data_3I7K
# 
_entry.id   3I7K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3I7K         
RCSB  RCSB054063   
WWPDB D_1000054063 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2B5M 'Crystal Structure of DDB1'                                           unspecified 
PDB 3I7H 'Crystal Structure of DDB1 in Complex with the H-Box Motif of HBX'    unspecified 
PDB 3I7L 'Crystal Structure of DDB1 in Complex with the H-Box Motif of DDB2'   unspecified 
PDB 3I7N 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDTC1'  unspecified 
PDB 3I7O 'Crystal Structure of DDB1 in Complex with the H-Box Motif of IQWD1'  unspecified 
PDB 3I7P 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I89 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR22'  unspecified 
PDB 3I8C 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR21A' unspecified 
PDB 3I8E 'Crystal Structure of DDB1 in Complex with the H-Box Motif of WDR42A' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3I7K 
_pdbx_database_status.recvd_initial_deposition_date   2009-07-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, T.'          1 
'Robert, E.I.'    2 
'Breugel, P.C.V.' 3 
'Strubin, M.'     4 
'Zheng, N.'       5 
# 
_citation.id                        primary 
_citation.title                     
'A promiscuous alpha-helical motif anchors viral hijackers and substrate receptors to the CUL4-DDB1 ubiquitin ligase machinery.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            17 
_citation.page_first                105 
_citation.page_last                 111 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19966799 
_citation.pdbx_database_id_DOI      10.1038/nsmb.1719 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Li, T.'            1 
primary 'Robert, E.I.'      2 
primary 'van Breugel, P.C.' 3 
primary 'Strubin, M.'       4 
primary 'Zheng, N.'         5 
# 
_cell.entry_id           3I7K 
_cell.length_a           64.081 
_cell.length_b           132.215 
_cell.length_c           184.001 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3I7K 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA damage-binding protein 1' 127399.766 1 ? ? ?                ? 
2 polymer syn 'X protein'                    1658.880   1 ? ? 'Residues 86-99' ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Damage-specific DNA-binding protein 1, UV-damaged DNA-binding factor, DDB p127 subunit, DNA damage-binding protein a, DDBa, UV-damaged DNA-binding protein 1, UV-DDB 1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE-binding factor, XPE-BF, HBV X-associated protein 1, XAP-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
;GSHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLL
FILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNI
RLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESI
TYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYL
DNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIH
EHASIDLPGIKGLWPLRSDPNRETYDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVR
LVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCA
IGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTV
LRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPL
YESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQH
TFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFN
GKLLASINSTVRLYEWTTEKDVRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAV
EILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMI
GLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDG
SGMKREATADDLIKVVEELTRIH
;
A ? 
2 'polypeptide(L)' no no NFVSWHANRQLGMP NFVSWHANRQLGMP B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    SER n 
1 3    HIS n 
1 4    MET n 
1 5    SER n 
1 6    TYR n 
1 7    ASN n 
1 8    TYR n 
1 9    VAL n 
1 10   VAL n 
1 11   THR n 
1 12   ALA n 
1 13   GLN n 
1 14   LYS n 
1 15   PRO n 
1 16   THR n 
1 17   ALA n 
1 18   VAL n 
1 19   ASN n 
1 20   GLY n 
1 21   CYS n 
1 22   VAL n 
1 23   THR n 
1 24   GLY n 
1 25   HIS n 
1 26   PHE n 
1 27   THR n 
1 28   SER n 
1 29   ALA n 
1 30   GLU n 
1 31   ASP n 
1 32   LEU n 
1 33   ASN n 
1 34   LEU n 
1 35   LEU n 
1 36   ILE n 
1 37   ALA n 
1 38   LYS n 
1 39   ASN n 
1 40   THR n 
1 41   ARG n 
1 42   LEU n 
1 43   GLU n 
1 44   ILE n 
1 45   TYR n 
1 46   VAL n 
1 47   VAL n 
1 48   THR n 
1 49   ALA n 
1 50   GLU n 
1 51   GLY n 
1 52   LEU n 
1 53   ARG n 
1 54   PRO n 
1 55   VAL n 
1 56   LYS n 
1 57   GLU n 
1 58   VAL n 
1 59   GLY n 
1 60   MET n 
1 61   TYR n 
1 62   GLY n 
1 63   LYS n 
1 64   ILE n 
1 65   ALA n 
1 66   VAL n 
1 67   MET n 
1 68   GLU n 
1 69   LEU n 
1 70   PHE n 
1 71   ARG n 
1 72   PRO n 
1 73   LYS n 
1 74   GLY n 
1 75   GLU n 
1 76   SER n 
1 77   LYS n 
1 78   ASP n 
1 79   LEU n 
1 80   LEU n 
1 81   PHE n 
1 82   ILE n 
1 83   LEU n 
1 84   THR n 
1 85   ALA n 
1 86   LYS n 
1 87   TYR n 
1 88   ASN n 
1 89   ALA n 
1 90   CYS n 
1 91   ILE n 
1 92   LEU n 
1 93   GLU n 
1 94   TYR n 
1 95   LYS n 
1 96   GLN n 
1 97   SER n 
1 98   GLY n 
1 99   GLU n 
1 100  SER n 
1 101  ILE n 
1 102  ASP n 
1 103  ILE n 
1 104  ILE n 
1 105  THR n 
1 106  ARG n 
1 107  ALA n 
1 108  HIS n 
1 109  GLY n 
1 110  ASN n 
1 111  VAL n 
1 112  GLN n 
1 113  ASP n 
1 114  ARG n 
1 115  ILE n 
1 116  GLY n 
1 117  ARG n 
1 118  PRO n 
1 119  SER n 
1 120  GLU n 
1 121  THR n 
1 122  GLY n 
1 123  ILE n 
1 124  ILE n 
1 125  GLY n 
1 126  ILE n 
1 127  ILE n 
1 128  ASP n 
1 129  PRO n 
1 130  GLU n 
1 131  CYS n 
1 132  ARG n 
1 133  MET n 
1 134  ILE n 
1 135  GLY n 
1 136  LEU n 
1 137  ARG n 
1 138  LEU n 
1 139  TYR n 
1 140  ASP n 
1 141  GLY n 
1 142  LEU n 
1 143  PHE n 
1 144  LYS n 
1 145  VAL n 
1 146  ILE n 
1 147  PRO n 
1 148  LEU n 
1 149  ASP n 
1 150  ARG n 
1 151  ASP n 
1 152  ASN n 
1 153  LYS n 
1 154  GLU n 
1 155  LEU n 
1 156  LYS n 
1 157  ALA n 
1 158  PHE n 
1 159  ASN n 
1 160  ILE n 
1 161  ARG n 
1 162  LEU n 
1 163  GLU n 
1 164  GLU n 
1 165  LEU n 
1 166  HIS n 
1 167  VAL n 
1 168  ILE n 
1 169  ASP n 
1 170  VAL n 
1 171  LYS n 
1 172  PHE n 
1 173  LEU n 
1 174  TYR n 
1 175  GLY n 
1 176  CYS n 
1 177  GLN n 
1 178  ALA n 
1 179  PRO n 
1 180  THR n 
1 181  ILE n 
1 182  CYS n 
1 183  PHE n 
1 184  VAL n 
1 185  TYR n 
1 186  GLN n 
1 187  ASP n 
1 188  PRO n 
1 189  GLN n 
1 190  GLY n 
1 191  ARG n 
1 192  HIS n 
1 193  VAL n 
1 194  LYS n 
1 195  THR n 
1 196  TYR n 
1 197  GLU n 
1 198  VAL n 
1 199  SER n 
1 200  LEU n 
1 201  ARG n 
1 202  GLU n 
1 203  LYS n 
1 204  GLU n 
1 205  PHE n 
1 206  ASN n 
1 207  LYS n 
1 208  GLY n 
1 209  PRO n 
1 210  TRP n 
1 211  LYS n 
1 212  GLN n 
1 213  GLU n 
1 214  ASN n 
1 215  VAL n 
1 216  GLU n 
1 217  ALA n 
1 218  GLU n 
1 219  ALA n 
1 220  SER n 
1 221  MET n 
1 222  VAL n 
1 223  ILE n 
1 224  ALA n 
1 225  VAL n 
1 226  PRO n 
1 227  GLU n 
1 228  PRO n 
1 229  PHE n 
1 230  GLY n 
1 231  GLY n 
1 232  ALA n 
1 233  ILE n 
1 234  ILE n 
1 235  ILE n 
1 236  GLY n 
1 237  GLN n 
1 238  GLU n 
1 239  SER n 
1 240  ILE n 
1 241  THR n 
1 242  TYR n 
1 243  HIS n 
1 244  ASN n 
1 245  GLY n 
1 246  ASP n 
1 247  LYS n 
1 248  TYR n 
1 249  LEU n 
1 250  ALA n 
1 251  ILE n 
1 252  ALA n 
1 253  PRO n 
1 254  PRO n 
1 255  ILE n 
1 256  ILE n 
1 257  LYS n 
1 258  GLN n 
1 259  SER n 
1 260  THR n 
1 261  ILE n 
1 262  VAL n 
1 263  CYS n 
1 264  HIS n 
1 265  ASN n 
1 266  ARG n 
1 267  VAL n 
1 268  ASP n 
1 269  PRO n 
1 270  ASN n 
1 271  GLY n 
1 272  SER n 
1 273  ARG n 
1 274  TYR n 
1 275  LEU n 
1 276  LEU n 
1 277  GLY n 
1 278  ASP n 
1 279  MET n 
1 280  GLU n 
1 281  GLY n 
1 282  ARG n 
1 283  LEU n 
1 284  PHE n 
1 285  MET n 
1 286  LEU n 
1 287  LEU n 
1 288  LEU n 
1 289  GLU n 
1 290  LYS n 
1 291  GLU n 
1 292  GLU n 
1 293  GLN n 
1 294  MET n 
1 295  ASP n 
1 296  GLY n 
1 297  THR n 
1 298  VAL n 
1 299  THR n 
1 300  LEU n 
1 301  LYS n 
1 302  ASP n 
1 303  LEU n 
1 304  ARG n 
1 305  VAL n 
1 306  GLU n 
1 307  LEU n 
1 308  LEU n 
1 309  GLY n 
1 310  GLU n 
1 311  THR n 
1 312  SER n 
1 313  ILE n 
1 314  ALA n 
1 315  GLU n 
1 316  CYS n 
1 317  LEU n 
1 318  THR n 
1 319  TYR n 
1 320  LEU n 
1 321  ASP n 
1 322  ASN n 
1 323  GLY n 
1 324  VAL n 
1 325  VAL n 
1 326  PHE n 
1 327  VAL n 
1 328  GLY n 
1 329  SER n 
1 330  ARG n 
1 331  LEU n 
1 332  GLY n 
1 333  ASP n 
1 334  SER n 
1 335  GLN n 
1 336  LEU n 
1 337  VAL n 
1 338  LYS n 
1 339  LEU n 
1 340  ASN n 
1 341  VAL n 
1 342  ASP n 
1 343  SER n 
1 344  ASN n 
1 345  GLU n 
1 346  GLN n 
1 347  GLY n 
1 348  SER n 
1 349  TYR n 
1 350  VAL n 
1 351  VAL n 
1 352  ALA n 
1 353  MET n 
1 354  GLU n 
1 355  THR n 
1 356  PHE n 
1 357  THR n 
1 358  ASN n 
1 359  LEU n 
1 360  GLY n 
1 361  PRO n 
1 362  ILE n 
1 363  VAL n 
1 364  ASP n 
1 365  MET n 
1 366  CYS n 
1 367  VAL n 
1 368  VAL n 
1 369  ASP n 
1 370  LEU n 
1 371  GLU n 
1 372  ARG n 
1 373  GLN n 
1 374  GLY n 
1 375  GLN n 
1 376  GLY n 
1 377  GLN n 
1 378  LEU n 
1 379  VAL n 
1 380  THR n 
1 381  CYS n 
1 382  SER n 
1 383  GLY n 
1 384  ALA n 
1 385  PHE n 
1 386  LYS n 
1 387  GLU n 
1 388  GLY n 
1 389  SER n 
1 390  LEU n 
1 391  ARG n 
1 392  ILE n 
1 393  ILE n 
1 394  ARG n 
1 395  ASN n 
1 396  GLY n 
1 397  ILE n 
1 398  GLY n 
1 399  ILE n 
1 400  HIS n 
1 401  GLU n 
1 402  HIS n 
1 403  ALA n 
1 404  SER n 
1 405  ILE n 
1 406  ASP n 
1 407  LEU n 
1 408  PRO n 
1 409  GLY n 
1 410  ILE n 
1 411  LYS n 
1 412  GLY n 
1 413  LEU n 
1 414  TRP n 
1 415  PRO n 
1 416  LEU n 
1 417  ARG n 
1 418  SER n 
1 419  ASP n 
1 420  PRO n 
1 421  ASN n 
1 422  ARG n 
1 423  GLU n 
1 424  THR n 
1 425  TYR n 
1 426  ASP n 
1 427  THR n 
1 428  LEU n 
1 429  VAL n 
1 430  LEU n 
1 431  SER n 
1 432  PHE n 
1 433  VAL n 
1 434  GLY n 
1 435  GLN n 
1 436  THR n 
1 437  ARG n 
1 438  VAL n 
1 439  LEU n 
1 440  MET n 
1 441  LEU n 
1 442  ASN n 
1 443  GLY n 
1 444  GLU n 
1 445  GLU n 
1 446  VAL n 
1 447  GLU n 
1 448  GLU n 
1 449  THR n 
1 450  GLU n 
1 451  LEU n 
1 452  MET n 
1 453  GLY n 
1 454  PHE n 
1 455  VAL n 
1 456  ASP n 
1 457  ASP n 
1 458  GLN n 
1 459  GLN n 
1 460  THR n 
1 461  PHE n 
1 462  PHE n 
1 463  CYS n 
1 464  GLY n 
1 465  ASN n 
1 466  VAL n 
1 467  ALA n 
1 468  HIS n 
1 469  GLN n 
1 470  GLN n 
1 471  LEU n 
1 472  ILE n 
1 473  GLN n 
1 474  ILE n 
1 475  THR n 
1 476  SER n 
1 477  ALA n 
1 478  SER n 
1 479  VAL n 
