data_3I7H
# 
_entry.id   3I7H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I7H         
RCSB  RCSB054060   
WWPDB D_1000054060 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7K 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I7H 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I7H 
_cell.length_a           63.856 
_cell.length_b           132.860 
_cell.length_c           183.818 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I7H 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1' 127399.766 1 ? ? ?                 ? 
2 polymer syn 'X protein'                    1578.983   1 ? ? 'Residues 88-101' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no ILPKVLHKRTLGLS ILPKVLHKRTLGLS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    ILE n 
2 2    LEU n 
2 3    PRO n 
2 4    LYS n 
2 5    VAL n 
2 6    LEU n 
2 7    HIS n 
2 8    LYS n 
2 9    ARG n 
2 10   THR n 
2 11   LEU n 
2 12   GLY n 
2 13   LEU n 
2 14   SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Human Hepatitis B virus' 
_pdbx_entity_src_syn.organism_common_name   HBV 
_pdbx_entity_src_syn.ncbi_taxonomy_id       10407 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1  ? 
2 UNP Q9QMH9_HBV Q9QMH9 2 ILPKVLHKRTLGLS 88 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I7H A 4 ? 1143 ? Q16531 1  ? 1140 ? 1  1140 
2 2 3I7H B 1 ? 14   ? Q9QMH9 88 ? 101  ? 88 101  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I7H GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I7H SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I7H HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I7H TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I7H ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I7H VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I7H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_percent_sol   59.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I7H 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             48.80 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   31592 
_reflns.number_all                   32999 
_reflns.percent_possible_obs         95.7 
_reflns.pdbx_Rmerge_I_obs            0.101 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              2.98 
_reflns_shell.percent_possible_all   70 
_reflns_shell.Rmerge_I_obs           0.378 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3I7H 
_refine.ls_number_reflns_obs                     31592 
_refine.ls_number_reflns_all                     32999 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.80 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    95.7 
_refine.ls_R_factor_obs                          0.236 
_refine.ls_R_factor_all                          0.256 
_refine.ls_R_factor_R_work                       0.234 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.6 
_refine.ls_number_reflns_R_free                  1527 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.910 
_refine.correlation_coeff_Fo_to_Fc_free          0.872 
_refine.B_iso_mean                               69.504 
_refine.aniso_B[1][1]                            -1.05 
_refine.aniso_B[2][2]                            -1.20 
_refine.aniso_B[3][3]                            2.25 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.930 
_refine.pdbx_overall_ESU_R_Free                  0.445 
_refine.overall_SU_ML                            0.323 
_refine.overall_SU_B                             16.952 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8837 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8837 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        48.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.016  0.022  ? 8998  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.733  1.967  ? 12186 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.156  5.000  ? 1123  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   40.759 24.716 ? 405   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   21.826 15.000 ? 1597  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   20.582 15.000 ? 49    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.110  0.200  ? 1407  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 6704  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.275  0.200  ? 4338  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.324  0.200  ? 5954  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.196  0.200  ? 324   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.278  0.200  ? 34    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.149  0.200  ? 4     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.900 
_refine_ls_shell.d_res_low                        2.975 
_refine_ls_shell.number_reflns_R_work             2058 
_refine_ls_shell.R_factor_R_work                  0.337 
_refine_ls_shell.percent_reflns_obs               85.69 
_refine_ls_shell.R_factor_R_free                  0.393 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2058 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I7H 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, X protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I7H 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING/VIRAL PROTEIN' 
_struct_keywords.text            
;DDB1, HBV, X protein, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Activator, Apoptosis, Mitochondrion, Transcription, Transcription regulation, PROTEIN BINDING-VIRAL PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 253  ? LYS A 257  ? PRO A 250  LYS A 254  5 ? 5  
HELX_P HELX_P2 2 ASN A 344  ? SER A 348  ? ASN A 341  SER A 345  5 ? 5  
HELX_P HELX_P3 3 ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P4 4 SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P5 5 GLU A 1072 ? SER A 1078 ? GLU A 1069 SER A 1075 1 ? 7  
HELX_P HELX_P6 6 ASP A 1093 ? SER A 1099 ? ASP A 1090 SER A 1096 1 ? 7  
HELX_P HELX_P7 7 SER A 1104 ? VAL A 1111 ? SER A 1101 VAL A 1108 1 ? 8  
HELX_P HELX_P8 8 THR A 1128 ? ARG A 1141 ? THR A 1125 ARG A 1138 1 ? 14 
HELX_P HELX_P9 9 ILE B 1    ? GLY B 12   ? ILE B 88   GLY B 99   1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.045 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 3 ? 
L ? 3 ? 
M ? 2 ? 
N ? 4 ? 
O ? 3 ? 
P ? 3 ? 
Q ? 5 ? 
R ? 4 ? 
S ? 4 ? 
T ? 4 ? 
U ? 4 ? 
V ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? parallel      
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 7    ? GLN A 13   ? ASN A 4    GLN A 10   
A 2 ILE A 1040 ? SER A 1045 ? ILE A 1037 SER A 1042 
A 3 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 4 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? LYS A 95   ? ASN A 85   LYS A 92   
C 4 ASP A 102  ? ASN A 110  ? ASP A 99   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? TYR A 139  ? MET A 130  TYR A 136  
D 3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D 4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E 1 HIS A 166  ? PHE A 172  ? HIS A 163  PHE A 169  
E 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E 3 GLY A 190  ? GLU A 197  ? GLY A 187  GLU A 194  
E 4 GLU A 213  ? VAL A 215  ? GLU A 210  VAL A 212  
F 1 MET A 221  ? VAL A 225  ? MET A 218  VAL A 222  
F 2 GLY A 231  ? ILE A 235  ? GLY A 228  ILE A 232  
F 3 ILE A 240  ? ASN A 244  ? ILE A 237  ASN A 241  
F 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
G 1 ILE A 261  ? ARG A 266  ? ILE A 258  ARG A 263  
G 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
G 3 ARG A 282  ? GLU A 292  ? ARG A 279  GLU A 289  
G 4 VAL A 298  ? GLU A 310  ? VAL A 295  GLU A 307  
H 1 CYS A 316  ? ASP A 321  ? CYS A 313  ASP A 318  
H 2 VAL A 324  ? GLY A 328  ? VAL A 321  GLY A 325  
H 3 SER A 334  ? LEU A 339  ? SER A 331  LEU A 336  
H 4 VAL A 350  ? PHE A 356  ? VAL A 347  PHE A 353  
I 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
I 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
I 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
I 4 LEU A 713  ? PRO A 719  ? LEU A 710  PRO A 716  
J 1 ILE A 399  ? ASP A 406  ? ILE A 396  ASP A 403  
J 2 THR A 701  ? ILE A 707  ? THR A 698  ILE A 704  
J 3 LEU A 694  ? ALA A 697  ? LEU A 691  ALA A 694  
J 4 TYR A 681  ? PRO A 684  ? TYR A 678  PRO A 681  
K 1 GLY A 412  ? TRP A 414  ? GLY A 409  TRP A 411  
K 2 VAL A 429  ? SER A 431  ? VAL A 426  SER A 428  
K 3 THR A 436  ? VAL A 438  ? THR A 433  VAL A 435  
L 1 GLN A 470  ? ILE A 474  ? GLN A 467  ILE A 471  
L 2 VAL A 479  ? SER A 483  ? VAL A 476  SER A 480  
L 3 SER A 491  ? GLU A 492  ? SER A 488  GLU A 489  
M 1 ALA A 518  ? TYR A 521  ? ALA A 515  TYR A 518  
M 2 SER A 533  ? GLU A 536  ? SER A 530  GLU A 533  
N 1 CYS A 543  ? ASP A 545  ? CYS A 540  ASP A 542  
N 2 LEU A 558  ? GLY A 562  ? LEU A 555  GLY A 559  
N 3 SER A 568  ? LYS A 573  ? SER A 565  LYS A 570  
N 4 LEU A 579  ? MET A 584  ? LEU A 576  MET A 581  
O 1 SER A 593  ? THR A 597  ? SER A 590  THR A 594  
O 2 HIS A 603  ? ALA A 608  ? HIS A 600  ALA A 605  
O 3 LEU A 614  ? LEU A 619  ? LEU A 611  LEU A 616  
P 1 VAL A 652  ? ALA A 654  ? VAL A 649  ALA A 651  
P 2 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
P 3 PHE A 671  ? ASN A 673  ? PHE A 668  ASN A 670  
Q 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
Q 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
Q 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
Q 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
Q 5 SER A 766  ? VAL A 768  ? SER A 763  VAL A 765  
R 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
R 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
R 3 GLY A 849  ? SER A 857  ? GLY A 846  SER A 854  
R 4 LYS A 860  ? ALA A 865  ? LYS A 857  ALA A 862  
S 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
S 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
S 3 GLY A 849  ? SER A 857  ? GLY A 846  SER A 854  
S 4 GLU A 868  ? VAL A 869  ? GLU A 865  VAL A 866  
T 1 VAL A 873  ? GLU A 878  ? VAL A 870  GLU A 875  
T 2 LEU A 883  ? ILE A 887  ? LEU A 880  ILE A 884  
T 3 THR A 890  ? TRP A 896  ? THR A 887  TRP A 893  
T 4 VAL A 902  ? ARG A 903  ? VAL A 899  ARG A 900  
U 1 LEU A 917  ? LYS A 920  ? LEU A 914  LYS A 917  
U 2 ILE A 924  ? ASP A 928  ? ILE A 921  ASP A 925  
U 3 VAL A 933  ? LYS A 939  ? VAL A 930  LYS A 936  
U 4 ASN A 944  ? ARG A 950  ? ASN A 941  ARG A 947  
V 1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
V 2 ASN A 967  ? GLU A 972  ? ASN A 964  GLU A 969  
V 3 ASN A 976  ? GLN A 981  ? ASN A 973  GLN A 978  
V 4 GLN A 996  ? HIS A 1002 ? GLN A 993  HIS A 999  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 12   ? N ALA A 9    O ILE A 1040 ? O ILE A 1037 
A 2 3 O SER A 1045 ? O SER A 1042 N GLN A 1028 ? N GLN A 1025 
A 3 4 O GLY A 1034 ? O GLY A 1031 N ASN A 1008 ? N ASN A 1005 
B 1 2 N GLY A 20   ? N GLY A 17   O ALA A 37   ? O ALA A 34   
B 2 3 N ILE A 36   ? N ILE A 33   O GLU A 43   ? O GLU A 40   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N PHE A 70   ? N PHE A 67   O LEU A 79   ? O LEU A 76   
C 2 3 N THR A 84   ? N THR A 81   O ASN A 88   ? O ASN A 85   
C 3 4 N LYS A 95   ? N LYS A 92   O ASP A 102  ? O ASP A 99   
D 1 2 N ILE A 126  ? N ILE A 123  O GLY A 135  ? O GLY A 132  
D 2 3 N LEU A 136  ? N LEU A 133  O LYS A 144  ? O LYS A 141  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E 2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
E 3 4 N ARG A 191  ? N ARG A 188  O VAL A 215  ? O VAL A 212  
F 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F 2 3 N ILE A 234  ? N ILE A 231  O THR A 241  ? O THR A 238  
F 3 4 N ILE A 240  ? N ILE A 237  O ILE A 251  ? O ILE A 248  
G 1 2 N VAL A 262  ? N VAL A 259  O GLY A 277  ? O GLY A 274  
G 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
G 3 4 N LEU A 283  ? N LEU A 280  O GLY A 309  ? O GLY A 306  
H 1 2 N THR A 318  ? N THR A 315  O PHE A 326  ? O PHE A 323  
H 2 3 N VAL A 327  ? N VAL A 324  O GLN A 335  ? O GLN A 332  
H 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
I 1 2 N ASP A 364  ? N ASP A 361  O CYS A 381  ? O CYS A 378  
I 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
I 3 4 N ARG A 394  ? N ARG A 391  O HIS A 714  ? O HIS A 711  
J 1 2 N ILE A 405  ? N ILE A 402  O LEU A 702  ? O LEU A 699  
J 2 3 O THR A 703  ? O THR A 700  N LEU A 696  ? N LEU A 693  
J 3 4 O ALA A 695  ? O ALA A 692  N CYS A 683  ? N CYS A 680  
K 1 2 N GLY A 412  ? N GLY A 409  O SER A 431  ? O SER A 428  
K 2 3 N LEU A 430  ? N LEU A 427  O ARG A 437  ? O ARG A 434  
L 1 2 N LEU A 471  ? N LEU A 468  O VAL A 482  ? O VAL A 479  
L 2 3 N LEU A 481  ? N LEU A 478  O SER A 491  ? O SER A 488  
M 1 2 O TYR A 521  ? O TYR A 518  N SER A 533  ? N SER A 530  
N 1 2 N CYS A 543  ? N CYS A 540  O GLY A 562  ? O GLY A 559  
N 2 3 N ILE A 561  ? N ILE A 558  O ARG A 570  ? O ARG A 567  
N 3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
O 1 2 N THR A 597  ? N THR A 594  O TYR A 604  ? O TYR A 601  
O 2 3 N HIS A 603  ? N HIS A 600  O LEU A 619  ? O LEU A 616  
P 1 2 N VAL A 652  ? N VAL A 649  O ILE A 662  ? O ILE A 659  
P 2 3 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
Q 1 2 N ARG A 725  ? N ARG A 722  O LEU A 739  ? O LEU A 736  
Q 2 3 N PHE A 736  ? N PHE A 733  O ILE A 797  ? O ILE A 794  
Q 3 4 N ILE A 796  ? N ILE A 793  O HIS A 806  ? O HIS A 803  
Q 4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
R 1 2 N LEU A 817  ? N LEU A 814  O GLY A 835  ? O GLY A 832  
R 2 3 N VAL A 834  ? N VAL A 831  O VAL A 852  ? O VAL A 849  
R 3 4 N GLN A 855  ? N GLN A 852  O GLN A 862  ? O GLN A 859  
S 1 2 N LEU A 817  ? N LEU A 814  O GLY A 835  ? O GLY A 832  
S 2 3 N VAL A 834  ? N VAL A 831  O VAL A 852  ? O VAL A 849  
S 3 4 N GLY A 849  ? N GLY A 846  O VAL A 869  ? O VAL A 866  
T 1 2 N VAL A 877  ? N VAL A 874  O LEU A 884  ? O LEU A 881  
T 2 3 N ILE A 887  ? N ILE A 884  O THR A 890  ? O THR A 887  
T 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
U 1 2 N LYS A 918  ? N LYS A 915  O VAL A 926  ? O VAL A 923  
U 2 3 N GLY A 927  ? N GLY A 924  O LEU A 934  ? O LEU A 931  
U 3 4 N ALA A 937  ? N ALA A 934  O GLU A 946  ? O GLU A 943  
V 1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
V 2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
V 3 4 N GLN A 981  ? N GLN A 978  O GLN A 996  ? O GLN A 993  
# 
_database_PDB_matrix.entry_id          3I7H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I7H 
_atom_sites.fract_transf_matrix[1][1]   0.015660 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007527 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005440 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 23.195  25.253 10.155  1.00 99.41  ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 22.060  25.370 9.187   1.00 99.41  ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 21.022  26.391 9.680   1.00 99.41  ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 19.823  26.256 9.401   1.00 99.41  ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 21.409  23.992 8.961   1.00 107.98 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 20.908  23.713 7.525   1.00 107.98 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 19.818  22.254 7.350   1.00 107.98 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 20.776  20.922 8.112   1.00 107.98 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.495  27.417 10.397  1.00 79.78  ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.612  28.422 11.031  1.00 79.78  ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.826  29.843 10.545  1.00 79.78  ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.943  30.387 10.599  1.00 79.78  ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 20.783  28.429 12.540  1.00 51.21  ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 22.127  28.734 12.879  1.00 51.21  ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.731  30.447 10.095  1.00 64.54  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.771  31.798 9.558   1.00 64.54  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 18.632  32.609 10.171  1.00 64.54  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 17.466  32.401 9.846   1.00 64.54  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.708  31.786 8.015   1.00 116.36 ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.592  30.743 7.335   1.00 116.36 ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.956  30.639 7.633   1.00 116.36 ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 20.062  29.868 6.388   1.00 116.36 ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.763  29.678 7.022   1.00 116.36 ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.862  28.907 5.765   1.00 116.36 ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 22.211  28.817 6.086   1.00 116.36 ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 23.002  27.868 5.473   1.00 116.36 ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.994  33.514 11.076  1.00 68.95  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 18.032  34.300 11.826  1.00 68.95  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 18.129  35.799 11.612  1.00 68.95  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 19.155  36.321 11.170  1.00 68.95  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 18.184  34.015 13.301  1.00 55.87  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 17.730  32.633 13.673  1.00 55.87  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 16.533  32.326 13.632  1.00 55.87  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 18.684  31.787 14.078  1.00 55.87  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 17.048  36.481 11.971  1.00 50.74  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.880  37.897 11.683  1.00 50.74  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 16.140  38.601 12.834  1.00 50.74  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 15.107  38.109 13.300  1.00 50.74  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 16.125  38.046 10.363  1.00 42.26  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 16.038  39.457 9.885   1.00 42.26  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.997  39.996 9.024   1.00 42.26  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.998  40.267 10.292  1.00 42.26  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 16.916  41.329 8.573   1.00 42.26  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.900  41.577 9.842   1.00 42.26  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 15.854  42.098 8.992   1.00 42.26  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 15.691  43.399 8.600   1.00 42.26  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.694  39.718 13.310  1.00 48.07  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 16.123  40.441 14.455  1.00 48.07  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 16.028  41.923 14.177  1.00 48.07  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 17.036  42.617 13.964  1.00 48.07  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 16.838  40.168 15.865  1.00 44.20  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 17.110  38.697 16.086  1.00 44.20  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 18.134  40.958 16.042  1.00 44.20  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.801  42.407 14.177  1.00 62.27  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.565  43.821 13.986  1.00 62.27  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 14.005  44.356 15.282  1.00 62.27  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 13.240  43.640 15.939  1.00 62.27  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.493  44.070 12.919  1.00 39.58  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 13.967  45.129 11.963  1.00 39.58  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 13.159  42.798 12.191  1.00 39.58  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 14.361  45.587 15.661  1.00 30.54  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 13.600  46.235 16.721  1.00 30.54  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 12.190  46.534 16.233  1.00 30.54  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 11.987  46.953 15.081  1.00 30.54  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 14.162  47.560 17.136  1.00 12.31  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 15.322  47.370 17.976  1.00 12.31  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 13.045  48.414 17.854  1.00 12.31  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 11.216  46.316 17.115  1.00 42.71  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.824   46.612 16.795  1.00 42.71  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 9.380   47.860 17.538  1.00 42.71  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.545   48.603 17.054  1.00 42.71  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 8.937   45.430 17.126  1.00 18.47  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 9.950   48.079 18.717  1.00 36.35  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.724   49.293 19.478  1.00 36.35  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 11.007  49.570 20.216  1.00 36.35  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 11.543  48.682 20.836  1.00 36.35  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.523   49.147 20.444  1.00 30.79  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.442   50.162 21.628  1.00 30.79  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 8.303   51.612 21.185  1.00 30.79  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 7.279   51.998 20.632  1.00 30.79  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 9.334   52.408 21.417  1.00 30.79  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 11.524  50.794 20.122  1.00 27.29  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.782  51.113 20.785  1.00 27.29  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 12.528  51.114 22.278  1.00 27.29  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 11.371  51.163 22.707  1.00 27.29  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 13.334  52.430 20.291  1.00 48.05  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.791  52.349 18.850  1.00 48.05  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 14.532  53.611 18.400  1.00 48.05  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 13.785  54.882 18.870  1.00 48.05  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 14.456  56.147 18.448  1.00 48.05  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.599  50.972 23.076  1.00 22.15  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.582  51.014 24.558  1.00 22.15  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 13.038  52.307 25.069  1.00 22.15  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 13.565  53.356 24.722  1.00 22.15  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 15.059  50.935 24.929  1.00 29.10  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.661  50.265 23.800  1.00 29.10  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 14.942  50.682 22.569  1.00 29.10  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 12.018  52.228 25.908  1.00 21.01  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 11.371  53.421 26.405  1.00 21.01  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.734  53.707 27.839  1.00 21.01  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 11.446  54.774 28.330  1.00 21.01  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 9.878   53.282 26.358  1.00 23.18  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 9.479   52.270 27.308  1.00 23.18  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 9.427   52.913 24.966  1.00 23.18  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 12.306  52.756 28.550  1.00 25.82  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 12.802  53.087 29.881  1.00 25.82  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 14.039  53.993 29.798  1.00 25.82  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 14.769  53.969 28.824  1.00 25.82  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 13.096  51.851 30.658  1.00 12.42  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 14.240  54.804 30.823  1.00 31.24  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 15.331  55.755 30.886  1.00 31.24  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 16.314  55.309 31.925  1.00 31.24  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 15.966  55.126 33.100  1.00 31.24  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.876  57.142 31.333  1.00 21.00  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 16.103  58.010 31.572  1.00 21.00  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 14.003  57.763 30.294  1.00 21.00  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 17.564  55.217 31.508  1.00 26.79  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 18.612  54.721 32.371  1.00 26.79  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 19.481  55.809 32.970  1.00 26.79  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 20.202  55.579 33.917  1.00 26.79  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 19.446  53.717 31.589  1.00 21.42  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 18.697  52.421 31.333  1.00 21.42  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 17.745  52.077 32.065  1.00 21.42  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 19.105  51.695 30.284  1.00 21.42  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 19.408  57.006 32.414  1.00 20.55  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 20.181  58.122 32.934  1.00 20.55  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.813  59.386 32.235  1.00 20.55  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 19.256  59.367 31.136  1.00 20.55  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 20.092  60.500 32.885  1.00 34.21  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.786  61.812 32.320  1.00 34.21  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.675  62.826 32.998  1.00 34.21  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 20.878  62.789 34.206  1.00 34.21  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 18.288  62.176 32.395  1.00 39.60  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.502  62.189 34.028  1.00 39.60  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 21.240  63.707 32.193  1.00 44.83  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 22.154  64.709 32.670  1.00 44.83  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.795  66.024 32.001  1.00 44.83  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 21.382  66.062 30.847  1.00 44.83  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 23.578  64.257 32.359  1.00 39.09  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 24.525  65.394 32.308  1.00 39.09  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.036  63.299 33.417  1.00 39.09  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 21.931  67.098 32.759  1.00 32.02  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.659  68.469 32.300  1.00 32.02  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 22.961  69.275 31.997  1.00 32.02  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 24.037  68.929 32.486  1.00 32.02  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 20.766  69.139 33.358  1.00 31.41  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 19.527  69.535 32.757  1.00 31.41  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 21.452  70.264 34.118  1.00 31.41  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 22.894  70.317 31.172  1.00 46.94  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 24.085  71.155 30.925  1.00 46.94  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 24.097  71.868 29.584  1.00 46.94  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 23.087  71.898 28.876  1.00 46.94  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 25.245  72.439 29.218  1.00 46.22  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 25.335  73.297 28.025  1.00 46.22  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 26.249  72.682 26.954  1.00 46.22  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 27.440  72.989 26.867  1.00 46.22  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 25.792  74.715 28.417  1.00 44.95  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 25.162  75.237 29.668  1.00 44.95  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.790  75.179 30.894  1.00 44.95  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 23.964  75.825 29.888  1.00 44.95  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 25.004  75.708 31.817  1.00 44.95  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.888  76.106 31.231  1.00 44.95  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.678  71.818 26.131  1.00 34.26  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 26.473  70.928 25.291  1.00 34.26  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 26.199  71.192 23.829  1.00 34.26  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.943  70.774 22.944  1.00 34.26  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 26.107  69.486 25.657  1.00 33.04  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 26.414  68.466 24.594  1.00 33.04  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 27.693  67.926 24.473  1.00 33.04  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 25.409  68.024 23.730  1.00 33.04  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 27.979  66.976 23.509  1.00 33.04  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.678  67.076 22.751  1.00 33.04  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 26.971  66.540 22.647  1.00 33.04  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 25.103  71.884 23.592  1.00 62.59  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 24.670  72.204 22.266  1.00 62.59  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 25.331  73.521 21.869  1.00 62.59  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.847  73.672 20.751  1.00 62.59  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 23.141  72.289 22.260  1.00 45.09  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 22.631  71.552 21.146  1.00 45.09  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 22.653  73.717 22.222  1.00 45.09  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 25.313  74.456 22.815  1.00 74.88  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.972  75.740 22.717  1.00 74.88  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 25.990  76.255 24.138  1.00 74.88  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 25.128  75.878 24.923  1.00 74.88  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 25.159  76.696 21.856  1.00 80.13  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 23.994  77.083 22.557  1.00 80.13  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 26.961  77.111 24.462  1.00 58.37  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 27.070  77.728 25.791  1.00 58.37  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 25.856  78.592 26.114  1.00 58.37  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 25.524  78.791 27.274  1.00 58.37  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 28.332  78.545 25.882  1.00 27.70  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 25.192  79.077 25.076  1.00 102.03 ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 24.036  79.939 25.233  1.00 102.03 ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.737  79.141 25.394  1.00 102.03 ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 21.642  79.688 25.249  1.00 102.03 ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 23.948  80.922 24.052  1.00 142.57 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 24.457  80.370 22.717  1.00 142.57 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 24.555  81.427 21.634  1.00 142.57 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 23.497  81.859 21.129  1.00 142.57 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 25.689  81.817 21.279  1.00 142.57 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 22.867  77.857 25.722  1.00 56.85  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.742  76.910 25.726  1.00 56.85  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.751  76.024 26.962  1.00 56.85  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.814  75.743 27.521  1.00 56.85  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.848  75.976 24.527  1.00 57.63  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 21.000  76.399 23.350  1.00 57.63  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 21.089  75.699 22.318  1.00 57.63  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 20.246  77.393 23.433  1.00 57.63  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 20.566  75.562 27.364  1.00 52.10  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 20.447  74.523 28.398  1.00 52.10  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.902  73.213 27.841  1.00 52.10  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.803  73.164 27.284  1.00 52.10  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 19.573  74.972 29.568  1.00 31.64  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 19.485  73.896 30.654  1.00 31.64  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 20.895  73.645 31.252  1.00 31.64  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 18.455  74.248 31.743  1.00 31.64  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 20.658  72.143 27.995  1.00 51.86  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 20.196  70.885 27.450  1.00 51.86  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.757  69.918 28.540  1.00 51.86  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 20.208  70.012 29.702  1.00 51.86  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 21.273  70.228 26.582  1.00 56.07  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.877  71.172 25.572  1.00 56.07  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 21.283  71.455 24.520  1.00 56.07  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 23.089  71.651 25.874  1.00 56.07  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.860  69.008 28.156  1.00 42.71  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.655  67.771 28.896  1.00 42.71  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 19.100  66.592 28.019  1.00 42.71  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 18.687  66.464 26.838  1.00 42.71  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 17.196  67.627 29.361  1.00 41.07  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.810  66.315 30.057  1.00 41.07  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 17.202  66.272 31.526  1.00 41.07  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 15.325  66.000 29.890  1.00 41.07  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 19.963  65.752 28.584  1.00 39.15  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 20.409  64.558 27.871  1.00 39.15  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 19.878  63.324 28.536  1.00 39.15  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 20.132  63.086 29.701  1.00 39.15  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 21.932  64.480 27.767  1.00 55.76  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.606  65.203 26.590  1.00 55.76  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 22.603  66.739 26.738  1.00 55.76  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 24.026  64.714 26.417  1.00 55.76  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 19.152  62.525 27.775  1.00 28.00  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 18.527  61.309 28.241  1.00 28.00  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 19.265  60.114 27.720  1.00 28.00  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 19.569  60.074 26.574  1.00 28.00  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 17.102  61.249 27.795  1.00 44.42  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 16.422  62.554 28.080  1.00 44.42  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 16.348  60.269 28.587  1.00 44.42  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 15.058  62.357 28.507  1.00 44.42  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 19.555  59.154 28.589  1.00 23.70  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 20.209  57.920 28.211  1.00 23.70  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 19.211  56.799 28.129  1.00 23.70  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 18.284  56.683 28.873  1.00 23.70  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 21.276  57.559 29.120  1.00 3.07   ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 19.348  55.944 27.142  1.00 34.57  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 18.362  54.907 26.941  1.00 34.57  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 19.285  53.798 27.316  1.00 34.57  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 19.715  53.741 28.428  1.00 34.57  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 17.294  55.377 25.993  1.00 30.61  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 16.313  56.300 26.623  1.00 30.61  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 15.087  56.397 25.837  1.00 30.61  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 14.129  57.286 26.510  1.00 30.61  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 12.893  57.394 25.748  1.00 30.61  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 19.624  52.932 26.381  1.00 46.23  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 20.327  51.710 26.698  1.00 46.23  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 21.301  52.193 25.670  1.00 46.23  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 22.329  52.694 25.992  1.00 46.23  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 19.429  50.643 26.094  1.00 25.35  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 20.021  49.280 26.186  1.00 25.35  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 20.555  48.926 27.173  1.00 25.35  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 19.912  48.523 25.161  1.00 25.35  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 20.973  52.027 24.415  1.00 29.28  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 21.913  52.306 23.389  1.00 29.28  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 21.619  53.616 22.734  1.00 29.28  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 22.236  53.962 21.786  1.00 29.28  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 21.905  51.207 22.378  1.00 32.79  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 20.569  50.883 22.056  1.00 32.79  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 22.451  50.037 22.966  1.00 32.79  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 20.688  54.372 23.263  1.00 42.57  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 20.345  55.646 22.672  1.00 42.57  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 20.557  56.873 23.575  1.00 42.57  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 20.288  56.842 24.733  1.00 42.57  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 18.924  55.588 22.139  1.00 56.68  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 18.726  54.652 20.977  1.00 56.68  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 18.545  55.417 19.714  1.00 56.68  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 18.788  54.626 18.523  1.00 56.68  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 18.642  55.106 17.300  1.00 56.68  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 18.237  56.338 17.128  1.00 56.68  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 18.882  54.361 16.251  1.00 56.68  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 21.084  57.934 22.993  1.00 25.94  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 21.281  59.235 23.599  1.00 25.94  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 20.259  60.206 23.007  1.00 25.94  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 20.203  60.389 21.795  1.00 25.94  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 22.727  59.704 23.334  1.00 21.35  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 23.202  61.170 23.514  1.00 21.35  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 22.304  61.991 24.415  1.00 21.35  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 24.645  61.268 24.027  1.00 21.35  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 19.429  60.803 23.848  1.00 41.68  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 18.418  61.731 23.368  1.00 41.68  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 18.829  63.123 23.783  1.00 41.68  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 19.204  63.334 24.922  1.00 41.68  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 17.033  61.396 23.924  1.00 31.52  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 16.284  60.275 23.210  1.00 31.52  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 14.904  60.042 23.816  1.00 31.52  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 14.535  60.757 24.760  1.00 31.52  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 14.160  59.137 23.375  1.00 31.52  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 18.775  64.076 22.859  1.00 47.20  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 19.269  65.417 23.155  1.00 47.20  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 18.205  66.532 23.018  1.00 47.20  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 17.629  66.740 21.942  1.00 47.20  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 20.525  65.734 22.349  1.00 30.47  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 21.470  64.538 22.347  1.00 30.47  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 21.235  66.884 22.981  1.00 30.47  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.896  64.798 21.842  1.00 30.47  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 17.965  67.242 24.122  1.00 25.86  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.915  68.248 24.179  1.00 25.86  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 17.455  69.627 24.525  1.00 25.86  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 18.516  69.750 25.164  1.00 25.86  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 15.854  67.870 25.229  1.00 22.11  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 15.136  66.594 24.914  1.00 22.11  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 15.772  65.355 25.084  1.00 22.11  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.832  66.611 24.458  1.00 22.11  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 15.135  64.156 24.799  1.00 22.11  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 13.192  65.430 24.154  1.00 22.11  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 13.856  64.204 24.329  1.00 22.11  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 13.227  63.032 24.011  1.00 22.11  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 16.707  70.653 24.117  1.00 39.80  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.959  72.015 24.553  1.00 39.80  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.814  72.394 25.474  1.00 39.80  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.646  72.305 25.081  1.00 39.80  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 17.034  72.985 23.360  1.00 52.67  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 16.961  74.438 23.830  1.00 52.67  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 18.324  72.738 22.565  1.00 52.67  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 16.143  72.769 26.704  1.00 42.66  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 15.165  73.275 27.636  1.00 42.66  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 14.674  74.639 27.146  1.00 42.66  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 15.491  75.521 26.826  1.00 42.66  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 15.817  73.466 28.994  1.00 66.26  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 14.807  73.981 30.001  1.00 66.26  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 16.422  72.161 29.458  1.00 66.26  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 13.354  74.832 27.089  1.00 73.14  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 12.792  76.131 26.670  1.00 73.14  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 11.596  76.623 27.498  1.00 73.14  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 11.337  76.152 28.614  1.00 73.14  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 12.366  76.134 25.178  1.00 54.03  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 11.331  75.161 24.961  1.00 54.03  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 13.543  75.853 24.267  1.00 54.03  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.877  77.582 26.920  1.00 92.37  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 9.716   78.165 27.547  1.00 92.37  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 8.542   77.181 27.529  1.00 92.37  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.986   76.863 28.582  1.00 92.37  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 9.359   79.475 26.859  1.00 87.45  ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 8.175   76.680 26.350  1.00 94.02  ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 7.020   75.781 26.258  1.00 94.02  ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.340   74.388 26.801  1.00 94.02  ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.430   73.592 27.065  1.00 94.02  ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.470   75.703 24.826  1.00 153.73 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 5.007   75.213 24.744  1.00 153.73 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 4.445   75.171 23.321  1.00 153.73 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 4.424   76.229 22.636  1.00 153.73 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 4.003   74.074 22.895  1.00 153.73 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.636   74.110 26.970  1.00 113.29 ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 9.115   72.834 27.524  1.00 113.29 ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.492  72.402 27.035  1.00 113.29 ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.473  73.131 27.174  1.00 113.29 ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 10.563  71.194 26.485  1.00 44.22  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.789  70.674 25.893  1.00 44.22  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.629  70.487 24.372  1.00 44.22  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.688  69.852 23.901  1.00 44.22  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 12.150  69.316 26.509  1.00 69.27  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 12.390  69.075 27.999  1.00 69.27  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 11.329  69.716 28.853  1.00 69.27  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 12.415  67.579 28.249  1.00 69.27  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.566  71.023 23.606  1.00 50.54  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.526  70.874 22.173  1.00 50.54  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.653  69.938 21.812  1.00 50.54  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 14.789  70.162 22.218  1.00 50.54  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 12.632  72.239 21.490  1.00 99.02  ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 11.306  73.018 21.587  1.00 99.02  ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 11.460  74.542 21.599  1.00 99.02  ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 10.376  75.184 22.356  1.00 99.02  ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 10.140  76.497 22.379  1.00 99.02  ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 10.914  77.325 21.676  1.00 99.02  ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 9.134   76.986 23.110  1.00 99.02  ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 13.336  68.858 21.080  1.00 42.59  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 14.330  67.850 20.772  1.00 42.59  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 15.185  68.294 19.618  1.00 42.59  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 14.647  68.746 18.624  1.00 42.59  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 13.476  66.653 20.337  1.00 88.71  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 12.251  67.250 19.748  1.00 88.71  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 12.018  68.538 20.493  1.00 88.71  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 16.497  68.150 19.712  1.00 47.45  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 17.340  68.520 18.573  1.00 47.45  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 17.970  67.341 17.823  1.00 47.45  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 18.081  67.375 16.600  1.00 47.45  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 18.399  69.540 18.972  1.00 32.72  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 17.785  70.528 19.969  1.00 32.72  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 19.650  68.853 19.577  1.00 32.72  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 18.361  66.296 18.548  1.00 49.82  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 19.129  65.196 17.952  1.00 49.82  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 19.020  63.864 18.708  1.00 49.82  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 19.259  63.793 19.912  1.00 49.82  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 20.603  65.612 17.841  1.00 46.63  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 21.515  64.554 17.228  1.00 46.63  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 21.660  64.732 15.712  1.00 46.63  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 20.454  64.206 14.917  1.00 46.63  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 20.463  62.705 14.823  1.00 46.63  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 18.677  62.803 17.994  1.00 48.66  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 18.668  61.460 18.602  1.00 48.66  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 19.622  60.476 17.886  1.00 48.66  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 19.410  60.097 16.728  1.00 48.66  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 17.242  60.932 18.701  1.00 57.78  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 17.061  59.788 19.618  1.00 57.78  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.866  58.528 18.852  1.00 57.78  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 16.757  57.438 19.454  1.00 57.78  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.816  58.630 17.614  1.00 57.78  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 20.673  60.078 18.605  1.00 62.04  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 21.749  59.250 18.063  1.00 62.04  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 21.853  57.851 18.665  1.00 62.04  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 21.640  57.657 19.870  1.00 62.04  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 23.071  59.920 18.306  1.00 50.78  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 23.273  61.003 17.270  1.00 50.78  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 23.103  60.485 19.728  1.00 50.78  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 22.212  56.892 17.815  1.00 75.34  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 22.416  55.508 18.224  1.00 75.34  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 23.858  55.174 18.555  1.00 75.34  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 24.797  55.711 17.963  1.00 75.34  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 24.030  54.284 19.524  1.00 38.23  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 25.351  53.705 19.821  1.00 38.23  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 25.387  52.199 19.859  1.00 38.23  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 24.386  51.520 20.103  1.00 38.23  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 25.972  54.274 21.075  1.00 36.62  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 26.310  55.699 20.847  1.00 36.62  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 27.089  56.441 22.263  1.00 36.62  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 28.641  55.494 22.225  1.00 36.62  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 26.590  51.720 19.581  1.00 46.00  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 26.906  50.326 19.443  1.00 46.00  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 27.432  49.856 20.785  1.00 46.00  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 28.566  49.341 20.897  1.00 46.00  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 27.963  50.180 18.366  1.00 44.60  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 27.413  50.233 16.976  1.00 44.60  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 26.039  50.188 16.740  1.00 44.60  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 28.272  50.273 15.880  1.00 44.60  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 25.528  50.205 15.448  1.00 44.60  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 27.776  50.301 14.576  1.00 44.60  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 26.403  50.264 14.362  1.00 44.60  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 25.925  50.284 13.064  1.00 44.60  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 26.579  50.040 21.797  1.00 39.16  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 26.963  49.873 23.184  1.00 39.16  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 25.835  50.315 24.073  1.00 39.16  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 24.976  51.076 23.671  1.00 39.16  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 25.824  49.808 25.285  1.00 26.92  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 24.874  50.244 26.261  1.00 26.92  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 25.539  51.383 27.038  1.00 26.92  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 26.555  51.160 27.674  1.00 26.92  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 24.536  49.093 27.224  1.00 31.59  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 24.004  47.804 26.573  1.00 31.59  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 23.665  46.731 27.628  1.00 31.59  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 22.361  47.119 28.319  1.00 31.59  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 22.122  46.530 29.667  1.00 31.59  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 24.965  52.582 27.011  1.00 34.25  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 25.447  53.699 27.851  1.00 34.25  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 25.378  53.461 29.371  1.00 34.25  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 24.313  53.272 29.902  1.00 34.25  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 24.693  54.992 27.534  1.00 22.37  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.830  55.318 26.070  1.00 22.37  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 25.282  56.135 28.283  1.00 22.37  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 24.008  56.482 25.651  1.00 22.37  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 26.514  53.549 30.052  1.00 22.58  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 26.684  53.151 31.452  1.00 22.58  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 27.296  54.295 32.204  1.00 22.58  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 27.330  54.285 33.448  1.00 22.58  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 27.657  51.997 31.552  1.00 2.38   ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 27.871  55.243 31.466  1.00 40.66  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 28.346  56.480 32.060  1.00 40.66  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 28.096  57.565 31.083  1.00 40.66  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 28.425  57.430 29.901  1.00 40.66  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 29.819  56.466 32.348  1.00 22.24  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 30.203  57.769 33.031  1.00 22.24  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 30.195  55.229 33.244  1.00 22.24  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 27.511  58.652 31.567  1.00 30.62  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 27.163  59.772 30.703  1.00 30.62  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 27.432  61.046 31.478  1.00 30.62  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 26.679  61.361 32.374  1.00 30.62  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.702  59.638 30.295  1.00 32.99  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 25.162  60.728 29.455  1.00 32.99  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.456  60.413 28.985  1.00 32.99  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 22.544  60.784 30.458  1.00 32.99  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 28.518  61.757 31.180  1.00 37.90  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 28.811  63.038 31.879  1.00 37.90  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 29.320  64.184 30.996  1.00 37.90  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 30.191  63.978 30.174  1.00 37.90  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 29.742  62.820 33.072  1.00 81.61  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 29.040  62.270 34.318  1.00 81.61  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 27.859  63.142 34.813  1.00 81.61  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 26.816  62.557 35.195  1.00 81.61  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 27.963  64.396 34.832  1.00 81.61  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.749  65.378 31.168  1.00 49.09  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 29.212  66.597 30.476  1.00 49.09  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 30.275  67.299 31.292  1.00 49.09  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 30.191  67.317 32.511  1.00 49.09  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 28.078  67.595 30.323  1.00 32.31  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 26.854  67.281 29.478  1.00 32.31  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.668  68.112 29.970  1.00 32.31  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 27.135  67.566 28.028  1.00 32.31  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 31.248  67.912 30.626  1.00 41.09  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 32.309  68.678 31.308  1.00 41.09  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 32.873  69.746 30.388  1.00 41.09  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 32.820  69.578 29.164  1.00 41.09  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 33.423  67.742 31.790  1.00 50.95  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 34.107  66.955 30.688  1.00 50.95  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 35.486  67.023 30.528  1.00 50.95  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 33.378  66.128 29.828  1.00 50.95  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 36.118  66.303 29.538  1.00 50.95  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 34.000  65.398 28.830  1.00 50.95  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 35.369  65.486 28.678  1.00 50.95  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.392  70.844 30.946  1.00 35.87  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 34.180  71.800 30.111  1.00 35.87  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.684  71.844 30.468  1.00 35.87  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 36.080  72.393 31.489  1.00 35.87  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 33.513  73.190 29.938  1.00 86.59  ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 33.176  73.961 31.218  1.00 86.59  ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 31.735  74.518 31.225  1.00 86.59  ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 30.774  73.471 31.594  1.00 86.59  ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 29.559  73.668 32.111  1.00 86.59  ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 29.116  74.896 32.343  1.00 86.59  ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 28.779  72.625 32.403  1.00 86.59  ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.533  71.227 29.633  1.00 57.60  ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 37.984  71.384 29.887  1.00 57.60  ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 38.495  72.769 29.468  1.00 57.60  ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 38.048  73.316 28.459  1.00 57.60  ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 38.633  70.287 29.040  1.00 46.39  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 37.568  69.866 28.019  1.00 46.39  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 36.227  70.393 28.455  1.00 46.39  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 39.424  73.308 30.257  1.00 70.04  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 39.936  74.695 30.147  1.00 70.04  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 40.159  75.160 28.714  1.00 70.04  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 40.783  74.459 27.930  1.00 70.04  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 41.227  74.851 30.967  1.00 93.24  ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 41.966  73.529 31.236  1.00 93.24  ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 41.298  72.731 32.376  1.00 93.24  ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 41.333  71.225 32.134  1.00 93.24  ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 42.600  70.627 32.643  1.00 93.24  ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.630  76.335 28.384  1.00 73.32  ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 39.690  76.874 27.017  1.00 73.32  ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.833  76.097 26.022  1.00 73.32  ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 39.309  75.685 24.949  1.00 73.32  ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 37.565  75.888 26.385  1.00 82.86  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 36.626  75.119 25.561  1.00 82.86  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 35.284  75.809 25.455  1.00 82.86  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.654  76.122 26.464  1.00 82.86  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 36.437  73.718 26.123  1.00 86.69  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 37.508  72.748 25.708  1.00 86.69  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 37.299  72.236 24.308  1.00 86.69  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 36.687  72.962 23.488  1.00 86.69  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 37.750  71.104 24.028  1.00 86.69  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.857  76.030 24.218  1.00 56.54  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 33.644  76.771 23.915  1.00 56.54  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 32.436  76.334 24.799  1.00 56.54  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 31.932  77.112 25.631  1.00 56.54  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 33.336  76.606 22.417  1.00 50.90  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 32.123  77.253 22.072  1.00 50.90  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 32.001  75.080 24.618  1.00 58.99  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.842  74.522 25.299  1.00 58.99  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 31.197  73.272 26.071  1.00 58.99  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 32.373  72.962 26.251  1.00 58.99  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.767  74.203 24.278  1.00 42.58  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 30.273  73.794 22.923  1.00 42.58  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 29.118  73.870 21.908  1.00 42.58  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 29.399  72.999 20.677  1.00 42.58  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 30.538  73.427 19.756  1.00 42.58  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 30.173  72.563 26.546  1.00 44.15  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 30.370  71.293 27.251  1.00 44.15  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.770  70.213 26.286  1.00 44.15  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 30.230  70.110 25.165  1.00 44.15  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 29.104  70.857 27.970  1.00 69.37  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 28.988  71.466 29.321  1.00 69.37  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 27.858  71.586 29.852  1.00 69.37  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 30.054  71.828 29.853  1.00 69.37  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.724  69.411 26.721  1.00 58.28  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 32.065  68.199 26.023  1.00 58.28  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 31.360  67.012 26.726  1.00 58.28  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.967  67.105 27.907  1.00 58.28  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 33.579  68.067 26.037  1.00 58.42  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 34.310  67.903 24.702  1.00 58.42  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 33.789  68.836 23.607  1.00 58.42  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 35.783  68.134 24.957  1.00 58.42  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 31.173  65.909 26.006  1.00 37.95  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 30.407  64.770 26.559  1.00 37.95  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 31.241  63.519 26.813  1.00 37.95  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 31.980  63.077 25.939  1.00 37.95  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 29.207  64.422 25.663  1.00 35.48  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 28.390  63.211 26.117  1.00 35.48  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 27.614  63.548 27.391  1.00 35.48  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 27.460  62.681 25.028  1.00 35.48  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 31.112  62.936 28.004  1.00 50.00  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 31.738  61.631 28.250  1.00 50.00  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 30.811  60.429 28.383  1.00 50.00  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 29.902  60.415 29.207  1.00 50.00  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 32.625  61.629 29.459  1.00 42.07  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 33.316  60.339 29.638  1.00 42.07  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 34.119  59.846 28.626  1.00 42.07  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 33.151  59.600 30.795  1.00 42.07  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.760  58.648 28.766  1.00 42.07  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 33.792  58.399 30.965  1.00 42.07  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 34.607  57.913 29.947  1.00 42.07  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 31.092  59.402 27.590  1.00 31.63  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 30.248  58.215 27.553  1.00 31.63  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 31.110  56.981 27.718  1.00 31.63  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 32.123  56.843 27.046  1.00 31.63  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 29.450  58.151 26.235  1.00 23.21  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 28.324  59.193 26.280  1.00 23.21  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 28.906  56.762 25.986  1.00 23.21  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 27.039  58.802 25.475  1.00 23.21  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 30.744  56.119 28.650  1.00 37.25  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 31.390  54.839 28.750  1.00 37.25  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 30.338  53.783 28.486  1.00 37.25  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 29.291  53.734 29.127  1.00 37.25  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 32.072  54.643 30.110  1.00 26.84  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 32.548  53.213 30.441  1.00 26.84  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 33.607  52.728 29.482  1.00 26.84  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 33.050  53.041 31.879  1.00 26.84  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 30.631  52.943 27.514  1.00 19.93  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 29.786  51.829 27.191  1.00 19.93  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 29.956  50.642 28.193  1.00 19.93  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 31.014  50.481 28.791  1.00 19.93  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 30.098  51.431 25.781  1.00 21.35  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 28.901  51.495 25.002  1.00 21.35  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 30.683  50.050 25.732  1.00 21.35  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 28.912  49.834 28.373  1.00 34.75  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 28.951  48.665 29.274  1.00 34.75  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 29.988  47.577 28.939  1.00 34.75  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 30.467  46.922 29.845  1.00 34.75  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 27.607  48.041 29.343  1.00 37.37  ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 30.274  47.361 27.648  1.00 31.28  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 31.380  46.537 27.151  1.00 31.28  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.738  47.277 27.187  1.00 31.28  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.732  46.832 26.577  1.00 31.28  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 31.120  46.104 25.697  1.00 24.74  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 30.517  44.694 25.460  1.00 24.74  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.607  44.760 24.227  1.00 24.74  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 29.775  43.609 23.267  1.00 24.74  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 29.270  42.364 23.852  1.00 24.74  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.784  48.411 27.872  1.00 34.46  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 34.065  49.021 28.215  1.00 34.46  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 34.655  49.997 27.166  1.00 34.46  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 35.745  50.558 27.367  1.00 34.46  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 35.046  47.932 28.704  1.00 28.65  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 34.599  47.371 30.036  1.00 28.65  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 34.180  46.044 30.175  1.00 28.65  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 34.562  48.201 31.164  1.00 28.65  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 33.768  45.551 31.400  1.00 28.65  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 34.127  47.725 32.380  1.00 28.65  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 33.730  46.396 32.495  1.00 28.65  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 33.278  45.987 33.750  1.00 28.65  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 33.880  50.243 26.105  1.00 75.86  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 34.151  51.304 25.130  1.00 75.86  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 33.953  52.689 25.766  1.00 75.86  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 32.849  53.019 26.192  1.00 75.86  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 33.242  51.194 23.880  1.00 84.45  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 33.155  49.762 23.288  1.00 84.45  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 33.590  49.519 22.154  1.00 84.45  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 32.560  48.832 24.039  1.00 84.45  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 35.038  53.471 25.842  1.00 43.18  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 35.033  54.886 26.236  1.00 43.18  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 35.069  55.810 25.032  1.00 43.18  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 35.357  55.380 23.916  1.00 43.18  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 36.218  55.181 27.101  1.00 26.54  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 34.779  57.087 25.265  1.00 31.29  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 34.866  58.111 24.228  1.00 31.29  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 34.370  59.431 24.744  1.00 31.29  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 33.436  59.452 25.563  1.00 31.29  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 34.038  57.744 22.984  1.00 50.02  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 32.238  57.640 23.221  1.00 50.02  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 34.990  60.510 24.235  1.00 56.67  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 34.545  61.907 24.377  1.00 56.67  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 33.928  62.404 23.077  1.00 56.67  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 34.516  62.258 22.014  1.00 56.67  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 35.715  62.864 24.655  1.00 27.97  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 36.479  62.468 25.912  1.00 27.97  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 35.218  64.304 24.832  1.00 27.97  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 37.754  63.223 26.127  1.00 27.97  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 32.762  63.030 23.183  1.00 51.86  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 32.042  63.555 22.027  1.00 51.86  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 31.797  65.057 22.077  1.00 51.86  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 31.681  65.651 23.165  1.00 51.86  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 30.689  62.880 21.902  1.00 45.54  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 30.654  61.370 22.009  1.00 45.54  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 29.229  60.965 21.836  1.00 45.54  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 31.487  60.775 20.915  1.00 45.54  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 31.719  65.639 20.875  1.00 40.09  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 31.365  67.040 20.654  1.00 40.09  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 30.156  67.232 19.740  1.00 40.09  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 30.009  66.540 18.745  1.00 40.09  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 32.542  67.839 20.113  1.00 59.52  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 32.311  69.312 20.321  1.00 59.52  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 33.115  70.198 19.413  1.00 59.52  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 34.191  69.753 18.932  1.00 59.52  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.658  71.349 19.211  1.00 59.52  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 29.299  68.183 20.096  1.00 83.32  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 28.167  68.551 19.260  1.00 83.32  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 28.625  69.635 18.303  1.00 83.32  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 29.089  70.687 18.739  1.00 83.32  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 27.026  69.072 20.135  1.00 64.81  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 25.739  69.410 19.399  1.00 64.81  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 24.812  68.418 19.084  1.00 64.81  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 25.436  70.739 19.044  1.00 64.81  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 23.641  68.727 18.426  1.00 64.81  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 24.258  71.057 18.379  1.00 64.81  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 23.368  70.044 18.075  1.00 64.81  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 22.194  70.340 17.422  1.00 64.81  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 28.527  69.369 17.005  1.00 86.39  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 28.934  70.356 16.006  1.00 86.39  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 27.836  70.574 14.989  1.00 86.39  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 27.638  69.741 14.101  1.00 86.39  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 30.228  69.945 15.290  1.00 96.32  ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 30.751  71.012 14.308  1.00 96.32  ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.721  70.430 13.274  1.00 96.32  ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 33.176  70.455 13.761  1.00 96.32  ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 34.046  69.429 13.098  1.00 96.32  ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 27.144  71.705 15.111  1.00 78.96  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 26.055  72.036 14.194  1.00 78.96  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 26.485  72.799 12.940  1.00 78.96  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 25.647  73.361 12.255  1.00 78.96  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 24.943  72.787 14.921  1.00 99.09  ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.607  72.739 14.191  1.00 99.09  ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.448  72.530 15.133  1.00 99.09  ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 22.200  73.338 16.037  1.00 99.09  ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.730  71.428 14.935  1.00 99.09  ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 27.781  72.796 12.634  1.00 114.73 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 28.317  73.476 11.447  1.00 114.73 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 27.325  73.564 10.268  1.00 114.73 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 26.799  74.647 9.981   1.00 114.73 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 29.669  72.874 11.021  1.00 143.86 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 29.585  71.475 10.817  1.00 143.86 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 27.056  72.433 9.609   1.00 77.95  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 26.061  72.385 8.527   1.00 77.95  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 24.664  72.588 9.087   1.00 77.95  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 24.430  72.269 10.252  1.00 77.95  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 23.737  73.125 8.286   1.00 87.93  ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 22.323  73.193 8.692   1.00 87.93  ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 21.890  71.804 9.145   1.00 87.93  ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 20.728  71.595 9.497   1.00 87.93  ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 21.413  73.600 7.528   1.00 97.43  ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 21.821  74.827 6.701   1.00 97.43  ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 21.059  74.916 5.366   1.00 97.43  ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 20.951  73.876 4.674   1.00 97.43  ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 20.576  76.018 5.006   1.00 97.43  ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 22.842  70.863 9.084   1.00 101.42 ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 22.693  69.462 9.499   1.00 101.42 ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 23.681  69.099 10.610  1.00 101.42 ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 24.786  69.636 10.659  1.00 101.42 ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 22.897  68.554 8.298   1.00 67.47  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 21.864  68.783 7.368   1.00 67.47  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 23.292  68.164 11.477  1.00 70.14  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 23.941  68.021 12.800  1.00 70.14  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 24.967  66.895 12.938  1.00 70.14  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 24.893  65.884 12.236  1.00 70.14  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.903  67.849 13.926  1.00 45.76  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.511  68.327 13.474  1.00 45.76  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 23.362  68.578 15.140  1.00 45.76  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 20.365  67.920 14.384  1.00 45.76  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 25.908  67.049 13.867  1.00 73.34  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 26.955  66.044 14.028  1.00 73.34  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 27.490  65.799 15.436  1.00 73.34  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 27.809  66.746 16.182  1.00 73.34  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 28.107  66.343 13.082  1.00 95.38  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 27.739  66.075 11.663  1.00 95.38  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 27.548  64.889 11.324  1.00 95.38  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 27.596  67.047 10.899  1.00 95.38  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 27.597  64.507 15.770  1.00 36.10  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 28.250  64.084 16.996  1.00 36.10  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 29.578  63.538 16.618  1.00 36.10  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 29.665  62.371 16.289  1.00 36.10  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 27.504  62.982 17.733  1.00 49.94  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 25.990  63.148 17.598  1.00 49.94  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 27.941  62.977 19.190  1.00 49.94  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 25.430  64.485 18.135  1.00 49.94  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 30.591  64.403 16.666  1.00 61.64  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 31.974  64.050 16.385  1.00 61.64  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 32.660  63.460 17.627  1.00 61.64  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 32.423  63.892 18.743  1.00 61.64  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 32.768  65.276 15.826  1.00 82.97  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 34.237  64.936 15.540  1.00 82.97  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 32.730  66.442 16.789  1.00 82.97  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 34.520  64.343 14.158  1.00 82.97  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 33.509  62.464 17.404  1.00 52.81  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 34.317  61.832 18.438  1.00 52.81  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 35.669  62.505 18.645  1.00 52.81  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 36.638  62.123 17.989  1.00 52.81  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 34.621  60.412 17.987  1.00 32.63  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 33.388  59.781 17.613  1.00 32.63  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 35.366  59.602 19.057  1.00 32.63  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 35.744  63.472 19.565  1.00 57.67  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 37.029  64.086 19.974  1.00 57.67  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 38.100  63.100 20.425  1.00 57.67  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 39.289  63.330 20.172  1.00 57.67  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 36.835  65.091 21.101  1.00 40.09  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 36.093  66.321 20.693  1.00 40.09  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 36.951  67.243 19.859  1.00 40.09  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 36.879  68.620 20.340  1.00 40.09  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.612  69.077 21.356  1.00 40.09  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 38.457  68.259 21.980  1.00 40.09  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.502  70.343 21.753  1.00 40.09  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 37.688  62.042 21.125  1.00 42.34  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 38.606  60.978 21.559  1.00 42.34  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 37.845  59.696 21.691  1.00 42.34  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 36.610  59.717 21.612  1.00 42.34  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 39.230  61.320 22.861  1.00 26.82  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 38.568  58.587 21.870  1.00 51.82  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 37.966  57.247 22.084  1.00 51.82  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 39.025  56.177 22.306  1.00 51.82  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 40.189  56.428 22.066  1.00 51.82  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 37.082  56.817 20.911  1.00 61.95  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 37.845  56.199 19.786  1.00 61.95  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 38.596  56.944 18.898  1.00 61.95  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 37.973  54.906 19.400  1.00 61.95  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 39.148  56.135 18.011  1.00 61.95  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 38.786  54.894 18.294  1.00 61.95  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 38.592  54.986 22.727  1.00 51.64  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 39.462  53.870 23.090  1.00 51.64  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 38.799  52.972 24.129  1.00 51.64  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 38.025  53.454 24.965  1.00 51.64  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 39.111  51.670 24.087  1.00 35.59  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 38.480  50.677 24.948  1.00 35.59  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 39.198  50.420 26.300  1.00 35.59  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 40.341  49.960 26.325  1.00 35.59  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 38.281  49.381 24.163  1.00 35.29  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 37.459  48.366 24.934  1.00 35.29  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.819  48.000 26.062  1.00 35.29  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 36.326  47.933 24.360  1.00 35.29  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 38.505  50.647 27.420  1.00 29.01  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 39.143  50.621 28.763  1.00 29.01  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 38.966  49.303 29.548  1.00 29.01  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 39.162  49.255 30.787  1.00 29.01  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.754  51.879 29.651  1.00 38.47  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 38.836  53.156 28.847  1.00 38.47  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 37.349  51.766 30.215  1.00 38.47  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 38.603  48.236 28.838  1.00 74.68  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 38.613  46.868 29.374  1.00 74.68  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 39.887  46.557 30.181  1.00 74.68  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 40.930  47.180 29.960  1.00 74.68  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 38.592  45.934 28.191  1.00 77.46  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.787  44.703 28.341  1.00 77.46  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.500  44.118 26.986  1.00 77.46  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 38.408  43.933 26.178  1.00 77.46  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 36.232  43.868 26.705  1.00 77.46  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.817  45.603 31.108  1.00 67.09  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 41.045  45.030 31.664  1.00 67.09  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 40.976  43.529 31.701  1.00 67.09  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 40.035  42.953 32.225  1.00 67.09  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 41.354  45.550 33.060  1.00 42.46  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 41.776  46.999 33.061  1.00 42.46  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 42.811  47.370 32.469  1.00 42.46  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 41.060  47.788 33.679  1.00 42.46  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 41.989  42.892 31.141  1.00 70.28  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 42.116  41.449 31.214  1.00 70.28  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 41.928  40.955 32.653  1.00 70.28  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 41.460  39.848 32.882  1.00 70.28  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 43.496  41.041 30.694  1.00 106.21 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 43.660  39.554 30.415  1.00 106.21 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 42.609  39.057 29.438  1.00 106.21 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 42.633  37.603 29.313  1.00 106.21 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 41.735  36.895 28.632  1.00 106.21 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 40.727  37.509 28.017  1.00 106.21 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 41.842  35.571 28.565  1.00 106.21 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 42.281  41.788 33.622  1.00 71.68  ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 42.228  41.388 35.025  1.00 71.68  ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 40.961  41.950 35.687  1.00 71.68  ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 40.181  42.657 35.028  1.00 71.68  ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 43.493  41.866 35.796  1.00 63.23  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 44.637  42.224 34.829  1.00 63.23  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 43.931  40.820 36.783  1.00 63.23  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 44.693  43.727 34.410  1.00 63.23  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 40.743  41.611 36.968  1.00 32.47  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 39.713  42.286 37.806  1.00 32.47  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 38.245  41.929 37.594  1.00 32.47  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 37.693  42.038 36.484  1.00 32.47  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 37.607  41.508 38.676  1.00 50.20  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 36.184  41.191 38.626  1.00 50.20  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 35.294  42.453 38.638  1.00 50.20  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 35.600  43.428 39.346  1.00 50.20  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 35.805  40.258 39.776  1.00 79.66  ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 35.807  40.908 41.129  1.00 79.66  ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 35.869  39.870 42.192  1.00 79.66  ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 37.083  40.089 42.970  1.00 79.66  ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 37.135  40.670 44.166  1.00 79.66  ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 36.020  41.086 44.765  1.00 79.66  ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 38.315  40.815 44.771  1.00 79.66  ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 34.180  42.418 37.865  1.00 40.16  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 33.179  43.474 37.863  1.00 40.16  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 32.668  43.698 39.278  1.00 40.16  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 32.154  42.808 39.932  1.00 40.16  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 32.062  42.918 36.984  1.00 38.69  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.635  41.836 36.252  1.00 38.69  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 33.798  41.310 36.978  1.00 38.69  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 32.860  44.915 39.726  1.00 39.09  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 32.566  45.343 41.048  1.00 39.09  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 31.059  45.278 41.252  1.00 39.09  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 30.296  45.495 40.315  1.00 39.09  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 33.054  46.782 41.145  1.00 50.24  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 33.596  47.055 42.417  1.00 50.24  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 30.611  44.983 42.468  1.00 90.58  ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 29.187  45.084 42.736  1.00 90.58  ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 28.840  46.510 43.081  1.00 90.58  ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 29.550  47.157 43.865  1.00 90.58  ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 28.750  44.175 43.857  1.00 66.54  ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 27.246  44.065 43.903  1.00 66.54  ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 26.713  43.630 45.253  1.00 66.54  ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 25.488  43.378 45.335  1.00 66.54  ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 27.509  43.538 46.219  1.00 66.54  ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 27.709  46.946 42.528  1.00 41.01  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 27.258  48.365 42.389  1.00 41.01  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 27.730  48.950 41.078  1.00 41.01  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 27.467  50.120 40.804  1.00 41.01  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 27.634  49.402 43.510  1.00 45.47  ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 29.031  49.702 43.460  1.00 45.47  ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 27.232  48.955 44.895  1.00 45.47  ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 28.461  48.154 40.305  1.00 33.19  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 28.728  48.457 38.897  1.00 33.19  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 29.786  49.490 38.536  1.00 33.19  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 30.470  50.075 39.412  1.00 33.19  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 29.911  49.684 37.216  1.00 32.29  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 30.763  50.728 36.646  1.00 32.29  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 30.354  52.046 37.267  1.00 32.29  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 29.197  52.350 37.274  1.00 32.29  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 30.600  50.854 35.086  1.00 26.19  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 31.229  49.708 34.360  1.00 26.19  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 31.355  52.029 34.536  1.00 26.19  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 30.259  48.728 33.956  1.00 26.19  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 31.297  52.806 37.793  1.00 50.19  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 31.054  54.200 38.133  1.00 50.19  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 32.036  55.085 37.378  1.00 50.19  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 33.221  54.774 37.323  1.00 50.19  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 31.262  54.456 39.612  1.00 20.93  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 30.327  53.593 40.428  1.00 20.93  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 31.009  55.877 39.902  1.00 20.93  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 30.781  53.408 41.831  1.00 20.93  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 31.549  56.188 36.813  1.00 34.84  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 32.401  57.133 36.080  1.00 34.84  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 32.337  58.516 36.694  1.00 34.84  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 31.265  59.003 36.958  1.00 34.84  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 33.465  59.153 36.954  1.00 32.57  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 33.440  60.419 37.691  1.00 32.57  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 34.493  61.374 37.121  1.00 32.57  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 35.463  60.937 36.509  1.00 32.57  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 33.627  60.222 39.244  1.00 25.46  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 34.985  59.616 39.543  1.00 25.46  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 32.533  59.353 39.846  1.00 25.46  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 35.241  59.393 41.015  1.00 25.46  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 34.311  62.676 37.297  1.00 42.78  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 35.265  63.607 36.723  1.00 42.78  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 35.528  64.694 37.724  1.00 42.78  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 34.585  65.269 38.254  1.00 42.78  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 34.768  64.198 35.366  1.00 23.90  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 34.813  63.148 34.264  1.00 23.90  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 35.651  65.343 34.899  1.00 23.90  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 34.070  63.557 33.073  1.00 23.90  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.819  64.950 37.973  1.00 61.20  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 37.311  66.008 38.872  1.00 61.20  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.814  67.404 38.441  1.00 61.20  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 36.699  67.699 37.249  1.00 61.20  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 38.855  65.924 38.996  1.00 83.73  ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 39.552  67.294 38.916  1.00 83.73  ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 39.581  68.050 39.920  1.00 83.73  ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 40.097  67.605 37.836  1.00 83.73  ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 36.501  68.262 39.421  1.00 38.47  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 35.961  69.573 39.084  1.00 38.47  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 36.914  70.416 38.207  1.00 38.47  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 36.451  71.225 37.387  1.00 38.47  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 