00 26.30 ? 526  ILE A O     1 
ATOM   3437 C  CB    . ILE A 1 492 ? 68.721  -3.625  0.994   1.00 26.33 ? 526  ILE A CB    1 
ATOM   3438 C  CG1   . ILE A 1 492 ? 67.289  -3.402  0.486   1.00 26.38 ? 526  ILE A CG1   1 
ATOM   3439 C  CG2   . ILE A 1 492 ? 68.700  -3.792  2.500   1.00 25.57 ? 526  ILE A CG2   1 
ATOM   3440 C  CD1   . ILE A 1 492 ? 66.501  -2.340  1.249   1.00 26.08 ? 526  ILE A CD1   1 
ATOM   3441 N  N     . SER A 1 493 ? 71.890  -3.462  0.472   1.00 25.69 ? 527  SER A N     1 
ATOM   3442 C  CA    . SER A 1 493 ? 73.267  -3.687  0.912   1.00 25.35 ? 527  SER A CA    1 
ATOM   3443 C  C     . SER A 1 493 ? 74.057  -2.366  1.011   1.00 24.95 ? 527  SER A C     1 
ATOM   3444 O  O     . SER A 1 493 ? 74.665  -2.081  2.046   1.00 24.97 ? 527  SER A O     1 
ATOM   3445 C  CB    . SER A 1 493 ? 73.984  -4.656  -0.028  1.00 25.25 ? 527  SER A CB    1 
ATOM   3446 O  OG    . SER A 1 493 ? 75.371  -4.672  0.256   1.00 25.51 ? 527  SER A OG    1 
ATOM   3447 N  N     . ASP A 1 494 ? 74.037  -1.568  -0.060  1.00 24.39 ? 528  ASP A N     1 
ATOM   3448 C  CA    . ASP A 1 494 ? 74.719  -0.266  -0.072  1.00 24.26 ? 528  ASP A CA    1 
ATOM   3449 C  C     . ASP A 1 494 ? 74.309  0.599   1.134   1.00 23.56 ? 528  ASP A C     1 
ATOM   3450 O  O     . ASP A 1 494 ? 75.153  1.224   1.773   1.00 23.58 ? 528  ASP A O     1 
ATOM   3451 C  CB    . ASP A 1 494 ? 74.441  0.499   -1.381  1.00 24.41 ? 528  ASP A CB    1 
ATOM   3452 C  CG    . ASP A 1 494 ? 75.080  -0.160  -2.618  1.00 25.67 ? 528  ASP A CG    1 
ATOM   3453 O  OD1   . ASP A 1 494 ? 76.084  -0.904  -2.489  1.00 26.91 ? 528  ASP A OD1   1 
ATOM   3454 O  OD2   . ASP A 1 494 ? 74.571  0.073   -3.737  1.00 26.40 ? 528  ASP A OD2   1 
ATOM   3455 N  N     . ILE A 1 495 ? 73.015  0.610   1.441   1.00 22.78 ? 529  ILE A N     1 
ATOM   3456 C  CA    . ILE A 1 495 ? 72.482  1.381   2.561   1.00 22.27 ? 529  ILE A CA    1 
ATOM   3457 C  C     . ILE A 1 495 ? 73.009  0.901   3.908   1.00 21.86 ? 529  ILE A C     1 
ATOM   3458 O  O     . ILE A 1 495 ? 73.453  1.704   4.723   1.00 21.62 ? 529  ILE A O     1 
ATOM   3459 C  CB    . ILE A 1 495 ? 70.926  1.366   2.568   1.00 22.27 ? 529  ILE A CB    1 
ATOM   3460 C  CG1   . ILE A 1 495 ? 70.382  2.172   1.378   1.00 21.77 ? 529  ILE A CG1   1 
ATOM   3461 C  CG2   . ILE A 1 495 ? 70.389  1.933   3.881   1.00 21.55 ? 529  ILE A CG2   1 
ATOM   3462 C  CD1   . ILE A 1 495 ? 69.011  1.742   0.899   1.00 21.36 ? 529  ILE A CD1   1 
ATOM   3463 N  N     . VAL A 1 496 ? 72.952  -0.408  4.141   1.00 21.80 ? 530  VAL A N     1 
ATOM   3464 C  CA    . VAL A 1 496 ? 73.400  -0.991  5.412   1.00 21.51 ? 530  VAL A CA    1 
ATOM   3465 C  C     . VAL A 1 496 ? 74.910  -0.842  5.528   1.00 21.64 ? 530  VAL A C     1 
ATOM   3466 O  O     . VAL A 1 496 ? 75.437  -0.556  6.609   1.00 21.48 ? 530  VAL A O     1 
ATOM   3467 C  CB    . VAL A 1 496 ? 73.008  -2.497  5.543   1.00 21.50 ? 530  VAL A CB    1 
ATOM   3468 C  CG1   . VAL A 1 496 ? 73.547  -3.090  6.838   1.00 20.59 ? 530  VAL A CG1   1 
ATOM   3469 C  CG2   . VAL A 1 496 ? 71.490  -2.664  5.477   1.00 21.36 ? 530  VAL A CG2   1 
ATOM   3470 N  N     . ILE A 1 497 ? 75.605  -1.036  4.411   1.00 21.77 ? 531  ILE A N     1 
ATOM   3471 C  CA    . ILE A 1 497 ? 77.053  -0.867  4.392   1.00 22.16 ? 531  ILE A CA    1 
ATOM   3472 C  C     . ILE A 1 497 ? 77.435  0.565   4.790   1.00 22.12 ? 531  ILE A C     1 
ATOM   3473 O  O     . ILE A 1 497 ? 78.326  0.758   5.621   1.00 22.49 ? 531  ILE A O     1 
ATOM   3474 C  CB    . ILE A 1 497 ? 77.675  -1.277  3.035   1.00 22.27 ? 531  ILE A CB    1 
ATOM   3475 C  CG1   . ILE A 1 497 ? 77.768  -2.810  2.958   1.00 22.88 ? 531  ILE A CG1   1 
ATOM   3476 C  CG2   . ILE A 1 497 ? 79.056  -0.650  2.876   1.00 22.03 ? 531  ILE A CG2   1 
ATOM   3477 C  CD1   . ILE A 1 497 ? 78.004  -3.371  1.561   1.00 23.33 ? 531  ILE A CD1   1 
ATOM   3478 N  N     . SER A 1 498 ? 76.741  1.558   4.239   1.00 21.97 ? 532  SER A N     1 
ATOM   3479 C  CA    . SER A 1 498 ? 76.979  2.946   4.642   1.00 21.84 ? 532  SER A CA    1 
ATOM   3480 C  C     . SER A 1 498 ? 76.773  3.130   6.158   1.00 21.88 ? 532  SER A C     1 
ATOM   3481 O  O     . SER A 1 498 ? 77.507  3.892   6.786   1.00 22.41 ? 532  SER A O     1 
ATOM   3482 C  CB    . SER A 1 498 ? 76.113  3.927   3.845   1.00 21.61 ? 532  SER A CB    1 
ATOM   3483 O  OG    . SER A 1 498 ? 74.809  4.043   4.376   1.00 21.45 ? 532  SER A OG    1 
ATOM   3484 N  N     . LEU A 1 499 ? 75.809  2.416   6.740   1.00 21.65 ? 533  LEU A N     1 
ATOM   3485 C  CA    . LEU A 1 499 ? 75.575  2.465   8.191   1.00 21.64 ? 533  LEU A CA    1 
ATOM   3486 C  C     . LEU A 1 499 ? 76.679  1.807   9.015   1.00 21.95 ? 533  LEU A C     1 
ATOM   3487 O  O     . LEU A 1 499 ? 76.999  2.294   10.091  1.00 22.19 ? 533  LEU A O     1 
ATOM   3488 C  CB    . LEU A 1 499 ? 74.228  1.830   8.560   1.00 21.53 ? 533  LEU A CB    1 
ATOM   3489 C  CG    . LEU A 1 499 ? 72.962  2.606   8.184   1.00 21.17 ? 533  LEU A CG    1 
ATOM   3490 C  CD1   . LEU A 1 499 ? 71.745  1.688   8.248   1.00 20.93 ? 533  LEU A CD1   1 
ATOM   3491 C  CD2   . LEU A 1 499 ? 72.781  3.819   9.093   1.00 18.53 ? 533  LEU A CD2   1 
ATOM   3492 N  N     . ILE A 1 500 ? 77.245  0.699   8.532   1.00 22.28 ? 534  ILE A N     1 
ATOM   3493 C  CA    . ILE A 1 500 ? 78.358  0.053   9.227   1.00 22.38 ? 534  ILE A CA    1 
ATOM   3494 C  C     . ILE A 1 500 ? 79.525  1.041   9.326   1.00 22.93 ? 534  ILE A C     1 
ATOM   3495 O  O     . ILE A 1 500 ? 80.056  1.280   10.415  1.00 22.86 ? 534  ILE A O     1 
ATOM   3496 C  CB    . ILE A 1 500 ? 78.811  -1.260  8.524   1.00 22.64 ? 534  ILE A CB    1 
ATOM   3497 C  CG1   . ILE A 1 500 ? 77.715  -2.330  8.601   1.00 22.64 ? 534  ILE A CG1   1 
ATOM   3498 C  CG2   . ILE A 1 500 ? 80.095  -1.810  9.150   1.00 21.52 ? 534  ILE A CG2   1 
ATOM   3499 C  CD1   . ILE A 1 500 ? 77.819  -3.375  7.514   1.00 22.87 ? 534  ILE A CD1   1 
ATOM   3500 N  N     . SER A 1 501 ? 79.892  1.637   8.193   1.00 23.47 ? 535  SER A N     1 
ATOM   3501 C  CA    . SER A 1 501 ? 80.942  2.656   8.153   1.00 23.94 ? 535  SER A CA    1 
ATOM   3502 C  C     . SER A 1 501 ? 80.652  3.798   9.115   1.00 24.42 ? 535  SER A C     1 
ATOM   3503 O  O     . SER A 1 501 ? 81.525  4.197   9.889   1.00 24.54 ? 535  SER A O     1 
ATOM   3504 C  CB    . SER A 1 501 ? 81.091  3.218   6.741   1.00 23.92 ? 535  SER A CB    1 
ATOM   3505 O  OG    . SER A 1 501 ? 81.224  2.180   5.785   1.00 23.84 ? 535  SER A OG    1 
ATOM   3506 N  N     . SER A 1 502 ? 79.425  4.316   9.063   1.00 25.09 ? 536  SER A N     1 
ATOM   3507 C  CA    . SER A 1 502 ? 79.015  5.426   9.925   1.00 25.59 ? 536  SER A CA    1 
ATOM   3508 C  C     . SER A 1 502 ? 79.193  5.071   11.388  1.00 25.93 ? 536  SER A C     1 
ATOM   3509 O  O     . SER A 1 502 ? 79.841  5.806   12.131  1.00 26.31 ? 536  SER A O     1 
ATOM   3510 C  CB    . SER A 1 502 ? 77.562  5.818   9.671   1.00 25.73 ? 536  SER A CB    1 
ATOM   3511 O  OG    . SER A 1 502 ? 77.018  6.489   10.801  1.00 26.81 ? 536  SER A OG    1 
ATOM   3512 N  N     . TYR A 1 503 ? 78.621  3.941   11.799  1.00 26.24 ? 537  TYR A N     1 
ATOM   3513 C  CA    . TYR A 1 503 ? 78.720  3.499   13.196  1.00 26.34 ? 537  TYR A CA    1 
ATOM   3514 C  C     . TYR A 1 503 ? 80.139  3.091   13.590  1.00 27.00 ? 537  TYR A C     1 
ATOM   3515 O  O     . TYR A 1 503 ? 80.510  3.206   14.746  1.00 27.16 ? 537  TYR A O     1 
ATOM   3516 C  CB    . TYR A 1 503 ? 77.719  2.369   13.491  1.00 26.06 ? 537  TYR A CB    1 
ATOM   3517 C  CG    . TYR A 1 503 ? 76.343  2.880   13.834  1.00 24.39 ? 537  TYR A CG    1 
ATOM   3518 C  CD1   . TYR A 1 503 ? 75.436  3.229   12.832  1.00 24.39 ? 537  TYR A CD1   1 
ATOM   3519 C  CD2   . TYR A 1 503 ? 75.956  3.050   15.154  1.00 22.88 ? 537  TYR A CD2   1 
ATOM   3520 C  CE1   . TYR A 1 503 ? 74.173  3.727   13.143  1.00 23.19 ? 537  TYR A CE1   1 
ATOM   3521 C  CE2   . TYR A 1 503 ? 74.694  3.541   15.477  1.00 22.78 ? 537  TYR A CE2   1 
ATOM   3522 C  CZ    . TYR A 1 503 ? 73.812  3.880   14.466  1.00 22.23 ? 537  TYR A CZ    1 
ATOM   3523 O  OH    . TYR A 1 503 ? 72.566  4.360   14.772  1.00 20.59 ? 537  TYR A OH    1 
ATOM   3524 N  N     . ARG A 1 504 ? 80.930  2.635   12.626  1.00 28.02 ? 538  ARG A N     1 
ATOM   3525 C  CA    . ARG A 1 504 ? 82.330  2.292   12.882  1.00 28.87 ? 538  ARG A CA    1 
ATOM   3526 C  C     . ARG A 1 504 ? 83.140  3.521   13.305  1.00 29.01 ? 538  ARG A C     1 
ATOM   3527 O  O     . ARG A 1 504 ? 83.998  3.436   14.183  1.00 29.19 ? 538  ARG A O     1 
ATOM   3528 C  CB    . ARG A 1 504 ? 82.964  1.653   11.639  1.00 29.12 ? 538  ARG A CB    1 
ATOM   3529 C  CG    . ARG A 1 504 ? 84.155  0.757   11.939  1.00 30.21 ? 538  ARG A CG    1 
ATOM   3530 C  CD    . ARG A 1 504 ? 84.673  0.072   10.672  1.00 32.16 ? 538  ARG A CD    1 
ATOM   3531 N  NE    . ARG A 1 504 ? 85.400  -1.163  10.986  1.00 34.38 ? 538  ARG A NE    1 
ATOM   3532 C  CZ    . ARG A 1 504 ? 86.315  -1.738  10.201  1.00 36.29 ? 538  ARG A CZ    1 
ATOM   3533 N  NH1   . ARG A 1 504 ? 86.650  -1.206  9.025   1.00 37.04 ? 538  ARG A NH1   1 
ATOM   3534 N  NH2   . ARG A 1 504 ? 86.913  -2.859  10.599  1.00 36.81 ? 538  ARG A NH2   1 
ATOM   3535 N  N     . SER A 1 505 ? 82.853  4.656   12.681  1.00 29.36 ? 539  SER A N     1 
ATOM   3536 C  CA    . SER A 1 505 ? 83.556  5.912   12.969  1.00 29.69 ? 539  SER A CA    1 
ATOM   3537 C  C     . SER A 1 505 ? 83.409  6.412   14.408  1.00 29.60 ? 539  SER A C     1 
ATOM   3538 O  O     . SER A 1 505 ? 84.340  7.014   14.954  1.00 29.70 ? 539  SER A O     1 
ATOM   3539 C  CB    . SER A 1 505 ? 83.090  7.016   12.022  1.00 29.81 ? 539  SER A CB    1 
ATOM   3540 O  OG    . SER A 1 505 ? 83.053  8.266   12.701  1.00 31.50 ? 539  SER A OG    1 
ATOM   3541 N  N     . CYS A 1 506 ? 82.253  6.167   15.018  1.00 29.34 ? 540  CYS A N     1 
ATOM   3542 C  CA    . CYS A 1 506 ? 81.951  6.753   16.316  1.00 29.39 ? 540  CYS A CA    1 
ATOM   3543 C  C     . CYS A 1 506 ? 81.979  5.773   17.498  1.00 29.13 ? 540  CYS A C     1 
ATOM   3544 O  O     . CYS A 1 506 ? 81.510  6.104   18.584  1.00 28.97 ? 540  CYS A O     1 
ATOM   3545 C  CB    . CYS A 1 506 ? 80.611  7.494   16.244  1.00 29.48 ? 540  CYS A CB    1 
ATOM   3546 S  SG    . CYS A 1 506 ? 79.200  6.487   15.735  1.00 30.63 ? 540  CYS A SG    1 
ATOM   3547 N  N     . ILE A 1 507 ? 82.558  4.590   17.297  1.00 29.15 ? 541  ILE A N     1 
ATOM   3548 C  CA    . ILE A 1 507 ? 82.679  3.581   18.361  1.00 28.96 ? 541  ILE A CA    1 
ATOM   3549 C  C     . ILE A 1 507 ? 83.476  4.092   19.558  1.00 28.96 ? 541  ILE A C     1 
ATOM   3550 O  O     . ILE A 1 507 ? 83.023  3.991   20.697  1.00 28.39 ? 541  ILE A O     1 
ATOM   3551 C  CB    . ILE A 1 507 ? 83.338  2.286   17.831  1.00 29.13 ? 541  ILE A CB    1 
ATOM   3552 C  CG1   . ILE A 1 507 ? 82.337  1.512   16.962  1.00 29.44 ? 541  ILE A CG1   1 
ATOM   3553 C  CG2   . ILE A 1 507 ? 83.852  1.420   18.980  1.00 28.81 ? 541  ILE A CG2   1 
ATOM   3554 C  CD1   . ILE A 1 507 ? 82.814  0.142   16.525  1.00 29.92 ? 541  ILE A CD1   1 
ATOM   3555 N  N     . LYS A 1 508 ? 84.659  4.643   19.295  1.00 29.18 ? 542  LYS A N     1 
ATOM   3556 C  CA    . LYS A 1 508 ? 85.491  5.206   20.367  1.00 29.46 ? 542  LYS A CA    1 
ATOM   3557 C  C     . LYS A 1 508 ? 84.813  6.398   21.042  1.00 29.37 ? 542  LYS A C     1 
ATOM   3558 O  O     . LYS A 1 508 ? 84.807  6.497   22.269  1.00 29.30 ? 542  LYS A O     1 
ATOM   3559 C  CB    . LYS A 1 508 ? 86.891  5.604   19.856  1.00 29.58 ? 542  LYS A CB    1 
ATOM   3560 C  CG    . LYS A 1 508 ? 87.885  4.438   19.776  1.00 30.00 ? 542  LYS A CG    1 
ATOM   3561 C  CD    . LYS A 1 508 ? 89.333  4.919   19.630  1.00 30.23 ? 542  LYS A CD    1 
ATOM   3562 N  N     . GLU A 1 509 ? 84.240  7.291   20.236  1.00 29.57 ? 543  GLU A N     1 
ATOM   3563 C  CA    . GLU A 1 509 ? 83.598  8.502   20.753  1.00 29.62 ? 543  GLU A CA    1 
ATOM   3564 C  C     . GLU A 1 509 ? 82.382  8.184   21.629  1.00 29.35 ? 543  GLU A C     1 
ATOM   3565 O  O     . GLU A 1 509 ? 82.167  8.822   22.660  1.00 29.13 ? 543  GLU A O     1 
ATOM   3566 C  CB    . GLU A 1 509 ? 83.182  9.433   19.605  1.00 29.90 ? 543  GLU A CB    1 
ATOM   3567 C  CG    . GLU A 1 509 ? 82.865  10.862  20.060  1.00 30.61 ? 543  GLU A CG    1 
ATOM   3568 C  CD    . GLU A 1 509 ? 82.149  11.697  19.004  1.00 32.05 ? 543  GLU A CD    1 
ATOM   3569 O  OE1   . GLU A 1 509 ? 82.216  11.339  17.797  1.00 32.61 ? 543  GLU A OE1   1 
ATOM   3570 O  OE2   . GLU A 1 509 ? 81.522  12.720  19.395  1.00 31.47 ? 543  GLU A OE2   1 
ATOM   3571 N  N     . TYR A 1 510 ? 81.591  7.198   21.221  1.00 29.25 ? 544  TYR A N     1 
ATOM   3572 C  CA    . TYR A 1 510 ? 80.375  6.838   21.954  1.00 29.39 ? 544  TYR A CA    1 
ATOM   3573 C  C     . TYR A 1 510 ? 80.547  5.604   22.852  1.00 29.39 ? 544  TYR A C     1 
ATOM   3574 O  O     . TYR A 1 510 ? 79.564  5.092   23.387  1.00 29.37 ? 544  TYR A O     1 
ATOM   3575 C  CB    . TYR A 1 510 ? 79.210  6.626   20.974  1.00 29.35 ? 544  TYR A CB    1 
ATOM   3576 C  CG    . TYR A 1 510 ? 78.814  7.850   20.151  1.00 29.55 ? 544  TYR A CG    1 
ATOM   3577 C  CD1   . TYR A 1 510 ? 78.945  9.148   20.656  1.00 29.77 ? 544  TYR A CD1   1 
ATOM   3578 C  CD2   . TYR A 1 510 ? 78.273  7.703   18.880  1.00 29.58 ? 544  TYR A CD2   1 
ATOM   3579 C  CE1   . TYR A 1 510 ? 78.569  10.259  19.905  1.00 29.82 ? 544  TYR A CE1   1 
ATOM   3580 C  CE2   . TYR A 1 510 ? 77.897  8.806   18.122  1.00 29.91 ? 544  TYR A CE2   1 
ATOM   3581 C  CZ    . TYR A 1 510 ? 78.045  10.084  18.640  1.00 30.28 ? 544  TYR A CZ    1 
ATOM   3582 O  OH    . TYR A 1 510 ? 77.664  11.182  17.895  1.00 29.60 ? 544  TYR A OH    1 
ATOM   3583 N  N     . ARG A 1 511 ? 81.788  5.148   23.025  1.00 29.51 ? 545  ARG A N     1 
ATOM   3584 C  CA    . ARG A 1 511 ? 82.104  3.993   23.870  1.00 29.68 ? 545  ARG A CA    1 
ATOM   3585 C  C     . ARG A 1 511 ? 81.254  2.770   23.528  1.00 29.58 ? 545  ARG A C     1 
ATOM   3586 O  O     . ARG A 1 511 ? 80.657  2.161   24.406  1.00 29.31 ? 545  ARG A O     1 
ATOM   3587 C  CB    . ARG A 1 511 ? 81.950  4.350   25.357  1.00 29.88 ? 545  ARG A CB    1 
ATOM   3588 C  CG    . ARG A 1 511 ? 82.881  5.465   25.841  1.00 30.71 ? 545  ARG A CG    1 
ATOM   3589 C  CD    . ARG A 1 511 ? 82.852  5.599   27.368  1.00 31.89 ? 545  ARG A CD    1 
ATOM   3590 N  NE    . ARG A 1 511 ? 83.834  6.562   27.870  1.00 32.23 ? 545  ARG A NE    1 
ATOM   3591 N  N     . PHE A 1 512 ? 81.191  2.423   22.247  1.00 29.90 ? 546  PHE A N     1 
ATOM   3592 C  CA    . PHE A 1 512 ? 80.440  1.245   21.814  1.00 30.13 ? 546  PHE A CA    1 