1 480  ARG n 
1 481  LEU n 
1 482  VAL n 
1 483  SER n 
1 484  GLN n 
1 485  GLU n 
1 486  PRO n 
1 487  LYS n 
1 488  ALA n 
1 489  LEU n 
1 490  VAL n 
1 491  SER n 
1 492  GLU n 
1 493  TRP n 
1 494  LYS n 
1 495  GLU n 
1 496  PRO n 
1 497  GLN n 
1 498  ALA n 
1 499  LYS n 
1 500  ASN n 
1 501  ILE n 
1 502  SER n 
1 503  VAL n 
1 504  ALA n 
1 505  SER n 
1 506  CYS n 
1 507  ASN n 
1 508  SER n 
1 509  SER n 
1 510  GLN n 
1 511  VAL n 
1 512  VAL n 
1 513  VAL n 
1 514  ALA n 
1 515  VAL n 
1 516  GLY n 
1 517  ARG n 
1 518  ALA n 
1 519  LEU n 
1 520  TYR n 
1 521  TYR n 
1 522  LEU n 
1 523  GLN n 
1 524  ILE n 
1 525  HIS n 
1 526  PRO n 
1 527  GLN n 
1 528  GLU n 
1 529  LEU n 
1 530  ARG n 
1 531  GLN n 
1 532  ILE n 
1 533  SER n 
1 534  HIS n 
1 535  THR n 
1 536  GLU n 
1 537  MET n 
1 538  GLU n 
1 539  HIS n 
1 540  GLU n 
1 541  VAL n 
1 542  ALA n 
1 543  CYS n 
1 544  LEU n 
1 545  ASP n 
1 546  ILE n 
1 547  THR n 
1 548  PRO n 
1 549  LEU n 
1 550  GLY n 
1 551  ASP n 
1 552  SER n 
1 553  ASN n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  LEU n 
1 559  CYS n 
1 560  ALA n 
1 561  ILE n 
1 562  GLY n 
1 563  LEU n 
1 564  TRP n 
1 565  THR n 
1 566  ASP n 
1 567  ILE n 
1 568  SER n 
1 569  ALA n 
1 570  ARG n 
1 571  ILE n 
1 572  LEU n 
1 573  LYS n 
1 574  LEU n 
1 575  PRO n 
1 576  SER n 
1 577  PHE n 
1 578  GLU n 
1 579  LEU n 
1 580  LEU n 
1 581  HIS n 
1 582  LYS n 
1 583  GLU n 
1 584  MET n 
1 585  LEU n 
1 586  GLY n 
1 587  GLY n 
1 588  GLU n 
1 589  ILE n 
1 590  ILE n 
1 591  PRO n 
1 592  ARG n 
1 593  SER n 
1 594  ILE n 
1 595  LEU n 
1 596  MET n 
1 597  THR n 
1 598  THR n 
1 599  PHE n 
1 600  GLU n 
1 601  SER n 
1 602  SER n 
1 603  HIS n 
1 604  TYR n 
1 605  LEU n 
1 606  LEU n 
1 607  CYS n 
1 608  ALA n 
1 609  LEU n 
1 610  GLY n 
1 611  ASP n 
1 612  GLY n 
1 613  ALA n 
1 614  LEU n 
1 615  PHE n 
1 616  TYR n 
1 617  PHE n 
1 618  GLY n 
1 619  LEU n 
1 620  ASN n 
1 621  ILE n 
1 622  GLU n 
1 623  THR n 
1 624  GLY n 
1 625  LEU n 
1 626  LEU n 
1 627  SER n 
1 628  ASP n 
1 629  ARG n 
1 630  LYS n 
1 631  LYS n 
1 632  VAL n 
1 633  THR n 
1 634  LEU n 
1 635  GLY n 
1 636  THR n 
1 637  GLN n 
1 638  PRO n 
1 639  THR n 
1 640  VAL n 
1 641  LEU n 
1 642  ARG n 
1 643  THR n 
1 644  PHE n 
1 645  ARG n 
1 646  SER n 
1 647  LEU n 
1 648  SER n 
1 649  THR n 
1 650  THR n 
1 651  ASN n 
1 652  VAL n 
1 653  PHE n 
1 654  ALA n 
1 655  CYS n 
1 656  SER n 
1 657  ASP n 
1 658  ARG n 
1 659  PRO n 
1 660  THR n 
1 661  VAL n 
1 662  ILE n 
1 663  TYR n 
1 664  SER n 
1 665  SER n 
1 666  ASN n 
1 667  HIS n 
1 668  LYS n 
1 669  LEU n 
1 670  VAL n 
1 671  PHE n 
1 672  SER n 
1 673  ASN n 
1 674  VAL n 
1 675  ASN n 
1 676  LEU n 
1 677  LYS n 
1 678  GLU n 
1 679  VAL n 
1 680  ASN n 
1 681  TYR n 
1 682  MET n 
1 683  CYS n 
1 684  PRO n 
1 685  LEU n 
1 686  ASN n 
1 687  SER n 
1 688  ASP n 
1 689  GLY n 
1 690  TYR n 
1 691  PRO n 
1 692  ASP n 
1 693  SER n 
1 694  LEU n 
1 695  ALA n 
1 696  LEU n 
1 697  ALA n 
1 698  ASN n 
1 699  ASN n 
1 700  SER n 
1 701  THR n 
1 702  LEU n 
1 703  THR n 
1 704  ILE n 
1 705  GLY n 
1 706  THR n 
1 707  ILE n 
1 708  ASP n 
1 709  GLU n 
1 710  ILE n 
1 711  GLN n 
1 712  LYS n 
1 713  LEU n 
1 714  HIS n 
1 715  ILE n 
1 716  ARG n 
1 717  THR n 
1 718  VAL n 
1 719  PRO n 
1 720  LEU n 
1 721  TYR n 
1 722  GLU n 
1 723  SER n 
1 724  PRO n 
1 725  ARG n 
1 726  LYS n 
1 727  ILE n 
1 728  CYS n 
1 729  TYR n 
1 730  GLN n 
1 731  GLU n 
1 732  VAL n 
1 733  SER n 
1 734  GLN n 
1 735  CYS n 
1 736  PHE n 
1 737  GLY n 
1 738  VAL n 
1 739  LEU n 
1 740  SER n 
1 741  SER n 
1 742  ARG n 
1 743  ILE n 
1 744  GLU n 
1 745  VAL n 
1 746  GLN n 
1 747  ASP n 
1 748  THR n 
1 749  SER n 
1 750  GLY n 
1 751  GLY n 
1 752  THR n 
1 753  THR n 
1 754  ALA n 
1 755  LEU n 
1 756  ARG n 
1 757  PRO n 
1 758  SER n 
1 759  ALA n 
1 760  SER n 
1 761  THR n 
1 762  GLN n 
1 763  ALA n 
1 764  LEU n 
1 765  SER n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  SER n 
1 770  SER n 
1 771  SER n 
1 772  LYS n 
1 773  LEU n 
1 774  PHE n 
1 775  SER n 
1 776  SER n 
1 777  SER n 
1 778  THR n 
1 779  ALA n 
1 780  PRO n 
1 781  HIS n 
1 782  GLU n 
1 783  THR n 
1 784  SER n 
1 785  PHE n 
1 786  GLY n 
1 787  GLU n 
1 788  GLU n 
1 789  VAL n 
1 790  GLU n 
1 791  VAL n 
1 792  HIS n 
1 793  ASN n 
1 794  LEU n 
1 795  LEU n 
1 796  ILE n 
1 797  ILE n 
1 798  ASP n 
1 799  GLN n 
1 800  HIS n 
1 801  THR n 
1 802  PHE n 
1 803  GLU n 
1 804  VAL n 
1 805  LEU n 
1 806  HIS n 
1 807  ALA n 
1 808  HIS n 
1 809  GLN n 
1 810  PHE n 
1 811  LEU n 
1 812  GLN n 
1 813  ASN n 
1 814  GLU n 
1 815  TYR n 
1 816  ALA n 
1 817  LEU n 
1 818  SER n 
1 819  LEU n 
1 820  VAL n 
1 821  SER n 
1 822  CYS n 
1 823  LYS n 
1 824  LEU n 
1 825  GLY n 
1 826  LYS n 
1 827  ASP n 
1 828  PRO n 
1 829  ASN n 
1 830  THR n 
1 831  TYR n 
1 832  PHE n 
1 833  ILE n 
1 834  VAL n 
1 835  GLY n 
1 836  THR n 
1 837  ALA n 
1 838  MET n 
1 839  VAL n 
1 840  TYR n 
1 841  PRO n 
1 842  GLU n 
1 843  GLU n 
1 844  ALA n 
1 845  GLU n 
1 846  PRO n 
1 847  LYS n 
1 848  GLN n 
1 849  GLY n 
1 850  ARG n 
1 851  ILE n 
1 852  VAL n 
1 853  VAL n 
1 854  PHE n 
1 855  GLN n 
1 856  TYR n 
1 857  SER n 
1 858  ASP n 
1 859  GLY n 
1 860  LYS n 
1 861  LEU n 
1 862  GLN n 
1 863  THR n 
1 864  VAL n 
1 865  ALA n 
1 866  GLU n 
1 867  LYS n 
1 868  GLU n 
1 869  VAL n 
1 870  LYS n 
1 871  GLY n 
1 872  ALA n 
1 873  VAL n 
1 874  TYR n 
1 875  SER n 
1 876  MET n 
1 877  VAL n 
1 878  GLU n 
1 879  PHE n 
1 880  ASN n 
1 881  GLY n 
1 882  LYS n 
1 883  LEU n 
1 884  LEU n 
1 885  ALA n 
1 886  SER n 
1 887  ILE n 
1 888  ASN n 
1 889  SER n 
1 890  THR n 
1 891  VAL n 
1 892  ARG n 
1 893  LEU n 
1 894  TYR n 
1 895  GLU n 
1 896  TRP n 
1 897  THR n 
1 898  THR n 
1 899  GLU n 
1 900  LYS n 
1 901  ASP n 
1 902  VAL n 
1 903  ARG n 
1 904  THR n 
1 905  GLU n 
1 906  CYS n 
1 907  ASN n 
1 908  HIS n 
1 909  TYR n 
1 910  ASN n 
1 911  ASN n 
1 912  ILE n 
1 913  MET n 
1 914  ALA n 
1 915  LEU n 
1 916  TYR n 
1 917  LEU n 
1 918  LYS n 
1 919  THR n 
1 920  LYS n 
1 921  GLY n 
1 922  ASP n 
1 923  PHE n 
1 924  ILE n 
1 925  LEU n 
1 926  VAL n 
1 927  GLY n 
1 928  ASP n 
1 929  LEU n 
1 930  MET n 
1 931  ARG n 
1 932  SER n 
1 933  VAL n 
1 934  LEU n 
1 935  LEU n 
1 936  LEU n 
1 937  ALA n 
1 938  TYR n 
1 939  LYS n 
1 940  PRO n 
1 941  MET n 
1 942  GLU n 
1 943  GLY n 
1 944  ASN n 
1 945  PHE n 
1 946  GLU n 
1 947  GLU n 
1 948  ILE n 
1 949  ALA n 
1 950  ARG n 
1 951  ASP n 
1 952  PHE n 
1 953  ASN n 
1 954  PRO n 
1 955  ASN n 
1 956  TRP n 
1 957  MET n 
1 958  SER n 
1 959  ALA n 
1 960  VAL n 
1 961  GLU n 
1 962  ILE n 
1 963  LEU n 
1 964  ASP n 
1 965  ASP n 
1 966  ASP n 
1 967  ASN n 
1 968  PHE n 
1 969  LEU n 
1 970  GLY n 
1 971  ALA n 
1 972  GLU n 
1 973  ASN n 
1 974  ALA n 
1 975  PHE n 
1 976  ASN n 
1 977  LEU n 
1 978  PHE n 
1 979  VAL n 
1 980  CYS n 
1 981  GLN n 
1 982  LYS n 
1 983  ASP n 
1 984  SER n 
1 985  ALA n 
1 986  ALA n 
1 987  THR n 
1 988  THR n 
1 989  ASP n 
1 990  GLU n 
1 991  GLU n 
1 992  ARG n 
1 993  GLN n 
1 994  HIS n 
1 995  LEU n 
1 996  GLN n 
1 997  GLU n 
1 998  VAL n 
1 999  GLY n 
1 1000 LEU n 
1 1001 PHE n 
1 1002 HIS n 
1 1003 LEU n 
1 1004 GLY n 
1 1005 GLU n 
1 1006 PHE n 
1 1007 VAL n 
1 1008 ASN n 
1 1009 VAL n 
1 1010 PHE n 
1 1011 CYS n 
1 1012 HIS n 
1 1013 GLY n 
1 1014 SER n 
1 1015 LEU n 
1 1016 VAL n 
1 1017 MET n 
1 1018 GLN n 
1 1019 ASN n 
1 1020 LEU n 
1 1021 GLY n 
1 1022 GLU n 
1 1023 THR n 
1 1024 SER n 
1 1025 THR n 
1 1026 PRO n 
1 1027 THR n 
1 1028 GLN n 
1 1029 GLY n 
1 1030 SER n 
1 1031 VAL n 
1 1032 LEU n 
1 1033 PHE n 
1 1034 GLY n 
1 1035 THR n 
1 1036 VAL n 
1 1037 ASN n 
1 1038 GLY n 
1 1039 MET n 
1 1040 ILE n 
1 1041 GLY n 
1 1042 LEU n 
1 1043 VAL n 
1 1044 THR n 
1 1045 SER n 
1 1046 LEU n 
1 1047 SER n 
1 1048 GLU n 
1 1049 SER n 
1 1050 TRP n 
1 1051 TYR n 
1 1052 ASN n 
1 1053 LEU n 
1 1054 LEU n 
1 1055 LEU n 
1 1056 ASP n 
1 1057 MET n 
1 1058 GLN n 
1 1059 ASN n 
1 1060 ARG n 
1 1061 LEU n 
1 1062 ASN n 
1 1063 LYS n 
1 1064 VAL n 
1 1065 ILE n 
1 1066 LYS n 
1 1067 SER n 
1 1068 VAL n 
1 1069 GLY n 
1 1070 LYS n 
1 1071 ILE n 
1 1072 GLU n 
1 1073 HIS n 
1 1074 SER n 
1 1075 PHE n 
1 1076 TRP n 
1 1077 ARG n 
1 1078 SER n 
1 1079 PHE n 
1 1080 HIS n 
1 1081 THR n 
1 1082 GLU n 
1 1083 ARG n 
1 1084 LYS n 
1 1085 THR n 
1 1086 GLU n 
1 1087 PRO n 
1 1088 ALA n 
1 1089 THR n 
1 1090 GLY n 
1 1091 PHE n 
1 1092 ILE n 
1 1093 ASP n 
1 1094 GLY n 
1 1095 ASP n 
1 1096 LEU n 
1 1097 ILE n 
1 1098 GLU n 
1 1099 SER n 
1 1100 PHE n 
1 1101 LEU n 
1 1102 ASP n 
1 1103 ILE n 
1 1104 SER n 
1 1105 ARG n 
1 1106 PRO n 
1 1107 LYS n 
1 1108 MET n 
1 1109 GLN n 
1 1110 GLU n 
1 1111 VAL n 
1 1112 VAL n 
1 1113 ALA n 
1 1114 ASN n 
1 1115 LEU n 
1 1116 GLN n 
1 1117 TYR n 
1 1118 ASP n 
1 1119 ASP n 
1 1120 GLY n 
1 1121 SER n 
1 1122 GLY n 
1 1123 MET n 
1 1124 LYS n 
1 1125 ARG n 
1 1126 GLU n 
1 1127 ALA n 
1 1128 THR n 
1 1129 ALA n 
1 1130 ASP n 
1 1131 ASP n 
1 1132 LEU n 
1 1133 ILE n 
1 1134 LYS n 
1 1135 VAL n 
1 1136 VAL n 
1 1137 GLU n 
1 1138 GLU n 
1 1139 LEU n 
1 1140 THR n 
1 1141 ARG n 
1 1142 ILE n 
1 1143 HIS n 
2 1    ASN n 
2 2    PHE n 
2 3    VAL n 
2 4    SER n 
2 5    TRP n 
2 6    HIS n 
2 7    ALA n 
2 8    ASN n 
2 9    ARG n 
2 10   GLN n 
2 11   LEU n 
2 12   GLY n 
2 13   MET n 
2 14   PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DDB1, XAP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Woodchuck hepatitis B virus' 
_pdbx_entity_src_syn.organism_common_name   WHV 
_pdbx_entity_src_syn.ncbi_taxonomy_id       10433 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DDB1_HUMAN   Q16531 1 
;MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFIL
TAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLE
ELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNG
VVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA
SIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRT
FRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFE
VLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKL
LASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLV
TSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM
KREATADDLIKVVEELTRIH
;
1  ? 