35.742  70.217 40.451  1.00 56.72  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 35.692  69.071 41.423  1.00 56.72  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 36.629  68.077 40.879  1.00 56.72  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 38.216  70.198 38.359  1.00 41.01  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 39.211  70.858 37.536  1.00 41.01  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 39.357  70.231 36.143  1.00 41.01  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 40.310  70.551 35.434  1.00 41.01  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 40.574  70.815 38.229  1.00 88.18  ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 40.900  71.962 39.181  1.00 88.18  ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 42.258  71.753 39.859  1.00 88.18  ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 42.593  70.584 40.189  1.00 88.18  ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 43.001  72.744 40.055  1.00 88.18  ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.440  69.362 35.731  1.00 44.87  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.601  68.631 34.465  1.00 44.87  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 40.062  68.211 34.217  1.00 44.87  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 40.570  68.286 33.090  1.00 44.87  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 38.079  69.449 33.291  1.00 75.21  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 36.473  70.123 33.600  1.00 75.21  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.753  67.798 35.274  1.00 59.58  ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 42.122  67.330 35.125  1.00 59.58  ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 42.065  65.880 34.698  1.00 59.58  ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.915  65.407 33.950  1.00 59.58  ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 42.910  67.471 36.433  1.00 81.14  ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 43.498  68.856 36.671  1.00 81.14  ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 44.549  68.866 37.806  1.00 81.14  ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.833  68.249 37.421  1.00 81.14  ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 46.781  67.837 38.274  1.00 81.14  ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 46.637  67.961 39.594  1.00 81.14  ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 47.891  67.289 37.803  1.00 81.14  ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 41.042  65.171 35.164  1.00 71.38  ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 41.001  63.731 34.953  1.00 71.38  ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 39.659  63.066 35.113  1.00 71.38  ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 38.741  63.585 35.749  1.00 71.38  ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 41.971  63.042 35.899  1.00 55.84  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 41.725  63.352 37.340  1.00 55.84  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 42.517  62.088 38.310  1.00 55.84  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 44.189  62.741 38.336  1.00 55.84  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 39.597  61.886 34.522  1.00 25.55  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 38.503  60.943 34.689  1.00 25.55  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 38.904  59.751 35.593  1.00 25.55  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 39.940  59.101 35.372  1.00 25.55  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 38.108  60.340 33.379  1.00 39.95  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 37.915  61.429 32.343  1.00 39.95  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 36.855  59.585 33.567  1.00 39.95  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 37.225  60.961 31.054  1.00 39.95  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 38.095  59.482 36.613  1.00 42.19  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 38.277  58.315 37.426  1.00 42.19  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 37.189  57.315 37.094  1.00 42.19  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 35.997  57.646 37.101  1.00 42.19  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 37.600  56.089 36.788  1.00 43.48  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 36.669  55.000 36.621  1.00 43.48  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 36.843  54.012 37.760  1.00 43.48  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 37.949  53.852 38.244  1.00 43.48  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 36.958  54.300 35.324  1.00 21.58  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 36.454  54.872 34.012  1.00 21.58  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 36.481  56.399 33.949  1.00 21.58  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 37.297  54.284 32.893  1.00 21.58  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 35.750  53.377 38.189  1.00 41.74  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 35.791  52.250 39.089  1.00 41.74  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 35.093  51.062 38.428  1.00 41.74  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 33.952  50.769 38.740  1.00 41.74  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 35.110  52.594 40.397  1.00 32.49  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 35.441  51.672 41.594  1.00 32.49  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 34.972  50.216 41.482  1.00 32.49  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 33.533  50.094 41.232  1.00 32.49  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 32.591  49.903 42.168  1.00 32.49  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 32.945  49.783 43.446  1.00 32.49  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 31.297  49.806 41.821  1.00 32.49  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 35.792  50.364 37.534  1.00 37.39  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 35.227  49.238 36.792  1.00 37.39  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 35.220  47.895 37.536  1.00 37.39  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 34.360  47.050 37.257  1.00 37.39  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 35.987  49.053 35.485  1.00 25.73  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 36.356  50.305 34.695  1.00 25.73  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 37.291  49.964 33.583  1.00 25.73  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 35.111  50.887 34.113  1.00 25.73  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 36.175  47.690 38.451  1.00 43.33  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 36.466  46.370 39.036  1.00 43.33  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 36.977  46.478 40.457  1.00 43.33  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 37.612  47.461 40.836  1.00 43.33  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 37.600  45.683 38.289  1.00 33.20  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 37.498  45.566 36.792  1.00 33.20  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 38.402  46.259 35.956  1.00 33.20  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 36.525  44.739 36.199  1.00 33.20  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 38.335  46.145 34.555  1.00 33.20  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 36.451  44.610 34.817  1.00 33.20  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 37.366  45.307 33.996  1.00 33.20  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 37.279  45.161 32.627  1.00 33.20  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 36.773  45.430 41.237  1.00 27.86  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 37.235  45.417 42.616  1.00 27.86  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 38.761  45.485 42.713  1.00 27.86  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 39.473  44.753 42.000  1.00 27.86  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 36.677  44.197 43.328  1.00 60.61  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 35.252  44.391 43.710  1.00 60.61  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 34.937  45.517 44.138  1.00 60.61  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 34.440  43.457 43.576  1.00 60.61  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 39.251  46.371 43.577  1.00 37.63  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 40.670  46.533 43.809  1.00 37.63  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 41.356  47.481 42.843  1.00 37.63  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 42.522  47.802 43.011  1.00 37.63  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 40.656  47.969 41.839  1.00 45.69  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 41.354  48.709 40.816  1.00 45.69  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 40.687  50.050 40.465  1.00 45.69  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 39.505  50.109 40.102  1.00 45.69  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 41.469  47.824 39.579  1.00 23.02  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 42.516  46.717 39.474  1.00 23.02  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 41.989  45.695 38.490  1.00 23.02  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 43.942  47.200 39.036  1.00 23.02  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 41.454  51.125 40.560  1.00 53.60  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 40.939  52.424 40.191  1.00 53.60  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 41.714  52.946 38.992  1.00 53.60  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 42.889  53.312 39.116  1.00 53.60  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 41.008  53.390 41.381  1.00 30.24  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 40.381  54.773 41.116  1.00 30.24  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 39.001  54.923 40.951  1.00 30.24  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 41.178  55.931 41.073  1.00 30.24  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 38.431  56.175 40.719  1.00 30.24  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 40.609  57.202 40.870  1.00 30.24  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 39.236  57.321 40.694  1.00 30.24  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 41.051  52.973 37.836  1.00 57.03  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 41.659  53.396 36.572  1.00 57.03  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 41.609  54.916 36.388  1.00 57.03  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 40.591  55.552 36.648  1.00 57.03  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 40.977  52.689 35.393  1.00 23.53  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 41.733  52.798 34.093  1.00 23.53  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 41.097  52.014 32.944  1.00 23.53  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 41.651  50.598 32.878  1.00 23.53  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 41.682  50.035 31.500  1.00 23.53  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 42.715  55.494 35.939  1.00 53.71  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 42.812  56.932 35.761  1.00 53.71  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 43.107  57.261 34.303  1.00 53.71  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 43.947  56.618 33.664  1.00 53.71  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 43.909  57.557 36.681  1.00 40.33  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 43.918  59.067 36.570  1.00 40.33  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 43.692  57.174 38.158  1.00 40.33  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 42.399  58.261 33.788  1.00 60.25  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 42.691  58.847 32.494  1.00 60.25  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 42.995  60.324 32.671  1.00 60.25  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 42.147  61.078 33.159  1.00 60.25  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 41.509  58.711 31.554  1.00 44.76  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 41.428  57.283 31.043  1.00 44.76  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 41.627  59.676 30.392  1.00 44.76  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 40.024  56.750 30.882  1.00 44.76  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 44.208  60.752 32.271  1.00 37.59  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 44.529  62.183 32.305  1.00 37.59  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 43.857  62.921 31.146  1.00 37.59  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 43.679  62.353 30.073  1.00 37.59  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 46.061  62.205 32.174  1.00 53.64  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 46.508  60.762 32.199  1.00 53.64  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 45.341  59.958 31.767  1.00 53.64  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 43.500  64.177 31.366  1.00 68.70  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 42.626  64.884 30.433  1.00 68.70  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 43.254  65.796 29.367  1.00 68.70  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 42.682  65.935 28.286  1.00 68.70  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 41.503  65.596 31.198  1.00 49.68  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 40.055  65.136 30.964  1.00 49.68  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 39.875  63.779 30.255  1.00 49.68  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 39.318  65.183 32.269  1.00 49.68  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 44.394  66.421 29.676  1.00 64.72  ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 45.194  67.239 28.721  1.00 64.72  ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.988  66.959 27.215  1.00 64.72  ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 44.822  65.810 26.810  1.00 64.72  ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 46.687  67.144 29.067  1.00 87.56  ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 47.117  65.724 29.374  1.00 87.56  ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 47.203  64.906 28.434  1.00 87.56  ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 47.350  65.424 30.562  1.00 87.56  ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 45.079  68.025 26.413  1.00 95.24  ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 44.554  68.119 25.027  1.00 95.24  ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 44.862  66.972 24.024  1.00 95.24  ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 44.187  66.848 22.994  1.00 95.24  ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 44.919  69.493 24.432  1.00 109.04 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 43.782  70.217 23.690  1.00 109.04 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 43.830  69.947 22.184  1.00 109.04 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 43.149  70.953 21.356  1.00 109.04 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 43.657  72.139 21.004  1.00 109.04 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 44.858  72.529 21.424  1.00 109.04 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 42.951  72.951 20.233  1.00 109.04 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 45.865  66.147 24.312  1.00 89.16  ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 46.107  64.949 23.515  1.00 89.16  ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 45.490  63.729 24.150  1.00 89.16  ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 44.425  63.825 24.765  1.00 89.16  ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 47.588  64.752 23.305  1.00 103.93 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 48.150  65.776 22.383  1.00 103.93 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 47.407  66.206 21.467  1.00 103.93 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 49.318  66.165 22.580  1.00 103.93 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 46.145  62.577 24.001  1.00 60.03  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 45.616  61.331 24.577  1.00 60.03  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 44.308  60.899 23.843  1.00 60.03  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 43.414  60.303 24.429  1.00 60.03  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 45.420  61.543 26.097  1.00 50.01  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 45.091  60.269 26.855  1.00 50.01  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 45.148  59.162 26.322  1.00 50.01  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 44.754  60.430 28.129  1.00 50.01  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 44.221  61.204 22.545  1.00 72.61  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 43.020  60.956 21.718  1.00 72.61  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 42.648  59.475 21.580  1.00 72.61  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 41.774  59.107 20.765  1.00 72.61  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 43.191  61.585 20.326  1.00 62.26  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 42.995  63.101 20.311  1.00 62.26  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 43.088  63.687 18.896  1.00 62.26  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 42.359  65.024 18.791  1.00 62.26  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 42.801  65.816 17.612  1.00 62.26  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 43.335  58.631 22.359  1.00 44.02  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 42.980  57.209 22.472  1.00 44.02  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 42.661  56.841 23.906  1.00 44.02  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 42.272  55.724 24.196  1.00 44.02  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 44.075  56.312 21.924  1.00 72.68  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 44.111  56.307 20.433  1.00 72.68  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 45.520  56.251 19.939  1.00 72.68  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 46.368  57.017 20.455  1.00 72.68  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 45.787  55.433 19.040  1.00 72.68  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 42.841  57.806 24.788  1.00 38.70  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 42.549  57.648 26.179  1.00 38.70  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 43.385  56.570 26.849  1.00 38.70  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 42.875  55.792 27.688  1.00 38.70  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 41.041  57.453 26.379  1.00 45.68  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 40.262  58.677 25.896  1.00 45.68  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 38.795  58.372 25.624  1.00 45.68  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 40.413  59.814 26.878  1.00 45.68  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 44.673  56.516 26.503  1.00 70.16  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 45.592  55.644 27.223  1.00 70.16  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 45.301  55.983 28.672  1.00 70.16  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 45.184  57.168 29.024  1.00 70.16  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 47.062  55.929 26.893  1.00 96.08  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 47.491  55.646 25.458  1.00 96.08  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 48.933  56.096 25.251  1.00 96.08  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 49.114  56.875 23.954  1.00 96.08  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 49.723  56.074 22.851  1.00 96.08  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 45.127  54.938 29.483  1.00 59.45  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 44.841  55.063 30.915  1.00 59.45  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 45.891  54.351 31.780  1.00 59.45  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 46.770  53.671 31.270  1.00 59.45  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 43.448  54.502 31.203  1.00 65.25  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 45.803  54.503 33.089  1.00 43.93  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 46.553  53.622 33.963  1.00 43.93  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 45.669  53.252 35.156  1.00 43.93  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 44.731  53.983 35.461  1.00 43.93  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.886  54.264 34.391  1.00 31.53  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 47.735  55.433 35.354  1.00 31.53  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 47.720  55.219 36.765  1.00 31.53  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 47.635  56.746 34.871  1.00 31.53  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 47.583  56.308 37.681  1.00 31.53  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 47.486  57.825 35.770  1.00 31.53  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 47.471  57.605 37.193  1.00 31.53  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 45.954  52.118 35.799  1.00 36.19  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 45.300  51.698 37.028  1.00 36.19  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 46.162  52.062 38.247  1.00 36.19  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 47.379  52.193 38.121  1.00 36.19  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 45.091  50.185 37.017  1.00 72.18  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 44.148  49.724 35.932  1.00 72.18  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 44.502  48.874 35.114  1.00 72.18  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 42.936  50.259 35.928  1.00 72.18  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 45.533  52.215 39.411  1.00 37.78  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 46.210  52.337 40.688  1.00 37.78  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 45.609  51.331 41.660  1.00 37.78  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 44.389  51.340 41.844  1.00 37.78  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 45.911  53.680 41.324  1.00 23.70  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 46.345  54.826 40.418  1.00 23.70  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 46.577  53.767 42.660  1.00 23.70  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.949  56.179 40.892  1.00 23.70  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 46.408  50.492 42.325  1.00 60.20  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 45.811  49.500 43.236  1.00 60.20  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 45.011  50.197 44.323  1.00 60.20  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 45.432  51.219 44.857  1.00 60.20  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 46.833  48.557 43.866  1.00 77.84  ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 46.162  47.327 44.454  1.00 77.84  ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 46.850  46.812 45.684  1.00 77.84  ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 48.094  46.115 45.360  1.00 77.84  ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 49.142  46.011 46.182  1.00 77.84  ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 49.107  46.562 47.404  1.00 77.84  ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 50.236  45.362 45.773  1.00 77.84  ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 43.843  49.658 44.628  1.00 40.85  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.989  50.244 45.650  1.00 40.85  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 42.849  49.202 46.711  1.00 40.85  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 42.213  48.150 46.473  1.00 40.85  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 41.598  50.520 45.083  1.00 54.26  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 40.740  51.670 45.598  1.00 54.26  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 39.306  51.237 45.546  1.00 54.26  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 41.102  52.064 47.001  1.00 54.26  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 43.431  49.487 47.877  1.00 39.37  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 43.449  48.500 48.973  1.00 39.37  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 42.025  48.069 49.364  1.00 39.37  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 41.767  46.878 49.620  1.00 39.37  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 44.248  49.014 50.178  1.00 63.66  ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 45.257  48.003 50.739  1.00 63.66  ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 46.455  47.763 49.799  1.00 63.66  ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 47.474  48.478 49.906  1.00 63.66  ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 46.386  46.842 48.954  1.00 63.66  ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 41.107  49.040 49.344  1.00 55.03  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 39.692  48.841 49.672  1.00 55.03  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 38.958  47.996 48.624  1.00 55.03  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 38.357  48.515 47.659  1.00 55.03  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 39.001  50.184 49.937  1.00 51.01  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 39.385  50.860 51.298  1.00 51.01  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 40.906  51.114 51.509  1.00 51.01  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 41.492  52.043 50.925  1.00 51.01  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 41.514  50.379 52.301  1.00 51.01  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 39.138  46.678 48.814  1.00 33.94  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 38.330  45.552 48.299  1.00 33.94  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 36.883  45.823 47.787  1.00 33.94  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 36.571  45.458 46.656  1.00 33.94  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 38.307  44.466 49.396  1.00 67.55  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 38.426  44.831 50.915  1.00 67.55  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 37.538  46.024 51.362  1.00 67.55  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 38.194  43.611 51.855  1.00 67.55  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 36.006  46.435 48.601  1.00 57.13  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 34.552  46.515 48.279  1.00 57.13  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 33.919  47.939 48.317  1.00 57.13  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 33.262  48.341 49.281  1.00 57.13  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 33.796  45.518 49.166  1.00 70.88  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 32.318  45.464 48.931  1.00 70.88  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 31.750  45.554 47.678  1.00 70.88  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 31.289  45.282 49.793  1.00 70.88  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 30.434  45.457 47.782  1.00 70.88  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 30.128  45.289 49.055  1.00 70.88  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 34.104  48.683 47.235  1.00 36.22  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 33.651  50.074 47.138  1.00 36.22  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 32.160  50.308 46.758  1.00 36.22  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 31.691  49.878 45.697  1.00 36.22  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 34.560  50.875 46.191  1.00 28.82  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 33.908  52.171 45.765  1.00 28.82  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 35.851  51.163 46.876  1.00 28.82  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 31.445  51.031 47.629  1.00 47.42  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 30.009  51.292 47.439  1.00 47.42  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 29.678  52.468 46.507  1.00 47.42  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 28.889  52.299 45.575  1.00 47.42  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 29.268  51.422 48.784  1.00 26.30  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 28.705  50.061 49.243  1.00 26.30  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 28.082  52.328 48.636  1.00 26.30  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 29.715  49.053 49.569  1.00 26.30  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 30.270  53.638 46.776  1.00 27.77  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 30.150  54.813 45.906  1.00 27.77  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 31.423  55.705 45.931  1.00 27.77  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 32.191  55.668 46.924  1.00 27.77  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 28.885  55.629 46.245  1.00 37.05  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 28.496  56.578 45.127  1.00 37.05  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.980  56.362 43.989  1.00 37.05  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 27.729  57.544 45.356  1.00 37.05  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 31.660  56.471 44.843  1.00 33.82  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 32.761  57.469 44.805  1.00 33.82  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 32.440  58.777 44.091  1.00 33.82  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 31.825  58.766 43.034  1.00 33.82  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 34.036  56.978 44.064  1.00 29.38  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 35.269  57.507 44.753  1.00 29.38  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 34.083  55.508 43.961  1.00 29.38  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 32.907  59.890 44.654  1.00 36.10  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 33.020  61.154 43.942  1.00 36.10  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 34.373  61.793 44.226  1.00 36.10  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 35.020  61.461 45.227  1.00 36.10  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 31.933  62.123 44.383  1.00 42.33  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 30.734  62.165 43.479  1.00 42.33  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.537  61.522 44.134  1.00 42.33  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.685  60.766 43.151  1.00 42.33  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 28.280  61.642 42.015  1.00 42.33  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 34.797  62.707 43.351  1.00 64.06  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 35.868  63.663 43.656  1.00 64.06  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 35.336  64.828 44.485  1.00 64.06  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 34.211  65.277 44.273  1.00 64.06  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 36.378  64.278 42.377  1.00 36.79  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 37.259  63.400 41.591  1.00 36.79  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.774  62.756 40.446  1.00 36.79  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 38.605  63.217 41.969  1.00 36.79  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 37.620  61.924 39.654  1.00 36.79  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 39.469  62.395 41.191  1.00 36.79  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 38.966  61.753 40.015  1.00 36.79  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 36.151  65.358 45.389  1.00 39.81  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 35.738  66.516 46.173  1.00 39.81  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 36.087  67.857 45.532  1.00 39.81  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 37.087  68.005 44.822  1.00 39.81  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 36.324  66.464 47.568  1.00 30.77  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 35.812  65.325 48.447  1.00 30.77  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 36.749  65.161 49.657  1.00 30.77  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 34.365  65.527 48.895  1.00 30.77  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 35.236  68.841 45.800  1.00 48.20  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 35.435  70.186 45.316  1.00 48.20  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 36.358  70.894 46.297  1.00 48.20  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 36.384  70.545 47.492  1.00 48.20  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 34.091  70.908 45.288  1.00 48.19  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 33.203  70.585 44.109  1.00 48.19  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 32.133  69.692 44.238  1.00 48.19  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 33.408  71.205 42.867  1.00 48.19  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 31.305  69.409 43.137  1.00 48.19  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 32.611  70.938 41.782  1.00 48.19  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 31.562  70.041 41.914  1.00 48.19  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.756  69.784 40.824  1.00 48.19  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 37.087  71.894 45.804  1.00 82.18  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 37.868  72.779 46.671  1.00 82.18  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 39.146  72.132 47.147  1.00 82.18  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 39.645  72.418 48.240  1.00 82.18  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 39.670  71.258 46.298  1.00 95.24  ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 40.861  70.489 46.588  1.00 95.24  ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 42.062  71.012 45.819  1.00 95.24  ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 41.942  71.363 44.641  1.00 95.24  ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 40.604  69.036 46.225  1.00 51.92  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 39.859  68.107 47.564  1.00 51.92  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 43.221  71.048 46.478  1.00 64.49  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 44.445  71.537 45.838  1.00 64.49  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 45.172  70.415 45.112  1.00 64.49  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 46.337  70.528 44.767  1.00 64.49  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 45.356  72.223 46.855  1.00 98.00  ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 44.777  73.510 47.442  1.00 98.00  ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 45.564  74.007 48.640  1.00 98.00  ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 45.707  73.303 49.645  1.00 98.00  ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 46.083  75.229 48.538  1.00 98.00  ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.444  69.329 44.892  1.00 63.42  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.851  68.188 44.075  1.00 63.42  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 43.573  67.378 43.855  1.00 63.42  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 42.650  67.449 44.668  1.00 63.42  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 45.917  67.326 44.812  1.00 21.06  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 43.507  66.584 42.784  1.00 52.21  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 42.301  65.774 42.736  1.00 52.21  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 42.205  64.977 44.044  1.00 52.21  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 43.234  64.509 44.557  1.00 52.21  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.561  64.835 41.555  1.00 52.93  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.515  65.562 40.705  1.00 52.93  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 44.411  66.298 41.662  1.00 52.93  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 41.006  64.850 44.603  1.00 45.73  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 40.848  64.034 45.811  1.00 45.73  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 39.578  63.228 45.808  1.00 45.73  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 38.456  63.752 45.805  1.00 45.73  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.871  64.854 47.111  1.00 34.81  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 41.964  65.795 47.079  1.00 34.81  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 40.986  63.928 48.300  1.00 34.81  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 39.775  61.931 45.844  1.00 51.69  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 38.685  61.023 45.753  1.00 51.69  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 38.013  60.812 47.119  1.00 51.69  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 38.655  60.915 48.171  1.00 51.69  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 39.197  59.752 45.117  1.00 42.51  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 38.172  59.245 44.141  1.00 42.51  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 39.636  58.718 46.124  1.00 42.51  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 38.280  59.956 42.833  1.00 42.51  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 36.715  60.551 47.110  1.00 30.05  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 36.019  60.373 48.346  1.00 30.05  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 35.009  59.246 48.247  1.00 30.05  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 34.026  59.357 47.517  1.00 30.05  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 35.332  61.658 48.772  1.00 36.52  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 34.373  61.350 50.287  1.00 36.52  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 35.226  58.175 49.009  1.00 34.72  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 34.411  56.970 48.853  1.00 34.72  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 33.912  56.292 50.138  1.00 34.72  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 34.434  56.500 51.237  1.00 34.72  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 35.129  55.943 47.962  1.00 33.21  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 36.372  55.361 48.573  1.00 33.21  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 36.337  54.135 49.198  1.00 33.21  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 37.589  56.036 48.497  1.00 33.21  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 37.520  53.577 49.776  1.00 33.21  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 38.777  55.496 49.051  1.00 33.21  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 38.742  54.267 49.700  1.00 33.21  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 32.873  55.491 49.966  1.00 50.18  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 32.345  54.680 51.029  1.00 50.18  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 32.662  53.262 50.645  1.00 50.18  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 32.289  52.793 49.557  1.00 50.18  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 30.804  54.861 51.188  1.00 52.96  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 30.179  53.724 52.017  1.00 52.96  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 30.488  56.222 51.805  1.00 52.96  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 33.364  52.573 51.532  1.00 39.87  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 33.683  51.173 51.278  1.00 39.87  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 33.155  50.287 52.375  1.00 39.87  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 32.913  50.741 53.486  1.00 39.87  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 35.178  50.999 51.122  1.00 51.20  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 35.972  51.274 52.368  1.00 51.20  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 36.287  50.247 53.253  1.00 51.20  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 36.433  52.551 52.655  1.00 51.20  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 37.041  50.485 54.393  1.00 51.20  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 37.194  52.808 53.797  1.00 51.20  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 37.490  51.764 54.653  1.00 51.20  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 38.240  51.990 55.761  1.00 51.20  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 32.979  49.020 52.041  1.00 79.44  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 32.589  48.029 53.014  1.00 79.44  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 33.731  47.047 53.313  1.00 79.44  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 34.511  46.666 52.437  1.00 79.44  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 31.350  47.305 52.527  1.00 46.14  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 30.525  46.657 53.605  1.00 46.14  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 29.449  45.750 53.012  1.00 46.14  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 28.580  46.197 52.260  1.00 46.14  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 29.521  44.452 53.328  1.00 46.14  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 33.838  46.691 54.582  1.00 60.55  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 34.710  45.638 55.046  1.00 60.55  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 33.999  44.988 56.246  1.00 60.55  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 32.900  45.435 56.645  1.00 60.55  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 36.106  46.192 55.389  1.00 67.10  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 36.117  47.101 56.601  1.00 67.10  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 35.155  47.089 57.378  1.00 67.10  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 37.104  47.837 56.797  1.00 67.10  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 34.580  43.911 56.819  1.00 92.56  ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 34.027  43.527 58.136  1.00 92.56  ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 33.288  44.387 59.153  1.00 92.56  ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 32.147  44.071 59.474  1.00 92.56  ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 34.886  42.341 58.573  1.00 41.54  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 35.767  41.998 57.410  1.00 41.54  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 35.676  43.035 56.356  1.00 41.54  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 33.925  45.440 59.660  1.00 54.91  ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 33.357  46.268 60.753  1.00 54.91  ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 32.328  47.326 60.342  1.00 54.91  ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 32.115  48.320 61.066  1.00 54.91  ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 34.758  46.904 60.767  1.00 61.50  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 35.689  46.346 61.840  1.00 61.50  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 37.072  46.045 61.291  1.00 61.50  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 38.013  46.820 61.481  1.00 61.50  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 37.198  44.918 60.585  1.00 61.50  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 31.710  47.099 59.178  1.00 72.27  ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 30.776  48.039 58.581  1.00 72.27  ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 31.433  48.845 57.482  1.00 72.27  ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 32.393  48.396 56.861  1.00 72.27  ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 30.918  50.052 57.268  1.00 57.66  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 31.276  50.893 56.134  1.00 57.66  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 31.894  52.201 56.594  1.00 57.66  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 31.503  52.771 57.605  1.00 57.66  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 30.023  51.206 55.332  1.00 43.78  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 29.241  49.971 54.904  1.00 43.78  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 28.050  50.319 54.011  1.00 43.78  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 27.561  49.128 53.328  1.00 43.78  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 26.742  49.148 52.276  1.00 43.78  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 26.301  50.305 51.778  1.00 43.78  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 26.339  48.006 51.726  1.00 43.78  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 32.856  52.694 55.839  1.00 62.47  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 33.567  53.898 56.242  1.00 62.47  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 33.800  54.800 55.031  1.00 62.47  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 33.803  54.341 53.877  1.00 62.47  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 34.909  53.542 56.926  1.00 50.58  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 34.928  52.188 57.578  1.00 50.58  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 34.880  52.017 58.945  1.00 50.58  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 34.980  50.943 57.045  1.00 50.58  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 34.900  50.725 59.224  1.00 50.58  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 34.960  50.052 58.087  1.00 50.58  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 33.982  56.084 55.301  1.00 30.50  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 34.294  57.034 54.256  1.00 30.50  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 35.765  57.406 54.389  1.00 30.50  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 36.255  57.616 55.507  1.00 30.50  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 33.395  58.285 54.311  1.00 29.25  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 33.369  58.920 55.717  1.00 29.25  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 33.808  59.294 53.231  1.00 29.25  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 36.469  57.473 53.253  1.00 47.01  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.923  57.661 53.219  1.00 47.01  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 38.281  58.532 52.016  1.00 47.01  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 37.528  58.563 51.043  1.00 47.01  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 38.606  56.287 53.132  1.00 57.17  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 40.128  56.324 53.156  1.00 57.17  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 40.729  54.915 53.177  1.00 57.17  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 42.259  54.958 53.324  1.00 57.17  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 42.867  53.603 53.307  1.00 57.17  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 39.418  59.231 52.090  1.00 40.84  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 39.917  60.066 50.977  1.00 40.84  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 41.279  59.595 50.429  1.00 40.84  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 42.035  58.909 51.130  1.00 40.84  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 40.029  61.523 51.420  1.00 47.55  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 40.714  61.561 52.668  1.00 47.55  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 38.654  62.131 51.630  1.00 47.55  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 41.558  59.916 49.165  1.00 45.05  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.888  59.725 48.564  1.00 45.05  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 43.147  60.812 47.554  1.00 45.05  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 42.286  61.099 46.731  1.00 45.05  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 43.011  58.433 47.761  1.00 47.98  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 43.085  57.130 48.495  1.00 47.98  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 42.317  56.062 48.077  1.00 47.98  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 43.925  56.940 49.575  1.00 47.98  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 42.360  54.846 48.732  1.00 47.98  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 43.970  55.718 50.239  1.00 47.98  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 43.188  54.679 49.805  1.00 47.98  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 43.207  53.452 50.416  1.00 47.98  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 44.340  61.388 47.578  1.00 50.14  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 44.750  62.300 46.525  1.00 50.14  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 45.166  61.490 45.268  1.00 50.14  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 45.701  60.385 45.375  1.00 50.14  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 45.880  63.219 47.032  1.00 75.03  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 45.483  64.053 48.276  1.00 75.03  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 46.442  65.204 48.630  1.00 75.03  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 47.274  65.591 47.779  1.00 75.03  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 46.340  65.732 49.766  1.00 75.03  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 44.912  62.006 44.072  1.00 56.48  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 45.449  61.286 42.910  1.00 56.48  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 46.693  61.963 42.343  1.00 56.48  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 46.609  63.061 41.784  1.00 56.48  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 44.395  60.940 41.774  1.00 35.96  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 45.075  60.189 40.676  1.00 35.96  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 43.274  60.071 42.314  1.00 35.96  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 47.843  61.311 42.512  1.00 59.25  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 49.065  61.814 41.928  1.00 59.25  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 49.225  61.166 40.582  1.00 59.25  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 49.780  60.073 40.474  1.00 59.25  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 50.283  61.536 42.805  1.00 123.66 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 51.460  62.000 42.159  1.00 123.66 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.720  61.838 39.554  1.00 69.08  ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 48.842  61.350 38.180  1.00 69.08  ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 50.279  61.442 37.697  1.00 69.08  ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 50.629  60.812 36.702  1.00 69.08  ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 47.882  62.079 37.226  1.00 65.69  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 47.847  63.617 37.102  1.00 65.69  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 46.650  64.059 36.220  1.00 65.69  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 47.871  64.384 38.476  1.00 65.69  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 51.094  62.220 38.421  1.00 88.01  ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 52.529  62.342 38.163  1.00 88.01  ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 53.264  61.029 38.409  1.00 88.01  ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 54.097  60.626 37.605  1.00 88.01  ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 53.141  63.470 39.016  1.00 92.55  ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 54.710  63.600 38.965  1.00 92.55  ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 55.236  64.080 37.509  1.00 92.55  ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 54.156  64.920 36.905  1.00 92.55  ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 54.369  65.895 36.016  1.00 92.55  ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 55.635  66.201 35.602  1.00 92.55  ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 53.299  66.578 35.549  1.00 92.55  ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 52.953  60.371 39.522  1.00 51.50  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 53.644  59.136 39.902  1.00 51.50  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 52.707  57.958 40.125  1.00 51.50  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 53.163  56.862 40.451  1.00 51.50  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 54.515  59.356 41.125  1.00 86.11  ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 53.733  59.562 42.381  1.00 86.11  ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 54.501  60.370 43.379  1.00 86.11  ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 54.195  60.273 44.588  1.00 86.11  ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 55.413  61.111 42.946  1.00 86.11  ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 51.408  58.195 39.931  1.00 58.15  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 50.393  57.131 39.860  1.00 58.15  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 50.068  56.442 41.187  1.00 58.15  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 49.539  55.326 41.201  1.00 58.15  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 50.771  56.090 38.792  1.00 49.99  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 51.048  56.744 37.462  1.00 49.99  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 51.411  55.769 36.384  1.00 49.99  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 51.778  56.554 35.138  1.00 49.99  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 51.432  55.758 33.957  1.00 49.99  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 50.386  57.101 42.296  1.00 45.83  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 50.070  56.569 43.617  1.00 45.83  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 48.685  57.095 43.959  1.00 45.83  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 47.992  57.650 43.076  1.00 45.83  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 51.086  57.050 44.657  1.00 95.12  ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 52.550  56.736 44.349  1.00 95.12  ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 53.513  57.399 45.331  1.00 95.12  ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 53.133  57.589 46.512  1.00 95.12  ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 54.652  57.727 44.919  1.00 95.12  ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 48.302  56.910 45.228  1.00 83.18  ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 47.098  57.489 45.827  1.00 83.18  ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 47.440  58.524 46.903  1.00 83.18  ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 46.569  59.281 47.349  1.00 83.18  ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 46.235  56.398 46.479  1.00 88.18  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 45.103  55.897 45.622  1.00 88.18  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 44.861  54.535 45.506  1.00 88.18  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 44.265  56.774 44.950  1.00 88.18  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 43.811  54.053 44.726  1.00 88.18  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 43.216  56.300 44.168  1.00 88.18  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 42.992  54.937 44.059  1.00 88.18  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 48.700  58.539 47.335  1.00 80.34  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 49.139  59.359 48.482  1.00 80.34  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 48.229  59.275 49.687  1.00 80.34  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 47.605  58.243 49.923  1.00 80.34  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 49.329  60.817 48.091  1.00 72.04  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 50.357  60.978 47.032  1.00 72.04  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 51.205  60.101 46.840  1.00 72.04  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 50.285  62.085 46.305  1.00 72.04  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 48.174  60.346 50.465  1.00 75.43  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 47.300  60.366 51.618  1.00 75.43  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 46.047  61.088 51.151  1.00 75.43  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 45.992  61.532 50.003  1.00 75.43  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 47.981  61.063 52.805  1.00 79.20  ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 47.600  60.487 54.188  1.00 79.20  ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 48.279  61.239 55.367  1.00 79.20  ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 47.885  60.616 56.725  1.00 79.20  ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 47.977  61.548 57.898  1.00 79.20  ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 45.035  61.169 52.008  1.00 64.56  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 43.867  62.000 51.726  1.00 64.56  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 43.768  63.200 52.663  1.00 64.56  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 44.237  63.125 53.798  1.00 64.56  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 43.163  64.312 52.190  1.00 61.94  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 42.888  65.548 52.912  1.00 61.94  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 42.264  65.390 54.284  1.00 61.94  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 42.363  66.298 55.102  1.00 61.94  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 41.898  66.259 51.995  1.00 58.72  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 42.373  65.912 50.671  1.00 58.72  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 42.728  64.443 50.790  1.00 58.72  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 41.617  64.267 54.547  1.00 54.09  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 41.086  64.062 55.869  1.00 54.09  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 40.777  62.617 56.143  1.00 54.09  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 40.360  61.875 55.257  1.00 54.09  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 39.887  64.977 56.124  1.00 63.75  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 38.620  64.626 55.414  1.00 63.75  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 37.861  63.489 55.586  1.00 63.75  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 37.915  65.438 54.467  1.00 63.75  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 36.739  63.538 54.782  1.00 63.75  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 36.743  64.720 54.086  1.00 63.75  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 38.155  66.688 53.896  1.00 63.75  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 35.812  65.224 53.163  1.00 63.75  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 37.228  67.188 52.979  1.00 63.75  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 36.068  66.455 52.628  1.00 63.75  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 40.976  62.232 57.396  1.00 57.68  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 41.024  60.835 57.796  1.00 57.68  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 39.690  60.100 57.694  1.00 57.68  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 38.680  60.654 57.272  1.00 57.68  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 41.648  60.685 59.198  1.00 102.90 ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 41.494  61.874 60.147  1.00 102.90 ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 42.750  62.752 60.191  1.00 102.90 ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 42.698  63.935 59.206  1.00 102.90 ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 41.431  64.742 59.285  1.00 102.90 ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 39.710  58.838 58.072  1.00 49.82  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 38.575  57.966 57.890  1.00 49.82  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 37.588  58.099 59.045  1.00 49.82  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 37.984  58.262 60.205  1.00 49.82  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 39.081  56.534 57.790  1.00 83.69  ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 38.036  55.498 57.499  1.00 83.69  ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 38.628  54.115 57.416  1.00 83.69  ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 39.440  53.822 56.531  1.00 83.69  ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 38.219  53.245 58.331  1.00 83.69  ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 36.301  58.026 58.731  1.00 50.72  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 35.265  57.998 59.753  1.00 50.72  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 34.294  56.889 59.395  1.00 50.72  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 34.109  56.599 58.213  1.00 50.72  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 34.530  59.337 59.795  1.00 83.59  ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 35.408  60.548 60.126  1.00 83.59  ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 35.856  60.600 61.590  1.00 83.59  ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 35.400  59.761 62.424  1.00 83.59  ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 36.674  61.502 61.892  1.00 83.59  ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 33.665  56.281 60.397  1.00 60.56  ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 32.592  55.312 60.136  1.00 60.56  ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 31.294  55.959 59.673  1.00 60.56  ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 30.950  57.055 60.089  1.00 60.56  ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 32.342  54.431 61.348  1.00 67.06  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 33.622  53.850 61.897  1.00 67.06  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 34.555  53.557 61.143  1.00 67.06  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 33.691  53.706 63.218  1.00 67.06  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 30.595  55.287 58.770  1.00 42.03  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 29.272  55.723 58.352  1.00 42.03  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 28.274  54.624 58.702  1.00 42.03  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 28.659  53.565 59.209  1.00 42.03  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 29.215  56.061 56.849  1.00 37.25  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 29.977  57.336 56.587  1.00 37.25  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 29.779  54.909 56.011  1.00 37.25  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 27.004  54.910 58.429  1.00 39.52  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 25.880  54.018 58.646  1.00 39.52  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 26.008  52.708 57.847  1.00 39.52  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 26.513  52.689 56.730  1.00 39.52  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 24.645  54.787 58.217  1.00 56.62  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 23.365  54.180 58.593  1.00 56.62  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 22.417  54.135 57.419  1.00 56.62  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 22.228  55.179 56.753  1.00 56.62  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 21.860  53.038 57.170  1.00 56.62  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 25.540  51.611 58.426  1.00 59.77  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 25.559  50.295 57.767  1.00 59.77  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 24.984  50.247 56.332  1.00 59.77  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 25.257  49.304 55.594  1.00 59.77  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 24.839  49.262 58.647  1.00 39.81  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 24.174  51.235 55.947  1.00 37.56  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 23.489  51.194 54.653  1.00 37.56  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 23.760  52.474 53.885  1.00 37.56  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 23.027  52.838 52.945  1.00 37.56  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 21.991  50.953 54.819  1.00 59.01  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 21.639  49.640 55.513  1.00 59.01  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 21.802  48.411 54.607  1.00 59.01  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 21.653  48.554 53.370  1.00 59.01  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 22.065  47.300 55.132  1.00 59.01  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 24.830  53.160 54.285  1.00 42.68  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 25.289  54.333 53.551  1.00 42.68  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 25.527  53.903 52.111  1.00 42.68  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 26.108  52.836 51.870  1.00 42.68  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 26.558  54.884 54.163  1.00 41.07  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 25.078  54.709 51.153  1.00 32.09  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 25.143  54.251 49.807  1.00 32.09  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 25.274  55.296 48.728  1.00 32.09  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 25.608  54.949 47.585  1.00 32.09  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 23.929  53.381 49.529  1.00 30.72  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 22.751  54.161 49.473  1.00 30.72  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 24.974  56.554 49.040  1.00 32.86  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 25.122  57.632 48.046  1.00 32.86  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 26.137  58.614 48.571  1.00 32.86  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 26.092  59.009 49.744  1.00 32.86  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 23.823  58.353 47.809  1.00 58.24  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.718  57.473 47.392  1.00 58.24  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 22.060  58.056 45.837  1.00 58.24  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 22.976  56.947 44.733  1.00 58.24  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 27.070  58.996 47.722  1.00 40.45  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 28.002  60.041 48.072  1.00 40.45  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 27.708  61.248 47.220  1.00 40.45  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.655  61.130 45.983  1.00 40.45  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 29.426  59.603 47.823  1.00 22.60  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 30.397  60.776 48.048  1.00 22.60  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 29.749  58.392 48.729  1.00 22.60  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 27.485  62.391 47.886  1.00 44.02  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 27.392  63.691 47.205  1.00 44.02  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 28.544  64.617 47.570  1.00 44.02  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 28.873  64.817 48.747  1.00 44.02  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 26.057  64.434 47.451  1.00 33.80  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 24.865  63.457 47.421  1.00 33.80  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 25.889  65.532 46.422  1.00 33.80  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 23.444  64.107 47.640  1.00 33.80  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 29.130  65.181 46.519  1.00 39.92  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 30.177  66.175 46.610  1.00 39.92  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 29.641  67.591 46.398  1.00 39.92  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 29.236  67.951 45.308  1.00 39.92  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 31.216  65.877 45.597  1.00 26.14  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 29.685  68.408 47.439  1.00 52.66  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 29.060  69.723 47.396  1.00 52.66  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 30.034  70.822 47.002  1.00 52.66  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 31.163  70.819 47.458  1.00 52.66  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.456  70.048 48.723  1.00 30.18  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 27.396  71.102 48.529  1.00 30.18  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 27.854  68.779 49.349  1.00 30.18  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 29.606  71.756 46.133  1.00 42.85  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 30.593  72.674 45.542  1.00 42.85  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 31.113  73.810 46.443  1.00 42.85  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 30.552  74.117 47.506  1.00 42.85  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 29.875  73.233 44.299  1.00 66.27  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 28.568  72.480 44.198  1.00 66.27  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 28.262  72.017 45.595  1.00 66.27  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 32.169  74.438 45.934  1.00 175.22 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 33.110  75.296 46.662  1.00 175.22 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 32.661  76.201 47.818  1.00 175.22 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 33.391  76.317 48.803  1.00 175.22 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 33.945  76.090 45.660  1.00 78.46  ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 35.319  75.498 45.422  1.00 78.46  ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 36.345  76.079 46.366  1.00 78.46  ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 36.037  76.287 47.557  1.00 78.46  ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 37.472  76.344 45.916  1.00 78.46  ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 31.490  76.858 47.708  1.00 69.68  ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 31.055  77.684 48.850  1.00 69.68  ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 31.089  76.921 50.178  1.00 69.68  ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 31.471  77.491 51.205  1.00 69.68  ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.610  78.026 48.503  1.00 59.24  ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.574  77.987 47.010  1.00 59.24  ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 30.523  76.904 46.594  1.00 59.24  ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 30.691  75.646 50.145  1.00 51.47  ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 30.703  74.788 51.325  1.00 51.47  ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 31.810  73.755 51.227  1.00 51.47  ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 32.613  73.624 52.156  1.00 51.47  ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 29.382  74.061 51.477  1.00 104.04 ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 28.186  74.933 51.323  1.00 104.04 ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 27.471  74.943 50.128  1.00 104.04 ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 27.757  75.733 52.369  1.00 104.04 ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 26.339  75.741 49.973  1.00 104.04 ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 26.633  76.530 52.227  1.00 104.04 ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 25.922  76.536 51.020  1.00 104.04 ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 31.830  73.018 50.111  1.00 58.82  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 32.774  71.941 49.896  1.00 58.82  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 32.739  70.904 51.004  1.00 58.82  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 33.072  71.177 52.148  1.00 58.82  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 32.329  69.699 50.682  1.00 60.35  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 32.532  68.586 51.587  1.00 60.35  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 31.832  67.417 50.953  1.00 60.35  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 31.702  67.354 49.726  1.00 60.35  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 31.356  66.499 51.778  1.00 41.17  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 30.590  65.416 51.243  1.00 41.17  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 29.318  65.216 52.025  1.00 41.17  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 29.280  65.455 53.234  1.00 41.17  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 31.413  64.166 51.227  1.00 25.80  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 28.268  64.793 51.332  1.00 34.68  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 27.073  64.355 52.020  1.00 34.68  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 26.932  62.897 51.779  1.00 34.68  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 27.149  62.425 50.650  1.00 34.68  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 25.858  65.038 51.495  1.00 53.76  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.842  66.453 52.057  1.00 53.76  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 24.625  64.291 51.918  1.00 53.76  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 25.010  67.433 51.274  1.00 53.76  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 26.573  62.181 52.836  1.00 37.57  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 26.400  60.748 52.749  1.00 37.57  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 24.961  60.311 53.092  1.00 37.57  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 24.528  60.302 54.258  1.00 37.57  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 27.455  60.054 53.614  1.00 30.16  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 28.836  60.448 53.126  1.00 30.16  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 27.354  58.557 53.515  1.00 30.16  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 29.955  59.828 53.951  1.00 30.16  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 24.204  59.938 52.083  1.00 41.83  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 22.874  59.454 52.394  1.00 41.83  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 22.873  57.947 52.671  1.00 41.83  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 23.535  57.181 51.964  1.00 41.83  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 21.870  59.791 51.296  1.00 37.71  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 22.154  61.192 50.748  1.00 37.71  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 20.448  59.629 51.842  1.00 37.71  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 21.049  61.786 49.940  1.00 37.71  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 22.150  57.555 53.720  1.00 39.47  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 21.961  56.164 54.112  1.00 39.47  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 20.478  55.831 54.270  1.00 39.47  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 19.615  56.428 53.601  1.00 39.47  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 20.168  54.837 55.101  1.00 62.02  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 18.804  54.694 55.616  1.00 62.02  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 18.779  55.467 56.937  1.00 62.02  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 19.813  55.690 57.585  1.00 62.02  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 18.411  53.234 55.846  1.00 71.74  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 18.411  52.355 54.605  1.00 71.74  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 17.052  52.278 53.888  1.00 71.74  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 15.972  52.279 54.503  1.00 71.74  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 17.111  52.185 52.578  1.00 71.74  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 17.603  55.903 57.337  1.00 48.55  ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 17.449  56.664 58.586  1.00 48.55  ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 18.522  57.698 58.951  1.00 48.55  ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 18.527  58.169 60.078  1.00 48.55  ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 17.261  55.704 59.753  1.00 63.42  ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 18.379  54.712 59.874  1.00 63.42  ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 18.060  53.647 60.862  1.00 63.42  ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 16.881  53.192 60.854  1.00 63.42  ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 18.987  53.290 61.643  1.00 63.42  ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 19.390  58.095 58.022  1.00 52.37  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 20.428  59.092 58.340  1.00 52.37  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 21.012  59.804 57.127  1.00 52.37  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 21.251  59.177 56.104  1.00 52.37  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 21.560  58.391 59.080  1.00 52.66  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 21.816  57.122 58.482  1.00 52.66  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 21.252  61.108 57.238  1.00 52.75  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 22.018  61.858 56.217  1.00 52.75  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 23.102  62.673 56.928  1.00 52.75  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 22.829  63.281 57.971  1.00 52.75  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 21.113  62.806 55.376  1.00 24.72  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 20.110  62.005 54.550  1.00 24.72  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 21.935  63.674 54.427  1.00 24.72  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 19.070  62.824 53.882  1.00 24.72  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 24.322  62.685 56.393  1.00 54.49  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 25.435  63.282 57.127  1.00 54.49  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 26.375  64.056 56.255  1.00 54.49  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 26.719  63.621 55.149  1.00 54.49  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 26.294  62.231 57.825  1.00 43.91  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 26.764  61.291 56.853  1.00 43.91  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 25.508  61.509 58.893  1.00 43.91  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 26.818  65.191 56.783  1.00 52.79  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 27.773  66.035 56.094  1.00 52.79  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 29.139  65.826 56.684  1.00 52.79  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 29.263  65.747 57.906  1.00 52.79  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 27.410  67.495 56.236  1.00 49.34  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 28.360  68.381 55.489  1.00 49.34  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 28.326  68.427 54.104  1.00 49.34  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 29.309  69.177 56.162  1.00 49.34  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 29.193  69.240 53.401  1.00 49.34  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 30.189  70.011 55.461  1.00 49.34  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 30.121  70.025 54.077  1.00 49.34  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 30.959  70.801 53.319  1.00 49.34  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 30.155  65.755 55.822  1.00 45.71  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 31.526  65.467 56.224  1.00 45.71  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 32.448  66.422 55.519  1.00 45.71  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 32.397  66.535 54.295  1.00 45.71  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 31.903  64.060 55.778  1.00 41.35  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 31.337  62.978 56.636  1.00 41.35  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 32.044  62.409 57.674  1.00 41.35  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 30.131  62.362 56.614  1.00 41.35  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 31.290  61.495 58.264  1.00 41.35  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 30.123  61.449 57.643  1.00 41.35  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 33.295  67.111 56.274  1.00 74.24  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 34.354  67.932 55.674  1.00 74.24  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 35.433  68.341 56.667  1.00 74.24  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 35.186  69.112 57.594  1.00 74.24  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.800  69.170 54.953  1.00 56.05  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 34.870  70.214 54.692  1.00 56.05  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.901  69.953 54.037  1.00 56.05  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 34.649  71.400 55.231  1.00 56.05  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 36.644  67.848 56.435  1.00 70.68  ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 37.709  67.965 57.407  1.00 70.68  ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 37.139  67.355 58.664  1.00 70.68  ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 36.500  66.303 58.604  1.00 70.68  ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 37.329  68.046 59.784  1.00 62.03  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 36.820  67.606 61.081  1.00 62.03  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 35.387  68.114 61.378  1.00 62.03  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 34.953  68.153 62.537  1.00 62.03  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 37.801  68.018 62.189  1.00 86.87  ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 37.824  67.031 63.353  1.00 86.87  ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 38.870  66.949 64.033  1.00 86.87  ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 36.811  66.328 63.597  1.00 86.87  ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 34.661  68.498 60.331  1.00 66.91  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 33.267  68.922 60.474  1.00 66.91  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 32.280  67.782 60.164  1.00 66.91  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 32.230  67.261 59.037  1.00 66.91  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 32.978  70.155 59.615  1.00 74.74  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 31.669  70.831 59.952  1.00 74.74  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 31.356  71.985 59.000  1.00 74.74  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 30.472  73.041 59.668  1.00 74.74  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 29.577  72.474 60.744  1.00 74.74  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 31.516  67.404 61.187  1.00 54.07  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 30.528  66.343 61.095  1.00 54.07  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 29.170  66.895 61.377  1.00 54.07  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 28.926  67.367 62.488  1.00 54.07  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 30.765  65.287 62.162  1.00 52.08  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 29.797  64.122 62.068  1.00 52.08  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 30.022  63.101 61.159  1.00 52.08  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 28.671  64.045 62.869  1.00 52.08  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 29.175  62.031 61.046  1.00 52.08  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 27.801  62.965 62.766  1.00 52.08  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 28.065  61.959 61.839  1.00 52.08  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 27.246  60.855 61.682  1.00 52.08  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 28.269  66.819 60.406  1.00 53.20  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 26.878  67.135 60.683  1.00 53.20  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 26.037  65.941 60.356  1.00 53.20  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 26.329  65.238 59.398  1.00 53.20  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 26.419  68.388 59.941  1.00 58.48  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 26.075  69.511 60.928  1.00 58.48  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 26.202  70.915 60.346  1.00 58.48  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 24.663  69.290 61.491  1.00 58.48  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 25.017  65.692 61.168  1.00 47.60  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 24.188  64.505 61.001  1.00 47.60  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 22.731  64.743 61.330  1.00 47.60  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 22.407  65.235 62.417  1.00 47.60  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 24.714  63.369 61.852  1.00 48.90  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 21.852  64.372 60.399  1.00 53.97  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 20.414  64.266 60.704  1.00 53.97  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 19.834  62.869 60.488  1.00 53.97  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 20.419  62.034 59.798  1.00 53.97  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 19.556  65.311 59.976  1.00 51.56  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 19.974  65.415 58.509  1.00 51.56  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 19.620  66.650 60.724  1.00 51.56  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 18.812  65.315 57.539  1.00 51.56  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 18.683  62.630 61.104  1.00 62.85  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 18.062  61.318 61.087  1.00 62.85  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 16.558  61.441 61.067  1.00 62.85  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 15.899  60.896 61.947  1.00 62.85  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 18.474  60.544 62.296  1.00 19.12  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 16.007  62.138 60.056  1.00 46.60  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 14.571  62.430 60.062  1.00 46.60  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 13.756  61.183 59.752  1.00 46.60  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 13.973  60.569 58.711  1.00 46.60  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 14.427  63.451 58.934  1.00 41.80  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 15.541  63.090 57.958  1.00 41.80  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 16.680  62.668 58.848  1.00 41.80  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 12.784  60.829 60.609  1.00 44.96  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 12.200  59.508 60.370  1.00 44.96  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 11.499  59.435 59.009  1.00 44.96  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 11.358  58.338 58.465  1.00 44.96  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 11.184  59.332 61.517  1.00 56.04  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 11.351  60.481 62.412  1.00 56.04  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 12.115  61.554 61.701  1.00 56.04  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 11.094  60.591 58.468  1.00 55.60  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 10.363  60.651 57.206  1.00 55.60  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 11.070  59.856 56.127  1.00 55.60  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 10.452  59.476 55.134  1.00 55.60  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 10.145  62.099 56.681  1.00 61.37  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 9.666   63.048 57.816  1.00 61.37  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 9.180   62.071 55.481  1.00 61.37  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 8.984   64.404 57.387  1.00 61.37  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 12.362  59.595 56.336  1.00 43.94  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 13.222  58.938 55.346  1.00 43.94  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 13.472  57.467 55.642  1.00 43.94  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 13.845  56.712 54.734  1.00 43.94  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 14.514  59.792 55.091  1.00 56.20  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 14.394  60.465 53.722  1.00 56.20  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 15.839  59.010 55.242  1.00 56.20  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 15.237  61.690 53.554  1.00 56.20  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 13.197  57.065 56.889  1.00 55.06  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 13.405  55.694 57.390  1.00 55.06  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 12.742  54.565 56.610  1.00 55.06  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 13.235  53.453 56.638  1.00 55.06  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 13.019  55.591 58.869  1.00 62.65  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 13.557  54.345 59.583  1.00 62.65  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 12.487  53.261 59.682  1.00 62.65  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 13.062  51.893 60.027  1.00 62.65  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 13.549  51.888 61.422  1.00 62.65  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 11.625  54.820 55.939  1.00 41.69  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 11.028  53.814 55.058  1.00 41.69  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 11.855  53.818 53.777  1.00 41.69  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 13.087  53.956 53.844  1.00 41.69  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 9.579   54.148 54.770  1.00 52.31  ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 8.802   54.570 56.005  1.00 52.31  ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 7.806   55.694 55.734  1.00 52.31  ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 7.024   55.643 54.787  1.00 52.31  ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 7.833   56.713 56.576  1.00 52.31  ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 11.207  53.689 52.618  1.00 30.27  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 11.909  53.618 51.308  1.00 30.27  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 13.363  54.137 51.224  1.00 30.27  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 13.682  55.181 51.786  1.00 30.27  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 11.057  54.271 50.235  1.00 50.96  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 11.538  53.954 48.959  1.00 50.96  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 14.235  53.389 50.535  1.00 39.97  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 15.617  53.822 50.284  1.00 39.97  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 15.605  55.013 49.383  1.00 39.97  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 14.779  55.108 48.474  1.00 39.97  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 16.500  52.780 49.518  1.00 31.00  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 16.529  51.535 50.209  1.00 31.00  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 17.917  53.243 49.438  1.00 31.00  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 16.555  55.901 49.634  1.00 38.99  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 16.827  56.999 48.755  1.00 38.99  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 17.729  56.481 47.610  1.00 38.99  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 18.738  55.828 47.831  1.00 38.99  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 17.397  58.196 49.587  1.00 21.11  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 16.242  58.889 50.304  1.00 21.11  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 18.158  59.223 48.741  1.00 21.11  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 16.705  59.904 51.271  1.00 21.11  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 17.369  56.812 46.381  1.00 46.49  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.875  56.102 45.220  1.00 46.49  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 18.565  56.994 44.172  1.00 46.49  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 19.392  56.520 43.384  1.00 46.49  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 16.713  55.224 44.656  1.00 44.18  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 16.568  55.287 43.136  1.00 44.18  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 16.854  53.815 45.188  1.00 44.18  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 18.231  58.279 44.165  1.00 46.07  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 18.878  59.215 43.253  1.00 46.07  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 18.791  60.620 43.795  1.00 46.07  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 18.143  60.846 44.803  1.00 46.07  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 18.309  59.119 41.842  1.00 38.13  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 16.558  59.443 41.710  1.00 38.13  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 19.495  61.540 43.143  1.00 32.67  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.648  62.906 43.603  1.00 32.67  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 20.111  63.810 42.476  1.00 32.67  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 20.709  63.371 41.499  1.00 32.67  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.623  63.006 44.776  1.00 48.35  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 22.040  62.762 44.390  1.00 48.35  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 22.808  63.708 43.735  1.00 48.35  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.831  61.672 44.548  1.00 48.35  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 24.008  63.211 43.505  1.00 48.35  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 24.049  61.979 43.989  1.00 48.35  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 19.824  65.090 42.625  1.00 40.93  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 20.286  66.067 41.694  1.00 40.93  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 20.471  67.357 42.478  1.00 40.93  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.803  67.523 43.510  1.00 40.93  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 19.248  66.242 40.609  1.00 40.51  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 19.693  67.205 39.549  1.00 40.51  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 20.875  67.247 39.193  1.00 40.51  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.763  68.015 39.053  1.00 40.51  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 21.375  68.252 42.043  1.00 33.90  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.410  69.574 42.676  1.00 33.90  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.720  70.655 41.887  1.00 33.90  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 20.871  70.772 40.654  1.00 33.90  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 22.770  70.009 43.201  1.00 32.50  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 23.701  70.571 42.238  1.00 32.50  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 24.858  71.181 43.003  1.00 32.50  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 26.133  70.736 42.461  1.00 32.50  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 26.479  70.858 41.182  1.00 32.50  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 25.631  71.420 40.329  1.00 32.50  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 27.652  70.402 40.752  1.00 32.50  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 19.968  71.434 42.659  1.00 54.04  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 19.046  72.426 42.180  1.00 54.04  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.758  73.738 41.948  1.00 54.04  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.589  74.374 40.898  1.00 54.04  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 18.001  72.684 43.246  1.00 53.12  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 16.997  73.697 42.749  1.00 53.12  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 17.319  71.380 43.640  1.00 53.12  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 20.536  74.129 42.957  1.00 53.85  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 21.140  75.443 43.060  1.00 53.85  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.634  75.223 43.025  1.00 53.85  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 23.150  74.524 43.884  1.00 53.85  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.759  76.095 44.411  1.00 52.93  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 19.238  76.425 44.538  1.00 52.93  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.582  76.839 43.533  1.00 52.93  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.705  76.307 45.673  1.00 52.93  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 23.350  75.837 42.064  1.00 49.92  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.792  75.599 41.930  1.00 49.92  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 25.586  75.743 43.226  1.00 49.92  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 26.448  74.908 43.497  1.00 49.92  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 25.221  76.655 40.921  1.00 30.74  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 24.006  76.862 40.076  1.00 30.74  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 22.866  76.798 41.054  1.00 30.74  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 25.300  76.791 44.002  1.00 54.59  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.770  76.941 45.395  1.00 54.59  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.719  75.617 46.145  1.00 54.59  