ATOM   3593 C  C     . PHE A 1 512 ? 81.269  -0.019  21.930  1.00 30.52 ? 546  PHE A C     1 
ATOM   3594 O  O     . PHE A 1 512 ? 82.501  0.017   21.915  1.00 30.47 ? 546  PHE A O     1 
ATOM   3595 C  CB    . PHE A 1 512 ? 79.966  1.360   20.354  1.00 30.09 ? 546  PHE A CB    1 
ATOM   3596 C  CG    . PHE A 1 512 ? 78.833  2.336   20.130  1.00 29.61 ? 546  PHE A CG    1 
ATOM   3597 C  CD1   . PHE A 1 512 ? 77.937  2.669   21.143  1.00 29.30 ? 546  PHE A CD1   1 
ATOM   3598 C  CD2   . PHE A 1 512 ? 78.642  2.889   18.872  1.00 28.76 ? 546  PHE A CD2   1 
ATOM   3599 C  CE1   . PHE A 1 512 ? 76.901  3.557   20.906  1.00 29.36 ? 546  PHE A CE1   1 
ATOM   3600 C  CE2   . PHE A 1 512 ? 77.607  3.767   18.629  1.00 29.01 ? 546  PHE A CE2   1 
ATOM   3601 C  CZ    . PHE A 1 512 ? 76.735  4.104   19.644  1.00 29.00 ? 546  PHE A CZ    1 
ATOM   3602 N  N     . SER A 1 513 ? 80.565  -1.140  22.038  1.00 31.07 ? 547  SER A N     1 
ATOM   3603 C  CA    . SER A 1 513 ? 81.171  -2.454  21.915  1.00 31.43 ? 547  SER A CA    1 
ATOM   3604 C  C     . SER A 1 513 ? 81.126  -2.825  20.433  1.00 31.78 ? 547  SER A C     1 
ATOM   3605 O  O     . SER A 1 513 ? 80.053  -3.063  19.878  1.00 31.75 ? 547  SER A O     1 
ATOM   3606 C  CB    . SER A 1 513 ? 80.411  -3.476  22.770  1.00 31.40 ? 547  SER A CB    1 
ATOM   3607 O  OG    . SER A 1 513 ? 80.935  -4.784  22.612  1.00 31.53 ? 547  SER A OG    1 
ATOM   3608 N  N     . GLU A 1 514 ? 82.293  -2.841  19.796  1.00 32.26 ? 548  GLU A N     1 
ATOM   3609 C  CA    . GLU A 1 514 ? 82.410  -3.176  18.375  1.00 32.73 ? 548  GLU A CA    1 
ATOM   3610 C  C     . GLU A 1 514 ? 81.796  -4.540  18.052  1.00 32.79 ? 548  GLU A C     1 
ATOM   3611 O  O     . GLU A 1 514 ? 81.138  -4.705  17.027  1.00 33.04 ? 548  GLU A O     1 
ATOM   3612 C  CB    . GLU A 1 514 ? 83.885  -3.149  17.962  1.00 32.97 ? 548  GLU A CB    1 
ATOM   3613 C  CG    . GLU A 1 514 ? 84.149  -3.356  16.469  1.00 34.12 ? 548  GLU A CG    1 
ATOM   3614 C  CD    . GLU A 1 514 ? 85.579  -2.986  16.068  1.00 35.62 ? 548  GLU A CD    1 
ATOM   3615 O  OE1   . GLU A 1 514 ? 86.489  -3.109  16.919  1.00 36.38 ? 548  GLU A OE1   1 
ATOM   3616 O  OE2   . GLU A 1 514 ? 85.790  -2.568  14.905  1.00 36.60 ? 548  GLU A OE2   1 
ATOM   3617 N  N     . ARG A 1 515 ? 82.007  -5.511  18.934  1.00 32.91 ? 549  ARG A N     1 
ATOM   3618 C  CA    . ARG A 1 515 ? 81.491  -6.870  18.732  1.00 32.95 ? 549  ARG A CA    1 
ATOM   3619 C  C     . ARG A 1 515 ? 79.971  -6.975  18.856  1.00 32.40 ? 549  ARG A C     1 
ATOM   3620 O  O     . ARG A 1 515 ? 79.379  -7.924  18.346  1.00 32.24 ? 549  ARG A O     1 
ATOM   3621 C  CB    . ARG A 1 515 ? 82.166  -7.877  19.684  1.00 33.13 ? 549  ARG A CB    1 
ATOM   3622 C  CG    . ARG A 1 515 ? 82.160  -7.486  21.164  1.00 34.56 ? 549  ARG A CG    1 
ATOM   3623 C  CD    . ARG A 1 515 ? 82.670  -8.615  22.058  1.00 35.93 ? 549  ARG A CD    1 
ATOM   3624 N  NE    . ARG A 1 515 ? 81.587  -9.233  22.828  1.00 37.57 ? 549  ARG A NE    1 
ATOM   3625 C  CZ    . ARG A 1 515 ? 81.574  -9.402  24.155  1.00 38.83 ? 549  ARG A CZ    1 
ATOM   3626 N  NH1   . ARG A 1 515 ? 82.599  -9.024  24.919  1.00 39.13 ? 549  ARG A NH1   1 
ATOM   3627 N  NH2   . ARG A 1 515 ? 80.521  -9.977  24.728  1.00 39.09 ? 549  ARG A NH2   1 
ATOM   3628 N  N     . ARG A 1 516 ? 79.339  -6.020  19.531  1.00 31.82 ? 550  ARG A N     1 
ATOM   3629 C  CA    . ARG A 1 516 ? 77.883  -6.027  19.643  1.00 31.50 ? 550  ARG A CA    1 
ATOM   3630 C  C     . ARG A 1 516 ? 77.255  -5.085  18.626  1.00 30.80 ? 550  ARG A C     1 
ATOM   3631 O  O     . ARG A 1 516 ? 76.361  -5.489  17.881  1.00 30.80 ? 550  ARG A O     1 
ATOM   3632 C  CB    . ARG A 1 516 ? 77.428  -5.685  21.069  1.00 31.64 ? 550  ARG A CB    1 
ATOM   3633 C  CG    . ARG A 1 516 ? 77.540  -6.854  22.050  1.00 32.70 ? 550  ARG A CG    1 
ATOM   3634 C  CD    . ARG A 1 516 ? 76.776  -6.602  23.360  1.00 34.53 ? 550  ARG A CD    1 
ATOM   3635 N  NE    . ARG A 1 516 ? 77.390  -5.567  24.206  1.00 35.90 ? 550  ARG A NE    1 
ATOM   3636 C  CZ    . ARG A 1 516 ? 78.327  -5.777  25.141  1.00 37.37 ? 550  ARG A CZ    1 
ATOM   3637 N  NH1   . ARG A 1 516 ? 78.805  -6.997  25.392  1.00 37.64 ? 550  ARG A NH1   1 
ATOM   3638 N  NH2   . ARG A 1 516 ? 78.800  -4.746  25.839  1.00 37.87 ? 550  ARG A NH2   1 
ATOM   3639 N  N     . ILE A 1 517 ? 77.741  -3.844  18.581  1.00 30.07 ? 551  ILE A N     1 
ATOM   3640 C  CA    . ILE A 1 517 ? 77.130  -2.790  17.754  1.00 29.44 ? 551  ILE A CA    1 
ATOM   3641 C  C     . ILE A 1 517 ? 77.159  -3.078  16.248  1.00 28.81 ? 551  ILE A C     1 
ATOM   3642 O  O     . ILE A 1 517 ? 76.154  -2.893  15.571  1.00 28.57 ? 551  ILE A O     1 
ATOM   3643 C  CB    . ILE A 1 517 ? 77.768  -1.389  18.032  1.00 29.39 ? 551  ILE A CB    1 
ATOM   3644 C  CG1   . ILE A 1 517 ? 76.964  -0.265  17.362  1.00 29.74 ? 551  ILE A CG1   1 
ATOM   3645 C  CG2   . ILE A 1 517 ? 79.196  -1.334  17.551  1.00 29.46 ? 551  ILE A CG2   1 
ATOM   3646 C  CD1   . ILE A 1 517 ? 75.555  -0.098  17.908  1.00 29.92 ? 551  ILE A CD1   1 
ATOM   3647 N  N     . LEU A 1 518 ? 78.293  -3.541  15.729  1.00 28.32 ? 552  LEU A N     1 
ATOM   3648 C  CA    . LEU A 1 518 ? 78.464  -3.664  14.278  1.00 27.83 ? 552  LEU A CA    1 
ATOM   3649 C  C     . LEU A 1 518 ? 77.672  -4.822  13.667  1.00 27.55 ? 552  LEU A C     1 
ATOM   3650 O  O     . LEU A 1 518 ? 77.126  -4.670  12.575  1.00 27.66 ? 552  LEU A O     1 
ATOM   3651 C  CB    . LEU A 1 518 ? 79.953  -3.751  13.891  1.00 27.81 ? 552  LEU A CB    1 
ATOM   3652 C  CG    . LEU A 1 518 ? 80.874  -2.574  14.255  1.00 27.59 ? 552  LEU A CG    1 
ATOM   3653 C  CD1   . LEU A 1 518 ? 82.192  -2.658  13.483  1.00 27.23 ? 552  LEU A CD1   1 
ATOM   3654 C  CD2   . LEU A 1 518 ? 80.217  -1.232  14.000  1.00 26.90 ? 552  LEU A CD2   1 
ATOM   3655 N  N     . PRO A 1 519 ? 77.620  -5.990  14.345  1.00 27.16 ? 553  PRO A N     1 
ATOM   3656 C  CA    . PRO A 1 519 ? 76.725  -7.057  13.860  1.00 26.85 ? 553  PRO A CA    1 
ATOM   3657 C  C     . PRO A 1 519 ? 75.238  -6.691  13.918  1.00 26.42 ? 553  PRO A C     1 
ATOM   3658 O  O     . PRO A 1 519 ? 74.458  -7.132  13.068  1.00 26.08 ? 553  PRO A O     1 
ATOM   3659 C  CB    . PRO A 1 519 ? 77.032  -8.233  14.798  1.00 26.83 ? 553  PRO A CB    1 
ATOM   3660 C  CG    . PRO A 1 519 ? 78.429  -8.001  15.242  1.00 26.94 ? 553  PRO A CG    1 
ATOM   3661 C  CD    . PRO A 1 519 ? 78.557  -6.501  15.364  1.00 27.38 ? 553  PRO A CD    1 
ATOM   3662 N  N     . GLU A 1 520 ? 74.853  -5.896  14.911  1.00 25.99 ? 554  GLU A N     1 
ATOM   3663 C  CA    . GLU A 1 520 ? 73.482  -5.418  15.001  1.00 25.86 ? 554  GLU A CA    1 
ATOM   3664 C  C     . GLU A 1 520 ? 73.117  -4.493  13.828  1.00 25.27 ? 554  GLU A C     1 
ATOM   3665 O  O     . GLU A 1 520 ? 72.024  -4.602  13.269  1.00 25.12 ? 554  GLU A O     1 
ATOM   3666 C  CB    . GLU A 1 520 ? 73.239  -4.722  16.342  1.00 25.92 ? 554  GLU A CB    1 
ATOM   3667 C  CG    . GLU A 1 520 ? 71.836  -4.125  16.505  1.00 27.30 ? 554  GLU A CG    1 
ATOM   3668 C  CD    . GLU A 1 520 ? 70.711  -5.069  16.068  1.00 28.53 ? 554  GLU A CD    1 
ATOM   3669 O  OE1   . GLU A 1 520 ? 70.753  -6.278  16.405  1.00 29.22 ? 554  GLU A OE1   1 
ATOM   3670 O  OE2   . GLU A 1 520 ? 69.783  -4.588  15.381  1.00 28.98 ? 554  GLU A OE2   1 
ATOM   3671 N  N     . ILE A 1 521 ? 74.021  -3.595  13.446  1.00 24.66 ? 555  ILE A N     1 
ATOM   3672 C  CA    . ILE A 1 521 ? 73.758  -2.725  12.296  1.00 24.31 ? 555  ILE A CA    1 
ATOM   3673 C  C     . ILE A 1 521 ? 73.666  -3.571  11.026  1.00 24.13 ? 555  ILE A C     1 
ATOM   3674 O  O     . ILE A 1 521 ? 72.769  -3.376  10.213  1.00 24.41 ? 555  ILE A O     1 
ATOM   3675 C  CB    . ILE A 1 521 ? 74.840  -1.622  12.094  1.00 24.14 ? 555  ILE A CB    1 
ATOM   3676 C  CG1   . ILE A 1 521 ? 74.989  -0.728  13.333  1.00 23.70 ? 555  ILE A CG1   1 
ATOM   3677 C  CG2   . ILE A 1 521 ? 74.498  -0.760  10.900  1.00 23.56 ? 555  ILE A CG2   1 
ATOM   3678 C  CD1   . ILE A 1 521 ? 73.740  0.011   13.743  1.00 23.19 ? 555  ILE A CD1   1 
ATOM   3679 N  N     . ALA A 1 522 ? 74.592  -4.512  10.865  1.00 23.93 ? 556  ALA A N     1 
ATOM   3680 C  CA    . ALA A 1 522 ? 74.642  -5.349  9.664   1.00 23.81 ? 556  ALA A CA    1 
ATOM   3681 C  C     . ALA A 1 522 ? 73.418  -6.253  9.529   1.00 23.59 ? 556  ALA A C     1 
ATOM   3682 O  O     . ALA A 1 522 ? 73.014  -6.574  8.409   1.00 23.29 ? 556  ALA A O     1 
ATOM   3683 C  CB    . ALA A 1 522 ? 75.927  -6.187  9.648   1.00 23.79 ? 556  ALA A CB    1 
ATOM   3684 N  N     . SER A 1 523 ? 72.840  -6.656  10.666  1.00 23.44 ? 557  SER A N     1 
ATOM   3685 C  CA    . SER A 1 523 ? 71.649  -7.521  10.682  1.00 23.44 ? 557  SER A CA    1 
ATOM   3686 C  C     . SER A 1 523 ? 70.397  -6.782  10.207  1.00 23.47 ? 557  SER A C     1 
ATOM   3687 O  O     . SER A 1 523 ? 69.362  -7.407  9.971   1.00 23.49 ? 557  SER A O     1 
ATOM   3688 C  CB    . SER A 1 523 ? 71.399  -8.103  12.079  1.00 23.60 ? 557  SER A CB    1 
ATOM   3689 O  OG    . SER A 1 523 ? 70.805  -7.152  12.955  1.00 23.64 ? 557  SER A OG    1 
ATOM   3690 N  N     . THR A 1 524 ? 70.493  -5.455  10.101  1.00 23.26 ? 558  THR A N     1 
ATOM   3691 C  CA    . THR A 1 524 ? 69.473  -4.633  9.456   1.00 23.05 ? 558  THR A CA    1 
ATOM   3692 C  C     . THR A 1 524 ? 69.170  -5.116  8.038   1.00 23.26 ? 558  THR A C     1 
ATOM   3693 O  O     . THR A 1 524 ? 68.028  -5.063  7.593   1.00 23.27 ? 558  THR A O     1 
ATOM   3694 C  CB    . THR A 1 524 ? 69.921  -3.153  9.372   1.00 23.07 ? 558  THR A CB    1 
ATOM   3695 O  OG1   . THR A 1 524 ? 70.339  -2.699  10.666  1.00 21.57 ? 558  THR A OG1   1 
ATOM   3696 C  CG2   . THR A 1 524 ? 68.782  -2.268  8.856   1.00 22.85 ? 558  THR A CG2   1 
ATOM   3697 N  N     . TYR A 1 525 ? 70.199  -5.579  7.336   1.00 23.47 ? 559  TYR A N     1 
ATOM   3698 C  CA    . TYR A 1 525 ? 70.042  -6.120  5.981   1.00 23.72 ? 559  TYR A CA    1 
ATOM   3699 C  C     . TYR A 1 525 ? 69.046  -7.283  5.959   1.00 24.06 ? 559  TYR A C     1 
ATOM   3700 O  O     . TYR A 1 525 ? 68.156  -7.334  5.111   1.00 24.04 ? 559  TYR A O     1 
ATOM   3701 C  CB    . TYR A 1 525 ? 71.406  -6.578  5.458   1.00 23.59 ? 559  TYR A CB    1 
ATOM   3702 C  CG    . TYR A 1 525 ? 71.403  -7.244  4.098   1.00 23.54 ? 559  TYR A CG    1 
ATOM   3703 C  CD1   . TYR A 1 525 ? 71.513  -6.492  2.934   1.00 23.28 ? 559  TYR A CD1   1 
ATOM   3704 C  CD2   . TYR A 1 525 ? 71.340  -8.631  3.980   1.00 23.29 ? 559  TYR A CD2   1 
ATOM   3705 C  CE1   . TYR A 1 525 ? 71.530  -7.101  1.688   1.00 23.36 ? 559  TYR A CE1   1 
ATOM   3706 C  CE2   . TYR A 1 525 ? 71.353  -9.246  2.742   1.00 23.27 ? 559  TYR A CE2   1 
ATOM   3707 C  CZ    . TYR A 1 525 ? 71.448  -8.476  1.601   1.00 23.19 ? 559  TYR A CZ    1 
ATOM   3708 O  OH    . TYR A 1 525 ? 71.468  -9.081  0.375   1.00 23.28 ? 559  TYR A OH    1 
ATOM   3709 N  N     . GLY A 1 526 ? 69.207  -8.209  6.902   1.00 24.36 ? 560  GLY A N     1 
ATOM   3710 C  CA    . GLY A 1 526 ? 68.321  -9.359  7.014   1.00 24.39 ? 560  GLY A CA    1 
ATOM   3711 C  C     . GLY A 1 526 ? 66.901  -8.981  7.386   1.00 24.50 ? 560  GLY A C     1 
ATOM   3712 O  O     . GLY A 1 526 ? 65.951  -9.555  6.860   1.00 24.30 ? 560  GLY A O     1 
ATOM   3713 N  N     . VAL A 1 527 ? 66.751  -8.016  8.290   1.00 24.76 ? 561  VAL A N     1 
ATOM   3714 C  CA    . VAL A 1 527 ? 65.429  -7.616  8.762   1.00 25.17 ? 561  VAL A CA    1 
ATOM   3715 C  C     . VAL A 1 527 ? 64.613  -7.003  7.629   1.00 25.84 ? 561  VAL A C     1 
ATOM   3716 O  O     . VAL A 1 527 ? 63.430  -7.310  7.471   1.00 25.69 ? 561  VAL A O     1 
ATOM   3717 C  CB    . VAL A 1 527 ? 65.506  -6.600  9.904   1.00 25.12 ? 561  VAL A CB    1 
ATOM   3718 C  CG1   . VAL A 1 527 ? 64.101  -6.221  10.355  1.00 24.98 ? 561  VAL A CG1   1 
ATOM   3719 C  CG2   . VAL A 1 527 ? 66.313  -7.157  11.063  1.00 24.82 ? 561  VAL A CG2   1 
ATOM   3720 N  N     . LEU A 1 528 ? 65.264  -6.155  6.837   1.00 26.53 ? 562  LEU A N     1 
ATOM   3721 C  CA    . LEU A 1 528 ? 64.610  -5.472  5.727   1.00 27.20 ? 562  LEU A CA    1 
ATOM   3722 C  C     . LEU A 1 528 ? 64.220  -6.412  4.592   1.00 27.81 ? 562  LEU A C     1 
ATOM   3723 O  O     . LEU A 1 528 ? 63.191  -6.203  3.953   1.00 28.06 ? 562  LEU A O     1 
ATOM   3724 C  CB    . LEU A 1 528 ? 65.490  -4.336  5.201   1.00 27.10 ? 562  LEU A CB    1 
ATOM   3725 C  CG    . LEU A 1 528 ? 65.598  -3.153  6.171   1.00 27.30 ? 562  LEU A CG    1 
ATOM   3726 C  CD1   . LEU A 1 528 ? 66.682  -2.171  5.729   1.00 27.04 ? 562  LEU A CD1   1 
ATOM   3727 C  CD2   . LEU A 1 528 ? 64.255  -2.463  6.322   1.00 26.42 ? 562  LEU A CD2   1 
ATOM   3728 N  N     . LEU A 1 529 ? 65.026  -7.439  4.342   1.00 28.52 ? 563  LEU A N     1 
ATOM   3729 C  CA    . LEU A 1 529 ? 64.655  -8.481  3.374   1.00 29.19 ? 563  LEU A CA    1 
ATOM   3730 C  C     . LEU A 1 529 ? 63.764  -9.552  4.012   1.00 29.50 ? 563  LEU A C     1 
ATOM   3731 O  O     . LEU A 1 529 ? 63.312  -10.462 3.323   1.00 29.47 ? 563  LEU A O     1 
ATOM   3732 C  CB    . LEU A 1 529 ? 65.899  -9.140  2.753   1.00 29.36 ? 563  LEU A CB    1 
ATOM   3733 C  CG    . LEU A 1 529 ? 66.645  -8.347  1.676   1.00 29.95 ? 563  LEU A CG    1 
ATOM   3734 C  CD1   . LEU A 1 529 ? 67.889  -9.116  1.233   1.00 30.77 ? 563  LEU A CD1   1 
ATOM   3735 C  CD2   . LEU A 1 529 ? 65.747  -8.048  0.480   1.00 30.09 ? 563  LEU A CD2   1 
ATOM   3736 N  N     . ASN A 1 530 ? 63.530  -9.436  5.320   1.00 30.09 ? 564  ASN A N     1 
ATOM   3737 C  CA    . ASN A 1 530 ? 62.655  -10.339 6.081   1.00 30.67 ? 564  ASN A CA    1 
ATOM   3738 C  C     . ASN A 1 530 ? 63.199  -11.770 6.251   1.00 30.89 ? 564  ASN A C     1 
ATOM   3739 O  O     . ASN A 1 530 ? 62.427  -12.723 6.364   1.00 30.67 ? 564  ASN A O     1 
ATOM   3740 C  CB    . ASN A 1 530 ? 61.241  -10.366 5.468   1.00 30.88 ? 564  ASN A CB    1 
ATOM   3741 C  CG    . ASN A 1 530 ? 60.176  -10.824 6.459   1.00 31.37 ? 564  ASN A CG    1 
ATOM   3742 O  OD1   . ASN A 1 530 ? 60.200  -10.455 7.634   1.00 32.49 ? 564  ASN A OD1   1 
ATOM   3743 N  ND2   . ASN A 1 530 ? 59.237  -11.632 5.984   1.00 31.52 ? 564  ASN A ND2   1 
ATOM   3744 N  N     . ASP A 1 531 ? 64.525  -11.907 6.279   1.00 31.28 ? 565  ASP A N     1 
ATOM   3745 C  CA    . ASP A 1 531 ? 65.185  -13.185 6.568   1.00 31.54 ? 565  ASP A CA    1 
ATOM   3746 C  C     . ASP A 1 531 ? 66.333  -12.928 7.558   1.00 31.99 ? 565  ASP A C     1 
ATOM   3747 O  O     . ASP A 1 531 ? 67.473  -12.706 7.147   1.00 31.84 ? 565  ASP A O     1 
ATOM   3748 C  CB    . ASP A 1 531 ? 65.691  -13.841 5.276   1.00 31.49 ? 565  ASP A CB    1 