2 UNP Q89246_9HEPA Q89246 2 NFVSWHANRQLGMP 86 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3I7K A 4 ? 1143 ? Q16531 1  ? 1140 ? 1  1140 
2 2 3I7K B 1 ? 14   ? Q89246 86 ? 99   ? 86 99   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3I7K GLY A 1   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -2  1 
1 3I7K SER A 2   ? UNP Q16531 ?   ?   'EXPRESSION TAG' -1  2 
1 3I7K HIS A 3   ? UNP Q16531 ?   ?   'EXPRESSION TAG' 0   3 
1 3I7K TYR A 425 ? UNP Q16531 ASP 422 'SEE REMARK 999' 422 4 
1 3I7K ASP A 901 ? UNP Q16531 GLU 898 'SEE REMARK 999' 898 5 
1 3I7K VAL A 902 ? UNP Q16531 LEU 899 'SEE REMARK 999' 899 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3I7K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.02 
_exptl_crystal.density_percent_sol   59.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'16% PEG 4000, 0.2M SODIUM CHLORIDE, 0.1M MES, 0.005 M DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           173 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-05-28 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0   1.0 
2 1.005 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0,1.005 
# 
_reflns.entry_id                     3I7K 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             46.03 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   35137 
_reflns.number_all                   38728 
_reflns.percent_possible_obs         90.7 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   94.6 
_reflns_shell.Rmerge_I_obs           0.426 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2285 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3I7K 
_refine.ls_number_reflns_obs                     35137 
_refine.ls_number_reflns_all                     38728 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.03 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    94.01 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_all                          0.252 
_refine.ls_R_factor_R_work                       0.230 
_refine.ls_R_factor_R_free                       0.271 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1851 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.916 
_refine.correlation_coeff_Fo_to_Fc_free          0.888 
_refine.B_iso_mean                               71.954 
_refine.aniso_B[1][1]                            0.27 
_refine.aniso_B[2][2]                            -1.36 
_refine.aniso_B[3][3]                            1.09 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2B5M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.679 
_refine.pdbx_overall_ESU_R_Free                  0.396 
_refine.overall_SU_ML                            0.289 
_refine.overall_SU_B                             14.606 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8843 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8843 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        46.03 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.013  0.022  ? 9007  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.598  1.964  ? 12200 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.104  5.000  ? 1123  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   39.387 24.732 ? 410   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   20.377 15.000 ? 1589  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   21.506 15.000 ? 49    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.108  0.200  ? 1402  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.005  0.020  ? 6733  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.251  0.200  ? 4180  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.320  0.200  ? 5969  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.175  0.200  ? 310   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.182  0.200  ? 33    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.186  0.200  ? 5     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.872 
_refine_ls_shell.number_reflns_R_work             2285 
_refine_ls_shell.R_factor_R_work                  0.339 
_refine_ls_shell.percent_reflns_obs               85.23 
_refine_ls_shell.R_factor_R_free                  0.445 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2285 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3I7K 
_struct.title                     'Crystal Structure of DDB1 in Complex with the H-Box Motif of WHX' 
_struct.pdbx_descriptor           'DNA damage-binding protein 1, X protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3I7K 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING/VIRAL PROTEIN' 
_struct_keywords.text            
;DDB1, HBV, X protein, H-Box Motif, Cytoplasm, DNA damage, DNA repair, DNA-binding, Host-virus interaction, Nucleus, Phosphoprotein, Polymorphism, Ubl conjugation, Ubl conjugation pathway, Activator, Apoptosis, Mitochondrion, Transcription, Transcription regulation, PROTEIN BINDING-VIRAL PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 253  ? GLN A 258  ? PRO A 250  GLN A 255  5 ? 6  
HELX_P HELX_P2  2  ASN A 344  ? SER A 348  ? ASN A 341  SER A 345  5 ? 5  
HELX_P HELX_P3  3  ALA A 384  ? GLU A 387  ? ALA A 381  GLU A 384  5 ? 4  
HELX_P HELX_P4  4  GLU A 731  ? SER A 733  ? GLU A 728  SER A 730  5 ? 3  
HELX_P HELX_P5  5  SER A 1047 ? ILE A 1065 ? SER A 1044 ILE A 1062 1 ? 19 
HELX_P HELX_P6  6  GLU A 1072 ? ARG A 1077 ? GLU A 1069 ARG A 1074 1 ? 6  
HELX_P HELX_P7  7  ASP A 1093 ? SER A 1099 ? ASP A 1090 SER A 1096 1 ? 7  
HELX_P HELX_P8  8  SER A 1104 ? VAL A 1112 ? SER A 1101 VAL A 1109 1 ? 9  
HELX_P HELX_P9  9  THR A 1128 ? ARG A 1141 ? THR A 1125 ARG A 1138 1 ? 14 
HELX_P HELX_P10 10 ASN B 1    ? GLY B 12   ? ASN B 86   GLY B 97   1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            21 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            316 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             18 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             313 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.072 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 4 ? 
H ? 4 ? 
I ? 4 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
M ? 3 ? 
N ? 4 ? 
O ? 3 ? 
P ? 4 ? 
Q ? 5 ? 
R ? 4 ? 
S ? 4 ? 
T ? 4 ? 
U ? 4 ? 
V ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? parallel      
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 7    ? THR A 11   ? ASN A 4    THR A 8    
A 2 GLY A 1041 ? SER A 1045 ? GLY A 1038 SER A 1042 
A 3 GLN A 1028 ? THR A 1035 ? GLN A 1025 THR A 1032 
A 4 VAL A 1007 ? HIS A 1012 ? VAL A 1004 HIS A 1009 
B 1 GLY A 20   ? GLY A 24   ? GLY A 17   GLY A 21   
B 2 ASN A 33   ? ALA A 37   ? ASN A 30   ALA A 34   
B 3 ARG A 41   ? VAL A 47   ? ARG A 38   VAL A 44   
B 4 LEU A 52   ? GLY A 59   ? LEU A 49   GLY A 56   
C 1 ILE A 64   ? PHE A 70   ? ILE A 61   PHE A 67   
C 2 LEU A 79   ? THR A 84   ? LEU A 76   THR A 81   
C 3 ASN A 88   ? LYS A 95   ? ASN A 85   LYS A 92   
C 4 ASP A 102  ? ASN A 110  ? ASP A 99   ASN A 107  
D 1 ILE A 124  ? ILE A 127  ? ILE A 121  ILE A 124  
D 2 MET A 133  ? ARG A 137  ? MET A 130  ARG A 134  
D 3 LEU A 142  ? PRO A 147  ? LEU A 139  PRO A 144  
D 4 PHE A 158  ? ARG A 161  ? PHE A 155  ARG A 158  
E 1 VAL A 167  ? PHE A 172  ? VAL A 164  PHE A 169  
E 2 THR A 180  ? ASP A 187  ? THR A 177  ASP A 184  
E 3 GLY A 190  ? GLU A 197  ? GLY A 187  GLU A 194  
E 4 GLU A 213  ? VAL A 215  ? GLU A 210  VAL A 212  
F 1 MET A 221  ? ALA A 224  ? MET A 218  ALA A 221  
F 2 ALA A 232  ? ILE A 235  ? ALA A 229  ILE A 232  
F 3 ILE A 240  ? ASN A 244  ? ILE A 237  ASN A 241  
F 4 LYS A 247  ? ILE A 251  ? LYS A 244  ILE A 248  
G 1 ILE A 261  ? ASP A 268  ? ILE A 258  ASP A 265  
G 2 ARG A 273  ? ASP A 278  ? ARG A 270  ASP A 275  
G 3 ARG A 282  ? GLU A 292  ? ARG A 279  GLU A 289  
G 4 VAL A 298  ? GLU A 310  ? VAL A 295  GLU A 307  
H 1 ALA A 314  ? TYR A 319  ? ALA A 311  TYR A 316  
H 2 VAL A 324  ? SER A 329  ? VAL A 321  SER A 326  
H 3 SER A 334  ? LEU A 339  ? SER A 331  LEU A 336  
H 4 VAL A 350  ? PHE A 356  ? VAL A 347  PHE A 353  
I 1 ILE A 362  ? VAL A 368  ? ILE A 359  VAL A 365  
I 2 GLN A 377  ? SER A 382  ? GLN A 374  SER A 379  
I 3 SER A 389  ? ASN A 395  ? SER A 386  ASN A 392  
I 4 LEU A 713  ? PRO A 719  ? LEU A 710  PRO A 716  
J 1 ILE A 399  ? ASP A 406  ? ILE A 396  ASP A 403  
J 2 THR A 701  ? ILE A 707  ? THR A 698  ILE A 704  
J 3 LEU A 694  ? ASN A 698  ? LEU A 691  ASN A 695  
J 4 TYR A 681  ? PRO A 684  ? TYR A 678  PRO A 681  
K 1 ILE A 410  ? LEU A 416  ? ILE A 407  LEU A 413  
K 2 THR A 427  ? PHE A 432  ? THR A 424  PHE A 429  
K 3 THR A 436  ? LEU A 441  ? THR A 433  LEU A 438  
K 4 VAL A 446  ? GLU A 447  ? VAL A 443  GLU A 444  
L 1 THR A 460  ? CYS A 463  ? THR A 457  CYS A 460  
L 2 GLN A 470  ? THR A 475  ? GLN A 467  THR A 472  
L 3 VAL A 479  ? SER A 483  ? VAL A 476  SER A 480  
L 4 LEU A 489  ? TRP A 493  ? LEU A 486  TRP A 490  
M 1 GLN A 510  ? VAL A 515  ? GLN A 507  VAL A 512  
M 2 ALA A 518  ? GLN A 523  ? ALA A 515  GLN A 520  
M 3 SER A 533  ? GLU A 536  ? SER A 530  GLU A 533  
N 1 VAL A 541  ? ASP A 545  ? VAL A 538  ASP A 542  
N 2 CYS A 559  ? LEU A 563  ? CYS A 556  LEU A 560  
N 3 SER A 568  ? LEU A 572  ? SER A 565  LEU A 569  
N 4 LEU A 579  ? MET A 584  ? LEU A 576  MET A 581  
O 1 PRO A 591  ? THR A 598  ? PRO A 588  THR A 595  
O 2 HIS A 603  ? LEU A 609  ? HIS A 600  LEU A 606  
O 3 LEU A 614  ? PHE A 615  ? LEU A 611  PHE A 612  
P 1 VAL A 640  ? THR A 643  ? VAL A 637  THR A 640  
P 2 VAL A 652  ? CYS A 655  ? VAL A 649  CYS A 652  
P 3 THR A 660  ? ILE A 662  ? THR A 657  ILE A 659  
P 4 PHE A 671  ? ASN A 673  ? PHE A 668  ASN A 670  
Q 1 SER A 723  ? GLN A 730  ? SER A 720  GLN A 727  
Q 2 CYS A 735  ? VAL A 745  ? CYS A 732  VAL A 742  
Q 3 GLU A 788  ? ASP A 798  ? GLU A 785  ASP A 795  
Q 4 VAL A 804  ? GLN A 809  ? VAL A 801  GLN A 806  
Q 5 SER A 765  ? VAL A 768  ? SER A 762  VAL A 765  
R 1 GLU A 814  ? LYS A 823  ? GLU A 811  LYS A 820  
R 2 THR A 830  ? MET A 838  ? THR A 827  MET A 835  
R 3 GLY A 849  ? TYR A 856  ? GLY A 846  TYR A 853  
R 4 LEU A 861  ? VAL A 869  ? LEU A 858  VAL A 866  
S 1 VAL A 873  ? GLU A 878  ? VAL A 870  GLU A 875  
S 2 LEU A 883  ? ILE A 887  ? LEU A 880  ILE A 884  
S 3 THR A 890  ? TRP A 896  ? THR A 887  TRP A 893  
S 4 VAL A 902  ? ARG A 903  ? VAL A 899  ARG A 900  
T 1 LYS A 918  ? LYS A 920  ? LYS A 915  LYS A 917  
T 2 ILE A 924  ? ASP A 928  ? ILE A 921  ASP A 925  
T 3 VAL A 933  ? LYS A 939  ? VAL A 930  LYS A 936  
T 4 ASN A 944  ? ARG A 950  ? ASN A 941  ARG A 947  
U 1 MET A 957  ? ILE A 962  ? MET A 954  ILE A 959  
U 2 ASN A 967  ? GLU A 972  ? ASN A 964  GLU A 969  
U 3 ASN A 976  ? LYS A 982  ? ASN A 973  LYS A 979  
U 4 LEU A 995  ? HIS A 1002 ? LEU A 992  HIS A 999  
V 1 PHE A 1079 ? HIS A 1080 ? PHE A 1076 HIS A 1077 