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.583  75.330 46.970  1.00 54.59  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 24.887  77.946 46.127  1.00 76.16  ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 24.540  79.143 45.260  1.00 76.16  ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 25.322  80.089 45.170  1.00 76.16  ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 23.378  79.102 44.597  1.00 76.16  ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.687  74.818 45.844  1.00 46.29  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 24.505  73.479 46.414  1.00 46.29  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 23.813  73.609 47.743  1.00 46.29  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 24.242  73.055 48.742  1.00 46.29  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 22.733  74.367 47.755  1.00 48.47  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 22.038  74.617 48.997  1.00 48.47  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 20.763  73.833 48.992  1.00 48.47  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 20.138  73.622 50.036  1.00 48.47  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 21.786  76.094 49.117  1.00 42.50  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 22.938  76.727 48.609  1.00 42.50  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 20.397  73.378 47.799  1.00 49.24  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 19.266  72.482 47.644  1.00 49.24  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 19.537  71.393 46.616  1.00 49.24  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 20.004  71.657 45.493  1.00 49.24  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 17.978  73.252 47.301  1.00 36.11  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 17.526  74.266 48.369  1.00 36.11  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 16.381  75.102 47.879  1.00 36.11  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 16.633  75.614 46.552  1.00 36.11  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 15.685  76.034 45.728  1.00 36.11  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 14.409  76.032 46.099  1.00 36.11  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 16.031  76.484 44.531  1.00 36.11  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 19.223  70.173 47.049  1.00 38.78  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 19.313  68.940 46.273  1.00 38.78  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 17.925  68.307 46.258  1.00 38.78  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 17.153  68.475 47.225  1.00 38.78  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 20.290  67.977 46.949  1.00 47.62  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 21.727  68.354 46.733  1.00 47.62  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 22.432  69.089 47.685  1.00 47.62  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 22.389  67.993 45.565  1.00 47.62  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 23.775  69.457 47.470  1.00 47.62  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 23.704  68.356 45.346  1.00 47.62  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 24.386  69.089 46.296  1.00 47.62  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 25.687  69.438 46.060  1.00 47.62  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 17.595  67.599 45.177  1.00 35.30  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 16.368  66.810 45.129  1.00 35.30  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 16.744  65.375 45.467  1.00 35.30  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 17.856  64.968 45.154  1.00 35.30  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 15.721  66.918 43.744  1.00 19.28  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 14.924  68.221 43.533  1.00 19.28  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 14.659  68.538 42.070  1.00 19.28  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.632  68.186 44.321  1.00 19.28  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 15.841  64.623 46.121  1.00 23.56  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 16.085  63.216 46.526  1.00 23.56  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 14.952  62.322 46.104  1.00 23.56  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 13.828  62.579 46.480  1.00 23.56  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 16.213  63.101 48.028  1.00 26.77  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 17.417  63.871 48.572  1.00 26.77  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 17.761  63.496 50.046  1.00 26.77  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 18.638  63.696 47.683  1.00 26.77  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 15.263  61.247 45.368  1.00 37.36  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 14.290  60.219 44.957  1.00 37.36  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 14.269  58.870 45.679  1.00 37.36  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 15.238  58.137 45.627  1.00 37.36  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 13.139  58.575 46.334  1.00 28.16  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 12.728  57.259 46.917  1.00 28.16  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 12.450  56.166 45.906  1.00 28.16  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 12.152  56.457 44.750  1.00 28.16  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 11.378  57.397 47.635  1.00 52.15  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 11.498  57.333 49.122  1.00 52.15  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 12.618  57.213 49.650  1.00 52.15  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 10.464  57.408 49.793  1.00 52.15  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 12.456  54.917 46.386  1.00 38.84  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 11.954  53.760 45.640  1.00 38.84  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 10.427  53.752 45.583  1.00 38.84  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 9.813   52.859 45.008  1.00 38.84  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 12.402  52.476 46.312  1.00 69.70  ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 12.585  51.332 45.361  1.00 69.70  ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 14.292  51.363 44.828  1.00 69.70  ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 15.181  50.513 46.176  1.00 69.70  ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 9.799   54.733 46.206  1.00 28.28  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 8.346   54.691 46.343  1.00 28.28  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 7.738   55.816 45.539  1.00 28.28  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 6.494   55.954 45.434  1.00 28.28  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 7.925   54.753 47.812  1.00 67.91  ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 7.557   53.391 48.365  1.00 67.91  ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 7.830   53.257 49.846  1.00 67.91  ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 7.585   54.222 50.601  1.00 67.91  ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 8.291   52.168 50.259  1.00 67.91  ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 8.640   56.603 44.958  1.00 25.11  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 8.234   57.806 44.276  1.00 25.11  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 8.197   59.078 45.103  1.00 25.11  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 7.910   60.094 44.539  1.00 25.11  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 8.482   59.032 46.410  1.00 29.59  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 8.532   60.238 47.249  1.00 29.59  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 9.655   61.152 46.794  1.00 29.59  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 10.787  60.704 46.624  1.00 29.59  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 8.867   59.919 48.696  1.00 48.29  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 7.841   59.395 49.639  1.00 48.29  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 8.710   59.082 50.824  1.00 48.29  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 8.097   58.396 51.938  1.00 48.29  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 7.506   57.203 51.867  1.00 48.29  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 7.410   56.553 50.706  1.00 48.29  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 6.979   56.654 52.965  1.00 48.29  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 9.387   62.441 46.639  1.00 37.77  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 10.456  63.358 46.274  1.00 37.77  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 10.803  64.277 47.441  1.00 37.77  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 9.919   64.780 48.108  1.00 37.77  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 10.048  64.140 45.047  1.00 24.39  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 11.038  65.195 44.591  1.00 24.39  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 12.317  64.537 44.150  1.00 24.39  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 10.454  65.973 43.450  1.00 24.39  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 12.080  64.480 47.716  1.00 50.25  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 12.449  65.314 48.847  1.00 50.25  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 13.346  66.481 48.452  1.00 50.25  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 14.066  66.421 47.449  1.00 50.25  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 13.181  64.510 49.902  1.00 29.46  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 12.384  63.410 50.517  1.00 29.46  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 12.347  62.158 49.946  1.00 29.46  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 11.732  63.606 51.735  1.00 29.46  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 11.653  61.128 50.556  1.00 29.46  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 10.997  62.584 52.366  1.00 29.46  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 10.964  61.344 51.773  1.00 29.46  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 13.310  67.541 49.254  1.00 32.98  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 14.257  68.604 49.108  1.00 32.98  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 15.239  68.482 50.231  1.00 32.98  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 14.845  68.322 51.372  1.00 32.98  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 13.566  69.944 49.188  1.00 35.82  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 13.283  70.582 47.815  1.00 35.82  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.689  71.338 46.974  1.00 35.82  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 15.616  71.705 48.459  1.00 35.82  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 16.520  68.509 49.906  1.00 28.43  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 17.515  68.608 50.936  1.00 28.43  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 18.070  70.033 50.890  1.00 28.43  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 18.531  70.512 49.825  1.00 28.43  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 18.613  67.561 50.775  1.00 33.16  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 19.912  67.759 51.577  1.00 33.16  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 19.764  67.402 53.051  1.00 33.16  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 21.078  66.952 50.945  1.00 33.16  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 17.977  70.704 52.050  1.00 36.72  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 18.401  72.089 52.235  1.00 36.72  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 19.598  72.134 53.148  1.00 36.72  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 19.642  71.480 54.191  1.00 36.72  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 17.263  72.911 52.825  1.00 20.58  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 15.979  72.843 51.971  1.00 20.58  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 14.744  72.341 52.720  1.00 20.58  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.678  74.122 51.226  1.00 20.58  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 20.592  72.889 52.717  1.00 55.50  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 21.725  73.211 53.548  1.00 55.50  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 21.599  74.699 53.879  1.00 55.50  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 21.504  75.537 52.954  1.00 55.50  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 23.024  72.946 52.785  1.00 67.88  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 23.181  71.730 51.862  1.00 67.88  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 24.629  71.561 51.480  1.00 67.88  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 22.692  70.476 52.534  1.00 67.88  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 21.575  75.032 55.177  1.00 36.05  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 21.436  76.451 55.590  1.00 36.05  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 22.797  77.111 55.833  1.00 36.05  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 23.606  76.591 56.640  1.00 36.05  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 20.564  76.555 56.833  1.00 72.41  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 20.447  77.957 57.405  1.00 72.41  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 19.906  77.977 58.851  1.00 72.41  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 19.845  79.108 59.409  1.00 72.41  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 19.554  76.891 59.418  1.00 72.41  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 23.043  78.240 55.154  1.00 81.21  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 24.359  78.930 55.151  1.00 81.21  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 24.552  79.898 56.334  1.00 81.21  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 23.579  80.341 56.950  1.00 81.21  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 24.590  79.667 53.819  1.00 69.78  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 24.074  78.903 52.595  1.00 69.78  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 24.027  79.724 51.297  1.00 69.78  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 22.833  79.290 50.408  1.00 69.78  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 22.788  79.927 49.024  1.00 69.78  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 25.807  80.214 56.654  1.00 114.64 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 26.124  81.161 57.727  1.00 114.64 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 27.246  82.099 57.336  1.00 114.64 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 28.418  81.730 57.404  1.00 114.64 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 26.500  80.433 59.019  1.00 131.53 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 25.317  80.094 59.909  1.00 131.53 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 24.845  81.262 60.762  1.00 131.53 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 25.080  82.434 60.383  1.00 131.53 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 24.231  80.999 61.819  1.00 131.53 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 26.878  83.309 56.919  1.00 88.06  ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 27.843  84.377 56.657  1.00 88.06  ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 28.396  84.816 58.015  1.00 88.06  ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 27.628  85.144 58.915  1.00 88.06  ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 27.158  85.551 55.935  1.00 107.39 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 28.052  86.290 54.920  1.00 107.39 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 27.749  87.794 54.804  1.00 107.39 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 26.730  88.172 54.178  1.00 107.39 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 28.553  88.602 55.326  1.00 107.39 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.716  84.754 58.158  1.00 138.64 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 30.373  85.067 59.419  1.00 138.64 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 31.119  86.385 59.310  1.00 138.64 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 32.181  86.463 58.691  1.00 138.64 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 31.336  83.946 59.814  1.00 100.18 ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 30.670  82.594 60.008  1.00 100.18 ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 31.653  81.512 60.407  1.00 100.18 ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 32.851  81.762 60.537  1.00 100.18 ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 31.150  80.299 60.605  1.00 100.18 ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 30.558  87.425 59.917  1.00 178.12 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 31.166  88.750 59.892  1.00 178.12 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 32.582  88.701 59.328  1.00 178.12 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 33.559  88.839 60.064  1.00 178.12 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 31.180  89.360 61.295  1.00 95.86  ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 31.961  88.549 62.316  1.00 95.86  ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 31.950  89.301 63.955  1.00 95.86  ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 32.716  90.882 63.607  1.00 95.86  ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 32.686  88.503 58.017  1.00 83.91  ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 33.981  88.445 57.351  1.00 83.91  ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 34.686  87.119 57.617  1.00 83.91  ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 35.708  87.076 58.303  1.00 83.91  ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 34.866  89.610 57.799  1.00 123.77 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 34.255  90.961 57.483  1.00 123.77 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 33.144  90.994 56.914  1.00 123.77 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 34.886  91.990 57.805  1.00 123.77 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 34.135  86.041 57.070  1.00 128.79 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 34.721  84.707 57.238  1.00 128.79 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 34.096  83.618 56.383  1.00 128.79 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 33.834  82.517 56.876  1.00 128.79 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 33.874  83.930 55.102  1.00 131.41 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 33.259  83.015 54.124  1.00 131.41 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 31.884  82.529 54.606  1.00 131.41 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 31.293  83.128 55.513  1.00 131.41 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 34.177  81.783 53.765  1.00 125.28 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 35.550  82.080 54.047  1.00 125.28 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 34.028  81.379 52.285  1.00 125.28 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 31.386  81.452 53.994  1.00 60.19  ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 30.133  80.825 54.397  1.00 60.19  ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 30.408  79.422 54.932  1.00 60.19  ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 31.366  78.782 54.509  1.00 60.19  ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 29.098  80.815 53.231  1.00 124.06 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 28.418  82.185 53.094  1.00 124.06 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 29.751  80.407 51.907  1.00 124.06 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 29.587  78.973 55.887  1.00 109.30 ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 29.635  77.596 56.424  1.00 109.30 ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 28.254  76.950 56.537  1.00 109.30 ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 27.228  77.612 56.404  1.00 109.30 ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 30.314  77.506 57.826  1.00 75.05  ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 29.790  78.517 58.703  1.00 75.05  ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 31.832  77.613 57.708  1.00 75.05  ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 28.244  75.649 56.794  1.00 64.17  ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 27.003  74.921 57.033  1.00 64.17  ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 26.605  74.968 58.488  1.00 64.17  ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 27.341  74.490 59.354  1.00 64.17  ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 27.150  73.447 56.646  1.00 85.18  ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 26.804  73.002 55.226  1.00 85.18  ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 28.046  73.004 54.370  1.00 85.18  ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 26.230  71.611 55.277  1.00 85.18  ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 25.433  75.513 58.770  1.00 46.21  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 24.973  75.449 60.142  1.00 46.21  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 24.232  74.139 60.372  1.00 46.21  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 24.377  73.534 61.442  1.00 46.21  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 24.090  76.645 60.504  1.00 70.15  ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 23.687  76.679 61.987  1.00 70.15  ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 22.989  77.989 62.350  1.00 70.15  ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 21.495  77.923 62.119  1.00 70.15  ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 20.863  79.145 62.646  1.00 70.15  ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 23.435  73.714 59.375  1.00 55.76  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 22.632  72.487 59.460  1.00 55.76  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 22.121  71.962 58.108  1.00 55.76  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 22.343  72.576 57.049  1.00 55.76  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 21.452  72.712 60.400  1.00 89.83  ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 21.125  71.489 61.206  1.00 89.83  ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 22.071  70.907 61.779  1.00 89.83  ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 19.933  71.110 61.272  1.00 89.83  ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 21.442  70.815 58.156  1.00 56.03  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 20.699  70.283 57.001  1.00 56.03  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 19.233  70.061 57.388  1.00 56.03  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 18.907  69.804 58.545  1.00 56.03  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 21.291  68.956 56.468  1.00 43.05  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 22.739  68.517 56.738  1.00 43.05  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 22.814  67.017 56.883  1.00 43.05  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 23.715  68.972 55.694  1.00 43.05  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 18.359  70.144 56.396  1.00 40.73  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 16.922  69.957 56.582  1.00 40.73  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 16.354  69.181 55.377  1.00 40.73  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 16.772  69.395 54.219  1.00 40.73  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 16.255  71.336 56.670  1.00 46.51  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 14.871  71.374 57.285  1.00 46.51  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 14.487  72.789 57.686  1.00 46.51  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 14.814  73.787 56.659  1.00 46.51  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 13.974  74.207 55.708  1.00 46.51  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 12.735  73.716 55.617  1.00 46.51  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 14.384  75.120 54.829  1.00 46.51  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 15.402  68.291 55.633  1.00 24.12  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 14.732  67.619 54.536  1.00 24.12  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 13.240  67.995 54.472  1.00 24.12  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 12.660  68.382 55.465  1.00 24.12  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 14.971  66.094 54.594  1.00 19.62  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 13.710  65.329 54.173  1.00 19.62  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 16.167  65.703 53.707  1.00 19.62  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 12.618  67.926 53.307  1.00 41.85  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 11.198  68.200 53.255  1.00 41.85  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 10.564  67.446 52.117  1.00 41.85  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 11.009  67.539 50.981  1.00 41.85  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.932  69.694 53.123  1.00 63.29  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 10.665  70.381 54.457  1.00 63.29  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 10.734  71.907 54.376  1.00 63.29  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 10.945  72.459 53.262  1.00 63.29  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 10.586  72.551 55.438  1.00 63.29  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 9.527   66.688 52.444  1.00 29.86  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 8.768   65.920 51.477  1.00 29.86  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 7.976   66.816 50.517  1.00 29.86  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 7.092   67.551 50.936  1.00 29.86  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 7.840   64.990 52.246  1.00 29.11  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 6.836   64.137 51.488  1.00 29.11  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 7.454   63.515 50.213  1.00 29.11  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 6.315   63.076 52.433  1.00 29.11  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 8.282   66.760 49.233  1.00 28.86  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 7.599   67.627 48.301  1.00 28.86  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 6.344   66.962 47.737  1.00 28.86  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 5.381   67.657 47.315  1.00 28.86  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.523   68.068 47.166  1.00 34.46  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 9.897   68.655 47.526  1.00 34.46  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 10.455  69.370 46.336  1.00 34.46  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 9.838   69.613 48.698  1.00 34.46  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 6.348   65.626 47.735  1.00 47.17  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 5.263   64.844 47.121  1.00 47.17  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 5.781   63.597 46.448  1.00 47.17  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 6.840   63.106 46.789  1.00 47.17  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 5.047   63.081 45.478  1.00 23.67  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 5.489   61.858 44.807  1.00 23.67  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 5.605   61.938 43.255  1.00 23.67  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 4.787   62.613 42.652  1.00 23.67  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 4.587   60.709 45.248  1.00 39.43  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 3.292   60.656 44.509  1.00 39.43  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 2.688   59.298 44.577  1.00 39.43  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 2.186   58.811 43.539  1.00 39.43  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 2.744   58.714 45.676  1.00 39.43  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 6.599   61.211 42.639  1.00 51.35  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 6.811   61.257 41.166  1.00 51.35  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 6.360   60.095 40.418  1.00 51.35  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.174   60.052 40.152  1.00 51.35  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 7.769   62.381 40.680  1.00 32.91  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 9.129   61.855 40.755  1.00 32.91  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 7.677   63.625 41.533  1.00 32.91  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 7.290   59.166 40.124  1.00 11.24  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.959   57.883 39.466  1.00 11.24  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 8.427   57.422 39.897  1.00 11.24  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 9.337   58.189 39.726  1.00 11.24  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 6.641   58.001 37.958  1.00 19.20  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 7.830   58.298 37.274  1.00 19.20  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 8.627   56.162 40.525  1.00 20.79  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 9.964   55.682 40.878  1.00 20.79  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 10.915  56.242 39.813  1.00 20.79  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.577  56.220 38.623  1.00 20.79  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 9.987   54.213 40.914  1.00 17.98  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 8.576   53.729 41.383  1.00 17.98  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 11.254  53.839 41.709  1.00 17.98  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 8.474   53.248 42.809  1.00 17.98  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 12.067  56.882 40.233  1.00 14.39  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 12.895  57.626 39.293  1.00 14.39  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 14.249  56.961 39.170  1.00 14.39  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 14.816  56.592 40.179  1.00 14.39  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 13.003  59.070 39.808  1.00 9.30   ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 14.761  56.733 37.973  1.00 37.16  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 16.184  56.420 37.893  1.00 37.16  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 16.904  57.732 38.075  1.00 37.16  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 18.017  57.786 38.551  1.00 37.16  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 16.585  55.839 36.544  1.00 39.80  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 16.692  54.347 36.523  1.00 39.80  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 17.979  53.788 37.128  1.00 39.80  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 19.094  54.353 36.917  1.00 39.80  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 17.861  52.730 37.805  1.00 39.80  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 16.183  58.796 37.774  1.00 61.64  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.752  59.957 37.185  1.00 61.64  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 15.961  61.185 37.562  1.00 61.64  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.745  61.256 37.375  1.00 61.64  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 16.636  59.778 35.679  1.00 52.29  ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 18.015  60.405 34.885  1.00 52.29  ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.673  62.185 38.038  1.00 20.99  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 16.035  63.442 38.428  1.00 20.99  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 16.840  64.659 37.956  1.00 20.99  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 17.934  64.903 38.441  1.00 20.99  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 15.984  63.429 39.940  1.00 21.30  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.764  63.616 40.802  1.00 21.30  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 13.588  62.795 40.385  1.00 21.30  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 15.257  63.229 42.195  1.00 21.30  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 16.326  65.415 37.000  1.00 27.55  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 17.006  66.637 36.563  1.00 27.55  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 16.190  67.910 36.794  1.00 27.55  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 15.219  68.171 36.039  1.00 27.55  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.304  66.575 35.105  1.00 44.47  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 18.228  65.521 34.899  1.00 44.47  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 17.967  67.830 34.679  1.00 44.47  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.575  68.695 37.811  1.00 36.32  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 16.151  70.093 37.884  1.00 36.32  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.476  70.819 36.566  1.00 36.32  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.637  70.940 36.189  1.00 36.32  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 16.796  70.853 39.053  1.00 34.47  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 16.082  72.165 39.265  1.00 34.47  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 14.931  72.220 40.035  1.00 34.47  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.511  73.341 38.627  1.00 34.47  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 14.227  73.396 40.200  1.00 34.47  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 15.814  74.548 38.791  1.00 34.47  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.666  74.555 39.581  1.00 34.47  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 13.924  75.694 39.742  1.00 34.47  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.455  71.276 35.861  1.00 49.48  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.688  71.925 34.586  1.00 49.48  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.835  73.428 34.770  1.00 49.48  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 16.922  73.966 34.606  1.00 49.48  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.581  71.611 33.565  1.00 39.32  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.364  70.201 33.017  1.00 39.32  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.326  70.268 31.952  1.00 39.32  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 15.622  69.648 32.413  1.00 39.32  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.740  74.102 35.089  1.00 53.27  ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.763  75.515 35.386  1.00 53.27  ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.378  75.932 35.784  1.00 53.27  ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 12.395  75.316 35.371  1.00 53.27  ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 15.167  76.331 34.170  1.00 99.81  ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 15.854  77.615 34.553  1.00 99.81  ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 16.685  77.578 35.487  1.00 99.81  ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 15.576  78.657 33.926  1.00 99.81  ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 13.291  76.985 36.581  1.00 41.27  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 12.016  77.635 36.830  1.00 41.27  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 11.050  76.680 37.477  1.00 41.27  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 9.855   76.642 37.121  1.00 41.27  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.457  78.262 35.552  1.00 63.05  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.338  79.395 35.041  1.00 63.05  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 12.479  80.448 35.689  1.00 63.05  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 12.954  79.179 33.879  1.00 63.05  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.580  75.908 38.442  1.00 35.44  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.792  74.855 39.130  1.00 35.44  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 10.238  73.691 38.277  1.00 35.44  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.303   73.003 38.714  1.00 35.44  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 10.810  73.455 37.089  1.00 38.92  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.431  72.293 36.292  1.00 38.92  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.469  71.173 36.358  1.00 38.92  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.560  71.321 35.842  1.00 38.92  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.194  72.639 34.834  1.00 57.36  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 9.820   71.390 34.064  1.00 57.36  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 9.105   73.652 34.717  1.00 57.36  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 11.102  70.054 36.987  1.00 32.36  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 11.965  68.879 37.060  1.00 32.36  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.584  67.829 36.001  1.00 32.36  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.370  67.592 35.704  1.00 32.36  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.954  68.227 38.470  1.00 24.53  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 12.946  67.070 38.556  1.00 24.53  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 12.288  69.259 39.549  1.00 24.53  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.620  67.209 35.424  1.00 21.17  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.367  66.051 34.599  1.00 21.17  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.657  64.837 35.447  1.00 21.17  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.767  64.710 35.975  1.00 21.17  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 13.198  66.054 33.305  1.00 30.49  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 13.203  64.730 32.597  1.00 30.49  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 12.168  64.385 31.746  1.00 30.49  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 14.229  63.824 32.811  1.00 30.49  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 12.155  63.153 31.100  1.00 30.49  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 14.230  62.618 32.185  1.00 30.49  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 13.177  62.270 31.323  1.00 30.49  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.640  63.968 35.576  1.00 27.90  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.734  62.689 36.312  1.00 27.90  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 11.938  61.519 35.394  1.00 27.90  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 10.982  61.081 34.751  1.00 27.90  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 10.493  62.400 37.042  1.00 35.03  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 10.733  61.239 38.009  1.00 35.03  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 10.095  63.624 37.778  1.00 35.03  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 13.175  61.016 35.348  1.00 29.32  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 13.532  59.933 34.446  1.00 29.32  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 13.193  58.634 35.114  1.00 29.32  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.688  58.349 36.190  1.00 29.32  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 12.331  57.844 34.502  1.00 22.47  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.864  56.645 35.183  1.00 22.47  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 12.076  55.392 34.354  1.00 22.47  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 12.235  55.412 33.130  1.00 22.47  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 10.405  56.762 35.621  1.00 28.82  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.802   55.487 35.757  1.00 28.82  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 12.026  54.276 35.045  1.00 42.32  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 12.455  53.057 34.446  1.00 42.32  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 11.417  51.964 34.721  1.00 42.32  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 11.193  51.104 33.888  1.00 42.32  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 13.810  52.798 35.056  1.00 35.22  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 14.216  51.441 35.130  1.00 35.22  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 15.656  51.499 35.329  1.00 35.22  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 16.076  50.952 36.601  1.00 35.22  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 15.958  49.672 36.961  1.00 35.22  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 15.331  48.757 36.189  1.00 35.22  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 16.459  49.316 38.142  1.00 35.22  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.771  52.053 35.884  1.00 33.30  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 9.738   51.133 36.326  1.00 33.30  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 8.391   51.715 36.046  1.00 33.30  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 7.391   51.061 36.302  1.00 33.30  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 9.841   50.884 37.844  1.00 12.57  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 11.225  50.481 38.391  1.00 12.57  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 11.301  50.535 39.867  1.00 12.57  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 11.470  49.078 37.949  1.00 12.57  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 8.369   52.964 35.582  1.00 24.46  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 7.134   53.673 35.270  1.00 24.46  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 7.299   54.682 34.145  1.00 24.46  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 8.351   54.706 33.480  1.00 24.46  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 6.260   55.498 33.907  1.00 23.57  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 6.326   56.506 32.852  1.00 23.57  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 7.242   57.615 33.338  1.00 23.57  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 7.218   57.955 34.507  1.00 23.57  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.946   57.066 32.557  1.00 24.17  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 4.165   56.240 31.517  1.00 24.17  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 4.648   55.245 30.904  1.00 24.17  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 3.011   56.620 31.280  1.00 24.17  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 8.082   58.162 32.472  1.00 14.72  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.860   59.320 32.853  1.00 14.72  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.916   60.539 32.773  1.00 14.72  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.740   60.422 32.347  1.00 14.72  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 10.049  59.471 31.928  1.00 24.63  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 11.119  58.694 32.412  1.00 24.63  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 8.402   61.707 33.187  1.00 31.64  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 7.515   62.855 33.281  1.00 31.64  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 8.221   64.174 33.561  1.00 31.64  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 9.301   64.215 34.166  1.00 31.64  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 6.391   62.584 34.317  1.00 22.55  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 6.804   62.551 35.780  1.00 22.55  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 5.787   61.856 36.740  1.00 22.55  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 6.193   61.300 37.774  1.00 22.55  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 4.502   61.912 36.429  1.00 22.55  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 7.584   65.252 33.105  1.00 37.87  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 7.916   66.625 33.514  1.00 37.87  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 7.089   66.990 34.704  1.00 37.87  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 5.918   66.681 34.774  1.00 37.87  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.594   67.605 32.392  1.00 35.09  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.735   68.292 31.642  1.00 35.09  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 10.117  67.788 31.967  1.00 35.09  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 8.461   68.154 30.197  1.00 35.09  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 7.696   67.662 35.650  1.00 39.22  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 6.981   68.012 36.868  1.00 39.22  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 7.328   69.456 37.332  1.00 39.22  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 8.474   69.907 37.182  1.00 39.22  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 7.231   66.913 37.925  1.00 31.77  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 7.552   67.493 39.269  1.00 31.77  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 6.068   65.978 37.983  1.00 31.77  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 6.331   70.186 37.833  1.00 42.39  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 6.586   71.516 38.343  1.00 42.39  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.583   71.516 39.844  1.00 42.39  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.590   71.129 40.449  1.00 42.39  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 5.567   72.531 37.821  1.00 61.53  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 5.738   73.961 38.429  1.00 61.53  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 5.768   75.102 37.358  1.00 61.53  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 4.498   75.126 36.430  1.00 61.53  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 3.156   74.920 37.133  1.00 61.53  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.694   71.933 40.442  1.00 41.23  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.759   72.106 41.894  1.00 41.23  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 7.170   73.450 42.240  1.00 41.23  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 7.593   74.461 41.700  1.00 41.23  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 9.195   72.073 42.402  1.00 33.57  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.997   70.806 42.114  1.00 33.57  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 11.454  70.916 42.541  1.00 33.57  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 9.327   69.535 42.711  1.00 33.57  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 6.207   73.481 43.149  1.00 46.81  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.618   74.744 43.534  1.00 46.81  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 6.024   75.172 44.915  1.00 46.81  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 6.405   74.333 45.735  1.00 46.81  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 4.117   74.656 43.420  1.00 30.54  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.659   74.860 42.024  1.00 30.54  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 4.335   75.497 41.214  1.00 30.54  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 2.522   74.295 41.706  1.00 30.54  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 5.939   76.474 45.176  1.00 42.49  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 6.229   77.018 46.511  1.00 42.49  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 5.138   76.698 47.501  1.00 42.49  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 5.438   76.256 48.600  1.00 42.49  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 6.412   78.534 46.515  1.00 29.22  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 6.866   78.990 47.903  1.00 29.22  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 7.384   78.955 45.420  1.00 29.22  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 3.886   76.950 47.125  1.00 47.61  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 2.761   76.563 47.984  1.00 47.61  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 2.265   75.145 47.709  1.00 47.61  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 2.157   74.723 46.557  1.00 47.61  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.605   77.560 47.890  1.00 35.89  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 2.045   78.985 48.144  1.00 35.89  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 2.561   79.288 49.257  1.00 35.89  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 1.874   79.814 47.214  1.00 35.89  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 1.961   74.412 48.778  1.00 37.32  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 1.517   73.051 48.639  1.00 37.32  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? 0.081   73.102 48.249  1.00 37.32  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -0.737  73.467 49.073  1.00 37.32  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 1.644   72.338 49.962  1.00 39.31  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? 0.601   72.722 50.819  1.00 39.31  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -0.246  72.761 47.002  1.00 57.90  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -1.647  72.789 46.532  1.00 57.90  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -2.556  71.841 47.330  1.00 57.90  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -2.165  71.350 48.398  1.00 57.90  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -1.726  72.473 45.030  1.00 64.83  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -1.898  70.967 44.738  1.00 64.83  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -1.432  70.085 45.482  1.00 64.83  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.580  70.677 43.642  1.00 64.83  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -3.756  71.579 46.814  1.00 66.45  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -4.579  70.482 47.314  1.00 66.45  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -3.740  69.202 47.603  1.00 66.45  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -2.593  69.042 47.112  1.00 66.45  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -5.710  70.190 46.325  1.00 101.54 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -6.851  69.374 46.918  1.00 101.54 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -8.112  69.415 46.084  1.00 101.54 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -9.136  68.832 46.513  1.00 101.54 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -8.077  70.028 44.996  1.00 101.54 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.302  68.298 48.409  1.00 62.77  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -3.611  67.050 48.810  1.00 62.77  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -2.357  67.326 49.653  1.00 62.77  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -1.865  66.433 50.355  1.00 62.77  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -3.253  66.154 47.600  1.00 89.33  ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -4.432  65.682 46.721  1.00 89.33  ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -4.739  66.622 45.548  1.00 89.33  ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -5.787  66.525 44.916  1.00 89.33  ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -3.823  67.527 45.256  1.00 89.33  ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -1.844  68.558 49.578  1.00 39.41  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.716  68.980 50.403  1.00 39.41  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.523   68.503 49.717  1.00 39.41  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 1.464   68.056 50.373  1.00 39.41  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.479   68.599 48.388  1.00 55.15  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.591   68.306 47.511  1.00 55.15  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 2.238   69.564 46.886  1.00 55.15  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 1.552   70.439 46.314  1.00 55.15  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 1.114   67.399 46.390  1.00 41.05  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 1.983   67.451 45.267  1.00 41.05  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 3.567   69.639 46.970  1.00 28.45  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 4.285   70.703 46.294  1.00 28.45  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 4.610   70.333 44.855  1.00 28.45  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 5.168   71.169 44.111  1.00 28.45  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 5.561   71.030 47.045  1.00 43.33  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 5.307   71.566 48.430  1.00 43.33  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 5.211   70.708 49.530  1.00 43.33  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 5.167   72.929 48.647  1.00 43.33  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.990   71.199 50.808  1.00 43.33  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 4.948   73.422 49.929  1.00 43.33  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.859   72.553 50.994  1.00 43.33  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 4.638   73.058 52.233  1.00 43.33  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 4.292   69.081 44.486  1.00 47.76  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 4.611   68.544 43.159  1.00 47.76  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 3.363   68.466 42.316  1.00 47.76  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 2.354   67.905 42.723  1.00 47.76  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 5.248   67.124 43.182  1.00 34.64  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 5.721   66.762 41.810  1.00 34.64  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 6.404   67.047 44.134  1.00 34.64  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 3.433   69.039 41.132  1.00 35.97  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 2.314   68.986 40.243  1.00 35.97  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 2.882   68.522 38.942  1.00 35.97  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 3.867   69.113 38.477  1.00 35.97  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 1.718   70.383 40.049  1.00 33.77  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.635   70.377 38.927  1.00 33.77  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? 1.191   70.948 41.411  1.00 33.77  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 2.283   67.471 38.362  1.00 39.69  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.759   66.895 37.092  1.00 39.69  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 2.305   67.783 35.965  1.00 39.69  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 1.191   68.241 35.993  1.00 39.69  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 2.227   65.507 36.903  1.00 2.70   ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 3.190   68.073 35.021  1.00 42.49  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 2.842   68.835 33.828  1.00 42.49  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 2.680   67.856 32.678  1.00 42.49  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 1.733   67.963 31.894  1.00 42.49  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 3.944   69.821 33.432  1.00 56.06  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 4.231   70.948 34.391  1.00 56.06  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 5.975   71.469 34.244  1.00 56.06  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 6.077   72.319 32.646  1.00 56.06  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 3.622   66.916 32.573  1.00 38.57  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 3.724   66.046 31.418  1.00 38.57  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 4.187   64.630 31.761  1.00 38.57  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 5.045   64.422 32.637  1.00 38.57  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.677   66.658 30.405  1.00 78.17  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 4.440   66.233 28.990  1.00 78.17  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 4.955   67.262 28.031  1.00 78.17  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 4.733   68.456 28.280  1.00 78.17  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 5.589   66.904 27.026  1.00 78.17  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.635   63.670 31.018  1.00 36.30  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 3.934   62.257 31.216  1.00 36.30  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 4.548   61.530 30.018  1.00 36.30  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 4.091   61.681 28.902  1.00 36.30  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.651   61.584 31.559  1.00 34.31  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 2.387   61.818 32.949  1.00 34.31  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 2.776   60.118 31.306  1.00 34.31  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 5.566   60.712 30.233  1.00 30.11  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 6.127   59.958 29.076  1.00 30.11  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 6.080   58.424 29.117  1.00 30.11  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 6.690   57.788 29.961  1.00 30.11  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 7.512   60.468 28.694  1.00 41.44  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.610   61.966 28.673  1.00 41.44  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 8.324   62.649 29.674  1.00 41.44  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 6.975   62.704 27.672  1.00 41.44  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.409   64.032 29.655  1.00 41.44  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 7.057   64.086 27.648  1.00 41.44  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 7.765   64.757 28.626  1.00 41.44  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 5.333   57.875 28.169  1.00 28.88  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 5.115   56.444 28.013  1.00 28.88  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 6.360   55.595 28.079  1.00 28.88  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 7.241   55.713 27.237  1.00 28.88  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 4.411   56.128 26.671  1.00 30.04  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 3.045   56.557 26.757  1.00 30.04  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 4.427   54.648 26.390  1.00 30.04  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 6.408   54.723 29.076  1.00 20.92  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 7.460   53.733 29.183  1.00 20.92  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.800   52.411 29.243  1.00 20.92  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 5.956   52.168 30.129  1.00 20.92  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 8.247   53.928 30.486  1.00 24.38  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 9.314   52.870 30.694  1.00 24.38  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.816   52.728 31.797  1.00 24.38  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.671   52.143 29.651  1.00 24.38  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 7.179   51.515 28.355  1.00 23.63  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 6.716   50.141 28.561  1.00 23.63  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 7.338   49.393 29.764  1.00 23.63  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 7.009   48.258 29.968  1.00 23.63  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 6.750   49.362 27.260  1.00 18.11  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 6.090   50.098 26.098  1.00 18.11  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 6.247   49.331 24.843  1.00 18.11  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 4.642   50.323 26.323  1.00 18.11  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 8.150   50.106 30.571  1.00 42.01  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 8.493   49.761 31.975  1.00 42.01  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 9.189   48.485 31.783  1.00 42.01  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.471   48.189 30.651  1.00 42.01  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 9.472   47.726 32.843  1.00 21.03  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.864   46.363 32.473  1.00 21.03  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 8.657   45.658 31.873  1.00 21.03  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 7.593   45.566 32.496  1.00 21.03  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 10.294  45.707 33.788  1.00 17.36  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 10.553  46.820 34.709  1.00 17.36  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 9.525   47.930 34.285  1.00 17.36  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 8.790   45.187 30.650  1.00 19.28  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 7.800   44.249 30.156  1.00 19.28  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.987   42.886 30.782  1.00 19.28  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.837   42.120 30.371  1.00 19.28  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.866   44.065 28.663  1.00 20.08  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 7.864   45.433 27.961  1.00 20.08  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.730   43.170 28.199  1.00 20.08  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.493   45.434 26.464  1.00 20.08  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 7.204   42.612 31.813  1.00 17.41  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 7.384   41.425 32.626  1.00 17.41  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 6.831   40.174 31.921  1.00 17.41  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 7.491   39.188 31.900  1.00 17.41  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.710   41.689 33.960  1.00 25.19  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 6.119   40.440 34.579  1.00 25.19  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 7.694   42.379 34.847  1.00 25.19  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.643   40.229 31.330  1.00 19.80  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 5.071   39.112 30.615  1.00 19.80  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 4.138   39.706 29.550  1.00 19.80  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.758   40.876 29.687  1.00 19.80  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 4.324   38.222 31.599  1.00 36.26  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 3.493   37.142 30.924  1.00 36.26  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 3.769   36.777 29.761  1.00 36.26  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 2.546   36.652 31.592  1.00 36.26  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.785   38.956 28.489  1.00 23.25  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.868   39.479 27.442  1.00 23.25  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 2.070   38.421 26.636  1.00 23.25  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 2.403   37.253 26.674  1.00 23.25  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 3.640   40.384 26.492  1.00 34.88  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.920   39.791 25.972  1.00 34.88  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 5.702   40.902 24.782  1.00 34.88  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 5.917   39.855 23.368  1.00 34.88  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 1.021   38.797 25.912  1.00 35.26  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? 0.471   37.881 24.911  1.00 35.26  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.149  38.626 23.743  1.00 35.26  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.661  39.725 23.927  1.00 35.26  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -0.536  36.929 25.517  1.00 48.12  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -1.976  37.751 26.120  1.00 48.12  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -0.095  38.041 22.547  1.00 38.72  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -0.710  38.648 21.367  1.00 38.72  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -2.177  38.223 21.225  1.00 38.72  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -2.523  37.062 21.452  1.00 38.72  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? 0.041   38.279 20.075  1.00 23.15  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -0.717  38.766 18.894  1.00 23.15  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 1.391   38.890 20.060  1.00 23.15  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.035  39.164 20.844  1.00 43.57  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -4.472  38.912 20.691  1.00 43.57  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.077  39.749 19.554  1.00 43.57  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -4.867  40.973 19.501  1.00 43.57  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -5.218  39.236 21.996  1.00 25.37  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -6.701  39.210 21.785  1.00 25.37  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -4.873  38.216 23.037  1.00 25.37  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -5.835  39.097 18.663  1.00 64.49  ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -6.596  39.809 17.633  1.00 64.49  ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -7.767  40.441 18.349  1.00 64.49  ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -8.886  39.961 18.244  1.00 64.49  ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -7.138  38.861 16.563  1.00 111.73 ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -6.094  37.910 16.025  1.00 111.73 ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -5.453  37.190 16.825  1.00 111.73 ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -5.947  37.856 14.788  1.00 111.73 ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -7.511  41.514 19.083  1.00 102.14 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -8.490  42.024 20.030  1.00 102.14 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -9.816  42.467 19.435  1.00 102.14 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -10.858 41.909 19.784  1.00 102.14 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -7.894  43.137 20.877  1.00 46.20  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -7.412  42.735 22.255  1.00 46.20  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -6.670  43.926 22.774  1.00 46.20  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -8.592  42.341 23.185  1.00 46.20  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -9.792  43.459 18.548  1.00 94.26  ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -11.046 43.937 17.972  1.00 94.26  ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -11.490 43.126 16.744  1.00 94.26  ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -11.880 43.682 15.717  1.00 94.26  ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -11.012 45.448 17.734  1.00 89.46  ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -11.289 46.245 19.025  1.00 89.46  ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -12.690 46.003 19.616  1.00 89.46  ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -13.640 46.683 19.178  1.00 89.46  ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -12.843 45.150 20.522  1.00 89.46  ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.440 41.800 16.896  1.00 103.27 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -11.722 40.818 15.837  1.00 103.27 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.399 41.281 14.415  1.00 103.27 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -12.251 41.286 13.527  1.00 103.27 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -13.154 40.278 15.946  1.00 142.68 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -13.314 39.109 16.948  1.00 142.68 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -14.805 38.828 17.187  1.00 142.68 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -15.474 39.976 17.869  1.00 142.68 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -16.795 40.264 17.778  1.00 142.68 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -17.617 39.494 17.024  1.00 142.68 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -17.294 41.335 18.441  1.00 142.68 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -10.154 41.687 14.224  1.00 120.46 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -9.629  41.971 12.908  1.00 120.46 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -8.467  41.016 12.778  1.00 120.46 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -7.755  40.792 13.762  1.00 120.46 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.159  43.426 12.842  1.00 102.45 ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -10.304 44.453 12.864  1.00 102.45 ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -10.147 45.546 13.923  1.00 102.45 ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -9.271  45.490 14.791  1.00 102.45 ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -11.022 46.541 13.861  1.00 102.45 ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -8.286  40.418 11.601  1.00 48.63  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -7.155  39.498 11.390  1.00 48.63  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.761  40.079 11.619  1.00 48.63  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -4.813  39.637 10.989  1.00 48.63  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -5.628  41.060 12.516  1.00 124.34 ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.330  41.684 12.840  1.00 124.34 ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -3.674  41.120 14.108  1.00 124.34 ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -4.162  40.157 14.698  1.00 124.34 ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -4.475  43.208 12.982  1.00 81.05  ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -5.690  43.698 13.813  1.00 81.05  ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -5.642  43.368 15.321  1.00 81.05  ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -4.718  42.726 15.809  1.00 81.05  ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.662  43.816 16.055  1.00 81.05  ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -2.578  41.747 14.532  1.00 135.62 ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -1.952  41.437 15.814  1.00 135.62 ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -1.868  42.644 16.734  1.00 135.62 ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -1.381  43.706 16.340  1.00 135.62 ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -2.354  42.479 17.961  1.00 41.66  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -2.256  43.503 18.990  1.00 41.66  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -1.479  42.965 20.176  1.00 41.66  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -1.550  41.786 20.484  1.00 41.66  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -3.639  43.890 19.453  1.00 54.42  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -4.303  44.878 18.568  1.00 54.42  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -5.341  45.652 19.320  1.00 54.42  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -5.108  46.777 19.771  1.00 54.42  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -6.488  45.042 19.505  1.00 54.42  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -0.740  43.791 20.883  1.00 45.56  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? 0.043   43.214 21.960  1.00 45.56  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -0.367  43.752 23.327  1.00 45.56  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -0.547  44.964 23.473  1.00 45.56  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 1.519   43.451 21.691  1.00 27.36  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 2.536   42.456 22.230  1.00 27.36  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 3.944   42.985 22.179  1.00 27.36  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 2.227   42.240 23.654  1.00 27.36  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -0.537  42.874 24.322  1.00 37.09  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -0.853  43.347 25.683  1.00 37.09  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? 0.170   42.882 26.673  1.00 37.09  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? 0.477   41.699 26.729  1.00 37.09  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -2.234  42.941 26.191  1.00 28.24  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -3.327  43.483 25.294  1.00 28.24  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -2.325  41.467 26.233  1.00 28.24  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.682   43.832 27.456  1.00 30.34  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.839   43.587 28.297  1.00 30.34  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 1.547   43.859 29.747  1.00 30.34  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? 0.808   44.786 30.092  1.00 30.34  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 3.003   44.502 27.913  1.00 21.94  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 2.765   45.846 28.421  1.00 21.94  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 3.207   44.503 26.389  1.00 21.94  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 2.159   43.057 30.594  1.00 26.36  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 2.336   43.411 31.965  1.00 26.36  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 3.563   44.299 32.026  1.00 26.36  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 4.647   43.841 31.637  1.00 26.36  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 2.561   42.121 32.752  1.00 24.47  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 1.235   40.928 32.428  1.00 24.47  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 3.406   45.540 32.554  1.00 24.08  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 4.496   46.542 32.580  1.00 24.08  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 4.531   47.291 33.851  1.00 24.08  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 3.455   47.541 34.411  1.00 24.08  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 4.267   47.516 31.431  1.00 22.16  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 4.029   46.792 30.245  1.00 22.16  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 5.750   47.648 34.285  1.00 21.24  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 5.991   48.452 35.494  1.00 21.24  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 6.185   47.552 36.676  1.00 21.24  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 6.084   46.307 36.463  1.00 21.24  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 6.424   48.160 37.885  1.00 32.53  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 6.361   47.457 39.191  1.00 32.53  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 5.617   48.384 40.157  1.00 32.53  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 5.468   49.610 39.852  1.00 32.53  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 7.740   47.235 39.617  1.00 35.18  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 5.145   47.818 41.231  1.00 28.44  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 4.580   48.591 42.294  1.00 28.44  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 3.437   49.530 41.878  1.00 28.44  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 2.703   49.203 40.929  1.00 28.44  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 5.672   49.231 42.973  1.00 8.81   ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 6.909   48.293 43.040  1.00 8.81   ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 8.109   48.667 42.479  1.00 8.81   ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 6.909   47.074 43.755  1.00 8.81   ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 9.314   47.797 42.522  1.00 8.81   ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 8.129   46.185 43.837  1.00 8.81   ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 9.325   46.543 43.224  1.00 8.81   ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 3.378   50.719 42.549  1.00 25.00  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 2.290   51.624 42.408  1.00 25.00  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 2.337   52.246 40.922  1.00 25.00  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 1.425   52.960 40.517  1.00 25.00  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 2.603   52.847 43.398  1.00 18.18  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 3.570   54.177 42.739  1.00 18.18  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 4.624   54.735 43.790  1.00 18.18  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 4.483   56.220 43.299  1.00 18.18  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 4.696   56.555 41.611  1.00 18.18  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 3.375   51.712 40.203  1.00 20.50  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 3.682   51.966 38.620  1.00 20.50  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 3.237   50.933 37.568  1.00 20.50  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 3.372   51.095 36.291  1.00 20.50  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 5.165   52.279 38.336  1.00 29.10  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.449   53.770 37.873  1.00 29.10  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 5.175   54.858 39.003  1.00 29.10  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 4.077   55.448 39.018  1.00 29.10  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 6.095   55.138 39.834  1.00 29.10  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 2.725   49.829 38.101  1.00 22.59  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 2.324   48.724 37.200  1.00 22.59  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 1.086   49.029 36.354  1.00 22.59  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? 0.208   49.811 36.701  1.00 22.59  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 0.988   48.365 35.232  1.00 21.81  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? -0.115  48.610 34.309  1.00 21.81  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.198  47.506 33.301  1.00 21.81  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? 0.699   46.658 33.199  1.00 21.81  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? 0.122   49.896 33.496  1.00 32.12  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 1.000   49.697 32.390  1.00 32.12  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -1.254  47.534 32.512  1.00 22.89  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -1.171  46.843 31.235  1.00 22.89  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -0.984  47.865 30.139  1.00 22.89  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -1.397  49.047 30.278  1.00 22.89  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -2.400  46.017 30.921  1.00 17.78  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -3.094  45.242 32.019  1.00 17.78  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -4.280  44.633 31.370  1.00 17.78  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.212  44.152 32.703  1.00 17.78  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -0.336  47.433 29.066  1.00 31.65  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -0.235  48.275 27.882  1.00 31.65  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -0.771  47.555 26.647  1.00 31.65  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.424  46.407 26.387  1.00 31.65  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 1.203   48.757 27.669  1.00 25.69  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 1.781   49.466 28.853  1.00 25.69  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 1.432   50.967 28.997  1.00 25.69  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 1.956   51.495 30.276  1.00 25.69  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 2.504   52.700 30.453  1.00 25.69  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 2.602   53.544 29.441  1.00 25.69  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 2.966   53.072 31.632  1.00 25.69  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -1.645  48.204 25.899  1.00 42.00  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -2.075  47.581 24.667  1.00 42.00  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -1.394  48.250 23.498  1.00 42.00  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -1.490  49.468 23.343  1.00 42.00  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -3.585  47.620 24.460  1.00 19.74  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -4.336  47.107 25.696  1.00 19.74  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -3.947  46.765 23.204  1.00 19.74  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -4.409  48.068 26.839  1.00 19.74  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -0.712  47.456 22.677  1.00 30.20  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? 0.018   47.994 21.548  1.00 30.20  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -0.546  47.527 20.218  1.00 30.20  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -0.555  46.324 19.931  1.00 30.20  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 1.470   47.613 21.636  1.00 32.62  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 2.088   48.248 22.881  1.00 32.62  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 2.220   48.082 20.385  1.00 32.62  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.111   47.366 24.064  1.00 32.62  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -1.035  48.475 19.420  1.00 47.60  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.650  48.191 18.112  1.00 47.60  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -0.772  48.804 17.031  1.00 47.60  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? -0.114  49.824 17.239  1.00 47.60  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -3.057  48.787 18.043  1.00 83.81  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -3.813  48.606 16.730  1.00 83.81  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -5.200  49.295 16.811  1.00 83.81  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -6.328  48.371 17.067  1.00 83.81  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -7.403  48.640 17.823  1.00 83.81  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -7.522  49.806 18.453  1.00 83.81  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -8.359  47.728 17.963  1.00 83.81  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.754  48.167 15.874  1.00 57.72  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? 0.050   48.623 14.754  1.00 57.72  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -0.777  49.542 13.832  1.00 57.72  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -1.970  49.305 13.643  1.00 57.72  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.522   47.380 14.011  1.00 80.65  ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 1.912   47.524 13.465  1.00 80.65  ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 2.208   48.477 12.744  1.00 80.65  ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 2.774   46.562 13.780  1.00 80.65  ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.165  50.587 13.277  1.00 46.29  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -0.870  51.503 12.379  1.00 46.29  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -1.790  52.537 13.028  1.00 46.29  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -2.057  52.488 14.217  1.00 46.29  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -2.251  53.502 12.238  1.00 58.34  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.308  54.433 12.638  1.00 58.34  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -4.636  53.796 12.222  1.00 58.34  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -4.733  53.233 11.125  1.00 58.34  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.187  55.787 11.863  1.00 33.10  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -1.750  56.321 11.843  1.00 33.10  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.165  56.829 12.373  1.00 33.10  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.230  56.735 13.194  1.00 33.10  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -5.661  53.892 13.066  1.00 60.89  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -6.983  53.368 12.710  1.00 60.89  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.012  54.473 12.626  1.00 60.89  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -7.723  55.615 12.975  1.00 60.89  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.207  54.133 12.145  1.00 63.21  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.363 55.050 12.146  1.00 63.21  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -11.668 54.303 12.422  1.00 63.21  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -11.904 53.230 11.848  1.00 63.21  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.519 55.850 10.812  1.00 100.21 ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -10.140 55.003 9.594   1.00 100.21 ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.718  57.131 10.840  1.00 100.21 ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -11.317 54.339 8.954   1.00 100.21 ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -12.511 54.861 13.295  1.00 91.54  ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -13.768 54.201 13.684  1.00 91.54  ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -14.916 54.788 12.864  1.00 91.54  ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -14.979 56.004 12.654  1.00 91.54  ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.029 54.307 15.204  1.00 103.01 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -12.953 53.700 16.070  1.00 103.01 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -13.237 52.914 17.169  1.00 103.01 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -11.599 53.783 16.013  1.00 103.01 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -12.108 52.535 17.744  1.00 103.01 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -11.100 53.048 17.060  1.00 103.01 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -15.812 53.912 12.409  1.00 145.64 ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -16.784 54.243 11.362  1.00 145.64 ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.178 54.573 11.877  1.00 145.64 ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -18.747 53.837 12.690  1.00 145.64 ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.881 53.112 10.335  1.00 94.59  ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -15.540 52.612 9.824   1.00 94.59  ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -15.676 51.699 8.636   1.00 94.59  ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -16.784 51.643 8.065   1.00 94.59  ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -14.679 51.041 8.270   1.00 94.59  ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -18.719 55.675 11.358  1.00 110.75 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -20.039 56.199 11.724  1.00 110.75 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -21.102 55.714 10.718  1.00 110.75 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -21.940 54.869 11.057  1.00 110.75 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -20.010 57.737 11.792  1.00 94.85  ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -18.995 58.306 12.746  1.00 94.85  ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -17.647 58.012 12.679  1.00 94.85  ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -19.130 59.189 13.766  1.00 94.85  ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -17.001 58.667 13.629  1.00 94.85  ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -17.877 59.395 14.298  1.00 94.85  ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -21.058 56.243 9.490   1.00 135.51 ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -21.922 55.768 8.399   1.00 135.51 ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -21.149 55.050 7.305   1.00 135.51 ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -19.959 55.303 7.087   1.00 135.51 ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -22.719 56.900 7.793   1.00 55.25  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -21.851 54.155 6.617   1.00 113.94 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.314 53.467 5.452   1.00 113.94 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.393 53.344 4.375   1.00 113.94 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -23.412 52.668 4.567   1.00 113.94 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -20.747 52.095 5.837   1.00 94.33  ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -20.054 51.491 4.750   1.00 94.33  ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.158 54.031 3.258   1.00 172.23 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -23.052 54.025 2.103   1.00 172.23 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -22.322 53.426 0.917   1.00 172.23 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.159 53.750 0.665   1.00 172.23 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.485 55.455 1.690   1.00 72.40  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.289 56.162 2.796   1.00 72.40  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -24.269 55.409 0.384   1.00 72.40  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.428 56.839 3.864   1.00 72.40  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -23.013 52.566 0.179   1.00 110.62 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -22.434 51.944 -1.011  1.00 110.62 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -22.738 52.760 -2.264  1.00 110.62 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -23.860 53.247 -2.425  1.00 110.62 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -22.919 50.499 -1.166  1.00 114.41 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -22.481 49.606 -0.005  1.00 114.41 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -21.815 48.575 -0.262  1.00 114.41 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -22.791 49.937 1.167   1.00 114.41 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -21.727 52.920 -3.127  1.00 101.74 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -21.843 53.669 -4.390  1.00 101.74 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -20.574 53.502 -5.250  1.00 101.74 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -19.734 54.397 -5.287  1.00 101.74 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -22.138 55.154 -4.110  1.00 135.71 ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -23.278 55.900 -4.828  1.00 135.71 ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -24.460 55.009 -5.233  1.00 135.71 ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -23.775 57.047 -3.952  1.00 135.71 ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -20.442 52.346 -5.947  1.00 104.47 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -19.270 51.904 -6.741  1.00 104.47 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -18.684 52.916 -7.724  1.00 104.47 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -19.377 53.835 -8.161  1.00 104.47 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -19.817 50.716 -7.535  1.00 121.28 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -20.903 50.179 -6.697  1.00 121.28 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -21.525 51.344 -5.989  1.00 121.28 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -17.407 52.732 -8.062  1.00 113.24 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -16.743 53.504 -9.119  1.00 113.24 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -16.817 55.026 -9.062  1.00 113.24 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -16.863 55.680 -10.111 1.00 113.24 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -16.846 55.578 -7.844  1.00 74.31  ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.634 57.004 -7.596  1.00 74.31  ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.239 57.385 -8.081  1.00 74.31  ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.309 56.572 -8.021  1.00 74.31  ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.710 57.337 -6.089  1.00 63.77  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -18.063 56.930 -5.509  1.00 63.77  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.470 58.831 -5.850  1.00 63.77  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.056 56.690 -3.979  1.00 63.77  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -15.085 58.619 -8.558  1.00 84.42  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.766 59.085 -8.971  1.00 84.42  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -13.377 60.479 -8.447  1.00 84.42  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.479 61.119 -8.989  1.00 84.42  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -13.574 58.935 -10.495 1.00 88.86  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -13.622 57.468 -10.960 1.00 88.86  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -13.001 57.204 -12.352 1.00 88.86  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -12.815 55.612 -12.437 1.00 88.86  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -11.910 55.255 -13.570 1.00 88.86  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -14.013 60.924 -7.368  1.00 84.69  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -13.605 62.176 -6.733  1.00 84.69  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.633 62.775 -5.795  1.00 84.69  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.844 62.661 -6.040  1.00 84.69  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -14.156 63.405 -4.713  1.00 68.04  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -15.052 64.103 -3.786  1.00 68.04  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -14.474 65.286 -3.030  1.00 68.04  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -13.317 65.290 -2.596  1.00 68.04  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -15.804 63.153 -2.839  1.00 96.22  ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -15.153 61.924 -2.222  1.00 96.22  ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -15.867 61.593 -0.930  1.00 96.22  ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -15.211 60.751 -3.188  1.00 96.22  ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -15.337 66.294 -2.911  1.00 125.07 ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -15.060 67.548 -2.236  1.00 125.07 ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -16.222 67.852 -1.301  1.00 125.07 ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -17.380 67.607 -1.662  1.00 125.07 ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -14.913 68.682 -3.253  1.00 84.08  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -13.858 68.425 -4.265  1.00 84.08  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -12.582 68.931 -4.285  1.00 84.08  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -13.971 67.574 -5.394  1.00 84.08  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -11.899 68.446 -5.374  1.00 84.08  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -12.729 67.604 -6.066  1.00 84.08  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -15.006 66.784 -5.909  1.00 84.08  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -12.494 66.874 -7.231  1.00 84.08  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -14.776 66.046 -7.063  1.00 84.08  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -13.526 66.100 -7.716  1.00 84.08  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -15.916 68.401 -0.104  1.00 105.89 ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -16.877 68.762 0.959   1.00 105.89 ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -17.837 69.869 0.499   1.00 105.89 ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -17.758 70.272 -0.664  1.00 105.89 ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -15.962 69.278 2.078   1.00 85.89  ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -14.702 69.755 1.354   1.00 85.89  ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -14.526 68.739 0.273   1.00 85.89  ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -18.721 70.366 1.377   1.00 83.99  ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -19.655 71.455 0.982   1.00 83.99  ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -20.626 71.994 2.047   1.00 83.99  ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -21.664 71.386 2.352   1.00 83.99  ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -20.450 71.050 -0.273  1.00 150.91 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -20.798 72.112 -1.314  1.00 150.91 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -19.538 72.684 -1.945  1.00 150.91 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -21.692 71.507 -2.380  1.00 150.91 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -20.289 73.160 2.581   1.00 127.08 ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.153 73.862 3.518   1.00 127.08 ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.165 74.714 2.753   1.00 127.08 ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -21.812 75.354 1.764   1.00 127.08 ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -20.292 74.682 4.478   1.00 94.62  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -20.816 76.044 4.850   1.00 94.62  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -19.766 76.844 5.619   1.00 94.62  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -18.384 76.466 5.306   1.00 94.62  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -17.480 77.276 4.766   1.00 94.62  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -17.795 78.531 4.465   1.00 94.62  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -16.256 76.826 4.535   1.00 94.62  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -23.417 74.707 3.216   1.00 144.78 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -24.542 75.338 2.509   1.00 144.78 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -24.956 76.694 3.128   1.00 144.78 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.153 76.979 3.286   1.00 144.78 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -25.735 74.367 2.479   1.00 103.70 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -26.264 74.172 1.171   1.00 103.70 