ATOM   3749 C  CG    . ASP A 1 531 ? 66.092  -15.308 5.467   1.00 30.99 ? 565  ASP A CG    1 
ATOM   3750 O  OD1   . ASP A 1 531 ? 66.199  -15.773 6.622   1.00 29.96 ? 565  ASP A OD1   1 
ATOM   3751 O  OD2   . ASP A 1 531 ? 66.304  -15.996 4.445   1.00 29.99 ? 565  ASP A OD2   1 
ATOM   3752 N  N     . PRO A 1 532 ? 66.025  -12.949 8.871   1.00 32.62 ? 566  PRO A N     1 
ATOM   3753 C  CA    . PRO A 1 532 ? 66.955  -12.538 9.933   1.00 33.02 ? 566  PRO A CA    1 
ATOM   3754 C  C     . PRO A 1 532 ? 68.340  -13.196 9.936   1.00 33.57 ? 566  PRO A C     1 
ATOM   3755 O  O     . PRO A 1 532 ? 69.311  -12.559 10.358  1.00 33.98 ? 566  PRO A O     1 
ATOM   3756 C  CB    . PRO A 1 532 ? 66.208  -12.913 11.217  1.00 33.04 ? 566  PRO A CB    1 
ATOM   3757 C  CG    . PRO A 1 532 ? 64.780  -12.882 10.848  1.00 32.95 ? 566  PRO A CG    1 
ATOM   3758 C  CD    . PRO A 1 532 ? 64.711  -13.335 9.421   1.00 32.57 ? 566  PRO A CD    1 
ATOM   3759 N  N     . GLN A 1 533 ? 68.437  -14.447 9.492   1.00 33.95 ? 567  GLN A N     1 
ATOM   3760 C  CA    . GLN A 1 533 ? 69.722  -15.161 9.506   1.00 34.31 ? 567  GLN A CA    1 
ATOM   3761 C  C     . GLN A 1 533 ? 70.502  -15.051 8.189   1.00 34.24 ? 567  GLN A C     1 
ATOM   3762 O  O     . GLN A 1 533 ? 71.600  -15.600 8.063   1.00 34.24 ? 567  GLN A O     1 
ATOM   3763 C  CB    . GLN A 1 533 ? 69.519  -16.632 9.883   1.00 34.55 ? 567  GLN A CB    1 
ATOM   3764 C  CG    . GLN A 1 533 ? 68.833  -17.488 8.817   1.00 35.33 ? 567  GLN A CG    1 
ATOM   3765 C  CD    . GLN A 1 533 ? 68.177  -18.724 9.407   1.00 36.55 ? 567  GLN A CD    1 
ATOM   3766 O  OE1   . GLN A 1 533 ? 67.668  -18.691 10.530  1.00 37.08 ? 567  GLN A OE1   1 
ATOM   3767 N  NE2   . GLN A 1 533 ? 68.181  -19.822 8.652   1.00 37.28 ? 567  GLN A NE2   1 
ATOM   3768 N  N     . LEU A 1 534 ? 69.936  -14.345 7.214   1.00 34.15 ? 568  LEU A N     1 
ATOM   3769 C  CA    . LEU A 1 534 ? 70.640  -14.053 5.973   1.00 34.11 ? 568  LEU A CA    1 
ATOM   3770 C  C     . LEU A 1 534 ? 71.661  -12.945 6.238   1.00 33.95 ? 568  LEU A C     1 
ATOM   3771 O  O     . LEU A 1 534 ? 71.378  -12.001 6.978   1.00 34.22 ? 568  LEU A O     1 
ATOM   3772 C  CB    . LEU A 1 534 ? 69.646  -13.627 4.892   1.00 34.13 ? 568  LEU A CB    1 
ATOM   3773 C  CG    . LEU A 1 534 ? 70.165  -13.492 3.461   1.00 34.37 ? 568  LEU A CG    1 
ATOM   3774 C  CD1   . LEU A 1 534 ? 70.875  -14.767 2.988   1.00 33.98 ? 568  LEU A CD1   1 
ATOM   3775 C  CD2   . LEU A 1 534 ? 69.005  -13.130 2.542   1.00 33.95 ? 568  LEU A CD2   1 
ATOM   3776 N  N     . LYS A 1 535 ? 72.852  -13.085 5.660   1.00 33.69 ? 569  LYS A N     1 
ATOM   3777 C  CA    . LYS A 1 535 ? 73.936  -12.125 5.849   1.00 33.52 ? 569  LYS A CA    1 
ATOM   3778 C  C     . LYS A 1 535 ? 74.271  -11.440 4.538   1.00 33.26 ? 569  LYS A C     1 
ATOM   3779 O  O     . LYS A 1 535 ? 73.893  -11.914 3.465   1.00 32.83 ? 569  LYS A O     1 
ATOM   3780 C  CB    . LYS A 1 535 ? 75.178  -12.810 6.420   1.00 33.64 ? 569  LYS A CB    1 
ATOM   3781 C  CG    . LYS A 1 535 ? 75.012  -13.250 7.872   1.00 34.27 ? 569  LYS A CG    1 
ATOM   3782 C  CD    . LYS A 1 535 ? 76.291  -13.859 8.446   1.00 34.93 ? 569  LYS A CD    1 
ATOM   3783 C  CE    . LYS A 1 535 ? 76.550  -15.266 7.928   1.00 35.32 ? 569  LYS A CE    1 
ATOM   3784 N  NZ    . LYS A 1 535 ? 77.835  -15.825 8.446   1.00 35.58 ? 569  LYS A NZ    1 
ATOM   3785 N  N     . ILE A 1 536 ? 74.989  -10.324 4.639   1.00 33.25 ? 570  ILE A N     1 
ATOM   3786 C  CA    . ILE A 1 536 ? 75.244  -9.465  3.487   1.00 33.17 ? 570  ILE A CA    1 
ATOM   3787 C  C     . ILE A 1 536 ? 76.278  -10.126 2.576   1.00 33.53 ? 570  ILE A C     1 
ATOM   3788 O  O     . ILE A 1 536 ? 77.395  -10.396 3.015   1.00 33.41 ? 570  ILE A O     1 
ATOM   3789 C  CB    . ILE A 1 536 ? 75.775  -8.064  3.904   1.00 33.02 ? 570  ILE A CB    1 
ATOM   3790 C  CG1   . ILE A 1 536 ? 74.866  -7.393  4.939   1.00 32.55 ? 570  ILE A CG1   1 
ATOM   3791 C  CG2   . ILE A 1 536 ? 75.903  -7.167  2.687   1.00 32.41 ? 570  ILE A CG2   1 
ATOM   3792 C  CD1   . ILE A 1 536 ? 75.504  -6.203  5.626   1.00 31.81 ? 570  ILE A CD1   1 
ATOM   3793 N  N     . PRO A 1 537 ? 75.915  -10.397 1.310   1.00 34.16 ? 571  PRO A N     1 
ATOM   3794 C  CA    . PRO A 1 537 ? 76.894  -10.983 0.388   1.00 34.81 ? 571  PRO A CA    1 
ATOM   3795 C  C     . PRO A 1 537 ? 78.029  -10.022 0.000   1.00 35.51 ? 571  PRO A C     1 
ATOM   3796 O  O     . PRO A 1 537 ? 77.758  -8.932  -0.506  1.00 35.74 ? 571  PRO A O     1 
ATOM   3797 C  CB    . PRO A 1 537 ? 76.051  -11.354 -0.841  1.00 34.79 ? 571  PRO A CB    1 
ATOM   3798 C  CG    . PRO A 1 537 ? 74.831  -10.525 -0.753  1.00 34.56 ? 571  PRO A CG    1 
ATOM   3799 C  CD    . PRO A 1 537 ? 74.578  -10.285 0.701   1.00 34.20 ? 571  PRO A CD    1 
ATOM   3800 N  N     . VAL A 1 538 ? 79.277  -10.438 0.240   1.00 36.28 ? 572  VAL A N     1 
ATOM   3801 C  CA    . VAL A 1 538 ? 80.478  -9.646  -0.085  1.00 36.87 ? 572  VAL A CA    1 
ATOM   3802 C  C     . VAL A 1 538 ? 81.613  -10.533 -0.615  1.00 37.54 ? 572  VAL A C     1 
ATOM   3803 O  O     . VAL A 1 538 ? 81.505  -11.758 -0.601  1.00 37.66 ? 572  VAL A O     1 
ATOM   3804 C  CB    . VAL A 1 538 ? 81.012  -8.894  1.156   1.00 36.89 ? 572  VAL A CB    1 
ATOM   3805 C  CG1   . VAL A 1 538 ? 79.991  -7.904  1.664   1.00 36.77 ? 572  VAL A CG1   1 
ATOM   3806 C  CG2   . VAL A 1 538 ? 81.394  -9.878  2.253   1.00 36.78 ? 572  VAL A CG2   1 
ATOM   3807 N  N     . SER A 1 539 ? 82.698  -9.905  -1.071  1.00 38.31 ? 573  SER A N     1 
ATOM   3808 C  CA    . SER A 1 539 ? 83.900  -10.617 -1.532  1.00 38.90 ? 573  SER A CA    1 
ATOM   3809 C  C     . SER A 1 539 ? 84.986  -10.609 -0.463  1.00 39.43 ? 573  SER A C     1 
ATOM   3810 O  O     . SER A 1 539 ? 84.951  -9.786  0.455   1.00 39.74 ? 573  SER A O     1 
ATOM   3811 C  CB    . SER A 1 539 ? 84.455  -9.960  -2.797  1.00 38.90 ? 573  SER A CB    1 
ATOM   3812 O  OG    . SER A 1 539 ? 83.440  -9.804  -3.767  1.00 39.07 ? 573  SER A OG    1 
ATOM   3813 N  N     . ARG A 1 540 ? 85.953  -11.517 -0.590  1.00 40.00 ? 574  ARG A N     1 
ATOM   3814 C  CA    . ARG A 1 540 ? 87.099  -11.565 0.324   1.00 40.35 ? 574  ARG A CA    1 
ATOM   3815 C  C     . ARG A 1 540 ? 87.951  -10.302 0.191   1.00 40.76 ? 574  ARG A C     1 
ATOM   3816 O  O     . ARG A 1 540 ? 88.470  -9.791  1.186   1.00 40.75 ? 574  ARG A O     1 
ATOM   3817 C  CB    . ARG A 1 540 ? 87.959  -12.808 0.064   1.00 40.40 ? 574  ARG A CB    1 
ATOM   3818 C  CG    . ARG A 1 540 ? 89.058  -13.037 1.100   1.00 40.36 ? 574  ARG A CG    1 
ATOM   3819 N  N     . ARG A 1 541 ? 88.088  -9.808  -1.040  1.00 41.27 ? 575  ARG A N     1 
ATOM   3820 C  CA    . ARG A 1 541 ? 88.816  -8.566  -1.315  1.00 41.64 ? 575  ARG A CA    1 
ATOM   3821 C  C     . ARG A 1 541 ? 88.171  -7.363  -0.621  1.00 41.98 ? 575  ARG A C     1 
ATOM   3822 O  O     . ARG A 1 541 ? 88.871  -6.458  -0.164  1.00 42.14 ? 575  ARG A O     1 
ATOM   3823 C  CB    . ARG A 1 541 ? 88.900  -8.313  -2.823  1.00 41.61 ? 575  ARG A CB    1 
ATOM   3824 N  N     . PHE A 1 542 ? 86.842  -7.358  -0.539  1.00 42.34 ? 576  PHE A N     1 
ATOM   3825 C  CA    . PHE A 1 542 ? 86.124  -6.297  0.166   1.00 42.71 ? 576  PHE A CA    1 
ATOM   3826 C  C     . PHE A 1 542 ? 86.289  -6.407  1.685   1.00 42.98 ? 576  PHE A C     1 
ATOM   3827 O  O     . PHE A 1 542 ? 86.417  -5.396  2.381   1.00 43.00 ? 576  PHE A O     1 
ATOM   3828 C  CB    . PHE A 1 542 ? 84.637  -6.316  -0.188  1.00 42.70 ? 576  PHE A CB    1 
ATOM   3829 C  CG    . PHE A 1 542 ? 83.844  -5.255  0.520   1.00 43.08 ? 576  PHE A CG    1 
ATOM   3830 C  CD1   . PHE A 1 542 ? 83.764  -3.968  0.001   1.00 43.38 ? 576  PHE A CD1   1 
ATOM   3831 C  CD2   . PHE A 1 542 ? 83.203  -5.531  1.721   1.00 43.05 ? 576  PHE A CD2   1 
ATOM   3832 C  CE1   . PHE A 1 542 ? 83.046  -2.978  0.660   1.00 43.30 ? 576  PHE A CE1   1 
ATOM   3833 C  CE2   . PHE A 1 542 ? 82.483  -4.549  2.380   1.00 43.03 ? 576  PHE A CE2   1 
ATOM   3834 C  CZ    . PHE A 1 542 ? 82.406  -3.270  1.851   1.00 43.16 ? 576  PHE A CZ    1 
ATOM   3835 N  N     . LEU A 1 543 ? 86.265  -7.640  2.185   1.00 43.38 ? 577  LEU A N     1 
ATOM   3836 C  CA    . LEU A 1 543 ? 86.459  -7.927  3.611   1.00 43.70 ? 577  LEU A CA    1 
ATOM   3837 C  C     . LEU A 1 543 ? 87.864  -7.517  4.090   1.00 43.87 ? 577  LEU A C     1 
ATOM   3838 O  O     . LEU A 1 543 ? 88.037  -7.109  5.241   1.00 44.02 ? 577  LEU A O     1 
ATOM   3839 C  CB    . LEU A 1 543 ? 86.219  -9.424  3.881   1.00 43.76 ? 577  LEU A CB    1 
ATOM   3840 C  CG    . LEU A 1 543 ? 85.674  -9.853  5.247   1.00 44.20 ? 577  LEU A CG    1 
ATOM   3841 C  CD1   . LEU A 1 543 ? 84.236  -9.379  5.436   1.00 44.07 ? 577  LEU A CD1   1 
ATOM   3842 C  CD2   . LEU A 1 543 ? 85.751  -11.372 5.397   1.00 44.18 ? 577  LEU A CD2   1 
ATOM   3843 N  N     . ASP A 1 544 ? 88.855  -7.627  3.203   1.00 44.02 ? 578  ASP A N     1 
ATOM   3844 C  CA    . ASP A 1 544 ? 90.240  -7.234  3.511   1.00 44.12 ? 578  ASP A CA    1 
ATOM   3845 C  C     . ASP A 1 544 ? 90.432  -5.713  3.555   1.00 44.00 ? 578  ASP A C     1 
ATOM   3846 O  O     . ASP A 1 544 ? 91.329  -5.225  4.252   1.00 44.00 ? 578  ASP A O     1 
ATOM   3847 C  CB    . ASP A 1 544 ? 91.230  -7.857  2.509   1.00 44.23 ? 578  ASP A CB    1 
ATOM   3848 C  CG    . ASP A 1 544 ? 91.586  -9.307  2.847   1.00 44.75 ? 578  ASP A CG    1 
ATOM   3849 O  OD1   . ASP A 1 544 ? 90.671  -10.117 3.121   1.00 45.74 ? 578  ASP A OD1   1 
ATOM   3850 O  OD2   . ASP A 1 544 ? 92.789  -9.642  2.829   1.00 45.30 ? 578  ASP A OD2   1 
ATOM   3851 N  N     . LYS A 1 545 ? 89.610  -4.973  2.808   1.00 43.86 ? 579  LYS A N     1 
ATOM   3852 C  CA    . LYS A 1 545 ? 89.614  -3.506  2.883   1.00 43.76 ? 579  LYS A CA    1 
ATOM   3853 C  C     . LYS A 1 545 ? 89.111  -3.042  4.253   1.00 43.66 ? 579  LYS A C     1 
ATOM   3854 O  O     . LYS A 1 545 ? 89.632  -2.079  4.824   1.00 43.62 ? 579  LYS A O     1 
ATOM   3855 C  CB    . LYS A 1 545 ? 88.764  -2.885  1.766   1.00 43.73 ? 579  LYS A CB    1 
ATOM   3856 C  CG    . LYS A 1 545 ? 89.403  -2.951  0.387   1.00 43.67 ? 579  LYS A CG    1 
ATOM   3857 N  N     . LEU A 1 546 ? 88.111  -3.748  4.776   1.00 43.43 ? 580  LEU A N     1 
ATOM   3858 C  CA    . LEU A 1 546 ? 87.542  -3.446  6.090   1.00 43.33 ? 580  LEU A CA    1 
ATOM   3859 C  C     . LEU A 1 546 ? 88.484  -3.827  7.240   1.00 43.19 ? 580  LEU A C     1 
ATOM   3860 O  O     . LEU A 1 546 ? 88.333  -3.327  8.358   1.00 43.31 ? 580  LEU A O     1 
ATOM   3861 C  CB    . LEU A 1 546 ? 86.198  -4.164  6.264   1.00 43.35 ? 580  LEU A CB    1 
ATOM   3862 C  CG    . LEU A 1 546 ? 84.997  -3.638  5.462   1.00 43.25 ? 580  LEU A CG    1 
ATOM   3863 C  CD1   . LEU A 1 546 ? 85.393  -2.954  4.154   1.00 43.05 ? 580  LEU A CD1   1 
ATOM   3864 C  CD2   . LEU A 1 546 ? 84.029  -4.779  5.193   1.00 43.00 ? 580  LEU A CD2   1 
ATOM   3865 N  N     . GLY A 1 547 ? 89.447  -4.706  6.968   1.00 42.87 ? 581  GLY A N     1 
ATOM   3866 C  CA    . GLY A 1 547 ? 90.406  -5.146  7.980   1.00 42.58 ? 581  GLY A CA    1 
ATOM   3867 C  C     . GLY A 1 547 ? 89.793  -6.124  8.967   1.00 42.28 ? 581  GLY A C     1 
ATOM   3868 O  O     . GLY A 1 547 ? 90.162  -6.139  10.144  1.00 42.27 ? 581  GLY A O     1 
ATOM   3869 N  N     . LEU A 1 548 ? 88.863  -6.947  8.477   1.00 41.91 ? 582  LEU A N     1 
ATOM   3870 C  CA    . LEU A 1 548 ? 88.129  -7.903  9.307   1.00 41.57 ? 582  LEU A CA    1 
ATOM   3871 C  C     . LEU A 1 548 ? 88.202  -9.344  8.784   1.00 41.26 ? 582  LEU A C     1 
ATOM   3872 O  O     . LEU A 1 548 ? 87.413  -10.194 9.207   1.00 41.12 ? 582  LEU A O     1 
ATOM   3873 C  CB    . LEU A 1 548 ? 86.659  -7.487  9.391   1.00 41.60 ? 582  LEU A CB    1 
ATOM   3874 C  CG    . LEU A 1 548 ? 86.336  -6.128  10.008  1.00 41.58 ? 582  LEU A CG    1 
ATOM   3875 C  CD1   . LEU A 1 548 ? 84.851  -5.842  9.840   1.00 41.32 ? 582  LEU A CD1   1 
ATOM   3876 C  CD2   . LEU A 1 548 ? 86.741  -6.083  11.480  1.00 41.72 ? 582  LEU A CD2   1 
ATOM   3877 N  N     . SER A 1 549 ? 89.144  -9.632  7.886   1.00 40.83 ? 583  SER A N     1 
ATOM   3878 C  CA    . SER A 1 549 ? 89.245  -10.977 7.308   1.00 40.61 ? 583  SER A CA    1 
ATOM   3879 C  C     . SER A 1 549 ? 89.592  -12.031 8.370   1.00 40.36 ? 583  SER A C     1 
ATOM   3880 O  O     . SER A 1 549 ? 89.258  -13.206 8.209   1.00 40.36 ? 583  SER A O     1 
ATOM   3881 C  CB    . SER A 1 549 ? 90.248  -11.017 6.145   1.00 40.56 ? 583  SER A CB    1 
ATOM   3882 O  OG    . SER A 1 549 ? 91.588  -11.119 6.594   1.00 40.61 ? 583  SER A OG    1 
ATOM   3883 N  N     . ARG A 1 550 ? 90.246  -11.597 9.450   1.00 40.00 ? 584  ARG A N     1 
ATOM   3884 C  CA    . ARG A 1 550 ? 90.594  -12.465 10.580  1.00 39.75 ? 584  ARG A CA    1 
ATOM   3885 C  C     . ARG A 1 550 ? 89.753  -12.182 11.825  1.00 39.32 ? 584  ARG A C     1 
ATOM   3886 O  O     . ARG A 1 550 ? 90.062  -12.687 12.912  1.00 39.26 ? 584  ARG A O     1 
ATOM   3887 C  CB    . ARG A 1 550 ? 92.064  -12.274 10.944  1.00 39.83 ? 584  ARG A CB    1 
ATOM   3888 C  CG    . ARG A 1 550 ? 93.026  -12.606 9.827   1.00 40.29 ? 584  ARG A CG    1 
ATOM   3889 C  CD    . ARG A 1 550 ? 94.443  -12.711 10.349  1.00 41.01 ? 584  ARG A CD    1 
ATOM   3890 N  NE    . ARG A 1 550 ? 94.580  -13.798 11.319  1.00 41.64 ? 584  ARG A NE    1 
ATOM   3891 C  CZ    . ARG A 1 550 ? 95.739  -14.226 11.816  1.00 42.48 ? 584  ARG A CZ    1 
ATOM   3892 N  NH1   . ARG A 1 550 ? 96.890  -13.677 11.435  1.00 42.79 ? 584  ARG A NH1   1 
ATOM   3893 N  NH2   . ARG A 1 550 ? 95.746  -15.223 12.695  1.00 42.85 ? 584  ARG A NH2   1 
ATOM   3894 N  N     . SER A 1 551 ? 88.702  -11.379 11.666  1.00 38.76 ? 585  SER A N     1 
ATOM   3895 C  CA    . SER A 1 551 ? 87.854  -10.964 12.783  1.00 38.40 ? 585  SER A CA    1 
ATOM   3896 C  C     . SER A 1 551 ? 86.602  -11.847 12.874  1.00 37.98 ? 585  SER A C     1 
ATOM   3897 O  O     . SER A 1 551 ? 85.962  -12.120 11.856  1.00 37.60 ? 585  SER A O     1 
ATOM   3898 C  CB    . SER A 1 551 ? 87.450  -9.493  12.620  1.00 38.41 ? 585  SER A CB    1 
ATOM   3899 O  OG    . SER A 1 551 ? 86.724  -9.024  13.745  1.00 38.64 ? 585  SER A OG    1 
ATOM   3900 N  N     . PRO A 1 552 ? 86.252  -12.305 14.094  1.00 37.78 ? 586  PRO A N     1 
ATOM   3901 C  CA    . PRO A 1 552 ? 84.982  -13.026 14.263  1.00 37.65 ? 586  PRO A CA    1 
ATOM   3902 C  C     . PRO A 1 552 ? 83.771  -12.110 14.070  1.00 37.44 ? 586  PRO A C     1 
ATOM   3903 O  O     . PRO A 1 552 ? 82.698  -12.573 13.681  1.00 37.37 ? 586  PRO A O     1 
ATOM   3904 C  CB    . PRO A 1 552 ? 85.051  -13.555 15.705  1.00 37.67 ? 586  PRO A CB    1 