V 2 THR A 1085 ? GLU A 1086 ? THR A 1082 GLU A 1083 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 8    ? N TYR A 5    O THR A 1044 ? O THR A 1041 
A 2 3 O VAL A 1043 ? O VAL A 1040 N VAL A 1031 ? N VAL A 1028 
A 3 4 O GLY A 1034 ? O GLY A 1031 N ASN A 1008 ? N ASN A 1005 
B 1 2 N GLY A 24   ? N GLY A 21   O ASN A 33   ? O ASN A 30   
B 2 3 N LEU A 34   ? N LEU A 31   O TYR A 45   ? O TYR A 42   
B 3 4 N VAL A 46   ? N VAL A 43   O ARG A 53   ? O ARG A 50   
C 1 2 N PHE A 70   ? N PHE A 67   O LEU A 79   ? O LEU A 76   
C 2 3 N THR A 84   ? N THR A 81   O ASN A 88   ? O ASN A 85   
C 3 4 N LYS A 95   ? N LYS A 92   O ASP A 102  ? O ASP A 99   
D 1 2 N ILE A 124  ? N ILE A 121  O ARG A 137  ? O ARG A 134  
D 2 3 N ILE A 134  ? N ILE A 131  O ILE A 146  ? O ILE A 143  
D 3 4 N VAL A 145  ? N VAL A 142  O PHE A 158  ? O PHE A 155  
E 1 2 N ILE A 168  ? N ILE A 165  O VAL A 184  ? O VAL A 181  
E 2 3 N ILE A 181  ? N ILE A 178  O TYR A 196  ? O TYR A 193  
E 3 4 N VAL A 193  ? N VAL A 190  O GLU A 213  ? O GLU A 210  
F 1 2 N ILE A 223  ? N ILE A 220  O ILE A 233  ? O ILE A 230  
F 2 3 N ILE A 234  ? N ILE A 231  O THR A 241  ? O THR A 238  
F 3 4 N ILE A 240  ? N ILE A 237  O ILE A 251  ? O ILE A 248  
G 1 2 N CYS A 263  ? N CYS A 260  O GLY A 277  ? O GLY A 274  
G 2 3 N TYR A 274  ? N TYR A 271  O LEU A 286  ? O LEU A 283  
G 3 4 N GLU A 291  ? N GLU A 288  O THR A 299  ? O THR A 296  
H 1 2 N GLU A 315  ? N GLU A 312  O GLY A 328  ? O GLY A 325  
H 2 3 N VAL A 327  ? N VAL A 324  O GLN A 335  ? O GLN A 332  
H 3 4 N SER A 334  ? N SER A 331  O PHE A 356  ? O PHE A 353  
I 1 2 N ASP A 364  ? N ASP A 361  O CYS A 381  ? O CYS A 378  
I 2 3 N LEU A 378  ? N LEU A 375  O ILE A 393  ? O ILE A 390  
I 3 4 N ARG A 394  ? N ARG A 391  O HIS A 714  ? O HIS A 711  
J 1 2 N ILE A 405  ? N ILE A 402  O LEU A 702  ? O LEU A 699  
J 2 3 O THR A 703  ? O THR A 700  N LEU A 696  ? N LEU A 693  
J 3 4 O ALA A 695  ? O ALA A 692  N CYS A 683  ? N CYS A 680  
K 1 2 N LEU A 416  ? N LEU A 413  O THR A 427  ? O THR A 424  
K 2 3 N LEU A 428  ? N LEU A 425  O LEU A 439  ? O LEU A 436  
K 3 4 N MET A 440  ? N MET A 437  O GLU A 447  ? O GLU A 444  
L 1 2 N PHE A 461  ? N PHE A 458  O ILE A 474  ? O ILE A 471  
L 2 3 N GLN A 473  ? N GLN A 470  O ARG A 480  ? O ARG A 477  
L 3 4 N VAL A 479  ? N VAL A 476  O TRP A 493  ? O TRP A 490  
M 1 2 N VAL A 515  ? N VAL A 512  O ALA A 518  ? O ALA A 515  
M 2 3 N LEU A 519  ? N LEU A 516  O THR A 535  ? O THR A 532  
N 1 2 N ALA A 542  ? N ALA A 539  O GLY A 562  ? O GLY A 559  
N 2 3 N CYS A 559  ? N CYS A 556  O LEU A 572  ? O LEU A 569  
N 3 4 N ALA A 569  ? N ALA A 566  O GLU A 583  ? O GLU A 580  
O 1 2 N THR A 597  ? N THR A 594  O TYR A 604  ? O TYR A 601  
O 2 3 N CYS A 607  ? N CYS A 604  O PHE A 615  ? O PHE A 612  
P 1 2 N VAL A 640  ? N VAL A 637  O CYS A 655  ? O CYS A 652  
P 2 3 N VAL A 652  ? N VAL A 649  O ILE A 662  ? O ILE A 659  
P 3 4 N VAL A 661  ? N VAL A 658  O SER A 672  ? O SER A 669  
Q 1 2 N GLN A 730  ? N GLN A 727  O CYS A 735  ? O CYS A 732  
Q 2 3 N VAL A 738  ? N VAL A 735  O LEU A 795  ? O LEU A 792  
Q 3 4 N LEU A 794  ? N LEU A 791  O HIS A 808  ? O HIS A 805  
Q 4 5 O GLN A 809  ? O GLN A 806  N SER A 767  ? N SER A 764  
R 1 2 N TYR A 815  ? N TYR A 812  O ALA A 837  ? O ALA A 834  
R 2 3 N THR A 836  ? N THR A 833  O ARG A 850  ? O ARG A 847  
R 3 4 N GLN A 855  ? N GLN A 852  O GLN A 862  ? O GLN A 859  
S 1 2 N SER A 875  ? N SER A 872  O SER A 886  ? O SER A 883  
S 2 3 N ALA A 885  ? N ALA A 882  O ARG A 892  ? O ARG A 889  
S 3 4 N GLU A 895  ? N GLU A 892  O ARG A 903  ? O ARG A 900  
T 1 2 N LYS A 918  ? N LYS A 915  O VAL A 926  ? O VAL A 923  
T 2 3 N LEU A 925  ? N LEU A 922  O LEU A 936  ? O LEU A 933  
T 3 4 N ALA A 937  ? N ALA A 934  O GLU A 946  ? O GLU A 943  
U 1 2 N GLU A 961  ? N GLU A 958  O LEU A 969  ? O LEU A 966  
U 2 3 N PHE A 968  ? N PHE A 965  O CYS A 980  ? O CYS A 977  
U 3 4 N GLN A 981  ? N GLN A 978  O GLN A 996  ? O GLN A 993  
V 1 2 N PHE A 1079 ? N PHE A 1076 O GLU A 1086 ? O GLU A 1083 
# 
_database_PDB_matrix.entry_id          3I7K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3I7K 
_atom_sites.fract_transf_matrix[1][1]   0.015605 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007563 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005435 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 4    ? 22.601  24.591 8.977   1.00 127.38 ? 1    MET A N   1 
ATOM 2    C CA  . MET A 1 4    ? 21.354  25.156 8.385   1.00 127.38 ? 1    MET A CA  1 
ATOM 3    C C   . MET A 1 4    ? 20.698  26.128 9.370   1.00 127.38 ? 1    MET A C   1 
ATOM 4    O O   . MET A 1 4    ? 19.530  25.940 9.759   1.00 127.38 ? 1    MET A O   1 
ATOM 5    C CB  . MET A 1 4    ? 20.369  24.036 8.035   1.00 119.55 ? 1    MET A CB  1 
ATOM 6    C CG  . MET A 1 4    ? 20.969  22.837 7.332   1.00 119.55 ? 1    MET A CG  1 
ATOM 7    S SD  . MET A 1 4    ? 20.220  21.302 7.922   1.00 119.55 ? 1    MET A SD  1 
ATOM 8    C CE  . MET A 1 4    ? 21.326  20.823 9.253   1.00 119.55 ? 1    MET A CE  1 
ATOM 9    N N   . SER A 1 5    ? 21.444  27.169 9.761   1.00 109.63 ? 2    SER A N   1 
ATOM 10   C CA  . SER A 1 5    ? 20.993  28.097 10.814  1.00 109.63 ? 2    SER A CA  1 
ATOM 11   C C   . SER A 1 5    ? 20.925  29.580 10.415  1.00 109.63 ? 2    SER A C   1 
ATOM 12   O O   . SER A 1 5    ? 21.946  30.279 10.423  1.00 109.63 ? 2    SER A O   1 
ATOM 13   C CB  . SER A 1 5    ? 21.898  27.958 12.026  1.00 62.45  ? 2    SER A CB  1 
ATOM 14   O OG  . SER A 1 5    ? 21.414  28.770 13.075  1.00 62.45  ? 2    SER A OG  1 
ATOM 15   N N   . TYR A 1 6    ? 19.724  30.064 10.098  1.00 72.14  ? 3    TYR A N   1 
ATOM 16   C CA  . TYR A 1 6    ? 19.564  31.439 9.590   1.00 72.14  ? 3    TYR A CA  1 
ATOM 17   C C   . TYR A 1 6    ? 18.456  32.257 10.292  1.00 72.14  ? 3    TYR A C   1 
ATOM 18   O O   . TYR A 1 6    ? 17.263  32.050 10.051  1.00 72.14  ? 3    TYR A O   1 
ATOM 19   C CB  . TYR A 1 6    ? 19.390  31.445 8.057   1.00 130.33 ? 3    TYR A CB  1 
ATOM 20   C CG  . TYR A 1 6    ? 20.351  30.520 7.330   1.00 130.33 ? 3    TYR A CG  1 
ATOM 21   C CD1 . TYR A 1 6    ? 21.729  30.682 7.453   1.00 130.33 ? 3    TYR A CD1 1 
ATOM 22   C CD2 . TYR A 1 6    ? 19.883  29.475 6.536   1.00 130.33 ? 3    TYR A CD2 1 
ATOM 23   C CE1 . TYR A 1 6    ? 22.618  29.834 6.809   1.00 130.33 ? 3    TYR A CE1 1 
ATOM 24   C CE2 . TYR A 1 6    ? 20.768  28.621 5.881   1.00 130.33 ? 3    TYR A CE2 1 
ATOM 25   C CZ  . TYR A 1 6    ? 22.135  28.810 6.024   1.00 130.33 ? 3    TYR A CZ  1 
ATOM 26   O OH  . TYR A 1 6    ? 23.031  27.982 5.389   1.00 130.33 ? 3    TYR A OH  1 
ATOM 27   N N   . ASN A 1 7    ? 18.877  33.194 11.145  1.00 63.18  ? 4    ASN A N   1 
ATOM 28   C CA  . ASN A 1 7    ? 17.963  34.036 11.907  1.00 63.18  ? 4    ASN A CA  1 
ATOM 29   C C   . ASN A 1 7    ? 18.099  35.552 11.710  1.00 63.18  ? 4    ASN A C   1 
ATOM 30   O O   . ASN A 1 7    ? 19.196  36.075 11.500  1.00 63.18  ? 4    ASN A O   1 
ATOM 31   C CB  . ASN A 1 7    ? 18.030  33.672 13.390  1.00 57.71  ? 4    ASN A CB  1 
ATOM 32   C CG  . ASN A 1 7    ? 17.338  32.372 13.684  1.00 57.71  ? 4    ASN A CG  1 
ATOM 33   O OD1 . ASN A 1 7    ? 16.205  32.147 13.249  1.00 57.71  ? 4    ASN A OD1 1 
ATOM 34   N ND2 . ASN A 1 7    ? 18.013  31.496 14.411  1.00 57.71  ? 4    ASN A ND2 1 
ATOM 35   N N   . TYR A 1 8    ? 16.948  36.221 11.800  1.00 58.67  ? 5    TYR A N   1 
ATOM 36   C CA  . TYR A 1 8    ? 16.799  37.654 11.591  1.00 58.67  ? 5    TYR A CA  1 
ATOM 37   C C   . TYR A 1 8    ? 16.144  38.321 12.806  1.00 58.67  ? 5    TYR A C   1 
ATOM 38   O O   . TYR A 1 8    ? 15.150  37.810 13.339  1.00 58.67  ? 5    TYR A O   1 
ATOM 39   C CB  . TYR A 1 8    ? 15.937  37.896 10.348  1.00 40.96  ? 5    TYR A CB  1 
ATOM 40   C CG  . TYR A 1 8    ? 15.912  39.354 9.935   1.00 40.96  ? 5    TYR A CG  1 
ATOM 41   C CD1 . TYR A 1 8    ? 16.859  39.872 9.056   1.00 40.96  ? 5    TYR A CD1 1 
ATOM 42   C CD2 . TYR A 1 8    ? 14.940  40.221 10.443  1.00 40.96  ? 5    TYR A CD2 1 
ATOM 43   C CE1 . TYR A 1 8    ? 16.838  41.219 8.688   1.00 40.96  ? 5    TYR A CE1 1 
ATOM 44   C CE2 . TYR A 1 8    ? 14.901  41.558 10.075  1.00 40.96  ? 5    TYR A CE2 1 
ATOM 45   C CZ  . TYR A 1 8    ? 15.849  42.058 9.198   1.00 40.96  ? 5    TYR A CZ  1 
ATOM 46   O OH  . TYR A 1 8    ? 15.784  43.397 8.852   1.00 40.96  ? 5    TYR A OH  1 
ATOM 47   N N   . VAL A 1 9    ? 16.684  39.466 13.221  1.00 49.36  ? 6    VAL A N   1 
ATOM 48   C CA  . VAL A 1 9    ? 16.258  40.146 14.472  1.00 49.36  ? 6    VAL A CA  1 
ATOM 49   C C   . VAL A 1 9    ? 16.111  41.662 14.320  1.00 49.36  ? 6    VAL A C   1 
ATOM 50   O O   . VAL A 1 9    ? 17.097  42.369 14.046  1.00 49.36  ? 6    VAL A O   1 
ATOM 51   C CB  . VAL A 1 9    ? 17.236  39.867 15.669  1.00 48.23  ? 6    VAL A CB  1 
ATOM 52   C CG1 . VAL A 1 9    ? 16.817  40.592 16.899  1.00 48.23  ? 6    VAL A CG1 1 
ATOM 53   C CG2 . VAL A 1 9    ? 17.229  38.434 16.007  1.00 48.23  ? 6    VAL A CG2 1 
ATOM 54   N N   . VAL A 1 10   ? 14.898  42.164 14.541  1.00 55.71  ? 7    VAL A N   1 
ATOM 55   C CA  . VAL A 1 10   ? 14.704  43.608 14.576  1.00 55.71  ? 7    VAL A CA  1 
ATOM 56   C C   . VAL A 1 10   ? 14.097  44.147 15.854  1.00 55.71  ? 7    VAL A C   1 
ATOM 57   O O   . VAL A 1 10   ? 13.305  43.459 16.523  1.00 55.71  ? 7    VAL A O   1 
ATOM 58   C CB  . VAL A 1 10   ? 13.746  44.091 13.526  1.00 43.42  ? 7    VAL A CB  1 
ATOM 59   C CG1 . VAL A 1 10   ? 14.434  45.147 12.699  1.00 43.42  ? 7    VAL A CG1 1 
ATOM 60   C CG2 . VAL A 1 10   ? 13.229  42.940 12.701  1.00 43.42  ? 7    VAL A CG2 1 
ATOM 61   N N   . THR A 1 11   ? 14.432  45.405 16.156  1.00 34.11  ? 8    THR A N   1 
ATOM 62   C CA  . THR A 1 11   ? 13.695  46.141 17.131  1.00 34.11  ? 8    THR A CA  1 
ATOM 63   C C   . THR A 1 11   ? 12.317  46.423 16.566  1.00 34.11  ? 8    THR A C   1 
ATOM 64   O O   . THR A 1 11   ? 12.171  46.732 15.374  1.00 34.11  ? 8    THR A O   1 
ATOM 65   C CB  . THR A 1 11   ? 14.320  47.448 17.382  1.00 23.68  ? 8    THR A CB  1 
ATOM 66   O OG1 . THR A 1 11   ? 15.551  47.271 18.117  1.00 23.68  ? 8    THR A OG1 1 
ATOM 67   C CG2 . THR A 1 11   ? 13.311  48.365 18.153  1.00 23.68  ? 8    THR A CG2 1 
ATOM 68   N N   . ALA A 1 12   ? 11.304  46.281 17.417  1.00 43.86  ? 9    ALA A N   1 
ATOM 69   C CA  . ALA A 1 12   ? 9.932   46.577 17.026  1.00 43.86  ? 9    ALA A CA  1 
ATOM 70   C C   . ALA A 1 12   ? 9.445   47.803 17.772  1.00 43.86  ? 9    ALA A C   1 
ATOM 71   O O   . ALA A 1 12   ? 8.527   48.494 17.330  1.00 43.86  ? 9    ALA A O   1 
ATOM 72   C CB  . ALA A 1 12   ? 9.048   45.405 17.293  1.00 13.94  ? 9    ALA A CB  1 
ATOM 73   N N   . GLN A 1 13   ? 10.076  48.045 18.912  1.00 35.81  ? 10   GLN A N   1 