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -23.959 77.519 3.467   1.00 187.13 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -24.171 78.846 4.072   1.00 187.13 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -22.857 79.647 4.086   1.00 187.13 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -21.782 79.060 4.224   1.00 187.13 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -24.708 78.697 5.502   1.00 163.31 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -25.939 79.551 5.762   1.00 163.31 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -26.192 79.878 6.942   1.00 163.31 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -26.657 79.887 4.797   1.00 163.31 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -22.927 80.989 3.951   1.00 120.16 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -21.662 81.742 3.947   1.00 120.16 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -21.104 82.049 5.356   1.00 120.16 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -20.402 83.054 5.546   1.00 120.16 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -22.033 83.036 3.205   1.00 147.97 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -23.499 83.229 3.475   1.00 147.97 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -24.100 81.873 3.788   1.00 147.97 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -21.405 81.187 6.328   1.00 186.05 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -21.118 81.485 7.732   1.00 186.05 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -20.587 80.292 8.539   1.00 186.05 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -19.450 80.310 9.024   1.00 186.05 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -22.377 82.038 8.428   1.00 196.01 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -23.397 82.618 7.448   1.00 196.01 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -23.155 83.639 6.801   1.00 196.01 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -24.550 81.967 7.350   1.00 196.01 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -21.425 79.260 8.655   1.00 179.46 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -21.270 78.161 9.620   1.00 179.46 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -20.562 76.926 9.054   1.00 179.46 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -21.137 76.194 8.241   1.00 179.46 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -22.654 77.765 10.143  1.00 185.14 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -23.728 77.728 9.050   1.00 185.14 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -25.121 77.641 9.628   1.00 185.14 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -25.402 76.310 10.162  1.00 185.14 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -26.452 76.010 10.929  1.00 185.14 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -27.334 76.949 11.268  1.00 185.14 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -26.618 74.766 11.365  1.00 185.14 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -19.334 76.678 9.517   1.00 182.94 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -18.463 75.620 8.962   1.00 182.94 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -18.903 74.186 9.281   1.00 182.94 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -18.074 73.271 9.303   1.00 182.94 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -17.005 75.822 9.394   1.00 96.56  ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -16.516 77.250 9.288   1.00 96.56  ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -15.575 77.605 10.412  1.00 96.56  ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -14.797 76.719 10.810  1.00 96.56  ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -15.615 78.757 10.901  1.00 96.56  ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -20.198 74.004 9.539   1.00 201.38 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.805 72.675 9.630   1.00 201.38 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -21.378 72.279 8.260   1.00 201.38 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -22.593 72.115 8.104   1.00 201.38 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -21.896 72.577 10.749  1.00 90.28  ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -22.589 73.826 10.870  1.00 90.28  ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -21.280 72.209 12.101  1.00 90.28  ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -20.481 72.154 7.276   1.00 116.51 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -20.792 71.669 5.922   1.00 116.51 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -21.925 70.626 5.913   1.00 116.51 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -21.901 69.676 6.700   1.00 116.51 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -19.531 71.073 5.266   1.00 150.23 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -18.281 71.951 5.272   1.00 150.23 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -17.572 72.191 6.456   1.00 150.23 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -17.779 72.497 4.085   1.00 150.23 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -16.416 72.979 6.469   1.00 150.23 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -16.624 73.292 4.083   1.00 150.23 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -15.947 73.524 5.280   1.00 150.23 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -14.805 74.298 5.291   1.00 150.23 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -22.913 70.802 5.034   1.00 88.33  ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.094 69.921 5.039   1.00 88.33  ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.384 69.232 3.694   1.00 88.33  ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.462 68.640 3.506   1.00 88.33  ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -25.340 70.659 5.588   1.00 95.58  ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -26.157 71.370 4.499   1.00 95.58  ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.367 71.616 4.716   1.00 95.58  ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.594 71.680 3.430   1.00 95.58  ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.415 69.310 2.777   1.00 126.05 ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.536 68.723 1.438   1.00 126.05 ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -22.250 68.054 1.006   1.00 126.05 ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -21.165 68.498 1.360   1.00 126.05 ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -23.824 69.792 0.379   1.00 119.03 ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -24.549 70.881 0.968   1.00 119.03 ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.596 69.196 -0.802  1.00 119.03 ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -22.377 66.989 0.227   1.00 94.27  ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -21.217 66.354 -0.394  1.00 94.27  ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -21.577 65.929 -1.799  1.00 94.27  ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -22.704 65.498 -2.039  1.00 94.27  ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -20.745 65.139 0.398   1.00 112.68 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -19.304 64.702 0.108   1.00 112.68 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -18.315 65.338 1.093   1.00 112.68 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -19.207 63.185 0.150   1.00 112.68 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.625 66.069 -2.724  1.00 155.04 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.875 65.789 -4.137  1.00 155.04 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.802 64.884 -4.742  1.00 155.04 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.605 65.201 -4.710  1.00 155.04 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -21.027 67.081 -4.984  1.00 124.67 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -21.739 66.772 -6.279  1.00 124.67 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -21.806 68.153 -4.228  1.00 124.67 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -20.267 63.762 -5.296  1.00 98.33  ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -19.419 62.735 -5.910  1.00 98.33  ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -19.280 62.939 -7.413  1.00 98.33  ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -20.267 63.156 -8.108  1.00 98.33  ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -19.993 61.320 -5.654  1.00 93.50  ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -20.103 60.691 -4.245  1.00 93.50  ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -20.998 59.451 -4.250  1.00 93.50  ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -18.734 60.361 -3.617  1.00 93.50  ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -18.054 62.863 -7.914  1.00 119.59 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -17.849 62.735 -9.348  1.00 119.59 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.789 61.257 -9.723  1.00 119.59 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -17.075 60.473 -9.088  1.00 119.59 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -16.565 63.436 -9.788  1.00 104.17 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -16.430 63.397 -11.201 1.00 104.17 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -18.556 60.878 -10.739 1.00 82.37  ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -18.429 59.555 -11.332 1.00 82.37  ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -17.862 59.732 -12.730 1.00 82.37  ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -17.576 60.865 -13.136 1.00 82.37  ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -19.777 58.837 -11.384 1.00 121.78 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -20.546 58.904 -10.104 1.00 121.78 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -21.667 59.725 -10.000 1.00 121.78 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -20.149 58.159 -8.997  1.00 121.78 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -22.388 59.801 -8.813  1.00 121.78 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -20.861 58.229 -7.803  1.00 121.78 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -21.985 59.053 -7.713  1.00 121.78 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -17.716 58.617 -13.454 1.00 93.69  ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -17.165 58.585 -14.816 1.00 93.69  ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -17.490 59.836 -15.606 1.00 93.69  ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -16.602 60.627 -15.905 1.00 93.69  ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -17.660 57.369 -15.636 1.00 76.24  ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -16.933 57.303 -16.983 1.00 76.24  ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -17.447 56.077 -14.866 1.00 76.24  ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -18.759 60.006 -15.949 1.00 90.63  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -19.170 61.173 -16.708 1.00 90.63  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -20.372 61.819 -16.072 1.00 90.63  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -21.185 62.422 -16.765 1.00 90.63  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -20.494 61.681 -14.753 1.00 118.54 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -21.666 62.188 -14.041 1.00 118.54 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -21.304 62.995 -12.800 1.00 118.54 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -20.120 63.193 -12.500 1.00 118.54 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -22.626 61.047 -13.682 1.00 108.93 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -23.253 60.374 -14.899 1.00 108.93 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -24.760 60.225 -14.786 1.00 108.93 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -25.511 60.847 -15.543 1.00 108.93 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -25.213 59.407 -13.835 1.00 108.93 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -22.341 63.471 -12.107 1.00 150.61 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -22.219 64.204 -10.842 1.00 150.61 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -23.592 64.245 -10.131 1.00 150.61 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -24.458 65.053 -10.484 1.00 150.61 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -21.635 65.653 -11.051 1.00 89.90  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -20.354 65.584 -11.697 1.00 89.90  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -21.481 66.403 -9.726  1.00 89.90  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -23.786 63.357 -9.150  1.00 134.11 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -24.975 63.378 -8.275  1.00 134.11 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -24.695 64.077 -6.940  1.00 134.11 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -23.657 63.854 -6.319  1.00 134.11 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -25.508 61.967 -8.024  1.00 115.21 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -26.602 61.517 -8.981  1.00 115.21 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -27.069 60.103 -8.641  1.00 115.21 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -26.216 59.063 -9.230  1.00 115.21 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -25.953 57.878 -8.671  1.00 115.21 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -26.452 57.560 -7.482  1.00 115.21 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -25.170 57.004 -9.296  1.00 115.21 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -25.632 64.918 -6.510  1.00 166.43 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -25.455 65.755 -5.319  1.00 166.43 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -26.276 65.207 -4.148  1.00 166.43 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -27.290 64.536 -4.361  1.00 166.43 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -25.851 67.228 -5.603  1.00 112.70 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -25.360 68.159 -4.495  1.00 112.70 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -25.314 67.683 -6.957  1.00 112.70 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -25.836 65.509 -2.922  1.00 179.93 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -26.460 64.992 -1.695  1.00 179.93 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -26.966 66.092 -0.743  1.00 179.93 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -27.222 67.224 -1.162  1.00 179.93 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -25.490 64.055 -0.954  1.00 134.77 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -24.621 63.052 -1.732  1.00 134.77 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -23.487 62.529 -0.856  1.00 134.77 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -25.421 61.896 -2.319  1.00 134.77 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.123 65.730 0.531   1.00 135.98 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -27.526 66.653 1.596   1.00 135.98 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -27.333 65.970 2.961   1.00 135.98 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -27.236 64.743 3.037   1.00 135.98 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -28.982 67.086 1.398   1.00 176.43 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -29.289 68.504 1.851   1.00 176.43 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -29.431 68.672 3.644   1.00 176.43 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -30.879 67.666 3.998   1.00 176.43 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.263 66.759 4.033   1.00 182.96 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -27.100 66.200 5.380   1.00 182.96 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -28.023 66.827 6.423   1.00 182.96 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -27.812 67.964 6.855   1.00 182.96 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -25.640 66.290 5.850   1.00 85.28  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -24.544 65.605 5.026   1.00 85.28  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -23.190 66.019 5.562   1.00 85.28  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -24.690 64.079 5.019   1.00 85.28  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.040 66.068 6.825   1.00 178.31 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -29.931 66.445 7.926   1.00 178.31 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -29.332 66.038 9.287   1.00 178.31 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -29.984 66.130 10.330  1.00 178.31 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -31.332 65.835 7.697   1.00 108.76 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -32.323 66.130 8.836   1.00 108.76 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -33.020 65.226 9.313   1.00 108.76 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -32.388 67.390 9.268   1.00 108.76 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -28.072 65.607 9.266   1.00 101.50 ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -27.380 65.175 10.470  1.00 101.50 ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -26.722 63.828 10.268  1.00 101.50 ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -25.521 63.742 10.007  1.00 101.50 ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.518 62.774 10.390  1.00 104.32 ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -27.024 61.416 10.204  1.00 104.32 ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -27.506 60.876 8.857   1.00 104.32 ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -27.104 59.790 8.432   1.00 104.32 ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -27.466 60.503 11.360  1.00 143.53 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -27.615 61.187 12.741  1.00 143.53 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -26.299 61.398 13.495  1.00 143.53 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -26.227 60.998 14.679  1.00 143.53 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -25.346 61.974 12.923  1.00 143.53 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -28.343 61.662 8.181   1.00 156.71 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -28.952 61.256 6.917   1.00 156.71 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -28.263 61.791 5.659   1.00 156.71 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -27.546 62.798 5.713   1.00 156.71 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -30.442 61.610 6.903   1.00 128.92 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -31.332 60.550 7.542   1.00 128.92 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -31.445 59.262 6.712   1.00 128.92 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -30.405 58.680 6.316   1.00 128.92 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -32.587 58.820 6.467   1.00 128.92 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -28.485 61.101 4.535   1.00 87.23  ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -27.947 61.510 3.229   1.00 87.23  ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -28.982 61.352 2.108   1.00 87.23  ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -29.111 60.277 1.513   1.00 87.23  ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -26.662 60.729 2.831   1.00 113.76 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -25.957 61.451 1.704   1.00 113.76 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -25.708 60.540 4.019   1.00 113.76 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -29.715 62.431 1.835   1.00 190.87 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -30.680 62.489 0.732   1.00 190.87 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -29.959 63.032 -0.506  1.00 190.87 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -28.935 63.703 -0.364  1.00 190.87 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -31.851 63.402 1.109   1.00 133.39 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -33.210 62.937 0.588   1.00 133.39 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -34.131 64.092 0.231   1.00 133.39 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -33.787 64.854 -0.697  1.00 133.39 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -35.201 64.232 0.866   1.00 133.39 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -30.481 62.759 -1.708  1.00 122.38 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -29.717 63.051 -2.939  1.00 122.38 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -30.382 63.791 -4.132  1.00 122.38 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -30.550 63.203 -5.203  1.00 122.38 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -28.990 61.787 -3.433  1.00 134.19 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.879 60.636 -3.885  1.00 134.19 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -29.198 59.767 -4.935  1.00 134.19 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -29.829 59.489 -5.978  1.00 134.19 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -28.027 59.375 -4.726  1.00 134.19 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -30.729 65.066 -3.964  1.00 162.76 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -31.083 65.907 -5.126  1.00 162.76 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -30.062 67.025 -5.338  1.00 162.76 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -29.321 67.386 -4.421  1.00 162.76 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -32.533 66.484 -5.084  1.00 136.11 ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -32.897 66.815 -3.733  1.00 136.11 ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -33.543 65.489 -5.671  1.00 136.11 ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -30.036 67.564 -6.555  1.00 102.79 ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -29.040 68.558 -6.955  1.00 102.79 ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.417 69.981 -6.539  1.00 102.79 ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -30.436 70.193 -5.893  1.00 102.79 ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -28.787 68.485 -8.470  1.00 163.97 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -30.020 68.754 -9.348  1.00 163.97 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -29.663 69.207 -10.759 1.00 163.97 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -28.585 68.818 -11.269 1.00 163.97 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -30.467 69.955 -11.359 1.00 163.97 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -28.568 70.941 -6.904  1.00 179.32 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -28.838 72.369 -6.717  1.00 179.32 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -29.047 73.020 -8.089  1.00 179.32 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -28.792 72.389 -9.119  1.00 179.32 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -27.680 73.046 -5.960  1.00 111.74 ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -27.657 73.160 -4.420  1.00 111.74 ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -27.735 71.815 -3.675  1.00 111.74 ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -26.416 73.927 -3.981  1.00 111.74 ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -29.516 74.269 -8.102  1.00 143.63 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -29.719 75.016 -9.353  1.00 143.63 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -28.391 75.482 -9.958  1.00 143.63 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -27.675 76.293 -9.363  1.00 143.63 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -30.664 76.215 -9.151  1.00 135.84 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -32.093 75.873 -8.713  1.00 135.84 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -33.156 75.269 -10.041 1.00 135.84 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -32.830 73.503 -10.003 1.00 135.84 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -28.069 74.956 -11.138 1.00 164.98 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -26.856 75.335 -11.865 1.00 164.98 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -25.670 74.408 -11.661 1.00 164.98 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -24.523 74.828 -11.814 1.00 164.98 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -25.944 73.150 -11.318 1.00 144.55 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -24.907 72.126 -11.161 1.00 144.55 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -25.038 71.042 -12.216 1.00 144.55 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -25.966 70.228 -12.158 1.00 144.55 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -24.972 71.494 -9.766  1.00 92.60  ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -23.779 71.799 -8.902  1.00 92.60  ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -23.534 73.103 -8.449  1.00 92.60  ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -22.902 70.781 -8.533  1.00 92.60  ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -22.424 73.394 -7.646  1.00 92.60  ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -21.789 71.056 -7.727  1.00 92.60  ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.549 72.367 -7.282  1.00 92.60  ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -24.114 71.033 -13.179 1.00 76.41  ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -24.104 69.986 -14.196 1.00 76.41  ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -24.086 68.643 -13.479 1.00 76.41  ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -23.399 68.477 -12.472 1.00 76.41  ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -22.937 70.104 -15.243 1.00 61.43  ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -23.253 71.146 -16.328 1.00 61.43  ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -21.607 70.380 -14.583 1.00 61.43  ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -24.890 67.718 -13.988 1.00 100.24 ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.069 66.411 -13.384 1.00 100.24 ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -24.872 65.322 -14.430 1.00 100.24 ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -25.044 64.134 -14.147 1.00 100.24 ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.459 66.309 -12.749 1.00 142.38 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.578 66.519 -13.755 1.00 142.38 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -28.353 65.566 -13.976 1.00 142.38 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -27.678 67.628 -14.329 1.00 142.38 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.529 65.745 -15.644 1.00 134.09 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -24.103 64.835 -16.706 1.00 134.09 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -22.651 65.117 -17.108 1.00 134.09 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -22.190 64.667 -18.161 1.00 134.09 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -25.047 64.897 -17.921 1.00 121.56 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -25.442 66.324 -18.306 1.00 121.56 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -26.466 66.479 -19.012 1.00 121.56 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -24.743 67.287 -17.908 1.00 121.56 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -21.946 65.867 -16.256 1.00 110.15 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.514 66.145 -16.428 1.00 110.15 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -19.704 65.713 -15.203 1.00 110.15 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -20.077 66.007 -14.062 1.00 110.15 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -20.249 67.634 -16.712 1.00 109.16 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -21.121 68.280 -17.787 1.00 109.16 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -21.107 67.544 -19.125 1.00 109.16 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -22.139 67.446 -19.794 1.00 109.16 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -19.943 67.031 -19.520 1.00 109.16 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -18.597 65.015 -15.456 1.00 91.12  ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -17.648 64.655 -14.408 1.00 91.12  ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -16.939 65.910 -13.908 1.00 91.12  ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -16.348 66.670 -14.695 1.00 91.12  ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -16.632 63.638 -14.916 1.00 155.77 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -15.484 63.388 -13.956 1.00 155.77 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -14.635 62.205 -14.348 1.00 155.77 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -14.639 61.178 -13.672 1.00 155.77 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -13.905 62.336 -15.451 1.00 155.77 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -17.027 66.114 -12.595 1.00 98.01  ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -16.452 67.270 -11.923 1.00 98.01  ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -15.013 66.952 -11.520 1.00 98.01  ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -14.685 65.807 -11.211 1.00 98.01  ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -17.271 67.618 -10.653 1.00 86.79  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -18.676 67.613 -10.948 1.00 86.79  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -16.904 68.962 -10.137 1.00 86.79  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -14.155 67.965 -11.548 1.00 71.55  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -12.799 67.882 -10.978 1.00 71.55  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -12.648 68.866 -9.820  1.00 71.55  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -11.534 69.146 -9.382  1.00 71.55  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -11.715 68.178 -12.036 1.00 105.95 ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -11.619 67.144 -13.119 1.00 105.95 ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -11.064 65.892 -12.863 1.00 105.95 ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -12.080 67.418 -14.400 1.00 105.95 ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -10.983 64.923 -13.866 1.00 105.95 ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -12.001 66.459 -15.407 1.00 105.95 ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -11.455 65.210 -15.139 1.00 105.95 ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -13.765 69.415 -9.346  1.00 79.96  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -13.750 70.313 -8.194  1.00 79.96  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -15.145 70.665 -7.688  1.00 79.96  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -16.048 70.935 -8.476  1.00 79.96  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -12.929 71.595 -8.458  1.00 69.79  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -12.284 72.139 -7.223  1.00 69.79  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -10.971 71.807 -6.913  1.00 69.79  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -13.007 72.929 -6.331  1.00 69.79  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -10.380 72.277 -5.734  1.00 69.79  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -12.431 73.393 -5.168  1.00 69.79  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -11.115 73.069 -4.864  1.00 69.79  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -15.299 70.678 -6.367  1.00 174.65 ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -16.573 70.980 -5.722  1.00 174.65 ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -16.319 71.715 -4.397  1.00 174.65 ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -16.735 71.273 -3.325  1.00 174.65 ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -17.376 69.681 -5.537  1.00 130.47 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -18.761 69.721 -4.380  1.00 130.47 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -15.628 72.847 -4.485  1.00 72.01  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -15.231 73.611 -3.290  1.00 72.01  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -16.074 74.834 -2.950  1.00 72.01  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -17.277 74.845 -3.204  1.00 72.01  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -15.434 75.854 -2.372  1.00 201.38 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -16.086 77.121 -1.991  1.00 201.38 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -15.241 78.333 -2.428  1.00 201.38 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -14.009 78.272 -2.362  1.00 201.38 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -16.326 77.164 -0.469  1.00 125.91 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -17.374 76.147 0.007   1.00 125.91 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -17.112 75.326 0.894   1.00 125.91 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -18.569 76.215 -0.572  1.00 125.91 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -15.882 79.426 -2.864  1.00 91.53  ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -15.122 80.606 -3.355  1.00 91.53  ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.274 81.935 -2.569  1.00 91.53  ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -14.777 82.058 -1.441  1.00 91.53  ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -15.284 80.829 -4.897  1.00 122.00 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -14.186 80.085 -5.679  1.00 122.00 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -16.686 80.443 -5.373  1.00 122.00 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -15.920 82.925 -3.191  1.00 119.63 ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -16.147 84.244 -2.593  1.00 119.63 ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -17.530 84.790 -2.980  1.00 119.63 ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -18.039 84.491 -4.067  1.00 119.63 ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -15.039 85.220 -3.005  1.00 117.29 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -18.129 85.574 -2.077  1.00 102.85 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -19.437 86.222 -2.292  1.00 102.85 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -20.595 85.226 -2.341  1.00 102.85 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -21.273 85.118 -3.365  1.00 102.85 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -19.437 87.087 -3.569  1.00 104.39 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -18.455 88.220 -3.540  1.00 104.39 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -17.090 88.028 -3.613  1.00 104.39 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -18.641 89.558 -3.455  1.00 104.39 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -16.479 89.198 -3.571  1.00 104.39 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -17.397 90.143 -3.475  1.00 104.39 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -20.823 84.517 -1.231  1.00 114.03 ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -21.888 83.496 -1.115  1.00 114.03 ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.954 82.603 -2.354  1.00 114.03 ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -23.016 82.482 -2.967  1.00 114.03 ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -23.262 84.146 -0.880  1.00 122.47 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -23.267 85.364 0.043   1.00 122.47 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -24.178 86.474 -0.471  1.00 122.47 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -25.263 86.214 -1.004  1.00 122.47 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -23.734 87.722 -0.317  1.00 122.47 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.821 81.982 -2.702  1.00 150.64 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.630 81.300 -4.001  1.00 150.64 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -19.977 79.900 -3.955  1.00 150.64 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.099 79.633 -3.129  1.00 150.64 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -19.840 82.205 -4.956  1.00 89.41  ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -20.695 83.201 -5.730  1.00 89.41  ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -19.892 84.105 -6.655  1.00 89.41  ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -20.424 85.080 -7.201  1.00 89.41  ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -18.610 83.788 -6.839  1.00 89.41  ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.407 79.034 -4.879  1.00 160.13 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -20.020 77.614 -4.931  1.00 160.13 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.372 77.252 -6.270  1.00 160.13 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -20.071 77.126 -7.281  1.00 160.13 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.257 76.717 -4.777  1.00 71.71  ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.304 76.704 -3.652  1.00 71.71  ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -22.361 77.974 -2.802  1.00 71.71  ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -23.680 76.373 -4.260  1.00 71.71  ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.054 77.058 -6.275  1.00 119.79 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.321 76.707 -7.510  1.00 119.79 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -17.588 75.272 -7.971  1.00 119.79 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -17.757 74.369 -7.152  1.00 119.79 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -15.766 77.012 -7.419  1.00 68.01  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -14.982 76.271 -8.496  1.00 68.01  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.188 76.675 -6.070  1.00 68.01  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -15.031 76.938 -9.837  1.00 68.01  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -17.660 75.076 -9.282  1.00 116.00 ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -17.651 73.733 -9.847  1.00 116.00 ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -16.829 73.741 -11.124 1.00 116.00 ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -17.321 74.172 -12.162 1.00 116.00 ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -19.077 73.232 -10.131 1.00 92.78  ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -19.132 71.798 -10.690 1.00 92.78  ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.504 71.376 -11.212 1.00 92.78  ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.410 72.201 -11.385 1.00 92.78  ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -20.657 70.075 -11.470 1.00 92.78  ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -15.580 73.284 -11.057 1.00 94.17  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -14.774 73.190 -12.267 1.00 94.17  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -14.976 71.829 -12.895 1.00 94.17  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -14.161 70.939 -12.719 1.00 94.17  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -13.273 73.415 -12.020 1.00 65.64  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -13.032 74.740 -11.283 1.00 65.64  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -12.499 73.351 -13.368 1.00 65.64  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -11.562 75.025 -10.968 1.00 65.64  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -16.074 71.663 -13.621 1.00 127.51 ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -16.315 70.425 -14.347 1.00 127.51 ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -15.475 70.446 -15.636 1.00 127.51 ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -14.998 71.509 -16.054 1.00 127.51 ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -17.836 70.188 -14.585 1.00 109.60 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -18.106 68.784 -14.642 1.00 109.60 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -18.338 70.881 -15.855 1.00 109.60 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -15.268 69.276 -16.240 1.00 131.36 ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.407 69.153 -17.428 1.00 131.36 ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.997 69.887 -18.620 1.00 131.36 ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -14.274 70.342 -19.511 1.00 131.36 ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -14.158 67.681 -17.785 1.00 72.50  ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -15.258 67.098 -18.461 1.00 72.50  ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -16.325 69.972 -18.617 1.00 143.67 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -17.077 70.713 -19.606 1.00 143.67 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -16.668 72.186 -19.573 1.00 143.67 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -16.229 72.733 -20.585 1.00 143.67 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -18.580 70.547 -19.349 1.00 73.76  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -16.776 72.802 -18.395 1.00 99.29  ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -16.574 74.245 -18.230 1.00 99.29  ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -16.524 74.683 -16.759 1.00 99.29  ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -17.396 74.319 -15.967 1.00 99.29  ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -17.692 75.010 -18.952 1.00 63.10  ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -18.971 74.704 -18.414 1.00 63.10  ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -15.500 75.459 -16.404 1.00 95.10  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -15.417 76.070 -15.074 1.00 95.10  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -16.614 77.010 -14.890 1.00 95.10  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -16.764 77.987 -15.615 1.00 95.10  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -14.010 76.734 -14.793 1.00 57.46  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -13.278 77.047 -16.083 1.00 57.46  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -14.112 77.977 -13.897 1.00 57.46  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -17.478 76.667 -13.938 1.00 94.35  ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -18.765 77.344 -13.726 1.00 94.35  ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -18.864 78.023 -12.359 1.00 94.35  ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -18.068 77.757 -11.461 1.00 94.35  ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -19.925 76.348 -13.897 1.00 129.64 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -20.054 75.793 -15.311 1.00 129.64 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -20.754 74.439 -15.362 1.00 129.64 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -22.209 74.563 -15.407 1.00 129.64 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -23.024 74.214 -14.413 1.00 129.64 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -22.534 73.709 -13.278 1.00 129.64 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -24.335 74.367 -14.558 1.00 129.64 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -19.847 78.906 -12.208 1.00 131.70 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.063 79.595 -10.938 1.00 131.70 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -21.536 79.608 -10.543 1.00 131.70 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -22.397 79.947 -11.350 1.00 131.70 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -19.507 81.026 -10.981 1.00 92.58  ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -18.035 81.251 -10.617 1.00 92.58  ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -17.151 81.035 -11.835 1.00 92.58  ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -17.825 82.647 -10.024 1.00 92.58  ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -21.810 79.227 -9.296  1.00 121.27 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.169 79.213 -8.757  1.00 121.27 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.198 79.806 -7.349  1.00 121.27 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.611 79.252 -6.421  1.00 121.27 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -23.787 77.782 -8.778  1.00 72.74  ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -25.005 77.680 -7.838  1.00 72.74  ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -24.161 77.382 -10.204 1.00 72.74  ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -23.876 80.943 -7.207  1.00 149.35 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.050 81.579 -5.905  1.00 149.35 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -25.128 80.862 -5.097  1.00 149.35 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -25.966 80.152 -5.659  1.00 149.35 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -24.368 83.066 -6.063  1.00 113.55 ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -25.430 83.266 -6.975  1.00 113.55 ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -25.092 81.035 -3.778  1.00 168.81 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -25.968 80.283 -2.887  1.00 168.81 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -27.281 81.009 -2.625  1.00 168.81 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -28.350 80.475 -2.921  1.00 168.81 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -25.258 79.947 -1.570  1.00 125.31 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -25.670 78.603 -0.957  1.00 125.31 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -27.115 78.578 -0.490  1.00 125.31 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -28.002 78.112 -1.207  1.00 125.31 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -27.359 79.095 0.710   1.00 125.31 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -27.200 82.214 -2.059  1.00 147.95 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -28.395 83.032 -1.818  1.00 147.95 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -28.982 83.496 -3.158  1.00 147.95 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -30.169 83.273 -3.407  1.00 147.95 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -28.110 84.211 -0.864  1.00 114.74 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -29.292 84.613 0.041   1.00 114.74 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -30.317 85.528 -0.637  1.00 114.74 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -31.528 85.215 -0.588  1.00 114.74 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -29.923 86.565 -1.208  1.00 114.74 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -28.157 84.119 -4.036  1.00 201.38 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -28.668 84.371 -5.391  1.00 201.38 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -28.967 83.094 -6.211  1.00 201.38 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -29.593 83.190 -7.269  1.00 201.38 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -27.553 85.209 -6.046  1.00 149.85 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -26.723 85.729 -4.909  1.00 149.85 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -26.791 84.657 -3.869  1.00 149.85 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -28.532 81.926 -5.718  1.00 158.48 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -28.813 80.610 -6.333  1.00 158.48 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -28.785 80.631 -7.864  1.00 158.48 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -29.668 80.079 -8.523  1.00 158.48 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -30.140 80.024 -5.801  1.00 117.08 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -30.473 78.599 -6.286  1.00 117.08 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -29.433 77.570 -5.860  1.00 117.08 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -29.806 76.937 -4.532  1.00 117.08 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -28.636 76.307 -3.863  1.00 117.08 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -27.767 81.272 -8.426  1.00 128.86 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -27.723 81.469 -9.865  1.00 128.86 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -26.344 81.258 -10.454 1.00 128.86 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -25.330 81.423 -9.775  1.00 128.86 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -28.244 82.853 -10.229 1.00 137.55 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.331 80.902 -11.733 1.00 154.79 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -25.110 80.788 -12.513 1.00 154.79 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -24.535 82.193 -12.777 1.00 154.79 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -24.812 82.804 -13.813 1.00 154.79 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -25.413 80.028 -13.816 1.00 136.69 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -24.339 79.425 -14.728 1.00 136.69 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -23.533 78.331 -14.040 1.00 136.69 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -25.021 78.869 -15.961 1.00 136.69 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -23.744 82.699 -11.825 1.00 139.98 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -23.173 84.062 -11.904 1.00 139.98 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -21.992 84.212 -12.883 1.00 139.98 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -21.395 85.292 -12.978 1.00 139.98 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -22.745 84.633 -10.500 1.00 77.73  ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -23.906 84.630 -9.507  1.00 77.73  ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -21.535 83.891 -9.944  1.00 77.73  ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -21.658 83.136 -13.596 1.00 140.36 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -20.533 83.126 -14.537 1.00 140.36 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -20.361 81.739 -15.173 1.00 140.36 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -20.793 80.730 -14.606 1.00 140.36 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -19.237 83.546 -13.827 1.00 162.53 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -18.451 84.401 -14.640 1.00 162.53 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -19.739 81.698 -16.353 1.00 187.58 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -19.410 80.437 -17.031 1.00 187.58 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -18.280 80.626 -18.041 1.00 187.58 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -18.461 81.264 -19.082 1.00 187.58 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -20.645 79.834 -17.714 1.00 72.12  ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.543 78.349 -18.016 1.00 72.12  ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.914 77.683 -18.115 1.00 72.12  ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.898 78.386 -18.440 1.00 72.12  ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -22.011 76.458 -17.872 1.00 72.12  ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -17.116 80.071 -17.713 1.00 164.87 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -15.955 80.099 -18.597 1.00 164.87 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -15.942 78.839 -19.442 1.00 164.87 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -16.349 77.779 -18.977 1.00 164.87 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -14.657 80.168 -17.785 1.00 108.45 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.441 80.512 -18.603 1.00 108.45 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -12.973 81.763 -18.877 1.00 108.45 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.540 79.596 -19.248 1.00 108.45 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -11.842 81.688 -19.656 1.00 108.45 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.554 80.371 -19.900 1.00 108.45 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -12.472 78.196 -19.342 1.00 108.45 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.512 79.797 -20.635 1.00 108.45 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -11.437 77.625 -20.076 1.00 108.45 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -10.470 78.427 -20.710 1.00 108.45 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -15.485 78.963 -20.685 1.00 167.42 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -15.211 77.799 -21.526 1.00 167.42 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -13.925 78.018 -22.327 1.00 167.42 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -13.371 79.122 -22.347 1.00 167.42 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.404 77.465 -22.437 1.00 77.36  ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -16.505 75.972 -22.842 1.00 77.36  ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.830 75.638 -23.529 1.00 77.36  ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -19.005 75.768 -22.565 1.00 77.36  ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -20.270 75.525 -23.283 1.00 77.36  ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.445 76.953 -22.962 1.00 98.18  ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -12.187 76.982 -23.685 1.00 98.18  ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -12.427 77.520 -25.096 1.00 98.18  ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -13.273 76.982 -25.820 1.00 98.18  ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -11.577 75.576 -23.721 1.00 125.05 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -10.056 75.531 -23.812 1.00 125.05 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -9.537  75.914 -25.181 1.00 125.05 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -10.149 75.495 -26.183 1.00 125.05 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -8.523  76.637 -25.255 1.00 125.05 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.688 78.590 -25.483 1.00 73.21  ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -11.850 79.300 -26.754 1.00 73.21  ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -12.091 78.394 -27.972 1.00 73.21  ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -12.734 78.830 -28.943 1.00 73.21  ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -10.529 80.055 -26.893 1.00 77.85  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -10.170 80.399 -25.497 1.00 77.85  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -10.617 79.206 -24.667 1.00 77.85  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -11.598 77.152 -27.906 1.00 86.67  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -11.740 76.176 -28.996 1.00 86.67  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -12.754 75.040 -28.746 1.00 86.67  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -12.852 74.093 -29.538 1.00 86.67  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -10.366 75.603 -29.365 1.00 148.88 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -9.646  76.353 -30.465 1.00 148.88 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -10.342 76.196 -31.804 1.00 148.88 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -11.297 76.907 -32.111 1.00 148.88 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -9.870  75.256 -32.603 1.00 148.88 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -13.518 75.139 -27.662 1.00 87.17  ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -14.408 74.057 -27.264 1.00 87.17  ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -13.624 72.775 -26.971 1.00 87.17  ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -14.155 71.676 -27.121 1.00 87.17  ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -15.475 73.805 -28.332 1.00 102.36 ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -12.360 72.923 -26.568 1.00 120.64 ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -11.552 71.807 -26.051 1.00 120.64 ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -11.926 71.556 -24.573 1.00 120.64 ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -11.979 72.506 -23.779 1.00 120.64 ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -10.034 72.102 -26.183 1.00 63.32  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -9.422  72.022 -27.605 1.00 63.32  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -7.914  72.463 -27.646 1.00 63.32  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.730  74.001 -27.609 1.00 63.32  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -6.503  74.589 -28.271 1.00 63.32  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -12.189 70.294 -24.208 1.00 104.18 ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -12.485 69.931 -22.804 1.00 104.18 ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -11.256 70.143 -21.891 1.00 104.18 ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -10.118 69.982 -22.341 1.00 104.18 ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -12.997 68.478 -22.668 1.00 77.53  ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -14.085 68.105 -23.690 1.00 77.53  ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -14.446 68.883 -24.572 1.00 77.53  ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -14.597 66.890 -23.567 1.00 77.53  ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -11.491 70.496 -20.624 1.00 136.42 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -10.404 70.768 -19.658 1.00 136.42 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.814  69.464 -19.070 1.00 136.42 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.478 68.426 -19.087 1.00 136.42 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -10.852 71.761 -18.531 1.00 99.91  ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -11.660 72.931 -19.118 1.00 99.91  ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -9.649  72.318 -17.786 1.00 99.91  ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -12.609 73.639 -18.120 1.00 99.91  ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -8.574  69.532 -18.563 1.00 123.71 ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.797  68.350 -18.118 1.00 123.71 ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.468  68.255 -16.614 1.00 123.71 ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -8.021  67.409 -15.912 1.00 123.71 ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.506  68.232 -18.930 1.00 67.03  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -6.769  67.599 -20.156 1.00 67.03  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.550  69.101 -16.144 1.00 100.99 ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -6.129  69.133 -14.745 1.00 100.99 ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -6.631  70.418 -14.107 1.00 100.99 ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -6.528  71.488 -14.708 1.00 100.99 ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -4.586  69.110 -14.619 1.00 95.64  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -4.156  69.023 -13.163 1.00 95.64  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -3.993  67.959 -15.407 1.00 95.64  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -7.170  70.311 -12.893 1.00 106.53 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -7.639  71.484 -12.144 1.00 106.53 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -6.579  72.021 -11.182 1.00 106.53 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -5.415  71.615 -11.249 1.00 106.53 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -8.914  71.164 -11.397 1.00 62.69  ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -6.992  72.948 -10.316 1.00 149.42 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -6.175  73.498 -9.225  1.00 149.42 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -6.925  74.703 -8.662  1.00 149.42 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -7.043  75.722 -9.340  1.00 149.42 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -4.788  73.919 -9.717  1.00 96.81  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -3.813  73.722 -8.710  1.00 96.81  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -7.434  74.588 -7.433  1.00 136.94 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -8.400  75.565 -6.903  1.00 136.94 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -8.385  75.691 -5.374  1.00 136.94 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -8.811  74.777 -4.668  1.00 136.94 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -9.813  75.210 -7.408  1.00 143.09 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -11.199 76.249 -6.847  1.00 143.09 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -7.904  76.827 -4.869  1.00 159.70 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -7.879  77.053 -3.418  1.00 159.70 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -9.218  77.509 -2.800  1.00 159.70 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -9.989  76.680 -2.300  1.00 159.70 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -6.676  77.922 -2.968  1.00 106.72 ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.480  79.188 -3.808  1.00 106.72 ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -7.401  79.990 -3.992  1.00 106.72 ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -5.248  79.387 -4.282  1.00 106.72 ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -9.489  78.814 -2.848  1.00 92.36  ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -10.694 79.409 -2.261  1.00 92.36  ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -11.013 80.676 -3.044  1.00 92.36  ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -12.174 80.986 -3.316  1.00 92.36  ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -10.460 79.746 -0.779  1.00 110.96 ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -11.668 79.720 -0.036  1.00 110.96 ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -9.948  81.385 -3.416  1.00 142.11 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -10.034 82.668 -4.101  1.00 142.11 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.265  82.665 -5.438  1.00 142.11 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -9.149  83.702 -6.100  1.00 142.11 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -9.506  83.778 -3.180  1.00 141.07 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -9.979  83.621 -1.850  1.00 141.07 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.749  81.500 -5.832  1.00 195.35 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -7.951  81.370 -7.061  1.00 195.35 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.270  80.111 -7.878  1.00 195.35 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -8.823  79.147 -7.346  1.00 195.35 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.458  81.405 -6.732  1.00 99.48  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -5.893  82.793 -6.509  1.00 99.48  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.383  82.854 -6.655  1.00 99.48  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -3.774  83.857 -6.309  1.00 99.48  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -3.774  81.787 -7.166  1.00 99.48  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -7.914  80.136 -9.168  1.00 172.09 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.099  79.005 -10.101 1.00 172.09 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -6.905  78.920 -11.070 1.00 172.09 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -6.408  79.944 -11.527 1.00 172.09 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.441  79.124 -10.925 1.00 103.59 ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -9.554  78.024 -11.987 1.00 103.59 ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -10.682 79.109 -10.017 1.00 103.59 ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.449  77.697 -11.354 1.00 77.67  ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -5.438  77.388 -12.396 1.00 77.67  ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -5.695  76.038 -13.123 1.00 77.67  ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -5.089  75.020 -12.789 1.00 77.67  ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -3.998  77.372 -11.824 1.00 66.15  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -2.981  77.061 -12.904 1.00 66.15  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -3.671  78.682 -11.203 1.00 66.15  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -6.585  76.040 -14.114 1.00 67.41  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -6.849  74.852 -14.949 1.00 67.41  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -5.692  74.506 -15.909 1.00 67.41  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -4.610  75.122 -15.862 1.00 67.41  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -8.187  74.977 -15.758 1.00 83.78  ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -9.343  74.339 -15.016 1.00 83.78  ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -8.510  76.419 -16.068 1.00 83.78  ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -5.918  73.494 -16.750 1.00 92.87  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -5.010  73.158 -17.851 1.00 92.87  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -5.752  72.351 -18.896 1.00 92.87  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -6.569  71.501 -18.563 1.00 92.87  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -3.792  72.392 -17.365 1.00 55.04  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -5.464  72.637 -20.161 1.00 82.04  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -6.088  71.950 -21.284 1.00 82.04  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -4.951  71.387 -22.138 1.00 82.04  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -4.694  71.862 -23.236 1.00 82.04  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -7.078  72.905 -22.041 1.00 57.51  ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -7.479  72.385 -23.425 1.00 57.51  ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -8.324  73.158 -21.183 1.00 57.51  ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -4.259  70.393 -21.574 1.00 65.93  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -3.119  69.694 -22.179 1.00 65.93  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -1.780  70.235 -21.700 1.00 65.93  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -1.324  69.904 -20.600 1.00 65.93  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -1.157  71.102 -22.497 1.00 83.53  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? 0.221   71.570 -22.233 1.00 83.53  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? -0.221  73.019 -22.007 1.00 83.53  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 0.560   73.838 -21.536 1.00 83.53  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 0.793   71.388 -23.656 1.00 109.42 ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.184   69.959 -24.025 1.00 109.42 ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 1.627   69.797 -25.481 1.00 109.42 ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 1.045   68.582 -26.072 1.00 109.42 ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 1.532   67.341 -25.943 1.00 109.42 ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? 2.644   67.104 -25.246 1.00 109.42 ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? 0.902   66.324 -26.526 1.00 109.42 ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.481  73.317 -22.325 1.00 93.44  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -2.048  74.653 -22.131 1.00 93.44  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -2.432  74.920 -20.676 1.00 93.44  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -2.645  73.999 -19.892 1.00 93.44  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -3.249  74.880 -23.063 1.00 127.21 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -2.512  76.201 -20.335 1.00 122.65 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -2.809  76.648 -18.986 1.00 122.65 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -3.545  77.985 -19.059 1.00 122.65 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -3.089  78.906 -19.731 1.00 122.65 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -1.506  76.814 -18.190 1.00 84.36  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? -0.711  75.566 -17.799 1.00 84.36  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 0.747   75.892 -17.456 1.00 84.36  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? -1.400  74.850 -16.645 1.00 84.36  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -4.685  78.082 -18.382 1.00 139.76 ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -5.414  79.344 -18.269 1.00 139.76 ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -5.600  79.694 -16.793 1.00 139.76 ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -6.057  78.857 -16.017 1.00 139.76 ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -6.789  79.241 -18.933 1.00 121.32 ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -6.793  78.923 -20.412 1.00 121.32 ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -6.805  77.603 -20.862 1.00 121.32 ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -6.823  79.942 -21.362 1.00 121.32 ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -6.824  77.306 -22.222 1.00 121.32 ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -6.845  79.656 -22.728 1.00 121.32 ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -6.846  78.336 -23.148 1.00 121.32 ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -6.869  78.050 -24.490 1.00 121.32 ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -5.251  80.923 -16.407 1.00 143.41 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.437  81.408 -15.026 1.00 143.41 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -6.605  82.396 -14.959 1.00 143.41 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -6.509  83.505 -15.471 1.00 143.41 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -4.117  82.010 -14.478 1.00 98.20  ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.190  82.820 -13.183 1.00 98.20  ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.145  83.670 -12.816 1.00 98.20  ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.293  82.746 -12.338 1.00 98.20  ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.207  84.422 -11.633 1.00 98.20  ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -5.366  83.490 -11.171 1.00 98.20  ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.329  84.320 -10.819 1.00 98.20  ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -4.434  85.045 -9.651  1.00 98.20  ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -7.704  81.976 -14.333 1.00 107.05 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -8.918  82.804 -14.205 1.00 107.05 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.053  83.421 -12.794 1.00 107.05 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -8.223  83.140 -11.931 1.00 107.05 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -10.170 81.991 -14.577 1.00 120.34 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -10.183 81.076 -15.815 1.00 120.34 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -11.516 80.345 -15.901 1.00 120.34 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -9.877  81.814 -17.117 1.00 120.34 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -10.073 84.257 -12.553 1.00 128.14 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -10.249 84.887 -11.227 1.00 128.14 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -11.710 85.075 -10.794 1.00 128.14 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -12.553 85.449 -11.606 1.00 128.14 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -9.472  86.212 -11.146 1.00 127.49 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -9.147  86.650 -9.717  1.00 127.49 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -7.653  86.886 -9.476  1.00 127.49 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -6.922  87.306 -10.377 1.00 127.49 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -7.199  86.616 -8.248  1.00 127.49 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -11.993 84.808 -9.514  1.00 163.35 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -13.346 84.953 -8.939  1.00 163.35 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -13.499 86.249 -8.123  1.00 163.35 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -13.995 86.233 -6.987  1.00 163.35 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -13.773 83.736 -8.039  1.00 94.11  ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.345 82.384 -8.635  1.00 94.11  ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -15.290 83.761 -7.760  1.00 94.11  ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -14.337 81.761 -9.627  1.00 94.11  ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -13.070 87.370 -8.697  1.00 201.38 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -13.359 88.669 -8.100  1.00 201.38 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -14.822 89.026 -8.378  1.00 201.38 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -15.441 88.415 -9.252  1.00 201.38 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -12.405 89.744 -8.614  1.00 82.78  ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -11.075 89.761 -7.922  1.00 82.78  ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -10.941 89.641 -6.551  1.00 82.78  ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -9.818  89.924 -8.407  1.00 82.78  ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -9.660  89.709 -6.225  1.00 82.78  ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -8.957  89.883 -7.332  1.00 82.78  ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -15.376 90.017 -7.647  1.00 170.51 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -16.812 90.240 -7.565  1.00 170.51 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -17.677 89.574 -8.645  1.00 170.51 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -17.899 90.148 -9.716  1.00 170.51 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -16.911 91.767 -7.614  1.00 118.21 ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -15.636 92.233 -6.912  1.00 118.21 ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -14.669 91.051 -6.872  1.00 118.21 ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -18.111 88.346 -8.348  1.00 118.45 ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -19.269 87.691 -8.992  1.00 118.45 ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -19.115 87.266 -10.464 1.00 118.45 ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -20.110 87.154 -11.189 1.00 118.45 ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -20.548 88.536 -8.784  1.00 155.60 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -20.967 88.701 -7.304  1.00 155.60 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -21.921 89.874 -7.054  1.00 155.60 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -22.006 90.817 -7.848  1.00 155.60 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -22.633 89.820 -5.931  1.00 155.60 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -17.878 87.024 -10.895 1.00 88.91  ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -17.609 86.616 -12.285 1.00 88.91  ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -16.175 86.133 -12.561 1.00 88.91  ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.306 86.210 -11.696 1.00 88.91  ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -18.015 87.715 -13.295 1.00 108.43 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -17.728 89.157 -12.865 1.00 108.43 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -16.254 89.460 -12.752 1.00 108.43 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -15.754 89.593 -11.617 1.00 108.43 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -15.599 89.554 -13.803 1.00 108.43 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -15.951 85.665 -13.787 1.00 152.67 ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -14.677 85.083 -14.208 1.00 152.67 ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -13.770 86.069 -14.953 1.00 152.67 ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -14.262 86.997 -15.600 1.00 152.67 ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -14.945 83.856 -15.073 1.00 133.83 ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -15.504 82.659 -14.306 1.00 133.83 ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -16.458 81.853 -15.163 1.00 133.83 ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -14.370 81.785 -13.770 1.00 133.83 ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -12.452 85.846 -14.877 1.00 126.74 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -11.456 86.825 -15.345 1.00 126.74 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -10.131 86.207 -15.825 1.00 126.74 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -9.216  86.008 -15.021 1.00 126.74 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -11.177 87.827 -14.221 1.00 156.77 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -10.448 89.099 -14.630 1.00 156.77 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -10.254 90.027 -13.434 1.00 156.77 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -11.530 90.441 -12.848 1.00 156.77 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -12.109 89.859 -11.799 1.00 156.77 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -11.532 88.826 -11.193 1.00 156.77 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -13.272 90.314 -11.353 1.00 156.77 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -10.027 85.949 -17.133 1.00 144.28 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -8.832  85.324 -17.750 1.00 144.28 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -7.553  86.181 -17.629 1.00 144.28 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -7.274  87.048 -18.469 1.00 144.28 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -9.106  84.899 -19.217 1.00 148.48 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -8.072  83.917 -19.831 1.00 148.48 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -8.465  83.384 -21.215 1.00 148.48 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -9.513  82.760 -21.387 1.00 148.48 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -7.605  83.613 -22.200 1.00 148.48 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -6.789  85.907 -16.569 1.00 101.00 ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -5.556  86.620 -16.242 1.00 101.00 ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -4.368  86.179 -17.113 1.00 101.00 ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -3.544  87.013 -17.488 1.00 101.00 ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -5.198  86.457 -14.711 1.00 72.04  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -6.295  87.045 -13.778 1.00 72.04  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -3.740  86.905 -14.396 1.00 72.04  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -6.393  88.573 -13.718 1.00 72.04  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -4.278  84.887 -17.439 1.00 113.23 ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -3.065  84.344 -18.080 1.00 113.23 ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -3.284  83.193 -19.071 1.00 113.23 ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -4.398  82.681 -19.214 1.00 113.23 ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -2.039  83.914 -17.015 1.00 122.24 ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -1.276  85.010 -16.539 1.00 122.24 ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -2.195  82.814 -19.749 1.00 145.85 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -2.131  81.668 -20.665 1.00 145.85 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -0.689  81.382 -21.118 1.00 145.85 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? -0.069  82.205 -21.800 1.00 145.85 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -3.048  81.870 -21.883 1.00 159.50 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -2.960  80.774 -22.903 1.00 159.50 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -3.449  79.505 -22.679 1.00 159.50 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -2.448  80.763 -24.157 1.00 159.50 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -3.235  78.757 -23.747 1.00 159.50 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -2.630  79.496 -24.659 1.00 159.50 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? -0.164  80.226 -20.706 1.00 88.20  ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 1.077   79.654 -21.260 1.00 88.20  ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 0.824   78.197 -21.682 1.00 88.20  ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? -0.127  77.572 -21.209 1.00 88.20  ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 2.290   79.780 -20.274 1.00 70.65  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 2.653   81.161 -20.149 1.00 70.65  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 3.534   78.985 -20.747 1.00 70.65  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 1.651   77.696 -22.604 1.00 77.78  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 1.642   76.296 -23.022 1.00 77.78  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 2.947   75.627 -22.565 1.00 77.78  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 4.036   76.195 -22.736 1.00 77.78  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 1.447   76.185 -24.543 1.00 106.76 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 1.288   74.751 -25.076 1.00 106.76 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? 0.434   74.649 -26.348 1.00 106.76 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? 0.624   73.667 -27.110 1.00 106.76 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? -0.426  75.537 -26.577 1.00 106.76 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 2.824   74.436 -21.967 1.00 62.23  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 3.974   73.700 -21.431 1.00 62.23  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 4.667   72.798 -22.450 1.00 62.23  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 4.085   72.424 -23.476 1.00 62.23  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 3.573   72.889 -20.199 1.00 107.28 ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.638   73.676 -18.900 1.00 107.28 ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 5.203   74.565 -18.680 1.00 107.28 ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 6.400   73.235 -18.490 1.00 107.28 ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 5.916   72.452 -22.154 1.00 69.92  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 6.720   71.606 -23.016 1.00 69.92  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 6.025   70.307 -23.356 1.00 69.92  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 6.162   69.795 -24.467 1.00 69.92  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 7.990   71.233 -22.298 1.00 88.88  ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 9.193   71.987 -22.704 1.00 88.88  ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.402  71.153 -22.459 1.00 88.88  ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 11.377  71.657 -21.857 1.00 88.88  ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 10.348  69.967 -22.848 1.00 88.88  ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.318   69.761 -22.368 1.00 86.69  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 4.684   68.451 -22.462 1.00 86.69  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.305   68.520 -21.834 1.00 86.69  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 2.905   69.561 -21.304 1.00 86.69  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.522   67.383 -21.744 1.00 81.05  ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 6.961   67.376 -22.143 1.00 81.05  ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.390   66.899 -23.361 1.00 81.05  ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 8.068   67.808 -21.495 1.00 81.05  ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 8.703   67.031 -23.443 1.00 81.05  ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 9.138   67.582 -22.324 1.00 81.05  ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.579   67.406 -21.892 1.00 72.75  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.258   67.337 -21.297 1.00 72.75  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.320   67.436 -19.777 1.00 72.75  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.259   66.951 -19.134 1.00 72.75  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.519   66.085 -21.737 1.00 99.78  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.959  66.212 -21.516 1.00 99.78  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -1.748  65.200 -22.289 1.00 99.78  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -2.992  65.245 -22.198 1.00 99.78  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -1.137  64.361 -22.986 1.00 99.78  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.318   68.088 -19.211 1.00 52.95  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.299   68.318 -17.785 1.00 52.95  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.402  67.168 -17.072 1.00 52.95  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.569  66.886 -17.325 1.00 52.95  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -0.363  69.659 -17.470 1.00 78.31  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -0.418  69.898 -15.971 1.00 78.31  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? 0.404   70.755 -18.156 1.00 78.31  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.328   66.509 -16.179 1.00 60.58  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? -0.215  65.415 -15.409 1.00 60.58  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -0.952  65.959 -14.223 1.00 60.58  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -2.081  65.579 -13.988 1.00 60.58  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 0.881   64.491 -14.965 1.00 56.93  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.322  66.869 -13.484 1.00 55.54  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -0.862  67.308 -12.190 1.00 55.54  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.379  68.697 -11.761 1.00 55.54  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 0.722   69.154 -12.146 1.00 55.54  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.549  66.277 -11.089 1.00 82.25  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 1.210   65.838 -10.926 1.00 82.25  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -1.213  69.330 -10.935 1.00 158.10 ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -1.057  70.715 -10.508 1.00 158.10 ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -1.422  70.871 -9.045  1.00 158.10 ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -2.070  69.996 -8.476  1.00 158.10 ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -1.994  71.605 -11.320 1.00 59.16  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -1.650  71.875 -12.781 1.00 59.16  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -2.852  72.526 -13.408 1.00 59.16  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.391  72.739 -12.914 1.00 59.16  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -1.024  71.996 -8.449  1.00 136.10 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -1.409  72.330 -7.075  1.00 136.10 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -1.204  73.806 -6.743  1.00 136.10 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? -0.162  74.380 -7.075  1.00 136.10 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? -0.636  71.470 -6.069  1.00 116.15 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -1.024  71.758 -4.623  1.00 116.15 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -0.106  71.744 -3.773  1.00 116.15 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -2.227  72.002 -4.342  1.00 116.15 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -2.198  74.402 -6.073  1.00 156.08 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -2.128  75.799 -5.598  1.00 156.08 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -2.912  76.064 -4.301  1.00 156.08 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -4.109  75.763 -4.202  1.00 156.08 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -2.589  76.813 -6.674  1.00 49.14  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -4.072  76.579 -7.023  1.00 49.14  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -1.666  76.757 -7.874  1.00 49.14  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -4.619  77.407 -8.190  1.00 49.14  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -2.216  76.641 -3.322  1.00 160.11 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -2.768  76.967 -2.002  1.00 160.11 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -1.920  78.064 -1.330  1.00 160.11 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -0.687  77.957 -1.304  1.00 160.11 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -2.781  75.731 -1.059  1.00 74.88  ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -1.537  75.034 -1.184  1.00 74.88  ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -3.938  74.782 -1.379  1.00 74.88  ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -2.571  79.119 -0.786  1.00 175.76 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -1.861  80.126 0.016   1.00 175.76 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -0.912  79.491 1.033   1.00 175.76 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -1.361  78.841 1.980   1.00 175.76 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -2.998  80.868 0.746   1.00 93.48  ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -4.278  80.092 0.424   1.00 93.48  ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -4.005  79.443 -0.896  1.00 93.48  ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? 0.390   79.679 0.830   1.00 167.08 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 1.401   79.049 1.683   1.00 167.08 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 1.924   79.931 2.833   1.00 167.08 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? 3.029   79.709 3.345   1.00 167.08 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 2.550   78.485 0.832   1.00 89.50  ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 2.255   77.238 -0.020  1.00 89.50  ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 3.494   76.772 -0.773  1.00 89.50  ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 1.671   76.095 0.813   1.00 89.50  ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 1.117   80.915 3.239   1.00 119.85 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 1.431   81.761 4.391   1.00 119.85 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 1.071   83.232 4.237   1.00 119.85 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? 0.009   83.675 4.698   1.00 119.85 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 1.962   83.983 3.580   1.00 167.19 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.885   85.453 3.497   1.00 167.19 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 0.646   86.008 2.787   1.00 167.19 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 0.528   87.219 2.602   1.00 167.19 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 3.155   86.025 2.854   1.00 125.70 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 4.372   85.882 3.740   1.00 125.70 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 4.517   86.662 4.712   1.00 125.70 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 5.191   84.987 3.447   1.00 125.70 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -0.263  85.125 2.386   1.00 152.73 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -1.558  85.527 1.849   1.00 152.73 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -2.636  84.573 2.354   1.00 152.73 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -2.328  83.550 2.975   1.00 152.73 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -1.537  85.546 0.319   1.00 154.47 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? -1.879  84.276 -0.210  1.00 154.47 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -3.895  84.913 2.078   1.00 147.95 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -5.041  84.112 2.508   1.00 147.95 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -5.997  83.816 1.344   1.00 147.95 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -7.206  84.059 1.439   1.00 147.95 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.790  84.806 3.666   1.00 165.58 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -4.899  85.088 4.882   1.00 165.58 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -4.075  84.265 5.279   1.00 165.58 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -5.083  86.257 5.483   1.00 165.58 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -5.449  83.294 0.245   1.00 161.28 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -6.258  82.944 -0.920  1.00 161.28 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -5.493  83.095 -2.217  1.00 161.28 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -5.593  82.248 -3.105  1.00 161.28 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -4.736  84.187 -2.322  1.00 98.72  ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -3.867  84.445 -3.470  1.00 98.72  ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -2.596  83.587 -3.386  1.00 98.72  ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -1.679  83.892 -2.618  1.00 98.72  ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -3.486  85.938 -3.547  1.00 89.22  ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -4.192  87.041 -4.369  1.00 89.22  ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -5.710  87.154 -4.101  1.00 89.22  ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -3.476  88.407 -4.144  1.00 89.22  ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -2.549  82.517 -4.180  1.00 87.62  ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -1.398  81.603 -4.218  1.00 87.62  ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? -0.197  82.180 -4.996  1.00 87.62  ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? -0.297  82.419 -6.205  1.00 87.62  ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -1.817  80.239 -4.783  1.00 109.63 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -0.692  79.471 -5.178  1.00 109.63 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 0.944   82.393 -4.297  1.00 100.09 ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 2.138   83.021 -4.874  1.00 100.09 ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 2.777   82.157 -5.957  1.00 100.09 ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 2.947   82.625 -7.089  1.00 100.09 ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 3.091   83.157 -3.672  1.00 157.88 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 2.248   82.962 -2.464  1.00 157.88 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 1.160   82.030 -2.884  1.00 157.88 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 3.115   80.914 -5.598  1.00 126.35 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 3.718   79.941 -6.519  1.00 126.35 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 2.789   78.752 -6.847  1.00 126.35 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 1.649   78.696 -6.373  1.00 126.35 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 5.051   79.431 -5.957  1.00 118.45 ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 6.241   80.387 -5.823  1.00 118.45 ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 7.474   79.598 -5.417  1.00 118.45 ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 6.523   81.169 -7.105  1.00 118.45 ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 3.279   77.813 -7.662  1.00 167.80 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 2.532   76.587 -7.982  1.00 167.80 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 3.448   75.377 -8.204  1.00 167.80 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 4.650   75.533 -8.453  1.00 167.80 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 1.659   76.791 -9.220  1.00 112.11 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? 