ATOM   3905 C  CG    . PRO A 1 552 ? 86.071  -12.724 16.390  1.00 37.75 ? 586  PRO A CG    1 
ATOM   3906 C  CD    . PRO A 1 552 ? 87.034  -12.247 15.345  1.00 37.75 ? 586  PRO A CD    1 
ATOM   3907 N  N     . ILE A 1 553 ? 83.963  -10.819 14.336  1.00 37.30 ? 587  ILE A N     1 
ATOM   3908 C  CA    . ILE A 1 553 ? 82.938  -9.799  14.109  1.00 37.17 ? 587  ILE A CA    1 
ATOM   3909 C  C     . ILE A 1 553 ? 82.569  -9.764  12.618  1.00 37.23 ? 587  ILE A C     1 
ATOM   3910 O  O     . ILE A 1 553 ? 81.398  -9.627  12.263  1.00 36.96 ? 587  ILE A O     1 
ATOM   3911 C  CB    . ILE A 1 553 ? 83.418  -8.397  14.595  1.00 37.00 ? 587  ILE A CB    1 
ATOM   3912 C  CG1   . ILE A 1 553 ? 83.754  -8.427  16.092  1.00 36.83 ? 587  ILE A CG1   1 
ATOM   3913 C  CG2   . ILE A 1 553 ? 82.361  -7.343  14.340  1.00 36.94 ? 587  ILE A CG2   1 
ATOM   3914 C  CD1   . ILE A 1 553 ? 84.389  -7.156  16.611  1.00 36.09 ? 587  ILE A CD1   1 
ATOM   3915 N  N     . GLY A 1 554 ? 83.573  -9.918  11.758  1.00 37.36 ? 588  GLY A N     1 
ATOM   3916 C  CA    . GLY A 1 554 ? 83.364  -9.959  10.311  1.00 37.55 ? 588  GLY A CA    1 
ATOM   3917 C  C     . GLY A 1 554 ? 82.666  -11.220 9.831   1.00 37.65 ? 588  GLY A C     1 
ATOM   3918 O  O     . GLY A 1 554 ? 81.934  -11.185 8.840   1.00 37.67 ? 588  GLY A O     1 
ATOM   3919 N  N     . LYS A 1 555 ? 82.893  -12.337 10.522  1.00 37.75 ? 589  LYS A N     1 
ATOM   3920 C  CA    . LYS A 1 555 ? 82.198  -13.586 10.198  1.00 37.92 ? 589  LYS A CA    1 
ATOM   3921 C  C     . LYS A 1 555 ? 80.698  -13.456 10.492  1.00 37.98 ? 589  LYS A C     1 
ATOM   3922 O  O     . LYS A 1 555 ? 79.874  -14.011 9.765   1.00 37.96 ? 589  LYS A O     1 
ATOM   3923 C  CB    . LYS A 1 555 ? 82.805  -14.780 10.957  1.00 37.87 ? 589  LYS A CB    1 
ATOM   3924 C  CG    . LYS A 1 555 ? 82.206  -16.146 10.569  1.00 38.09 ? 589  LYS A CG    1 
ATOM   3925 C  CD    . LYS A 1 555 ? 82.956  -17.318 11.212  1.00 37.90 ? 589  LYS A CD    1 
ATOM   3926 N  N     . ALA A 1 556 ? 80.356  -12.711 11.543  1.00 38.16 ? 590  ALA A N     1 
ATOM   3927 C  CA    . ALA A 1 556 ? 78.957  -12.505 11.938  1.00 38.52 ? 590  ALA A CA    1 
ATOM   3928 C  C     . ALA A 1 556 ? 78.176  -11.547 11.015  1.00 38.89 ? 590  ALA A C     1 
ATOM   3929 O  O     . ALA A 1 556 ? 76.961  -11.681 10.879  1.00 38.76 ? 590  ALA A O     1 
ATOM   3930 C  CB    . ALA A 1 556 ? 78.883  -12.016 13.383  1.00 38.34 ? 590  ALA A CB    1 
ATOM   3931 N  N     . MET A 1 557 ? 78.869  -10.597 10.382  1.00 39.46 ? 591  MET A N     1 
ATOM   3932 C  CA    . MET A 1 557 ? 78.214  -9.551  9.579   1.00 39.89 ? 591  MET A CA    1 
ATOM   3933 C  C     . MET A 1 557 ? 77.984  -9.952  8.122   1.00 40.26 ? 591  MET A C     1 
ATOM   3934 O  O     . MET A 1 557 ? 76.929  -9.656  7.554   1.00 40.08 ? 591  MET A O     1 
ATOM   3935 C  CB    . MET A 1 557 ? 79.038  -8.262  9.606   1.00 39.90 ? 591  MET A CB    1 
ATOM   3936 C  CG    . MET A 1 557 ? 79.084  -7.563  10.954  1.00 40.20 ? 591  MET A CG    1 
ATOM   3937 S  SD    . MET A 1 557 ? 80.369  -6.284  11.012  1.00 42.04 ? 591  MET A SD    1 
ATOM   3938 C  CE    . MET A 1 557 ? 79.786  -5.156  9.745   1.00 41.15 ? 591  MET A CE    1 
ATOM   3939 N  N     . PHE A 1 558 ? 78.973  -10.617 7.527   1.00 40.84 ? 592  PHE A N     1 
ATOM   3940 C  CA    . PHE A 1 558 ? 78.993  -10.864 6.088   1.00 41.41 ? 592  PHE A CA    1 
ATOM   3941 C  C     . PHE A 1 558 ? 79.056  -12.342 5.734   1.00 42.02 ? 592  PHE A C     1 
ATOM   3942 O  O     . PHE A 1 558 ? 79.572  -13.159 6.504   1.00 42.05 ? 592  PHE A O     1 
ATOM   3943 C  CB    . PHE A 1 558 ? 80.213  -10.196 5.463   1.00 41.40 ? 592  PHE A CB    1 
ATOM   3944 C  CG    . PHE A 1 558 ? 80.336  -8.734  5.775   1.00 41.86 ? 592  PHE A CG    1 
ATOM   3945 C  CD1   . PHE A 1 558 ? 79.534  -7.806  5.126   1.00 41.74 ? 592  PHE A CD1   1 
ATOM   3946 C  CD2   . PHE A 1 558 ? 81.265  -8.282  6.708   1.00 42.05 ? 592  PHE A CD2   1 
ATOM   3947 C  CE1   . PHE A 1 558 ? 79.645  -6.458  5.406   1.00 41.99 ? 592  PHE A CE1   1 
ATOM   3948 C  CE2   . PHE A 1 558 ? 81.385  -6.930  6.993   1.00 42.01 ? 592  PHE A CE2   1 
ATOM   3949 C  CZ    . PHE A 1 558 ? 80.575  -6.017  6.341   1.00 42.25 ? 592  PHE A CZ    1 
ATOM   3950 N  N     . GLU A 1 559 ? 78.526  -12.665 4.556   1.00 42.73 ? 593  GLU A N     1 
ATOM   3951 C  CA    . GLU A 1 559 ? 78.737  -13.962 3.924   1.00 43.38 ? 593  GLU A CA    1 
ATOM   3952 C  C     . GLU A 1 559 ? 79.504  -13.730 2.626   1.00 43.77 ? 593  GLU A C     1 
ATOM   3953 O  O     . GLU A 1 559 ? 79.186  -12.816 1.867   1.00 43.71 ? 593  GLU A O     1 
ATOM   3954 C  CB    . GLU A 1 559 ? 77.409  -14.674 3.630   1.00 43.47 ? 593  GLU A CB    1 
ATOM   3955 C  CG    . GLU A 1 559 ? 77.592  -16.038 2.928   1.00 43.94 ? 593  GLU A CG    1 
ATOM   3956 C  CD    . GLU A 1 559 ? 76.302  -16.827 2.754   1.00 44.30 ? 593  GLU A CD    1 
ATOM   3957 O  OE1   . GLU A 1 559 ? 75.210  -16.286 3.033   1.00 44.71 ? 593  GLU A OE1   1 
ATOM   3958 O  OE2   . GLU A 1 559 ? 76.386  -17.998 2.325   1.00 44.53 ? 593  GLU A OE2   1 
ATOM   3959 N  N     . ILE A 1 560 ? 80.515  -14.560 2.383   1.00 44.28 ? 594  ILE A N     1 
ATOM   3960 C  CA    . ILE A 1 560 ? 81.308  -14.475 1.161   1.00 44.74 ? 594  ILE A CA    1 
ATOM   3961 C  C     . ILE A 1 560 ? 80.584  -15.190 0.011   1.00 45.11 ? 594  ILE A C     1 
ATOM   3962 O  O     . ILE A 1 560 ? 80.523  -16.421 -0.021  1.00 45.20 ? 594  ILE A O     1 
ATOM   3963 C  CB    . ILE A 1 560 ? 82.717  -15.074 1.364   1.00 44.77 ? 594  ILE A CB    1 
ATOM   3964 C  CG1   . ILE A 1 560 ? 83.525  -14.189 2.320   1.00 44.64 ? 594  ILE A CG1   1 
ATOM   3965 C  CG2   . ILE A 1 560 ? 83.437  -15.234 0.019   1.00 44.86 ? 594  ILE A CG2   1 
ATOM   3966 C  CD1   . ILE A 1 560 ? 84.914  -14.722 2.637   1.00 44.95 ? 594  ILE A CD1   1 
ATOM   3967 N  N     . ARG A 1 561 ? 80.031  -14.405 -0.915  1.00 45.48 ? 595  ARG A N     1 
ATOM   3968 C  CA    . ARG A 1 561 ? 79.303  -14.931 -2.074  1.00 45.72 ? 595  ARG A CA    1 
ATOM   3969 C  C     . ARG A 1 561 ? 80.095  -14.656 -3.363  1.00 45.98 ? 595  ARG A C     1 
ATOM   3970 O  O     . ARG A 1 561 ? 79.525  -14.260 -4.387  1.00 46.12 ? 595  ARG A O     1 
ATOM   3971 C  CB    . ARG A 1 561 ? 77.912  -14.284 -2.141  1.00 45.80 ? 595  ARG A CB    1 
ATOM   3972 C  CG    . ARG A 1 561 ? 76.832  -15.117 -2.849  1.00 45.74 ? 595  ARG A CG    1 
ATOM   3973 C  CD    . ARG A 1 561 ? 75.903  -15.811 -1.850  1.00 45.64 ? 595  ARG A CD    1 
ATOM   3974 N  NE    . ARG A 1 561 ? 74.745  -16.420 -2.501  1.00 45.37 ? 595  ARG A NE    1 
ATOM   3975 N  N     . ASP A 1 562 ? 81.409  -14.888 -3.306  1.00 46.22 ? 596  ASP A N     1 
ATOM   3976 C  CA    . ASP A 1 562 ? 82.325  -14.585 -4.418  1.00 46.35 ? 596  ASP A CA    1 
ATOM   3977 C  C     . ASP A 1 562 ? 82.545  -15.805 -5.312  1.00 46.35 ? 596  ASP A C     1 
ATOM   3978 O  O     . ASP A 1 562 ? 81.962  -15.908 -6.391  1.00 46.42 ? 596  ASP A O     1 
ATOM   3979 C  CB    . ASP A 1 562 ? 83.675  -14.091 -3.882  1.00 46.30 ? 596  ASP A CB    1 
ATOM   3980 O  "O5'" . U   B 2 1   ? 78.296  1.360   -0.012  1.00 53.43 ? 1    U   B "O5'" 1 
ATOM   3981 C  "C5'" . U   B 2 1   ? 78.601  0.076   -0.580  1.00 53.48 ? 1    U   B "C5'" 1 
ATOM   3982 C  "C4'" . U   B 2 1   ? 80.067  -0.061  -0.972  1.00 53.36 ? 1    U   B "C4'" 1 
ATOM   3983 O  "O4'" . U   B 2 1   ? 80.456  -1.467  -0.920  1.00 53.04 ? 1    U   B "O4'" 1 
ATOM   3984 C  "C3'" . U   B 2 1   ? 80.411  0.414   -2.386  1.00 53.26 ? 1    U   B "C3'" 1 
ATOM   3985 O  "O3'" . U   B 2 1   ? 81.674  1.110   -2.427  1.00 52.78 ? 1    U   B "O3'" 1 
ATOM   3986 C  "C2'" . U   B 2 1   ? 80.451  -0.898  -3.171  1.00 53.25 ? 1    U   B "C2'" 1 
ATOM   3987 O  "O2'" . U   B 2 1   ? 81.220  -0.815  -4.357  1.00 53.05 ? 1    U   B "O2'" 1 
ATOM   3988 C  "C1'" . U   B 2 1   ? 81.085  -1.827  -2.136  1.00 53.09 ? 1    U   B "C1'" 1 
ATOM   3989 N  N1    . U   B 2 1   ? 80.918  -3.304  -2.420  1.00 53.02 ? 1    U   B N1    1 
ATOM   3990 C  C2    . U   B 2 1   ? 81.966  -4.023  -2.982  1.00 53.18 ? 1    U   B C2    1 
ATOM   3991 O  O2    . U   B 2 1   ? 83.046  -3.532  -3.266  1.00 53.17 ? 1    U   B O2    1 
ATOM   3992 N  N3    . U   B 2 1   ? 81.714  -5.362  -3.205  1.00 52.93 ? 1    U   B N3    1 
ATOM   3993 C  C4    . U   B 2 1   ? 80.541  -6.045  -2.930  1.00 52.82 ? 1    U   B C4    1 
ATOM   3994 O  O4    . U   B 2 1   ? 80.460  -7.243  -3.185  1.00 52.45 ? 1    U   B O4    1 
ATOM   3995 C  C5    . U   B 2 1   ? 79.492  -5.237  -2.350  1.00 52.87 ? 1    U   B C5    1 
ATOM   3996 C  C6    . U   B 2 1   ? 79.718  -3.932  -2.125  1.00 52.89 ? 1    U   B C6    1 
ATOM   3997 P  P     . U   B 2 2   ? 81.756  2.708   -2.556  1.00 52.52 ? 2    U   B P     1 
ATOM   3998 O  OP1   . U   B 2 2   ? 81.397  3.086   -3.945  1.00 52.38 ? 2    U   B OP1   1 
ATOM   3999 O  OP2   . U   B 2 2   ? 83.054  3.153   -1.997  1.00 52.45 ? 2    U   B OP2   1 
ATOM   4000 O  "O5'" . U   B 2 2   ? 80.600  3.184   -1.557  1.00 50.95 ? 2    U   B "O5'" 1 
ATOM   4001 C  "C5'" . U   B 2 2   ? 80.196  4.545   -1.510  1.00 49.44 ? 2    U   B "C5'" 1 
ATOM   4002 C  "C4'" . U   B 2 2   ? 81.217  5.379   -0.759  1.00 48.16 ? 2    U   B "C4'" 1 
ATOM   4003 O  "O4'" . U   B 2 2   ? 82.110  6.034   -1.694  1.00 48.20 ? 2    U   B "O4'" 1 
ATOM   4004 C  "C3'" . U   B 2 2   ? 80.620  6.503   0.075   1.00 46.73 ? 2    U   B "C3'" 1 
ATOM   4005 O  "O3'" . U   B 2 2   ? 80.416  6.046   1.418   1.00 43.18 ? 2    U   B "O3'" 1 
ATOM   4006 C  "C2'" . U   B 2 2   ? 81.648  7.644   -0.033  1.00 47.76 ? 2    U   B "C2'" 1 
ATOM   4007 O  "O2'" . U   B 2 2   ? 82.254  7.980   1.208   1.00 48.54 ? 2    U   B "O2'" 1 
ATOM   4008 C  "C1'" . U   B 2 2   ? 82.697  7.133   -1.032  1.00 47.93 ? 2    U   B "C1'" 1 
ATOM   4009 N  N1    . U   B 2 2   ? 83.116  8.131   -2.061  1.00 47.39 ? 2    U   B N1    1 
ATOM   4010 P  P     . U   B 2 3   ? 79.082  5.296   1.910   1.00 39.70 ? 3    U   B P     1 
ATOM   4011 O  OP1   . U   B 2 3   ? 79.374  3.844   1.977   1.00 39.02 ? 3    U   B OP1   1 
ATOM   4012 O  OP2   . U   B 2 3   ? 77.916  5.799   1.148   1.00 38.74 ? 3    U   B OP2   1 
ATOM   4013 O  "O5'" . U   B 2 3   ? 78.935  5.840   3.403   1.00 36.37 ? 3    U   B "O5'" 1 
ATOM   4014 C  "C5'" . U   B 2 3   ? 80.072  6.206   4.156   1.00 33.60 ? 3    U   B "C5'" 1 
ATOM   4015 C  "C4'" . U   B 2 3   ? 79.651  6.751   5.505   1.00 31.64 ? 3    U   B "C4'" 1 
ATOM   4016 O  "O4'" . U   B 2 3   ? 80.695  6.452   6.454   1.00 32.64 ? 3    U   B "O4'" 1 
ATOM   4017 C  "C3'" . U   B 2 3   ? 79.472  8.259   5.575   1.00 29.46 ? 3    U   B "C3'" 1 
ATOM   4018 O  "O3'" . U   B 2 3   ? 78.112  8.609   5.336   1.00 24.00 ? 3    U   B "O3'" 1 
ATOM   4019 C  "C2'" . U   B 2 3   ? 79.879  8.600   7.001   1.00 31.14 ? 3    U   B "C2'" 1 
ATOM   4020 O  "O2'" . U   B 2 3   ? 78.764  8.631   7.873   1.00 31.20 ? 3    U   B "O2'" 1 
ATOM   4021 C  "C1'" . U   B 2 3   ? 80.850  7.486   7.408   1.00 33.17 ? 3    U   B "C1'" 1 
ATOM   4022 N  N1    . U   B 2 3   ? 82.325  7.856   7.516   1.00 35.99 ? 3    U   B N1    1 
ATOM   4023 C  C2    . U   B 2 3   ? 82.736  8.939   8.295   1.00 37.60 ? 3    U   B C2    1 
ATOM   4024 O  O2    . U   B 2 3   ? 81.981  9.671   8.923   1.00 37.78 ? 3    U   B O2    1 
ATOM   4025 N  N3    . U   B 2 3   ? 84.097  9.164   8.304   1.00 38.54 ? 3    U   B N3    1 
ATOM   4026 C  C4    . U   B 2 3   ? 85.071  8.421   7.648   1.00 39.44 ? 3    U   B C4    1 
ATOM   4027 O  O4    . U   B 2 3   ? 86.257  8.726   7.751   1.00 40.89 ? 3    U   B O4    1 
ATOM   4028 C  C5    . U   B 2 3   ? 84.576  7.309   6.875   1.00 38.66 ? 3    U   B C5    1 
ATOM   4029 C  C6    . U   B 2 3   ? 83.258  7.078   6.842   1.00 37.25 ? 3    U   B C6    1 
HETATM 4030 P  P     . 5BU B 2 4   ? 77.698  9.836   4.410   1.00 17.64 ? 4    5BU B P     1 
HETATM 4031 O  OP1   . 5BU B 2 4   ? 76.296  9.624   4.021   1.00 18.12 ? 4    5BU B OP1   1 
HETATM 4032 O  OP2   . 5BU B 2 4   ? 78.707  9.977   3.349   1.00 18.07 ? 4    5BU B OP2   1 
HETATM 4033 O  "O5'" . 5BU B 2 4   ? 77.725  11.086  5.393   1.00 15.82 ? 4    5BU B "O5'" 1 
HETATM 4034 C  "C5'" . 5BU B 2 4   ? 76.758  11.151  6.431   1.00 14.68 ? 4    5BU B "C5'" 1 
HETATM 4035 C  "C4'" . 5BU B 2 4   ? 76.749  12.477  7.156   1.00 14.20 ? 4    5BU B "C4'" 1 
HETATM 4036 O  "O4'" . 5BU B 2 4   ? 77.811  12.459  8.128   1.00 14.69 ? 4    5BU B "O4'" 1 
HETATM 4037 C  "C3'" . 5BU B 2 4   ? 77.012  13.735  6.318   1.00 14.54 ? 4    5BU B "C3'" 1 
HETATM 4038 O  "O3'" . 5BU B 2 4   ? 75.835  14.193  5.710   1.00 12.92 ? 4    5BU B "O3'" 1 
HETATM 4039 C  "C2'" . 5BU B 2 4   ? 77.489  14.686  7.393   1.00 14.50 ? 4    5BU B "C2'" 1 
HETATM 4040 O  "O2'" . 5BU B 2 4   ? 76.434  15.210  8.158   1.00 14.53 ? 4    5BU B "O2'" 1 
HETATM 4041 C  "C1'" . 5BU B 2 4   ? 78.355  13.760  8.234   1.00 15.53 ? 4    5BU B "C1'" 1 
HETATM 4042 N  N1    . 5BU B 2 4   ? 79.759  13.755  7.756   1.00 16.86 ? 4    5BU B N1    1 
HETATM 4043 C  C2    . 5BU B 2 4   ? 80.586  14.795  8.125   1.00 16.92 ? 4    5BU B C2    1 
HETATM 4044 O  O2    . 5BU B 2 4   ? 80.224  15.720  8.822   1.00 18.75 ? 4    5BU B O2    1 
HETATM 4045 N  N3    . 5BU B 2 4   ? 81.867  14.719  7.650   1.00 17.75 ? 4    5BU B N3    1 
HETATM 4046 C  C4    . 5BU B 2 4   ? 82.394  13.726  6.857   1.00 18.91 ? 4    5BU B C4    1 
HETATM 4047 O  O4    . 5BU B 2 4   ? 83.558  13.768  6.489   1.00 21.54 ? 4    5BU B O4    1 
HETATM 4048 C  C5    . 5BU B 2 4   ? 81.479  12.687  6.508   1.00 18.98 ? 4    5BU B C5    1 
HETATM 4049 C  C6    . 5BU B 2 4   ? 80.219  12.725  6.955   1.00 18.13 ? 4    5BU B C6    1 
HETATM 4050 BR BR    . 5BU B 2 4   ? 82.095  11.289  5.425   0.50 21.61 ? 4    5BU B BR    1 
ATOM   4051 P  P     . U   B 2 5   ? 75.837  15.100  4.410   1.00 12.47 ? 5    U   B P     1 
ATOM   4052 O  OP1   . U   B 2 5   ? 74.413  15.355  4.094   1.00 11.81 ? 5    U   B OP1   1 
ATOM   4053 O  OP2   . U   B 2 5   ? 76.727  14.577  3.352   1.00 12.51 ? 5    U   B OP2   1 
ATOM   4054 O  "O5'" . U   B 2 5   ? 76.495  16.416  5.026   1.00 12.51 ? 5    U   B "O5'" 1 
ATOM   4055 C  "C5'" . U   B 2 5   ? 77.086  17.418  4.212   1.00 12.21 ? 5    U   B "C5'" 1 
ATOM   4056 C  "C4'" . U   B 2 5   ? 77.768  18.398  5.144   1.00 12.28 ? 5    U   B "C4'" 1 
ATOM   4057 O  "O4'" . U   B 2 5   ? 78.606  17.604  6.010   1.00 13.19 ? 5    U   B "O4'" 1 
ATOM   4058 C  "C3'" . U   B 2 5   ? 78.694  19.450  4.551   1.00 10.81 ? 5    U   B "C3'" 1 
ATOM   4059 O  "O3'" . U   B 2 5   ? 77.978  20.633  4.265   1.00 9.05  ? 5    U   B "O3'" 1 
ATOM   4060 C  "C2'" . U   B 2 5   ? 79.706  19.649  5.676   1.00 12.41 ? 5    U   B "C2'" 1 