ATOM 74   C CA  . GLN A 1 13   ? 9.822   49.199 19.733  1.00 35.81  ? 10   GLN A CA  1 
ATOM 75   C C   . GLN A 1 13   ? 11.127  49.481 20.410  1.00 35.81  ? 10   GLN A C   1 
ATOM 76   O O   . GLN A 1 13   ? 11.673  48.619 21.066  1.00 35.81  ? 10   GLN A O   1 
ATOM 77   C CB  . GLN A 1 13   ? 8.717   48.929 20.760  1.00 37.55  ? 10   GLN A CB  1 
ATOM 78   C CG  . GLN A 1 13   ? 8.662   49.941 21.905  1.00 37.55  ? 10   GLN A CG  1 
ATOM 79   C CD  . GLN A 1 13   ? 8.511   51.387 21.414  1.00 37.55  ? 10   GLN A CD  1 
ATOM 80   O OE1 . GLN A 1 13   ? 7.486   51.756 20.827  1.00 37.55  ? 10   GLN A OE1 1 
ATOM 81   N NE2 . GLN A 1 13   ? 9.537   52.201 21.647  1.00 37.55  ? 10   GLN A NE2 1 
ATOM 82   N N   . LYS A 1 14   ? 11.665  50.683 20.213  1.00 27.57  ? 11   LYS A N   1 
ATOM 83   C CA  . LYS A 1 14   ? 12.947  51.003 20.841  1.00 27.57  ? 11   LYS A CA  1 
ATOM 84   C C   . LYS A 1 14   ? 12.768  50.942 22.347  1.00 27.57  ? 11   LYS A C   1 
ATOM 85   O O   . LYS A 1 14   ? 11.650  51.094 22.864  1.00 27.57  ? 11   LYS A O   1 
ATOM 86   C CB  . LYS A 1 14   ? 13.477  52.339 20.361  1.00 41.75  ? 11   LYS A CB  1 
ATOM 87   C CG  . LYS A 1 14   ? 13.938  52.314 18.876  1.00 41.75  ? 11   LYS A CG  1 
ATOM 88   C CD  . LYS A 1 14   ? 14.551  53.670 18.414  1.00 41.75  ? 11   LYS A CD  1 
ATOM 89   C CE  . LYS A 1 14   ? 13.512  54.820 18.476  1.00 41.75  ? 11   LYS A CE  1 
ATOM 90   N NZ  . LYS A 1 14   ? 14.109  56.196 18.629  1.00 41.75  ? 11   LYS A NZ  1 
ATOM 91   N N   . PRO A 1 15   ? 13.842  50.626 23.069  1.00 23.94  ? 12   PRO A N   1 
ATOM 92   C CA  . PRO A 1 15   ? 13.778  50.641 24.546  1.00 23.94  ? 12   PRO A CA  1 
ATOM 93   C C   . PRO A 1 15   ? 13.140  51.915 25.068  1.00 23.94  ? 12   PRO A C   1 
ATOM 94   O O   . PRO A 1 15   ? 13.416  52.989 24.539  1.00 23.94  ? 12   PRO A O   1 
ATOM 95   C CB  . PRO A 1 15   ? 15.251  50.601 24.944  1.00 27.08  ? 12   PRO A CB  1 
ATOM 96   C CG  . PRO A 1 15   ? 15.867  49.865 23.852  1.00 27.08  ? 12   PRO A CG  1 
ATOM 97   C CD  . PRO A 1 15   ? 15.158  50.195 22.591  1.00 27.08  ? 12   PRO A CD  1 
ATOM 98   N N   . THR A 1 16   ? 12.302  51.801 26.091  1.00 26.37  ? 13   THR A N   1 
ATOM 99   C CA  . THR A 1 16   ? 11.614  52.985 26.640  1.00 26.37  ? 13   THR A CA  1 
ATOM 100  C C   . THR A 1 16   ? 11.927  53.309 28.071  1.00 26.37  ? 13   THR A C   1 
ATOM 101  O O   . THR A 1 16   ? 11.561  54.362 28.526  1.00 26.37  ? 13   THR A O   1 
ATOM 102  C CB  . THR A 1 16   ? 10.097  52.894 26.538  1.00 26.32  ? 13   THR A CB  1 
ATOM 103  O OG1 . THR A 1 16   ? 9.630   51.726 27.250  1.00 26.32  ? 13   THR A OG1 1 
ATOM 104  C CG2 . THR A 1 16   ? 9.661   52.876 25.068  1.00 26.32  ? 13   THR A CG2 1 
ATOM 105  N N   . ALA A 1 17   ? 12.564  52.406 28.798  1.00 22.80  ? 14   ALA A N   1 
ATOM 106  C CA  . ALA A 1 17   ? 13.056  52.713 30.143  1.00 22.80  ? 14   ALA A CA  1 
ATOM 107  C C   . ALA A 1 17   ? 14.215  53.722 30.138  1.00 22.80  ? 14   ALA A C   1 
ATOM 108  O O   . ALA A 1 17   ? 15.083  53.692 29.270  1.00 22.80  ? 14   ALA A O   1 
ATOM 109  C CB  . ALA A 1 17   ? 13.517  51.454 30.795  1.00 10.29  ? 14   ALA A CB  1 
ATOM 110  N N   . VAL A 1 18   ? 14.246  54.592 31.127  1.00 27.96  ? 15   VAL A N   1 
ATOM 111  C CA  . VAL A 1 18   ? 15.342  55.530 31.254  1.00 27.96  ? 15   VAL A CA  1 
ATOM 112  C C   . VAL A 1 18   ? 16.401  55.002 32.186  1.00 27.96  ? 15   VAL A C   1 
ATOM 113  O O   . VAL A 1 18   ? 16.118  54.735 33.344  1.00 27.96  ? 15   VAL A O   1 
ATOM 114  C CB  . VAL A 1 18   ? 14.916  56.909 31.805  1.00 19.39  ? 15   VAL A CB  1 
ATOM 115  C CG1 . VAL A 1 18   ? 16.189  57.740 32.063  1.00 19.39  ? 15   VAL A CG1 1 
ATOM 116  C CG2 . VAL A 1 18   ? 14.030  57.652 30.805  1.00 19.39  ? 15   VAL A CG2 1 
ATOM 117  N N   . ASN A 1 19   ? 17.634  54.897 31.701  1.00 32.92  ? 16   ASN A N   1 
ATOM 118  C CA  . ASN A 1 19   ? 18.725  54.401 32.538  1.00 32.92  ? 16   ASN A CA  1 
ATOM 119  C C   . ASN A 1 19   ? 19.536  55.493 33.177  1.00 32.92  ? 16   ASN A C   1 
ATOM 120  O O   . ASN A 1 19   ? 20.020  55.334 34.286  1.00 32.92  ? 16   ASN A O   1 
ATOM 121  C CB  . ASN A 1 19   ? 19.591  53.434 31.761  1.00 27.39  ? 16   ASN A CB  1 
ATOM 122  C CG  . ASN A 1 19   ? 18.771  52.320 31.142  1.00 27.39  ? 16   ASN A CG  1 
ATOM 123  O OD1 . ASN A 1 19   ? 18.148  51.505 31.837  1.00 27.39  ? 16   ASN A OD1 1 
ATOM 124  N ND2 . ASN A 1 19   ? 18.728  52.302 29.820  1.00 27.39  ? 16   ASN A ND2 1 
ATOM 125  N N   . GLY A 1 20   ? 19.649  56.621 32.487  1.00 23.18  ? 17   GLY A N   1 
ATOM 126  C CA  . GLY A 1 20   ? 20.361  57.772 33.011  1.00 23.18  ? 17   GLY A CA  1 
ATOM 127  C C   . GLY A 1 20   ? 19.869  59.044 32.374  1.00 23.18  ? 17   GLY A C   1 
ATOM 128  O O   . GLY A 1 20   ? 19.215  59.020 31.338  1.00 23.18  ? 17   GLY A O   1 
ATOM 129  N N   . CYS A 1 21   ? 20.152  60.165 33.020  1.00 35.31  ? 18   CYS A N   1 
ATOM 130  C CA  . CYS A 1 21   ? 19.811  61.483 32.487  1.00 35.31  ? 18   CYS A CA  1 
ATOM 131  C C   . CYS A 1 21   ? 20.718  62.438 33.191  1.00 35.31  ? 18   CYS A C   1 
ATOM 132  O O   . CYS A 1 21   ? 21.071  62.232 34.356  1.00 35.31  ? 18   CYS A O   1 
ATOM 133  C CB  . CYS A 1 21   ? 18.346  61.865 32.683  1.00 34.02  ? 18   CYS A CB  1 
ATOM 134  S SG  . CYS A 1 21   ? 17.755  61.821 34.371  1.00 34.02  ? 18   CYS A SG  1 
ATOM 135  N N   . VAL A 1 22   ? 21.138  63.458 32.462  1.00 38.84  ? 19   VAL A N   1 
ATOM 136  C CA  . VAL A 1 22   ? 22.074  64.432 32.987  1.00 38.84  ? 19   VAL A CA  1 
ATOM 137  C C   . VAL A 1 22   ? 21.795  65.809 32.365  1.00 38.84  ? 19   VAL A C   1 
ATOM 138  O O   . VAL A 1 22   ? 21.177  65.939 31.300  1.00 38.84  ? 19   VAL A O   1 
ATOM 139  C CB  . VAL A 1 22   ? 23.517  63.944 32.752  1.00 40.95  ? 19   VAL A CB  1 
ATOM 140  C CG1 . VAL A 1 22   ? 23.993  64.331 31.373  1.00 40.95  ? 19   VAL A CG1 1 
ATOM 141  C CG2 . VAL A 1 22   ? 24.425  64.493 33.780  1.00 40.95  ? 19   VAL A CG2 1 
ATOM 142  N N   . THR A 1 23   ? 22.262  66.841 33.039  1.00 48.84  ? 20   THR A N   1 
ATOM 143  C CA  . THR A 1 23   ? 21.986  68.190 32.601  1.00 48.84  ? 20   THR A CA  1 
ATOM 144  C C   . THR A 1 23   ? 23.265  68.985 32.336  1.00 48.84  ? 20   THR A C   1 
ATOM 145  O O   . THR A 1 23   ? 24.272  68.798 33.022  1.00 48.84  ? 20   THR A O   1 
ATOM 146  C CB  . THR A 1 23   ? 21.081  68.844 33.635  1.00 30.11  ? 20   THR A CB  1 
ATOM 147  O OG1 . THR A 1 23   ? 19.925  69.371 32.973  1.00 30.11  ? 20   THR A OG1 1 
ATOM 148  C CG2 . THR A 1 23   ? 21.797  69.874 34.507  1.00 30.11  ? 20   THR A CG2 1 
ATOM 149  N N   . GLY A 1 24   ? 23.248  69.844 31.322  1.00 50.64  ? 21   GLY A N   1 
ATOM 150  C CA  . GLY A 1 24   ? 24.371  70.777 31.113  1.00 50.64  ? 21   GLY A CA  1 
ATOM 151  C C   . GLY A 1 24   ? 24.293  71.589 29.836  1.00 50.64  ? 21   GLY A C   1 
ATOM 152  O O   . GLY A 1 24   ? 23.203  71.795 29.277  1.00 50.64  ? 21   GLY A O   1 
ATOM 153  N N   . HIS A 1 25   ? 25.462  72.034 29.368  1.00 42.93  ? 22   HIS A N   1 
ATOM 154  C CA  . HIS A 1 25   ? 25.568  72.946 28.212  1.00 42.93  ? 22   HIS A CA  1 
ATOM 155  C C   . HIS A 1 25   ? 26.444  72.348 27.111  1.00 42.93  ? 22   HIS A C   1 
ATOM 156  O O   . HIS A 1 25   ? 27.681  72.508 27.084  1.00 42.93  ? 22   HIS A O   1 
ATOM 157  C CB  . HIS A 1 25   ? 26.090  74.314 28.657  1.00 40.93  ? 22   HIS A CB  1 
ATOM 158  C CG  . HIS A 1 25   ? 25.341  74.883 29.806  1.00 40.93  ? 22   HIS A CG  1 
ATOM 159  N ND1 . HIS A 1 25   ? 25.833  74.858 31.092  1.00 40.93  ? 22   HIS A ND1 1 
ATOM 160  C CD2 . HIS A 1 25   ? 24.118  75.455 29.875  1.00 40.93  ? 22   HIS A CD2 1 
ATOM 161  C CE1 . HIS A 1 25   ? 24.945  75.405 31.905  1.00 40.93  ? 22   HIS A CE1 1 
ATOM 162  N NE2 . HIS A 1 25   ? 23.892  75.772 31.191  1.00 40.93  ? 22   HIS A NE2 1 
ATOM 163  N N   . PHE A 1 26   ? 25.777  71.669 26.192  1.00 37.23  ? 23   PHE A N   1 
ATOM 164  C CA  . PHE A 1 26   ? 26.463  70.762 25.301  1.00 37.23  ? 23   PHE A CA  1 
ATOM 165  C C   . PHE A 1 26   ? 26.101  71.027 23.851  1.00 37.23  ? 23   PHE A C   1 
ATOM 166  O O   . PHE A 1 26   ? 26.924  70.786 22.966  1.00 37.23  ? 23   PHE A O   1 
ATOM 167  C CB  . PHE A 1 26   ? 26.116  69.331 25.732  1.00 34.30  ? 23   PHE A CB  1 
ATOM 168  C CG  . PHE A 1 26   ? 26.494  68.268 24.740  1.00 34.30  ? 23   PHE A CG  1 
ATOM 169  C CD1 . PHE A 1 26   ? 27.821  67.922 24.546  1.00 34.30  ? 23   PHE A CD1 1 
ATOM 170  C CD2 . PHE A 1 26   ? 25.508  67.587 24.038  1.00 34.30  ? 23   PHE A CD2 1 
ATOM 171  C CE1 . PHE A 1 26   ? 28.177  66.920 23.641  1.00 34.30  ? 23   PHE A CE1 1 
ATOM 172  C CE2 . PHE A 1 26   ? 25.837  66.586 23.138  1.00 34.30  ? 23   PHE A CE2 1 
ATOM 173  C CZ  . PHE A 1 26   ? 27.182  66.246 22.933  1.00 34.30  ? 23   PHE A CZ  1 
ATOM 174  N N   . THR A 1 27   ? 24.861  71.483 23.632  1.00 77.09  ? 24   THR A N   1 
ATOM 175  C CA  . THR A 1 27   ? 24.364  71.979 22.340  1.00 77.09  ? 24   THR A CA  1 
ATOM 176  C C   . THR A 1 27   ? 25.099  73.269 21.996  1.00 77.09  ? 24   THR A C   1 
ATOM 177  O O   . THR A 1 27   ? 25.540  73.472 20.858  1.00 77.09  ? 24   THR A O   1 
ATOM 178  C CB  . THR A 1 27   ? 22.827  72.247 22.393  1.00 56.91  ? 24   THR A CB  1 
ATOM 179  O OG1 . THR A 1 27   ? 22.131  71.083 21.947  1.00 56.91  ? 24   THR A OG1 1 
ATOM 180  C CG2 . THR A 1 27   ? 22.399  73.405 21.488  1.00 56.91  ? 24   THR A CG2 1 
ATOM 181  N N   . SER A 1 28   ? 25.210  74.127 23.005  1.00 77.17  ? 25   SER A N   1 
ATOM 182  C CA  . SER A 1 28   ? 25.994  75.335 22.958  1.00 77.17  ? 25   SER A CA  1 
ATOM 183  C C   . SER A 1 28   ? 26.285  75.696 24.404  1.00 77.17  ? 25   SER A C   1 
ATOM 184  O O   . SER A 1 28   ? 25.652  75.151 25.312  1.00 77.17  ? 25   SER A O   1 
ATOM 185  C CB  . SER A 1 28   ? 25.188  76.450 22.312  1.00 81.18  ? 25   SER A CB  1 
ATOM 186  O OG  . SER A 1 28   ? 24.040  76.729 23.081  1.00 81.18  ? 25   SER A OG  1 
ATOM 187  N N   . ALA A 1 29   ? 27.232  76.614 24.614  1.00 54.62  ? 26   ALA A N   1 
ATOM 188  C CA  . ALA A 1 29   ? 27.510  77.194 25.933  1.00 54.62  ? 26   ALA A CA  1 
ATOM 189  C C   . ALA A 1 29   ? 26.326  78.018 26.472  1.00 54.62  ? 26   ALA A C   1 
ATOM 190  O O   . ALA A 1 29   ? 26.242  78.274 27.669  1.00 54.62  ? 26   ALA A O   1 
ATOM 191  C CB  . ALA A 1 29   ? 28.783  78.041 25.867  1.00 31.01  ? 26   ALA A CB  1 
ATOM 192  N N   . GLU A 1 30   ? 25.410  78.374 25.573  1.00 80.97  ? 27   GLU A N   1 
ATOM 193  C CA  . GLU A 1 30   ? 24.308  79.298 25.826  1.00 80.97  ? 27   GLU A CA  1 
ATOM 194  C C   . GLU A 1 30   ? 22.947  78.589 25.778  1.00 80.97  ? 27   GLU A C   1 
ATOM 195  O O   . GLU A 1 30   ? 21.936  79.182 25.398  1.00 80.97  ? 27   GLU A O   1 
ATOM 196  C CB  . GLU A 1 30   ? 24.350  80.415 24.766  1.00 147.13 ? 27   GLU A CB  1 