2.232   75.880 -10.673 1.00 112.11 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 2.872   74.175 -8.130  1.00 75.88  ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 3.617   72.959 -8.422  1.00 75.88  ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 2.970   72.239 -9.594  1.00 75.88  ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 1.732   72.288 -9.736  1.00 75.88  ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 3.646   72.068 -7.219  1.00 152.07 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 3.797   71.573 -10.419 1.00 63.41  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 3.310   70.936 -11.665 1.00 63.41  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 3.985   69.631 -12.065 1.00 63.41  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.225   69.558 -12.201 1.00 63.41  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 3.340   71.897 -12.903 1.00 80.87  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 2.862   71.169 -14.165 1.00 80.87  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 4.733   72.442 -13.141 1.00 80.87  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 2.455   72.068 -15.303 1.00 80.87  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.143   68.624 -12.297 1.00 86.75  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 3.577   67.356 -12.869 1.00 86.75  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.423   67.335 -14.374 1.00 86.75  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.364   67.683 -14.902 1.00 86.75  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.491   66.921 -15.054 1.00 135.37 ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.507   66.824 -16.512 1.00 135.37 ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.252   65.414 -17.028 1.00 135.37 ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 3.926   64.526 -16.253 1.00 135.37 ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.814   67.384 -17.068 1.00 55.56  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.735   68.887 -17.372 1.00 55.56  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 6.637   69.233 -18.526 1.00 55.56  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 4.300   69.348 -17.677 1.00 55.56  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 4.383   65.207 -18.334 1.00 78.55  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 4.104   63.890 -18.906 1.00 78.55  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 5.256   63.171 -19.574 1.00 78.55  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 5.387   61.971 -19.383 1.00 78.55  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 2.971   63.929 -19.914 1.00 57.15  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.656   63.626 -19.384 1.00 57.15  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 0.979   64.331 -18.450 1.00 57.15  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 0.796   62.567 -19.794 1.00 57.15  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -0.246  63.765 -18.222 1.00 57.15  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.386  62.676 -19.036 1.00 57.15  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 0.912   61.526 -20.723 1.00 57.15  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -1.449  61.787 -19.172 1.00 57.15  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? -0.138  60.631 -20.855 1.00 57.15  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -1.304  60.768 -20.081 1.00 57.15  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 6.053   63.838 -20.402 1.00 82.45  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 7.049   63.062 -21.133 1.00 82.45  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.343   62.993 -20.341 1.00 82.45  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 8.882   61.911 -20.113 1.00 82.45  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 7.281   63.547 -22.575 1.00 83.72  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 6.023   63.836 -23.179 1.00 83.72  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 7.953   62.464 -23.393 1.00 83.72  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.826   64.144 -19.896 1.00 89.48  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 10.097  64.194 -19.189 1.00 89.48  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 9.971   63.742 -17.725 1.00 89.48  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 10.958  63.764 -16.985 1.00 89.48  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.702  65.602 -19.286 1.00 71.91  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.878   66.652 -18.551 1.00 71.91  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.718   66.373 -18.166 1.00 71.91  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 10.404  67.769 -18.348 1.00 71.91  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 8.759   63.344 -17.323 1.00 58.97  ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.479   62.843 -15.978 1.00 58.97  ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 9.132   63.760 -14.966 1.00 58.97  ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 10.093  63.383 -14.272 1.00 58.97  ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 8.950   61.376 -15.784 1.00 59.52  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 8.056   60.411 -16.558 1.00 59.52  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 8.875   60.982 -14.330 1.00 59.52  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 8.333   60.367 -18.015 1.00 59.52  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.612   64.974 -14.898 1.00 65.91  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.249   66.006 -14.122 1.00 65.91  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.269   66.810 -13.275 1.00 65.91  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.080   66.967 -13.626 1.00 65.91  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 9.983   66.942 -15.075 1.00 66.55  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 9.062   67.557 -15.973 1.00 66.55  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 8.789   67.334 -12.167 1.00 72.12  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 8.042   68.275 -11.326 1.00 72.12  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 8.641   69.693 -11.382 1.00 72.12  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 9.858   69.871 -11.524 1.00 72.12  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 7.998   67.771 -9.906  1.00 110.58 ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 7.790   70.706 -11.290 1.00 88.39  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 8.295   72.072 -11.368 1.00 88.39  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 7.575   73.114 -10.493 1.00 88.39  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 6.460   72.901 -9.993  1.00 88.39  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 8.427   72.557 -12.831 1.00 129.26 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 7.655   71.756 -13.885 1.00 129.26 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 8.565   70.978 -14.842 1.00 129.26 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 8.813   71.709 -16.089 1.00 129.26 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 9.346   71.182 -17.190 1.00 129.26 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 9.703   69.907 -17.220 1.00 129.26 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 9.524   71.936 -18.267 1.00 129.26 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 8.267   74.236 -10.311 1.00 128.09 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 7.760   75.384 -9.583  1.00 128.09 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 7.567   76.508 -10.592 1.00 128.09 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 8.396   76.688 -11.489 1.00 128.09 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 8.772   75.879 -8.510  1.00 136.80 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 9.835   74.811 -8.146  1.00 136.80 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 8.037   76.532 -7.317  1.00 136.80 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 9.333   73.562 -7.419  1.00 136.80 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 6.474   77.256 -10.456 1.00 201.38 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 6.200   78.391 -11.347 1.00 201.38 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 5.584   79.585 -10.597 1.00 201.38 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 4.903   79.403 -9.584  1.00 201.38 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 5.290   77.981 -12.523 1.00 106.40 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 5.432   76.716 -13.392 1.00 106.40 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 4.357   76.754 -14.484 1.00 106.40 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 6.821   76.518 -14.008 1.00 106.40 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 5.834   80.797 -11.097 1.00 179.03 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 5.234   82.012 -10.541 1.00 179.03 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 3.930   82.295 -11.280 1.00 179.03 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 3.934   82.591 -12.475 1.00 179.03 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 6.199   83.202 -10.621 1.00 108.17 ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 5.835   84.379 -9.703  1.00 108.17 ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 7.027   85.303 -9.449  1.00 108.17 ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 7.366   86.148 -10.680 1.00 108.17 ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 8.725   86.763 -10.600 1.00 108.17 ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 2.829   82.221 -10.533 1.00 117.90 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 1.457   82.077 -11.067 1.00 117.90 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 0.805   83.245 -11.842 1.00 117.90 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? 0.070   82.995 -12.806 1.00 117.90 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? 0.528   81.603 -9.943  1.00 188.19 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -0.716  80.803 -10.322 1.00 188.19 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -0.786  79.551 -9.476  1.00 188.19 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -1.964  81.648 -10.153 1.00 188.19 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 1.043   84.509 -11.425 1.00 136.64 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 0.482   85.596 -12.246 1.00 136.64 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 1.060   85.643 -13.675 1.00 136.64 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 0.488   86.317 -14.545 1.00 136.64 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? 0.863   86.864 -11.468 1.00 102.95 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 1.219   86.391 -10.076 1.00 102.95 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.777   85.024 -10.251 1.00 102.95 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 2.161   84.909 -13.894 1.00 141.74 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 2.943   84.908 -15.148 1.00 141.74 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 3.145   83.521 -15.780 1.00 141.74 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 3.372   83.418 -16.986 1.00 141.74 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 4.323   85.543 -14.909 1.00 100.65 ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 5.023   84.900 -13.850 1.00 100.65 ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 3.061   82.474 -14.953 1.00 109.10 ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 3.407   81.066 -15.302 1.00 109.10 ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 4.877   80.879 -15.717 1.00 109.10 ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 5.220   79.892 -16.374 1.00 109.10 ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 2.466   80.438 -16.369 1.00 87.32  ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 1.012   80.260 -15.926 1.00 87.32  ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 0.007   80.112 -16.884 1.00 87.32  ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 0.648   80.241 -14.576 1.00 87.32  ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? -1.327  79.951 -16.510 1.00 87.32  ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? -0.695  80.084 -14.199 1.00 87.32  ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -1.677  79.935 -15.172 1.00 87.32  ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 5.738   81.813 -15.316 1.00 87.11  ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 7.115   81.841 -15.811 1.00 87.11  ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 8.010   80.741 -15.220 1.00 87.11  ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 8.340   80.758 -14.038 1.00 87.11  ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 7.738   83.233 -15.640 1.00 93.46  ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 7.763   83.734 -14.218 1.00 93.46  ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 8.899   84.688 -13.966 1.00 93.46  ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 8.742   85.892 -14.267 1.00 93.46  ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 9.948   84.234 -13.458 1.00 93.46  ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 8.391   79.791 -16.068 1.00 71.36  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 9.262   78.679 -15.698 1.00 71.36  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 10.382  79.092 -14.744 1.00 71.36  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 11.249  79.870 -15.116 1.00 71.36  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 9.869   78.066 -16.967 1.00 119.87 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 10.276  76.585 -17.025 1.00 119.87 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 11.307  76.189 -15.950 1.00 119.87 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 9.041   75.672 -16.989 1.00 119.87 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 10.350  78.567 -13.519 1.00 117.51 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 11.407  78.805 -12.526 1.00 117.51 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 12.394  77.634 -12.455 1.00 117.51 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 13.221  77.451 -13.357 1.00 117.51 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 10.812  79.062 -11.133 1.00 97.93  ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 10.345  80.466 -10.753 1.00 97.93  ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 8.855   80.572 -10.906 1.00 97.93  ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 10.757  80.784 -9.317  1.00 97.93  ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 12.302  76.857 -11.370 1.00 123.04 ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 13.062  75.618 -11.234 1.00 123.04 ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 12.215  74.347 -11.386 1.00 123.04 ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 11.119  74.217 -10.830 1.00 123.04 ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 13.870  75.573 -9.932  1.00 144.33 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 14.620  74.289 -9.743  1.00 144.33 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 15.490  73.791 -10.691 1.00 144.33 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 14.615  73.392 -8.729  1.00 144.33 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 15.994  72.647 -10.265 1.00 144.33 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 15.477  72.382 -9.080  1.00 144.33 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 12.784  73.414 -12.142 1.00 117.68 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 12.150  72.165 -12.523 1.00 117.68 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 13.119  71.019 -12.284 1.00 117.68 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 14.323  71.162 -12.504 1.00 117.68 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 11.763  72.206 -14.002 1.00 139.57 ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 12.778  72.907 -14.905 1.00 139.57 ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 12.522  72.614 -16.368 1.00 139.57 ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 12.913  71.185 -16.724 1.00 139.57 ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 12.589  70.842 -18.137 1.00 139.57 ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 12.579  69.888 -11.837 1.00 133.52 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.375  68.700 -11.515 1.00 133.52 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 12.816  67.458 -12.203 1.00 133.52 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 11.656  67.075 -11.997 1.00 133.52 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.472  68.495 -9.989  1.00 135.88 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 14.010  67.122 -9.532  1.00 135.88 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.528  67.014 -9.543  1.00 135.88 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 16.209  68.058 -9.643  1.00 135.88 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 16.040  65.875 -9.439  1.00 135.88 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 13.663  66.856 -13.034 1.00 97.36  ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 13.371  65.582 -13.670 1.00 97.36  ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 13.524  64.514 -12.608 1.00 97.36  ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 14.410  64.609 -11.757 1.00 97.36  ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 14.340  65.314 -14.839 1.00 109.54 ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 13.991  66.013 -16.182 1.00 109.54 ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 14.162  67.828 -16.240 1.00 109.54 ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 15.769  68.040 -17.021 1.00 109.54 ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 12.624  63.533 -12.630 1.00 95.61  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.804  62.299 -11.859 1.00 95.61  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 13.042  61.157 -12.827 1.00 95.61  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.726  61.262 -14.016 1.00 95.61  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 11.641  61.993 -10.879 1.00 65.51  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.361  62.835 -10.765 1.00 65.51  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 9.199   61.981 -10.370 1.00 65.51  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 10.501  63.973 -9.771  1.00 65.51  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 13.631  60.085 -12.308 1.00 102.23 ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 13.975  58.921 -13.104 1.00 102.23 ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 12.740  58.234 -13.634 1.00 102.23 ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 11.638  58.420 -13.117 1.00 102.23 ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 12.925  57.446 -14.682 1.00 82.26  ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 11.843  56.639 -15.206 1.00 82.26  ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 10.876  57.436 -16.052 1.00 82.26  ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 11.124  58.614 -16.390 1.00 82.26  ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.767   56.775 -16.387 1.00 127.61 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.788   57.290 -17.342 1.00 127.61 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 7.324   56.934 -17.013 1.00 127.61 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 6.463   56.964 -17.894 1.00 127.61 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 9.175   56.901 -18.788 1.00 97.50  ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 8.981   55.430 -19.169 1.00 97.50  ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 9.520   54.453 -18.133 1.00 97.50  ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 10.703  54.582 -17.746 1.00 97.50  ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 8.754   53.558 -17.712 1.00 97.50  ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 7.053   56.596 -15.750 1.00 61.99  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.681   56.456 -15.254 1.00 61.99  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.305   57.864 -14.826 1.00 61.99  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 6.160   58.609 -14.320 1.00 61.99  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 5.539   55.454 -14.045 1.00 62.47  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 6.103   54.058 -14.370 1.00 62.47  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 4.073   55.338 -13.567 1.00 62.47  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 5.119   53.080 -15.067 1.00 62.47  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 4.034   58.213 -15.050 1.00 46.40  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 3.466   59.561 -14.818 1.00 46.40  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.297   59.992 -13.332 1.00 46.40  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 2.916   59.183 -12.472 1.00 46.40  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 2.091   59.719 -15.563 1.00 64.26  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.220   58.443 -15.420 1.00 64.26  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 2.299   60.130 -17.023 1.00 64.26  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 1.674   57.170 -16.243 1.00 64.26  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.597   61.270 -13.028 1.00 57.95  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.216   61.857 -11.736 1.00 57.95  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.707   61.808 -11.567 1.00 57.95  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 1.003   62.297 -12.432 1.00 57.95  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 3.664   63.319 -11.863 1.00 58.89  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 4.706   63.323 -12.943 1.00 58.89  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.353   62.210 -13.878 1.00 58.89  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.201   61.215 -10.491 1.00 41.19  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.244  61.236 -10.243 1.00 41.19  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.665  62.525 -9.548  1.00 41.19  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.628  63.193 -9.930  1.00 41.19  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.694  60.046 -9.396  1.00 83.03  ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -2.065  59.478 -9.796  1.00 83.03  ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.248  60.397 -9.483  1.00 83.03  ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.418  60.080 -10.307 1.00 83.03  ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.516  60.828 -10.390 1.00 83.03  ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.626  61.955 -9.695  1.00 83.03  ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.511  60.449 -11.176 1.00 83.03  ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? 0.063   62.867 -8.505  1.00 47.77  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -0.325  63.990 -7.703  1.00 47.77  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 0.891   64.760 -7.313  1.00 47.77  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 1.995   64.201 -7.257  1.00 47.77  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -1.038  63.524 -6.439  1.00 50.09  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -1.677  64.640 -5.845  1.00 50.09  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 0.676   66.044 -7.054  1.00 79.72  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 1.701   66.893 -6.473  1.00 79.72  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 1.054   67.781 -5.411  1.00 79.72  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? -0.127  68.133 -5.540  1.00 79.72  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.458   67.698 -7.551  1.00 114.40 ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 3.833   68.095 -7.029  1.00 114.40 ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 1.636   68.901 -8.044  1.00 114.40 ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 4.918   67.887 -8.023  1.00 114.40 ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 1.812   68.105 -4.356  1.00 133.21 ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 1.258   68.832 -3.203  1.00 133.21 ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 2.252   69.637 -2.369  1.00 133.21 ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 3.289   69.128 -1.934  1.00 133.21 ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? 0.464   67.891 -2.281  1.00 100.06 ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? -0.424  68.505 -1.185  1.00 100.06 ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -1.494  69.459 -1.732  1.00 100.06 ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -1.079  67.417 -0.362  1.00 100.06 ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 1.882   70.899 -2.153  1.00 144.06 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 2.574   71.835 -1.272  1.00 144.06 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 1.788   72.009 0.040   1.00 144.06 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 0.574   72.223 0.008   1.00 144.06 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 2.747   73.188 -1.990  1.00 95.84  ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 1.441   73.936 -2.344  1.00 95.84  ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 1.610   75.390 -3.417  1.00 95.84  ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 2.198   74.627 -4.924  1.00 95.84  ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 2.463   71.912 1.187   1.00 108.40 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 1.787   72.077 2.497   1.00 108.40 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 2.576   72.904 3.523   1.00 108.40 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 3.809   72.790 3.608   1.00 108.40 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 1.412   70.713 3.153   1.00 70.50  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 2.522   69.798 3.057   1.00 70.50  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? 0.157   70.103 2.502   1.00 70.50  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 1.856   73.725 4.298   1.00 118.78 ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 2.444   74.565 5.363   1.00 118.78 ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 2.446   73.774 6.680   1.00 118.78 ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 1.384   73.507 7.246   1.00 118.78 ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 1.667   75.930 5.557   1.00 106.27 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 1.341   76.525 4.291   1.00 106.27 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 2.482   76.922 6.375   1.00 106.27 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 3.623   73.388 7.163   1.00 176.86 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 3.696   72.679 8.442   1.00 176.86 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 4.189   73.567 9.577   1.00 176.86 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 3.387   74.236 10.235  1.00 176.86 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 4.522   71.390 8.339   1.00 113.11 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 3.755   70.213 7.778   1.00 113.11 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 4.417   69.216 7.056   1.00 113.11 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 2.375   70.097 7.961   1.00 113.11 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 3.717   68.117 6.532   1.00 113.11 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 1.671   69.007 7.436   1.00 113.11 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 2.342   68.017 6.724   1.00 113.11 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 5.498   73.572 9.809   1.00 159.55 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 6.088   74.447 10.817  1.00 159.55 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 7.314   75.177 10.269  1.00 159.55 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 7.203   76.333 9.852   1.00 159.55 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 6.424   73.678 12.105  1.00 170.45 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 5.220   73.348 12.988  1.00 170.45 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 4.581   72.015 12.642  1.00 170.45 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 5.228   70.966 12.856  1.00 170.45 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 3.425   72.014 12.167  1.00 170.45 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 8.464   74.497 10.258  1.00 153.82 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 9.740   75.099 9.845   1.00 153.82 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 10.482  74.281 8.775   1.00 153.82 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 11.703  74.100 8.833   1.00 153.82 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 10.632  75.383 11.063  1.00 127.65 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 10.011  76.295 11.960  1.00 127.65 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 9.705   73.772 7.822   1.00 194.62 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 10.178  73.310 6.515   1.00 194.62 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 8.932   73.245 5.620   1.00 194.62 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 8.088   72.356 5.781   1.00 194.62 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 10.898  71.943 6.585   1.00 73.93  ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 12.173  72.025 7.210   1.00 73.93  ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 8.789   74.227 4.727   1.00 172.91 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 7.694   74.248 3.755   1.00 172.91 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 7.922   73.115 2.755   1.00 172.91 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 8.957   73.085 2.082   1.00 172.91 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 7.652   75.585 3.011   1.00 111.66 ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 7.060   76.721 3.797   1.00 111.66 ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 5.747   76.735 4.223   1.00 111.66 ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 7.587   77.912 4.176   1.00 111.66 ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 5.503   77.870 4.854   1.00 111.66 ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 6.602   78.601 4.840   1.00 111.66 ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 6.971   72.182 2.662   1.00 80.40  ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 7.187   70.952 1.896   1.00 80.40  ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 6.394   70.851 0.584   1.00 80.40  ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 5.314   71.436 0.431   1.00 80.40  ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 6.938   69.714 2.780   1.00 155.21 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 8.153   69.208 3.563   1.00 155.21 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 8.267   69.427 4.942   1.00 155.21 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 9.174   68.487 2.930   1.00 155.21 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 9.378   68.954 5.669   1.00 155.21 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 10.289  68.013 3.648   1.00 155.21 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 10.382  68.251 5.013   1.00 155.21 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 11.472  67.786 5.720   1.00 155.21 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 6.966   70.101 -0.358  1.00 149.62 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 6.277   69.674 -1.575  1.00 149.62 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 6.742   68.291 -2.043  1.00 149.62 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 7.940   67.994 -2.098  1.00 149.62 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 6.461   70.677 -2.707  1.00 124.47 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 5.937   70.116 -4.029  1.00 124.47 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 4.579   70.684 -4.355  1.00 124.47 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 6.915   70.312 -5.173  1.00 124.47 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 5.776   67.456 -2.409  1.00 89.62  ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 6.056   66.061 -2.749  1.00 89.62  ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 5.372   65.675 -4.052  1.00 89.62  ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 4.537   66.414 -4.582  1.00 89.62  ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 5.584   65.142 -1.611  1.00 72.64  ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 5.524   65.795 -0.215  1.00 72.64  ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 4.441   65.198 0.672   1.00 72.64  ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 6.892   65.797 0.465   1.00 72.64  ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.726   64.507 -4.562  1.00 55.14  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 5.169   64.047 -5.822  1.00 55.14  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 4.935   62.538 -5.791  1.00 55.14  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.869   61.753 -5.603  1.00 55.14  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 6.123   64.417 -6.974  1.00 86.09  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.491   64.240 -8.676  1.00 86.09  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.686   62.128 -5.965  1.00 73.80  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.402   60.709 -6.107  1.00 73.80  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.399   60.400 -7.568  1.00 73.80  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 2.806   61.136 -8.361  1.00 73.80  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 2.047   60.346 -5.496  1.00 37.68  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 4.059   59.312 -7.926  1.00 62.79  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 3.895   58.762 -9.266  1.00 62.79  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.746   57.767 -9.319  1.00 62.79  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 1.805   57.840 -8.526  1.00 62.79  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.187   58.145 -9.754  1.00 70.89  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.353   59.094 -9.516  1.00 70.89  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.590   58.439 -10.057 1.00 70.89  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 6.128   60.453 -10.163 1.00 70.89  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.819   56.835 -10.250 1.00 54.67  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.657   56.011 -10.560 1.00 54.67  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 1.904   54.531 -10.416 1.00 54.67  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 0.964   53.750 -10.351 1.00 54.67  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 3.178   54.148 -10.390 1.00 74.16  ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.561   52.781 -10.087 1.00 74.16  ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 3.372   52.569 -8.601  1.00 74.16  ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 3.190   51.438 -8.148  1.00 74.16  ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 5.014   52.511 -10.482 1.00 76.00  ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 6.006   53.448 -9.792  1.00 76.00  ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 7.226   53.196 -9.926  1.00 76.00  ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.581   54.427 -9.125  1.00 76.00  ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 3.413   53.669 -7.850  1.00 69.31  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 3.157   53.645 -6.412  1.00 69.31  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 4.258   54.321 -5.625  1.00 69.31  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 4.181   54.429 -4.397  1.00 69.31  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 5.279   54.773 -6.351  1.00 65.89  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 6.415   55.481 -5.779  1.00 65.89  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 6.090   56.915 -5.351  1.00 65.89  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 5.137   57.541 -5.834  1.00 65.89  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.572   55.477 -6.768  1.00 99.96  ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.898   57.443 -4.447  1.00 64.69  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.767   58.832 -4.041  1.00 64.69  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 8.163   59.389 -3.820  1.00 64.69  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 9.057   58.662 -3.384  1.00 64.69  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.906   58.942 -2.774  1.00 63.73  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.722   60.272 -2.036  1.00 63.73  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.366   60.342 -1.364  1.00 63.73  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.827   60.492 -1.011  1.00 63.73  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.347   60.663 -4.159  1.00 108.47 ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.582   61.387 -3.883  1.00 108.47 ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 9.224   62.653 -3.117  1.00 108.47 ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 8.154   63.239 -3.340  1.00 108.47 ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 10.298  61.772 -5.177  1.00 95.59  ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.617  60.615 -6.078  1.00 95.59  ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.776   60.286 -7.133  1.00 95.59  ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 11.773  59.870 -5.896  1.00 95.59  ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 10.075  59.217 -7.990  1.00 95.59  ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 12.082  58.799 -6.755  1.00 95.59  ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 11.227  58.473 -7.798  1.00 95.59  ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 10.115  63.085 -2.229  1.00 172.10 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 9.820   64.245 -1.388  1.00 172.10 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 10.868  65.345 -1.387  1.00 172.10 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 12.066  65.068 -1.386  1.00 172.10 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 9.441   63.833 0.046   1.00 144.95 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 10.433  63.011 0.863   1.00 144.95 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 10.515  63.184 2.252   1.00 144.95 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 11.251  62.042 0.273   1.00 144.95 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 11.389  62.429 3.028   1.00 144.95 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 12.133  61.286 1.043   1.00 144.95 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 12.195  61.482 2.416   1.00 144.95 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 13.066  60.731 3.173   1.00 144.95 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 10.384  66.591 -1.396  1.00 72.43  ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 11.232  67.781 -1.375  1.00 72.43  ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 10.615  68.949 -0.588  1.00 72.43  ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 9.527   69.433 -0.900  1.00 72.43  ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 11.580  68.232 -2.805  1.00 124.26 ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 12.388  67.226 -3.585  1.00 124.26 ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 11.814  66.518 -4.639  1.00 124.26 ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 13.720  66.973 -3.259  1.00 124.26 ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 12.558  65.575 -5.364  1.00 124.26 ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 14.467  66.033 -3.973  1.00 124.26 ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 13.886  65.334 -5.029  1.00 124.26 ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 11.328  69.395 0.439   1.00 98.40  ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 11.040  70.679 1.059   1.00 98.40  ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 11.491  71.760 0.095   1.00 98.40  ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 12.111  71.467 -0.943  1.00 98.40  ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 11.189  73.010 0.444   1.00 195.95 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 11.508  74.168 -0.393  1.00 195.95 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 11.126  75.470 0.325   1.00 195.95 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 10.580  75.442 1.435   1.00 195.95 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 10.765  74.070 -1.731  1.00 163.35 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 11.486  74.428 -3.028  1.00 163.35 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 12.313  73.270 -3.549  1.00 163.35 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 10.460  74.809 -4.059  1.00 163.35 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 11.418  76.604 -0.313  1.00 141.03 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 11.043  77.917 0.206   1.00 141.03 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 9.803   78.395 -0.532  1.00 141.03 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 9.788   78.370 -1.760  1.00 141.03 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 12.182  78.926 -0.010  1.00 126.65 ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 13.568  78.313 0.174   1.00 126.65 ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.868  77.724 1.214   1.00 126.65 ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 14.422  78.462 -0.837  1.00 126.65 ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 8.763   78.818 0.191   1.00 183.63 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 7.586   79.409 -0.475  1.00 183.63 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 7.997   80.715 -1.142  1.00 183.63 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.334   81.195 -2.065  1.00 183.63 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 6.338   79.627 0.462   1.00 150.84 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 6.575   80.720 1.513   1.00 150.84 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 5.914   78.323 1.114   1.00 150.84 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 5.306   81.446 1.949   1.00 150.84 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.115   81.260 -0.667  1.00 182.65 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 9.672   82.509 -1.163  1.00 182.65 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 10.413  82.288 -2.492  1.00 182.65 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 10.219  83.038 -3.454  1.00 182.65 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 10.604  83.144 -0.109  1.00 122.16 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 10.169  82.985 1.371   1.00 122.16 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 9.025   83.919 1.813   1.00 122.16 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 8.524   84.723 0.997   1.00 122.16 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 8.620   83.847 2.997   1.00 122.16 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 11.247  81.248 -2.542  1.00 114.63 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 12.094  80.977 -3.712  1.00 114.63 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 12.051  79.505 -4.183  1.00 114.63 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 11.139  79.119 -4.934  1.00 114.63 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 13.560  81.444 -3.474  1.00 57.38  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 14.164  80.665 -2.415  1.00 57.38  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 13.606  82.959 -3.170  1.00 57.38  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 13.031  78.703 -3.750  1.00 194.65 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 13.115  77.287 -4.124  1.00 194.65 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 14.496  76.645 -4.114  1.00 194.65 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 15.344  76.956 -4.956  1.00 194.65 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 14.707  75.733 -3.164  1.00 199.19 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 15.954  74.970 -3.049  1.00 199.19 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 15.678  73.466 -2.987  1.00 199.19 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 15.006  72.996 -2.063  1.00 199.19 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 16.748  75.412 -1.806  1.00 80.83  ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 17.968  76.347 -1.938  1.00 80.83  ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 17.591  77.748 -2.465  1.00 80.83  ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 18.739  76.446 -0.600  1.00 80.83  ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 16.199  72.724 -3.968  1.00 132.18 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 16.041  71.262 -4.044  1.00 132.18 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 16.506  70.525 -2.784  1.00 132.18 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 17.712  70.351 -2.571  1.00 132.18 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 16.784  70.693 -5.259  1.00 115.09 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 16.119  70.693 -6.640  1.00 115.09 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 17.175  70.422 -7.715  1.00 115.09 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 14.955  69.696 -6.749  1.00 115.09 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 15.535  70.072 -1.981  1.00 136.95 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 15.779  69.443 -0.668  1.00 136.95 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 16.060  67.935 -0.673  1.00 136.95 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 16.674  67.404 -1.606  1.00 136.95 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 14.627  69.749 0.290   1.00 83.03  ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 14.820  71.001 0.905   1.00 83.03  ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 15.603  67.263 0.387   1.00 178.93 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 15.958  65.870 0.689   1.00 178.93 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 15.421  64.884 -0.336  1.00 178.93 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 14.236  64.912 -0.665  1.00 178.93 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 15.441  65.476 2.080   1.00 138.67 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 15.900  66.426 3.177   1.00 138.67 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 16.428  67.517 2.863   1.00 138.67 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 15.721  66.076 4.363   1.00 138.67 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 16.289  64.007 -0.832  1.00 133.96 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 15.840  62.996 -1.780  1.00 133.96 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 16.043  61.570 -1.303  1.00 133.96 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 17.171  61.064 -1.287  1.00 133.96 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 16.494  63.166 -3.148  1.00 90.33  ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 15.826  62.305 -4.214  1.00 90.33  ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 16.695  62.168 -5.416  1.00 90.33  ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 16.182  61.169 -6.341  1.00 90.33  ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 15.727  61.431 -7.564  1.00 90.33  ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 15.709  62.681 -8.029  1.00 90.33  ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 15.293  60.433 -8.327  1.00 90.33  ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.933  60.935 -0.932  1.00 136.18 ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.884  59.493 -0.709  1.00 136.18 ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 13.552  58.913 -1.182  1.00 136.18 ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.522  59.076 -0.530  1.00 136.18 ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 15.177  59.136 0.756   1.00 132.37 ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 16.558  58.505 0.972   1.00 132.37 ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 17.186  58.918 2.301   1.00 132.37 ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 17.965  60.220 2.170   1.00 132.37 ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 18.523  60.686 3.517   1.00 132.37 ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 13.588  58.266 -2.344  1.00 103.59 ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 12.447  57.540 -2.895  1.00 103.59 ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.882  56.552 -1.860  1.00 103.59 ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 12.515  55.534 -1.537  1.00 103.59 ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 12.862  56.813 -4.190  1.00 77.16  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 11.848  55.812 -4.741  1.00 77.16  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 12.286  55.184 -6.058  1.00 77.16  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 11.200  54.245 -6.581  1.00 77.16  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 11.608  53.477 -7.792  1.00 77.16  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 10.695  56.880 -1.346  1.00 134.82 ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 10.017  56.091 -0.312  1.00 134.82 ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.712   55.496 -0.836  1.00 134.82 ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 7.651   56.117 -0.712  1.00 134.82 ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 9.741   56.924 0.996   1.00 90.12  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 11.039  57.143 1.793   1.00 90.12  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 9.039   58.264 0.687   1.00 90.12  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 8.785   54.294 -1.411  1.00 97.97  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 7.590   53.660 -1.990  1.00 97.97  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 6.475   53.472 -0.952  1.00 97.97  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 6.715   53.603 0.254   1.00 97.97  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 7.884   52.322 -2.764  1.00 97.33  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 7.400   51.189 -2.029  1.00 97.33  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 9.371   52.158 -3.110  1.00 97.33  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 5.260   53.199 -1.432  1.00 67.93  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 4.101   52.977 -0.567  1.00 67.93  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 3.257   51.858 -1.128  1.00 67.93  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 3.691   50.708 -1.109  1.00 67.93  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 3.279   54.253 -0.392  1.00 57.51  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 3.953   55.376 0.407   1.00 57.51  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 2.977   56.490 0.623   1.00 57.51  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 4.540   54.907 1.768   1.00 57.51  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 2.062   52.180 -1.625  1.00 61.63  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 1.282   51.224 -2.431  1.00 61.63  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 1.816   50.895 -3.832  1.00 61.63  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 2.884   51.374 -4.266  1.00 61.63  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 1.083   50.046 -4.542  1.00 99.11  ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 1.401   49.768 -5.946  1.00 99.11  ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? 0.461   50.568 -6.838  1.00 99.11  ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? 0.646   50.642 -8.045  1.00 99.11  ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? 1.314   48.260 -6.295  1.00 159.69 ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? 0.036   47.741 -5.904  1.00 159.69 ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 2.427   47.477 -5.599  1.00 159.69 ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -0.554  51.159 -6.217  1.00 116.62 ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -1.479  52.037 -6.906  1.00 116.62 ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -1.016  53.479 -6.809  1.00 116.62 ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -0.421  53.887 -5.798  1.00 116.62 ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -2.896  51.892 -6.344  1.00 98.91  ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -3.476  50.491 -6.477  1.00 98.91  ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.410  49.944 -7.895  1.00 98.91  ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -4.387  50.020 -8.636  1.00 98.91  ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -2.259  49.390 -8.277  1.00 98.91  ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.285  54.260 -7.866  1.00 93.91  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -0.947  55.667 -7.870  1.00 93.91  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -1.542  56.378 -6.656  1.00 93.91  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -2.764  56.440 -6.490  1.00 93.91  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -1.559  56.171 -9.184  1.00 65.71  ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -2.543  55.124 -9.586  1.00 65.71  ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -1.934  53.861 -9.123  1.00 65.71  ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -0.648  56.864 -5.805  1.00 56.85  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -0.979  57.647 -4.629  1.00 56.85  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -1.591  59.024 -4.943  1.00 56.85  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.099  59.777 -5.791  1.00 56.85  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? 0.292   57.828 -3.778  1.00 68.40  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.834   56.534 -3.462  1.00 68.40  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? 0.006   58.597 -2.494  1.00 68.40  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -2.669  59.361 -4.250  1.00 60.63  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.243  60.682 -4.401  1.00 60.63  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.199  61.435 -3.091  1.00 60.63  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -3.943  61.144 -2.163  1.00 60.63  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -4.678  60.627 -4.886  1.00 40.45  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -5.093  62.006 -5.377  1.00 40.45  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -4.804  59.583 -5.983  1.00 40.45  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -2.332  62.427 -3.041  1.00 61.38  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.157  63.257 -1.859  1.00 61.38  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.395  64.101 -1.483  1.00 61.38  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -4.382  64.114 -2.219  1.00 61.38  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -0.905  64.116 -2.032  1.00 75.66  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? 0.425   63.370 -1.814  1.00 75.66  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? 0.730   62.361 -2.900  1.00 75.66  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 1.567   64.354 -1.716  1.00 75.66  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -3.344  64.758 -0.319  1.00 84.23  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -4.472  65.525 0.235   1.00 84.23  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -4.122  66.211 1.561   1.00 84.23  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -3.213  65.776 2.277   1.00 84.23  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -5.693  64.623 0.434   1.00 106.43 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -6.859  65.281 1.155   1.00 106.43 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -7.719  66.118 0.237   1.00 106.43 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -8.270  65.326 -0.857  1.00 106.43 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -8.919  65.831 -1.902  1.00 106.43 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -9.117  67.137 -2.011  1.00 106.43 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -9.372  65.021 -2.845  1.00 106.43 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -4.851  67.287 1.869   1.00 153.47 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -4.742  67.997 3.146   1.00 153.47 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -6.054  67.973 3.933   1.00 153.47 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -7.137  68.111 3.365   1.00 153.47 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -4.231  69.449 2.957   1.00 99.72  ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -2.817  69.477 3.178   1.00 99.72  ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -4.895  70.420 3.933   1.00 99.72  ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -5.924  67.799 5.247   1.00 163.18 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -7.049  67.710 6.177   1.00 163.18 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -6.786  68.536 7.442   1.00 163.18 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -5.718  69.140 7.576   1.00 163.18 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -7.269  66.250 6.565   1.00 175.29 ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -6.020  65.549 7.024   1.00 175.29 ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -5.526  65.742 8.312   1.00 175.29 ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -5.336  64.696 6.170   1.00 175.29 ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -4.375  65.098 8.735   1.00 175.29 ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -4.182  64.046 6.589   1.00 175.29 ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -3.707  64.243 7.872   1.00 175.29 ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -7.747  68.549 8.369   1.00 132.20 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -7.548  69.197 9.674   1.00 132.20 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -7.647  68.182 10.819  1.00 132.20 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -8.481  67.270 10.776  1.00 132.20 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -8.535  70.357 9.874   1.00 145.65 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -8.154  71.352 10.982  1.00 145.65 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -9.273  72.363 11.246  1.00 145.65 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -10.493 71.726 11.754  1.00 145.65 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -11.697 72.296 11.797  1.00 145.65 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -11.880 73.539 11.363  1.00 145.65 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -12.728 71.614 12.275  1.00 145.65 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -6.793  68.358 11.833  1.00 153.74 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -6.689  67.435 12.974  1.00 153.74 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -6.533  68.147 14.334  1.00 153.74 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -7.368  68.974 14.711  1.00 153.74 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.529  66.462 12.746  1.00 130.94 ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.296  67.157 12.671  1.00 130.94 ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -5.466  67.807 15.061  1.00 109.17 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -5.143  68.411 16.365  1.00 109.17 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -4.535  69.818 16.216  1.00 109.17 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -5.207  70.715 15.702  1.00 109.17 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -4.271  67.461 17.226  1.00 82.20  ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -2.979  66.717 16.818  1.00 82.20  ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -2.588  65.803 17.982  1.00 82.20  ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -3.050  65.898 15.504  1.00 82.20  ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -3.290  70.020 16.658  1.00 151.73 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -2.600  71.298 16.428  1.00 151.73 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -2.082  71.347 14.987  1.00 151.73 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -2.624  72.079 14.151  1.00 151.73 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -1.468  71.538 17.443  1.00 120.16 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -0.179  71.485 16.844  1.00 120.16 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -1.049  70.553 14.702  1.00 187.82 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -0.511  70.431 13.347  1.00 187.82 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -1.436  69.536 12.524  1.00 187.82 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -1.965  68.543 13.031  1.00 187.82 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 0.937   69.861 13.328  1.00 91.06  ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? 0.914   68.464 13.627  1.00 91.06  ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 1.818   70.566 14.355  1.00 91.06  ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -1.637  69.909 11.263  1.00 149.21 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -2.515  69.173 10.350  1.00 149.21 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -1.649  68.595 9.209   1.00 149.21 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -0.600  69.161 8.910   1.00 149.21 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -3.669  70.082 9.850   1.00 99.73  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -3.152  71.078 8.965   1.00 99.73  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -4.369  70.789 11.028  1.00 99.73  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -2.059  67.479 8.592   1.00 106.74 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -1.114  66.666 7.769   1.00 106.74 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -1.469  66.281 6.302   1.00 106.74 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -2.527  66.649 5.768   1.00 106.74 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -0.728  65.365 8.508   1.00 110.15 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -0.128  65.603 9.881   1.00 110.15 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 1.069   65.861 10.021  1.00 110.15 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -0.955  65.469 10.909  1.00 110.15 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -0.548  65.518 5.692   1.00 74.93  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -0.696  64.903 4.364   1.00 74.93  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.198  63.472 4.486   1.00 74.93  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -0.580  62.657 5.186   1.00 74.93  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? 0.674   64.851 3.612   1.00 111.89 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? 0.763   63.650 2.660   1.00 111.89 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? 0.931   66.140 2.850   1.00 111.89 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -2.290  63.162 3.789   1.00 77.31  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -2.838  61.798 3.752   1.00 77.31  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -2.691  61.144 2.378   1.00 77.31  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.404  61.485 1.429   1.00 77.31  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.306  61.806 4.174   1.00 61.23  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -4.957  60.440 4.227   1.00 61.23  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -5.545  59.991 5.407   1.00 61.23  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.032  59.624 3.095   1.00 61.23  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.183  58.738 5.460   1.00 61.23  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -5.664  58.375 3.141   1.00 61.23  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.242  57.930 4.322   1.00 61.23  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -1.769  60.188 2.302   1.00 40.43  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -1.549  59.350 1.110   1.00 40.43  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -2.708  58.385 0.795   1.00 40.43  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -3.005  57.491 1.580   1.00 40.43  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.241  58.573 1.254   1.00 82.50  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.343  58.561 -0.365  1.00 53.18  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.384  57.638 -0.821  1.00 53.18  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -3.865  56.620 -1.838  1.00 53.18  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.363  56.991 -2.903  1.00 53.18  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -5.549  58.398 -1.438  1.00 71.99  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -6.561  59.262 -0.283  1.00 71.99  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -4.002  55.341 -1.502  1.00 48.24  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -3.681  54.265 -2.434  1.00 48.24  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -4.145  52.921 -1.875  1.00 48.24  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -4.959  52.883 -0.946  1.00 48.24  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -2.174  54.244 -2.781  1.00 42.42  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -1.439  53.426 -1.898  1.00 42.42  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -3.638  51.828 -2.449  1.00 67.84  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -3.860  50.494 -1.895  1.00 67.84  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -3.162  50.324 -0.528  1.00 67.84  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -3.564  49.488 0.279   1.00 67.84  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -3.444  49.394 -2.888  1.00 57.98  ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -1.960  49.484 -3.317  1.00 57.98  ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -1.377  50.595 -3.432  1.00 57.98  ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -1.380  48.416 -3.574  1.00 57.98  ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -2.139  51.140 -0.265  1.00 72.84  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -1.465  51.167 1.035   1.00 72.84  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -1.650  52.537 1.714   1.00 72.84  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -0.700  53.326 1.776   1.00 72.84  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? 0.024   50.840 0.869   1.00 81.89  ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? 0.716   50.474 2.171   1.00 81.89  ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 2.247   50.606 2.106   1.00 81.89  ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 2.819   49.804 1.029   1.00 81.89  ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.918   48.477 1.031   1.00 81.89  ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 2.479   47.760 2.062   1.00 81.89  ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 3.460   47.864 -0.012  1.00 81.89  ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -2.866  52.819 2.234   1.00 60.63  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.198  54.108 2.844   1.00 60.63  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.187  54.494 3.898   1.00 60.63  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.051  53.795 4.904   1.00 60.63  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -4.541  53.845 3.511   1.00 46.53  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -5.128  52.768 2.723   1.00 46.53  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.008  51.897 2.288   1.00 46.53  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -1.479  55.592 3.655   1.00 38.54  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -0.389  56.019 4.519   1.00 38.54  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -0.715  57.402 5.049   1.00 38.54  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.580  58.080 4.523   1.00 38.54  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.946   55.954 3.750   1.00 62.59  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 1.145   54.612 3.269   1.00 62.59  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 2.127   56.338 4.621   1.00 62.59  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -0.092  57.802 6.142   1.00 48.81  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.269  59.155 6.621   1.00 48.81  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 1.081   59.711 6.934   1.00 48.81  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.876   59.064 7.610   1.00 48.81  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.106  59.214 7.868   1.00 48.40  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -0.917  60.557 8.537   1.00 48.40  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.547  59.017 7.507   1.00 48.40  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 1.359   60.910 6.442   1.00 131.75 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 2.665   61.502 6.674   1.00 131.75 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 2.586   62.668 7.660   1.00 131.75 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 1.987   63.705 7.367   1.00 131.75 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 3.372   61.858 5.360   1.00 65.51  ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 3.476   60.613 4.459   1.00 65.51  ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 4.752   62.335 5.652   1.00 65.51  ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 3.574   60.919 2.983   1.00 65.51  ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 3.189   62.450 8.833   1.00 125.76 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 3.121   63.360 9.982   1.00 125.76 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 4.375   64.242 10.071  1.00 125.76 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 4.913   64.696 9.055   1.00 125.76 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 2.995   62.566 11.300  1.00 155.15 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 1.605   62.180 11.779  1.00 155.15 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? 1.137   60.871 11.648  1.00 155.15 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? 0.777   63.108 12.417  1.00 155.15 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? -0.147  60.503 12.104  1.00 155.15 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? -0.509  62.749 12.878  1.00 155.15 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? -0.963  61.444 12.720  1.00 155.15 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -2.219  61.083 13.174  1.00 155.15 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 4.831   64.467 11.305  1.00 201.38 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 6.052   65.218 11.594  1.00 201.38 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 6.831   64.621 12.771  1.00 201.38 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 6.358   64.645 13.911  1.00 201.38 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 5.723   66.680 11.877  1.00 56.99  ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 5.164   67.289 10.737  1.00 56.99  ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 8.024   64.095 12.486  1.00 184.25 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 8.860   63.435 13.497  1.00 184.25 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 9.646   64.442 14.332  1.00 184.25 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 9.054   65.338 14.937  1.00 184.25 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 9.804   62.416 12.849  1.00 68.18  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 10.469  61.648 13.839  1.00 68.18  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 10.970  64.281 14.379  1.00 117.81 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 11.846  65.241 15.040  1.00 117.81 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 11.377  66.638 14.636  1.00 117.81 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 10.874  67.407 15.457  1.00 117.81 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 13.311  64.995 14.633  1.00 145.74 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 14.242  66.149 15.020  1.00 145.74 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 14.512  66.388 16.204  1.00 145.74 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 14.747  66.859 14.011  1.00 145.74 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 11.547  66.928 13.352  1.00 74.28  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 10.913  68.032 12.657  1.00 74.28  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 10.799  67.469 11.260  1.00 74.28  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 10.507  68.181 10.293  1.00 74.28  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 11.812  69.262 12.655  1.00 124.40 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 11.078  70.540 12.393  1.00 124.40 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 10.377  70.768 11.226  1.00 124.40 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 10.936  71.659 13.147  1.00 124.40 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 9.832   71.970 11.275  1.00 124.40 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 10.157  72.532 12.429  1.00 124.40 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 11.089  66.161 11.208  1.00 64.63  ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 10.946  65.271 10.058  1.00 64.63  ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 9.456   64.956 9.853   1.00 64.63  ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 8.594   65.728 10.290  1.00 64.63  ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 11.742  63.971 10.315  1.00 61.76  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 12.417  63.368 9.063   1.00 61.76  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 12.209  61.849 8.925   1.00 61.76  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 13.184  61.057 9.803   1.00 61.76  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 14.605  61.235 9.404   1.00 61.76  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 9.163   63.817 9.214   1.00 90.00  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 7.802   63.439 8.785   1.00 90.00  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 7.508   61.968 9.097   1.00 90.00  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 8.340   61.089 8.808   1.00 90.00  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 7.658   63.684 7.284   1.00 129.38 ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 8.165   65.023 6.727   1.00 129.38 ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 9.182   64.791 5.602   1.00 129.38 ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 7.005   65.941 6.293   1.00 129.38 ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 6.341   61.697 9.688   1.00 149.76 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 6.002   60.335 10.144  1.00 149.76 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 5.387   59.498 9.030   1.00 149.76 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 4.639   60.005 8.197   1.00 149.76 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 5.074   60.312 11.412  1.00 100.34 ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 4.746   58.878 11.858  1.00 100.34 ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 5.711   61.065 12.555  1.00 100.34 ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 5.740   58.216 9.028   1.00 133.72 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 5.162   57.228 8.134   1.00 133.72 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.441   56.157 8.945   1.00 133.72 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 5.076   55.298 9.579   1.00 133.72 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 6.253   56.588 7.268   1.00 104.54 ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.486   57.283 5.954   1.00 104.54 ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 6.298   58.664 5.820   1.00 104.54 ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 6.924   56.554 4.848   1.00 104.54 ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 6.522   59.302 4.605   1.00 104.54 ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 7.152   57.182 3.623   1.00 104.54 ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 6.949   58.561 3.503   1.00 104.54 ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 3.113   56.228 8.944   1.00 62.90  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.299   55.143 9.488   1.00 62.90  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.301   54.586 8.473   1.00 62.90  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.794   55.309 7.614   1.00 62.90  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.573   55.596 10.755  1.00 122.91 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 0.725   54.572 11.244  1.00 122.91 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 1.039   53.286 8.573   1.00 42.12  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? -0.090  52.684 7.880   1.00 42.12  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.372  53.185 8.497   1.00 42.12  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.437  53.520 9.686   1.00 42.12  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? -0.041  51.158 7.934   1.00 69.63  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 0.857   50.568 6.865   1.00 69.63  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 0.634   50.756 5.673   1.00 69.63  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 1.876   49.846 7.289   1.00 69.63  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.385  53.290 7.662   1.00 55.70  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -3.722  53.569 8.120   1.00 55.70  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.367  52.222 7.985   1.00 55.70  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -4.244  51.594 6.954   1.00 55.70  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.379  54.600 7.213   1.00 51.24  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -5.822  54.856 7.618   1.00 51.24  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -3.550  55.876 7.229   1.00 51.24  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.002  51.750 9.039   1.00 48.81  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -5.498  50.376 9.045   1.00 48.81  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -6.823  50.236 8.311   1.00 48.81  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -7.873  50.008 8.922   1.00 48.81  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -5.606  49.814 10.468  1.00 65.12  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -4.276  49.804 11.204  1.00 65.12  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -3.217  49.526 10.633  1.00 65.12  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -4.331  50.105 12.491  1.00 65.12  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -6.749  50.376 6.992   1.00 50.96  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -7.908  50.299 6.138   1.00 50.96  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -7.611  49.475 4.905   1.00 50.96  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -6.443  49.266 4.546   1.00 50.96  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -8.360  51.695 5.736   1.00 48.68  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.318  52.405 6.687   1.00 48.68  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -9.761  53.659 6.020   1.00 48.68  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -10.526 51.531 6.998   1.00 48.68  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -8.688  49.016 4.268   1.00 99.08  ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -8.624  48.135 3.111   1.00 99.08  ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -7.844  48.808 1.972   1.00 99.08  ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -6.794  48.317 1.553   1.00 99.08  ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -10.052 47.727 2.698   1.00 77.20  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -10.151 46.670 1.605   1.00 77.20  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -9.542  45.336 2.025   1.00 77.20  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -8.870  44.621 0.834   1.00 77.20  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -8.674  43.144 1.042   1.00 77.20  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -8.358  49.948 1.514   1.00 97.19  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -7.753  50.770 0.478   1.00 97.19  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -8.639  51.983 0.329   1.00 97.19  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -9.846  51.836 0.182   1.00 97.19  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -7.717  50.031 -0.862  1.00 112.68 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -7.833  50.965 -2.076  1.00 112.68 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -7.325  50.353 -3.368  1.00 112.68 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -7.554  49.141 -3.584  1.00 112.68 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -6.700  51.090 -4.171  1.00 112.68 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -8.044  53.171 0.370   1.00 52.56  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -8.736  54.425 0.035   1.00 52.56  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.165  54.975 -1.267  1.00 52.56  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -6.988  54.734 -1.578  1.00 52.56  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.494  55.540 1.078   1.00 46.53  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -9.743  56.391 1.237   1.00 46.53  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.045  54.983 2.412   1.00 46.53  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -8.968  55.730 -2.016  1.00 62.53  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -8.487  56.354 -3.259  1.00 62.53  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -8.679  57.854 -3.252  1.00 62.53  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -7.843  58.598 -3.757  1.00 62.53  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -9.162  55.745 -4.492  1.00 64.55  ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -8.832  54.273 -4.679  1.00 64.55  ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -7.718  53.814 -4.388  1.00 64.55  ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -9.802  53.525 -5.174  1.00 64.55  ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -9.793  58.292 -2.680  1.00 68.32  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -10.045 59.705 -2.492  1.00 68.32  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.501 59.896 -1.058  1.00 68.32  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.210 59.049 -0.504  1.00 68.32  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -11.062 60.204 -3.533  1.00 52.00  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.686 59.741 -4.929  1.00 52.00  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.284 58.625 -5.493  1.00 52.00  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.665  60.390 -5.657  1.00 52.00  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -10.894 58.176 -6.762  1.00 52.00  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.269  59.950 -6.922  1.00 52.00  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -9.888  58.846 -7.460  1.00 52.00  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -9.514  58.395 -8.690  1.00 52.00  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.060 60.995 -0.460  1.00 69.67  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.297 61.291 0.946   1.00 69.67  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.359 62.800 1.199   1.00 69.67  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.396  63.532 0.911   1.00 69.67  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.187  60.660 1.792   1.00 82.81  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -8.927  61.338 3.134   1.00 82.81  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -7.637  62.607 3.070   1.00 82.81  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -8.391  63.895 4.073   1.00 82.81  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -11.482 63.269 1.743   1.00 93.10  ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -11.626 64.695 2.066   1.00 93.10  ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -11.982 64.933 3.534   1.00 93.10  ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -12.697 64.119 4.137   1.00 93.10  ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -12.627 65.387 1.130   1.00 91.20  ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -14.198 64.536 0.876   1.00 91.20  ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -11.488 66.055 4.108   1.00 103.88 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -11.647 66.378 5.530   1.00 103.88 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -13.078 66.819 5.815   1.00 103.88 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -13.869 66.953 4.872   1.00 103.88 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -10.688 67.558 5.742   1.00 92.77  ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -9.975  67.758 4.469   1.00 92.77  ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -10.770 67.122 3.393   1.00 92.77  ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -13.411 67.049 7.088   1.00 140.75 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -14.784 67.430 7.452   1.00 140.75 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -14.926 68.225 8.771   1.00 140.75 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -13.921 68.527 9.433   1.00 140.75 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -15.704 66.188 7.428   1.00 83.67  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -17.131 66.357 6.867   1.00 83.67  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -17.254 67.579 5.929   1.00 83.67  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -17.669 65.071 6.180   1.00 83.67  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -16.177 68.573 9.112   1.00 117.27 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -16.548 69.308 10.342  1.00 117.27 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -18.075 69.518 10.509  1.00 117.27 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -18.511 70.463 11.171  1.00 117.27 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -15.813 70.657 10.407  1.00 143.19 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -15.802 71.249 11.800  1.00 143.19 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -15.969 70.538 12.794  1.00 143.19 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -15.606 72.560 11.880  1.00 143.19 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -18.867 68.601 9.948   1.00 124.09 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -20.319 68.777 9.720   1.00 124.09 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -21.255 68.933 10.942  1.00 124.09 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -20.803 69.030 12.092  1.00 124.09 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -20.837 67.641 8.824   1.00 110.54 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -20.930 66.410 9.528   1.00 110.54 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -22.566 68.973 10.659  1.00 79.96  ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -23.632 69.010 11.681  1.00 79.96  ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -24.226 67.617 11.857  1.00 79.96  ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -25.268 67.448 12.487  1.00 79.96  ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -24.728 70.039 11.331  1.00 107.52 ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -25.701 69.537 10.262  1.00 107.52 ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -25.354 69.541 9.056   1.00 107.52 ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -26.828 69.150 10.633  1.00 107.52 ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -23.555 66.626 11.279  1.00 146.90 ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -23.892 65.229 11.485  1.00 146.90 ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -22.668 64.407 11.824  1.00 146.90 ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -22.782 63.334 12.422  1.00 146.90 ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -21.499 64.913 11.424  1.00 129.84 ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -20.210 64.282 11.699  1.00 129.84 ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.099 65.337 11.820  1.00 129.84 ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -18.239 65.411 10.941  1.00 129.84 ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -19.850 63.308 10.573  1.00 97.93  ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -20.902 62.263 10.244  1.00 97.93  ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -20.887 61.010 10.863  1.00 97.93  ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -21.902 62.517 9.297   1.00 97.93  ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -21.847 60.036 10.559  1.00 97.93  ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -22.870 61.550 8.990   1.00 97.93  ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -22.832 60.311 9.625   1.00 97.93  ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -23.776 59.348 9.332   1.00 97.93  ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.116 66.168 12.893  1.00 124.59 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.047 67.177 13.121  1.00 124.59 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -16.615 66.599 13.132  1.00 124.59 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -16.461 65.391 12.930  1.00 124.59 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -18.431 67.800 14.471  1.00 129.40 ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -19.921 67.606 14.558  1.00 129.40 ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.157 66.247 13.938  1.00 129.40 ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -15.595 67.441 13.365  1.00 85.95  ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.180 67.078 13.058  1.00 85.95  ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -13.932 65.588 12.751  1.00 85.95  ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -13.841 64.755 13.655  1.00 85.95  ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -13.179 67.585 14.117  1.00 69.65  ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -11.690 67.430 13.668  1.00 69.65  ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -10.822 68.094 14.282  1.00 69.65  ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -11.381 66.656 12.720  1.00 69.65  ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -13.796 65.287 11.466  1.00 97.03  ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -13.748 63.918 10.974  1.00 97.03  ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -13.027 63.878 9.610   1.00 97.03  ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -12.133 64.708 9.356   1.00 97.03  ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -15.182 63.352 10.903  1.00 64.46  ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -15.334 62.293 9.956   1.00 64.46  ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -13.421 62.915 8.760   1.00 85.39  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -12.847 62.678 7.427   1.00 85.39  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -13.793 61.839 6.552   1.00 85.39  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -14.609 61.073 7.064   1.00 85.39  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.493 61.965 7.547   1.00 130.00 ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.392 62.660 8.362   1.00 130.00 ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.389  61.676 8.925   1.00 130.00 ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -9.699  63.752 7.567   1.00 130.00 ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -13.674 61.985 5.236   1.00 96.34  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.504 61.235 4.298   1.00 96.34  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.622 60.422 3.356   1.00 96.34  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -12.532 60.873 3.001   1.00 96.34  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -15.376 62.174 3.525   1.00 97.47  ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -14.092 59.236 2.953   1.00 79.74  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -13.235 58.225 2.298   1.00 79.74  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -13.964 57.272 1.347   1.00 79.74  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -14.963 56.656 1.733   1.00 79.74  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.578 57.350 3.367   1.00 82.05  ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.431 57.816 4.265   1.00 82.05  ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -11.817 58.827 5.361   1.00 82.05  ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.891 56.575 4.911   1.00 82.05  ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.452 57.097 0.133   1.00 88.86  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.098 56.161 -0.792  1.00 88.86  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.190 55.044 -1.278  1.00 88.86  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -12.086 55.293 -1.764  1.00 88.86  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -14.721 56.889 -1.974  1.00 93.78  ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -13.676 53.812 -1.155  1.00 80.78  ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -12.951 52.640 -1.628  1.00 80.78  ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.480 52.172 -2.990  1.00 80.78  ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.060 52.969 -3.738  1.00 80.78  ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -12.999 51.516 -0.572  1.00 128.55 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -14.227 50.621 -0.699  1.00 128.55 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -15.262 51.025 -1.225  1.00 128.55 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -14.103 49.387 -0.227  1.00 128.55 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -13.266 50.890 -3.300  1.00 126.84 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.893 50.210 -4.435  1.00 126.84 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -15.307 50.703 -4.716  1.00 126.84 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.641 51.057 -5.851  1.00 126.84 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.968 48.702 -4.163  1.00 130.30 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -12.723 47.956 -4.592  1.00 130.30 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -12.111 48.265 -5.617  1.00 130.30 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -12.356 46.942 -3.817  1.00 130.30 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -16.125 50.730 -3.666  1.00 111.15 ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.554 50.947 -3.808  1.00 111.15 ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -18.235 51.476 -2.547  1.00 111.15 ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -19.459 51.535 -2.483  1.00 111.15 ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -18.220 49.642 -4.251  1.00 159.26 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -17.651 48.532 -3.581  1.00 159.26 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.456 51.873 -1.551  1.00 129.61 ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.029 52.324 -0.292  1.00 129.61 ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -17.584 53.743 0.015   1.00 129.61 ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -16.483 54.145 -0.355  1.00 129.61 ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -17.596 51.416 0.878   1.00 137.94 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -17.271 50.110 0.385   1.00 137.94 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -18.700 51.313 1.914   1.00 137.94 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.441 54.500 0.688   1.00 78.41  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.032 55.784 1.231   1.00 78.41  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.105 55.701 2.745   1.00 78.41  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -18.993 55.039 3.280   1.00 78.41  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -18.923 56.918 0.707   1.00 62.93  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -18.491 58.372 0.984   1.00 62.93  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -19.251 59.373 0.100   1.00 62.93  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -18.616 58.747 2.470   1.00 62.93  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.185 56.383 3.429   1.00 121.09 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.091 56.301 4.886   1.00 121.09 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -16.679 57.637 5.543   1.00 121.09 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -16.118 58.508 4.877   1.00 121.09 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.140 55.144 5.309   1.00 93.96  ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -16.125 54.125 4.298   1.00 93.96  ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -16.598 54.533 6.627   1.00 93.96  ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -16.970 57.781 6.844   1.00 108.82 ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.792 59.035 7.609   1.00 108.82 ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.521 58.825 9.115   1.00 108.82 ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -17.427 58.429 9.852   1.00 108.82 ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -18.035 59.985 7.487   1.00 119.49 ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.374 59.197 7.452   1.00 119.49 ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -17.855 60.988 6.338   1.00 119.49 ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.882 58.727 6.063   1.00 119.49 ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.302 59.125 9.574   1.00 82.48  ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -14.895 58.853 10.967  1.00 82.48  ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -13.830 59.777 11.552  1.00 82.48  ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -13.600 60.863 11.027  1.00 82.48  ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.175 59.366 12.641  1.00 105.01 ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.108 60.204 13.228  1.00 105.01 ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -10.751 59.514 13.361  1.00 105.01 ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -10.615 58.484 14.018  1.00 105.01 ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -12.491 60.829 14.607  1.00 146.92 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -12.517 59.815 15.622  1.00 146.92 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -13.841 61.543 14.546  1.00 146.92 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -9.745  60.112 12.741  1.00 80.97  ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -8.367  59.655 12.867  1.00 80.97  ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -7.952  59.407 14.321  1.00 80.97  ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -8.393  60.129 15.223  1.00 80.97  ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -7.367  60.593 12.072  1.00 62.79  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -6.838  59.852 10.836  1.00 62.79  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -6.194  61.177 12.946  1.00 62.79  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -6.465  58.383 11.076  1.00 62.79  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.123  58.371 14.521  1.00 64.70  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.590  57.970 15.834  1.00 64.70  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.404  58.839 16.200  1.00 64.70  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -5.243  59.911 15.651  1.00 64.70  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -6.168  56.497 15.803  1.00 89.04  ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -6.865  55.670 16.860  1.00 89.04  ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -6.803  56.044 18.060  1.00 89.04  ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -7.480  54.649 16.474  1.00 89.04  ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.565  58.373 17.111  1.00 84.54  ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.401  59.144 17.550  1.00 84.54  ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.537  59.702 16.393  1.00 84.54  ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -2.969  60.584 15.649  1.00 84.54  ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.567  58.316 18.559  1.00 81.71  ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.216  58.923 18.979  1.00 81.71  ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -1.372  60.135 19.866  1.00 81.71  ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -1.527  59.937 21.091  1.00 81.71  ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -1.332  61.275 19.342  1.00 81.71  ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -1.324  59.179 16.254  1.00 54.87  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.292  59.800 15.466  1.00 54.87  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.767   58.760 15.153  1.00 54.87  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 1.062   58.541 13.998  1.00 54.87  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.359   61.005 16.213  1.00 68.67  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -0.496  62.275 16.094  1.00 68.67  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.815   61.260 15.736  1.00 68.67  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? 0.053   63.474 16.866  1.00 68.67  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.317   58.094 16.171  1.00 69.32  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.531   57.255 16.016  1.00 69.32  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.425   56.074 15.018  1.00 69.32  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 1.354   55.756 14.533  1.00 69.32  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 2.995   56.749 17.386  1.00 150.14 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 2.729   57.695 18.555  1.00 150.14 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 2.297   56.953 19.814  1.00 150.14 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 1.228   57.221 20.363  1.00 150.14 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 3.121   56.007 20.268  1.00 150.14 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.553   55.440 14.707  1.00 95.34  ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 3.542   54.227 13.891  1.00 95.34  ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 3.042   53.021 14.705  1.00 95.34  ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 2.498   52.071 14.132  1.00 95.34  ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.921   53.954 13.269  1.00 125.93 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.914   52.880 12.158  1.00 125.93 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 6.321   52.481 11.699  1.00 125.93 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 6.306   51.189 10.869  1.00 125.93 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 6.094   49.952 11.681  1.00 125.93 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 3.246   53.063 16.029  1.00 54.53  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 2.573   52.149 16.984  1.00 54.53  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 1.694   52.955 17.935  1.00 54.53  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 2.105   53.984 18.460  1.00 54.53  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 3.563   51.319 17.819  1.00 41.46  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 4.595   50.298 17.316  1.00 41.46  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 5.724   50.187 18.341  1.00 41.46  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 3.999   48.924 17.045  1.00 41.46  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? 