ATOM   4061 O  "O2'" . U   B 2 5   ? 79.286  20.504  6.730   1.00 11.44 ? 5    U   B "O2'" 1 
ATOM   4062 C  "C1'" . U   B 2 5   ? 79.850  18.226  6.204   1.00 14.14 ? 5    U   B "C1'" 1 
ATOM   4063 N  N1    . U   B 2 5   ? 80.899  17.429  5.507   1.00 16.78 ? 5    U   B N1    1 
ATOM   4064 C  C2    . U   B 2 5   ? 82.220  17.786  5.718   1.00 17.75 ? 5    U   B C2    1 
ATOM   4065 O  O2    . U   B 2 5   ? 82.559  18.714  6.440   1.00 16.45 ? 5    U   B O2    1 
ATOM   4066 N  N3    . U   B 2 5   ? 83.132  17.010  5.049   1.00 18.63 ? 5    U   B N3    1 
ATOM   4067 C  C4    . U   B 2 5   ? 82.870  15.938  4.225   1.00 18.98 ? 5    U   B C4    1 
ATOM   4068 O  O4    . U   B 2 5   ? 83.797  15.338  3.694   1.00 19.59 ? 5    U   B O4    1 
ATOM   4069 C  C5    . U   B 2 5   ? 81.472  15.627  4.059   1.00 18.96 ? 5    U   B C5    1 
ATOM   4070 C  C6    . U   B 2 5   ? 80.558  16.366  4.695   1.00 17.10 ? 5    U   B C6    1 
ATOM   4071 P  P     . U   B 2 6   ? 77.880  21.191  2.763   1.00 8.70  ? 6    U   B P     1 
ATOM   4072 O  OP1   . U   B 2 6   ? 77.037  22.400  2.762   1.00 7.29  ? 6    U   B OP1   1 
ATOM   4073 O  OP2   . U   B 2 6   ? 77.511  20.050  1.918   1.00 6.40  ? 6    U   B OP2   1 
ATOM   4074 O  "O5'" . U   B 2 6   ? 79.371  21.690  2.452   1.00 10.24 ? 6    U   B "O5'" 1 
ATOM   4075 C  "C5'" . U   B 2 6   ? 79.891  22.689  3.316   1.00 12.01 ? 6    U   B "C5'" 1 
ATOM   4076 C  "C4'" . U   B 2 6   ? 81.400  22.703  3.358   1.00 13.95 ? 6    U   B "C4'" 1 
ATOM   4077 O  "O4'" . U   B 2 6   ? 81.931  21.494  3.969   1.00 15.20 ? 6    U   B "O4'" 1 
ATOM   4078 C  "C3'" . U   B 2 6   ? 82.091  22.788  2.000   1.00 14.65 ? 6    U   B "C3'" 1 
ATOM   4079 O  "O3'" . U   B 2 6   ? 82.068  24.128  1.500   1.00 12.68 ? 6    U   B "O3'" 1 
ATOM   4080 C  "C2'" . U   B 2 6   ? 83.492  22.324  2.384   1.00 15.64 ? 6    U   B "C2'" 1 
ATOM   4081 O  "O2'" . U   B 2 6   ? 84.245  23.338  3.034   1.00 17.55 ? 6    U   B "O2'" 1 
ATOM   4082 C  "C1'" . U   B 2 6   ? 83.178  21.184  3.356   1.00 16.42 ? 6    U   B "C1'" 1 
ATOM   4083 N  N1    . U   B 2 6   ? 83.114  19.854  2.661   1.00 17.90 ? 6    U   B N1    1 
ATOM   4084 C  C2    . U   B 2 6   ? 84.271  19.105  2.532   1.00 18.53 ? 6    U   B C2    1 
ATOM   4085 O  O2    . U   B 2 6   ? 85.359  19.447  2.957   1.00 17.83 ? 6    U   B O2    1 
ATOM   4086 N  N3    . U   B 2 6   ? 84.107  17.912  1.875   1.00 19.61 ? 6    U   B N3    1 
ATOM   4087 C  C4    . U   B 2 6   ? 82.934  17.405  1.343   1.00 19.94 ? 6    U   B C4    1 
ATOM   4088 O  O4    . U   B 2 6   ? 82.951  16.318  0.781   1.00 21.28 ? 6    U   B O4    1 
ATOM   4089 C  C5    . U   B 2 6   ? 81.770  18.235  1.512   1.00 19.19 ? 6    U   B C5    1 
ATOM   4090 C  C6    . U   B 2 6   ? 81.908  19.403  2.144   1.00 18.24 ? 6    U   B C6    1 
ATOM   4091 P  P     . U   B 2 7   ? 81.956  24.345  -0.076  1.00 11.62 ? 7    U   B P     1 
ATOM   4092 O  OP1   . U   B 2 7   ? 82.211  25.783  -0.298  1.00 13.68 ? 7    U   B OP1   1 
ATOM   4093 O  OP2   . U   B 2 7   ? 80.681  23.769  -0.544  1.00 10.09 ? 7    U   B OP2   1 
ATOM   4094 O  "O5'" . U   B 2 7   ? 83.211  23.515  -0.643  1.00 11.65 ? 7    U   B "O5'" 1 
ATOM   4095 C  "C5'" . U   B 2 7   ? 83.338  23.205  -2.036  1.00 13.51 ? 7    U   B "C5'" 1 
ATOM   4096 C  "C4'" . U   B 2 7   ? 83.988  24.326  -2.825  1.00 14.93 ? 7    U   B "C4'" 1 
ATOM   4097 O  "O4'" . U   B 2 7   ? 85.379  24.434  -2.459  1.00 16.10 ? 7    U   B "O4'" 1 
ATOM   4098 C  "C3'" . U   B 2 7   ? 84.039  24.108  -4.323  1.00 16.94 ? 7    U   B "C3'" 1 
ATOM   4099 O  "O3'" . U   B 2 7   ? 82.843  24.556  -4.912  1.00 18.53 ? 7    U   B "O3'" 1 
ATOM   4100 C  "C2'" . U   B 2 7   ? 85.260  24.903  -4.783  1.00 16.75 ? 7    U   B "C2'" 1 
ATOM   4101 O  "O2'" . U   B 2 7   ? 84.984  26.256  -5.121  1.00 17.16 ? 7    U   B "O2'" 1 
ATOM   4102 C  "C1'" . U   B 2 7   ? 86.172  24.798  -3.565  1.00 16.23 ? 7    U   B "C1'" 1 
ATOM   4103 N  N1    . U   B 2 7   ? 87.269  23.791  -3.727  1.00 16.78 ? 7    U   B N1    1 
ATOM   4104 C  C2    . U   B 2 7   ? 88.296  24.075  -4.603  1.00 15.85 ? 7    U   B C2    1 
ATOM   4105 O  O2    . U   B 2 7   ? 88.353  25.095  -5.255  1.00 15.38 ? 7    U   B O2    1 
ATOM   4106 N  N3    . U   B 2 7   ? 89.262  23.112  -4.698  1.00 17.02 ? 7    U   B N3    1 
ATOM   4107 C  C4    . U   B 2 7   ? 89.312  21.908  -4.015  1.00 18.69 ? 7    U   B C4    1 
ATOM   4108 O  O4    . U   B 2 7   ? 90.246  21.136  -4.210  1.00 20.47 ? 7    U   B O4    1 
ATOM   4109 C  C5    . U   B 2 7   ? 88.206  21.668  -3.121  1.00 18.60 ? 7    U   B C5    1 
ATOM   4110 C  C6    . U   B 2 7   ? 87.247  22.601  -3.013  1.00 17.82 ? 7    U   B C6    1 
ATOM   4111 P  P     . U   B 2 8   ? 82.031  23.535  -5.812  1.00 20.41 ? 8    U   B P     1 
ATOM   4112 O  OP1   . U   B 2 8   ? 80.892  24.299  -6.366  1.00 21.16 ? 8    U   B OP1   1 
ATOM   4113 O  OP2   . U   B 2 8   ? 81.784  22.289  -5.059  1.00 20.32 ? 8    U   B OP2   1 
ATOM   4114 O  "O5'" . U   B 2 8   ? 83.068  23.241  -6.983  1.00 23.23 ? 8    U   B "O5'" 1 
ATOM   4115 C  "C5'" . U   B 2 8   ? 83.558  24.326  -7.768  1.00 26.92 ? 8    U   B "C5'" 1 
ATOM   4116 C  "C4'" . U   B 2 8   ? 84.719  23.883  -8.627  1.00 29.66 ? 8    U   B "C4'" 1 
ATOM   4117 O  "O4'" . U   B 2 8   ? 85.898  23.583  -7.846  1.00 30.46 ? 8    U   B "O4'" 1 
ATOM   4118 C  "C3'" . U   B 2 8   ? 84.469  22.591  -9.374  1.00 32.11 ? 8    U   B "C3'" 1 
ATOM   4119 O  "O3'" . U   B 2 8   ? 83.657  22.866  -10.475 1.00 35.29 ? 8    U   B "O3'" 1 
ATOM   4120 C  "C2'" . U   B 2 8   ? 85.878  22.175  -9.760  1.00 32.06 ? 8    U   B "C2'" 1 
ATOM   4121 O  "O2'" . U   B 2 8   ? 86.367  22.870  -10.894 1.00 31.24 ? 8    U   B "O2'" 1 
ATOM   4122 C  "C1'" . U   B 2 8   ? 86.636  22.554  -8.488  1.00 31.56 ? 8    U   B "C1'" 1 
ATOM   4123 N  N1    . U   B 2 8   ? 86.839  21.417  -7.530  1.00 32.18 ? 8    U   B N1    1 
ATOM   4124 C  C2    . U   B 2 8   ? 88.013  20.684  -7.600  1.00 32.89 ? 8    U   B C2    1 
ATOM   4125 O  O2    . U   B 2 8   ? 88.897  20.902  -8.410  1.00 33.93 ? 8    U   B O2    1 
ATOM   4126 N  N3    . U   B 2 8   ? 88.127  19.669  -6.684  1.00 32.69 ? 8    U   B N3    1 
ATOM   4127 C  C4    . U   B 2 8   ? 87.202  19.317  -5.720  1.00 33.07 ? 8    U   B C4    1 
ATOM   4128 O  O4    . U   B 2 8   ? 87.445  18.377  -4.971  1.00 33.58 ? 8    U   B O4    1 
ATOM   4129 C  C5    . U   B 2 8   ? 86.000  20.121  -5.696  1.00 32.87 ? 8    U   B C5    1 
ATOM   4130 C  C6    . U   B 2 8   ? 85.870  21.117  -6.584  1.00 32.51 ? 8    U   B C6    1 
ATOM   4131 P  P     . U   B 2 9   ? 82.751  21.692  -11.036 1.00 38.73 ? 9    U   B P     1 
ATOM   4132 O  OP1   . U   B 2 9   ? 81.638  21.472  -10.084 1.00 38.52 ? 9    U   B OP1   1 
ATOM   4133 O  OP2   . U   B 2 9   ? 83.650  20.571  -11.403 1.00 39.06 ? 9    U   B OP2   1 
ATOM   4134 O  "O5'" . U   B 2 9   ? 82.201  22.366  -12.384 1.00 41.34 ? 9    U   B "O5'" 1 
ATOM   4135 C  "C5'" . U   B 2 9   ? 81.113  23.293  -12.312 1.00 43.53 ? 9    U   B "C5'" 1 
ATOM   4136 C  "C4'" . U   B 2 9   ? 81.367  24.557  -13.121 1.00 44.67 ? 9    U   B "C4'" 1 
ATOM   4137 O  "O4'" . U   B 2 9   ? 80.085  25.159  -13.428 1.00 45.28 ? 9    U   B "O4'" 1 
ATOM   4138 C  "C3'" . U   B 2 9   ? 82.130  25.675  -12.416 1.00 45.45 ? 9    U   B "C3'" 1 
ATOM   4139 O  "O3'" . U   B 2 9   ? 82.693  26.588  -13.374 1.00 45.96 ? 9    U   B "O3'" 1 
ATOM   4140 C  "C2'" . U   B 2 9   ? 81.035  26.319  -11.571 1.00 45.42 ? 9    U   B "C2'" 1 
ATOM   4141 O  "O2'" . U   B 2 9   ? 81.304  27.660  -11.210 1.00 45.28 ? 9    U   B "O2'" 1 
ATOM   4142 C  "C1'" . U   B 2 9   ? 79.840  26.232  -12.531 1.00 45.75 ? 9    U   B "C1'" 1 
ATOM   4143 N  N1    . U   B 2 9   ? 78.481  26.007  -11.900 1.00 46.01 ? 9    U   B N1    1 
ATOM   4144 C  C2    . U   B 2 9   ? 77.388  26.676  -12.433 1.00 46.15 ? 9    U   B C2    1 
ATOM   4145 O  O2    . U   B 2 9   ? 77.471  27.440  -13.382 1.00 46.26 ? 9    U   B O2    1 
ATOM   4146 N  N3    . U   B 2 9   ? 76.186  26.423  -11.809 1.00 46.06 ? 9    U   B N3    1 
ATOM   4147 C  C4    . U   B 2 9   ? 75.972  25.581  -10.727 1.00 46.31 ? 9    U   B C4    1 
ATOM   4148 O  O4    . U   B 2 9   ? 74.840  25.450  -10.270 1.00 46.87 ? 9    U   B O4    1 
ATOM   4149 C  C5    . U   B 2 9   ? 77.150  24.914  -10.225 1.00 45.97 ? 9    U   B C5    1 
ATOM   4150 C  C6    . U   B 2 9   ? 78.329  25.146  -10.818 1.00 45.90 ? 9    U   B C6    1 
ATOM   4151 P  P     . U   B 2 10  ? 84.211  26.410  -13.851 1.00 46.44 ? 10   U   B P     1 
ATOM   4152 O  OP1   . U   B 2 10  ? 84.462  27.296  -15.011 1.00 45.97 ? 10   U   B OP1   1 
ATOM   4153 O  OP2   . U   B 2 10  ? 84.478  24.952  -13.941 1.00 47.00 ? 10   U   B OP2   1 
ATOM   4154 O  "O5'" . U   B 2 10  ? 85.021  26.968  -12.598 1.00 47.16 ? 10   U   B "O5'" 1 
ATOM   4155 C  "C5'" . U   B 2 10  ? 85.888  26.124  -11.844 1.00 47.07 ? 10   U   B "C5'" 1 
ATOM   4156 C  "C4'" . U   B 2 10  ? 86.895  26.974  -11.099 1.00 47.00 ? 10   U   B "C4'" 1 
ATOM   4157 O  "O4'" . U   B 2 10  ? 87.415  28.004  -11.987 1.00 46.60 ? 10   U   B "O4'" 1 
ATOM   4158 C  "C3'" . U   B 2 10  ? 86.335  27.752  -9.917  1.00 46.99 ? 10   U   B "C3'" 1 
ATOM   4159 O  "O3'" . U   B 2 10  ? 86.169  26.928  -8.759  1.00 46.13 ? 10   U   B "O3'" 1 
ATOM   4160 C  "C2'" . U   B 2 10  ? 87.430  28.801  -9.762  1.00 47.09 ? 10   U   B "C2'" 1 
ATOM   4161 O  "O2'" . U   B 2 10  ? 88.535  28.300  -9.037  1.00 47.54 ? 10   U   B "O2'" 1 
ATOM   4162 C  "C1'" . U   B 2 10  ? 87.811  29.124  -11.215 1.00 46.79 ? 10   U   B "C1'" 1 
ATOM   4163 N  N1    . U   B 2 10  ? 87.175  30.413  -11.711 1.00 46.71 ? 10   U   B N1    1 
ATOM   4164 C  C2    . U   B 2 10  ? 87.800  31.614  -11.414 1.00 46.52 ? 10   U   B C2    1 
ATOM   4165 O  O2    . U   B 2 10  ? 88.842  31.683  -10.787 1.00 46.67 ? 10   U   B O2    1 
ATOM   4166 N  N3    . U   B 2 10  ? 87.166  32.745  -11.880 1.00 46.34 ? 10   U   B N3    1 
ATOM   4167 C  C4    . U   B 2 10  ? 85.983  32.809  -12.597 1.00 46.24 ? 10   U   B C4    1 
ATOM   4168 O  O4    . U   B 2 10  ? 85.533  33.902  -12.941 1.00 45.72 ? 10   U   B O4    1 
ATOM   4169 C  C5    . U   B 2 10  ? 85.379  31.523  -12.869 1.00 46.35 ? 10   U   B C5    1 
ATOM   4170 C  C6    . U   B 2 10  ? 85.982  30.404  -12.426 1.00 46.45 ? 10   U   B C6    1 
HETATM 4171 P  PG    . ANP C 3 .   ? 71.374  27.944  16.572  1.00 17.91 ? 1000 ANP A PG    1 
HETATM 4172 O  O1G   . ANP C 3 .   ? 72.035  27.505  17.864  1.00 16.64 ? 1000 ANP A O1G   1 
HETATM 4173 O  O2G   . ANP C 3 .   ? 70.486  26.906  15.951  1.00 15.98 ? 1000 ANP A O2G   1 
HETATM 4174 O  O3G   . ANP C 3 .   ? 72.328  28.575  15.588  1.00 17.64 ? 1000 ANP A O3G   1 
HETATM 4175 P  PB    . ANP C 3 .   ? 70.697  30.885  17.122  1.00 16.43 ? 1000 ANP A PB    1 
HETATM 4176 O  O1B   . ANP C 3 .   ? 71.587  31.258  15.960  1.00 16.80 ? 1000 ANP A O1B   1 
HETATM 4177 O  O2B   . ANP C 3 .   ? 71.213  31.156  18.506  1.00 16.50 ? 1000 ANP A O2B   1 
HETATM 4178 N  N3B   . ANP C 3 .   ? 70.267  29.201  17.034  1.00 16.75 ? 1000 ANP A N3B   1 
HETATM 4179 P  PA    . ANP C 3 .   ? 68.972  32.408  15.506  1.00 19.74 ? 1000 ANP A PA    1 
HETATM 4180 O  O1A   . ANP C 3 .   ? 69.926  33.578  15.391  1.00 20.02 ? 1000 ANP A O1A   1 
HETATM 4181 O  O2A   . ANP C 3 .   ? 68.877  31.439  14.366  1.00 16.52 ? 1000 ANP A O2A   1 
HETATM 4182 O  O3A   . ANP C 3 .   ? 69.301  31.652  16.891  1.00 17.38 ? 1000 ANP A O3A   1 
HETATM 4183 O  "O5'" . ANP C 3 .   ? 67.506  33.006  15.795  1.00 19.65 ? 1000 ANP A "O5'" 1 
HETATM 4184 C  "C5'" . ANP C 3 .   ? 66.390  32.136  15.891  1.00 20.36 ? 1000 ANP A "C5'" 1 
HETATM 4185 C  "C4'" . ANP C 3 .   ? 65.113  32.899  15.616  1.00 20.66 ? 1000 ANP A "C4'" 1 
HETATM 4186 O  "O4'" . ANP C 3 .   ? 64.937  33.895  16.619  1.00 22.30 ? 1000 ANP A "O4'" 1 
HETATM 4187 C  "C3'" . ANP C 3 .   ? 65.129  33.605  14.275  1.00 21.16 ? 1000 ANP A "C3'" 1 
HETATM 4188 O  "O3'" . ANP C 3 .   ? 64.018  33.185  13.485  1.00 20.30 ? 1000 ANP A "O3'" 1 
HETATM 4189 C  "C2'" . ANP C 3 .   ? 65.041  35.084  14.584  1.00 21.95 ? 1000 ANP A "C2'" 1 
HETATM 4190 O  "O2'" . ANP C 3 .   ? 64.161  35.749  13.670  1.00 22.65 ? 1000 ANP A "O2'" 1 
HETATM 4191 C  "C1'" . ANP C 3 .   ? 64.529  35.127  16.018  1.00 22.35 ? 1000 ANP A "C1'" 1 
HETATM 4192 N  N9    . ANP C 3 .   ? 65.072  36.218  16.859  1.00 22.91 ? 1000 ANP A N9    1 
HETATM 4193 C  C8    . ANP C 3 .   ? 66.277  36.812  16.757  1.00 23.18 ? 1000 ANP A C8    1 
HETATM 4194 N  N7    . ANP C 3 .   ? 66.440  37.753  17.717  1.00 22.89 ? 1000 ANP A N7    1 
HETATM 4195 C  C5    . ANP C 3 .   ? 65.326  37.769  18.460  1.00 23.11 ? 1000 ANP A C5    1 
HETATM 4196 C  C6    . ANP C 3 .   ? 64.842  38.525  19.632  1.00 23.18 ? 1000 ANP A C6    1 
HETATM 4197 N  N6    . ANP C 3 .   ? 65.607  39.477  20.207  1.00 22.28 ? 1000 ANP A N6    1 
HETATM 4198 N  N1    . ANP C 3 .   ? 63.614  38.224  20.111  1.00 23.60 ? 1000 ANP A N1    1 
HETATM 4199 C  C2    . ANP C 3 .   ? 62.842  37.273  19.548  1.00 23.33 ? 1000 ANP A C2    1 
HETATM 4200 N  N3    . ANP C 3 .   ? 63.222  36.549  18.480  1.00 23.40 ? 1000 ANP A N3    1 
HETATM 4201 C  C4    . ANP C 3 .   ? 64.430  36.747  17.900  1.00 23.39 ? 1000 ANP A C4    1 
HETATM 4202 MG MG    . MG  D 4 .   ? 72.953  30.342  15.148  1.00 21.60 ? 900  MG  A MG    1 
HETATM 4203 O  O     . HOH E 5 .   ? 68.126  35.878  12.819  1.00 20.52 ? 1001 HOH A O     1 
HETATM 4204 O  O     . HOH E 5 .   ? 63.325  51.874  4.164   1.00 14.90 ? 1002 HOH A O     1 
HETATM 4205 O  O     . HOH E 5 .   ? 59.043  13.488  23.611  1.00 13.13 ? 1003 HOH A O     1 
HETATM 4206 O  O     . HOH E 5 .   ? 79.780  51.267  2.241   1.00 18.56 ? 1004 HOH A O     1 
HETATM 4207 O  O     . HOH E 5 .   ? 53.221  25.527  16.219  1.00 20.23 ? 1005 HOH A O     1 
HETATM 4208 O  O     . HOH E 5 .   ? 69.364  28.365  3.294   1.00 22.24 ? 1006 HOH A O     1 
HETATM 4209 O  O     . HOH E 5 .   ? 88.087  48.103  7.022   1.00 27.04 ? 1007 HOH A O     1 
HETATM 4210 O  O     . HOH E 5 .   ? 74.881  29.708  15.879  1.00 12.14 ? 1008 HOH A O     1 
HETATM 4211 O  O     . HOH E 5 .   ? 92.401  41.379  5.848   1.00 18.34 ? 1009 HOH A O     1 
HETATM 4212 O  O     . HOH E 5 .   ? 61.823  36.039  13.872  1.00 21.22 ? 1010 HOH A O     1 
HETATM 4213 O  O     . HOH E 5 .   ? 72.422  45.964  -1.115  1.00 9.49  ? 1011 HOH A O     1 
HETATM 4214 O  O     . HOH E 5 .   ? 64.716  16.887  -1.881  1.00 17.09 ? 1012 HOH A O     1 
HETATM 4215 O  O     . HOH E 5 .   ? 64.775  24.765  12.599  1.00 12.83 ? 1013 HOH A O     1 
HETATM 4216 O  O     . HOH E 5 .   ? 71.684  -11.366 10.583  1.00 25.10 ? 1014 HOH A O     1 
HETATM 4217 O  O     . HOH E 5 .   ? 63.842  2.597   18.668  1.00 17.75 ? 1015 HOH A O     1 