ATOM 197  C CG  . GLU A 1 30   ? 24.159  79.916 23.314  1.00 147.13 ? 27   GLU A CG  1 
ATOM 198  C CD  . GLU A 1 30   ? 24.762  80.830 22.259  1.00 147.13 ? 27   GLU A CD  1 
ATOM 199  O OE1 . GLU A 1 30   ? 25.863  80.512 21.757  1.00 147.13 ? 27   GLU A OE1 1 
ATOM 200  O OE2 . GLU A 1 30   ? 24.133  81.857 21.922  1.00 147.13 ? 27   GLU A OE2 1 
ATOM 201  N N   . ASP A 1 31   ? 22.944  77.313 26.151  1.00 47.79  ? 28   ASP A N   1 
ATOM 202  C CA  . ASP A 1 31   ? 21.772  76.429 26.121  1.00 47.79  ? 28   ASP A CA  1 
ATOM 203  C C   . ASP A 1 31   ? 21.714  75.615 27.419  1.00 47.79  ? 28   ASP A C   1 
ATOM 204  O O   . ASP A 1 31   ? 22.756  75.395 28.049  1.00 47.79  ? 28   ASP A O   1 
ATOM 205  C CB  . ASP A 1 31   ? 21.899  75.453 24.954  1.00 56.77  ? 28   ASP A CB  1 
ATOM 206  C CG  . ASP A 1 31   ? 21.193  75.933 23.692  1.00 56.77  ? 28   ASP A CG  1 
ATOM 207  O OD1 . ASP A 1 31   ? 20.570  77.014 23.705  1.00 56.77  ? 28   ASP A OD1 1 
ATOM 208  O OD2 . ASP A 1 31   ? 21.251  75.206 22.675  1.00 56.77  ? 28   ASP A OD2 1 
ATOM 209  N N   . LEU A 1 32   ? 20.521  75.177 27.828  1.00 53.11  ? 29   LEU A N   1 
ATOM 210  C CA  . LEU A 1 32   ? 20.387  74.146 28.876  1.00 53.11  ? 29   LEU A CA  1 
ATOM 211  C C   . LEU A 1 32   ? 19.819  72.861 28.279  1.00 53.11  ? 29   LEU A C   1 
ATOM 212  O O   . LEU A 1 32   ? 18.683  72.843 27.819  1.00 53.11  ? 29   LEU A O   1 
ATOM 213  C CB  . LEU A 1 32   ? 19.488  74.612 30.017  1.00 35.78  ? 29   LEU A CB  1 
ATOM 214  C CG  . LEU A 1 32   ? 19.365  73.630 31.180  1.00 35.78  ? 29   LEU A CG  1 
ATOM 215  C CD1 . LEU A 1 32   ? 20.716  73.402 31.902  1.00 35.78  ? 29   LEU A CD1 1 
ATOM 216  C CD2 . LEU A 1 32   ? 18.279  74.058 32.184  1.00 35.78  ? 29   LEU A CD2 1 
ATOM 217  N N   . ASN A 1 33   ? 20.607  71.793 28.276  1.00 45.77  ? 30   ASN A N   1 
ATOM 218  C CA  . ASN A 1 33   ? 20.180  70.542 27.660  1.00 45.77  ? 30   ASN A CA  1 
ATOM 219  C C   . ASN A 1 33   ? 19.768  69.500 28.683  1.00 45.77  ? 30   ASN A C   1 
ATOM 220  O O   . ASN A 1 33   ? 20.239  69.528 29.838  1.00 45.77  ? 30   ASN A O   1 
ATOM 221  C CB  . ASN A 1 33   ? 21.297  69.941 26.806  1.00 51.88  ? 30   ASN A CB  1 
ATOM 222  C CG  . ASN A 1 33   ? 21.754  70.850 25.700  1.00 51.88  ? 30   ASN A CG  1 
ATOM 223  O OD1 . ASN A 1 33   ? 21.000  71.190 24.793  1.00 51.88  ? 30   ASN A OD1 1 
ATOM 224  N ND2 . ASN A 1 33   ? 23.020  71.227 25.758  1.00 51.88  ? 30   ASN A ND2 1 
ATOM 225  N N   . LEU A 1 34   ? 18.898  68.580 28.257  1.00 43.12  ? 31   LEU A N   1 
ATOM 226  C CA  . LEU A 1 34   ? 18.699  67.330 28.991  1.00 43.12  ? 31   LEU A CA  1 
ATOM 227  C C   . LEU A 1 34   ? 19.260  66.188 28.150  1.00 43.12  ? 31   LEU A C   1 
ATOM 228  O O   . LEU A 1 34   ? 18.874  66.020 26.986  1.00 43.12  ? 31   LEU A O   1 
ATOM 229  C CB  . LEU A 1 34   ? 17.225  67.093 29.308  1.00 38.06  ? 31   LEU A CB  1 
ATOM 230  C CG  . LEU A 1 34   ? 16.842  65.833 30.081  1.00 38.06  ? 31   LEU A CG  1 
ATOM 231  C CD1 . LEU A 1 34   ? 17.507  65.750 31.438  1.00 38.06  ? 31   LEU A CD1 1 
ATOM 232  C CD2 . LEU A 1 34   ? 15.334  65.749 30.250  1.00 38.06  ? 31   LEU A CD2 1 
ATOM 233  N N   . LEU A 1 35   ? 20.197  65.432 28.707  1.00 55.74  ? 32   LEU A N   1 
ATOM 234  C CA  . LEU A 1 35   ? 20.657  64.225 28.030  1.00 55.74  ? 32   LEU A CA  1 
ATOM 235  C C   . LEU A 1 35   ? 20.110  62.975 28.707  1.00 55.74  ? 32   LEU A C   1 
ATOM 236  O O   . LEU A 1 35   ? 20.404  62.726 29.872  1.00 55.74  ? 32   LEU A O   1 
ATOM 237  C CB  . LEU A 1 35   ? 22.182  64.176 27.983  1.00 49.11  ? 32   LEU A CB  1 
ATOM 238  C CG  . LEU A 1 35   ? 22.893  64.925 26.852  1.00 49.11  ? 32   LEU A CG  1 
ATOM 239  C CD1 . LEU A 1 35   ? 22.574  66.439 26.805  1.00 49.11  ? 32   LEU A CD1 1 
ATOM 240  C CD2 . LEU A 1 35   ? 24.380  64.678 26.985  1.00 49.11  ? 32   LEU A CD2 1 
ATOM 241  N N   . ILE A 1 36   ? 19.310  62.203 27.975  1.00 37.45  ? 33   ILE A N   1 
ATOM 242  C CA  . ILE A 1 36   ? 18.723  60.967 28.498  1.00 37.45  ? 33   ILE A CA  1 
ATOM 243  C C   . ILE A 1 36   ? 19.354  59.755 27.874  1.00 37.45  ? 33   ILE A C   1 
ATOM 244  O O   . ILE A 1 36   ? 19.409  59.644 26.659  1.00 37.45  ? 33   ILE A O   1 
ATOM 245  C CB  . ILE A 1 36   ? 17.204  60.854 28.223  1.00 35.35  ? 33   ILE A CB  1 
ATOM 246  C CG1 . ILE A 1 36   ? 16.458  62.112 28.687  1.00 35.35  ? 33   ILE A CG1 1 
ATOM 247  C CG2 . ILE A 1 36   ? 16.636  59.567 28.883  1.00 35.35  ? 33   ILE A CG2 1 
ATOM 248  C CD1 . ILE A 1 36   ? 15.004  62.075 28.348  1.00 35.35  ? 33   ILE A CD1 1 
ATOM 249  N N   . ALA A 1 37   ? 19.803  58.837 28.714  1.00 26.10  ? 34   ALA A N   1 
ATOM 250  C CA  . ALA A 1 37   ? 20.323  57.551 28.255  1.00 26.10  ? 34   ALA A CA  1 
ATOM 251  C C   . ALA A 1 37   ? 19.224  56.531 28.340  1.00 26.10  ? 34   ALA A C   1 
ATOM 252  O O   . ALA A 1 37   ? 18.720  56.243 29.429  1.00 26.10  ? 34   ALA A O   1 
ATOM 253  C CB  . ALA A 1 37   ? 21.494  57.102 29.116  1.00 2.00   ? 34   ALA A CB  1 
ATOM 254  N N   . LYS A 1 38   ? 18.816  56.014 27.187  1.00 82.53  ? 35   LYS A N   1 
ATOM 255  C CA  . LYS A 1 38   ? 18.056  54.790 27.170  1.00 82.53  ? 35   LYS A CA  1 
ATOM 256  C C   . LYS A 1 38   ? 19.093  53.683 27.232  1.00 82.53  ? 35   LYS A C   1 
ATOM 257  O O   . LYS A 1 38   ? 19.986  53.730 28.076  1.00 82.53  ? 35   LYS A O   1 
ATOM 258  C CB  . LYS A 1 38   ? 17.148  54.698 25.956  1.00 33.36  ? 35   LYS A CB  1 
ATOM 259  C CG  . LYS A 1 38   ? 15.694  55.209 26.204  1.00 33.36  ? 35   LYS A CG  1 
ATOM 260  C CD  . LYS A 1 38   ? 15.593  56.756 26.218  1.00 33.36  ? 35   LYS A CD  1 
ATOM 261  C CE  . LYS A 1 38   ? 14.222  57.339 26.733  1.00 33.36  ? 35   LYS A CE  1 
ATOM 262  N NZ  . LYS A 1 38   ? 13.137  57.439 25.722  1.00 33.36  ? 35   LYS A NZ  1 
ATOM 263  N N   . ASN A 1 39   ? 19.028  52.677 26.384  1.00 43.52  ? 36   ASN A N   1 
ATOM 264  C CA  . ASN A 1 39   ? 19.945  51.566 26.647  1.00 43.52  ? 36   ASN A CA  1 
ATOM 265  C C   . ASN A 1 39   ? 21.207  51.857 25.826  1.00 43.52  ? 36   ASN A C   1 
ATOM 266  O O   . ASN A 1 39   ? 22.209  52.357 26.321  1.00 43.52  ? 36   ASN A O   1 
ATOM 267  C CB  . ASN A 1 39   ? 19.229  50.224 26.351  1.00 31.35  ? 36   ASN A CB  1 
ATOM 268  C CG  . ASN A 1 39   ? 20.148  49.002 26.396  1.00 31.35  ? 36   ASN A CG  1 
ATOM 269  O OD1 . ASN A 1 39   ? 19.928  48.045 25.664  1.00 31.35  ? 36   ASN A OD1 1 
ATOM 270  N ND2 . ASN A 1 39   ? 21.157  49.022 27.253  1.00 31.35  ? 36   ASN A ND2 1 
ATOM 271  N N   . THR A 1 40   ? 21.097  51.622 24.541  1.00 36.42  ? 37   THR A N   1 
ATOM 272  C CA  . THR A 1 40   ? 22.122  51.946 23.611  1.00 36.42  ? 37   THR A CA  1 
ATOM 273  C C   . THR A 1 40   ? 21.821  53.330 22.996  1.00 36.42  ? 37   THR A C   1 
ATOM 274  O O   . THR A 1 40   ? 22.470  53.734 22.046  1.00 36.42  ? 37   THR A O   1 
ATOM 275  C CB  . THR A 1 40   ? 22.027  50.904 22.511  1.00 30.60  ? 37   THR A CB  1 
ATOM 276  O OG1 . THR A 1 40   ? 20.629  50.701 22.207  1.00 30.60  ? 37   THR A OG1 1 
ATOM 277  C CG2 . THR A 1 40   ? 22.604  49.608 22.988  1.00 30.60  ? 37   THR A CG2 1 
ATOM 278  N N   . ARG A 1 41   ? 20.837  54.045 23.537  1.00 60.82  ? 38   ARG A N   1 
ATOM 279  C CA  . ARG A 1 41   ? 20.361  55.298 22.937  1.00 60.82  ? 38   ARG A CA  1 
ATOM 280  C C   . ARG A 1 41   ? 20.641  56.547 23.801  1.00 60.82  ? 38   ARG A C   1 
ATOM 281  O O   . ARG A 1 41   ? 20.321  56.546 24.997  1.00 60.82  ? 38   ARG A O   1 
ATOM 282  C CB  . ARG A 1 41   ? 18.863  55.194 22.601  1.00 60.42  ? 38   ARG A CB  1 
ATOM 283  C CG  . ARG A 1 41   ? 18.540  54.279 21.424  1.00 60.42  ? 38   ARG A CG  1 
ATOM 284  C CD  . ARG A 1 41   ? 18.730  55.035 20.134  1.00 60.42  ? 38   ARG A CD  1 
ATOM 285  N NE  . ARG A 1 41   ? 18.840  54.213 18.930  1.00 60.42  ? 38   ARG A NE  1 
ATOM 286  C CZ  . ARG A 1 41   ? 18.858  54.728 17.698  1.00 60.42  ? 38   ARG A CZ  1 
ATOM 287  N NH1 . ARG A 1 41   ? 18.772  56.039 17.524  1.00 60.42  ? 38   ARG A NH1 1 
ATOM 288  N NH2 . ARG A 1 41   ? 18.959  53.946 16.632  1.00 60.42  ? 38   ARG A NH2 1 
ATOM 289  N N   . LEU A 1 42   ? 21.252  57.584 23.192  1.00 33.65  ? 39   LEU A N   1 
ATOM 290  C CA  . LEU A 1 42   ? 21.430  58.904 23.805  1.00 33.65  ? 39   LEU A CA  1 
ATOM 291  C C   . LEU A 1 42   ? 20.395  59.827 23.199  1.00 33.65  ? 39   LEU A C   1 
ATOM 292  O O   . LEU A 1 42   ? 20.235  59.873 21.975  1.00 33.65  ? 39   LEU A O   1 
ATOM 293  C CB  . LEU A 1 42   ? 22.842  59.457 23.545  1.00 28.99  ? 39   LEU A CB  1 
ATOM 294  C CG  . LEU A 1 42   ? 23.320  60.896 23.937  1.00 28.99  ? 39   LEU A CG  1 
ATOM 295  C CD1 . LEU A 1 42   ? 22.893  61.425 25.314  1.00 28.99  ? 39   LEU A CD1 1 
ATOM 296  C CD2 . LEU A 1 42   ? 24.813  60.971 23.888  1.00 28.99  ? 39   LEU A CD2 1 
ATOM 297  N N   . GLU A 1 43   ? 19.657  60.523 24.041  1.00 47.65  ? 40   GLU A N   1 
ATOM 298  C CA  . GLU A 1 43   ? 18.683  61.469 23.553  1.00 47.65  ? 40   GLU A CA  1 
ATOM 299  C C   . GLU A 1 43   ? 19.135  62.820 24.029  1.00 47.65  ? 40   GLU A C   1 
ATOM 300  O O   . GLU A 1 43   ? 19.569  62.956 25.170  1.00 47.65  ? 40   GLU A O   1 
ATOM 301  C CB  . GLU A 1 43   ? 17.286  61.159 24.084  1.00 27.27  ? 40   GLU A CB  1 
ATOM 302  C CG  . GLU A 1 43   ? 16.644  59.894 23.464  1.00 27.27  ? 40   GLU A CG  1 
ATOM 303  C CD  . GLU A 1 43   ? 15.196  59.669 23.904  1.00 27.27  ? 40   GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 43   ? 14.649  60.403 24.767  1.00 27.27  ? 40   GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 43   ? 14.587  58.732 23.369  1.00 27.27  ? 40   GLU A OE2 1 
ATOM 306  N N   . ILE A 1 44   ? 19.058  63.818 23.157  1.00 54.68  ? 41   ILE A N   1 
ATOM 307  C CA  . ILE A 1 44   ? 19.506  65.148 23.505  1.00 54.68  ? 41   ILE A CA  1 
ATOM 308  C C   . ILE A 1 44   ? 18.376  66.159 23.346  1.00 54.68  ? 41   ILE A C   1 
ATOM 309  O O   . ILE A 1 44   ? 17.816  66.325 22.247  1.00 54.68  ? 41   ILE A O   1 
ATOM 310  C CB  . ILE A 1 44   ? 20.709  65.556 22.661  1.00 31.04  ? 41   ILE A CB  1 
ATOM 311  C CG1 . ILE A 1 44   ? 21.715  64.408 22.582  1.00 31.04  ? 41   ILE A CG1 1 
ATOM 312  C CG2 . ILE A 1 44   ? 21.364  66.771 23.275  1.00 31.04  ? 41   ILE A CG2 1 
ATOM 313  C CD1 . ILE A 1 44   ? 22.944  64.684 21.743  1.00 31.04  ? 41   ILE A CD1 1 
ATOM 314  N N   . TYR A 1 45   ? 18.033  66.833 24.445  1.00 27.08  ? 42   TYR A N   1 
ATOM 315  C CA  . TYR A 1 45   ? 16.932  67.825 24.416  1.00 27.08  ? 42   TYR A CA  1 
ATOM 316  C C   . TYR A 1 45   ? 17.425  69.238 24.664  1.00 27.08  ? 42   TYR A C   1 
ATOM 317  O O   . TYR A 1 45   ? 18.522  69.417 25.162  1.00 27.08  ? 42   TYR A O   1 
ATOM 318  C CB  . TYR A 1 45   ? 15.885  67.484 25.465  1.00 32.28  ? 42   TYR A CB  1 