0.497   52.454 18.188  1.00 54.70  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -0.478  53.146 19.014  1.00 54.70  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -0.660  52.432 20.384  1.00 54.70  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -0.894  51.209 20.430  1.00 54.70  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -1.767  53.283 18.200  1.00 72.20  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -3.000  53.366 19.026  1.00 72.20  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -3.227  54.387 19.924  1.00 72.20  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -4.082  52.556 19.087  1.00 72.20  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -4.392  54.193 20.513  1.00 72.20  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -4.931  53.091 20.021  1.00 72.20  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -0.534  53.196 21.485  1.00 34.50  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -0.453  52.615 22.830  1.00 34.50  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -1.473  53.024 23.885  1.00 34.50  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -1.367  54.089 24.487  1.00 34.50  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 0.908   52.849 23.474  1.00 24.82  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 2.042   52.446 22.543  1.00 24.82  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 1.008   52.025 24.752  1.00 24.82  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 3.427   52.377 23.255  1.00 24.82  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.396  52.123 24.180  1.00 38.06  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -3.269  52.246 25.350  1.00 38.06  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -2.539  51.976 26.683  1.00 38.06  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -1.654  51.129 26.738  1.00 38.06  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -4.386  51.234 25.218  1.00 54.99  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -5.738  51.793 24.917  1.00 54.99  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -6.583  51.971 26.171  1.00 54.99  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -7.830  51.226 25.999  1.00 54.99  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -8.799  51.115 26.905  1.00 54.99  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -8.691  51.711 28.093  1.00 54.99  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -9.868  50.383 26.620  1.00 54.99  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -2.931  52.657 27.759  1.00 28.96  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -2.405  52.340 29.083  1.00 28.96  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -3.509  52.057 30.087  1.00 28.96  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -4.582  52.689 30.047  1.00 28.96  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -1.517  53.444 29.572  1.00 19.11  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -0.281  53.334 28.869  1.00 19.11  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.231  53.366 31.052  1.00 19.11  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -3.257  51.083 30.967  1.00 34.77  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -4.219  50.682 31.970  1.00 34.77  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -3.521  50.630 33.342  1.00 34.77  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -2.922  49.639 33.724  1.00 34.77  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -4.903  49.363 31.550  1.00 21.80  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -5.940  48.900 32.595  1.00 21.80  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -5.574  49.533 30.192  1.00 21.80  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -3.577  51.725 34.077  1.00 60.00  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -2.993  51.870 35.383  1.00 60.00  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -3.526  50.761 36.268  1.00 60.00  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -4.736  50.605 36.354  1.00 60.00  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -3.572  53.204 35.868  1.00 23.05  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -3.877  53.920 34.728  1.00 23.05  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -4.281  52.936 33.665  1.00 23.05  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -2.655  49.977 36.902  1.00 31.04  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.126  49.020 37.891  1.00 31.04  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -2.765  49.519 39.299  1.00 31.04  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -3.328  49.075 40.305  1.00 31.04  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -2.516  47.645 37.628  1.00 20.53  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -2.955  46.871 36.386  1.00 20.53  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.032  45.716 36.140  1.00 20.53  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -4.393  46.390 36.478  1.00 20.53  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -1.820  50.460 39.403  1.00 26.11  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -1.575  51.020 40.743  1.00 26.11  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -0.893  49.930 41.691  1.00 26.11  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -0.625  50.231 42.882  1.00 26.11  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -2.729  51.698 41.280  1.00 20.82  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -3.293  52.793 40.365  1.00 20.82  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -4.404  52.602 39.609  1.00 20.82  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -2.494  53.999 40.182  1.00 20.82  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -4.730  53.569 38.737  1.00 20.82  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -2.837  54.979 39.344  1.00 20.82  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -3.936  54.781 38.613  1.00 20.82  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -4.220  55.829 37.719  1.00 20.82  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -0.541  48.750 41.107  1.00 35.05  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? 0.196   47.593 41.750  1.00 35.05  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 0.937   46.869 40.687  1.00 35.05  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? 0.902   47.170 39.483  1.00 35.05  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -0.722  46.739 42.534  1.00 31.62  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -1.639  45.869 41.591  1.00 31.62  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -2.912  45.315 42.270  1.00 31.62  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -3.523  44.340 41.788  1.00 31.62  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -3.346  45.860 43.297  1.00 31.62  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.556   45.746 41.095  1.00 26.79  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 2.479   44.947 40.203  1.00 26.79  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.837   43.825 39.392  1.00 26.79  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.367   42.853 39.965  1.00 26.79  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.538   44.159 40.987  1.00 36.74  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 4.576   44.991 41.538  1.00 36.74  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.888   43.863 38.050  1.00 27.31  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 1.384   42.689 37.340  1.00 27.31  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 2.480   41.648 37.041  1.00 27.31  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 3.585   42.011 36.655  1.00 27.31  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.893   43.278 36.022  1.00 39.02  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.809   44.371 35.747  1.00 39.02  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 2.310   44.910 37.107  1.00 39.02  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 2.180   40.361 37.171  1.00 30.35  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 3.206   39.349 36.983  1.00 30.35  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 3.012   38.451 35.781  1.00 30.35  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 3.995   38.054 35.155  1.00 30.35  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 3.363   38.506 38.225  1.00 31.10  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 3.662   39.341 39.402  1.00 31.10  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 4.646   38.710 40.339  1.00 31.10  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 4.920   39.692 41.382  1.00 31.10  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 5.413   39.414 42.583  1.00 31.10  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 5.749   38.159 42.891  1.00 31.10  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 5.595   40.390 43.469  1.00 31.10  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.766   38.114 35.455  1.00 26.14  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 1.517   37.118 34.423  1.00 26.14  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? 0.230   37.433 33.719  1.00 26.14  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -0.651  38.054 34.302  1.00 26.14  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 1.387   35.735 35.075  1.00 40.67  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.662   35.101 35.558  1.00 40.67  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.561   34.768 34.422  1.00 40.67  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 4.894   34.259 34.941  1.00 40.67  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 5.566   33.434 33.863  1.00 40.67  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? 0.082   36.973 32.491  1.00 17.77  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.145  37.277 31.769  1.00 17.77  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -1.636  36.147 30.807  1.00 17.77  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -0.864  35.656 30.003  1.00 17.77  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.047  38.701 31.051  1.00 20.28  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -2.393  39.064 30.388  1.00 20.28  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? 0.149   38.773 30.107  1.00 20.28  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -2.481  40.290 29.517  1.00 20.28  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -2.905  35.757 30.881  1.00 39.49  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -3.447  34.797 29.928  1.00 39.49  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -4.753  35.242 29.321  1.00 39.49  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -5.662  35.661 30.046  1.00 39.49  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -3.646  33.473 30.607  1.00 42.14  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -2.106  32.571 30.589  1.00 42.14  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -4.862  35.170 27.995  1.00 30.25  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -6.111  35.546 27.336  1.00 30.25  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.100  34.375 27.367  1.00 30.25  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -6.693  33.236 27.177  1.00 30.25  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -5.851  35.969 25.894  1.00 36.83  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -7.105  36.352 25.128  1.00 36.83  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -8.133  37.077 25.752  1.00 36.83  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -7.260  36.008 23.788  1.00 36.83  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -9.279  37.433 25.063  1.00 36.83  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -8.393  36.365 23.088  1.00 36.83  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -9.401  37.081 23.726  1.00 36.83  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -10.547 37.455 23.048  1.00 36.83  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -8.380  34.648 27.611  1.00 39.67  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -9.406  33.613 27.520  1.00 39.67  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -10.465 33.988 26.494  1.00 39.67  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -11.399 34.759 26.774  1.00 39.67  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.052 33.368 28.883  1.00 43.01  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -10.888 32.091 29.010  1.00 43.01  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -10.924 31.592 30.431  1.00 43.01  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -9.960  31.010 30.925  1.00 43.01  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -12.026 31.825 31.102  1.00 43.01  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -10.312 33.416 25.308  1.00 42.34  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -11.189 33.711 24.205  1.00 42.34  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -12.649 33.515 24.554  1.00 42.34  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -13.426 34.436 24.410  1.00 42.34  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -10.828 32.846 23.030  1.00 76.97  ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -11.373 33.331 21.738  1.00 76.97  ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -10.664 32.680 20.582  1.00 76.97  ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -11.094 32.902 19.432  1.00 76.97  ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -9.673  31.941 20.818  1.00 76.97  ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -13.019 32.327 25.030  1.00 27.52  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -14.428 31.989 25.286  1.00 27.52  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.066 32.849 26.355  1.00 27.52  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -16.275 32.922 26.407  1.00 27.52  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -14.615 30.534 25.743  1.00 23.28  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -13.909 29.579 24.798  1.00 23.28  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -14.111 30.340 27.186  1.00 23.28  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -14.265 33.459 27.222  1.00 28.80  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -14.749 34.397 28.241  1.00 28.80  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -14.577 35.850 27.787  1.00 28.80  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -15.013 36.795 28.465  1.00 28.80  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -13.965 34.215 29.535  1.00 79.35  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.681 33.423 30.456  1.00 79.35  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -13.901 36.031 26.657  1.00 42.76  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -13.637 37.355 26.140  1.00 42.76  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -13.045 38.202 27.245  1.00 42.76  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -13.424 39.354 27.412  1.00 42.76  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -14.924 37.995 25.585  1.00 59.32  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -15.386 37.447 24.250  1.00 59.32  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -14.552 37.943 23.077  1.00 59.32  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -14.807 39.013 22.532  1.00 59.32  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -13.567 37.154 22.668  1.00 59.32  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -12.133 37.627 28.028  1.00 36.36  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -11.431 38.414 29.057  1.00 36.36  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -9.973  38.007 29.261  1.00 36.36  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -9.466  37.123 28.548  1.00 36.36  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.200 38.399 30.382  1.00 49.75  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -11.956 36.939 31.407  1.00 49.75  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.307  38.663 30.217  1.00 23.31  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -7.917  38.332 30.601  1.00 23.31  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -7.788  37.815 32.025  1.00 23.31  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -8.664  38.015 32.833  1.00 23.31  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -6.985  39.512 30.392  1.00 34.37  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -6.767  39.849 28.961  1.00 34.37  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -7.451  40.901 28.375  1.00 34.37  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -5.905  39.104 28.193  1.00 34.37  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -7.258  41.231 27.033  1.00 34.37  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -5.706  39.390 26.852  1.00 34.37  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -6.380  40.456 26.263  1.00 34.37  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -6.721  37.112 32.331  1.00 20.55  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -6.475  36.716 33.708  1.00 20.55  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.125  37.305 34.064  1.00 20.55  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -4.186  37.226 33.258  1.00 20.55  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -4.993  37.943 35.214  1.00 24.53  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -3.709  38.557 35.475  1.00 24.53  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -3.308  38.350 36.917  1.00 24.53  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.062  38.738 37.788  1.00 24.53  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -3.697  40.087 35.130  1.00 17.64  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -2.355  40.734 35.481  1.00 17.64  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -3.992  40.333 33.669  1.00 17.64  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.134  37.772 37.174  1.00 24.58  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -1.639  37.732 38.535  1.00 24.58  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -0.933  39.010 38.855  1.00 24.58  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -0.071  39.402 38.108  1.00 24.58  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -0.669  36.571 38.789  1.00 13.84  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.063  35.141 38.379  1.00 13.84  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? 0.127   34.237 38.591  1.00 13.84  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.231  34.594 39.108  1.00 13.84  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -1.289  39.639 39.971  1.00 15.18  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -0.597  40.790 40.500  1.00 15.18  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -0.336  40.604 41.996  1.00 15.18  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -0.864  39.679 42.619  1.00 15.18  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -1.486  42.000 40.316  1.00 27.31  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -2.775  41.750 40.860  1.00 27.31  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? 0.452   41.516 42.565  1.00 20.89  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.799   41.499 43.964  1.00 20.89  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.809   42.925 44.427  1.00 20.89  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 1.010   43.834 43.627  1.00 20.89  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 2.203   40.937 44.122  1.00 41.31  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 3.118   41.713 43.374  1.00 41.31  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? 0.613   43.127 45.716  1.00 31.03  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? 0.676   44.463 46.244  1.00 31.03  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 1.380   44.433 47.560  1.00 31.03  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 1.429   43.402 48.211  1.00 31.03  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -0.705  45.047 46.400  1.00 34.29  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -1.585  44.317 47.318  1.00 34.29  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -2.818  45.084 47.465  1.00 34.29  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -3.656  44.502 48.484  1.00 34.29  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -4.639  43.641 48.236  1.00 34.29  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -4.916  43.251 46.991  1.00 34.29  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -5.360  43.170 49.244  1.00 34.29  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 1.947   45.553 47.954  1.00 52.24  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 2.621   45.589 49.216  1.00 52.24  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 1.699   46.170 50.263  1.00 52.24  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? 1.195   47.282 50.115  1.00 52.24  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 3.932   46.385 49.106  1.00 32.88  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.957   45.574 48.299  1.00 32.88  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 4.450   46.808 50.517  1.00 32.88  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 6.245   46.311 48.074  1.00 32.88  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.451   45.396 51.304  1.00 50.46  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.797   45.930 52.479  1.00 50.46  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.778   45.968 53.640  1.00 50.46  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 2.861   45.412 53.544  1.00 50.46  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.493  45.188 52.771  1.00 54.15  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.539  45.541 51.728  1.00 54.15  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -2.901  44.916 51.964  1.00 54.15  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -3.106  44.290 53.032  1.00 54.15  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -3.772  45.060 51.074  1.00 54.15  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.438   46.670 54.715  1.00 73.73  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.380   46.841 55.827  1.00 73.73  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 1.674   46.722 57.160  1.00 73.73  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.449   46.832 57.222  1.00 73.73  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 3.114   48.199 55.761  1.00 61.30  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 3.977   48.288 54.520  1.00 61.30  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 2.122   49.362 55.778  1.00 61.30  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 2.458   46.506 58.216  1.00 110.74 ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 1.966   46.397 59.597  1.00 110.74 ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 0.968   47.501 59.987  1.00 110.74 ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 1.061   48.635 59.516  1.00 110.74 ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 3.160   46.384 60.569  1.00 147.26 ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 2.816   46.291 62.062  1.00 147.26 ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 3.973   46.689 62.968  1.00 147.26 ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 5.050   46.095 62.923  1.00 147.26 ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 3.746   47.694 63.803  1.00 147.26 ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.006   47.139 60.834  1.00 143.74 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.919  48.093 61.440  1.00 143.74 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? -0.858  47.933 62.962  1.00 143.74 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? -0.092  47.111 63.470  1.00 143.74 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -2.347  47.845 60.932  1.00 145.68 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -3.249  49.073 61.054  1.00 145.68 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -2.784  50.131 61.530  1.00 145.68 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -4.435  48.975 60.670  1.00 145.68 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -1.655  48.726 63.681  1.00 119.46 ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -1.824  48.575 65.129  1.00 119.46 ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -2.140  47.116 65.459  1.00 119.46 ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -1.582  46.544 66.397  1.00 119.46 ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -2.962  49.479 65.687  1.00 101.58 ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -4.174  49.241 64.958  1.00 101.58 ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? -2.588  50.969 65.608  1.00 101.58 ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -3.018  46.523 64.655  1.00 81.49  ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -3.445  45.135 64.817  1.00 81.49  ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -2.331  44.143 64.483  1.00 81.49  ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -2.503  42.924 64.659  1.00 81.49  ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -4.674  44.854 63.935  1.00 81.63  ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -5.046  43.485 63.985  1.00 81.63  ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -1.198  44.667 64.008  1.00 91.36  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -0.109  43.836 63.486  1.00 91.36  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.391  43.401 62.053  1.00 91.36  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? 0.546   43.179 61.271  1.00 91.36  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -1.685  43.295 61.722  1.00 106.67 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -2.173  42.916 60.394  1.00 106.67 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -1.833  43.926 59.317  1.00 106.67 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -1.506  45.077 59.611  1.00 106.67 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -1.911  43.489 58.063  1.00 62.64  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -1.502  44.316 56.920  1.00 62.64  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -2.563  45.349 56.517  1.00 62.64  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -3.767  45.073 56.564  1.00 62.64  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -1.155  43.445 55.703  1.00 70.29  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -2.344  42.828 55.195  1.00 70.29  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? -0.168  42.372 56.094  1.00 70.29  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.122  46.529 56.102  1.00 87.73  ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -3.074  47.575 55.770  1.00 87.73  ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.184  47.831 54.268  1.00 87.73  ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -4.054  47.241 53.633  1.00 87.73  ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -2.816  48.840 56.568  1.00 78.95  ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -2.532  48.466 57.915  1.00 78.95  ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -4.041  49.716 56.568  1.00 78.95  ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -2.324  48.689 53.710  1.00 73.84  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -2.347  49.073 52.277  1.00 73.84  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -1.818  50.475 52.117  1.00 73.84  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -2.244  51.374 52.821  1.00 73.84  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -3.780  48.992 51.656  1.00 17.25  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -0.915  50.681 51.176  1.00 56.58  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -0.351  52.007 50.961  1.00 56.58  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -1.278  52.901 50.124  1.00 56.58  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -1.313  54.121 50.323  1.00 56.58  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? 1.038   51.908 50.327  1.00 70.94  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 2.280   51.517 51.157  1.00 70.94  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 2.007   50.511 52.273  1.00 70.94  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 3.408   50.999 50.239  1.00 70.94  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -2.038  52.299 49.208  1.00 37.86  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -2.912  53.049 48.306  1.00 37.86  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -3.878  52.102 47.591  1.00 37.86  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -3.668  50.895 47.576  1.00 37.86  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.080  53.833 47.304  1.00 33.95  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -2.154  53.349 45.886  1.00 33.95  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -0.836  52.875 45.290  1.00 33.95  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? 0.318   53.687 45.677  1.00 33.95  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 1.315   53.204 46.421  1.00 33.95  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 1.304   51.933 46.823  1.00 33.95  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 2.338   53.970 46.765  1.00 33.95  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -4.950  52.634 46.988  1.00 31.13  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -5.892  51.692 46.388  1.00 31.13  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -5.329  51.215 45.065  1.00 31.13  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -4.598  51.945 44.408  1.00 31.13  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.128  52.556 46.121  1.00 26.09  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -6.829  53.904 46.725  1.00 26.09  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -5.362  54.030 46.761  1.00 26.09  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -5.654  50.007 44.656  1.00 33.28  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.042  49.477 43.448  1.00 33.28  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.066  48.590 42.776  1.00 33.28  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.178  48.469 43.277  1.00 33.28  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -3.752  48.733 43.807  1.00 26.55  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -3.801  48.096 45.099  1.00 26.55  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -5.720  48.003 41.638  1.00 30.73  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -6.615  47.095 40.899  1.00 30.73  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -7.366  46.128 41.798  1.00 30.73  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -8.573  45.959 41.687  1.00 30.73  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -5.800  46.278 39.902  1.00 8.36   ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -6.619  45.473 42.673  1.00 40.13  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.167  44.393 43.463  1.00 40.13  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -8.033  44.867 44.639  1.00 40.13  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -8.804  44.102 45.198  1.00 40.13  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -6.051  43.469 43.930  1.00 38.83  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.021  44.202 44.546  1.00 38.83  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -7.939  46.129 44.998  1.00 47.67  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -8.761  46.616 46.069  1.00 47.67  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -9.984  47.368 45.520  1.00 47.67  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -11.005 47.504 46.198  1.00 47.67  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -7.937  47.481 47.028  1.00 33.76  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -7.297  48.555 46.310  1.00 33.76  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -6.876  46.650 47.697  1.00 33.76  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -9.896  47.821 44.276  1.00 44.89  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -10.934 48.681 43.712  1.00 44.89  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -11.770 47.955 42.655  1.00 44.89  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -12.531 48.585 41.897  1.00 44.89  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -10.323 49.977 43.154  1.00 81.08  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -9.806  50.929 44.235  1.00 81.08  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.368 52.360 44.108  1.00 81.08  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -9.852  53.303 44.727  1.00 81.08  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -11.435 52.522 43.312  1.00 81.08  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -11.628 46.627 42.620  1.00 39.94  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.297 45.787 41.616  1.00 39.94  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -13.790 45.849 41.788  1.00 39.94  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.290 45.996 42.910  1.00 39.94  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -11.841 44.334 41.722  1.00 33.42  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -14.500 45.693 40.677  1.00 48.03  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -15.951 45.650 40.686  1.00 48.03  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -16.524 44.485 41.494  1.00 48.03  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -17.641 44.572 41.982  1.00 48.03  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -16.487 45.637 39.260  1.00 34.52  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -15.976 46.769 38.371  1.00 34.52  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -16.589 46.650 37.010  1.00 34.52  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -16.246 48.162 38.965  1.00 34.52  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -15.782 43.391 41.618  1.00 86.27  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -16.157 42.328 42.541  1.00 86.27  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -14.905 41.589 42.945  1.00 86.27  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -13.912 41.561 42.197  1.00 86.27  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.123 41.339 41.914  1.00 44.59  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -17.422 41.689 40.577  1.00 44.59  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -14.964 40.970 44.121  1.00 39.62  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -13.797 40.409 44.720  1.00 39.62  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.181 39.136 45.452  1.00 39.62  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.322 38.739 45.376  1.00 39.62  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -13.184 41.450 45.633  1.00 32.88  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -13.837 41.485 46.849  1.00 32.88  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.217 38.492 46.116  1.00 46.70  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.371 37.185 46.757  1.00 46.70  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -12.015 36.781 47.298  1.00 46.70  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -11.001 37.282 46.854  1.00 46.70  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -13.849 36.129 45.768  1.00 37.20  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -12.778 35.574 45.021  1.00 37.20  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -11.998 35.864 48.248  1.00 32.61  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -10.776 35.541 48.980  1.00 32.61  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -10.572 34.032 49.020  1.00 32.61  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -11.445 33.263 48.640  1.00 32.61  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -10.825 36.118 50.429  1.00 30.69  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -9.962  37.333 50.581  1.00 30.69  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -12.256 36.489 50.781  1.00 30.69  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.413  33.584 49.458  1.00 41.88  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -9.191  32.152 49.509  1.00 41.88  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -9.621  31.648 50.867  1.00 41.88  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.193  32.164 51.903  1.00 41.88  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -7.743  31.823 49.247  1.00 52.82  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -7.671  30.536 48.699  1.00 52.82  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -10.494 30.651 50.854  1.00 94.35  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -11.009 30.069 52.082  1.00 94.35  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -10.571 28.623 52.244  1.00 94.35  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -11.233 27.852 52.933  1.00 94.35  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -12.535 30.156 52.106  1.00 50.28  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -13.111 29.384 51.062  1.00 50.28  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.470  28.249 51.599  1.00 64.44  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -8.923  26.904 51.749  1.00 64.44  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -8.476  26.674 53.169  1.00 64.44  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -7.896  27.563 53.805  1.00 64.44  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -7.714  26.656 50.852  1.00 39.84  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.983  25.516 51.316  1.00 39.84  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -8.744  25.459 53.635  1.00 63.56  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -8.344  25.034 54.947  1.00 63.56  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -7.222  24.033 54.767  1.00 63.56  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -6.834  23.362 55.727  1.00 63.56  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -9.526  24.405 55.689  1.00 51.72  ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -10.780 25.284 55.822  1.00 51.72  ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -10.457 26.661 56.433  1.00 51.72  ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -11.687 27.570 56.545  1.00 51.72  ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -12.585 27.362 55.354  1.00 51.72  ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -6.698  23.958 53.535  1.00 66.42  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -5.560  23.092 53.174  1.00 66.42  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -4.311  23.203 54.025  1.00 66.42  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -3.453  22.338 53.928  1.00 66.42  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -5.119  23.312 51.720  1.00 43.55  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -5.522  22.310 50.622  1.00 43.55  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -4.795  22.573 49.269  1.00 43.55  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -5.347  20.850 51.095  1.00 43.55  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -4.170  24.253 54.827  1.00 81.25  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -2.969  24.357 55.666  1.00 81.25  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -3.168  24.499 57.192  1.00 81.25  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -4.148  25.083 57.693  1.00 81.25  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -1.985  25.410 55.117  1.00 68.92  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -1.478  25.102 53.724  1.00 68.92  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -2.093  25.657 52.602  1.00 68.92  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? -0.388  24.257 53.530  1.00 68.92  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -1.635  25.377 51.309  1.00 68.92  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? 0.071   23.960 52.235  1.00 68.92  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -0.561  24.522 51.125  1.00 68.92  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -2.220  23.889 57.899  1.00 155.02 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -1.976  24.080 59.320  1.00 155.02 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -0.478  23.841 59.488  1.00 155.02 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -0.060  22.875 60.133  1.00 155.02 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -2.787  23.092 60.163  1.00 84.33  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -4.174  23.260 59.947  1.00 84.33  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? 0.324   24.712 58.870  1.00 134.88 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? 1.782   24.561 58.850  1.00 134.88 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 2.401   24.884 60.210  1.00 134.88 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 2.914   23.997 60.891  1.00 134.88 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 2.417   25.422 57.739  1.00 99.01  ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 2.900   26.669 58.225  1.00 99.01  ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 5.759   48.134 60.423  1.00 115.68 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 7.049   47.679 60.926  1.00 115.68 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 7.680   46.692 59.973  1.00 115.68 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 8.908   46.640 59.849  1.00 115.68 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 6.826   45.915 59.302  1.00 120.35 ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 7.242   44.888 58.341  1.00 120.35 ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 6.360   44.943 57.073  1.00 120.35 ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 5.206   45.395 57.138  1.00 120.35 ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 7.173   43.502 59.000  1.00 117.51 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 8.154   43.286 60.161  1.00 117.51 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 7.502   42.629 61.381  1.00 117.51 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 6.919   43.360 62.219  1.00 117.51 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 7.584   41.386 61.512  1.00 117.51 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 6.903   44.499 55.932  1.00 99.63  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 6.170   44.501 54.645  1.00 99.63  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.664   43.125 54.222  1.00 99.63  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.325   42.121 54.451  1.00 99.63  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 7.026   45.085 53.505  1.00 66.94  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 6.887   46.605 53.301  1.00 66.94  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.622   47.135 52.070  1.00 66.94  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 8.388   46.374 51.440  1.00 66.94  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 7.428   48.324 51.734  1.00 66.94  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.503   43.105 53.572  1.00 62.23  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 3.856   41.877 53.088  1.00 62.23  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.512   41.997 51.604  1.00 62.23  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 3.323   43.089 51.092  1.00 62.23  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 2.576   41.595 53.896  1.00 92.14  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 1.629   40.677 53.152  1.00 92.14  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 2.932   41.009 55.245  1.00 92.14  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.475   40.877 50.904  1.00 36.54  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 2.915   40.831 49.570  1.00 36.54  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.582   40.098 49.628  1.00 36.54  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.415   39.091 50.318  1.00 36.54  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.829   40.102 48.591  1.00 27.08  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 5.103   40.830 48.170  1.00 27.08  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.781   40.160 46.937  1.00 27.08  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 5.059   39.445 46.194  1.00 27.08  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 7.020   40.340 46.713  1.00 27.08  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.623   40.612 48.890  1.00 33.90  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -0.651  39.969 48.742  1.00 33.90  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -0.827  39.728 47.250  1.00 33.90  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -0.792  40.660 46.446  1.00 33.90  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -1.719  40.899 49.267  1.00 29.81  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.079  40.445 48.844  1.00 29.81  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -1.619  40.965 50.753  1.00 29.81  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -0.991  38.479 46.865  1.00 22.85  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.096  38.144 45.461  1.00 22.85  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -2.533  37.843 45.144  1.00 22.85  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.241  37.224 45.939  1.00 22.85  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.223  36.940 45.154  1.00 33.78  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 1.249   37.226 45.224  1.00 33.78  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 2.088   37.078 44.134  1.00 33.78  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 2.025   37.662 46.248  1.00 33.78  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 3.316   37.417 44.487  1.00 33.78  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 3.307   37.761 45.766  1.00 33.78  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -2.995  38.327 44.000  1.00 38.94  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.401  38.206 43.655  1.00 38.94  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.452  37.717 42.214  1.00 38.94  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.434  37.754 41.535  1.00 38.94  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.133  39.563 43.796  1.00 58.02  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -4.563  40.456 44.904  1.00 58.02  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -4.969  40.387 46.059  1.00 58.02  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -3.636  41.320 44.536  1.00 58.02  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -5.610  37.249 41.742  1.00 26.25  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -5.770  36.961 40.333  1.00 26.25  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -6.875  37.886 39.859  1.00 26.25  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -7.934  37.861 40.395  1.00 26.25  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.112  35.469 40.110  1.00 17.54  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -6.878  35.085 38.815  1.00 17.54  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.006  35.098 37.588  1.00 17.54  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -7.591  33.738 38.940  1.00 17.54  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -6.607  38.717 38.869  1.00 28.51  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -7.565  39.692 38.364  1.00 28.51  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.265  39.172 37.116  1.00 28.51  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -7.639  38.495 36.295  1.00 28.51  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -6.822  40.964 37.989  1.00 19.73  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -5.838  41.534 39.032  1.00 19.73  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -5.214  42.875 38.554  1.00 19.73  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -6.426  41.694 40.434  1.00 19.73  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -9.554  39.470 36.951  1.00 25.29  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.211 39.147 35.697  1.00 25.29  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -10.526 40.462 35.014  1.00 25.29  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -11.210 41.340 35.571  1.00 25.29  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -11.488 38.254 35.850  1.00 23.28  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -11.129 36.839 36.304  1.00 23.28  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.285 38.167 34.516  1.00 23.28  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -10.025 36.171 35.484  1.00 23.28  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.030 40.600 33.801  1.00 30.09  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.108 41.870 33.158  1.00 30.09  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -10.807 41.690 31.825  1.00 30.09  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -10.521 40.741 31.093  1.00 30.09  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -8.714  42.452 33.004  1.00 20.94  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.056  42.579 34.388  1.00 20.94  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -8.776  43.774 32.371  1.00 20.94  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -6.740  43.469 34.444  1.00 20.94  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -11.739 42.602 31.537  1.00 31.10  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -12.586 42.556 30.346  1.00 31.10  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -11.786 42.963 29.115  1.00 31.10  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.136 44.020 29.090  1.00 31.10  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -13.759 43.520 30.565  1.00 56.99  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -14.767 43.502 29.436  1.00 56.99  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -14.530 44.113 28.370  1.00 56.99  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -15.832 42.905 29.646  1.00 56.99  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -11.845 42.152 28.069  1.00 38.40  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -10.999 42.452 26.922  1.00 38.40  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -11.401 43.762 26.243  1.00 38.40  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -10.577 44.406 25.612  1.00 38.40  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -10.916 41.285 25.942  1.00 37.86  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.190 40.999 25.234  1.00 37.86  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -11.975 40.182 23.992  1.00 37.86  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -11.912 40.719 22.892  1.00 37.86  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -11.857 38.880 24.155  1.00 37.86  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -12.662 44.159 26.391  1.00 28.25  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.173 45.390 25.749  1.00 28.25  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -12.999 46.593 26.696  1.00 28.25  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -12.165 47.446 26.418  1.00 28.25  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -14.611 45.236 25.216  1.00 49.92  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -14.782 44.093 24.256  1.00 49.92  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -14.317 44.130 22.957  1.00 49.92  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -15.353 42.870 24.415  1.00 49.92  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -14.600 42.985 22.357  1.00 49.92  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -15.236 42.206 23.217  1.00 49.92  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -13.719 46.659 27.819  1.00 54.67  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -13.517 47.790 28.727  1.00 54.67  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -12.145 47.845 29.421  1.00 54.67  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -11.620 48.924 29.662  1.00 54.67  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -14.655 47.973 29.790  1.00 27.36  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -15.039 46.713 30.380  1.00 27.36  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -15.862 48.663 29.169  1.00 27.36  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -11.561 46.692 29.741  1.00 42.49  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -10.357 46.630 30.611  1.00 42.49  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -10.649 47.085 32.041  1.00 42.49  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -9.761  47.476 32.798  1.00 42.49  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.149  47.359 30.005  1.00 40.36  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -8.543  46.641 28.825  1.00 40.36  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -8.761  47.091 27.526  1.00 40.36  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -7.772  45.507 29.003  1.00 40.36  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -8.209  46.409 26.434  1.00 40.36  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -7.224  44.836 27.921  1.00 40.36  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -7.442  45.285 26.640  1.00 40.36  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -11.916 47.033 32.416  1.00 39.39  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.231 47.202 33.809  1.00 39.39  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -11.844 45.906 34.523  1.00 39.39  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -11.847 44.796 33.926  1.00 39.39  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -13.692 47.629 34.036  1.00 89.55  ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -14.742 46.864 33.231  1.00 89.55  ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -16.120 47.538 33.220  1.00 89.55  ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -17.090 46.875 32.766  1.00 89.55  ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -16.232 48.713 33.660  1.00 89.55  ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -11.459 46.050 35.780  1.00 38.33  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -11.127 44.903 36.561  1.00 38.33  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -12.430 44.262 37.049  1.00 38.33  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -12.952 44.574 38.120  1.00 38.33  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -10.235 45.323 37.692  1.00 40.00  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -9.697  44.102 38.441  1.00 40.00  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -9.117  46.155 37.124  1.00 40.00  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -12.975 43.374 36.239  1.00 20.37  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -14.222 42.741 36.598  1.00 20.37  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -14.205 42.097 37.991  1.00 20.37  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -15.078 42.389 38.802  1.00 20.37  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -14.627 41.723 35.536  1.00 33.97  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -14.803 42.234 34.106  1.00 33.97  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -15.270 41.117 33.197  1.00 33.97  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -15.746 43.387 34.058  1.00 33.97  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -13.235 41.225 38.270  1.00 36.93  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.197 40.481 39.547  1.00 36.93  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -11.757 40.227 40.001  1.00 36.93  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -10.845 40.139 39.160  1.00 36.93  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -13.955 39.157 39.423  1.00 36.88  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -13.975 38.341 40.681  1.00 36.88  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -14.899 38.536 41.687  1.00 36.88  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.184 37.319 41.096  1.00 36.88  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -14.671 37.676 42.667  1.00 36.88  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -13.638 36.924 42.332  1.00 36.88  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -11.556 40.120 41.320  1.00 29.03  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.233 39.923 41.899  1.00 29.03  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.291 38.960 43.089  1.00 29.03  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -10.869 39.269 44.141  1.00 29.03  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -9.616  41.258 42.317  1.00 2.38   ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -9.688  37.787 42.912  1.00 24.96  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -9.558  36.797 43.954  1.00 24.96  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.256  37.058 44.675  1.00 24.96  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.220  37.234 44.022  1.00 24.96  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -9.517  35.419 43.319  1.00 35.95  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.510  34.288 44.304  1.00 35.95  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.645 33.871 44.967  1.00 35.95  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.511  33.466 44.704  1.00 35.95  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -10.338 32.859 45.754  1.00 35.95  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -9.051  32.590 45.609  1.00 35.95  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.290  37.077 46.004  1.00 32.22  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.068  37.187 46.781  1.00 32.22  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -6.672  35.810 47.305  1.00 32.22  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.493  35.081 47.881  1.00 32.22  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.233  38.165 47.931  1.00 35.77  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.097  38.133 48.892  1.00 35.77  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.158  39.234 49.940  1.00 35.77  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.719  40.300 49.728  1.00 35.77  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -5.528  38.983 51.076  1.00 35.77  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.415  35.437 47.099  1.00 22.14  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -4.945  34.151 47.566  1.00 22.14  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.756  34.149 49.089  1.00 22.14  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -5.135  35.113 49.746  1.00 22.14  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.679  33.793 46.806  1.00 16.97  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -3.918  33.527 45.348  1.00 16.97  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -3.674  34.502 44.396  1.00 16.97  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.374  32.317 44.921  1.00 16.97  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -3.887  34.282 43.037  1.00 16.97  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -4.610  32.094 43.537  1.00 16.97  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.367  33.102 42.615  1.00 16.97  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -4.178  33.084 49.652  1.00 28.33  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -4.126  32.898 51.123  1.00 28.33  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -3.075  33.813 51.674  1.00 28.33  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -2.276  34.315 50.898  1.00 28.33  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.776  31.440 51.483  1.00 25.63  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.785  30.341 51.082  1.00 25.63  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -4.213  28.907 51.080  1.00 25.63  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -6.016  30.413 51.945  1.00 25.63  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -3.042  34.028 52.987  1.00 51.13  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.909  34.708 53.604  1.00 51.13  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.636  34.026 53.177  1.00 51.13  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? -0.546  32.802 53.260  1.00 51.13  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -1.980  34.600 55.095  1.00 51.11  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -2.789  35.670 55.737  1.00 51.11  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -2.439  35.793 57.202  1.00 51.11  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -1.419  36.405 57.569  1.00 51.11  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -3.270  35.178 58.057  1.00 51.11  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.326   34.812 52.695  1.00 42.10  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 1.643   34.321 52.268  1.00 42.10  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 1.711   33.383 51.072  1.00 42.10  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.757   32.825 50.783  1.00 42.10  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.370   33.774 53.467  1.00 40.98  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 2.208   34.683 54.645  1.00 40.98  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 2.876   35.730 54.741  1.00 40.98  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 1.252   34.352 55.513  1.00 40.98  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 0.608   33.225 50.358  1.00 33.78  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 0.620   32.508 49.082  1.00 33.78  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 1.108   33.422 47.938  1.00 33.78  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 0.445   34.403 47.612  1.00 33.78  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.802  31.986 48.802  1.00 35.23  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.847  30.856 47.790  1.00 35.23  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -2.190  30.098 47.747  1.00 35.23  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -3.283  30.714 47.872  1.00 35.23  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -2.133  28.861 47.564  1.00 35.23  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 2.268   33.128 47.352  1.00 28.12  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.744   33.835 46.121  1.00 28.12  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 2.361   32.996 44.947  1.00 28.12  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 2.760   31.813 44.864  1.00 28.12  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 4.266   33.955 46.040  1.00 53.04  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.894   34.965 46.944  1.00 53.04  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 6.127   35.577 46.617  1.00 53.04  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 4.265   35.319 48.132  1.00 53.04  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 6.720   36.520 47.498  1.00 53.04  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 4.830   36.245 49.010  1.00 53.04  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 6.047   36.836 48.706  1.00 53.04  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 6.514   37.728 49.643  1.00 53.04  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 1.617   33.593 44.020  1.00 18.51  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 1.230   32.864 42.806  1.00 18.51  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 2.442   32.987 41.898  1.00 18.51  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 3.151   33.986 41.981  1.00 18.51  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.004  33.489 42.196  1.00 19.67  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.769   31.969 41.123  1.00 31.43  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.953   32.080 40.281  1.00 31.43  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.643   31.805 38.859  1.00 31.43  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 4.326   32.305 37.993  1.00 31.43  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 5.088   31.154 40.699  1.00 21.18  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 5.521   31.144 42.153  1.00 21.18  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 6.541   30.079 42.355  1.00 21.18  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 6.054   32.514 42.576  1.00 21.18  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.634   30.991 38.607  1.00 20.15  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 2.288   30.653 37.238  1.00 20.15  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.783   30.735 37.012  1.00 20.15  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.003  30.754 37.950  1.00 20.15  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.823   29.253 36.901  1.00 22.37  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.685   28.393 38.016  1.00 22.37  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? 0.411   30.793 35.741  1.00 24.73  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -0.975  30.964 35.347  1.00 24.73  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.143  30.348 33.989  1.00 24.73  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -0.276  30.505 33.155  1.00 24.73  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.310  32.455 35.229  1.00 28.42  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -2.637  32.783 34.549  1.00 28.42  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -3.839  32.346 35.427  1.00 28.42  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -2.663  34.257 34.160  1.00 28.42  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.262  29.674 33.758  1.00 28.31  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -2.560  29.125 32.431  1.00 28.31  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.087  29.209 32.149  1.00 28.31  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -4.902  29.121 33.080  1.00 28.31  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -1.983  27.666 32.307  1.00 23.33  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -2.823  26.679 33.112  1.00 23.33  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -1.928  27.224 30.899  1.00 23.33  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -4.477  29.406 30.890  1.00 39.38  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -5.901  29.307 30.542  1.00 39.38  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.132  28.151 29.566  1.00 39.38  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -5.682  28.206 28.431  1.00 39.38  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -6.444  30.629 29.996  1.00 41.77  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -7.689  30.444 29.344  1.00 41.77  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -6.817  27.094 30.007  1.00 39.17  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.019  25.916 29.136  1.00 39.17  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -8.174  25.002 29.524  1.00 39.17  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -8.776  25.151 30.588  1.00 39.17  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -5.743  25.083 29.039  1.00 42.25  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -5.355  24.255 30.591  1.00 42.25  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -8.458  24.057 28.621  1.00 35.82  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -9.402  22.943 28.844  1.00 35.82  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -8.647  21.736 29.375  1.00 35.82  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -7.493  21.573 29.083  1.00 35.82  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.119 22.567 27.536  1.00 50.26  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -11.172 23.582 27.061  1.00 50.26  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -12.139 23.031 25.984  1.00 50.26  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -11.531 23.146 24.584  1.00 50.26  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -12.548 23.374 23.529  1.00 50.26  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.292  20.877 30.142  1.00 56.89  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.612  19.646 30.532  1.00 56.89  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.348  18.323 30.215  1.00 56.89  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.581 18.282 30.149  1.00 56.89  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.178  19.732 31.990  1.00 46.35  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -6.951  20.610 32.214  1.00 46.35  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -6.657  20.766 33.715  1.00 46.35  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -5.775  20.036 31.480  1.00 46.35  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -8.575  17.256 29.997  1.00 69.11  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.136  15.927 29.763  1.00 69.11  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -10.287 16.013 28.791  1.00 69.11  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -10.092 16.389 27.648  1.00 69.11  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.492 15.712 29.261  1.00 36.95  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -12.683 15.676 28.396  1.00 36.95  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -13.724 16.738 28.781  1.00 36.95  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -14.717 16.926 28.071  1.00 36.95  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.308 14.267 28.385  1.00 63.31  ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -12.354 13.101 27.955  1.00 63.31  ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.509 11.886 28.917  1.00 63.31  ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -11.584 10.686 28.593  1.00 63.31  ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -10.397 10.510 29.489  1.00 63.31  ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.490 17.415 29.911  1.00 37.29  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.310 18.536 30.413  1.00 37.29  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.222 19.669 29.382  1.00 37.29  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.110 20.008 28.964  1.00 37.29  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -13.736 18.972 31.769  1.00 50.40  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -14.578 20.027 32.484  1.00 50.40  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -15.376 20.748 31.842  1.00 50.40  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -14.411 20.153 33.723  1.00 50.40  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.380 20.201 28.913  1.00 57.94  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -15.483 21.203 27.822  1.00 57.94  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.203 22.644 28.222  1.00 57.94  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -14.900 23.471 27.374  1.00 57.94  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -16.933 21.091 27.363  1.00 49.22  ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -17.598 20.210 28.314  1.00 49.22  ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -16.705 19.826 29.414  1.00 49.22  ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.327 22.916 29.512  1.00 47.10  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -14.971 24.184 30.109  1.00 47.10  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -13.499 24.551 29.889  1.00 47.10  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -12.650 23.664 29.699  1.00 47.10  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.205 24.100 31.620  1.00 44.02  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -16.676 24.168 32.018  1.00 44.02  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -17.580 23.864 31.233  1.00 44.02  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -16.915 24.578 33.268  1.00 44.02  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.212 25.857 29.955  1.00 51.34  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -11.842 26.421 29.988  1.00 51.34  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -11.611 27.009 31.371  1.00 51.34  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -12.532 27.578 31.925  1.00 51.34  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -11.698 27.504 28.934  1.00 40.05  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -12.082 26.950 27.662  1.00 40.05  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -10.254 28.003 28.863  1.00 40.05  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -10.501 26.750 32.025  1.00 47.25  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -10.384 27.213 33.389  1.00 47.25  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.234  28.142 33.406  1.00 47.25  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -8.593  28.280 32.421  1.00 47.25  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -10.145 26.044 34.324  1.00 55.82  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.274 25.069 34.346  1.00 55.82  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.262 23.955 33.564  1.00 55.82  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -12.357 25.278 35.127  1.00 55.82  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.289 23.098 33.568  1.00 55.82  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -13.375 24.426 35.133  1.00 55.82  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -13.345 23.341 34.362  1.00 55.82  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -14.397 22.489 34.394  1.00 55.82  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -8.967  28.788 34.511  1.00 31.83  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -7.745  29.513 34.627  1.00 31.83  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.063  28.719 35.656  1.00 31.83  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -7.601  28.581 36.696  1.00 31.83  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -7.992  30.877 35.214  1.00 21.80  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -8.361  31.893 34.229  1.00 21.80  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -7.468  32.337 33.334  1.00 21.80  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -9.596  32.416 34.209  1.00 21.80  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -7.807  33.258 32.444  1.00 21.80  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -9.925  33.333 33.311  1.00 21.80  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -9.038  33.749 32.431  1.00 21.80  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -5.885  28.183 35.418  1.00 33.27  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.293  27.501 36.523  1.00 33.27  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.094  28.317 36.980  1.00 33.27  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.419  28.969 36.175  1.00 33.27  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -4.911  26.061 36.143  1.00 28.64  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -6.092  25.355 35.464  1.00 28.64  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -4.543  25.292 37.370  1.00 28.64  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -5.737  24.551 34.193  1.00 28.64  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -3.835  28.287 38.278  1.00 23.97  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -2.786  29.094 38.879  1.00 23.97  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -1.860  28.258 39.764  1.00 23.97  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.330  27.576 40.682  1.00 23.97  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.389  30.227 39.761  1.00 32.10  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.283  31.074 40.413  1.00 32.10  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.358  31.094 38.959  1.00 32.10  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -0.553  28.322 39.498  1.00 36.70  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? 0.441   27.683 40.359  1.00 36.70  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.966   28.633 41.421  1.00 36.70  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 1.437   29.707 41.086  1.00 36.70  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 0.880   28.237 42.691  1.00 24.32  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.289   29.097 43.797  1.00 24.32  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.446   28.502 44.565  1.00 24.32  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 3.079   27.542 44.103  1.00 24.32  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? 0.164   29.384 44.861  1.00 36.07  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.009  28.241 45.706  1.00 36.07  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.172  29.784 44.234  1.00 36.07  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.691   29.083 45.746  1.00 31.30  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.779   28.689 46.624  1.00 31.30  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.671   29.408 47.943  1.00 31.30  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.430   30.638 47.989  1.00 31.30  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 5.072   29.019 46.016  1.00 8.20   ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 3.860   28.641 49.016  1.00 38.84  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 3.651   29.140 50.354  1.00 38.84  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 4.931   29.694 50.928  1.00 38.84  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 5.898   28.975 51.136  1.00 38.84  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.074   28.054 51.221  1.00 33.63  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 1.599   27.846 50.975  1.00 33.63  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 0.490   29.257 51.378  1.00 33.63  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 1.452   30.140 52.600  1.00 33.63  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 4.950   30.989 51.186  1.00 38.15  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 6.219   31.669 51.430  1.00 38.15  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 6.423   32.123 52.859  1.00 38.15  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 6.045   33.213 53.222  1.00 38.15  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 6.426   32.824 50.425  1.00 22.81  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 7.520   33.766 50.897  1.00 22.81  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 6.782   32.209 49.063  1.00 22.81  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 7.068   31.297 53.659  1.00 103.45 ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 7.146   31.600 55.064  1.00 103.45 ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 8.388   32.428 55.434  1.00 103.45 ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 9.334   32.456 54.652  1.00 103.45 ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 7.019   30.296 55.829  1.00 54.98  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 5.582   29.796 55.861  1.00 54.98  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 5.233   28.542 55.358  1.00 54.98  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 4.579   30.593 56.382  1.00 54.98  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 3.921   28.099 55.397  1.00 54.98  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 3.281   30.168 56.427  1.00 54.98  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 2.951   28.928 55.937  1.00 54.98  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 1.634   28.545 56.021  1.00 54.98  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 8.359   33.141 56.599  1.00 74.20  ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 9.384   33.995 57.250  1.00 74.20  ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 10.864  33.794 56.879  1.00 74.20  ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 11.487  34.738 56.408  1.00 74.20  ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 9.174   33.696 58.739  1.00 109.12 ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 7.730   33.197 58.844  1.00 109.12 ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 7.154   33.117 57.443  1.00 109.12 ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 11.382  32.588 57.095  1.00 103.70 ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 12.763  32.255 56.767  1.00 103.70 ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 12.916  30.741 56.664  1.00 103.70 ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 13.116  30.058 57.669  1.00 103.70 ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 13.717  32.812 57.824  1.00 145.76 ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 13.789  34.330 57.861  1.00 145.76 ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 14.688  34.845 58.969  1.00 145.76 ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 15.105  34.036 59.823  1.00 145.76 ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 14.980  36.059 58.983  1.00 145.76 ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 12.772  30.295 55.431  1.00 99.50  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 12.728  28.923 55.038  1.00 99.50  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 13.022  29.289 53.648  1.00 99.50  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 12.324  30.099 53.085  1.00 99.50  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 11.309  28.385 55.122  1.00 106.09 ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 10.733  28.334 56.518  1.00 106.09 ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 10.116  29.631 56.955  1.00 106.09 ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 10.173  30.611 56.203  1.00 106.09 ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 9.559   29.675 58.057  1.00 106.09 ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 14.089  28.756 53.104  1.00 112.95 ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 14.647  29.317 51.862  1.00 112.95 ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 13.735  28.563 50.898  1.00 112.95 ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 12.614  29.018 50.634  1.00 112.95 ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 15.981  28.580 52.074  1.00 108.11 ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 14.184  27.415 50.391  1.00 48.73  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 13.300  26.538 49.644  1.00 48.73  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 11.969  26.479 50.385  1.00 48.73  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 11.948  26.251 51.595  1.00 48.73  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 13.892  25.130 49.519  1.00 97.79  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 14.913  24.966 48.397  1.00 97.79  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 14.273  24.838 47.017  1.00 97.79  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 13.055  25.122 46.886  1.00 97.79  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 14.998  24.460 46.058  1.00 97.79  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 10.863  26.738 49.677  1.00 67.80  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.555   26.554 50.261  1.00 67.80  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 9.044   25.161 49.905  1.00 67.80  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 9.279   24.671 48.799  1.00 67.80  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.721   27.638 49.578  1.00 44.91  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 9.516   28.045 48.327  1.00 44.91  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.771  27.237 48.295  1.00 44.91  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 8.345   24.528 50.839  1.00 52.59  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 8.010   23.127 50.681  1.00 52.59  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 6.529   22.917 50.399  1.00 52.59  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 6.074   21.782 50.282  1.00 52.59  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 8.508   22.332 51.896  1.00 120.29 ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 10.047  22.324 52.019  1.00 120.29 ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 10.535  21.671 53.299  1.00 120.29 ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 12.024  21.440 53.240  1.00 120.29 ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 12.424  20.409 54.224  1.00 120.29 ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 5.791   24.017 50.241  1.00 56.00  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.352   23.959 49.998  1.00 56.00  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 3.823   24.988 48.994  1.00 56.00  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 4.336   26.091 48.868  1.00 56.00  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 3.599   24.126 51.307  1.00 81.38  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 3.546   22.901 52.152  1.00 81.38  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 3.450   23.237 53.616  1.00 81.38  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 3.170   24.378 53.994  1.00 81.38  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 3.688   22.243 54.460  1.00 81.38  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 2.763   24.600 48.301  1.00 41.46  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 2.005   25.466 47.429  1.00 41.46  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 0.740   24.745 46.971  1.00 41.46  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 0.421   23.650 47.482  1.00 41.46  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? 0.004   25.356 46.028  1.00 32.69  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -1.240  24.764 45.542  1.00 32.69  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -1.358  24.933 44.059  1.00 32.69  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -0.739  25.824 43.500  1.00 32.69  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -2.449  25.433 46.157  1.00 36.26  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.505  25.452 47.627  1.00 36.26  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -3.920  25.808 48.067  1.00 36.26  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -4.177  27.249 48.098  1.00 36.26  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -5.289  27.828 47.653  1.00 36.26  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -6.252  27.122 47.107  1.00 36.26  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -5.428  29.137 47.728  1.00 36.26  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -2.172  24.095 43.429  1.00 33.33  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -2.526  24.331 42.052  1.00 33.33  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -4.015  24.610 42.067  1.00 33.33  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -4.766  23.719 42.361  1.00 33.33  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -2.235  23.121 41.189  1.00 8.34   ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -0.740  22.950 41.026  1.00 8.34   ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -2.830  23.302 39.791  1.00 8.34   ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.393  21.820 40.095  1.00 8.34   ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.458  25.831 41.774  1.00 33.15  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -5.860  26.137 42.005  1.00 33.15  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.582  26.177 40.647  1.00 33.15  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -6.058  26.781 39.699  1.00 33.15  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -6.039  27.459 42.815  1.00 30.27  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.463  27.609 43.245  1.00 30.27  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -5.111  27.524 44.070  1.00 30.27  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -7.745  25.521 40.515  1.00 20.54  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.446  25.598 39.252  1.00 20.54  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -9.681  26.448 39.393  1.00 20.54  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -10.540 26.129 40.195  1.00 20.54  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -8.884  24.234 38.787  1.00 10.21  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.862  24.368 37.579  1.00 10.21  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -7.691  23.370 38.450  1.00 10.21  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -9.781  27.503 38.591  1.00 34.19  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -10.801 28.539 38.746  1.00 34.19  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -11.773 28.521 37.598  1.00 34.19  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.427 28.103 36.522  1.00 34.19  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.129 29.891 38.722  1.00 25.16  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.439  30.279 40.000  1.00 25.16  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.061  30.305 40.071  1.00 25.16  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.167 30.690 41.104  1.00 25.16  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.404  30.722 41.242  1.00 25.16  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.536  31.132 42.291  1.00 25.16  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -8.152  31.140 42.363  1.00 25.16  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -13.000 28.976 37.788  1.00 48.71  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -13.892 29.052 36.636  1.00 48.71  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -14.489 30.415 36.549  1.00 48.71  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -15.062 30.929 37.519  1.00 48.71  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -14.994 28.015 36.690  1.00 69.60  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -15.063 27.226 35.424  1.00 69.60  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -16.343 27.392 34.667  1.00 69.60  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -17.307 26.659 34.892  1.00 69.60  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -16.354 28.327 33.727  1.00 69.60  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -14.331 31.038 35.396  1.00 47.23  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.021 32.277 35.211  1.00 47.23  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.234 31.997 34.342  1.00 47.23  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -16.155 32.015 33.115  1.00 47.23  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.103 33.361 34.637  1.00 30.07  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -14.750 34.713 34.749  1.00 30.07  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -14.920 35.323 36.010  1.00 30.07  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.266 35.354 33.618  1.00 30.07  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -15.555 36.546 36.146  1.00 30.07  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -15.901 36.609 33.744  1.00 30.07  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -16.035 37.189 35.016  1.00 30.07  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -16.641 38.408 35.146  1.00 30.07  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.345 31.674 34.985  1.00 104.16 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -18.529 31.270 34.252  1.00 104.16 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -19.539 32.377 34.356  1.00 104.16 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -19.565 33.103 35.363  1.00 104.16 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -19.125 30.003 34.852  1.00 77.76  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -19.575 30.274 36.172  1.00 77.76  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -20.384 32.491 33.334  1.00 110.24 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -21.450 33.482 33.313  1.00 110.24 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -21.415 34.306 34.587  1.00 110.24 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -21.872 33.861 35.640  1.00 110.24 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -22.812 32.803 33.161  1.00 114.67 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -23.959 33.795 33.143  1.00 114.67 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -23.696 35.011 33.250  1.00 114.67 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -25.122 33.358 33.023  1.00 114.67 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -20.863 35.508 34.487  1.00 59.12  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -20.700 36.356 35.650  1.00 59.12  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.659 36.361 36.753  1.00 59.12  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -19.040 37.406 37.006  1.00 59.12  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.465 35.243 37.454  1.00 57.20  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.425 35.267 38.484  1.00 57.20  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.301 34.209 38.395  1.00 57.20  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -17.331 33.287 37.557  1.00 57.20  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -19.013 35.441 39.900  1.00 131.69 ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -19.901 34.311 40.428  1.00 131.69 ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -19.151 33.372 41.398  1.00 131.69 ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -18.343 34.123 42.463  1.00 131.69 ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -19.180 34.877 43.423  1.00 131.69 ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.293 34.403 39.242  1.00 50.14  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.167 33.497 39.377  1.00 50.14  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.498 32.351 40.348  1.00 50.14  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -15.857 32.571 41.508  1.00 50.14  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -13.931 34.260 39.894  1.00 29.08  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -12.526 33.949 39.320  1.00 29.08  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -11.462 34.172 40.394  1.00 29.08  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.381 32.570 38.727  1.00 29.08  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.335 31.123 39.882  1.00 68.05  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -15.701 29.965 40.668  1.00 68.05  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.431 29.163 40.989  1.00 68.05  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -13.654 28.869 40.087  1.00 68.05  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -16.695 29.160 39.841  1.00 120.78 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.427 28.062 40.558  1.00 120.78 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -17.987 27.033 39.585  1.00 120.78 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -17.940 27.219 38.361  1.00 120.78 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -18.515 25.936 40.124  1.00 120.78 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -14.198 28.852 42.270  1.00 55.09  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -13.119 27.923 42.672  1.00 55.09  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -13.588 26.492 42.479  1.00 55.09  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -14.311 25.957 43.321  1.00 55.09  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.720 28.027 44.176  1.00 31.39  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -12.492 29.393 44.567  1.00 31.39  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -11.453 27.206 44.457  1.00 31.39  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -13.179 25.881 41.374  1.00 37.10  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.515 24.497 41.062  1.00 37.10  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.729 23.539 41.919  1.00 37.10  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -13.285 22.911 42.785  1.00 37.10  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -13.179 24.157 39.617  1.00 41.38  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -13.650 22.705 39.287  1.00 41.38  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -13.747 25.232 38.675  1.00 41.38  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -11.428 23.444 41.670  1.00 36.95  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.577 22.420 42.293  1.00 36.95  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -9.355  22.992 43.043  1.00 36.95  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -9.076  24.192 42.974  1.00 36.95  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -10.140 21.406 41.225  1.00 27.75  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.602  22.134 43.720  1.00 47.49  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.535  22.625 44.563  1.00 47.49  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.185  21.880 44.505  1.00 47.49  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -5.163  22.518 44.263  1.00 47.49  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -8.030  22.752 45.982  1.00 61.06  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -7.454  23.898 46.707  1.00 61.06  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.978  23.996 48.122  1.00 61.06  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -7.229  24.453 49.009  1.00 61.06  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -9.136  23.606 48.355  1.00 61.06  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -6.129  20.569 44.706  1.00 34.56  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -4.790  19.882 44.858  1.00 34.56  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -3.607  20.608 45.585  1.00 34.56  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -2.951  21.473 45.028  1.00 34.56  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -4.280  19.314 43.532  1.00 35.67  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -3.090  18.366 43.702  1.00 35.67  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.377  16.930 43.310  1.00 35.67  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -3.719  16.040 44.509  1.00 35.67  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -4.228  14.737 43.992  1.00 35.67  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -3.342  20.208 46.825  1.00 54.49  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -2.137  20.593 47.563  1.00 54.49  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? -0.969  19.929 46.889  1.00 54.49  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -1.140  18.944 46.207  1.00 54.49  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -2.237  20.093 48.997  1.00 59.84  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -0.989  20.262 49.819  1.00 59.84  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -1.120  19.661 51.200  1.00 59.84  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? -0.203  19.865 52.033  1.00 59.84  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -2.143  18.996 51.450  1.00 59.84  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 0.226   20.445 47.108  1.00 44.11  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 1.359   20.120 46.259  1.00 44.11  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 2.529   20.523 47.115  1.00 44.11  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 2.407   21.484 47.845  1.00 44.11  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 1.271   20.975 44.971  1.00 34.04  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 2.185   22.161 45.056  1.00 34.04  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 1.577   20.185 43.779  1.00 34.04  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 3.648   19.796 47.067  1.00 56.34  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 4.729   20.007 48.062  1.00 56.34  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 5.878   20.838 47.538  1.00 56.34  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 6.978   20.347 47.360  1.00 56.34  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 5.250   18.684 48.630  1.00 75.32  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 4.197   17.844 49.337  1.00 75.32  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 4.444   16.359 49.098  1.00 75.32  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 4.317   15.982 47.609  1.00 75.32  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 4.298   14.499 47.352  1.00 75.32  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 5.623   22.114 47.303  1.00 36.78  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 6.666   23.012 46.864  1.00 36.78  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 6.133   24.148 46.017  1.00 36.78  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 4.929   24.276 45.781  1.00 36.78  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 7.056   24.978 45.549  1.00 38.50  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.709   26.120 44.719  1.00 38.50  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.348   25.693 43.291  1.00 38.50  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 7.073   24.931 42.660  1.00 38.50  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.867   27.136 44.728  1.00 55.84  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 5.227   26.174 42.783  1.00 43.37  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 4.918   25.863 41.401  1.00 43.37  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.487   26.906 40.461  1.00 43.37  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.810   27.897 40.120  1.00 43.37  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.427   25.686 41.109  1.00 25.35  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 3.309   25.074 39.734  1.00 25.35  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 2.787   24.781 42.106  1.00 25.35  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.723   26.670 40.027  1.00 41.19  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 7.457   27.642 39.208  1.00 41.19  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.943   27.792 37.758  1.00 41.19  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 7.146   28.827 37.127  1.00 41.19  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.968   27.361 39.230  1.00 45.82  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.656   27.704 40.528  1.00 45.82  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 9.993   26.713 41.434  1.00 45.82  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.984   29.027 40.843  1.00 45.82  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.626  27.029 42.632  1.00 45.82  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 10.610  29.353 42.034  1.00 45.82  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.925  28.348 42.920  1.00 45.82  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.552  28.646 44.100  1.00 45.82  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 6.290   26.771 37.221  1.00 33.65  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.834   26.847 35.838  1.00 33.65  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.883   25.720 35.526  1.00 33.65  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.939   24.678 36.155  1.00 33.65  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 7.004   26.830 34.859  1.00 66.22  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 7.105   25.568 34.241  1.00 66.22  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.989   25.940 34.579  1.00 30.00  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 3.065   24.907 34.239  1.00 30.00  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 2.601   25.088 32.821  1.00 30.00  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 2.665   26.176 32.281  1.00 30.00  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.918   24.806 35.242  1.00 26.49  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 0.933   25.938 35.288  1.00 26.49  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.260  25.714 36.668  1.00 26.49  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? 