HETATM 4218 O  O     . HOH E 5 .   ? 56.708  4.568   18.217  1.00 14.83 ? 1016 HOH A O     1 
HETATM 4219 O  O     . HOH E 5 .   ? 88.822  44.181  2.475   1.00 19.39 ? 1017 HOH A O     1 
HETATM 4220 O  O     . HOH E 5 .   ? 76.066  20.394  -4.864  1.00 30.10 ? 1018 HOH A O     1 
HETATM 4221 O  O     . HOH E 5 .   ? 62.730  33.696  6.338   1.00 24.88 ? 1019 HOH A O     1 
HETATM 4222 O  O     . HOH E 5 .   ? 89.474  45.144  14.205  1.00 30.58 ? 1020 HOH A O     1 
HETATM 4223 O  O     . HOH E 5 .   ? 91.199  20.026  15.343  1.00 39.05 ? 1021 HOH A O     1 
HETATM 4224 O  O     . HOH E 5 .   ? 89.000  25.044  -1.526  1.00 24.33 ? 1022 HOH A O     1 
HETATM 4225 O  O     . HOH E 5 .   ? 70.728  32.589  10.683  1.00 18.29 ? 1023 HOH A O     1 
HETATM 4226 O  O     . HOH E 5 .   ? 81.810  29.798  -13.237 1.00 19.67 ? 1024 HOH A O     1 
HETATM 4227 O  O     . HOH E 5 .   ? 62.402  -4.033  19.830  1.00 20.89 ? 1025 HOH A O     1 
HETATM 4228 O  O     . HOH E 5 .   ? 74.505  -9.137  8.175   1.00 7.75  ? 1026 HOH A O     1 
HETATM 4229 O  O     . HOH E 5 .   ? 75.790  37.577  -11.079 1.00 26.06 ? 1027 HOH A O     1 
HETATM 4230 O  O     . HOH E 5 .   ? 93.775  27.382  15.375  1.00 30.29 ? 1028 HOH A O     1 
HETATM 4231 O  O     . HOH E 5 .   ? 75.371  32.048  -3.449  1.00 17.35 ? 1029 HOH A O     1 
HETATM 4232 O  O     . HOH E 5 .   ? 71.924  -9.271  7.856   1.00 16.58 ? 1030 HOH A O     1 
HETATM 4233 O  O     . HOH E 5 .   ? 71.313  52.261  1.023   1.00 5.09  ? 1031 HOH A O     1 
HETATM 4234 O  O     . HOH E 5 .   ? 74.850  36.674  -2.969  1.00 14.23 ? 1032 HOH A O     1 
HETATM 4235 O  O     . HOH E 5 .   ? 91.248  44.594  -0.845  1.00 9.47  ? 1033 HOH A O     1 
HETATM 4236 O  O     . HOH E 5 .   ? 65.703  13.406  19.423  1.00 18.83 ? 1034 HOH A O     1 
HETATM 4237 O  O     . HOH E 5 .   ? 58.316  25.180  17.986  1.00 32.62 ? 1035 HOH A O     1 
HETATM 4238 O  O     . HOH E 5 .   ? 59.799  28.891  15.914  1.00 27.64 ? 1036 HOH A O     1 
HETATM 4239 O  O     . HOH E 5 .   ? 61.885  -8.960  9.506   1.00 25.00 ? 1037 HOH A O     1 
HETATM 4240 O  O     . HOH E 5 .   ? 55.462  19.446  20.202  1.00 30.95 ? 1038 HOH A O     1 
HETATM 4241 O  O     . HOH E 5 .   ? 95.097  36.290  -3.586  1.00 23.00 ? 1039 HOH A O     1 
HETATM 4242 O  O     . HOH E 5 .   ? 62.144  16.628  -1.397  1.00 28.24 ? 1040 HOH A O     1 
HETATM 4243 O  O     . HOH E 5 .   ? 83.964  44.327  -1.687  1.00 13.54 ? 1041 HOH A O     1 
HETATM 4244 O  O     . HOH E 5 .   ? 92.347  36.332  10.484  1.00 19.55 ? 1042 HOH A O     1 
HETATM 4245 O  O     . HOH E 5 .   ? 68.489  -9.980  11.135  1.00 25.50 ? 1043 HOH A O     1 
HETATM 4246 O  O     . HOH E 5 .   ? 78.516  31.673  -4.105  1.00 15.61 ? 1044 HOH A O     1 
HETATM 4247 O  O     . HOH E 5 .   ? 73.695  29.181  13.578  1.00 3.29  ? 1045 HOH A O     1 
HETATM 4248 O  O     . HOH E 5 .   ? 71.158  24.614  23.291  1.00 2.00  ? 1046 HOH A O     1 
HETATM 4249 O  O     . HOH E 5 .   ? 74.968  -7.688  18.102  1.00 11.79 ? 1047 HOH A O     1 
HETATM 4250 O  O     . HOH E 5 .   ? 71.384  30.137  13.654  1.00 15.31 ? 1048 HOH A O     1 
HETATM 4251 O  O     . HOH E 5 .   ? 64.565  40.128  1.052   1.00 25.28 ? 1049 HOH A O     1 
HETATM 4252 O  O     . HOH E 5 .   ? 50.101  20.483  15.930  1.00 14.64 ? 1050 HOH A O     1 
HETATM 4253 O  O     . HOH E 5 .   ? 68.961  -4.122  12.672  1.00 15.92 ? 1051 HOH A O     1 
HETATM 4254 O  O     . HOH E 5 .   ? 81.207  31.702  -4.727  1.00 7.90  ? 1052 HOH A O     1 
HETATM 4255 O  O     . HOH E 5 .   ? 70.694  33.778  1.365   1.00 17.33 ? 1053 HOH A O     1 
HETATM 4256 O  O     . HOH E 5 .   ? 92.710  36.473  21.570  1.00 16.39 ? 1054 HOH A O     1 
HETATM 4257 O  O     . HOH E 5 .   ? 78.298  30.929  33.926  1.00 7.14  ? 1055 HOH A O     1 
HETATM 4258 O  O     . HOH E 5 .   ? 50.507  4.754   15.016  1.00 22.99 ? 1056 HOH A O     1 
HETATM 4259 O  O     . HOH E 5 .   ? 79.717  52.313  17.502  1.00 18.79 ? 1057 HOH A O     1 
HETATM 4260 O  O     . HOH E 5 .   ? 62.531  38.555  23.239  1.00 37.69 ? 1058 HOH A O     1 
HETATM 4261 O  O     . HOH E 5 .   ? 60.664  26.719  17.350  1.00 12.93 ? 1059 HOH A O     1 
HETATM 4262 O  O     . HOH E 5 .   ? 59.211  -7.968  17.375  1.00 21.84 ? 1060 HOH A O     1 
HETATM 4263 O  O     . HOH E 5 .   ? 84.872  -1.859  21.134  1.00 21.69 ? 1061 HOH A O     1 
HETATM 4264 O  O     . HOH E 5 .   ? 94.484  41.042  10.371  1.00 27.59 ? 1062 HOH A O     1 
HETATM 4265 O  O     . HOH E 5 .   ? 85.060  8.524   26.399  1.00 34.37 ? 1063 HOH A O     1 
HETATM 4266 O  O     . HOH E 5 .   ? 84.317  56.570  8.981   1.00 14.99 ? 1064 HOH A O     1 
HETATM 4267 O  O     . HOH E 5 .   ? 75.590  -3.088  23.878  1.00 23.71 ? 1065 HOH A O     1 
HETATM 4268 O  O     . HOH E 5 .   ? 61.757  -11.576 1.509   1.00 27.30 ? 1066 HOH A O     1 
HETATM 4269 O  O     . HOH E 5 .   ? 61.485  25.430  14.976  1.00 15.65 ? 1067 HOH A O     1 
HETATM 4270 O  O     . HOH E 5 .   ? 60.787  -3.661  -5.677  1.00 22.11 ? 1068 HOH A O     1 
HETATM 4271 O  O     . HOH E 5 .   ? 49.782  -1.844  11.014  1.00 23.50 ? 1069 HOH A O     1 
HETATM 4272 O  O     . HOH E 5 .   ? 83.481  50.120  15.383  1.00 24.69 ? 1070 HOH A O     1 
HETATM 4273 O  O     . HOH E 5 .   ? 45.511  9.769   8.578   1.00 14.31 ? 1071 HOH A O     1 
HETATM 4274 O  O     . HOH E 5 .   ? 69.180  31.784  -0.375  1.00 19.37 ? 1072 HOH A O     1 
HETATM 4275 O  O     . HOH E 5 .   ? 69.155  36.103  15.072  1.00 11.15 ? 1073 HOH A O     1 
HETATM 4276 O  O     . HOH E 5 .   ? 73.808  31.684  14.058  1.00 11.05 ? 1074 HOH A O     1 
HETATM 4277 O  O     . HOH E 5 .   ? 73.100  25.254  15.855  1.00 10.59 ? 1075 HOH A O     1 
HETATM 4278 O  O     . HOH E 5 .   ? 76.552  -3.380  -1.576  1.00 23.43 ? 1076 HOH A O     1 
HETATM 4279 O  O     . HOH E 5 .   ? 66.303  32.344  9.937   1.00 22.52 ? 1077 HOH A O     1 
HETATM 4280 O  O     . HOH E 5 .   ? 78.971  47.427  0.023   1.00 13.05 ? 1078 HOH A O     1 
HETATM 4281 O  O     . HOH E 5 .   ? 85.065  45.945  -8.811  1.00 14.41 ? 1079 HOH A O     1 
HETATM 4282 O  O     . HOH E 5 .   ? 75.034  27.119  17.511  1.00 35.06 ? 1080 HOH A O     1 
HETATM 4283 O  O     . HOH E 5 .   ? 71.485  27.969  -3.977  1.00 21.50 ? 1081 HOH A O     1 
HETATM 4284 O  O     . HOH E 5 .   ? 62.444  -6.736  13.502  1.00 26.13 ? 1082 HOH A O     1 
HETATM 4285 O  O     . HOH F 5 .   ? 77.703  17.413  9.813   1.00 22.86 ? 1083 HOH B O     1 
HETATM 4286 O  O     . HOH F 5 .   ? 75.599  7.414   2.268   1.00 13.58 ? 1084 HOH B O     1 
HETATM 4287 O  O     . HOH F 5 .   ? 85.568  21.879  -13.356 1.00 19.81 ? 1085 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   35  ?   ?   ?   A . n 
A 1 2   SER 2   36  ?   ?   ?   A . n 
A 1 3   LEU 3   37  ?   ?   ?   A . n 
A 1 4   TYR 4   38  ?   ?   ?   A . n 
A 1 5   ASN 5   39  ?   ?   ?   A . n 
A 1 6   ASP 6   40  ?   ?   ?   A . n 
A 1 7   GLY 7   41  ?   ?   ?   A . n 
A 1 8   ASN 8   42  ?   ?   ?   A . n 
A 1 9   ARG 9   43  ?   ?   ?   A . n 
A 1 10  ASP 10  44  ?   ?   ?   A . n 
A 1 11  GLN 11  45  ?   ?   ?   A . n 
A 1 12  ARG 12  46  ?   ?   ?   A . n 
A 1 13  ASN 13  47  ?   ?   ?   A . n 
A 1 14  PHE 14  48  ?   ?   ?   A . n 
A 1 15  GLY 15  49  ?   ?   ?   A . n 
A 1 16  ARG 16  50  ?   ?   ?   A . n 
A 1 17  ASN 17  51  ?   ?   ?   A . n 
A 1 18  GLN 18  52  ?   ?   ?   A . n 
A 1 19  ARG 19  53  ?   ?   ?   A . n 
A 1 20  ASN 20  54  ?   ?   ?   A . n 
A 1 21  ASN 21  55  ?   ?   ?   A . n 
A 1 22  ASN 22  56  ?   ?   ?   A . n 
A 1 23  SER 23  57  ?   ?   ?   A . n 
A 1 24  ASN 24  58  ?   ?   ?   A . n 
A 1 25  ARG 25  59  ?   ?   ?   A . n 
A 1 26  TYR 26  60  ?   ?   ?   A . n 
A 1 27  ARG 27  61  ?   ?   ?   A . n 
A 1 28  ASN 28  62  ?   ?   ?   A . n 
A 1 29  SER 29  63  ?   ?   ?   A . n 
A 1 30  ARG 30  64  ?   ?   ?   A . n 
A 1 31  PHE 31  65  ?   ?   ?   A . n 
A 1 32  ASN 32  66  ?   ?   ?   A . n 
A 1 33  SER 33  67  ?   ?   ?   A . n 
A 1 34  ARG 34  68  ?   ?   ?   A . n 
A 1 35  PRO 35  69  ?   ?   ?   A . n 
A 1 36  ARG 36  70  ?   ?   ?   A . n 
A 1 37  THR 37  71  ?   ?   ?   A . n 
A 1 38  ARG 38  72  ?   ?   ?   A . n 
A 1 39  SER 39  73  ?   ?   ?   A . n 
A 1 40  ARG 40  74  ?   ?   ?   A . n 
A 1 41  GLU 41  75  ?   ?   ?   A . n 
A 1 42  ASP 42  76  ?   ?   ?   A . n 
A 1 43  ASP 43  77  ?   ?   ?   A . n 
A 1 44  ASP 44  78  ?   ?   ?   A . n 
A 1 45  GLU 45  79  ?   ?   ?   A . n 
A 1 46  VAL 46  80  ?   ?   ?   A . n 
A 1 47  HIS 47  81  ?   ?   ?   A . n 
A 1 48  PHE 48  82  ?   ?   ?   A . n 
A 1 49  ASP 49  83  ?   ?   ?   A . n 
A 1 50  LYS 50  84  ?   ?   ?   A . n 
A 1 51  THR 51  85  ?   ?   ?   A . n 
A 1 52  THR 52  86  ?   ?   ?   A . n 
A 1 53  PHE 53  87  ?   ?   ?   A . n 
A 1 54  SER 54  88  88  SER SER A . n 
A 1 55  LYS 55  89  89  LYS LYS A . n 
A 1 56  LEU 56  90  90  LEU LEU A . n 
A 1 57  ILE 57  91  91  ILE ILE A . n 
A 1 58  HIS 58  92  92  HIS HIS A . n 
A 1 59  VAL 59  93  93  VAL VAL A . n 
A 1 60  PRO 60  94  94  PRO PRO A . n 
A 1 61  LYS 61  95  95  LYS LYS A . n 
A 1 62  GLU 62  96  96  GLU GLU A . n 
A 1 63  ASP 63  97  97  ASP ASP A . n 
A 1 64  ASN 64  98  98  ASN ASN A . n 
A 1 65  SER 65  99  99  SER SER A . n 
A 1 66  LYS 66  100 100 LYS LYS A . n 
A 1 67  GLU 67  101 101 GLU GLU A . n 
A 1 68  VAL 68  102 102 VAL VAL A . n 
A 1 69  THR 69  103 103 THR THR A . n 
A 1 70  LEU 70  104 104 LEU LEU A . n 
A 1 71  ASP 71  105 105 ASP ASP A . n 
A 1 72  SER 72  106 106 SER SER A . n 
A 1 73  LEU 73  107 107 LEU LEU A . n 
A 1 74  LEU 74  108 108 LEU LEU A . n 
A 1 75  GLU 75  109 109 GLU GLU A . n 
A 1 76  GLU 76  110 110 GLU GLU A . n 
A 1 77  GLY 77  111 111 GLY GLY A . n 
A 1 78  VAL 78  112 112 VAL VAL A . n 
A 1 79  LEU 79  113 113 LEU LEU A . n 
A 1 80  ASP 80  114 114 ASP ASP A . n 
A 1 81  LYS 81  115 115 LYS LYS A . n 
A 1 82  GLU 82  116 116 GLU GLU A . n 
A 1 83  ILE 83  117 117 ILE ILE A . n 
A 1 84  HIS 84  118 118 HIS HIS A . n 
A 1 85  LYS 85  119 119 LYS LYS A . n 
A 1 86  ALA 86  120 120 ALA ALA A . n 
A 1 87  ILE 87  121 121 ILE ILE A . n 
A 1 88  THR 88  122 122 THR THR A . n 
A 1 89  ARG 89  123 123 ARG ARG A . n 
A 1 90  MET 90  124 124 MET MET A . n 
A 1 91  GLU 91  125 125 GLU GLU A . n 
A 1 92  PHE 92  126 126 PHE PHE A . n 
A 1 93  PRO 93  127 127 PRO PRO A . n 
A 1 94  GLY 94  128 128 GLY GLY A . n 
A 1 95  LEU 95  129 129 LEU LEU A . n 
A 1 96  THR 96  130 130 THR THR A . n 
A 1 97  PRO 97  131 131 PRO PRO A . n 
A 1 98  VAL 98  132 132 VAL VAL A . n 
A 1 99  GLN 99  133 133 GLN GLN A . n 
A 1 100 GLN 100 134 134 GLN GLN A . n 
A 1 101 LYS 101 135 135 LYS LYS A . n 
A 1 102 THR 102 136 136 THR THR A . n 
A 1 103 ILE 103 137 137 ILE ILE A . n 
A 1 104 LYS 104 138 138 LYS LYS A . n 
A 1 105 PRO 105 139 139 PRO PRO A . n 
A 1 106 ILE 106 140 140 ILE ILE A . n 
A 1 107 LEU 107 141 141 LEU LEU A . n 
A 1 108 SER 108 142 142 SER SER A . n 
A 1 109 SER 109 143 143 SER SER A . n 
A 1 110 GLU 110 144 144 GLU GLU A . n 
A 1 111 ASP 111 145 145 ASP ASP A . n 
A 1 112 HIS 112 146 146 HIS HIS A . n 
A 1 113 ASP 113 147 147 ASP ASP A . n 
A 1 114 VAL 114 148 148 VAL VAL A . n 
A 1 115 ILE 115 149 149 ILE ILE A . n 
A 1 116 ALA 116 150 150 ALA ALA A . n 
A 1 117 ARG 117 151 151 ARG ARG A . n 
A 1 118 ALA 118 152 152 ALA ALA A . n 
A 1 119 LYS 119 153 153 LYS LYS A . n 
A 1 120 THR 120 154 154 THR THR A . n 
A 1 121 GLY 121 155 155 GLY GLY A . n 
A 1 122 THR 122 156 156 THR THR A . n 
A 1 123 GLY 123 157 157 GLY GLY A . n 
A 1 124 LYS 124 158 158 LYS LYS A . n 
A 1 125 THR 125 159 159 THR THR A . n 
A 1 126 PHE 126 160 160 PHE PHE A . n 
A 1 127 ALA 127 161 161 ALA ALA A . n 
A 1 128 PHE 128 162 162 PHE PHE A . n 
A 1 129 LEU 129 163 163 LEU LEU A . n 
A 1 130 ILE 130 164 164 ILE ILE A . n 
A 1 131 PRO 131 165 165 PRO PRO A . n 
A 1 132 ILE 132 166 166 ILE ILE A . n 
A 1 133 PHE 133 167 167 PHE PHE A . n 
A 1 134 GLN 134 168 168 GLN GLN A . n 
A 1 135 HIS 135 169 169 HIS HIS A . n 
A 1 136 LEU 136 170 170 LEU LEU A . n 
A 1 137 ILE 137 171 171 ILE ILE A . n 
A 1 138 ASN 138 172 172 ASN ASN A . n 
A 1 139 THR 139 173 173 THR THR A . n 
A 1 140 LYS 140 174 174 LYS LYS A . n 
A 1 141 PHE 141 175 175 PHE PHE A . n 
A 1 142 ASP 142 176 176 ASP ASP A . n 
A 1 143 SER 143 177 177 SER SER A . n 
A 1 144 GLN 144 178 178 GLN GLN A . n 
A 1 145 TYR 145 179 179 TYR TYR A . n 
A 1 146 MET 146 180 180 MET MET A . n 
A 1 147 VAL 147 181 181 VAL VAL A . n 
A 1 148 LYS 148 182 182 LYS LYS A . n 
A 1 149 ALA 149 183 183 ALA ALA A . n 
A 1 150 VAL 150 184 184 VAL VAL A . n 
A 1 151 ILE 151 185 185 ILE ILE A . n 
A 1 152 VAL 152 186 186 VAL VAL A . n 
A 1 153 ALA 153 187 187 ALA ALA A . n 
A 1 154 PRO 154 188 188 PRO PRO A . n 
A 1 155 THR 155 189 189 THR THR A . n 
A 1 156 ARG 156 190 190 ARG ARG A . n 
A 1 157 ASP 157 191 191 ASP ASP A . n 
A 1 158 LEU 158 192 192 LEU LEU A . n 
A 1 159 ALA 159 193 193 ALA ALA A . n 
A 1 160 LEU 160 194 194 LEU LEU A . n 
A 1 161 GLN 161 195 195 GLN GLN A . n 
A 1 162 ILE 162 196 196 ILE ILE A . n 
A 1 163 GLU 163 197 197 GLU GLU A . n 
A 1 164 ALA 164 198 198 ALA ALA A . n 
A 1 165 GLU 165 199 199 GLU GLU A . n 
A 1 166 VAL 166 200 200 VAL VAL A . n 
A 1 167 LYS 167 201 201 LYS LYS A . n 
A 1 168 LYS 168 202 202 LYS LYS A . n 
A 1 169 ILE 169 203 203 ILE ILE A . n 
A 1 170 HIS 170 204 204 HIS HIS A . n 
A 1 171 ASP 171 205 205 ASP ASP A . n 
A 1 172 MET 172 206 206 MET MET A . n 
A 1 173 ASN 173 207 207 ASN ASN A . n 
A 1 174 TYR 174 208 208 TYR TYR A . n 
A 1 175 GLY 175 209 209 GLY GLY A . n 
A 1 176 LEU 176 210 210 LEU LEU A . n 
A 1 177 LYS 177 211 211 LYS LYS A . n 
A 1 178 LYS 178 212 212 LYS LYS A . n 
A 1 179 TYR 179 213 213 TYR TYR A . n 
A 1 180 ALA 180 214 214 ALA ALA A . n 
A 1 181 CYS 181 215 215 CYS CYS A . n 
A 1 182 VAL 182 216 216 VAL VAL A . n 
A 1 183 SER 183 217 217 SER SER A . n 
A 1 184 LEU 184 218 218 LEU LEU A . n 
A 1 185 VAL 185 219 219 VAL VAL A . n 
A 1 186 GLY 186 220 220 GLY GLY A . n 
A 1 187 GLY 187 221 221 GLY GLY A . n 
A 1 188 THR 188 222 222 THR THR A . n 
A 1 189 ASP 189 223 223 ASP ASP A . n 
A 1 190 PHE 190 224 224 PHE PHE A . n 
A 1 191 ARG 191 225 225 ARG ARG A . n 
A 1 192 ALA 192 226 226 ALA ALA A . n 
A 1 193 ALA 193 227 227 ALA ALA A . n 
A 1 194 MET 194 228 228 MET MET A . n 
A 1 195 ASN 195 229 229 ASN ASN A . n 
A 1 196 LYS 196 230 230 LYS LYS A . n 
A 1 197 MET 197 231 231 MET MET A . n 
A 1 198 ASN 198 232 232 ASN ASN A . n 
A 1 199 LYS 199 233 233 LYS LYS A . n 
A 1 200 LEU 200 234 234 LEU LEU A . n 
A 1 201 ARG 201 235 235 ARG ARG A . n 
A 1 202 PRO 202 236 236 PRO PRO A . n 
A 1 203 ASN 203 237 237 ASN ASN A . n 
A 1 204 ILE 204 238 238 ILE ILE A . n 
A 1 205 VAL 205 239 239 VAL VAL A . n 
A 1 206 ILE 206 240 240 ILE ILE A . n 