ATOM 319  C CG  . TYR A 1 45   ? 15.196  66.203 25.174  1.00 32.28  ? 42   TYR A CG  1 
ATOM 320  C CD1 . TYR A 1 45   ? 15.776  64.981 25.546  1.00 32.28  ? 42   TYR A CD1 1 
ATOM 321  C CD2 . TYR A 1 45   ? 13.968  66.186 24.515  1.00 32.28  ? 42   TYR A CD2 1 
ATOM 322  C CE1 . TYR A 1 45   ? 15.153  63.762 25.263  1.00 32.28  ? 42   TYR A CE1 1 
ATOM 323  C CE2 . TYR A 1 45   ? 13.350  64.979 24.224  1.00 32.28  ? 42   TYR A CE2 1 
ATOM 324  C CZ  . TYR A 1 45   ? 13.947  63.777 24.613  1.00 32.28  ? 42   TYR A CZ  1 
ATOM 325  O OH  . TYR A 1 45   ? 13.332  62.591 24.354  1.00 32.28  ? 42   TYR A OH  1 
ATOM 326  N N   . VAL A 1 46   ? 16.623  70.234 24.323  1.00 46.01  ? 43   VAL A N   1 
ATOM 327  C CA  . VAL A 1 46   ? 16.889  71.566 24.812  1.00 46.01  ? 43   VAL A CA  1 
ATOM 328  C C   . VAL A 1 46   ? 15.775  71.855 25.768  1.00 46.01  ? 43   VAL A C   1 
ATOM 329  O O   . VAL A 1 46   ? 14.599  71.630 25.452  1.00 46.01  ? 43   VAL A O   1 
ATOM 330  C CB  . VAL A 1 46   ? 16.936  72.643 23.701  1.00 55.83  ? 43   VAL A CB  1 
ATOM 331  C CG1 . VAL A 1 46   ? 16.991  74.053 24.324  1.00 55.83  ? 43   VAL A CG1 1 
ATOM 332  C CG2 . VAL A 1 46   ? 18.147  72.429 22.794  1.00 55.83  ? 43   VAL A CG2 1 
ATOM 333  N N   . VAL A 1 47   ? 16.152  72.302 26.953  1.00 57.25  ? 44   VAL A N   1 
ATOM 334  C CA  . VAL A 1 47   ? 15.192  72.760 27.916  1.00 57.25  ? 44   VAL A CA  1 
ATOM 335  C C   . VAL A 1 47   ? 14.756  74.104 27.379  1.00 57.25  ? 44   VAL A C   1 
ATOM 336  O O   . VAL A 1 47   ? 15.596  75.006 27.192  1.00 57.25  ? 44   VAL A O   1 
ATOM 337  C CB  . VAL A 1 47   ? 15.828  72.948 29.297  1.00 72.96  ? 44   VAL A CB  1 
ATOM 338  C CG1 . VAL A 1 47   ? 14.780  73.414 30.300  1.00 72.96  ? 44   VAL A CG1 1 
ATOM 339  C CG2 . VAL A 1 47   ? 16.489  71.657 29.766  1.00 72.96  ? 44   VAL A CG2 1 
ATOM 340  N N   . THR A 1 48   ? 13.458  74.217 27.087  1.00 64.30  ? 45   THR A N   1 
ATOM 341  C CA  . THR A 1 48   ? 12.859  75.465 26.599  1.00 64.30  ? 45   THR A CA  1 
ATOM 342  C C   . THR A 1 48   ? 11.945  76.060 27.670  1.00 64.30  ? 45   THR A C   1 
ATOM 343  O O   . THR A 1 48   ? 12.288  76.076 28.856  1.00 64.30  ? 45   THR A O   1 
ATOM 344  C CB  . THR A 1 48   ? 12.057  75.275 25.271  1.00 56.97  ? 45   THR A CB  1 
ATOM 345  O OG1 . THR A 1 48   ? 11.072  74.250 25.431  1.00 56.97  ? 45   THR A OG1 1 
ATOM 346  C CG2 . THR A 1 48   ? 12.958  74.901 24.131  1.00 56.97  ? 45   THR A CG2 1 
ATOM 347  N N   . ALA A 1 49   ? 10.783  76.548 27.243  1.00 74.48  ? 46   ALA A N   1 
ATOM 348  C CA  . ALA A 1 49   ? 9.856   77.219 28.136  1.00 74.48  ? 46   ALA A CA  1 
ATOM 349  C C   . ALA A 1 49   ? 8.533   76.462 28.147  1.00 74.48  ? 46   ALA A C   1 
ATOM 350  O O   . ALA A 1 49   ? 7.825   76.445 29.157  1.00 74.48  ? 46   ALA A O   1 
ATOM 351  C CB  . ALA A 1 49   ? 9.667   78.666 27.703  1.00 100.05 ? 46   ALA A CB  1 
ATOM 352  N N   . GLU A 1 50   ? 8.203   75.828 27.026  1.00 106.42 ? 47   GLU A N   1 
ATOM 353  C CA  . GLU A 1 50   ? 7.046   74.954 26.995  1.00 106.42 ? 47   GLU A CA  1 
ATOM 354  C C   . GLU A 1 50   ? 7.406   73.622 27.660  1.00 106.42 ? 47   GLU A C   1 
ATOM 355  O O   . GLU A 1 50   ? 6.616   73.070 28.431  1.00 106.42 ? 47   GLU A O   1 
ATOM 356  C CB  . GLU A 1 50   ? 6.549   74.741 25.564  1.00 157.46 ? 47   GLU A CB  1 
ATOM 357  C CG  . GLU A 1 50   ? 5.041   74.996 25.368  1.00 157.46 ? 47   GLU A CG  1 
ATOM 358  C CD  . GLU A 1 50   ? 4.131   74.054 26.163  1.00 157.46 ? 47   GLU A CD  1 
ATOM 359  O OE1 . GLU A 1 50   ? 4.514   72.887 26.395  1.00 157.46 ? 47   GLU A OE1 1 
ATOM 360  O OE2 . GLU A 1 50   ? 3.018   74.482 26.544  1.00 157.46 ? 47   GLU A OE2 1 
ATOM 361  N N   . GLY A 1 51   ? 8.615   73.132 27.376  1.00 95.02  ? 48   GLY A N   1 
ATOM 362  C CA  . GLY A 1 51   ? 9.121   71.882 27.956  1.00 95.02  ? 48   GLY A CA  1 
ATOM 363  C C   . GLY A 1 51   ? 10.457  71.439 27.384  1.00 95.02  ? 48   GLY A C   1 
ATOM 364  O O   . GLY A 1 51   ? 11.494  72.053 27.637  1.00 95.02  ? 48   GLY A O   1 
ATOM 365  N N   . LEU A 1 52   ? 10.434  70.368 26.604  1.00 39.74  ? 49   LEU A N   1 
ATOM 366  C CA  . LEU A 1 52   ? 11.659  69.830 26.022  1.00 39.74  ? 49   LEU A CA  1 
ATOM 367  C C   . LEU A 1 52   ? 11.682  69.886 24.479  1.00 39.74  ? 49   LEU A C   1 
ATOM 368  O O   . LEU A 1 52   ? 10.791  69.345 23.827  1.00 39.74  ? 49   LEU A O   1 
ATOM 369  C CB  . LEU A 1 52   ? 11.851  68.374 26.494  1.00 61.47  ? 49   LEU A CB  1 
ATOM 370  C CG  . LEU A 1 52   ? 12.555  67.961 27.802  1.00 61.47  ? 49   LEU A CG  1 
ATOM 371  C CD1 . LEU A 1 52   ? 11.996  68.629 29.030  1.00 61.47  ? 49   LEU A CD1 1 
ATOM 372  C CD2 . LEU A 1 52   ? 12.467  66.463 27.971  1.00 61.47  ? 49   LEU A CD2 1 
ATOM 373  N N   . ARG A 1 53   ? 12.708  70.508 23.904  1.00 63.69  ? 50   ARG A N   1 
ATOM 374  C CA  . ARG A 1 53   ? 12.863  70.540 22.449  1.00 63.69  ? 50   ARG A CA  1 
ATOM 375  C C   . ARG A 1 53   ? 13.876  69.483 22.006  1.00 63.69  ? 50   ARG A C   1 
ATOM 376  O O   . ARG A 1 53   ? 15.078  69.622 22.263  1.00 63.69  ? 50   ARG A O   1 
ATOM 377  C CB  . ARG A 1 53   ? 13.327  71.927 21.983  1.00 133.56 ? 50   ARG A CB  1 
ATOM 378  C CG  . ARG A 1 53   ? 13.164  72.218 20.479  1.00 133.56 ? 50   ARG A CG  1 
ATOM 379  C CD  . ARG A 1 53   ? 11.862  72.968 20.189  1.00 133.56 ? 50   ARG A CD  1 
ATOM 380  N NE  . ARG A 1 53   ? 11.869  74.325 20.746  1.00 133.56 ? 50   ARG A NE  1 
ATOM 381  C CZ  . ARG A 1 53   ? 10.785  74.980 21.169  1.00 133.56 ? 50   ARG A CZ  1 
ATOM 382  N NH1 . ARG A 1 53   ? 9.581   74.411 21.115  1.00 133.56 ? 50   ARG A NH1 1 
ATOM 383  N NH2 . ARG A 1 53   ? 10.906  76.209 21.661  1.00 133.56 ? 50   ARG A NH2 1 
ATOM 384  N N   . PRO A 1 54   ? 13.403  68.417 21.334  1.00 44.66  ? 51   PRO A N   1 
ATOM 385  C CA  . PRO A 1 54   ? 14.308  67.374 20.857  1.00 44.66  ? 51   PRO A CA  1 
ATOM 386  C C   . PRO A 1 54   ? 15.254  67.973 19.872  1.00 44.66  ? 51   PRO A C   1 
ATOM 387  O O   . PRO A 1 54   ? 14.865  68.882 19.171  1.00 44.66  ? 51   PRO A O   1 
ATOM 388  C CB  . PRO A 1 54   ? 13.378  66.398 20.115  1.00 59.57  ? 51   PRO A CB  1 
ATOM 389  C CG  . PRO A 1 54   ? 12.058  66.621 20.679  1.00 59.57  ? 51   PRO A CG  1 
ATOM 390  C CD  . PRO A 1 54   ? 12.006  68.109 20.996  1.00 59.57  ? 51   PRO A CD  1 
ATOM 391  N N   . VAL A 1 55   ? 16.485  67.487 19.814  1.00 49.48  ? 52   VAL A N   1 
ATOM 392  C CA  . VAL A 1 55   ? 17.393  67.968 18.791  1.00 49.48  ? 52   VAL A CA  1 
ATOM 393  C C   . VAL A 1 55   ? 18.082  66.824 18.053  1.00 49.48  ? 52   VAL A C   1 
ATOM 394  O O   . VAL A 1 55   ? 18.242  66.887 16.837  1.00 49.48  ? 52   VAL A O   1 
ATOM 395  C CB  . VAL A 1 55   ? 18.405  69.021 19.328  1.00 40.13  ? 52   VAL A CB  1 
ATOM 396  C CG1 . VAL A 1 55   ? 17.662  70.259 19.903  1.00 40.13  ? 52   VAL A CG1 1 
ATOM 397  C CG2 . VAL A 1 55   ? 19.310  68.435 20.386  1.00 40.13  ? 52   VAL A CG2 1 
ATOM 398  N N   . LYS A 1 56   ? 18.461  65.771 18.780  1.00 57.16  ? 53   LYS A N   1 
ATOM 399  C CA  . LYS A 1 56   ? 19.248  64.662 18.226  1.00 57.16  ? 53   LYS A CA  1 
ATOM 400  C C   . LYS A 1 56   ? 19.132  63.408 19.102  1.00 57.16  ? 53   LYS A C   1 
ATOM 401  O O   . LYS A 1 56   ? 19.205  63.470 20.331  1.00 57.16  ? 53   LYS A O   1 
ATOM 402  C CB  . LYS A 1 56   ? 20.717  65.086 18.034  1.00 63.82  ? 53   LYS A CB  1 
ATOM 403  C CG  . LYS A 1 56   ? 21.559  64.181 17.130  1.00 63.82  ? 53   LYS A CG  1 
ATOM 404  C CD  . LYS A 1 56   ? 20.849  63.823 15.812  1.00 63.82  ? 53   LYS A CD  1 
ATOM 405  C CE  . LYS A 1 56   ? 21.814  63.232 14.768  1.00 63.82  ? 53   LYS A CE  1 
ATOM 406  N NZ  . LYS A 1 56   ? 21.207  62.062 14.005  1.00 63.82  ? 53   LYS A NZ  1 
ATOM 407  N N   . GLU A 1 57   ? 18.942  62.280 18.428  1.00 63.71  ? 54   GLU A N   1 
ATOM 408  C CA  . GLU A 1 57   ? 18.730  60.965 19.024  1.00 63.71  ? 54   GLU A CA  1 
ATOM 409  C C   . GLU A 1 57   ? 19.770  60.094 18.346  1.00 63.71  ? 54   GLU A C   1 
ATOM 410  O O   . GLU A 1 57   ? 19.756  59.974 17.129  1.00 63.71  ? 54   GLU A O   1 
ATOM 411  C CB  . GLU A 1 57   ? 17.328  60.469 18.637  1.00 63.02  ? 54   GLU A CB  1 
ATOM 412  C CG  . GLU A 1 57   ? 16.623  59.549 19.614  1.00 63.02  ? 54   GLU A CG  1 
ATOM 413  C CD  . GLU A 1 57   ? 16.803  58.075 19.287  1.00 63.02  ? 54   GLU A CD  1 
ATOM 414  O OE1 . GLU A 1 57   ? 16.760  57.251 20.217  1.00 63.02  ? 54   GLU A OE1 1 
ATOM 415  O OE2 . GLU A 1 57   ? 16.977  57.713 18.107  1.00 63.02  ? 54   GLU A OE2 1 
ATOM 416  N N   . VAL A 1 58   ? 20.692  59.501 19.092  1.00 68.19  ? 55   VAL A N   1 
ATOM 417  C CA  . VAL A 1 58   ? 21.733  58.702 18.431  1.00 68.19  ? 55   VAL A CA  1 
ATOM 418  C C   . VAL A 1 58   ? 21.925  57.269 18.959  1.00 68.19  ? 55   VAL A C   1 
ATOM 419  O O   . VAL A 1 58   ? 21.807  57.015 20.172  1.00 68.19  ? 55   VAL A O   1 
ATOM 420  C CB  . VAL A 1 58   ? 23.066  59.452 18.411  1.00 49.97  ? 55   VAL A CB  1 
ATOM 421  C CG1 . VAL A 1 58   ? 22.911  60.717 17.600  1.00 49.97  ? 55   VAL A CG1 1 
ATOM 422  C CG2 . VAL A 1 58   ? 23.524  59.780 19.826  1.00 49.97  ? 55   VAL A CG2 1 
ATOM 423  N N   . GLY A 1 59   ? 22.216  56.346 18.035  1.00 69.05  ? 56   GLY A N   1 
ATOM 424  C CA  . GLY A 1 59   ? 22.546  54.955 18.380  1.00 69.05  ? 56   GLY A CA  1 
ATOM 425  C C   . GLY A 1 59   ? 24.000  54.747 18.769  1.00 69.05  ? 56   GLY A C   1 
ATOM 426  O O   . GLY A 1 59   ? 24.905  55.240 18.110  1.00 69.05  ? 56   GLY A O   1 
ATOM 427  N N   . MET A 1 60   ? 24.215  54.041 19.870  1.00 44.75  ? 57   MET A N   1 
ATOM 428  C CA  . MET A 1 60   ? 25.549  53.544 20.275  1.00 44.75  ? 57   MET A CA  1 
ATOM 429  C C   . MET A 1 60   ? 25.566  52.037 20.103  1.00 44.75  ? 57   MET A C   1 
ATOM 430  O O   . MET A 1 60   ? 24.531  51.356 20.270  1.00 44.75  ? 57   MET A O   1 
ATOM 431  C CB  . MET A 1 60   ? 25.861  53.815 21.743  1.00 42.95  ? 57   MET A CB  1 
ATOM 432  C CG  . MET A 1 60   ? 25.705  55.236 22.191  1.00 42.95  ? 57   MET A CG  1 
ATOM 433  S SD  . MET A 1 60   ? 27.166  56.180 21.762  1.00 42.95  ? 57   MET A SD  1 
ATOM 434  C CE  . MET A 1 60   ? 28.432  55.291 22.689  1.00 42.95  ? 57   MET A CE  1 
ATOM 435  N N   . TYR A 1 61   ? 26.758  51.526 19.818  1.00 52.94  ? 58   TYR A N   1 
ATOM 436  C CA  . TYR A 1 61   ? 26.974  50.101 19.677  1.00 52.94  ? 58   TYR A CA  1 
ATOM 437  C C   . TYR A 1 61   ? 27.371  49.512 21.022  1.00 52.94  ? 58   TYR A C   1 
ATOM 438  O O   . TYR A 1 61   ? 28.429  48.887 21.152  1.00 52.94  ? 58   TYR A O   1 
ATOM 439  C CB  . TYR A 1 61   ? 28.032  49.841 18.598  1.00 44.79  ? 58   TYR A CB  1 
ATOM 440  C CG  . TYR A 1 61   ? 27.503  49.959 17.187  1.00 44.79  ? 58   TYR A CG  1 
ATOM 441  C CD1 . TYR A 1 61   ? 26.128  49.909 16.925  1.00 44.79  ? 58   TYR A CD1 1 