0.928   25.525 37.987  1.00 26.49  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 2.189   24.010 32.177  1.00 47.37  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.814   24.114 30.780  1.00 47.37  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.925   22.931 30.449  1.00 47.37  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 1.239   21.799 30.812  1.00 47.37  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 3.065   24.184 29.883  1.00 37.04  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.594   22.795 29.583  1.00 37.04  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 2.754   24.857 28.606  1.00 37.04  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.210  23.199 29.814  1.00 37.41  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.108  22.114 29.432  1.00 37.41  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.411  21.336 28.328  1.00 37.41  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -0.006  21.913 27.309  1.00 37.41  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.481  22.638 28.986  1.00 52.07  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.475  21.560 28.544  1.00 52.07  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.365  21.178 27.059  1.00 52.07  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -3.234  22.080 26.215  1.00 52.07  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -3.444  19.970 26.731  1.00 52.07  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -0.238  20.039 28.562  1.00 64.73  ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? 0.504   19.203 27.640  1.00 64.73  ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -0.428  18.716 26.536  1.00 64.73  ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -0.645  19.436 25.528  1.00 64.73  ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 1.222   18.056 28.369  1.00 52.29  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 2.352   17.425 27.573  1.00 52.29  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 3.187   18.205 26.754  1.00 52.29  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 2.602   16.043 27.662  1.00 52.29  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 4.233   17.623 26.029  1.00 52.29  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 3.655   15.447 26.930  1.00 52.29  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 4.465   16.241 26.115  1.00 52.29  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -0.988  17.520 26.721  1.00 87.86  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -1.839  16.935 25.699  1.00 87.86  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -3.133  16.432 26.281  1.00 87.86  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -3.656  15.418 25.846  1.00 87.86  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -1.125  15.784 25.003  1.00 39.73  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -0.007  16.241 24.084  1.00 39.73  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -0.246  16.584 22.923  1.00 39.73  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 1.231   16.206 24.583  1.00 39.73  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -3.648  17.142 27.270  1.00 46.15  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -4.893  16.751 27.929  1.00 46.15  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -4.774  16.851 29.432  1.00 46.15  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -5.773  17.016 30.137  1.00 46.15  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -3.528  16.766 29.894  1.00 43.92  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.168  16.811 31.289  1.00 43.92  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.516  18.143 31.629  1.00 43.92  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.247  18.960 30.747  1.00 43.92  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -2.195  15.679 31.562  1.00 34.00  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -2.751  14.333 31.153  1.00 34.00  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -1.960  13.212 31.785  1.00 34.00  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -2.676  11.858 31.670  1.00 34.00  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -2.207  11.006 32.799  1.00 34.00  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.261  18.371 32.911  1.00 34.19  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.579  19.595 33.334  1.00 34.19  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.164  19.255 33.716  1.00 34.19  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? 0.063   18.590 34.739  1.00 34.19  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.274  20.205 34.555  1.00 27.46  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -1.890  21.607 35.030  1.00 27.46  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -2.634  22.638 34.209  1.00 27.46  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -2.274  21.762 36.465  1.00 27.46  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.785   19.698 32.903  1.00 47.46  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 2.189   19.505 33.224  1.00 47.46  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.681   20.677 34.049  1.00 47.46  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 2.630   21.822 33.599  1.00 47.46  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 3.008   19.382 31.944  1.00 22.01  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 4.516   19.543 32.101  1.00 22.01  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 5.050   18.242 32.565  1.00 22.01  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 5.239   19.974 30.836  1.00 22.01  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 3.180   20.387 35.239  1.00 28.89  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.532   21.416 36.200  1.00 28.89  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 4.923   21.170 36.805  1.00 28.89  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.200   20.068 37.242  1.00 28.89  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.497   21.400 37.290  1.00 12.69  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 5.799   22.165 36.871  1.00 32.15  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 7.085   21.994 37.570  1.00 32.15  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 6.985   22.475 39.027  1.00 32.15  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 6.858   23.690 39.283  1.00 32.15  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 8.193   22.766 36.856  1.00 64.36  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 9.415   22.693 37.563  1.00 64.36  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 7.048   21.532 39.975  1.00 35.72  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 7.002   21.852 41.391  1.00 35.72  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.340   21.640 42.015  1.00 35.72  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 8.687   20.494 42.316  1.00 35.72  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 6.067   20.941 42.165  1.00 30.10  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 4.719   20.849 41.480  1.00 30.10  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 5.881   21.455 43.599  1.00 30.10  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 4.189   19.430 41.461  1.00 30.10  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 9.067   22.748 42.210  1.00 48.94  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.277  22.828 43.026  1.00 48.94  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.227  21.688 42.738  1.00 48.94  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 11.340  20.764 43.544  1.00 48.94  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 9.875   22.809 44.508  1.00 74.50  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 10.999  23.239 45.442  1.00 74.50  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 12.103  22.677 45.439  1.00 74.50  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 10.712  24.250 46.262  1.00 74.50  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 11.888  21.703 41.593  1.00 48.06  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 12.751  20.548 41.202  1.00 48.06  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.093  19.243 40.751  1.00 48.06  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 12.806  18.328 40.404  1.00 48.06  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 13.790  20.195 42.262  1.00 35.06  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.806  21.176 42.321  1.00 35.06  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 10.771  19.149 40.711  1.00 48.80  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.130  17.913 40.267  1.00 48.80  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.127   18.216 39.156  1.00 48.80  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 8.504   19.263 39.183  1.00 48.80  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 9.401   17.195 41.447  1.00 43.51  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 10.106  17.404 42.679  1.00 43.51  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 9.311   15.724 41.191  1.00 43.51  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 8.960   17.322 38.186  1.00 45.65  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 8.037   17.578 37.067  1.00 45.65  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 7.005   16.465 36.907  1.00 45.65  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.336   15.312 36.578  1.00 45.65  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 8.767   17.858 35.693  1.00 26.40  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 7.799   17.946 34.566  1.00 26.40  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 9.440   19.140 35.721  1.00 26.40  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 5.744   16.837 37.080  1.00 34.83  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 4.687   15.876 37.269  1.00 34.83  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 3.585   16.172 36.307  1.00 34.83  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.345   17.324 36.010  1.00 34.83  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 4.169   16.007 38.689  1.00 45.95  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 5.213   15.749 39.734  1.00 45.95  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 4.530   15.455 41.038  1.00 45.95  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 5.467   15.316 42.153  1.00 45.95  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 5.933   14.157 42.612  1.00 45.95  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.561   13.014 42.047  1.00 45.95  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 6.767   14.148 43.647  1.00 45.95  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 2.921   15.133 35.817  1.00 43.18  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 1.726   15.292 34.978  1.00 43.18  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 0.530   15.130 35.833  1.00 43.18  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.564   14.374 36.783  1.00 43.18  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 1.654   14.229 33.898  1.00 40.72  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 2.010   14.643 32.472  1.00 40.72  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 2.318   16.106 32.326  1.00 40.72  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 3.170   13.766 31.949  1.00 40.72  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? -0.535  15.845 35.507  1.00 38.21  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -1.770  15.713 36.256  1.00 38.21  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.916  15.441 35.346  1.00 38.21  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -2.922  15.844 34.187  1.00 38.21  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -2.061  16.947 37.060  1.00 37.75  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -1.118  17.120 38.201  1.00 37.75  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.169   17.600 37.996  1.00 37.75  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -1.515  16.821 39.502  1.00 37.75  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 1.030   17.758 39.040  1.00 37.75  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.653  16.995 40.568  1.00 37.75  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.616   17.470 40.325  1.00 37.75  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.479   17.643 41.375  1.00 37.75  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.893  14.760 35.932  1.00 59.07  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -5.078  14.257 35.278  1.00 59.07  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -6.280  15.045 35.791  1.00 59.07  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -6.410  15.330 36.991  1.00 59.07  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -5.208  12.790 35.649  1.00 67.01  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -6.167  11.979 34.844  1.00 67.01  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -6.156  10.536 35.292  1.00 67.01  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -5.179  10.114 35.975  1.00 67.01  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -7.133  9.830  34.969  1.00 67.01  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -7.139  15.426 34.861  1.00 41.72  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -8.385  16.078 35.218  1.00 41.72  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -9.464  15.034 35.072  1.00 41.72  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -9.855  14.654 33.955  1.00 41.72  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.663  17.319 34.339  1.00 21.95  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.827  18.121 34.778  1.00 21.95  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.951 18.374 34.062  1.00 21.95  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -9.996  18.785 36.049  1.00 21.95  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.821 19.165 34.804  1.00 21.95  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -11.255 19.425 36.026  1.00 21.95  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -9.211  18.893 37.204  1.00 21.95  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -11.743 20.164 37.109  1.00 21.95  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -9.717  19.627 38.301  1.00 21.95  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -10.976 20.232 38.241  1.00 21.95  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -9.930  14.566 36.219  1.00 69.55  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -10.887 13.485 36.268  1.00 69.55  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -12.223 13.919 35.696  1.00 69.55  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -12.341 15.013 35.156  1.00 69.55  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -11.079 13.025 37.689  1.00 56.13  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -9.802  12.929 38.327  1.00 56.13  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -11.690 11.673 37.671  1.00 56.13  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -13.229 13.060 35.785  1.00 31.10  ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -14.553 13.458 35.319  1.00 31.10  ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -15.348 13.999 36.496  1.00 31.10  ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -16.351 14.710 36.302  1.00 31.10  ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -15.295 12.329 34.643  1.00 46.15  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -15.658 11.380 35.640  1.00 46.15  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -14.390 11.649 33.587  1.00 46.15  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -14.872 13.677 37.702  1.00 44.39  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -15.368 14.230 38.955  1.00 44.39  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -14.751 15.609 39.226  1.00 44.39  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -15.016 16.220 40.278  1.00 44.39  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -15.013 13.298 40.113  1.00 59.36  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -15.750 11.969 40.127  1.00 59.36  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -15.181 10.973 39.144  1.00 59.36  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -14.032 10.513 39.354  1.00 59.36  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -15.883 10.643 38.166  1.00 59.36  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -13.912 16.082 38.292  1.00 40.41  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -13.224 17.374 38.394  1.00 40.41  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -12.244 17.405 39.546  1.00 40.41  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -12.371 18.212 40.452  1.00 40.41  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -14.229 18.509 38.503  1.00 39.04  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -15.056 18.682 37.228  1.00 39.04  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -16.327 19.415 37.524  1.00 39.04  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -16.784 20.234 36.325  1.00 39.04  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -16.964 19.492 35.024  1.00 39.04  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -11.267 16.503 39.478  1.00 40.83  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -10.251 16.273 40.491  1.00 40.83  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -8.929  16.379 39.728  1.00 40.83  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -8.866  15.955 38.552  1.00 40.83  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -10.402 14.838 40.991  1.00 69.77  ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -10.587 14.756 42.479  1.00 69.77  ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -10.877 13.645 42.993  1.00 69.77  ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -10.458 15.815 43.130  1.00 69.77  ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -7.874  16.937 40.333  1.00 29.04  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -6.564  16.813 39.678  1.00 29.04  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -5.702  15.765 40.391  1.00 29.04  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -5.440  15.883 41.601  1.00 29.04  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -5.750  18.177 39.468  1.00 55.39  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -6.237  18.976 38.281  1.00 55.39  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -5.712  19.015 40.700  1.00 55.39  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -5.264  14.744 39.647  1.00 42.61  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -4.483  13.657 40.252  1.00 42.61  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -3.262  13.288 39.447  1.00 42.61  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -3.200  13.526 38.246  1.00 42.61  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -5.340  12.409 40.462  1.00 56.41  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -5.851  11.766 39.201  1.00 56.41  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -5.866  10.279 39.395  1.00 56.41  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -6.555  9.618  38.294  1.00 56.41  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -7.770  9.079  38.368  1.00 56.41  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -8.462  9.089  39.503  1.00 56.41  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -8.296  8.518  37.290  1.00 56.41  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -2.292  12.697 40.121  1.00 50.47  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -1.042  12.305 39.494  1.00 50.47  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.693  10.930 40.030  1.00 50.47  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -1.324  10.452 40.977  1.00 50.47  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.106   13.306 39.815  1.00 60.70  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 1.277   12.963 39.068  1.00 60.70  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 0.454   13.298 41.294  1.00 60.70  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.281   10.278 39.408  1.00 39.96  ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 0.835   9.075  39.967  1.00 39.96  ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 2.189   9.407  40.466  1.00 39.96  ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 3.151   9.544  39.679  1.00 39.96  ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.940   7.952  38.957  1.00 42.13  ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? 0.567   8.317  37.579  1.00 42.13  ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? 0.030   7.120  36.870  1.00 42.13  ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? 0.742   6.078  36.893  1.00 42.13  ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? -1.094  7.211  36.319  1.00 42.13  ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 2.260   9.509  41.791  1.00 39.60  ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 3.452   9.944  42.443  1.00 39.60  ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 4.722   9.170  42.022  1.00 39.60  ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 5.840   9.623  42.244  1.00 39.60  ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 3.214   10.076 43.948  1.00 62.31  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 2.846   11.835 44.425  1.00 62.31  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 4.566   8.041  41.346  1.00 60.57  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 5.745   7.324  40.894  1.00 60.57  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 6.239   7.769  39.513  1.00 60.57  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 7.292   7.314  39.029  1.00 60.57  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 5.511   5.819  40.930  1.00 81.11  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 6.685   5.066  41.546  1.00 81.11  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 7.858   5.304  41.214  1.00 81.11  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 6.372   4.147  42.447  1.00 81.11  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 5.479   8.654  38.877  1.00 64.15  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 5.879   9.174  37.583  1.00 64.15  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 6.263   10.632 37.717  1.00 64.15  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 5.474   11.538 37.452  1.00 64.15  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 4.796   8.920  36.541  1.00 90.62  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 4.569   7.465  36.281  1.00 90.62  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 3.363   6.841  36.523  1.00 90.62  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 5.416   6.499  35.853  1.00 90.62  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 3.469   5.559  36.224  1.00 90.62  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 4.705   5.326  35.818  1.00 90.62  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 7.491   10.842 38.173  1.00 33.52  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 7.986   12.177 38.425  1.00 33.52  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 9.247   12.461 37.623  1.00 33.52  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 9.499   11.818 36.610  1.00 33.52  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 8.188   12.412 39.931  1.00 121.64 ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 9.172   11.495 40.630  1.00 121.64 ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 10.537  11.540 40.332  1.00 121.64 ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 8.741   10.619 41.625  1.00 121.64 ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 11.441  10.718 40.977  1.00 121.64 ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 9.637   9.790  42.285  1.00 121.64 ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 10.993  9.843  41.957  1.00 121.64 ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 11.904  9.022  42.602  1.00 121.64 ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 10.049  13.404 38.108  1.00 121.05 ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 11.100  14.017 37.327  1.00 121.05 ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 12.107  14.774 38.171  1.00 121.05 ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 11.744  15.372 39.185  1.00 121.05 ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 10.441  14.981 36.363  1.00 190.15 ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 11.286  16.163 36.065  1.00 190.15 ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 11.463  17.038 36.910  1.00 190.15 ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 11.796  16.225 34.850  1.00 190.15 ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 13.367  14.781 37.742  1.00 44.57  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 14.413  15.516 38.471  1.00 44.57  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 14.798  16.709 37.632  1.00 44.57  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 15.888  16.746 37.050  1.00 44.57  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 15.625  14.638 38.733  1.00 69.39  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 15.269  13.383 39.483  1.00 69.39  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 14.350  13.383 40.313  1.00 69.39  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 15.988  12.293 39.197  1.00 69.39  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 13.862  17.660 37.544  1.00 68.11  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 14.001  18.908 36.779  1.00 68.11  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 13.336  20.067 37.547  1.00 68.11  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 12.201  19.925 38.024  1.00 68.11  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 13.422  18.752 35.318  1.00 68.02  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 14.372  17.909 34.445  1.00 68.02  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 13.104  20.107 34.678  1.00 68.02  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 14.064  17.917 32.962  1.00 68.02  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 14.065  21.181 37.675  1.00 51.10  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 13.515  22.445 38.160  1.00 51.10  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 13.341  23.426 36.993  1.00 51.10  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.241  24.230 36.716  1.00 51.10  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 14.411  23.022 39.258  1.00 45.82  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 14.745  24.496 39.142  1.00 45.82  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 13.743  25.573 40.199  1.00 45.82  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 14.369  25.092 41.848  1.00 45.82  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 12.188  23.355 36.314  1.00 41.15  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 11.915  24.180 35.126  1.00 41.15  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.486  25.638 35.394  1.00 41.15  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 10.299  25.995 35.329  1.00 41.15  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 10.914  23.484 34.189  1.00 23.70  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.466  26.492 35.657  1.00 37.15  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 12.181  27.908 35.768  1.00 37.15  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 11.463  28.366 34.518  1.00 37.15  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 10.635  29.253 34.588  1.00 37.15  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 13.457  28.732 35.913  1.00 55.12  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 14.536  28.355 36.922  1.00 55.12  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 15.826  29.185 36.653  1.00 55.12  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 14.020  28.494 38.361  1.00 55.12  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 11.800  27.781 33.380  1.00 33.93  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 11.201  28.192 32.132  1.00 33.93  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 10.817  26.957 31.358  1.00 33.93  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 11.591  25.976 31.333  1.00 33.93  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 12.198  29.016 31.307  1.00 25.36  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 12.897  30.115 32.085  1.00 25.36  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 14.234  30.005 32.425  1.00 25.36  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 12.211  31.244 32.480  1.00 25.36  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 14.869  30.994 33.158  1.00 25.36  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 12.793  32.198 33.191  1.00 25.36  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 14.130  32.104 33.540  1.00 25.36  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 14.720  33.151 34.253  1.00 25.36  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 9.670   27.019 30.671  1.00 34.66  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 9.080   25.826 30.047  1.00 34.66  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 8.221   26.070 28.765  1.00 34.66  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 7.337   26.900 28.749  1.00 34.66  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 8.292   25.080 31.148  1.00 34.15  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.322   23.912 30.894  1.00 34.15  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 8.083   22.586 30.964  1.00 34.15  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 6.151   23.928 31.884  1.00 34.15  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 8.469   25.337 27.691  1.00 43.31  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 7.623   25.464 26.509  1.00 43.31  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 7.332   24.106 25.882  1.00 43.31  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.975   23.131 26.236  1.00 43.31  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 8.251   26.405 25.486  1.00 42.29  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 8.467   27.858 25.965  1.00 42.29  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 7.162   28.620 26.143  1.00 42.29  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 7.392   30.111 26.304  1.00 42.29  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.738   30.721 24.980  1.00 42.29  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 6.361   24.046 24.966  1.00 35.80  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.866   22.786 24.400  1.00 35.80  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.544   22.841 22.925  1.00 35.80  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 5.033   23.842 22.437  1.00 35.80  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 4.646   22.279 25.144  1.00 43.57  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 5.074   21.263 26.043  1.00 43.57  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 3.644   21.636 24.192  1.00 43.57  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 5.873   21.752 22.225  1.00 88.57  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 5.559   21.582 20.805  1.00 88.57  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.328   20.722 20.677  1.00 88.57  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 4.201   19.713 21.379  1.00 88.57  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 6.700   20.900 20.061  1.00 179.27 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 7.992   21.662 20.086  1.00 179.27 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 9.065   20.944 19.303  1.00 179.27 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 10.446  21.344 19.776  1.00 179.27 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 10.599  21.210 21.253  1.00 179.27 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.439   21.136 19.768  1.00 135.07 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.147   20.486 19.510  1.00 135.07 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 2.276   18.990 19.343  1.00 135.07 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.313   18.300 18.999  1.00 135.07 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 3.492   18.511 19.583  1.00 69.54  ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 3.811   17.101 19.659  1.00 69.54  ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 4.012   16.768 21.137  1.00 69.54  ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 3.316   17.313 21.996  1.00 69.54  ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 5.075   16.801 18.824  1.00 132.02 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 5.449   15.318 18.802  1.00 132.02 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 4.539   14.461 18.778  1.00 132.02 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 6.664   15.015 18.806  1.00 132.02 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.972   15.889 21.410  1.00 64.13  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 5.176   15.315 22.717  1.00 64.13  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 6.453   15.869 23.339  1.00 64.13  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 7.055   15.228 24.216  1.00 64.13  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 5.248   13.786 22.584  1.00 121.74 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 3.904   13.121 22.376  1.00 121.74 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 3.032   13.553 21.368  1.00 121.74 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 3.519   12.046 23.182  1.00 121.74 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 1.797   12.944 21.177  1.00 121.74 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 2.287   11.421 23.000  1.00 121.74 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 1.421   11.874 21.992  1.00 121.74 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.852   17.065 22.893  1.00 54.15  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 8.151   17.648 23.262  1.00 54.15  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 8.090   18.721 24.363  1.00 54.15  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 7.014   19.180 24.759  1.00 54.15  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.898   18.254 22.032  1.00 50.69  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 8.345   17.708 20.705  1.00 50.69  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 10.408  18.074 22.201  1.00 50.69  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.395   17.496 19.557  1.00 50.69  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 9.268   19.160 24.802  1.00 56.09  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 9.382   20.082 25.905  1.00 56.09  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.740  20.786 25.954  1.00 56.09  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 11.753  20.104 26.015  1.00 56.09  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 9.246   19.242 27.154  1.00 32.38  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 8.322   19.736 28.244  1.00 32.38  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 6.895   19.800 27.711  1.00 32.38  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 8.486   18.787 29.450  1.00 32.38  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.774  22.126 25.947  1.00 35.34  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 12.023  22.874 26.254  1.00 35.34  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 11.932  23.290 27.717  1.00 35.34  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 10.956  23.920 28.077  1.00 35.34  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 12.279  24.150 25.340  1.00 37.03  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 13.741  24.390 25.128  1.00 37.03  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 11.662  24.013 23.982  1.00 37.03  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 12.910  22.909 28.543  1.00 39.09  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 12.948  23.215 29.983  1.00 39.09  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 14.247  23.965 30.222  1.00 39.09  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 15.035  24.080 29.273  1.00 39.09  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 14.439  24.529 31.439  1.00 99.53  ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.772  24.909 32.046  1.00 99.53  ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 15.890  24.499 33.525  1.00 99.53  ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 15.068  24.937 34.330  1.00 99.53  ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.055  26.422 31.989  1.00 99.44  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.237  26.876 32.962  1.00 99.44  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 17.443  26.302 34.067  1.00 99.44  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 17.964  27.845 32.633  1.00 99.44  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 16.930  23.741 33.902  1.00 60.80  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.113  23.338 35.321  1.00 60.80  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.349  23.922 36.061  1.00 60.80  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 18.234  24.848 36.898  1.00 60.80  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 17.027  21.801 35.481  1.00 66.83  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 17.714  21.027 36.637  1.00 66.83  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 17.327  21.466 38.079  1.00 66.83  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 17.595  19.496 36.475  1.00 66.83  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.519  23.366 35.749  1.00 69.41  ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 20.777  23.753 36.378  1.00 69.41  ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.598  24.562 35.389  1.00 69.41  ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 22.638  24.094 34.906  1.00 69.41  ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 21.552  22.496 36.762  1.00 87.59  ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 22.388  22.661 38.012  1.00 87.59  ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 21.340  22.784 39.468  1.00 87.59  ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 20.610  21.140 39.543  1.00 87.59  ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 21.103  25.762 35.082  1.00 98.79  ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 21.662  26.671 34.055  1.00 98.79  ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 21.809  26.072 32.629  1.00 98.79  ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 22.714  26.455 31.882  1.00 98.79  ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 22.986  27.319 34.524  1.00 103.91 ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 23.166  27.477 36.048  1.00 103.91 ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 22.624  28.792 36.659  1.00 103.91 ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 23.127  30.038 36.054  1.00 103.91 ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 24.400  30.316 35.761  1.00 103.91 ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 25.366  29.427 35.962  1.00 103.91 ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 24.710  31.488 35.227  1.00 103.91 ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.906  25.163 32.248  1.00 69.67  ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 21.015  24.432 30.973  1.00 69.67  ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 19.687  24.227 30.251  1.00 69.67  ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 18.690  23.868 30.864  1.00 69.67  ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 21.663  23.061 31.206  1.00 51.30  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 21.084  22.406 32.319  1.00 51.30  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 19.682  24.412 28.939  1.00 58.02  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 18.486  24.144 28.130  1.00 58.02  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 18.272  22.647 27.846  1.00 58.02  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 19.221  21.936 27.524  1.00 58.02  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 18.596  24.848 26.797  1.00 30.00  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 17.331  24.662 26.000  1.00 30.00  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 18.930  26.318 27.002  1.00 30.00  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 17.029  22.172 27.935  1.00 32.20  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.775  20.715 27.897  1.00 32.20  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.647  20.291 26.940  1.00 32.20  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.616  20.939 26.825  1.00 32.20  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 16.574  20.099 29.324  1.00 47.68  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 17.558  20.428 30.481  1.00 47.68  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 16.941  20.382 31.900  1.00 47.68  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 18.823  19.592 30.453  1.00 47.68  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.873  19.177 26.258  1.00 43.06  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.884  18.611 25.381  1.00 43.06  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 14.340  17.320 25.979  1.00 43.06  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 15.096  16.467 26.450  1.00 43.06  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 15.478  18.354 24.004  1.00 39.54  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 14.430  18.296 22.901  1.00 39.54  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 13.678  19.589 22.963  1.00 39.54  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 15.062  18.125 21.514  1.00 39.54  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 13.021  17.193 25.985  1.00 53.68  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 12.378  16.059 26.601  1.00 53.68  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 11.110  15.696 25.837  1.00 53.68  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 10.360  16.568 25.341  1.00 53.68  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 12.091  16.332 28.080  1.00 55.20  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 13.295  16.532 29.015  1.00 55.20  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 13.466  17.991 29.361  1.00 55.20  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 13.122  15.761 30.270  1.00 55.20  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.888  14.393 25.718  1.00 41.46  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 9.737   13.892 24.993  1.00 41.46  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 9.040   12.833 25.841  1.00 41.46  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 9.676   12.169 26.677  1.00 41.46  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 10.161  13.349 23.667  1.00 23.05  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 7.729   12.711 25.640  1.00 59.14  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 6.897   11.848 26.470  1.00 59.14  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 6.921   10.373 26.034  1.00 59.14  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 6.485   10.013 24.943  1.00 59.14  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 5.468   12.384 26.527  1.00 53.59  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 4.581   11.510 27.346  1.00 53.59  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 4.695   11.500 28.742  1.00 53.59  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 3.632   10.674 26.742  1.00 53.59  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 3.905   10.692 29.516  1.00 53.59  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 2.826   9.858  27.509  1.00 53.59  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 2.977   9.876  28.897  1.00 53.59  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 2.203   9.081  29.692  1.00 53.59  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 7.445   9.519  26.898  1.00 59.71  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 7.462   8.091  26.647  1.00 59.71  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 6.306   7.401  27.426  1.00 59.71  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 6.382   7.254  28.668  1.00 59.71  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 8.828   7.518  27.037  1.00 83.86  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 10.010  8.039  26.203  1.00 83.86  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 10.391  7.130  25.003  1.00 83.86  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 11.145  5.842  25.421  1.00 83.86  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 10.245  4.722  25.884  1.00 83.86  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 5.232   6.973  26.708  1.00 57.60  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 4.068   6.421  27.416  1.00 57.60  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 4.355   5.055  28.035  1.00 57.60  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 3.685   4.671  28.992  1.00 57.60  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 2.981   6.336  26.329  1.00 54.66  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 3.541   7.080  25.131  1.00 54.66  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 5.027   6.968  25.248  1.00 54.66  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 5.347   4.347  27.496  1.00 113.09 ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 5.875   3.120  28.093  1.00 113.09 ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 6.140   3.319  29.593  1.00 113.09 ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 5.675   2.533  30.418  1.00 113.09 ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 7.162   2.706  27.361  1.00 132.07 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 7.640   1.272  27.606  1.00 132.07 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 9.030   0.777  26.543  1.00 132.07 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? 10.437  1.520  27.371  1.00 132.07 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 6.863   4.389  29.934  1.00 69.87  ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 7.237   4.687  31.321  1.00 69.87  ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 6.361   5.760  31.985  1.00 69.87  ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 6.574   6.100  33.160  1.00 69.87  ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 8.715   5.079  31.385  1.00 133.63 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 9.660   3.917  31.111  1.00 133.63 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 10.744  4.260  30.109  1.00 133.63 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 10.983  5.463  29.858  1.00 133.63 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 11.360  3.318  29.571  1.00 133.63 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 5.381   6.270  31.228  1.00 62.21  ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 4.494   7.357  31.654  1.00 62.21  ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 5.293   8.610  31.964  1.00 62.21  ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 4.813   9.524  32.647  1.00 62.21  ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 6.520   8.632  31.442  1.00 65.36  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 7.578   9.581  31.813  1.00 65.36  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 7.859   10.636 30.751  1.00 65.36  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 7.227   10.705 29.699  1.00 65.36  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 8.902   8.826  32.044  1.00 83.92  ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 9.202   8.580  33.501  1.00 83.92  ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 9.974   9.310  34.107  1.00 83.92  ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 8.614   7.527  34.067  1.00 83.92  ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 8.854   11.442 31.052  1.00 45.97  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 9.430   12.350 30.117  1.00 45.97  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 10.816  11.748 29.879  1.00 45.97  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 11.447  11.280 30.823  1.00 45.97  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 9.578   13.682 30.825  1.00 90.55  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 10.207  13.544 32.185  1.00 90.55  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 11.593  13.544 32.332  1.00 90.55  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 9.424   13.345 33.302  1.00 90.55  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 12.185  13.382 33.566  1.00 90.55  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 10.009  13.183 34.527  1.00 90.55  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 11.398  13.198 34.662  1.00 90.55  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 11.294  11.739 28.638  1.00 60.20  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 12.636  11.234 28.370  1.00 60.20  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 13.521  12.365 27.874  1.00 60.20  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 13.121  13.156 27.008  1.00 60.20  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 12.599  10.082 27.366  1.00 60.09  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 13.900  9.273  27.255  1.00 60.09  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 14.159  8.731  25.825  1.00 60.09  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 15.234  8.124  25.585  1.00 60.09  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 13.292  8.924  24.941  1.00 60.09  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 14.722  12.439 28.442  1.00 52.46  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 15.697  13.436 28.044  1.00 52.46  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 16.317  13.073 26.704  1.00 52.46  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 17.309  12.360 26.635  1.00 52.46  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 16.776  13.559 29.095  1.00 76.83  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 17.828  14.561 28.730  1.00 76.83  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 18.302  15.344 29.929  1.00 76.83  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 19.386  15.962 29.826  1.00 76.83  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 17.596  15.349 30.971  1.00 76.83  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 15.698  13.554 25.637  1.00 52.52  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 16.225  13.396 24.288  1.00 52.52  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.544  14.140 24.034  1.00 52.52  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 18.452  13.597 23.391  1.00 52.52  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 15.180  13.812 23.263  1.00 55.01  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 14.237  12.631 23.002  1.00 55.01  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 15.841  14.379 21.996  1.00 55.01  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 13.135  12.910 21.934  1.00 55.01  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.657  15.366 24.543  1.00 41.16  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.823  16.212 24.251  1.00 41.16  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 19.056  17.325 25.271  1.00 41.16  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 18.116  17.796 25.927  1.00 41.16  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 18.711  16.806 22.842  1.00 63.40  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 20.321  17.737 25.376  1.00 47.12  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 20.758  18.812 26.268  1.00 47.12  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 21.755  19.794 25.593  1.00 47.12  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 22.335  19.515 24.533  1.00 47.12  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 21.373  18.189 27.511  1.00 70.36  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.855  19.144 28.536  1.00 70.36  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 22.606  18.383 29.593  1.00 70.36  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 22.527  19.075 30.876  1.00 70.36  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 22.925  18.558 32.030  1.00 70.36  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 23.438  17.338 32.055  1.00 70.36  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 22.805  19.259 33.153  1.00 70.36  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.905  20.964 26.206  1.00 34.61  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.894  21.956 25.836  1.00 34.61  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.730  22.136 27.087  1.00 34.61  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 23.288  22.761 28.056  1.00 34.61  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 22.216  23.272 25.446  1.00 36.26  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 23.207  24.394 25.160  1.00 36.26  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 24.392  24.097 24.934  1.00 36.26  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 22.819  25.588 25.148  1.00 36.26  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.917  21.536 27.077  1.00 64.26  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.905  21.719 28.120  1.00 64.26  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.366  23.139 27.885  1.00 64.26  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 25.751  23.855 27.081  1.00 64.26  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 27.023  20.696 27.958  1.00 41.00  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 26.520  19.247 27.875  1.00 41.00  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 25.639  18.836 26.848  1.00 41.00  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 26.903  18.302 28.821  1.00 41.00  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 25.146  17.516 26.762  1.00 41.00  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 26.409  16.979 28.750  1.00 41.00  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 25.532  16.590 27.710  1.00 41.00  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 27.421  23.586 28.559  1.00 38.46  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 27.730  25.035 28.557  1.00 38.46  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 26.698  25.765 29.409  1.00 38.46  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 25.502  25.768 29.086  1.00 38.46  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 27.789  25.610 27.119  1.00 95.83  ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 27.787  27.135 27.083  1.00 95.83  ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 28.524  27.792 27.825  1.00 95.83  ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 26.962  27.704 26.204  1.00 95.83  ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 27.159  26.345 30.539  1.00 50.57  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 26.375  27.261 31.376  1.00 50.57  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 25.524  28.209 30.544  1.00 50.57  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 25.853  28.500 29.397  1.00 50.57  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 27.451  28.061 32.108  1.00 118.53 ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 28.560  27.098 32.278  1.00 118.53 ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 28.505  26.132 31.107  1.00 118.53 ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 24.424  28.648 31.141  1.00 45.71  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.512  29.639 30.583  1.00 45.71  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 22.520  30.034 31.668  1.00 45.71  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 21.561  29.297 31.911  1.00 45.71  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 22.768  29.084 29.361  1.00 41.23  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 23.507  29.334 28.067  1.00 41.23  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.305  30.272 27.973  1.00 41.23  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 23.253  28.504 27.060  1.00 41.23  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 22.772  31.166 32.342  1.00 42.83  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 21.778  31.750 33.259  1.00 42.83  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 20.607  32.306 32.427  1.00 42.83  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 20.618  33.438 31.965  1.00 42.83  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 22.384  32.827 34.183  1.00 84.98  ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 21.485  33.202 35.400  1.00 84.98  ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 20.186  32.792 35.633  1.00 84.98  ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 21.825  34.069 36.499  1.00 84.98  ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 19.715  33.339 36.799  1.00 84.98  ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 20.692  34.125 37.354  1.00 84.98  ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 22.979  34.787 36.853  1.00 84.98  ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 20.677  34.881 38.543  1.00 84.98  ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 22.967  35.539 38.033  1.00 84.98  ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 21.817  35.580 38.864  1.00 84.98  ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 19.600  31.481 32.234  1.00 26.34  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 18.559  31.765 31.274  1.00 26.34  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 17.560  32.712 31.886  1.00 26.34  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 17.357  32.725 33.119  1.00 26.34  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 17.804  30.480 30.913  1.00 78.07  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 18.624  29.391 30.246  1.00 78.07  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 19.236  29.862 28.621  1.00 78.07  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.739  29.795 27.651  1.00 78.07  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 16.901  33.469 31.018  1.00 37.08  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 15.872  34.391 31.440  1.00 37.08  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 14.605  34.172 30.666  1.00 37.08  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 13.593  34.727 31.012  1.00 37.08  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 16.338  35.812 31.192  1.00 29.34  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 16.506  36.047 29.797  1.00 29.34  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 14.685  33.398 29.591  1.00 35.28  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 13.571  33.111 28.689  1.00 35.28  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 14.030  32.070 27.640  1.00 35.28  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 15.238  31.827 27.498  1.00 35.28  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 13.082  34.386 28.019  1.00 59.66  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 13.064  31.508 26.891  1.00 28.10  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 13.204  30.247 26.127  1.00 28.10  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 12.064  30.042 25.102  1.00 28.10  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.892  30.238 25.437  1.00 28.10  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 13.190  29.069 27.144  1.00 19.89  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 12.155  27.948 26.794  1.00 19.89  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 14.553  28.533 27.333  1.00 19.89  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 12.378  29.626 23.878  1.00 54.23  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 11.317  29.301 22.910  1.00 54.23  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 11.643  28.184 21.897  1.00 54.23  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 12.799  28.016 21.461  1.00 54.23  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.847  30.559 22.171  1.00 37.94  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.623   30.378 21.239  1.00 37.94  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 8.326   29.988 21.972  1.00 37.94  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 8.305   28.958 22.712  1.00 37.94  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 7.328   30.731 21.812  1.00 37.94  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 10.603  27.431 21.539  1.00 48.87  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.610  26.561 20.372  1.00 48.87  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 10.445  27.395 19.097  1.00 48.87  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 9.502   28.168 19.004  1.00 48.87  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.444   25.574 20.488  1.00 20.93  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.657   24.675 21.721  1.00 20.93  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 9.264   24.762 19.217  1.00 20.93  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 8.363   24.312 22.493  1.00 20.93  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 11.354  27.250 18.127  1.00 56.00  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 11.176  27.874 16.789  1.00 56.00  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 10.527  26.918 15.776  1.00 56.00  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 9.631   27.300 15.024  1.00 56.00  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 12.507  28.362 16.234  1.00 34.62  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 13.294  29.345 17.090  1.00 34.62  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 14.374  29.937 16.240  1.00 34.62  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.371  30.460 17.646  1.00 34.62  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 11.036  25.686 15.751  1.00 58.34  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 10.411  24.532 15.107  1.00 58.34  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.804  23.303 15.934  1.00 58.34  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 11.227  23.437 17.100  1.00 58.34  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.853  24.370 13.643  1.00 68.09  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 12.374  24.330 13.472  1.00 68.09  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.864  25.001 12.541  1.00 68.09  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 13.085  23.645 14.250  1.00 68.09  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.708  22.124 15.314  1.00 39.30  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.917  20.855 15.991  1.00 39.30  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 12.356  20.538 16.377  1.00 39.30  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.587  19.662 17.220  1.00 39.30  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.350  19.748 15.140  1.00 52.36  ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 8.868   19.850 15.017  1.00 52.36  ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 8.173   19.632 16.037  1.00 52.36  ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 8.390   20.169 13.907  1.00 52.36  ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 13.319  21.239 15.777  1.00 59.78  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.740  20.946 16.039  1.00 59.78  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 15.541  22.186 16.442  1.00 59.78  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 16.758  22.095 16.674  1.00 59.78  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 15.428  20.223 14.847  1.00 74.09  ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 14.722  18.917 14.429  1.00 74.09  ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 14.659  17.951 15.220  1.00 74.09  ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 14.243  18.858 13.277  1.00 74.09  ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.858  23.327 16.529  1.00 60.27  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 15.516  24.579 16.879  1.00 60.27  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.909  25.317 18.047  1.00 60.27  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.672  25.429 18.164  1.00 60.27  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 15.570  25.504 15.682  1.00 56.60  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 16.575  25.051 14.656  1.00 56.60  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 17.794  25.163 14.853  1.00 56.60  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 16.069  24.531 13.540  1.00 56.60  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.796  25.842 18.893  1.00 36.29  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 15.404  26.379 20.189  1.00 36.29  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 16.088  27.697 20.541  1.00 36.29  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 17.319  27.740 20.715  1.00 36.29  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 15.666  25.313 21.252  1.00 40.37  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 15.321  23.935 20.795  1.00 40.37  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 16.293  22.953 20.713  1.00 40.37  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 14.021  23.625 20.391  1.00 40.37  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 15.969  21.654 20.259  1.00 40.37  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 13.678  22.334 19.921  1.00 40.37  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 14.647  21.349 19.851  1.00 40.37  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 15.297  28.771 20.631  1.00 50.56  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.853  30.103 20.916  1.00 50.56  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.937  30.334 22.404  1.00 50.56  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 15.046  29.937 23.131  1.00 50.56  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 15.004  31.216 20.295  1.00 50.82  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 15.605  32.590 19.925  1.00 50.82  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 14.568  33.598 20.210  1.00 50.82  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 16.854  32.990 20.662  1.00 50.82  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.992  30.996 22.851  1.00 42.15  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 17.248  31.165 24.263  1.00 42.15  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 17.910  32.499 24.500  1.00 42.15  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 18.598  33.029 23.601  1.00 42.15  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 17.696  33.031 25.714  1.00 33.57  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 18.117  34.371 26.134  1.00 33.57  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 18.633  34.280 27.556  1.00 33.57  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 18.130  33.507 28.392  1.00 33.57  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 16.958  35.323 26.075  1.00 34.04  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 19.631  35.096 27.848  1.00 32.32  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 20.382  34.884 29.056  1.00 32.32  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 20.892  36.144 29.772  1.00 32.32  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 20.938  37.240 29.219  1.00 32.32  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 21.470  33.852 28.768  1.00 67.79  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 22.827  34.224 29.214  1.00 67.79  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 23.582  34.970 28.163  1.00 67.79  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 24.820  34.954 28.228  1.00 67.79  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 22.951  35.560 27.272  1.00 67.79  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 21.233  35.956 31.036  1.00 45.75  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 21.668  36.985 31.932  1.00 45.75  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 22.647  38.015 31.347  1.00 45.75  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 22.738  39.131 31.844  1.00 45.75  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 22.276  36.277 33.124  1.00 84.39  ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 22.594  37.209 34.239  1.00 84.39  ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 23.685  37.793 34.281  1.00 84.39  ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 21.650  37.359 35.174  1.00 84.39  ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 23.368  37.653 30.290  1.00 49.73  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 24.396  38.537 29.735  1.00 49.73  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 23.960  39.380 28.497  1.00 49.73  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 24.779  40.020 27.814  1.00 49.73  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 25.645  37.746 29.452  1.00 45.23  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 22.655  39.380 28.244  1.00 32.61  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 22.024  40.167 27.174  1.00 32.61  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 22.270  39.563 25.778  1.00 32.61  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 21.930  40.159 24.755  1.00 32.61  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 22.336  41.690 27.289  1.00 28.06  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 22.388  42.198 28.715  1.00 28.06  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 23.559  42.761 29.233  1.00 28.06  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 21.271  42.093 29.567  1.00 28.06  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 23.633  43.237 30.565  1.00 28.06  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 21.344  42.558 30.910  1.00 28.06  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 22.539  43.131 31.404  1.00 28.06  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 22.817  38.350 25.746  1.00 36.22  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.955  37.618 24.477  1.00 36.22  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 21.774  36.717 24.142  1.00 36.22  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 21.053  36.241 25.012  1.00 36.22  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 24.239  36.794 24.431  1.00 35.16  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 25.452  37.547 24.947  1.00 35.16  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.983  38.473 24.316  1.00 35.16  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.907  37.133 26.100  1.00 35.16  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 21.578  36.498 22.856  1.00 42.27  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 20.662  35.495 22.392  1.00 42.27  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 21.459  34.317 21.859  1.00 42.27  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 22.667  34.464 21.580  1.00 42.27  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.826  36.060 21.276  1.00 41.29  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.783  37.090 21.623  1.00 41.29  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 18.112  37.545 20.347  1.00 41.29  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.776  36.462 22.558  1.00 41.29  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.793  33.157 21.740  1.00 48.14  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 21.366  31.988 21.070  1.00 48.14  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 20.347  30.976 20.650  1.00 48.14  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 19.356  30.769 21.350  1.00 48.14  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 22.349  31.284 21.970  1.00 42.23  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.724  30.634 23.145  1.00 42.23  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 21.484  29.263 23.145  1.00 42.23  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 21.395  31.376 24.269  1.00 42.23  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.919  28.633 24.253  1.00 42.23  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 20.825  30.760 25.380  1.00 42.23  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 20.592  29.383 25.369  1.00 42.23  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.620  30.311 19.527  1.00 46.09  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.788  29.203 19.037  1.00 46.09  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.482  27.868 19.229  1.00 46.09  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.653  27.721 18.853  1.00 46.09  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 19.484  29.350 17.544  1.00 34.37  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 18.737  28.130 17.009  1.00 34.37  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.679  30.629 17.300  1.00 34.37  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.762  26.908 19.813  1.00 54.18  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 20.214  25.510 19.908  1.00 54.18  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 19.531  24.623 18.891  1.00 54.18  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 18.346  24.800 18.579  1.00 54.18  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.908  24.946 21.273  1.00 51.47  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 21.067  25.502 22.416  1.00 51.47  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 20.270  23.639 18.403  1.00 64.99  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.763  22.735 17.381  1.00 64.99  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 20.242  21.338 17.736  1.00 64.99  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 21.315  21.184 18.313  1.00 64.99  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 20.325  23.163 16.038  1.00 51.42  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 19.601  22.711 14.830  1.00 51.42  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 20.472  22.883 13.581  1.00 51.42  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 21.573  22.294 13.484  1.00 51.42  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 19.992  23.693 12.619  1.00 51.42  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 19.452  20.322 17.409  1.00 64.19  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.903  18.949 17.620  1.00 64.19  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.775  18.468 16.473  1.00 64.19  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.592  18.884 15.328  1.00 64.19  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.733  17.995 17.858  1.00 65.33  ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.681  17.943 16.769  1.00 65.33  ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 16.733  16.756 17.006  1.00 65.33  ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 15.766  16.989 18.158  1.00 65.33  ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 14.840  15.842 18.359  1.00 65.33  ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.722  17.594 16.803  1.00 104.50 ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.652  17.003 15.846  1.00 104.50 ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 21.958  15.985 14.936  1.00 104.50 ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 21.235  15.100 15.412  1.00 104.50 ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 23.785  16.317 16.611  1.00 86.78  ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 25.117  16.414 15.909  1.00 86.78  ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 25.165  16.216 14.678  1.00 86.78  ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 26.122  16.669 16.610  1.00 86.78  ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 22.170  16.138 13.628  1.00 86.54  ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 21.745  15.152 12.629  1.00 86.54  ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 22.948  14.305 12.181  1.00 86.54  ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 23.446  14.444 11.063  1.00 86.54  ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 21.064  15.833 11.435  1.00 93.64  ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 19.750  16.242 11.771  1.00 93.64  ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.404  13.432 13.080  1.00 152.88 ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 24.581  12.594 12.852  1.00 152.88 ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.527  11.291 13.679  1.00 152.88 ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 23.732  11.177 14.617  1.00 152.88 ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.853  13.396 13.152  1.00 59.28  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 25.361  10.311 13.316  1.00 97.81  ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 25.459  9.027  14.030  1.00 97.81  ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 26.010  9.202  15.442  1.00 97.81  ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 26.269  10.325 15.874  1.00 97.81  ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 26.307  8.033  13.242  1.00 64.75  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 26.212  8.085  16.138  1.00 76.18  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 26.389  8.070  17.597  1.00 76.18  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 25.106  8.548  18.299  1.00 76.18  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 25.170  9.114  19.397  1.00 76.18  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 27.602  8.913  18.105  1.00 84.16  ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 28.658  8.890  17.145  1.00 84.16  ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 28.125  8.378  19.429  1.00 84.16  ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 23.952  8.327  17.651  1.00 113.41 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 22.636  8.587  18.249  1.00 113.41 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 22.559  7.847  19.579  1.00 113.41 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 21.973  6.764  19.673  1.00 113.41 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 21.453  8.161  17.332  1.00 88.54  ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 21.826  7.012  16.558  1.00 88.54  ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 21.027  9.299  16.391  1.00 88.54  ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 23.188  8.451  20.589  1.00 99.24  ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.384  7.885  21.918  1.00 99.24  ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 24.631  8.526  22.529  1.00 99.24  ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 25.316  7.904  23.337  1.00 99.24  ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 23.557  6.363  21.862  1.00 151.81 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 23.037  5.672  23.107  1.00 151.81 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 23.739  4.783  23.637  1.00 151.81 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 21.923  6.019  23.559  1.00 151.81 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 24.934  9.763  22.133  1.00 97.06  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 26.100  10.497 22.656  1.00 97.06  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 26.257  11.867 21.994  1.00 97.06  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 26.096  12.899 22.647  1.00 97.06  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 27.388  9.688  22.473  1.00 131.99 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 28.592  10.289 23.164  1.00 131.99 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 28.425  10.341 24.667  1.00 131.99 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 28.077  9.298  25.258  1.00 131.99 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 28.638  11.423 25.254  1.00 131.99 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 26.608  11.848 20.706  1.00 68.34  ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 26.578  13.020 19.841  1.00 68.34  ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 25.132  13.543 19.669  1.00 68.34  ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 24.911  14.734 19.391  1.00 68.34  ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 27.185  12.673 18.476  1.00 84.82  ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 28.721  12.517 18.466  1.00 84.82  ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 29.275  11.964 17.136  1.00 84.82  ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 30.455  11.543 17.098  1.00 84.82  ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 28.533  11.936 16.126  1.00 84.82  ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 24.165  12.637 19.843  1.00 61.62  ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 22.722  12.930 19.782  1.00 61.62  ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 22.212  13.668 21.046  1.00 61.62  ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 21.253  14.451 20.995  1.00 61.62  ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.968  11.606 19.554  1.00 115.01 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 20.463  11.687 19.375  1.00 115.01 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 20.071  12.365 18.074  1.00 115.01 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 18.651  12.728 18.083  1.00 115.01 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 17.718  12.195 17.293  1.00 115.01 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 18.042  11.266 16.388  1.00 115.01 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 16.455  12.604 17.405  1.00 115.01 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.890  13.423 22.164  1.00 69.88  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 22.498  13.909 23.486  1.00 69.88  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.923  15.368 23.731  1.00 69.88  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 22.490  15.984 24.714  1.00 69.88  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 23.114  12.986 24.543  1.00 93.96  ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 22.110  12.348 25.478  1.00 93.96  ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 21.278  11.246 24.818  1.00 93.96  ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 21.074  11.242 23.601  1.00 93.96  ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 20.781  10.313 25.631  1.00 93.96  ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 23.770  15.895 22.836  1.00 70.70  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 24.303  17.266 22.894  1.00 70.70  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 23.682  18.138 21.809  1.00 70.70  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 24.129  18.098 20.667  1.00 70.70  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 25.810  17.270 22.621  1.00 69.16  ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 26.652  16.763 23.750  1.00 69.16  ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 27.687  17.496 24.284  1.00 69.16  ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 26.636  15.590 24.422  1.00 69.16  ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 28.261  16.804 25.250  1.00 69.16  ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 27.643  15.643 25.352  1.00 69.16  ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.668  18.935 22.121  1.00 64.51  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.204  19.852 21.092  1.00 64.51  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 23.202  20.982 21.023  1.00 64.51  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 23.965  21.190 21.960  1.00 64.51  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.752  20.317 21.276  1.00 37.73  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 20.032  20.426 22.615  1.00 37.73  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 20.385  21.711 23.319  1.00 37.73  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.532  20.392 22.358  1.00 37.73  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.247  21.679 19.897  1.00 65.81  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.343  22.590 19.680  1.00 65.81  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 24.021  23.964 19.188  1.00 65.81  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 23.078  24.168 18.425  1.00 65.81  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.430  21.947 18.848  1.00 66.90  ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.463  21.364 19.768  1.00 66.90  ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 27.403  20.478 19.050  1.00 66.90  ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 28.330  20.966 18.391  1.00 66.90  ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 27.184  19.152 19.151  1.00 66.90  ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.851  24.891 19.653  1.00 51.30  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 24.614  26.292 19.504  1.00 51.30  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 25.061  26.770 18.148  1.00 51.30  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 26.224  27.101 17.930  1.00 51.30  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 25.318  27.033 20.611  1.00 43.33  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 24.839  26.581 21.973  1.00 43.33  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 25.408  27.392 23.107  1.00 43.33  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 26.343  28.204 22.894  1.00 43.33  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 24.916  27.186 24.231  1.00 43.33  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 24.083  26.806 17.256  1.00 43.41  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 24.244  27.118 15.862  1.00 43.41  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 24.240  28.622 15.593  1.00 43.41  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 24.637  29.049 14.491  1.00 43.41  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 23.117  26.438 15.018  1.00 34.71  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.243  24.936 15.057  1.00 34.71  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.766  26.793 15.537  1.00 34.71  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 23.782  29.416 16.574  1.00 64.04  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 23.673  30.883 16.421  1.00 64.04  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.906  31.687 17.685  1.00 64.04  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 23.475  31.291 18.754  1.00 64.04  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 24.599  32.811 17.567  1.00 59.95  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.878  33.682 18.716  1.00 59.95  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.704  35.147 18.328  1.00 59.95  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.749  35.486 17.146  1.00 59.95  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 26.293  33.460 19.279  1.00 57.36  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.769  32.071 19.745  1.00 57.36  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 28.181  32.111 20.293  1.00 57.36  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 25.860  31.494 20.791  1.00 57.36  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 24.509  36.004 19.332  1.00 56.24  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 24.142  37.402 19.122  1.00 56.24  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 24.036  38.144 20.431  1.00 56.24  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 23.307  37.727 21.309  1.00 56.24  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.791  37.478 18.423  1.00 43.19  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 22.469  38.828 17.854  1.00 43.19  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.908  39.184 16.591  1.00 43.19  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.702  39.741 18.575  1.00 43.19  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 22.601  40.443 16.042  1.00 43.19  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 21.389  41.011 18.028  1.00 43.19  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.839  41.351 16.754  1.00 43.19  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 24.759  39.249 20.561  1.00 39.30  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 24.606  40.096 21.727  1.00 39.30  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 23.485  41.080 21.472  1.00 39.30  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 23.656  41.989 20.664  1.00 39.30  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.878  40.860 22.032  1.00 29.55  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 25.770  41.756 23.246  1.00 29.55  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 25.867  41.276 24.544  1.00 29.55  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 25.606  43.103 23.357  1.00 29.55  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 25.762  42.290 25.392  1.00 29.55  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 25.603  43.404 24.701  1.00 29.55  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 22.347  40.881 22.152  1.00 37.32  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 21.127  41.698 21.968  1.00 37.32  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 21.238  43.058 22.626  1.00 37.32  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.761  44.030 22.070  1.00 37.32  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 19.908  41.014 22.590  1.00 25.91  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 18.467  40.977 22.057  1.00 25.91  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 17.652  40.713 23.268  1.00 25.91  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 17.952  42.210 21.353  1.00 25.91  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.838  43.113 23.815  1.00 28.98  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.953  44.346 24.567  1.00 28.98  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 20.761  44.606 25.467  1.00 28.98  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 20.750  45.618 26.183  1.00 28.98  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 19.764  43.712 25.431  1.00 35.17  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 18.541  43.789 26.277  1.00 35.17  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 18.404  42.561 27.165  1.00 35.17  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 19.145  41.597 26.992  1.00 35.17  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 17.275  43.899 25.438  1.00 39.05  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 17.162  45.119 24.540  1.00 39.05  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 17.021  46.454 25.292  1.00 39.05  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 17.105  46.495 26.556  1.00 39.05  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 16.824  47.463 24.582  1.00 39.05  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 17.473  42.602 28.120  1.00 30.11  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 17.221  41.481 29.014  1.00 30.11  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.832  40.975 28.735  1.00 30.11  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.861  41.616 29.109  1.00 30.11  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 17.324  41.878 30.478  1.00 21.94  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 17.207  40.707 31.407  1.00 21.94  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 18.371  40.090 31.933  1.00 21.94  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 15.934  40.156 31.723  1.00 21.94  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 18.290  38.948 32.782  1.00 21.94  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.828  39.039 32.547  1.00 21.94  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 17.036  38.417 33.085  1.00 21.94  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 15.728  39.830 28.076  1.00 30.14  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 14.437  39.308 27.609  1.00 30.14  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 13.632  38.540 28.679  1.00 30.14  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 14.145  37.644 29.334  1.00 30.14  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 14.631  38.420 26.385  1.00 32.16  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 13.290  37.865 25.917  1.00 32.16  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 15.329  39.186 25.282  1.00 32.16  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 12.364  38.917 28.837  1.00 21.88  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 11.452  38.347 29.834  1.00 21.88  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 10.445  37.438 29.212  1.00 21.88  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.864   36.638 29.894  1.00 21.88  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 10.688  39.423 30.585  1.00 34.18  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 11.389  39.877 31.851  1.00 34.18  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 12.284  39.189 32.399  1.00 34.18  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 10.966  41.054 32.354  1.00 34.18  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 10.196  37.557 27.921  1.00 42.88  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 9.145   36.749 27.360  1.00 42.88  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 9.264   36.716 25.859  1.00 42.88  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 9.503   37.760 25.250  1.00 42.88  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 7.719   37.216 27.816  1.00 31.99  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 7.582   38.765 27.868  1.00 31.99  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 6.660   36.660 26.913  1.00 31.99  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 9.138   35.504 25.290  1.00 19.72  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.942   35.332 23.863  1.00 19.72  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 7.510   34.897 23.664  1.00 19.72  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 6.937   34.247 24.515  1.00 19.72  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.818   34.207 23.275  1.00 30.43  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 11.281  34.434 23.380  1.00 30.43  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 12.032  33.733 24.317  1.00 30.43  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 11.923  35.304 22.518  1.00 30.43  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 13.389  33.922 24.419  1.00 30.43  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 13.275  35.499 22.599  1.00 30.43  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 14.011  34.809 23.560  1.00 30.43  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.955   35.209 22.503  1.00 39.54  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.719   34.571 22.119  1.00 39.54  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 5.455   34.615 20.609  1.00 39.54  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 5.860   35.543 19.938  1.00 39.54  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 4.536   35.072 22.972  1.00 50.66  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 4.033   36.747 22.683  1.00 50.66  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.806   33.573 20.098  1.00 40.92  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.525   33.416 18.680  1.00 40.92  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 3.390   34.314 18.212  1.00 40.92  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 2.224   34.028 18.483  1.00 40.92  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 4.131   31.960 18.395  1.00 64.67  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 5.261   30.993 18.499  1.00 64.67  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 5.976   30.564 17.403  1.00 64.67  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.802   30.372 19.570  1.00 64.67  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.907   29.714 17.793  1.00 64.67  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.826   29.584 19.106  1.00 64.67  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.714   35.371 17.482  1.00 28.96  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 2.695   36.277 16.960  1.00 28.96  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 3.302   37.314 16.040  1.00 28.96  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 4.512   37.303 15.793  1.00 28.96  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 2.457   38.217 15.548  1.00 49.88  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.864   39.269 14.634  1.00 49.88  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.928   40.439 14.832  1.00 49.88  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? 