A 1 207 ALA 207 241 241 ALA ALA A . n 
A 1 208 THR 208 242 242 THR THR A . n 
A 1 209 PRO 209 243 243 PRO PRO A . n 
A 1 210 GLY 210 244 244 GLY GLY A . n 
A 1 211 ARG 211 245 245 ARG ARG A . n 
A 1 212 LEU 212 246 246 LEU LEU A . n 
A 1 213 ILE 213 247 247 ILE ILE A . n 
A 1 214 ASP 214 248 248 ASP ASP A . n 
A 1 215 VAL 215 249 249 VAL VAL A . n 
A 1 216 LEU 216 250 250 LEU LEU A . n 
A 1 217 GLU 217 251 251 GLU GLU A . n 
A 1 218 LYS 218 252 252 LYS LYS A . n 
A 1 219 TYR 219 253 253 TYR TYR A . n 
A 1 220 SER 220 254 254 SER SER A . n 
A 1 221 ASN 221 255 255 ASN ASN A . n 
A 1 222 LYS 222 256 256 LYS LYS A . n 
A 1 223 PHE 223 257 257 PHE PHE A . n 
A 1 224 PHE 224 258 258 PHE PHE A . n 
A 1 225 ARG 225 259 259 ARG ARG A . n 
A 1 226 PHE 226 260 260 PHE PHE A . n 
A 1 227 VAL 227 261 261 VAL VAL A . n 
A 1 228 ASP 228 262 262 ASP ASP A . n 
A 1 229 TYR 229 263 263 TYR TYR A . n 
A 1 230 LYS 230 264 264 LYS LYS A . n 
A 1 231 VAL 231 265 265 VAL VAL A . n 
A 1 232 LEU 232 266 266 LEU LEU A . n 
A 1 233 ASP 233 267 267 ASP ASP A . n 
A 1 234 GLU 234 268 268 GLU GLU A . n 
A 1 235 ALA 235 269 269 ALA ALA A . n 
A 1 236 ASP 236 270 270 ASP ASP A . n 
A 1 237 ARG 237 271 271 ARG ARG A . n 
A 1 238 LEU 238 272 272 LEU LEU A . n 
A 1 239 LEU 239 273 273 LEU LEU A . n 
A 1 240 GLU 240 274 274 GLU GLU A . n 
A 1 241 ILE 241 275 275 ILE ILE A . n 
A 1 242 GLY 242 276 276 GLY GLY A . n 
A 1 243 PHE 243 277 277 PHE PHE A . n 
A 1 244 ARG 244 278 278 ARG ARG A . n 
A 1 245 ASP 245 279 279 ASP ASP A . n 
A 1 246 ASP 246 280 280 ASP ASP A . n 
A 1 247 LEU 247 281 281 LEU LEU A . n 
A 1 248 GLU 248 282 282 GLU GLU A . n 
A 1 249 THR 249 283 283 THR THR A . n 
A 1 250 ILE 250 284 284 ILE ILE A . n 
A 1 251 SER 251 285 285 SER SER A . n 
A 1 252 GLY 252 286 286 GLY GLY A . n 
A 1 253 ILE 253 287 287 ILE ILE A . n 
A 1 254 LEU 254 288 288 LEU LEU A . n 
A 1 255 ASN 255 289 289 ASN ASN A . n 
A 1 256 GLU 256 290 290 GLU GLU A . n 
A 1 257 LYS 257 291 291 LYS LYS A . n 
A 1 258 ASN 258 292 292 ASN ASN A . n 
A 1 259 SER 259 293 293 SER SER A . n 
A 1 260 LYS 260 294 294 LYS LYS A . n 
A 1 261 SER 261 295 295 SER SER A . n 
A 1 262 ALA 262 296 296 ALA ALA A . n 
A 1 263 ASP 263 297 297 ASP ASP A . n 
A 1 264 ASN 264 298 298 ASN ASN A . n 
A 1 265 ILE 265 299 299 ILE ILE A . n 
A 1 266 LYS 266 300 300 LYS LYS A . n 
A 1 267 THR 267 301 301 THR THR A . n 
A 1 268 LEU 268 302 302 LEU LEU A . n 
A 1 269 LEU 269 303 303 LEU LEU A . n 
A 1 270 PHE 270 304 304 PHE PHE A . n 
A 1 271 SER 271 305 305 SER SER A . n 
A 1 272 ALA 272 306 306 ALA ALA A . n 
A 1 273 THR 273 307 307 THR THR A . n 
A 1 274 LEU 274 308 308 LEU LEU A . n 
A 1 275 ASP 275 309 309 ASP ASP A . n 
A 1 276 ASP 276 310 310 ASP ASP A . n 
A 1 277 LYS 277 311 311 LYS LYS A . n 
A 1 278 VAL 278 312 312 VAL VAL A . n 
A 1 279 GLN 279 313 313 GLN GLN A . n 
A 1 280 LYS 280 314 314 LYS LYS A . n 
A 1 281 LEU 281 315 315 LEU LEU A . n 
A 1 282 ALA 282 316 316 ALA ALA A . n 
A 1 283 ASN 283 317 317 ASN ASN A . n 
A 1 284 ASN 284 318 318 ASN ASN A . n 
A 1 285 ILE 285 319 319 ILE ILE A . n 
A 1 286 MET 286 320 320 MET MET A . n 
A 1 287 ASN 287 321 321 ASN ASN A . n 
A 1 288 LYS 288 322 322 LYS LYS A . n 
A 1 289 LYS 289 323 323 LYS LYS A . n 
A 1 290 GLU 290 324 324 GLU GLU A . n 
A 1 291 CYS 291 325 325 CYS CYS A . n 
A 1 292 LEU 292 326 326 LEU LEU A . n 
A 1 293 PHE 293 327 327 PHE PHE A . n 
A 1 294 LEU 294 328 328 LEU LEU A . n 
A 1 295 ASP 295 329 329 ASP ASP A . n 
A 1 296 THR 296 330 330 THR THR A . n 
A 1 297 VAL 297 331 331 VAL VAL A . n 
A 1 298 ASP 298 332 332 ASP ASP A . n 
A 1 299 LYS 299 333 333 LYS LYS A . n 
A 1 300 ASN 300 334 334 ASN ASN A . n 
A 1 301 GLU 301 335 335 GLU GLU A . n 
A 1 302 PRO 302 336 336 PRO PRO A . n 
A 1 303 GLU 303 337 337 GLU GLU A . n 
A 1 304 ALA 304 338 338 ALA ALA A . n 
A 1 305 HIS 305 339 339 HIS HIS A . n 
A 1 306 GLU 306 340 340 GLU GLU A . n 
A 1 307 ARG 307 341 341 ARG ARG A . n 
A 1 308 ILE 308 342 342 ILE ILE A . n 
A 1 309 ASP 309 343 343 ASP ASP A . n 
A 1 310 GLN 310 344 344 GLN GLN A . n 
A 1 311 SER 311 345 345 SER SER A . n 
A 1 312 VAL 312 346 346 VAL VAL A . n 
A 1 313 VAL 313 347 347 VAL VAL A . n 
A 1 314 ILE 314 348 348 ILE ILE A . n 
A 1 315 SER 315 349 349 SER SER A . n 
A 1 316 GLU 316 350 350 GLU GLU A . n 
A 1 317 LYS 317 351 351 LYS LYS A . n 
A 1 318 PHE 318 352 352 PHE PHE A . n 
A 1 319 ALA 319 353 353 ALA ALA A . n 
A 1 320 ASN 320 354 354 ASN ASN A . n 
A 1 321 SER 321 355 355 SER SER A . n 
A 1 322 ILE 322 356 356 ILE ILE A . n 
A 1 323 PHE 323 357 357 PHE PHE A . n 
A 1 324 ALA 324 358 358 ALA ALA A . n 
A 1 325 ALA 325 359 359 ALA ALA A . n 
A 1 326 VAL 326 360 360 VAL VAL A . n 
A 1 327 GLU 327 361 361 GLU GLU A . n 
A 1 328 HIS 328 362 362 HIS HIS A . n 
A 1 329 ILE 329 363 363 ILE ILE A . n 
A 1 330 LYS 330 364 364 LYS LYS A . n 
A 1 331 LYS 331 365 365 LYS LYS A . n 
A 1 332 GLN 332 366 366 GLN GLN A . n 
A 1 333 ILE 333 367 367 ILE ILE A . n 
A 1 334 LYS 334 368 368 LYS LYS A . n 
A 1 335 GLU 335 369 369 GLU GLU A . n 
A 1 336 ARG 336 370 370 ARG ARG A . n 
A 1 337 ASP 337 371 371 ASP ASP A . n 
A 1 338 SER 338 372 372 SER SER A . n 
A 1 339 ASN 339 373 373 ASN ASN A . n 
A 1 340 TYR 340 374 374 TYR TYR A . n 
A 1 341 LYS 341 375 375 LYS LYS A . n 
A 1 342 ALA 342 376 376 ALA ALA A . n 
A 1 343 ILE 343 377 377 ILE ILE A . n 
A 1 344 ILE 344 378 378 ILE ILE A . n 
A 1 345 PHE 345 379 379 PHE PHE A . n 
A 1 346 ALA 346 380 380 ALA ALA A . n 
A 1 347 PRO 347 381 381 PRO PRO A . n 
A 1 348 THR 348 382 382 THR THR A . n 
A 1 349 VAL 349 383 383 VAL VAL A . n 
A 1 350 LYS 350 384 384 LYS LYS A . n 
A 1 351 PHE 351 385 385 PHE PHE A . n 
A 1 352 THR 352 386 386 THR THR A . n 
A 1 353 SER 353 387 387 SER SER A . n 
A 1 354 PHE 354 388 388 PHE PHE A . n 
A 1 355 LEU 355 389 389 LEU LEU A . n 
A 1 356 CYS 356 390 390 CYS CYS A . n 
A 1 357 SER 357 391 391 SER SER A . n 
A 1 358 ILE 358 392 392 ILE ILE A . n 
A 1 359 LEU 359 393 393 LEU LEU A . n 
A 1 360 LYS 360 394 394 LYS LYS A . n 
A 1 361 ASN 361 395 395 ASN ASN A . n 
A 1 362 GLU 362 396 396 GLU GLU A . n 
A 1 363 PHE 363 397 397 PHE PHE A . n 
A 1 364 LYS 364 398 398 LYS LYS A . n 
A 1 365 LYS 365 399 399 LYS LYS A . n 
A 1 366 ASP 366 400 400 ASP ASP A . n 
A 1 367 LEU 367 401 401 LEU LEU A . n 
A 1 368 PRO 368 402 402 PRO PRO A . n 
A 1 369 ILE 369 403 403 ILE ILE A . n 
A 1 370 LEU 370 404 404 LEU LEU A . n 
A 1 371 GLU 371 405 405 GLU GLU A . n 
A 1 372 PHE 372 406 406 PHE PHE A . n 
A 1 373 HIS 373 407 407 HIS HIS A . n 
A 1 374 GLY 374 408 408 GLY GLY A . n 
A 1 375 LYS 375 409 409 LYS LYS A . n 
A 1 376 ILE 376 410 410 ILE ILE A . n 
A 1 377 THR 377 411 411 THR THR A . n 
A 1 378 GLN 378 412 412 GLN GLN A . n 
A 1 379 ASN 379 413 413 ASN ASN A . n 
A 1 380 LYS 380 414 414 LYS LYS A . n 
A 1 381 ARG 381 415 415 ARG ARG A . n 
A 1 382 THR 382 416 416 THR THR A . n 
A 1 383 SER 383 417 417 SER SER A . n 
A 1 384 LEU 384 418 418 LEU LEU A . n 
A 1 385 VAL 385 419 419 VAL VAL A . n 
A 1 386 LYS 386 420 420 LYS LYS A . n 
A 1 387 ARG 387 421 421 ARG ARG A . n 
A 1 388 PHE 388 422 422 PHE PHE A . n 
A 1 389 LYS 389 423 423 LYS LYS A . n 
A 1 390 LYS 390 424 424 LYS LYS A . n 
A 1 391 ASP 391 425 425 ASP ASP A . n 
A 1 392 GLU 392 426 426 GLU GLU A . n 
A 1 393 SER 393 427 427 SER SER A . n 
A 1 394 GLY 394 428 428 GLY GLY A . n 
A 1 395 ILE 395 429 429 ILE ILE A . n 
A 1 396 LEU 396 430 430 LEU LEU A . n 
A 1 397 VAL 397 431 431 VAL VAL A . n 
A 1 398 CYS 398 432 432 CYS CYS A . n 
A 1 399 THR 399 433 433 THR THR A . n 
A 1 400 ASP 400 434 434 ASP ASP A . n 
A 1 401 VAL 401 435 435 VAL VAL A . n 
A 1 402 GLY 402 436 436 GLY GLY A . n 
A 1 403 ALA 403 437 437 ALA ALA A . n 
A 1 404 ARG 404 438 438 ARG ARG A . n 
A 1 405 GLY 405 439 439 GLY GLY A . n 
A 1 406 MET 406 440 440 MET MET A . n 
A 1 407 ASP 407 441 441 ASP ASP A . n 
A 1 408 PHE 408 442 442 PHE PHE A . n 
A 1 409 PRO 409 443 443 PRO PRO A . n 
A 1 410 ASN 410 444 444 ASN ASN A . n 
A 1 411 VAL 411 445 445 VAL VAL A . n 
A 1 412 HIS 412 446 446 HIS HIS A . n 
A 1 413 GLU 413 447 447 GLU GLU A . n 
A 1 414 VAL 414 448 448 VAL VAL A . n 
A 1 415 LEU 415 449 449 LEU LEU A . n 
A 1 416 GLN 416 450 450 GLN GLN A . n 
A 1 417 ILE 417 451 451 ILE ILE A . n 
A 1 418 GLY 418 452 452 GLY GLY A . n 
A 1 419 VAL 419 453 453 VAL VAL A . n 
A 1 420 PRO 420 454 454 PRO PRO A . n 
A 1 421 SER 421 455 455 SER SER A . n 
A 1 422 GLU 422 456 456 GLU GLU A . n 
A 1 423 LEU 423 457 457 LEU LEU A . n 
A 1 424 ALA 424 458 458 ALA ALA A . n 
A 1 425 ASN 425 459 459 ASN ASN A . n 
A 1 426 TYR 426 460 460 TYR TYR A . n 
A 1 427 ILE 427 461 461 ILE ILE A . n 
A 1 428 HIS 428 462 462 HIS HIS A . n 
A 1 429 ARG 429 463 463 ARG ARG A . n 
A 1 430 ILE 430 464 464 ILE ILE A . n 
A 1 431 GLY 431 465 465 GLY GLY A . n 
A 1 432 ARG 432 466 466 ARG ARG A . n 
A 1 433 THR 433 467 467 THR THR A . n 
A 1 434 ALA 434 468 468 ALA ALA A . n 
A 1 435 ARG 435 469 469 ARG ARG A . n 
A 1 436 SER 436 470 470 SER SER A . n 
A 1 437 GLY 437 471 471 GLY GLY A . n 
A 1 438 LYS 438 472 472 LYS LYS A . n 
A 1 439 GLU 439 473 473 GLU GLU A . n 
A 1 440 GLY 440 474 474 GLY GLY A . n 
A 1 441 SER 441 475 475 SER SER A . n 
A 1 442 SER 442 476 476 SER SER A . n 
A 1 443 VAL 443 477 477 VAL VAL A . n 
A 1 444 LEU 444 478 478 LEU LEU A . n 
A 1 445 PHE 445 479 479 PHE PHE A . n 
A 1 446 ILE 446 480 480 ILE ILE A . n 
A 1 447 CYS 447 481 481 CYS CYS A . n 
A 1 448 LYS 448 482 482 LYS LYS A . n 
A 1 449 ASP 449 483 483 ASP ASP A . n 
A 1 450 GLU 450 484 484 GLU GLU A . n 
A 1 451 LEU 451 485 485 LEU LEU A . n 
A 1 452 PRO 452 486 486 PRO PRO A . n 
A 1 453 PHE 453 487 487 PHE PHE A . n 
A 1 454 VAL 454 488 488 VAL VAL A . n 
A 1 455 ARG 455 489 489 ARG ARG A . n 
A 1 456 GLU 456 490 490 GLU GLU A . n 
A 1 457 LEU 457 491 491 LEU LEU A . n 
A 1 458 GLU 458 492 492 GLU GLU A . n 
A 1 459 ASP 459 493 493 ASP ASP A . n 
A 1 460 ALA 460 494 494 ALA ALA A . n 
A 1 461 LYS 461 495 495 LYS LYS A . n 
A 1 462 ASN 462 496 496 ASN ASN A . n 
A 1 463 ILE 463 497 497 ILE ILE A . n 
A 1 464 VAL 464 498 498 VAL VAL A . n 
A 1 465 ILE 465 499 499 ILE ILE A . n 
A 1 466 ALA 466 500 500 ALA ALA A . n 
A 1 467 LYS 467 501 501 LYS LYS A . n 
A 1 468 GLN 468 502 502 GLN GLN A . n 
A 1 469 GLU 469 503 503 GLU GLU A . n 
A 1 470 LYS 470 504 504 LYS LYS A . n 
A 1 471 TYR 471 505 505 TYR TYR A . n 
A 1 472 GLU 472 506 506 GLU GLU A . n 
A 1 473 PRO 473 507 507 PRO PRO A . n 
A 1 474 SER 474 508 508 SER SER A . n 
A 1 475 GLU 475 509 509 GLU GLU A . n 
A 1 476 GLU 476 510 510 GLU GLU A . n 
A 1 477 ILE 477 511 511 ILE ILE A . n 
A 1 478 LYS 478 512 512 LYS LYS A . n 
A 1 479 SER 479 513 513 SER SER A . n 
A 1 480 GLU 480 514 514 GLU GLU A . n 
A 1 481 VAL 481 515 515 VAL VAL A . n 
A 1 482 LEU 482 516 516 LEU LEU A . n 
A 1 483 GLU 483 517 517 GLU GLU A . n 
A 1 484 ALA 484 518 518 ALA ALA A . n 
A 1 485 VAL 485 519 519 VAL VAL A . n 
A 1 486 THR 486 520 520 THR THR A . n 
A 1 487 GLU 487 521 521 GLU GLU A . n 
A 1 488 GLU 488 522 522 GLU GLU A . n 
A 1 489 PRO 489 523 523 PRO PRO A . n 
A 1 490 GLU 490 524 524 GLU GLU A . n 
A 1 491 ASP 491 525 525 ASP ASP A . n 
A 1 492 ILE 492 526 526 ILE ILE A . n 
A 1 493 SER 493 527 527 SER SER A . n 
A 1 494 ASP 494 528 528 ASP ASP A . n 
A 1 495 ILE 495 529 529 ILE ILE A . n 
A 1 496 VAL 496 530 530 VAL VAL A . n 
A 1 497 ILE 497 531 531 ILE ILE A . n 
A 1 498 SER 498 532 532 SER SER A . n 
A 1 499 LEU 499 533 533 LEU LEU A . n 
A 1 500 ILE 500 534 534 ILE ILE A . n 
A 1 501 SER 501 535 535 SER SER A . n 
A 1 502 SER 502 536 536 SER SER A . n 
A 1 503 TYR 503 537 537 TYR TYR A . n 
A 1 504 ARG 504 538 538 ARG ARG A . n 
A 1 505 SER 505 539 539 SER SER A . n 
A 1 506 CYS 506 540 540 CYS CYS A . n 
A 1 507 ILE 507 541 541 ILE ILE A . n 
A 1 508 LYS 508 542 542 LYS LYS A . n 
A 1 509 GLU 509 543 543 GLU GLU A . n 
A 1 510 TYR 510 544 544 TYR TYR A . n 
A 1 511 ARG 511 545 545 ARG ARG A . n 
A 1 512 PHE 512 546 546 PHE PHE A . n 
A 1 513 SER 513 547 547 SER SER A . n 
A 1 514 GLU 514 548 548 GLU GLU A . n 
A 1 515 ARG 515 549 549 ARG ARG A . n 
A 1 516 ARG 516 550 550 ARG ARG A . n 
A 1 517 ILE 517 551 551 ILE ILE A . n 
A 1 518 LEU 518 552 552 LEU LEU A . n 
A 1 519 PRO 519 553 553 PRO PRO A . n 
A 1 520 GLU 520 554 554 GLU GLU A . n 
A 1 521 ILE 521 555 555 ILE ILE A . n 
A 1 522 ALA 522 556 556 ALA ALA A . n 
A 1 523 SER 523 557 557 SER SER A . n 
A 1 524 THR 524 558 558 THR THR A . n 
A 1 525 TYR 525 559 559 TYR TYR A . n 
A 1 526 GLY 526 560 560 GLY GLY A . n 
A 1 527 VAL 527 561 561 VAL VAL A . n 
A 1 528 LEU 528 562 562 LEU LEU A . n 
A 1 529 LEU 529 563 563 LEU LEU A . n 
A 1 530 ASN 530 564 564 ASN ASN A . n 
A 1 531 ASP 531 565 565 ASP ASP A . n 
A 1 532 PRO 532 566 566 PRO PRO A . n 
A 1 533 GLN 533 567 567 GLN GLN A . n 
A 1 534 LEU 534 568 568 LEU LEU A . n 
A 1 535 LYS 535 569 569 LYS LYS A . n 
A 1 536 ILE 536 570 570 ILE ILE A . n 
A 1 537 PRO 537 571 571 PRO PRO A . n 
A 1 538 VAL 538 572 572 VAL VAL A . n 
A 1 539 SER 539 573 573 SER SER A . n 
A 1 540 ARG 540 574 574 ARG ARG A . n 
A 1 541 ARG 541 575 575 ARG ARG A . n 
A 1 542 PHE 542 576 576 PHE PHE A . n 
A 1 543 LEU 543 577 577 LEU LEU A . n 
A 1 544 ASP 544 578 578 ASP ASP A . n 
A 1 545 LYS 545 579 579 LYS LYS A . n 
A 1 546 LEU 546 580 580 LEU LEU A . n 
A 1 547 GLY 547 581 581 GLY GLY A . n 
A 1 548 LEU 548 582 582 LEU LEU A . n 
A 1 549 SER 549 583 583 SER SER A . n 
A 1 550 ARG 550 584 584 ARG ARG A . n 
A 1 551 SER 551 585 585 SER SER A . n 
A 1 552 PRO 552 586 586 PRO PRO A . n 
A 1 553 ILE 553 587 587 ILE ILE A . n 
A 1 554 GLY 554 588 588 GLY GLY A . n 
A 1 555 LYS 555 589 589 LYS LYS A . n 
A 1 556 ALA 556 590 590 ALA ALA A . n 
A 1 557 MET 557 591 591 MET MET A . n 
A 1 558 PHE 558 592 592 PHE PHE A . n 
A 1 559 GLU 559 593 593 GLU GLU A . n 
A 1 560 ILE 560 594 594 ILE ILE A . n 
A 1 561 ARG 561 595 595 ARG ARG A . n 
A 1 562 ASP 562 596 596 ASP ASP A . n 
A 1 563 TYR 563 597 ?   ?   ?   A . n 
B 2 1   U   1   1   1   U   U   B . n 
B 2 2   U   2   2   2   U   U   B . n 
B 2 3   U   3   3   3   U   U   B . n 
B 2 4   5BU 4   4   4   5BU 5BU B . n 
B 2 5   U   5   5   5   U   U   B . n 
B 2 6   U   6   6   6   U   U   B . n 
B 2 7   U   7   7   7   U   U   B . n 
B 2 8   U   8   8   8   U   U   B . n 
B 2 9   U   9   9   9   U   U   B . n 
B 2 10  U   10  10  10  U   U   B . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    5BU 
_pdbx_struct_mod_residue.label_seq_id     4 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     5BU 
_pdbx_struct_mod_residue.auth_seq_id      4 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   U 
_pdbx_struct_mod_residue.details          "5-BROMO-URIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3810  ? 