0.811   40.244 15.267  1.00 49.88  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 2.772   38.750 13.203  1.00 55.36  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 2.719   39.806 12.280  1.00 55.36  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 2.354   41.656 14.515  1.00 44.05  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 1.394   42.772 14.532  1.00 44.05  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 1.137   43.338 13.150  1.00 44.05  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? 0.467   44.372 12.996  1.00 44.05  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 1.857   43.893 15.431  1.00 22.69  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.554   43.477 16.709  1.00 22.69  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 3.360   44.682 17.279  1.00 22.69  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 1.500   42.960 17.667  1.00 22.69  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 1.664   42.632 12.156  1.00 66.86  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 1.581   43.045 10.779  1.00 66.86  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? 0.267   42.572 10.202  1.00 66.86  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -0.745  43.218 10.433  1.00 66.86  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 2.764   42.530 9.975   1.00 65.78  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 3.228   43.608 9.033   1.00 65.78  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 3.891   42.177 10.913  1.00 65.78  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? 0.291   41.435 9.501   1.00 95.35  ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -0.833  40.874 8.702   1.00 95.35  ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.196  41.610 8.680   1.00 95.35  ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -2.663  42.157 9.689   1.00 95.35  ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -1.019  39.377 9.030   1.00 103.73 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -2.157  38.641 8.289   1.00 103.73 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -2.106  38.687 6.473   1.00 103.73 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? -0.532  37.901 6.098   1.00 103.73 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -2.825  41.578 7.505   1.00 82.91  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -4.161  42.139 7.271   1.00 82.91  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.210  41.643 8.287   1.00 82.91  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -5.856  42.440 8.983   1.00 82.91  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -4.605  41.803 5.842   1.00 134.80 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -4.957  43.019 4.985   1.00 134.80 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -6.447  43.340 4.965   1.00 134.80 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -7.231  42.665 4.291   1.00 134.80 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -6.838  44.391 5.684   1.00 134.80 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 8.879   35.654 1.377   1.00 98.18  ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 9.624   36.817 1.888   1.00 98.18  ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 10.493  36.495 3.117   1.00 98.18  ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 11.629  36.971 3.208   1.00 98.18  ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 8.518   37.820 2.247   1.00 72.26  ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 7.218   36.954 2.390   1.00 72.26  ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 7.539   35.532 1.982   1.00 72.26  ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 9.941   35.703 4.040   1.00 82.52  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.594  35.209 5.263   1.00 82.52  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.639   34.204 5.893   1.00 82.52  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.480   34.095 5.475   1.00 82.52  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 10.810  36.296 6.324   1.00 73.39  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 9.657   37.149 6.372   1.00 73.39  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 12.075  37.105 6.054   1.00 73.39  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 10.112  33.515 6.927   1.00 59.16  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 9.377   32.392 7.513   1.00 59.16  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 9.399   32.453 9.047   1.00 59.16  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 10.475  32.562 9.661   1.00 59.16  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 9.956   31.063 6.992   1.00 88.52  ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 9.539   29.799 7.748   1.00 88.52  ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 8.257   29.175 7.212   1.00 88.52  ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 7.166   29.759 7.304   1.00 88.52  ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 8.382   27.968 6.657   1.00 88.52  ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 8.202   32.388 9.641   1.00 78.51  ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 8.002   32.445 11.097  1.00 78.51  ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 8.073   33.842 11.711  1.00 78.51  ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 8.578   34.773 11.080  1.00 78.51  ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 7.558   33.988 12.941  1.00 41.91  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 7.715   35.233 13.726  1.00 41.91  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 7.501   35.137 15.253  1.00 41.91  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 6.418   34.806 15.736  1.00 41.91  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 6.885   36.375 13.118  1.00 24.10  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 6.036   36.959 14.094  1.00 24.10  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 8.553   35.452 15.999  1.00 46.86  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 8.482   35.468 17.459  1.00 46.86  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.830   36.834 18.046  1.00 46.86  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.921   37.360 17.808  1.00 46.86  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 9.364   34.366 18.091  1.00 22.93  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.562   34.627 19.567  1.00 22.93  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.723   33.046 17.891  1.00 22.93  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.880   37.385 18.801  1.00 41.55  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.994   38.679 19.456  1.00 41.55  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 8.568   38.506 20.843  1.00 41.55  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 8.267   37.523 21.511  1.00 41.55  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 6.609   39.307 19.575  1.00 42.58  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 6.011   40.002 18.350  1.00 42.58  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 4.748   40.736 18.695  1.00 42.58  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 7.015   40.997 17.783  1.00 42.58  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 9.401   39.448 21.275  1.00 24.61  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.904   39.460 22.650  1.00 24.61  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.847   40.824 23.344  1.00 24.61  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.855   41.863 22.689  1.00 24.61  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 11.317  38.899 22.731  1.00 42.37  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 12.326  39.691 21.987  1.00 42.37  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.868  40.849 22.541  1.00 42.37  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 12.762  39.271 20.724  1.00 42.37  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.824  41.598 21.840  1.00 42.37  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 13.727  40.000 20.007  1.00 42.37  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 14.262  41.161 20.566  1.00 42.37  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 9.791   40.798 24.679  1.00 26.27  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 9.690   41.989 25.509  1.00 26.27  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 10.832  42.081 26.494  1.00 26.27  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 11.154  41.137 27.166  1.00 26.27  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 11.418  43.267 26.573  1.00 42.58  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 12.584  43.588 27.378  1.00 42.58  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 12.245  44.149 28.756  1.00 42.58  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 11.121  44.547 29.037  1.00 42.58  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 13.346  44.676 26.645  1.00 62.22  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 13.654  44.208 25.334  1.00 62.22  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 14.628  45.046 27.354  1.00 62.22  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 13.250  44.177 29.617  1.00 31.39  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 13.218  44.933 30.855  1.00 31.39  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 13.172  46.433 30.591  1.00 31.39  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 12.546  47.177 31.330  1.00 31.39  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 14.452  44.621 31.666  1.00 7.74   ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 14.849  45.797 32.533  1.00 7.74   ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 14.254  43.291 32.503  1.00 7.74   ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 13.842  46.884 29.533  1.00 20.75  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 13.759  48.270 29.132  1.00 20.75  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 12.544  48.570 28.300  1.00 20.75  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 12.474  49.627 27.688  1.00 20.75  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 14.978  48.647 28.326  1.00 16.10  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 16.225  48.787 29.167  1.00 16.10  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 17.318  48.593 28.634  1.00 16.10  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 16.100  49.155 30.464  1.00 16.10  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 11.592  47.695 28.167  1.00 34.33  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 10.401  48.016 27.414  1.00 34.33  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 10.502  48.063 25.923  1.00 34.33  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.763   48.779 25.250  1.00 34.33  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 11.437  47.282 25.426  1.00 43.87  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.757  47.178 24.045  1.00 43.87  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 11.042  45.979 23.531  1.00 43.87  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 11.083  44.938 24.149  1.00 43.87  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 13.244  46.950 23.949  1.00 39.98  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 13.800  46.851 22.565  1.00 39.98  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 14.201  45.222 22.101  1.00 39.98  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 15.136  45.539 20.699  1.00 39.98  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 10.407  46.103 22.386  1.00 27.72  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.833   44.948 21.751  1.00 27.72  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.611  44.598 20.496  1.00 27.72  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.989  45.450 19.747  1.00 27.72  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 8.410   45.171 21.394  1.00 14.71  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.652   45.624 22.610  1.00 14.71  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.831   43.926 20.939  1.00 14.71  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 6.465   46.443 22.315  1.00 14.71  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 10.852  43.324 20.279  1.00 37.09  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.645  42.891 19.162  1.00 37.09  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 11.012  41.785 18.376  1.00 37.09  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.973   41.308 18.696  1.00 37.09  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.649  41.379 17.311  1.00 39.53  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 11.043  40.324 16.523  1.00 39.53  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 12.116  39.481 15.901  1.00 39.53  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 13.160  40.009 15.545  1.00 39.53  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 10.170  40.942 15.450  1.00 40.23  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.705   40.191 14.226  1.00 40.23  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 8.599   39.268 14.578  1.00 40.23  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 9.193   41.263 13.299  1.00 40.23  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.884  38.175 15.808  1.00 53.34  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.865  37.286 15.206  1.00 53.34  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 12.203  36.424 14.157  1.00 53.34  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 11.146  35.865 14.398  1.00 53.34  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 13.560  36.357 16.221  1.00 49.90  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 14.753  35.713 15.556  1.00 49.90  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 14.009  37.103 17.453  1.00 49.90  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 12.833  36.313 12.995  1.00 64.26  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 12.311  35.513 11.898  1.00 64.26  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 13.382  34.530 11.504  1.00 64.26  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 14.540  34.636 11.922  1.00 64.26  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 12.043  36.372 10.658  1.00 78.64  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 11.782  37.715 11.055  1.00 78.64  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 10.860  35.854 9.867   1.00 78.64  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.984  33.566 10.691  1.00 59.01  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.917  32.678 10.059  1.00 59.01  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 14.067  33.159 8.622   1.00 59.01  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 13.142  33.778 8.071   1.00 59.01  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 13.376  31.262 10.127  1.00 67.64  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 12.846  31.010 11.430  1.00 67.64  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 15.247  32.904 8.045   1.00 71.10  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.589  33.271 6.669   1.00 71.10  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 15.948  32.048 5.845   1.00 71.10  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 15.857  30.915 6.309   1.00 71.10  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.805  34.192 6.649   1.00 45.41  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.761  35.621 7.186   1.00 45.41  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 18.183  36.152 7.466   1.00 45.41  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 15.969  36.560 6.259   1.00 45.41  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 16.385  32.306 4.616   1.00 88.07  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 16.948  31.290 3.749   1.00 88.07  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 18.462  31.373 3.718   1.00 88.07  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 19.082  32.222 4.369   1.00 88.07  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 16.437  31.495 2.335   1.00 77.47  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 15.034  31.526 2.327   1.00 77.47  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 19.043  30.471 2.939   1.00 64.55  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.459  30.512 2.561   1.00 64.55  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.832  31.843 1.902   1.00 64.55  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.689  32.566 2.397   1.00 64.55  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 20.797  29.320 1.633   1.00 125.93 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 20.408  29.459 0.126   1.00 125.93 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 18.900  29.371 -0.160  1.00 125.93 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 18.302  28.302 0.088   1.00 125.93 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 18.318  30.365 -0.659  1.00 125.93 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 20.154  32.166 0.806   1.00 58.84  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.522  33.313 -0.026  1.00 58.84  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 20.492  34.635 0.758   1.00 58.84  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 21.425  35.450 0.648   1.00 58.84  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.691  33.370 -1.326  1.00 89.57  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.567  34.227 -1.232  1.00 89.57  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 19.449  34.815 1.572   1.00 48.21  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 19.274  36.051 2.320   1.00 48.21  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 20.315  36.164 3.432   1.00 48.21  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 21.059  37.146 3.512   1.00 48.21  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 17.857  36.139 2.878   1.00 94.69  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 16.812  36.059 1.816   1.00 94.69  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 16.450  34.948 1.115   1.00 94.69  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.985  37.131 1.331   1.00 94.69  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 15.450  35.256 0.222   1.00 94.69  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 15.142  36.586 0.332   1.00 94.69  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 15.870  38.494 1.645   1.00 94.69  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 14.196  37.355 -0.361  1.00 94.69  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 14.927  39.263 0.956   1.00 94.69  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 14.103  38.686 -0.038  1.00 94.69  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 20.389  35.145 4.283   1.00 60.54  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 21.304  35.238 5.395   1.00 60.54  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 22.662  35.572 4.824   1.00 60.54  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 23.445  36.276 5.452   1.00 60.54  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 21.358  33.951 6.214   1.00 64.44  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 22.562  33.902 7.131   1.00 64.44  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 22.465  34.268 8.475   1.00 64.44  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.819  33.515 6.642   1.00 64.44  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 23.593  34.241 9.308   1.00 64.44  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.934  33.482 7.461   1.00 64.44  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 24.821  33.843 8.787   1.00 64.44  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 25.949  33.795 9.579   1.00 64.44  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 22.937  35.076 3.621   1.00 53.68  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 24.217  35.359 2.972   1.00 53.68  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 24.300  36.720 2.310   1.00 53.68  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 25.245  37.468 2.560   1.00 53.68  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.654  34.228 2.049   1.00 65.19  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 25.364  33.142 2.805   1.00 65.19  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 26.425  33.377 3.382   1.00 65.19  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.773  31.960 2.846   1.00 65.19  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 23.302  37.045 1.504   1.00 50.13  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 23.168  38.383 0.973   1.00 50.13  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 23.294  39.410 2.109   1.00 50.13  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 24.134  40.335 2.061   1.00 50.13  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 21.794  38.522 0.331   1.00 48.81  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 21.565  39.488 -0.826  1.00 48.81  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 20.076  39.488 -1.131  1.00 48.81  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 22.066  40.908 -0.536  1.00 48.81  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 22.452  39.236 3.133   1.00 48.44  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 22.367  40.182 4.246   1.00 48.44  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 23.644  40.232 5.048   1.00 48.44  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 24.084  41.315 5.411   1.00 48.44  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 21.152  39.894 5.137   1.00 37.78  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 19.784  39.957 4.422   1.00 37.78  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 18.652  39.490 5.335   1.00 37.78  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 19.477  41.346 3.808   1.00 37.78  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 24.244  39.066 5.296   1.00 57.06  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 25.495  38.995 6.034   1.00 57.06  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 26.519  39.837 5.287   1.00 57.06  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 27.277  40.622 5.896   1.00 57.06  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.979  37.551 6.171   1.00 42.02  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.841  37.159 7.408   1.00 42.02  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 27.475  35.763 7.217   1.00 42.02  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.947  38.137 7.809   1.00 42.02  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 26.507  39.669 3.959   1.00 46.45  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 27.269  40.504 3.021   1.00 46.45  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 26.927  41.944 3.319   1.00 46.45  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.716  42.652 3.955   1.00 46.45  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 26.924  40.122 1.567   1.00 93.04  ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 27.574  41.029 0.525   1.00 93.04  ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 27.708  42.247 0.765   1.00 93.04  ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 27.918  40.522 -0.565  1.00 93.04  ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.732  42.350 2.901   1.00 64.53  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 25.249  43.699 3.144   1.00 64.53  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.825  44.332 4.402   1.00 64.53  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 26.290  45.469 4.365   1.00 64.53  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.745  43.697 3.249   1.00 82.75  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 23.066  44.058 1.975   1.00 82.75  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 21.620  45.070 2.351   1.00 82.75  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 22.370  46.633 2.830   1.00 82.75  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.808  43.574 5.498   1.00 40.50  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 26.260  44.044 6.788   1.00 40.50  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 27.701  44.443 6.735   1.00 40.50  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 28.043  45.559 7.139   1.00 40.50  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 26.065  42.971 7.846   1.00 62.69  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.621  42.792 8.269   1.00 62.69  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.476  41.947 9.517   1.00 62.69  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 25.434  41.740 10.260  1.00 62.69  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 23.272  41.465 9.760   1.00 62.69  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 28.555  43.551 6.235   1.00 63.38  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 29.996  43.823 6.216   1.00 63.38  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 30.340  45.026 5.347   1.00 63.38  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 31.194  45.836 5.711   1.00 63.38  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.798  42.586 5.815   1.00 118.21 ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 30.848  41.554 6.918   1.00 118.21 ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 30.317  40.455 6.774   1.00 118.21 ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 31.468  41.909 8.038   1.00 118.21 ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 29.645  45.157 4.219   1.00 52.53  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.782  46.339 3.391   1.00 52.53  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 29.317  47.539 4.192   1.00 52.53  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 30.022  48.561 4.251   1.00 52.53  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 28.989  46.209 2.094   1.00 86.65  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 29.333  44.963 1.321   1.00 86.65  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 28.892  45.016 -0.122  1.00 86.65  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 29.402  43.841 -0.827  1.00 86.65  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 29.602  43.750 -2.140  1.00 86.65  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 29.346  44.768 -2.962  1.00 86.65  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 30.075  42.617 -2.629  1.00 86.65  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 28.155  47.381 4.832   1.00 70.25  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 27.492  48.433 5.598   1.00 70.25  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 28.288  49.033 6.744   1.00 70.25  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 28.142  50.225 7.027   1.00 70.25  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 26.180  47.923 6.159   1.00 51.83  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.913  48.348 5.446   1.00 51.83  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.717  47.741 6.137   1.00 51.83  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 24.830  49.859 5.468   1.00 51.83  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 29.086  48.213 7.431   1.00 54.06  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 29.981  48.729 8.488   1.00 54.06  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 31.018  49.699 7.939   1.00 54.06  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 31.260  50.733 8.552   1.00 54.06  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 30.677  47.604 9.266   1.00 56.07  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 29.695  46.584 9.828   1.00 56.07  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 29.666  45.431 9.397   1.00 56.07  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 28.878  47.010 10.782  1.00 56.07  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 31.595  49.349 6.782   1.00 75.01  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 32.602  50.139 6.061   1.00 75.01  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 32.112  51.551 5.801   1.00 75.01  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 32.787  52.526 6.118   1.00 75.01  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 32.939  49.484 4.716   1.00 63.39  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 33.555  48.100 4.780   1.00 63.39  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 35.090  48.136 4.861   1.00 63.39  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 35.685  46.728 4.639   1.00 63.39  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 37.171  46.672 4.684   1.00 63.39  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 30.929  51.651 5.217   1.00 56.35  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 30.291  52.939 4.984   1.00 56.35  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 29.897  53.654 6.306   1.00 56.35  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 30.535  54.637 6.690   1.00 56.35  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 29.051  52.772 4.094   1.00 119.41 ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 28.700  54.077 3.434   1.00 119.41 ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 29.310  51.726 3.052   1.00 119.41 ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 28.874  53.122 6.991   1.00 86.90  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 28.165  53.788 8.097   1.00 86.90  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 29.067  54.333 9.199   1.00 86.90  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 29.929  53.617 9.734   1.00 86.90  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 27.081  52.859 8.738   1.00 33.76  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 25.882  52.691 7.811   1.00 33.76  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 26.559  53.420 10.066  1.00 33.76  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 25.085  51.470 8.147   1.00 33.76  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 28.839  55.605 9.529   1.00 89.55  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 29.521  56.286 10.619  1.00 89.55  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 29.063  55.638 11.900  1.00 89.55  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 27.979  55.072 11.940  1.00 89.55  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 29.142  57.762 10.623  1.00 95.65  ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 29.470  58.483 9.325   1.00 95.65  ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 28.518  59.638 9.088   1.00 95.65  ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 28.778  60.316 7.753   1.00 95.65  ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 27.737  61.332 7.467   1.00 95.65  ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 29.874  55.723 12.949  1.00 57.04  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 29.590  54.985 14.197  1.00 57.04  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 30.065  55.750 15.420  1.00 57.04  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 31.254  55.789 15.729  1.00 57.04  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 30.194  53.573 14.146  1.00 58.24  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.352  53.040 15.443  1.00 58.24  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 29.101  56.314 16.132  1.00 92.80  ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 29.335  57.440 17.027  1.00 92.80  ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 30.667  57.507 17.749  1.00 92.80  ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 31.497  58.337 17.391  1.00 92.80  ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 28.170  57.640 17.978  1.00 32.11  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 28.512  58.633 19.132  1.00 32.11  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 26.936  58.085 17.163  1.00 32.11  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 30.880  56.652 18.746  1.00 45.21  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 32.105  56.734 19.527  1.00 45.21  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 33.172  55.850 18.913  1.00 45.21  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 33.981  55.249 19.646  1.00 45.21  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 33.178  55.766 17.575  1.00 48.04  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 34.086  54.889 16.825  1.00 48.04  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 34.053  53.475 17.425  1.00 48.04  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 35.039  53.031 18.057  1.00 48.04  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 35.536  55.441 16.821  1.00 69.83  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 36.128  55.838 15.450  1.00 69.83  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 36.025  57.344 15.139  1.00 69.83  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 37.088  57.783 14.117  1.00 69.83  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 38.519  57.702 14.625  1.00 69.83  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 32.927  52.776 17.256  1.00 41.23  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 32.782  51.413 17.818  1.00 41.23  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 32.408  50.408 16.734  1.00 41.23  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 31.500  50.665 15.956  1.00 41.23  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 31.703  51.333 18.978  1.00 40.57  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 32.110  52.158 20.219  1.00 40.57  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 31.355  49.832 19.328  1.00 40.57  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 30.981  52.289 21.242  1.00 40.57  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 33.088  49.265 16.692  1.00 47.14  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.794  48.263 15.674  1.00 47.14  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 31.525  47.483 15.997  1.00 47.14  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 31.456  46.795 17.017  1.00 47.14  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 33.985  47.338 15.444  1.00 88.10  ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 34.597  47.477 14.068  1.00 88.10  ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 35.068  48.890 13.772  1.00 88.10  ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 34.450  49.565 12.914  1.00 88.10  ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 36.055  49.326 14.401  1.00 88.10  ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.520  47.608 15.123  1.00 37.21  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 29.273  46.831 15.229  1.00 37.21  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.580  45.338 15.510  1.00 37.21  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 28.741  44.567 16.004  1.00 37.21  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.489  46.986 13.928  1.00 50.43  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.378  45.999 13.760  1.00 50.43  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 26.063  46.303 14.045  1.00 50.43  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 27.376  44.717 13.320  1.00 50.43  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 25.298  45.250 13.798  1.00 50.43  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 26.069  44.278 13.347  1.00 50.43  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.803  44.950 15.170  1.00 31.40  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 31.204  43.583 15.181  1.00 31.40  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 31.579  43.242 16.609  1.00 31.40  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 31.246  42.170 17.090  1.00 31.40  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 32.380  43.400 14.229  1.00 58.89  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 32.341  42.109 13.658  1.00 58.89  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 32.267  44.154 17.285  1.00 42.78  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 32.553  44.002 18.697  1.00 42.78  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 31.237  43.921 19.457  1.00 42.78  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 31.067  43.082 20.360  1.00 42.78  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 33.344  45.219 19.206  1.00 31.58  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 33.729  45.134 20.657  1.00 31.58  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 34.792  44.354 21.058  1.00 31.58  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 33.025  45.836 21.610  1.00 31.58  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 35.156  44.269 22.371  1.00 31.58  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 33.384  45.752 22.966  1.00 31.58  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 34.451  44.961 23.342  1.00 31.58  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 30.318  44.806 19.060  1.00 42.28  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 29.133  45.131 19.815  1.00 42.28  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 28.218  43.932 19.814  1.00 42.28  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 27.864  43.409 20.865  1.00 42.28  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 28.485  46.387 19.227  1.00 52.85  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 27.016  46.572 19.497  1.00 52.85  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 26.039  46.751 18.566  1.00 52.85  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 26.357  46.608 20.772  1.00 52.85  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 24.820  46.901 19.176  1.00 52.85  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 24.990  46.811 20.530  1.00 52.85  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 26.788  46.470 22.095  1.00 52.85  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 24.062  46.884 21.552  1.00 52.85  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 25.857  46.556 23.107  1.00 52.85  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 24.520  46.759 22.833  1.00 52.85  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.892  43.464 18.628  1.00 52.14  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 26.997  42.346 18.469  1.00 52.14  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 27.575  40.984 18.848  1.00 52.14  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.841  40.008 18.883  1.00 52.14  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 26.491  42.299 17.033  1.00 40.87  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 25.591  43.442 16.675  1.00 40.87  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 24.446  43.547 17.666  1.00 40.87  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 23.296  44.247 17.083  1.00 40.87  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 22.167  44.514 17.727  1.00 40.87  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 22.016  44.165 18.992  1.00 40.87  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 21.203  45.149 17.094  1.00 40.87  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.872  40.901 19.119  1.00 31.01  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 29.463  39.597 19.383  1.00 31.01  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 29.076  39.117 20.770  1.00 31.01  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 29.088  39.885 21.742  1.00 31.01  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 30.981  39.560 19.163  1.00 41.51  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 31.622  40.609 19.834  1.00 41.51  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.681  37.852 20.827  1.00 41.49  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 28.177  37.234 22.033  1.00 41.49  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 29.258  37.385 23.089  1.00 41.49  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 30.431  37.100 22.838  1.00 41.49  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.854  35.772 21.714  1.00 39.94  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 27.423  34.944 22.893  1.00 39.94  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 26.096  34.492 22.987  1.00 39.94  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 28.342  34.554 23.868  1.00 39.94  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 25.699  33.712 24.053  1.00 39.94  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 27.947  33.786 24.936  1.00 39.94  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 26.633  33.358 25.026  1.00 39.94  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.869  37.856 24.266  1.00 47.19  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.848  38.147 25.315  1.00 47.19  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 29.400  37.724 26.727  1.00 47.19  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 28.455  38.260 27.272  1.00 47.19  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 30.179  39.627 25.260  1.00 58.30  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 31.103  40.075 26.335  1.00 58.30  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 32.223  39.356 26.696  1.00 58.30  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 31.094  41.183 27.111  1.00 58.30  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 32.856  39.995 27.665  1.00 58.30  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 32.193  41.108 27.933  1.00 58.30  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 30.056  36.736 27.316  1.00 46.45  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 29.740  36.381 28.710  1.00 46.45  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 30.952  36.605 29.623  1.00 46.45  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 31.704  37.542 29.415  1.00 46.45  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 29.103  34.965 28.850  1.00 49.31  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 30.000  33.949 28.387  1.00 49.31  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 27.850  34.875 28.031  1.00 49.31  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 31.136  35.794 30.651  1.00 80.18  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 32.343  35.923 31.458  1.00 80.18  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 33.278  34.797 31.080  1.00 80.18  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 34.476  34.892 31.275  1.00 80.18  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 32.022  35.896 32.954  1.00 130.14 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 33.143  36.431 33.852  1.00 130.14 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 33.408  37.930 33.681  1.00 130.14 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 32.434  38.713 33.588  1.00 130.14 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 34.597  38.329 33.655  1.00 130.14 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 32.701  33.743 30.512  1.00 76.46  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 33.402  32.518 30.137  1.00 76.46  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 33.751  32.456 28.628  1.00 76.46  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 34.173  31.403 28.137  1.00 76.46  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 32.552  31.300 30.573  1.00 74.52  ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 33.039  29.921 30.095  1.00 74.52  ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 32.615  28.776 31.028  1.00 74.52  ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 32.932  29.013 32.451  1.00 74.52  ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 34.131  28.869 33.017  1.00 74.52  ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 35.182  28.494 32.301  1.00 74.52  ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 34.280  29.114 34.312  1.00 74.52  ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 33.575  33.560 27.894  1.00 61.91  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.917  33.599 26.454  1.00 61.91  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 33.490  34.873 25.716  1.00 61.91  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 32.624  35.622 26.190  1.00 61.91  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 33.367  32.368 25.705  1.00 60.37  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 31.917  31.986 26.021  1.00 60.37  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 31.129  31.677 24.748  1.00 60.37  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 31.255  30.229 24.299  1.00 60.37  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 30.747  30.071 22.896  1.00 60.37  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 34.097  35.107 24.552  1.00 72.22  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 33.597  36.131 23.640  1.00 72.22  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.721  35.710 22.183  1.00 72.22  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.724  35.996 21.544  1.00 72.22  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 34.316  37.461 23.859  1.00 52.57  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 34.316  37.763 25.260  1.00 52.57  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.623  38.605 23.095  1.00 52.57  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 32.712  35.024 21.654  1.00 55.41  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 32.776  34.564 20.261  1.00 55.41  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 31.984  35.545 19.397  1.00 55.41  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 31.107  36.233 19.912  1.00 55.41  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 32.264  33.118 20.097  1.00 86.41  ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 32.875  32.057 21.036  1.00 86.41  ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 34.421  31.980 21.023  1.00 86.41  ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 35.086  32.738 21.776  1.00 86.41  ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 34.976  31.122 20.294  1.00 86.41  ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 32.314  35.651 18.091  1.00 57.07  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 31.543  36.536 17.177  1.00 57.07  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 30.105  36.067 16.916  1.00 57.07  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.770  34.915 17.181  1.00 57.07  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 32.339  36.515 15.870  1.00 35.80  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 33.330  35.403 15.989  1.00 35.80  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 33.442  34.967 17.429  1.00 35.80  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 29.265  36.961 16.407  1.00 51.80  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 27.877  36.616 16.102  1.00 51.80  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.746  35.508 15.041  1.00 51.80  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 28.419  35.564 14.021  1.00 51.80  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 27.116  37.859 15.668  1.00 32.86  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.891  34.511 15.295  1.00 35.70  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.602  33.439 14.338  1.00 35.70  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 25.096  33.326 14.107  1.00 35.70  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 24.300  33.436 15.049  1.00 35.70  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 27.108  32.056 14.841  1.00 51.92  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 28.488  32.149 15.180  1.00 51.92  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 26.968  30.964 13.780  1.00 51.92  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.726  33.110 12.842  1.00 42.86  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 23.368  32.745 12.426  1.00 42.86  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 22.335  33.798 12.715  1.00 42.86  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 21.150  33.489 12.839  1.00 42.86  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.784  35.043 12.826  1.00 62.18  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.913  36.143 13.191  1.00 62.18  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 22.128  37.373 12.327  1.00 62.18  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 23.114  37.479 11.625  1.00 62.18  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 22.122  36.492 14.658  1.00 53.28  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 21.228  35.740 15.577  1.00 53.28  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.746  34.811 16.473  1.00 53.28  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.856  35.937 15.542  1.00 53.28  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.902  34.099 17.335  1.00 53.28  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 19.020  35.236 16.395  1.00 53.28  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 19.543  34.315 17.291  1.00 53.28  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 21.202  38.313 12.391  1.00 61.56  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 21.289  39.503 11.589  1.00 61.56  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 20.483  40.579 12.271  1.00 61.56  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 19.390  40.285 12.761  1.00 61.56  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 20.698  39.226 10.213  1.00 46.46  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 21.745  38.518 9.345   1.00 46.46  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 20.210  40.525 9.559   1.00 46.46  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 21.181  37.935 8.123   1.00 46.46  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.982  41.815 12.341  1.00 42.32  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 20.098  42.829 12.892  1.00 42.32  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.560  43.714 11.827  1.00 42.32  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 20.209  44.656 11.407  1.00 42.32  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 20.636  43.638 14.092  1.00 43.50  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 21.962  44.238 13.832  1.00 43.50  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 22.463  45.065 14.637  1.00 43.50  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.506  43.836 12.802  1.00 43.50  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 18.344  43.372 11.410  1.00 48.21  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.497  44.233 10.620  1.00 48.21  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.624  45.683 10.995  1.00 48.21  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 17.468  46.543 10.152  1.00 48.21  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 17.912  45.954 12.261  1.00 38.82  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 18.154  47.303 12.699  1.00 38.82  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 19.235  47.864 11.795  1.00 38.82  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 19.050  48.899 11.157  1.00 38.82  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 18.657  47.292 14.136  1.00 27.40  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 17.548  47.483 15.175  1.00 27.40  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 16.355  47.150 14.913  1.00 27.40  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 17.916  47.952 16.284  1.00 27.40  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 20.356  47.154 11.723  1.00 60.21  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 21.481  47.543 10.876  1.00 60.21  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 21.176  47.429 9.384   1.00 60.21  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 21.584  48.271 8.588   1.00 60.21  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.713  46.714 11.234  1.00 52.68  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 24.094  47.133 10.756  1.00 52.68  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 24.460  46.320 9.536   1.00 52.68  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 24.182  48.664 10.503  1.00 52.68  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 20.463  46.390 8.992   1.00 35.69  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 20.049  46.331 7.618   1.00 35.69  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 19.178  47.523 7.254   1.00 35.69  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 19.396  48.154 6.242   1.00 35.69  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 19.470  44.983 7.250   1.00 40.66  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 20.653  44.115 6.837   1.00 40.66  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 18.487  45.098 6.115   1.00 40.66  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 20.447  42.641 6.960   1.00 40.66  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 18.242  47.887 8.104   1.00 45.37  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 17.291  48.930 7.735   1.00 45.37  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 17.927  50.303 7.507   1.00 45.37  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 17.418  51.113 6.746   1.00 45.37  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 16.161  48.995 8.755   1.00 42.30  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 15.298  47.738 8.750   1.00 42.30  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 13.976  47.946 9.417   1.00 42.30  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 13.801  48.974 10.118  1.00 42.30  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 13.093  47.079 9.231   1.00 42.30  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 19.064  50.553 8.129   1.00 51.12  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 19.733  51.829 7.953   1.00 51.12  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 20.399  51.935 6.597   1.00 51.12  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 21.237  52.802 6.384   1.00 51.12  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 20.785  52.007 9.029   1.00 54.32  ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.675  50.898 9.022   1.00 54.32  ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 20.057  51.030 5.690   1.00 74.78  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.554  51.102 4.328   1.00 74.78  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.767  52.163 3.611   1.00 74.78  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 20.305  52.852 2.743   1.00 74.78  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 20.380  49.765 3.616   1.00 82.86  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.394  49.861 2.113   1.00 82.86  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 21.579  50.113 1.423   1.00 82.86  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 19.217  49.675 1.381   1.00 82.86  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 21.588  50.185 0.033   1.00 82.86  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 19.218  49.744 -0.016  1.00 82.86  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 20.400  50.000 -0.690  1.00 82.86  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.490  52.278 3.981   1.00 76.53  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.581  53.234 3.372   1.00 76.53  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 17.892  54.616 3.905   1.00 76.53  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 17.590  55.614 3.262   1.00 76.53  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 16.113  52.878 3.643   1.00 47.22  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.633  51.413 3.564   1.00 47.22  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 14.183  51.304 3.936   1.00 47.22  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 15.833  50.759 2.196   1.00 47.22  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.499  54.680 5.080   1.00 70.03  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 18.881  55.965 5.627   1.00 70.03  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 20.296  56.305 5.185   1.00 70.03  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 21.212  56.417 5.994   1.00 70.03  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 18.754  55.974 7.153   1.00 87.06  ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.385  56.414 7.620   1.00 87.06  ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 17.279  56.905 8.762   1.00 87.06  ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 16.418  56.280 6.842   1.00 87.06  ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.482  56.463 3.887   1.00 84.84  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 21.808  56.707 3.367   1.00 84.84  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 21.749  57.691 2.196   1.00 84.84  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.792  57.701 1.416   1.00 84.84  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 22.514  55.363 2.989   1.00 55.32  ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 23.036  54.642 4.231   1.00 55.32  ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 23.704  55.576 2.051   1.00 55.32  ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 23.894  53.386 3.900   1.00 55.32  ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 22.769  58.541 2.116   1.00 140.82 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 23.029  59.344 0.934   1.00 140.82 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 23.360  58.402 -0.217  1.00 140.82 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 24.278  57.586 -0.103  1.00 140.82 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 24.216  60.272 1.194   1.00 98.28  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 25.403  59.526 1.432   1.00 98.28  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.626  58.515 -1.322  1.00 104.89 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.862  57.653 -2.484  1.00 104.89 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 24.343  57.467 -2.829  1.00 104.89 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.750  56.348 -3.155  1.00 104.89 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 22.077  58.111 -3.717  1.00 81.01  ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 20.611  57.688 -3.715  1.00 81.01  ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 20.026  57.733 -5.110  1.00 81.01  ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.574  56.670 -5.955  1.00 81.01  ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 20.016  55.467 -6.110  1.00 81.01  ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 18.888  55.159 -5.473  1.00 81.01  ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 20.586  54.562 -6.897  1.00 81.01  ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 25.151  58.558 -2.785  1.00 82.10  ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.600  58.392 -2.978  1.00 82.10  ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 27.171  57.190 -2.223  1.00 82.10  ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.725  56.290 -2.850  1.00 82.10  ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 27.171  59.708 -2.443  1.00 112.11 ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 26.120  60.712 -2.782  1.00 112.11 ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 24.797  59.985 -2.613  1.00 112.11 ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 26.995  57.171 -0.899  1.00 84.85  ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 27.414  56.054 -0.041  1.00 84.85  ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 26.673  54.785 -0.395  1.00 84.85  ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 27.193  53.687 -0.226  1.00 84.85  ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 27.130  56.374 1.417   1.00 83.47  ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 28.026  57.431 1.996   1.00 83.47  ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 27.733  57.652 3.470   1.00 83.47  ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 28.891  58.355 4.168   1.00 83.47  ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 30.093  57.465 4.298   1.00 83.47  ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 25.452  54.949 -0.889  1.00 64.94  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 24.593  53.831 -1.207  1.00 64.94  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 25.061  53.084 -2.452  1.00 64.94  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 24.743  51.906 -2.630  1.00 64.94  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 23.169  54.327 -1.401  1.00 74.39  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 22.134  53.385 -0.879  1.00 74.39  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 20.499  53.849 -1.436  1.00 74.39  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 20.264  55.423 -0.584  1.00 74.39  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.794  53.776 -3.319  1.00 111.72 ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 26.361  53.149 -4.512  1.00 111.72 ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.723  52.526 -4.232  1.00 111.72 ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 28.247  51.762 -5.049  1.00 111.72 ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.449  54.144 -5.666  1.00 124.56 ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 25.258  54.095 -6.603  1.00 124.56 ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.784  55.470 -7.000  1.00 124.56 ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 25.573  56.410 -7.113  1.00 124.56 ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 23.481  55.602 -7.205  1.00 124.56 ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 28.291  52.861 -3.077  1.00 89.02  ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 29.514  52.224 -2.622  1.00 89.02  ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 29.200  50.796 -2.173  1.00 89.02  ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 29.655  49.842 -2.806  1.00 89.02  ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 30.182  53.024 -1.513  1.00 76.00  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 31.504  52.420 -1.115  1.00 76.00  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 32.214  53.207 -0.049  1.00 76.00  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 33.178  52.650 0.536   1.00 76.00  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 31.810  54.376 0.196   1.00 76.00  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 28.428  50.660 -1.088  1.00 112.11 ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 27.733  49.411 -0.754  1.00 112.11 ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 26.988  49.072 -2.028  1.00 112.11 ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 26.526  49.985 -2.722  1.00 112.11 ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 26.702  49.617 0.415   1.00 61.52  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 25.629  48.512 0.448   1.00 61.52  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 27.389  49.692 1.759   1.00 61.52  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 26.869  47.793 -2.370  1.00 65.93  ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 26.154  47.466 -3.600  1.00 65.93  ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 27.056  47.854 -4.759  1.00 65.93  ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 26.685  48.660 -5.609  1.00 65.93  ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 24.844  48.299 -3.696  1.00 54.71  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 24.287  48.362 -5.124  1.00 54.71  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 23.815  47.773 -2.721  1.00 54.71  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 28.275  47.329 -4.742  1.00 118.56 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 29.151  47.419 -5.892  1.00 118.56 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 29.157  46.031 -6.558  1.00 118.56 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 30.128  45.656 -7.222  1.00 118.56 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 30.578  47.913 -5.483  1.00 30.90  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 28.045  45.294 -6.365  1.00 78.60  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 27.764  43.950 -6.962  1.00 78.60  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 26.916  42.994 -6.086  1.00 78.60  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 26.784  41.795 -6.385  1.00 78.60  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 29.047  43.239 -7.422  1.00 92.18  ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 29.905  42.801 -6.266  1.00 92.18  ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 29.487  41.986 -5.442  1.00 92.18  ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 31.109  43.347 -6.189  1.00 92.18  ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 23.109  36.502 -8.832  1.00 86.72  ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 22.479  37.736 -8.342  1.00 86.72  ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 22.775  38.949 -9.231  1.00 86.72  ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 23.869  39.068 -9.803  1.00 86.72  ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 22.826  38.039 -6.850  1.00 118.36 ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 24.132  37.435 -6.245  1.00 118.36 ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 25.430  38.051 -6.785  1.00 118.36 ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 26.014  37.167 -7.835  1.00 118.36 ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 27.144  37.449 -8.498  1.00 118.36 ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 27.843  38.608 -8.238  1.00 118.36 ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 27.580  36.567 -9.432  1.00 118.36 ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 21.788  39.839 -9.344  1.00 86.87  ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 21.922  41.069 -10.132 1.00 86.87  ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 23.043  41.951 -9.541  1.00 86.87  ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 24.196  41.495 -9.415  1.00 86.87  ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 20.571  41.819 -10.228 1.00 79.20  ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 19.569  41.331 -11.324 1.00 79.20  ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 18.968  39.911 -11.092 1.00 79.20  ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 19.647  38.901 -11.388 1.00 79.20  ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 17.798  39.800 -10.656 1.00 79.20  ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 22.710  43.194 -9.188  1.00 132.20 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 23.651  44.122 -8.554  1.00 132.20 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 23.210  45.559 -8.791  1.00 132.20 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 23.768  46.250 -9.649  1.00 132.20 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 25.099  43.902 -9.069  1.00 49.68  ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 22.200  46.005 -8.046  1.00 98.67  ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 21.739  47.399 -8.148  1.00 98.67  ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 21.271  47.977 -6.814  1.00 98.67  ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 20.717  47.255 -5.982  1.00 98.67  ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.564  47.563 -9.151  1.00 98.94  ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 20.573  46.492 -10.108 1.00 98.94  ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 20.610  48.954 -9.848  1.00 98.94  ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 21.489  49.281 -6.630  1.00 72.25  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 20.881  50.024 -5.533  1.00 72.25  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 19.341  49.979 -5.594  1.00 72.25  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 18.676  49.773 -4.586  1.00 72.25  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 21.375  51.469 -5.538  1.00 70.45  ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 18.775  50.169 -6.779  1.00 107.42 ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 17.318  50.198 -6.920  1.00 107.42 ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 16.714  48.779 -7.021  1.00 107.42 ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 15.504  48.595 -7.212  1.00 107.42 ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 16.919  51.121 -8.086  1.00 89.13  ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 17.272  52.598 -7.819  1.00 89.13  ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 16.998  53.088 -6.697  1.00 89.13  ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 17.815  53.267 -8.731  1.00 89.13  ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 17.586  47.788 -6.866  1.00 106.19 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 17.222  46.380 -6.765  1.00 106.19 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 17.139  46.045 -5.267  1.00 106.19 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 16.426  45.126 -4.852  1.00 106.19 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 18.331  45.541 -7.433  1.00 105.79 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 17.809  44.321 -8.200  1.00 105.79 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 16.616  44.283 -8.581  1.00 105.79 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 18.624  43.400 -8.442  1.00 105.79 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 17.854  46.847 -4.475  1.00 82.65  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 18.199  46.580 -3.070  1.00 82.65  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 17.377  47.439 -2.098  1.00 82.65  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 16.805  46.947 -1.121  1.00 82.65  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.671  46.936 -2.906  1.00 58.61  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.728  46.029 -2.293  1.00 58.61  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 20.885  46.424 -0.857  1.00 58.61  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 20.441  44.552 -2.489  1.00 58.61  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 17.354  48.738 -2.375  1.00 90.52  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 16.425  49.680 -1.770  1.00 90.52  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 15.009  49.097 -1.668  1.00 90.52  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 14.206  49.536 -0.852  1.00 90.52  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 16.420  50.992 -2.605  1.00 57.68  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 16.310  52.220 -1.696  1.00 57.68  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 15.350  50.965 -3.722  1.00 57.68  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 16.965  53.463 -2.275  1.00 57.68  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 14.729  48.107 -2.514  1.00 71.96  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 13.448  47.411 -2.563  1.00 71.96  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 13.459  46.190 -1.623  1.00 71.96  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 12.482  45.930 -0.911  1.00 71.96  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 13.142  47.005 -4.017  1.00 76.97  ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 11.875  46.163 -4.231  1.00 76.97  ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 12.079  45.113 -5.341  1.00 76.97  ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 12.629  45.750 -6.628  1.00 76.97  ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 12.806  44.786 -7.749  1.00 76.97  ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 14.568  45.451 -1.629  1.00 64.83  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.739  44.278 -0.761  1.00 64.83  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 14.455  44.653 0.696   1.00 64.83  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.658  44.001 1.378   1.00 64.83  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 16.178  43.678 -0.863  1.00 78.30  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 16.358  42.569 0.147   1.00 78.30  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 16.488  43.170 -2.277  1.00 78.30  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 15.101  45.723 1.150   1.00 68.53  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 14.983  46.173 2.530   1.00 68.53  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 13.530  46.545 2.881   1.00 68.53  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 13.028  46.170 3.947   1.00 68.53  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 16.013  47.301 2.854   1.00 56.29  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 15.698  47.981 4.162   1.00 56.29  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 17.428  46.731 2.916   1.00 56.29  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 12.844  47.230 1.966   1.00 63.16  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 11.468  47.656 2.208   1.00 63.16  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.543  46.486 2.477   1.00 63.16  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 9.685   46.574 3.351   1.00 63.16  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 10.944  48.506 1.066   1.00 118.01 ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 11.378  49.941 1.164   1.00 118.01 ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 11.048  50.719 -0.083  1.00 118.01 ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 11.038  50.116 -1.182  1.00 118.01 ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 10.799  51.937 0.031   1.00 118.01 ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.730  45.388 1.748   1.00 57.77  ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 9.981   44.166 2.032   1.00 57.77  ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 10.155  43.675 3.495   1.00 57.77  ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 9.254   43.024 4.045   1.00 57.77  ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 10.318  43.072 1.021   1.00 116.28 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 9.554   43.206 -0.286  1.00 116.28 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 10.446  43.085 -1.514  1.00 116.28 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 11.460  42.348 -1.458  1.00 116.28 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 10.130  43.734 -2.543  1.00 116.28 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.288  44.009 4.120   1.00 59.03  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.528  43.645 5.514   1.00 59.03  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 10.941  44.663 6.471   1.00 59.03  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 10.505  44.319 7.560   1.00 59.03  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 13.012  43.541 5.811   1.00 30.79  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 13.909  42.638 4.972   1.00 30.79  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 15.335  43.256 4.811   1.00 30.79  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.950  41.278 5.619   1.00 30.79  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 10.958  45.928 6.081   1.00 46.23  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.376  46.974 6.906   1.00 46.23  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 8.909   46.604 7.110   1.00 46.23  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.322   46.893 8.156   1.00 46.23  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.442  48.324 6.215   1.00 48.84  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 9.701   48.230 4.999   1.00 48.84  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 11.896  48.723 5.902   1.00 48.84  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 8.324   45.933 6.124   1.00 49.01  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 6.923   45.542 6.222   1.00 49.01  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.705   44.384 7.175   1.00 49.01  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.546   43.995 7.416   1.00 49.01  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 6.359   45.167 4.856   1.00 99.39  ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 5.930   46.339 4.043   1.00 99.39  ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.980   45.949 2.605   1.00 99.39  ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 6.162   47.104 1.735   1.00 99.39  ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.533   47.021 0.463   1.00 99.39  ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 6.772   45.833 -0.089  1.00 99.39  ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 6.669   48.126 -0.257  1.00 99.39  ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.810   43.841 7.704   1.00 58.83  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.771   42.645 8.566   1.00 58.83  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 7.244   42.943 9.983   1.00 58.83  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 6.883   42.022 10.733  1.00 58.83  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 9.144   41.928 8.592   1.00 108.06 ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 8.941   40.403 8.403   1.00 108.06 ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 9.952   42.269 9.893   1.00 108.06 ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.184  39.750 7.852   1.00 108.06 ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 7.198   44.239 10.314  1.00 54.46  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.675   44.741 11.580  1.00 54.46  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 6.091   46.157 11.397  1.00 54.46  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 5.969   46.947 12.356  1.00 54.46  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 7.797   44.780 12.600  1.00 58.16  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 8.942   45.643 12.183  1.00 58.16  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 10.074  45.135 11.586  1.00 58.16  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 9.121   46.983 12.259  1.00 58.16  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 10.907  46.126 11.321  1.00 58.16  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 10.349  47.258 11.711  1.00 58.16  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . ILE B 2 1    ? 15.255  33.852 48.947  1.00 52.61  ? 88   ILE B N   1 
ATOM 8728 C CA  . ILE B 2 1    ? 14.461  32.724 48.458  1.00 52.61  ? 88   ILE B CA  1 
ATOM 8729 C C   . ILE B 2 1    ? 14.144  32.858 46.961  1.00 52.61  ? 88   ILE B C   1 
ATOM 8730 O O   . ILE B 2 1    ? 13.711  33.931 46.495  1.00 52.61  ? 88   ILE B O   1 
ATOM 8731 C CB  . ILE B 2 1    ? 13.147  32.539 49.253  1.00 123.03 ? 88   ILE B CB  1 
ATOM 8732 C CG1 . ILE B 2 1    ? 12.204  33.721 49.031  1.00 123.03 ? 88   ILE B CG1 1 
ATOM 8733 C CG2 . ILE B 2 1    ? 13.438  32.352 50.730  1.00 123.03 ? 88   ILE B CG2 1 
ATOM 8734 C CD1 . ILE B 2 1    ? 10.759  33.330 48.974  1.00 123.03 ? 88   ILE B CD1 1 
ATOM 8735 N N   . LEU B 2 2    ? 14.330  31.758 46.233  1.00 61.97  ? 89   LEU B N   1 
ATOM 8736 C CA  . LEU B 2 2    ? 14.291  31.781 44.779  1.00 61.97  ? 89   LEU B CA  1 
ATOM 8737 C C   . LEU B 2 2    ? 13.195  32.648 44.109  1.00 61.97  ? 89   LEU B C   1 
ATOM 8738 O O   . LEU B 2 2    ? 13.509  33.364 43.157  1.00 61.97  ? 89   LEU B O   1 
ATOM 8739 C CB  . LEU B 2 2    ? 14.328  30.373 44.197  1.00 47.10  ? 89   LEU B CB  1 
ATOM 8740 C CG  . LEU B 2 2    ? 14.846  30.198 42.766  1.00 47.10  ? 89   LEU B CG  1 
ATOM 8741 C CD1 . LEU B 2 2    ? 15.981  31.118 42.426  1.00 47.10  ? 89   LEU B CD1 1 
ATOM 8742 C CD2 . LEU B 2 2    ? 15.322  28.809 42.590  1.00 47.10  ? 89   LEU B CD2 1 
ATOM 8743 N N   . PRO B 2 3    ? 11.923  32.595 44.588  1.00 50.69  ? 90   PRO B N   1 
ATOM 8744 C CA  . PRO B 2 3    ? 10.853  33.357 43.910  1.00 50.69  ? 90   PRO B CA  1 
ATOM 8745 C C   . PRO B 2 3    ? 11.101  34.853 43.907  1.00 50.69  ? 90   PRO B C   1 
ATOM 8746 O O   . PRO B 2 3    ? 11.200  35.464 42.845  1.00 50.69  ? 90   PRO B O   1 
ATOM 8747 C CB  . PRO B 2 3    ? 9.625   33.081 44.767  1.00 18.33  ? 90   PRO B CB  1 
ATOM 8748 C CG  . PRO B 2 3    ? 9.911   31.835 45.441  1.00 18.33  ? 90   PRO B CG  1 
ATOM 8749 C CD  . PRO B 2 3    ? 11.379  31.856 45.737  1.00 18.33  ? 90   PRO B CD  1 
ATOM 8750 N N   . LYS B 2 4    ? 11.203  35.438 45.092  1.00 49.07  ? 91   LYS B N   1 
ATOM 8751 C CA  . LYS B 2 4    ? 11.392  36.870 45.191  1.00 49.07  ? 91   LYS B CA  1 
ATOM 8752 C C   . LYS B 2 4    ? 12.620  37.275 44.373  1.00 49.07  ? 91   LYS B C   1 
ATOM 8753 O O   . LYS B 2 4    ? 12.566  38.229 43.574  1.00 49.07  ? 91   LYS B O   1 
ATOM 8754 C CB  . LYS B 2 4    ? 11.507  37.285 46.657  1.00 45.19  ? 91   LYS B CB  1 
ATOM 8755 C CG  . LYS B 2 4    ? 10.378  36.734 47.534  1.00 45.19  ? 91   LYS B CG  1 
ATOM 8756 C CD  . LYS B 2 4    ? 10.086  37.674 48.705  1.00 45.19  ? 91   LYS B CD  1 
ATOM 8757 C CE  . LYS B 2 4    ? 10.035  36.925 50.038  1.00 45.19  ? 91   LYS B CE  1 
ATOM 8758 N NZ  . LYS B 2 4    ? 10.182  37.898 51.160  1.00 45.19  ? 91   LYS B NZ  1 
ATOM 8759 N N   . VAL B 2 5    ? 13.705  36.515 44.534  1.00 30.90  ? 92   VAL B N   1 
ATOM 8760 C CA  . VAL B 2 5    ? 14.879  36.758 43.735  1.00 30.90  ? 92   VAL B CA  1 
ATOM 8761 C C   . VAL B 2 5    ? 14.469  36.746 42.274  1.00 30.90  ? 92   VAL B C   1 
ATOM 8762 O O   . VAL B 2 5    ? 14.925  37.596 41.515  1.00 30.90  ? 92   VAL B O   1 
ATOM 8763 C CB  . VAL B 2 5    ? 16.024  35.724 43.934  1.00 34.67  ? 92   VAL B CB  1 
ATOM 8764 C CG1 . VAL B 2 5    ? 17.233  36.108 43.094  1.00 34.67  ? 92   VAL B CG1 1 
ATOM 8765 C CG2 . VAL B 2 5    ? 16.428  35.583 45.419  1.00 34.67  ? 92   VAL B CG2 1 
ATOM 8766 N N   . LEU B 2 6    ? 13.620  35.808 41.866  1.00 43.74  ? 93   LEU B N   1 
ATOM 8767 C CA  . LEU B 2 6    ? 13.284  35.718 40.456  1.00 43.74  ? 93   LEU B CA  1 
ATOM 8768 C C   . LEU B 2 6    ? 12.528  36.958 40.015  1.00 43.74  ? 93   LEU B C   1 
ATOM 8769 O O   . LEU B 2 6    ? 12.843  37.583 38.998  1.00 43.74  ? 93   LEU B O   1 
ATOM 8770 C CB  . LEU B 2 6    ? 12.455  34.469 40.162  1.00 30.09  ? 93   LEU B CB  1 
ATOM 8771 C CG  . LEU B 2 6    ? 13.136  33.105 40.074  1.00 30.09  ? 93   LEU B CG  1 
ATOM 8772 C CD1 . LEU B 2 6    ? 12.178  32.279 39.299  1.00 30.09  ? 93   LEU B CD1 1 
ATOM 8773 C CD2 . LEU B 2 6    ? 14.569  33.134 39.428  1.00 30.09  ? 93   LEU B CD2 1 
ATOM 8774 N N   . HIS B 2 7    ? 11.532  37.315 40.807  1.00 50.47  ? 94   HIS B N   1 
ATOM 8775 C CA  . HIS B 2 7    ? 10.661  38.414 40.460  1.00 50.47  ? 94   HIS B CA  1 
ATOM 8776 C C   . HIS B 2 7    ? 11.478  39.691 40.440  1.00 50.47  ? 94   HIS B C   1 
ATOM 8777 O O   . HIS B 2 7    ? 11.184  40.620 39.676  1.00 50.47  ? 94   HIS B O   1 
ATOM 8778 C CB  . HIS B 2 7    ? 9.509   38.525 41.446  1.00 61.63  ? 94   HIS B CB  1 
ATOM 8779 C CG  . HIS B 2 7    ? 8.749   39.795 41.312  1.00 61.63  ? 94   HIS B CG  1 
ATOM 8780 N ND1 . HIS B 2 7    ? 7.818   39.997 40.316  1.00 61.63  ? 94   HIS B ND1 1 
ATOM 8781 C CD2 . HIS B 2 7    ? 8.806   40.945 42.022  1.00 61.63  ? 94   HIS B CD2 1 
ATOM 8782 C CE1 . HIS B 2 7    ? 7.318   41.214 40.429  1.00 61.63  ? 94   HIS B CE1 1 
ATOM 8783 N NE2 . HIS B 2 7    ? 7.898   41.809 41.459  1.00 61.63  ? 94   HIS B NE2 1 
ATOM 8784 N N   . LYS B 2 8    ? 12.513  39.733 41.269  1.00 50.45  ? 95   LYS B N   1 
ATOM 8785 C CA  . LYS B 2 8    ? 13.434  40.839 41.212  1.00 50.45  ? 95   LYS B CA  1 
ATOM 8786 C C   . LYS B 2 8    ? 14.068  40.926 39.819  1.00 50.45  ? 95   LYS B C   1 
ATOM 8787 O O   . LYS B 2 8    ? 13.916  41.920 39.118  1.00 50.45  ? 95   LYS B O   1 
ATOM 8788 C CB  . LYS B 2 8    ? 14.489  40.692 42.301  1.00 61.06  ? 95   LYS B CB  1 
ATOM 8789 C CG  . LYS B 2 8    ? 13.985  41.028 43.687  1.00 61.06  ? 95   LYS B CG  1 
ATOM 8790 C CD  . LYS B 2 8    ? 15.145  41.230 44.668  1.00 61.06  ? 95   LYS B CD  1 
ATOM 8791 C CE  . LYS B 2 8    ? 14.675  42.027 45.879  1.00 61.06  ? 95   LYS B CE  1 
ATOM 8792 N NZ  . LYS B 2 8    ? 15.748  42.239 46.880  1.00 61.06  ? 95   LYS B NZ  1 
ATOM 8793 N N   . ARG B 2 9    ? 14.744  39.852 39.426  1.00 46.09  ? 96   ARG B N   1 
ATOM 8794 C CA  . ARG B 2 9    ? 15.510  39.749 38.165  1.00 46.09  ? 96   ARG B CA  1 
ATOM 8795 C C   . ARG B 2 9    ? 14.719  40.253 36.941  1.00 46.09  ? 96   ARG B C   1 
ATOM 8796 O O   . ARG B 2 9    ? 15.272  40.797 35.977  1.00 46.09  ? 96   ARG B O   1 
ATOM 8797 C CB  . ARG B 2 9    ? 15.911  38.281 37.974  1.00 38.68  ? 96   ARG B CB  1 
ATOM 8798 C CG  . ARG B 2 9    ? 16.967  38.009 36.950  1.00 38.68  ? 96   ARG B CG  1 
ATOM 8799 C CD  . ARG B 2 9    ? 17.502  36.580 37.110  1.00 38.68  ? 96   ARG B CD  1 
ATOM 8800 N NE  . ARG B 2 9    ? 18.315  36.157 35.964  1.00 38.68  ? 96   ARG B NE  1 
ATOM 8801 C CZ  . ARG B 2 9    ? 17.902  35.340 34.983  1.00 38.68  ? 96   ARG B CZ  1 
ATOM 8802 N NH1 . ARG B 2 9    ? 16.672  34.820 34.983  1.00 38.68  ? 96   ARG B NH1 1 
ATOM 8803 N NH2 . ARG B 2 9    ? 18.738  35.051 33.986  1.00 38.68  ? 96   ARG B NH2 1 
ATOM 8804 N N   . THR B 2 10   ? 13.409  40.089 37.050  1.00 29.29  ? 97   THR B N   1 
ATOM 8805 C CA  . THR B 2 10   ? 12.466  40.263 35.990  1.00 29.29  ? 97   THR B CA  1 
ATOM 8806 C C   . THR B 2 10   ? 12.211  41.737 35.864  1.00 29.29  ? 97   THR B C   1 
ATOM 8807 O O   . THR B 2 10   ? 11.826  42.197 34.798  1.00 29.29  ? 97   THR B O   1 
ATOM 8808 C CB  . THR B 2 10   ? 11.149  39.489 36.355  1.00 16.98  ? 97   THR B CB  1 
ATOM 8809 O OG1 . THR B 2 10   ? 10.685  38.795 35.224  1.00 16.98  ? 97   THR B OG1 1 
ATOM 8810 C CG2 . THR B 2 10   ? 9.984   40.390 36.896  1.00 16.98  ? 97   THR B CG2 1 
ATOM 8811 N N   . LEU B 2 11   ? 12.416  42.467 36.966  1.00 51.39  ? 98   LEU B N   1 
ATOM 8812 C CA  . LEU B 2 11   ? 12.154  43.910 37.037  1.00 51.39  ? 98   LEU B CA  1 
ATOM 8813 C C   . LEU B 2 11   ? 13.384  44.706 36.777  1.00 51.39  ? 98   LEU B C   1 
ATOM 8814 O O   . LEU B 2 11   ? 13.329  45.907 36.467  1.00 51.39  ? 98   LEU B O   1 
ATOM 8815 C CB  . LEU B 2 11   ? 11.722  44.304 38.429  1.00 23.65  ? 98   LEU B CB  1 
ATOM 8816 C CG  . LEU B 2 11   ? 10.330  43.887 38.812  1.00 23.65  ? 98   LEU B CG  1 
ATOM 8817 C CD1 . LEU B 2 11   ? 10.055  44.428 40.207  1.00 23.65  ? 98   LEU B CD1 1 
ATOM 8818 C CD2 . LEU B 2 11   ? 9.357   44.412 37.727  1.00 23.65  ? 98   LEU B CD2 1 
ATOM 8819 N N   . GLY B 2 12   ? 14.515  44.056 36.961  1.00 28.21  ? 99   GLY B N   1 
ATOM 8820 C CA  . GLY B 2 12   ? 15.735  44.743 36.680  1.00 28.21  ? 99   GLY B CA  1 
ATOM 8821 C C   . GLY B 2 12   ? 16.611  44.505 37.849  1.00 28.21  ? 99   GLY B C   1 
ATOM 8822 O O   . GLY B 2 12   ? 17.151  45.439 38.440  1.00 28.21  ? 99   GLY B O   1 
ATOM 8823 N N   . LEU B 2 13   ? 16.712  43.221 38.182  1.00 111.47 ? 100  LEU B N   1 
ATOM 8824 C CA  . LEU B 2 13   ? 17.778  42.708 39.019  1.00 111.47 ? 100  LEU B CA  1 
ATOM 8825 C C   . LEU B 2 13   ? 17.709  43.403 40.386  1.00 111.47 ? 100  LEU B C   1 
ATOM 8826 O O   . LEU B 2 13   ? 18.554  43.185 41.253  1.00 111.47 ? 100  LEU B O   1 
ATOM 8827 C CB  . LEU B 2 13   ? 19.144  42.888 38.294  1.00 70.97  ? 100  LEU B CB  1 
ATOM 8828 C CG  . LEU B 2 13   ? 19.477  42.161 36.954  1.00 70.97  ? 100  LEU B CG  1 
ATOM 8829 C CD1 . LEU B 2 13   ? 18.434  42.265 35.794  1.00 70.97  ? 100  LEU B CD1 1 
ATOM 8830 C CD2 . LEU B 2 13   ? 20.900  42.518 36.424  1.00 70.97  ? 100  LEU B CD2 1 
ATOM 8831 N N   . SER B 2 14   ? 16.666  44.216 40.560  1.00 117.58 ? 101  SER B N   1 
ATOM 8832 C CA  . SER B 2 14   ? 16.469  45.028 41.753  1.00 117.58 ? 101  SER B CA  1 
ATOM 8833 C C   . SER B 2 14   ? 16.205  44.131 42.962  1.00 117.58 ? 101  SER B C   1 
ATOM 8834 O O   . SER B 2 14   ? 15.055  43.755 43.187  1.00 117.58 ? 101  SER B O   1 
ATOM 8835 C CB  . SER B 2 14   ? 15.266  45.969 41.577  1.00 52.01  ? 101  SER B CB  1 
ATOM 8836 O OG  . SER B 2 14   ? 14.955  46.224 40.226  1.00 52.01  ? 101  SER B OG  1 
ATOM 8837 O OXT . SER B 2 14   ? 17.085  43.761 43.747  1.00 52.01  ? 101  SER B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    ILE 1    88   88   ILE ILE B . n 
B 2 2    LEU 2    89   89   LEU LEU B . n 
B 2 3    PRO 3    90   90   PRO PRO B . n 
B 2 4    LYS 4    91   91   LYS LYS B . n 
B 2 5    VAL 5    92   92   VAL VAL B . n 
B 2 6    LEU 6    93   93   LEU LEU B . n 
B 2 7    HIS 7    94   94   HIS HIS B . n 
B 2 8    LYS 8    95   95   LYS LYS B . n 
B 2 9    ARG 9    96   96   ARG ARG B . n 
B 2 10   THR 10   97   97   THR THR B . n 
B 2 11   LEU 11   98   98   LEU LEU B . n 
B 2 12   GLY 12   99   99   GLY GLY B . n 
B 2 13   LEU 13   100  100  LEU LEU B . n 
B 2 14   SER 14   101  101  SER SER B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1520  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  49480 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I7H 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    255 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    279 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB  A CYS 313 ? ? SG  A CYS 313 ? ? 1.710 1.812 -0.102 0.016 N 
2 1 CE2 A PHE 382 ? ? CD2 A PHE 382 ? ? 1.512 1.388 0.124  0.020 N 
3 1 CB  A LYS 383 ? ? CG  A LYS 383 ? ? 1.772 1.521 0.251  0.027 N 
4 1 CE  A LYS 383 ? ? NZ  A LYS 383 ? ? 1.734 1.486 0.248  0.025 N 
5 1 N   A GLU 384 ? ? CA  A GLU 384 ? ? 1.632 1.459 0.173  0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A LYS 35  ? ? CA A LYS 35  ? ? C   A LYS 35  ? ? 146.20 110.40 35.80  2.00 N 
2  1 N  A LYS 35  ? ? CA A LYS 35  ? ? C   A LYS 35  ? ? 94.38  111.00 -16.62 2.70 N 
3  1 N  A ASN 36  ? ? CA A ASN 36  ? ? C   A ASN 36  ? ? 83.86  111.00 -27.14 2.70 N 
4  1 N  A PRO 185 ? ? CA A PRO 185 ? ? C   A PRO 185 ? ? 129.00 112.10 16.90  2.60 N 
5  1 N  A GLN 186 ? ? CA A GLN 186 ? ? CB  A GLN 186 ? ? 83.62  110.60 -26.98 1.80 N 
6  1 N  A SER 309 ? ? CA A SER 309 ? ? C   A SER 309 ? ? 85.68  111.00 -25.32 2.70 N 
7  1 CB A ASP 330 ? ? CG A ASP 330 ? ? OD1 A ASP 330 ? ? 123.74 118.30 5.44   0.90 N 
8  1 CG A LYS 383 ? ? CD A LYS 383 ? ? CE  A LYS 383 ? ? 93.77  111.90 -18.13 3.00 N 
9  1 N  A ARG 514 ? ? CA A ARG 514 ? ? CB  A ARG 514 ? ? 98.24  110.60 -12.36 1.80 N 
10 1 N  A ARG 514 ? ? CA A ARG 514 ? ? C   A ARG 514 ? ? 93.26  111.00 -17.74 2.70 N 
11 1 C  A TYR 837 ? ? N  A PRO 838 ? ? CA  A PRO 838 ? ? 131.26 119.30 11.96  1.50 Y 
12 1 N  A GLU 840 ? ? CA A GLU 840 ? ? C   A GLU 840 ? ? 90.85  111.00 -20.15 2.70 N 
13 1 N  A ALA 841 ? ? CA A ALA 841 ? ? CB  A ALA 841 ? ? 91.71  110.10 -18.39 1.40 N 
14 1 N  A GLY 856 ? ? CA A GLY 856 ? ? C   A GLY 856 ? ? 131.53 113.10 18.43  2.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LYS A 35   ? ? -111.88 -114.04 
2   1 ASN A 36   ? ? -126.10 -78.50  
3   1 TYR A 58   ? ? -95.45  57.80   
4   1 LYS A 74   ? ? -123.27 -169.30 
5   1 TYR A 84   ? ? 88.44   4.47    
6   1 CYS A 87   ? ? 175.16  146.87  
7   1 SER A 94   ? ? -29.15  -71.75  
8   1 GLU A 96   ? ? -51.16  0.16    
9   1 GLN A 109  ? ? -44.02  155.14  
10  1 THR A 118  ? ? 90.58   -1.27   
11  1 CYS A 128  ? ? 38.38   38.90   
12  1 ASP A 146  ? ? -22.09  145.53  
13  1 ARG A 147  ? ? -48.18  -18.10  
14  1 ASP A 148  ? ? -96.87  -145.76 
15  1 LYS A 150  ? ? -62.86  8.66    
16  1 GLU A 161  ? ? -68.77  82.58   
17  1 LEU A 162  ? ? -18.21  -54.83  
18  1 PRO A 185  ? ? -24.18  -60.29  
19  1 ASN A 203  ? ? 46.18   -150.40 
20  1 LYS A 208  ? ? -68.44  -179.00 
21  1 SER A 217  ? ? -151.70 -17.21  
22  1 GLU A 235  ? ? 39.36   14.63   
23  1 ASN A 241  ? ? -164.73 115.05  
24  1 ALA A 249  ? ? -145.80 57.49   
25  1 GLN A 255  ? ? -77.59  -140.56 
26  1 SER A 256  ? ? -19.23  136.75  
27  1 ASN A 267  ? ? -39.70  -36.29  
28  1 MET A 291  ? ? -10.28  72.82   
29  1 ASP A 292  ? ? 75.47   68.23   
30  1 THR A 294  ? ? 56.29   -163.32 
31  1 THR A 308  ? ? -104.86 -96.81  
32  1 ILE A 310  ? ? -32.40  130.57  
33  1 LEU A 317  ? ? -91.89  -70.72  
34  1 ARG A 327  ? ? -133.31 -32.65  
35  1 ASN A 341  ? ? -60.73  -166.17 
36  1 GLU A 342  ? ? -41.31  161.14  
37  1 GLN A 343  ? ? 64.43   -19.16  
38  1 LEU A 356  ? ? -69.82  5.63    
39  1 GLU A 368  ? ? -85.86  47.23   
40  1 ARG A 369  ? ? 29.82   55.58   
41  1 PHE A 382  ? ? 55.38   -144.99 
42  1 LYS A 383  ? ? -68.94  1.63    
43  1 HIS A 399  ? ? -95.87  -70.94  
44  1 LEU A 404  ? ? -171.89 78.53   
45  1 PRO A 405  ? ? -48.62  156.51  
46  1 PRO A 412  ? ? -63.95  -176.08 
47  1 LEU A 413  ? ? -178.97 102.82  
48  1 SER A 415  ? ? -102.91 43.53   
49  1 ASN A 418  ? ? -139.61 -62.86  
50  1 GLU A 420  ? ? -70.98  24.88   
51  1 TYR A 422  ? ? -32.31  131.45  
52  1 THR A 433  ? ? -163.93 99.44   
53  1 LEU A 436  ? ? -121.40 -158.57 
54  1 PHE A 459  ? ? -171.45 138.16  
55  1 CYS A 460  ? ? -146.50 57.66   
56  1 VAL A 463  ? ? -116.88 -111.31 
57  1 HIS A 465  ? ? 68.43   62.69   
58  1 SER A 475  ? ? -170.57 130.40  
59  1 LYS A 484  ? ? 38.02   45.42   
60  1 SER A 488  ? ? 178.01  156.32  
61  1 SER A 499  ? ? -114.75 -72.15  
62  1 SER A 502  ? ? 169.21  110.94  
63  1 ASN A 504  ? ? -80.55  -84.27  
64  1 SER A 505  ? ? -152.81 -38.21  
65  1 ILE A 521  ? ? -101.35 48.19   
66  1 PRO A 523  ? ? -17.12  90.07   
67  1 GLN A 528  ? ? -63.58  93.31   
68  1 HIS A 531  ? ? -171.55 113.90  
69  1 ASP A 548  ? ? -62.72  3.58    
70  1 LEU A 576  ? ? -38.88  114.66  
71  1 LEU A 577  ? ? -99.41  -106.88 
72  1 GLU A 585  ? ? -144.89 20.56   
73  1 PHE A 596  ? ? -104.13 -91.82  
74  1 GLU A 597  ? ? -132.75 -81.27  
75  1 SER A 599  ? ? -162.23 104.06  
76  1 LEU A 606  ? ? -89.11  -153.58 
77  1 THR A 620  ? ? -132.35 -96.56  
78  1 LEU A 623  ? ? -55.04  104.57  
79  1 SER A 624  ? ? -86.06  -146.26 
80  1 LYS A 628  ? ? -52.19  109.09  
81  1 LEU A 631  ? ? -140.63 -110.90 
82  1 SER A 643  ? ? -138.50 -124.13 
83  1 LEU A 644  ? ? -76.71  -117.83 
84  1 SER A 645  ? ? -78.30  -71.46  
85  1 SER A 653  ? ? -170.69 -164.12 
86  1 ARG A 655  ? ? -116.25 73.77   
87  1 TYR A 660  ? ? -98.98  -141.30 
88  1 SER A 662  ? ? -81.34  -125.00 
89  1 HIS A 664  ? ? -149.60 10.15   
90  1 LYS A 665  ? ? -74.57  -155.63 
91  1 GLU A 675  ? ? -177.43 129.33  
92  1 ASN A 683  ? ? -177.36 28.23   
93  1 SER A 684  ? ? -64.10  -174.53 
94  1 PRO A 688  ? ? -54.12  -178.38 
95  1 ASP A 689  ? ? -12.74  101.86  
96  1 SER A 690  ? ? -156.78 -149.68 
97  1 ASN A 695  ? ? -99.74  -156.50 
98  1 SER A 697  ? ? -157.54 10.16   
99  1 ASP A 705  ? ? -81.28  -159.56 
100 1 GLU A 706  ? ? -49.64  -111.92 
101 1 ILE A 707  ? ? -161.80 -54.33  
102 1 THR A 750  ? ? -107.38 -86.52  
103 1 ALA A 751  ? ? 150.38  132.32  
104 1 SER A 764  ? ? 175.73  159.74  
105 1 SER A 772  ? ? -150.04 64.46   
106 1 HIS A 797  ? ? -90.93  -67.86  
107 1 THR A 833  ? ? -116.92 -166.59 
108 1 ALA A 834  ? ? -172.54 135.16  
109 1 PRO A 838  ? ? -21.39  -59.10  
110 1 GLU A 839  ? ? -160.28 93.53   
111 1 ALA A 841  ? ? -84.46  -94.27  
112 1 ASP A 855  ? ? 0.16    101.19  
113 1 VAL A 861  ? ? -73.90  -70.32  
114 1 GLU A 863  ? ? -136.70 -54.00  
115 1 LYS A 864  ? ? 35.50   103.67  
116 1 LYS A 867  ? ? -100.73 68.54   
117 1 PHE A 876  ? ? -85.22  -94.55  
118 1 ASN A 885  ? ? 46.21   72.64   
119 1 THR A 894  ? ? -67.34  -174.30 
120 1 LYS A 897  ? ? 65.00   60.45   
121 1 TYR A 906  ? ? -122.38 -156.11 
122 1 ASN A 908  ? ? -109.29 69.62   
123 1 ASP A 919  ? ? -105.35 -142.89 
124 1 LEU A 926  ? ? -113.54 -75.93  
125 1 MET A 927  ? ? -106.63 67.95   
126 1 ASN A 950  ? ? 72.00   114.05  
127 1 PRO A 951  ? ? -39.40  152.87  
128 1 ASN A 952  ? ? -170.57 98.31   
129 1 ASP A 961  ? ? -147.93 -159.53 
130 1 SER A 981  ? ? -101.75 71.72   
131 1 ALA A 983  ? ? -66.06  -176.04 
132 1 THR A 985  ? ? -53.86  78.96   
133 1 ASP A 986  ? ? 153.91  28.74   
134 1 GLU A 987  ? ? 177.44  -68.78  
135 1 PHE A 998  ? ? -177.98 125.40  
136 1 VAL A 1013 ? ? -85.04  -97.48  
137 1 MET A 1014 ? ? -2.11   143.15  
138 1 SER A 1027 ? ? -160.50 118.64  
139 1 ASP A 1053 ? ? -52.71  -75.10  
140 1 MET A 1054 ? ? -28.41  -47.11  
141 1 VAL A 1061 ? ? -66.22  -71.06  
142 1 VAL A 1065 ? ? -33.68  -72.88  
143 1 THR A 1078 ? ? -117.12 -146.38 
144 1 LYS A 1081 ? ? 172.44  161.70  
145 1 VAL A 1109 ? ? 73.19   54.47   
146 1 GLU A 1123 ? ? -62.11  -123.46 
147 1 ALA A 1124 ? ? 156.68  77.09   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    312 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   CYS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    313 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -145.14 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    THR 
_pdbx_validate_chiral.auth_seq_id     308 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#