1 MORE         -34   ? 
1 'SSA (A^2)'  21710 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O3G ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O1B ? C ANP . ? A ANP 1000 ? 1_555 96.6  ? 
2  O3G ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1048 ? 1_555 80.6  ? 
3  O1B ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1048 ? 1_555 79.3  ? 
4  O3G ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1045 ? 1_555 77.1  ? 
5  O1B ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1045 ? 1_555 151.0 ? 
6  O   ? E HOH . ? A HOH 1048 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1045 ? 1_555 71.8  ? 
7  O3G ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1074 ? 1_555 155.7 ? 
8  O1B ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1074 ? 1_555 103.5 ? 
9  O   ? E HOH . ? A HOH 1048 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1074 ? 1_555 89.8  ? 
10 O   ? E HOH . ? A HOH 1045 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1074 ? 1_555 78.7  ? 
11 O3G ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1008 ? 1_555 86.7  ? 
12 O1B ? C ANP . ? A ANP 1000 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1008 ? 1_555 131.5 ? 
13 O   ? E HOH . ? A HOH 1048 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1008 ? 1_555 148.1 ? 
14 O   ? E HOH . ? A HOH 1045 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1008 ? 1_555 76.9  ? 
15 O   ? E HOH . ? A HOH 1074 ? 1_555 MG ? D MG . ? A MG 900 ? 1_555 O   ? E HOH . ? A HOH 1008 ? 1_555 90.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-09-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 76.4650 43.6110  28.0380 0.3487 0.2167 0.1519 -0.0117 0.0637  -0.1559 5.6485 4.0899 2.4200 -0.4869 
0.5530  -1.0318 -0.1093 0.0964  0.0129  -0.8319 0.3096  0.0823  0.8476  -0.4776 -0.0828 
'X-RAY DIFFRACTION' 2 ? refined 80.9670 37.9220  10.0580 0.0298 0.0122 0.0828 -0.0107 -0.0113 -0.0115 2.1361 1.6424 1.1288 0.5232  
-0.4479 -0.1376 0.0570  -0.0540 -0.0030 -0.1310 0.2452  -0.0653 0.1980  -0.0898 0.0909  
'X-RAY DIFFRACTION' 3 ? refined 65.8980 10.0780  12.9180 0.0238 0.0205 0.0742 -0.0038 -0.0026 0.0328  1.4219 2.0559 0.7471 0.1063  
-0.0952 -0.1103 0.0317  0.0278  -0.0595 -0.1515 -0.1677 0.0763  0.0878  0.0821  -0.0140 
'X-RAY DIFFRACTION' 4 ? refined 81.4150 -10.8190 5.8770  0.1344 0.0977 0.2647 0.0603  0.0467  0.0460  8.8181 2.7356 7.0366 1.2431  
2.1183  2.5517  -0.0660 0.2036  -0.1376 0.2740  0.0333  -0.0890 -0.3411 0.3089  0.7561  
'X-RAY DIFFRACTION' 5 ? refined 82.1290 16.7430  -1.7940 0.2582 0.0574 0.2118 -0.0135 0.0906  -0.0618 3.2933 5.8504 2.7151 2.0861  
-2.2838 -3.6968 -0.3385 -0.0354 0.3739  0.2722  -0.4440 -0.5046 -0.7423 0.4733  -0.0755 
'X-RAY DIFFRACTION' 6 ? refined 66.7680 33.9120  16.7670 0.0243 0.0512 0.1827 -0.0007 0.0339  -0.0511 0.0778 0.0358 8.9036 0.0527  
0.8243  0.5542  0.0002  -0.0153 0.0151  -0.0411 0.0166  0.0155  -0.0080 -0.1753 -0.3865 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 88   A 113  ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 114  A 334  ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 335  A 564  ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 A 565  A 596  ? . . . . ? 
'X-RAY DIFFRACTION' 5 5 B 1    B 10   ? . . . . ? 
'X-RAY DIFFRACTION' 6 6 A 1000 A 1000 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
REFMAC   refinement        5.5.0070 ? 2 
HKL-2000 'data reduction'  .        ? 3 
HKL-2000 'data scaling'    .        ? 4 
REFMAC   phasing           5.5.0070 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 207 ? ? -163.00 94.84 
2 1 ASP A 434 ? ? -66.54  2.13  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 96  ? CG  ? A GLU 62  CG  
2  1 Y 1 A GLU 96  ? CD  ? A GLU 62  CD  
3  1 Y 1 A GLU 96  ? OE1 ? A GLU 62  OE1 
4  1 Y 1 A GLU 96  ? OE2 ? A GLU 62  OE2 
5  1 Y 1 A ASP 97  ? CG  ? A ASP 63  CG  
6  1 Y 1 A ASP 97  ? OD1 ? A ASP 63  OD1 
7  1 Y 1 A ASP 97  ? OD2 ? A ASP 63  OD2 
8  1 Y 1 A ASN 98  ? CG  ? A ASN 64  CG  
9  1 Y 1 A ASN 98  ? OD1 ? A ASN 64  OD1 
10 1 Y 1 A ASN 98  ? ND2 ? A ASN 64  ND2 
11 1 Y 1 A LYS 100 ? CG  ? A LYS 66  CG  
12 1 Y 1 A LYS 100 ? CD  ? A LYS 66  CD  
13 1 Y 1 A LYS 100 ? CE  ? A LYS 66  CE  
14 1 Y 1 A LYS 100 ? NZ  ? A LYS 66  NZ  
15 1 Y 1 A GLU 109 ? CD  ? A GLU 75  CD  
16 1 Y 1 A GLU 109 ? OE1 ? A GLU 75  OE1 
17 1 Y 1 A GLU 109 ? OE2 ? A GLU 75  OE2 
18 1 Y 1 A LYS 115 ? CG  ? A LYS 81  CG  
19 1 Y 1 A LYS 115 ? CD  ? A LYS 81  CD  
20 1 Y 1 A LYS 115 ? CE  ? A LYS 81  CE  
21 1 Y 1 A LYS 115 ? NZ  ? A LYS 81  NZ  
22 1 Y 1 A GLU 125 ? CD  ? A GLU 91  CD  
23 1 Y 1 A GLU 125 ? OE1 ? A GLU 91  OE1 
24 1 Y 1 A GLU 125 ? OE2 ? A GLU 91  OE2 
25 1 Y 1 A LYS 294 ? CE  ? A LYS 260 CE  
26 1 Y 1 A LYS 294 ? NZ  ? A LYS 260 NZ  
27 1 Y 1 A LYS 311 ? CG  ? A LYS 277 CG  
28 1 Y 1 A LYS 311 ? CD  ? A LYS 277 CD  
29 1 Y 1 A LYS 311 ? CE  ? A LYS 277 CE  
30 1 Y 1 A LYS 311 ? NZ  ? A LYS 277 NZ  
31 1 Y 1 A GLN 313 ? CG  ? A GLN 279 CG  
32 1 Y 1 A GLN 313 ? CD  ? A GLN 279 CD  
33 1 Y 1 A GLN 313 ? OE1 ? A GLN 279 OE1 
34 1 Y 1 A GLN 313 ? NE2 ? A GLN 279 NE2 
35 1 Y 1 A LYS 314 ? CE  ? A LYS 280 CE  
36 1 Y 1 A LYS 314 ? NZ  ? A LYS 280 NZ  
37 1 Y 1 A LYS 323 ? CE  ? A LYS 289 CE  
38 1 Y 1 A LYS 323 ? NZ  ? A LYS 289 NZ  
39 1 Y 1 A LYS 333 ? CG  ? A LYS 299 CG  
40 1 Y 1 A LYS 333 ? CD  ? A LYS 299 CD  
41 1 Y 1 A LYS 333 ? CE  ? A LYS 299 CE  
42 1 Y 1 A LYS 333 ? NZ  ? A LYS 299 NZ  
43 1 Y 1 A LYS 368 ? CD  ? A LYS 334 CD  
44 1 Y 1 A LYS 368 ? CE  ? A LYS 334 CE  
45 1 Y 1 A LYS 368 ? NZ  ? A LYS 334 NZ  
46 1 Y 1 A LYS 409 ? CE  ? A LYS 375 CE  
47 1 Y 1 A LYS 409 ? NZ  ? A LYS 375 NZ  
48 1 Y 1 A GLU 456 ? CG  ? A GLU 422 CG  
49 1 Y 1 A GLU 456 ? CD  ? A GLU 422 CD  
50 1 Y 1 A GLU 456 ? OE1 ? A GLU 422 OE1 
51 1 Y 1 A GLU 456 ? OE2 ? A GLU 422 OE2 
52 1 Y 1 A LYS 482 ? CD  ? A LYS 448 CD  
53 1 Y 1 A LYS 482 ? CE  ? A LYS 448 CE  
54 1 Y 1 A LYS 482 ? NZ  ? A LYS 448 NZ  
55 1 Y 1 A LYS 504 ? CD  ? A LYS 470 CD  
56 1 Y 1 A LYS 504 ? CE  ? A LYS 470 CE  
57 1 Y 1 A LYS 504 ? NZ  ? A LYS 470 NZ  
58 1 Y 1 A LYS 542 ? CE  ? A LYS 508 CE  
59 1 Y 1 A LYS 542 ? NZ  ? A LYS 508 NZ  
60 1 Y 1 A ARG 545 ? CZ  ? A ARG 511 CZ  
61 1 Y 1 A ARG 545 ? NH1 ? A ARG 511 NH1 
62 1 Y 1 A ARG 545 ? NH2 ? A ARG 511 NH2 
63 1 Y 1 A ARG 574 ? CD  ? A ARG 540 CD  
64 1 Y 1 A ARG 574 ? NE  ? A ARG 540 NE  
65 1 Y 1 A ARG 574 ? CZ  ? A ARG 540 CZ  
66 1 Y 1 A ARG 574 ? NH1 ? A ARG 540 NH1 
67 1 Y 1 A ARG 574 ? NH2 ? A ARG 540 NH2 
68 1 Y 1 A ARG 575 ? CG  ? A ARG 541 CG  
69 1 Y 1 A ARG 575 ? CD  ? A ARG 541 CD  
70 1 Y 1 A ARG 575 ? NE  ? A ARG 541 NE  
71 1 Y 1 A ARG 575 ? CZ  ? A ARG 541 CZ  
72 1 Y 1 A ARG 575 ? NH1 ? A ARG 541 NH1 
73 1 Y 1 A ARG 575 ? NH2 ? A ARG 541 NH2 
74 1 Y 1 A LYS 579 ? CD  ? A LYS 545 CD  
75 1 Y 1 A LYS 579 ? CE  ? A LYS 545 CE  
76 1 Y 1 A LYS 579 ? NZ  ? A LYS 545 NZ  
77 1 Y 1 A LYS 589 ? CE  ? A LYS 555 CE  
78 1 Y 1 A LYS 589 ? NZ  ? A LYS 555 NZ  
79 1 Y 1 A ARG 595 ? CZ  ? A ARG 561 CZ  
80 1 Y 1 A ARG 595 ? NH1 ? A ARG 561 NH1 
81 1 Y 1 A ARG 595 ? NH2 ? A ARG 561 NH2 
82 1 Y 1 A ASP 596 ? CG  ? A ASP 562 CG  
83 1 Y 1 A ASP 596 ? OD1 ? A ASP 562 OD1 
84 1 Y 1 A ASP 596 ? OD2 ? A ASP 562 OD2 
85 1 Y 1 B U   2   ? C2  ? B U   2   C2  
86 1 Y 1 B U   2   ? O2  ? B U   2   O2  
87 1 Y 1 B U   2   ? N3  ? B U   2   N3  
88 1 Y 1 B U   2   ? C4  ? B U   2   C4  
89 1 Y 1 B U   2   ? O4  ? B U   2   O4  
90 1 Y 1 B U   2   ? C5  ? B U   2   C5  
91 1 Y 1 B U   2   ? C6  ? B U   2   C6  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 35  ? A GLY 1   
2  1 Y 1 A SER 36  ? A SER 2   
3  1 Y 1 A LEU 37  ? A LEU 3   
4  1 Y 1 A TYR 38  ? A TYR 4   
5  1 Y 1 A ASN 39  ? A ASN 5   
6  1 Y 1 A ASP 40  ? A ASP 6   
7  1 Y 1 A GLY 41  ? A GLY 7   
8  1 Y 1 A ASN 42  ? A ASN 8   
9  1 Y 1 A ARG 43  ? A ARG 9   
10 1 Y 1 A ASP 44  ? A ASP 10  
11 1 Y 1 A GLN 45  ? A GLN 11  
12 1 Y 1 A ARG 46  ? A ARG 12  
13 1 Y 1 A ASN 47  ? A ASN 13  
14 1 Y 1 A PHE 48  ? A PHE 14  
15 1 Y 1 A GLY 49  ? A GLY 15  
16 1 Y 1 A ARG 50  ? A ARG 16  
17 1 Y 1 A ASN 51  ? A ASN 17  
18 1 Y 1 A GLN 52  ? A GLN 18  
19 1 Y 1 A ARG 53  ? A ARG 19  
20 1 Y 1 A ASN 54  ? A ASN 20  
21 1 Y 1 A ASN 55  ? A ASN 21  
22 1 Y 1 A ASN 56  ? A ASN 22  
23 1 Y 1 A SER 57  ? A SER 23  
24 1 Y 1 A ASN 58  ? A ASN 24  
25 1 Y 1 A ARG 59  ? A ARG 25  
26 1 Y 1 A TYR 60  ? A TYR 26  
27 1 Y 1 A ARG 61  ? A ARG 27  
28 1 Y 1 A ASN 62  ? A ASN 28  
29 1 Y 1 A SER 63  ? A SER 29  
30 1 Y 1 A ARG 64  ? A ARG 30  
31 1 Y 1 A PHE 65  ? A PHE 31  
32 1 Y 1 A ASN 66  ? A ASN 32  
33 1 Y 1 A SER 67  ? A SER 33  
34 1 Y 1 A ARG 68  ? A ARG 34  
35 1 Y 1 A PRO 69  ? A PRO 35  
36 1 Y 1 A ARG 70  ? A ARG 36  
37 1 Y 1 A THR 71  ? A THR 37  
38 1 Y 1 A ARG 72  ? A ARG 38  
39 1 Y 1 A SER 73  ? A SER 39  
40 1 Y 1 A ARG 74  ? A ARG 40  
41 1 Y 1 A GLU 75  ? A GLU 41  
42 1 Y 1 A ASP 76  ? A ASP 42  
43 1 Y 1 A ASP 77  ? A ASP 43  
44 1 Y 1 A ASP 78  ? A ASP 44  
45 1 Y 1 A GLU 79  ? A GLU 45  
46 1 Y 1 A VAL 80  ? A VAL 46  
47 1 Y 1 A HIS 81  ? A HIS 47  
48 1 Y 1 A PHE 82  ? A PHE 48  
49 1 Y 1 A ASP 83  ? A ASP 49  
50 1 Y 1 A LYS 84  ? A LYS 50  
51 1 Y 1 A THR 85  ? A THR 51  
52 1 Y 1 A THR 86  ? A THR 52  
53 1 Y 1 A PHE 87  ? A PHE 53  
54 1 Y 1 A TYR 597 ? A TYR 563 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
4 'MAGNESIUM ION'                               MG  
5 water                                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ANP 1  1000 1000 ANP ANP A . 
D 4 MG  1  900  900  MG  MG  A . 
E 5 HOH 1  1001 1001 HOH HOH A . 
E 5 HOH 2  1002 1002 HOH HOH A . 
E 5 HOH 3  1003 1003 HOH HOH A . 
E 5 HOH 4  1004 1004 HOH HOH A . 
E 5 HOH 5  1005 1005 HOH HOH A . 
E 5 HOH 6  1006 1006 HOH HOH A . 
E 5 HOH 7  1007 1007 HOH HOH A . 
E 5 HOH 8  1008 1008 HOH HOH A . 
E 5 HOH 9  1009 1009 HOH HOH A . 
E 5 HOH 10 1010 1010 HOH HOH A . 
E 5 HOH 11 1011 1011 HOH HOH A . 
E 5 HOH 12 1012 1012 HOH HOH A . 
E 5 HOH 13 1013 1013 HOH HOH A . 
E 5 HOH 14 1014 1014 HOH HOH A . 
E 5 HOH 15 1015 1015 HOH HOH A . 
E 5 HOH 16 1016 1016 HOH HOH A . 
E 5 HOH 17 1017 1017 HOH HOH A . 
E 5 HOH 18 1018 1018 HOH HOH A . 
E 5 HOH 19 1019 1019 HOH HOH A . 
E 5 HOH 20 1020 1020 HOH HOH A . 
E 5 HOH 21 1021 1021 HOH HOH A . 
E 5 HOH 22 1022 1022 HOH HOH A . 
E 5 HOH 23 1023 1023 HOH HOH A . 
E 5 HOH 24 1024 1024 HOH HOH A . 
E 5 HOH 25 1025 1025 HOH HOH A . 
E 5 HOH 26 1026 1026 HOH HOH A . 
E 5 HOH 27 1027 1027 HOH HOH A . 
E 5 HOH 28 1028 1028 HOH HOH A . 
E 5 HOH 29 1029 1029 HOH HOH A . 
E 5 HOH 30 1030 1030 HOH HOH A . 
E 5 HOH 31 1031 1031 HOH HOH A . 
E 5 HOH 32 1032 1032 HOH HOH A . 
E 5 HOH 33 1033 1033 HOH HOH A . 
E 5 HOH 34 1034 1034 HOH HOH A . 
E 5 HOH 35 1035 1035 HOH HOH A . 
E 5 HOH 36 1036 1036 HOH HOH A . 
E 5 HOH 37 1037 1037 HOH HOH A . 
E 5 HOH 38 1038 1038 HOH HOH A . 
E 5 HOH 39 1039 1039 HOH HOH A . 
E 5 HOH 40 1040 1040 HOH HOH A . 
E 5 HOH 41 1041 1041 HOH HOH A . 
E 5 HOH 42 1042 1042 HOH HOH A . 
E 5 HOH 43 1043 1043 HOH HOH A . 
E 5 HOH 44 1044 1044 HOH HOH A . 
E 5 HOH 45 1045 1045 HOH HOH A . 
E 5 HOH 46 1046 1046 HOH HOH A . 
E 5 HOH 47 1047 1047 HOH HOH A . 
E 5 HOH 48 1048 1048 HOH HOH A . 
E 5 HOH 49 1049 1049 HOH HOH A . 
E 5 HOH 50 1050 1050 HOH HOH A . 
E 5 HOH 51 1051 1051 HOH HOH A . 
E 5 HOH 52 1052 1052 HOH HOH A . 
E 5 HOH 53 1053 1053 HOH HOH A . 
E 5 HOH 54 1054 1054 HOH HOH A . 
E 5 HOH 55 1055 1055 HOH HOH A . 
E 5 HOH 56 1056 1056 HOH HOH A . 
E 5 HOH 57 1057 1057 HOH HOH A . 
E 5 HOH 58 1058 1058 HOH HOH A . 
E 5 HOH 59 1059 1059 HOH HOH A . 
E 5 HOH 60 1060 1060 HOH HOH A . 
E 5 HOH 61 1061 1061 HOH HOH A . 
E 5 HOH 62 1062 1062 HOH HOH A . 
E 5 HOH 63 1063 1063 HOH HOH A . 
E 5 HOH 64 1064 1064 HOH HOH A . 
E 5 HOH 65 1065 1065 HOH HOH A . 
E 5 HOH 66 1066 1066 HOH HOH A . 
E 5 HOH 67 1067 1067 HOH HOH A . 
E 5 HOH 68 1068 1068 HOH HOH A . 
E 5 HOH 69 1069 1069 HOH HOH A . 
E 5 HOH 70 1070 1070 HOH HOH A . 
E 5 HOH 71 1071 1071 HOH HOH A . 
E 5 HOH 72 1072 1072 HOH HOH A . 
E 5 HOH 73 1073 1073 HOH HOH A . 
E 5 HOH 74 1074 1074 HOH HOH A . 
E 5 HOH 75 1075 1075 HOH HOH A . 
E 5 HOH 76 1076 1076 HOH HOH A . 
E 5 HOH 77 1077 1077 HOH HOH A . 
E 5 HOH 78 1078 1078 HOH HOH A . 
E 5 HOH 79 1079 1079 HOH HOH A . 
E 5 HOH 80 1080 1080 HOH HOH A . 
E 5 HOH 81 1081 1081 HOH HOH A . 
E 5 HOH 82 1082 1082 HOH HOH A . 
F 5 HOH 1  1083 1083 HOH HOH B . 
F 5 HOH 2  1084 1084 HOH HOH B . 
F 5 HOH 3  1085 1085 HOH HOH B . 
#