ATOM 442  C CD2 . TYR A 1 61   ? 28.381  50.080 16.100  1.00 44.79  ? 58   TYR A CD2 1 
ATOM 443  C CE1 . TYR A 1 61   ? 25.629  50.001 15.622  1.00 44.79  ? 58   TYR A CE1 1 
ATOM 444  C CE2 . TYR A 1 61   ? 27.895  50.169 14.780  1.00 44.79  ? 58   TYR A CE2 1 
ATOM 445  C CZ  . TYR A 1 61   ? 26.519  50.129 14.556  1.00 44.79  ? 58   TYR A CZ  1 
ATOM 446  O OH  . TYR A 1 61   ? 26.033  50.214 13.270  1.00 44.79  ? 58   TYR A OH  1 
ATOM 447  N N   . GLY A 1 62   ? 26.493  49.688 22.013  1.00 41.52  ? 59   GLY A N   1 
ATOM 448  C CA  . GLY A 1 62   ? 26.866  49.514 23.428  1.00 41.52  ? 59   GLY A CA  1 
ATOM 449  C C   . GLY A 1 62   ? 25.869  50.051 24.432  1.00 41.52  ? 59   GLY A C   1 
ATOM 450  O O   . GLY A 1 62   ? 25.288  51.109 24.245  1.00 41.52  ? 59   GLY A O   1 
ATOM 451  N N   . LYS A 1 63   ? 25.652  49.290 25.492  1.00 31.77  ? 60   LYS A N   1 
ATOM 452  C CA  . LYS A 1 63   ? 24.849  49.716 26.630  1.00 31.77  ? 60   LYS A CA  1 
ATOM 453  C C   . LYS A 1 63   ? 25.596  50.848 27.329  1.00 31.77  ? 60   LYS A C   1 
ATOM 454  O O   . LYS A 1 63   ? 26.678  50.606 27.882  1.00 31.77  ? 60   LYS A O   1 
ATOM 455  C CB  . LYS A 1 63   ? 24.682  48.547 27.612  1.00 41.19  ? 60   LYS A CB  1 
ATOM 456  C CG  . LYS A 1 63   ? 24.077  47.268 27.016  1.00 41.19  ? 60   LYS A CG  1 
ATOM 457  C CD  . LYS A 1 63   ? 24.220  46.053 27.958  1.00 41.19  ? 60   LYS A CD  1 
ATOM 458  C CE  . LYS A 1 63   ? 23.229  46.085 29.133  1.00 41.19  ? 60   LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 63   ? 21.920  46.733 28.815  1.00 41.19  ? 60   LYS A NZ  1 
ATOM 460  N N   . ILE A 1 64   ? 25.060  52.067 27.302  1.00 33.91  ? 61   ILE A N   1 
ATOM 461  C CA  . ILE A 1 64   ? 25.633  53.191 28.075  1.00 33.91  ? 61   ILE A CA  1 
ATOM 462  C C   . ILE A 1 64   ? 25.578  52.966 29.599  1.00 33.91  ? 61   ILE A C   1 
ATOM 463  O O   . ILE A 1 64   ? 24.543  52.597 30.112  1.00 33.91  ? 61   ILE A O   1 
ATOM 464  C CB  . ILE A 1 64   ? 24.931  54.523 27.760  1.00 22.12  ? 61   ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 64   ? 24.914  54.783 26.251  1.00 22.12  ? 61   ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 64   ? 25.621  55.645 28.481  1.00 22.12  ? 61   ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 64   ? 24.347  56.136 25.849  1.00 22.12  ? 61   ILE A CD1 1 
ATOM 468  N N   . ALA A 1 65   ? 26.682  53.224 30.303  1.00 28.65  ? 62   ALA A N   1 
ATOM 469  C CA  . ALA A 1 65   ? 26.873  52.859 31.718  1.00 28.65  ? 62   ALA A CA  1 
ATOM 470  C C   . ALA A 1 65   ? 27.503  54.003 32.462  1.00 28.65  ? 62   ALA A C   1 
ATOM 471  O O   . ALA A 1 65   ? 27.599  53.986 33.685  1.00 28.65  ? 62   ALA A O   1 
ATOM 472  C CB  . ALA A 1 65   ? 27.797  51.656 31.844  1.00 2.00   ? 62   ALA A CB  1 
ATOM 473  N N   . VAL A 1 66   ? 28.006  54.975 31.723  1.00 43.90  ? 63   VAL A N   1 
ATOM 474  C CA  . VAL A 1 66   ? 28.470  56.214 32.324  1.00 43.90  ? 63   VAL A CA  1 
ATOM 475  C C   . VAL A 1 66   ? 28.191  57.305 31.337  1.00 43.90  ? 63   VAL A C   1 
ATOM 476  O O   . VAL A 1 66   ? 28.528  57.191 30.159  1.00 43.90  ? 63   VAL A O   1 
ATOM 477  C CB  . VAL A 1 66   ? 29.957  56.193 32.611  1.00 18.12  ? 63   VAL A CB  1 
ATOM 478  C CG1 . VAL A 1 66   ? 30.358  57.454 33.328  1.00 18.12  ? 63   VAL A CG1 1 
ATOM 479  C CG2 . VAL A 1 66   ? 30.337  54.953 33.457  1.00 18.12  ? 63   VAL A CG2 1 
ATOM 480  N N   . MET A 1 67   ? 27.544  58.353 31.804  1.00 28.64  ? 64   MET A N   1 
ATOM 481  C CA  . MET A 1 67   ? 27.241  59.492 30.944  1.00 28.64  ? 64   MET A CA  1 
ATOM 482  C C   . MET A 1 67   ? 27.582  60.769 31.717  1.00 28.64  ? 64   MET A C   1 
ATOM 483  O O   . MET A 1 67   ? 26.944  61.081 32.702  1.00 28.64  ? 64   MET A O   1 
ATOM 484  C CB  . MET A 1 67   ? 25.779  59.432 30.511  1.00 31.27  ? 64   MET A CB  1 
ATOM 485  C CG  . MET A 1 67   ? 25.349  60.439 29.462  1.00 31.27  ? 64   MET A CG  1 
ATOM 486  S SD  . MET A 1 67   ? 23.688  60.060 28.845  1.00 31.27  ? 64   MET A SD  1 
ATOM 487  C CE  . MET A 1 67   ? 22.711  60.500 30.300  1.00 31.27  ? 64   MET A CE  1 
ATOM 488  N N   . GLU A 1 68   ? 28.612  61.486 31.316  1.00 36.05  ? 65   GLU A N   1 
ATOM 489  C CA  . GLU A 1 68   ? 29.019  62.672 32.097  1.00 36.05  ? 65   GLU A CA  1 
ATOM 490  C C   . GLU A 1 68   ? 29.434  63.856 31.237  1.00 36.05  ? 65   GLU A C   1 
ATOM 491  O O   . GLU A 1 68   ? 30.205  63.683 30.286  1.00 36.05  ? 65   GLU A O   1 
ATOM 492  C CB  . GLU A 1 68   ? 30.156  62.330 33.066  1.00 77.10  ? 65   GLU A CB  1 
ATOM 493  C CG  . GLU A 1 68   ? 29.758  61.480 34.258  1.00 77.10  ? 65   GLU A CG  1 
ATOM 494  C CD  . GLU A 1 68   ? 28.738  62.144 35.165  1.00 77.10  ? 65   GLU A CD  1 
ATOM 495  O OE1 . GLU A 1 68   ? 27.965  61.397 35.797  1.00 77.10  ? 65   GLU A OE1 1 
ATOM 496  O OE2 . GLU A 1 68   ? 28.696  63.394 35.249  1.00 77.10  ? 65   GLU A OE2 1 
ATOM 497  N N   . LEU A 1 69   ? 28.915  65.036 31.565  1.00 43.35  ? 66   LEU A N   1 
ATOM 498  C CA  . LEU A 1 69   ? 29.343  66.267 30.897  1.00 43.35  ? 66   LEU A CA  1 
ATOM 499  C C   . LEU A 1 69   ? 30.429  66.964 31.698  1.00 43.35  ? 66   LEU A C   1 
ATOM 500  O O   . LEU A 1 69   ? 30.435  66.888 32.922  1.00 43.35  ? 66   LEU A O   1 
ATOM 501  C CB  . LEU A 1 69   ? 28.174  67.232 30.686  1.00 39.59  ? 66   LEU A CB  1 
ATOM 502  C CG  . LEU A 1 69   ? 27.059  66.858 29.712  1.00 39.59  ? 66   LEU A CG  1 
ATOM 503  C CD1 . LEU A 1 69   ? 25.861  67.741 29.961  1.00 39.59  ? 66   LEU A CD1 1 
ATOM 504  C CD2 . LEU A 1 69   ? 27.504  66.913 28.248  1.00 39.59  ? 66   LEU A CD2 1 
ATOM 505  N N   . PHE A 1 70   ? 31.329  67.653 31.001  1.00 46.05  ? 67   PHE A N   1 
ATOM 506  C CA  . PHE A 1 70   ? 32.440  68.395 31.610  1.00 46.05  ? 67   PHE A CA  1 
ATOM 507  C C   . PHE A 1 70   ? 33.030  69.336 30.570  1.00 46.05  ? 67   PHE A C   1 
ATOM 508  O O   . PHE A 1 70   ? 33.006  69.022 29.375  1.00 46.05  ? 67   PHE A O   1 
ATOM 509  C CB  . PHE A 1 70   ? 33.526  67.418 32.061  1.00 54.43  ? 67   PHE A CB  1 
ATOM 510  C CG  . PHE A 1 70   ? 34.158  66.631 30.924  1.00 54.43  ? 67   PHE A CG  1 
ATOM 511  C CD1 . PHE A 1 70   ? 35.477  66.869 30.546  1.00 54.43  ? 67   PHE A CD1 1 
ATOM 512  C CD2 . PHE A 1 70   ? 33.431  65.657 30.232  1.00 54.43  ? 67   PHE A CD2 1 
ATOM 513  C CE1 . PHE A 1 70   ? 36.065  66.150 29.506  1.00 54.43  ? 67   PHE A CE1 1 
ATOM 514  C CE2 . PHE A 1 70   ? 34.006  64.935 29.188  1.00 54.43  ? 67   PHE A CE2 1 
ATOM 515  C CZ  . PHE A 1 70   ? 35.327  65.180 28.824  1.00 54.43  ? 67   PHE A CZ  1 
ATOM 516  N N   . ARG A 1 71   ? 33.564  70.479 31.002  1.00 51.17  ? 68   ARG A N   1 
ATOM 517  C CA  . ARG A 1 71   ? 34.353  71.331 30.080  1.00 51.17  ? 68   ARG A CA  1 
ATOM 518  C C   . ARG A 1 71   ? 35.820  71.433 30.498  1.00 51.17  ? 68   ARG A C   1 
ATOM 519  O O   . ARG A 1 71   ? 36.138  71.956 31.565  1.00 51.17  ? 68   ARG A O   1 
ATOM 520  C CB  . ARG A 1 71   ? 33.689  72.685 29.749  1.00 130.54 ? 68   ARG A CB  1 
ATOM 521  C CG  . ARG A 1 71   ? 33.908  73.831 30.717  1.00 130.54 ? 68   ARG A CG  1 
ATOM 522  C CD  . ARG A 1 71   ? 33.007  75.010 30.357  1.00 130.54 ? 68   ARG A CD  1 
ATOM 523  N NE  . ARG A 1 71   ? 31.586  74.656 30.438  1.00 130.54 ? 68   ARG A NE  1 
ATOM 524  C CZ  . ARG A 1 71   ? 30.887  74.560 31.572  1.00 130.54 ? 68   ARG A CZ  1 
ATOM 525  N NH1 . ARG A 1 71   ? 31.463  74.792 32.749  1.00 130.54 ? 68   ARG A NH1 1 
ATOM 526  N NH2 . ARG A 1 71   ? 29.602  74.227 31.533  1.00 130.54 ? 68   ARG A NH2 1 
ATOM 527  N N   . PRO A 1 72   ? 36.715  70.910 29.649  1.00 65.69  ? 69   PRO A N   1 
ATOM 528  C CA  . PRO A 1 72   ? 38.158  70.956 29.887  1.00 65.69  ? 69   PRO A CA  1 
ATOM 529  C C   . PRO A 1 72   ? 38.701  72.386 29.806  1.00 65.69  ? 69   PRO A C   1 
ATOM 530  O O   . PRO A 1 72   ? 38.018  73.301 29.308  1.00 65.69  ? 69   PRO A O   1 
ATOM 531  C CB  . PRO A 1 72   ? 38.744  70.096 28.756  1.00 52.55  ? 69   PRO A CB  1 
ATOM 532  C CG  . PRO A 1 72   ? 37.572  69.386 28.130  1.00 52.55  ? 69   PRO A CG  1 
ATOM 533  C CD  . PRO A 1 72   ? 36.384  70.244 28.378  1.00 52.55  ? 69   PRO A CD  1 
ATOM 534  N N   . LYS A 1 73   ? 39.920  72.569 30.309  1.00 75.58  ? 70   LYS A N   1 
ATOM 535  C CA  . LYS A 1 73   ? 40.553  73.893 30.376  1.00 75.58  ? 70   LYS A CA  1 
ATOM 536  C C   . LYS A 1 73   ? 40.440  74.672 29.056  1.00 75.58  ? 70   LYS A C   1 
ATOM 537  O O   . LYS A 1 73   ? 40.863  74.201 27.997  1.00 75.58  ? 70   LYS A O   1 
ATOM 538  C CB  . LYS A 1 73   ? 42.016  73.782 30.846  1.00 127.12 ? 70   LYS A CB  1 
ATOM 539  C CG  . LYS A 1 73   ? 42.729  72.440 30.540  1.00 127.12 ? 70   LYS A CG  1 
ATOM 540  C CD  . LYS A 1 73   ? 42.752  71.491 31.754  1.00 127.12 ? 70   LYS A CD  1 
ATOM 541  C CE  . LYS A 1 73   ? 43.909  70.492 31.659  1.00 127.12 ? 70   LYS A CE  1 
ATOM 542  N NZ  . LYS A 1 73   ? 44.135  69.727 32.920  1.00 127.12 ? 70   LYS A NZ  1 
ATOM 543  N N   . GLY A 1 74   ? 39.841  75.856 29.138  1.00 80.04  ? 71   GLY A N   1 
ATOM 544  C CA  . GLY A 1 74   ? 39.654  76.716 27.973  1.00 80.04  ? 71   GLY A CA  1 
ATOM 545  C C   . GLY A 1 74   ? 38.842  76.030 26.894  1.00 80.04  ? 71   GLY A C   1 
ATOM 546  O O   . GLY A 1 74   ? 39.359  75.716 25.813  1.00 80.04  ? 71   GLY A O   1 
ATOM 547  N N   . GLU A 1 75   ? 37.567  75.788 27.192  1.00 84.47  ? 72   GLU A N   1 
ATOM 548  C CA  . GLU A 1 75   ? 36.703  75.076 26.258  1.00 84.47  ? 72   GLU A CA  1 
ATOM 549  C C   . GLU A 1 75   ? 35.374  75.768 26.005  1.00 84.47  ? 72   GLU A C   1 
ATOM 550  O O   . GLU A 1 75   ? 34.723  76.254 26.927  1.00 84.47  ? 72   GLU A O   1 
ATOM 551  C CB  . GLU A 1 75   ? 36.497  73.643 26.719  1.00 85.31  ? 72   GLU A CB  1 
ATOM 552  C CG  . GLU A 1 75   ? 37.470  72.684 26.090  1.00 85.31  ? 72   GLU A CG  1 
ATOM 553  C CD  . GLU A 1 75   ? 36.992  72.168 24.746  1.00 85.31  ? 72   GLU A CD  1 
ATOM 554  O OE1 . GLU A 1 75   ? 35.865  72.513 24.325  1.00 85.31  ? 72   GLU A OE1 1 
ATOM 555  O OE2 . GLU A 1 75   ? 37.742  71.401 24.108  1.00 85.31  ? 72   GLU A OE2 1 
ATOM 556  N N   . SER A 1 76   ? 34.988  75.794 24.734  1.00 58.26  ? 73   SER A N   1 
ATOM 557  C CA  . SER A 1 76   ? 33.800  76.497 24.273  1.00 58.26  ? 73   SER A CA  1 
ATOM 558  C C   . SER A 1 76   ? 32.529  76.024 25.029  1.00 58.26  ? 73   SER A C   1 
ATOM 559  O O   . SER A 1 76   ? 31.992  76.757 25.876  1.00 58.26  ? 73   SER A O   1 
ATOM 560  C CB  . SER A 1 76   ? 33.690  76.333 22.752  1.00 59.71  ? 73   SER A CB  1 
ATOM 561  O OG  . SER A 1 76   ? 32.372  76.570 22.292  1.00 59.71  ? 73   SER A OG  1 
ATOM 562  N N   . LYS A 1 77   ? 32.075  74.801 24.747  1.00 74.50  ? 74   LYS A N   1 
ATOM 563  C CA  . LYS A 1 77   ? 30.912  74.222 25.424  1.00 74.50  ? 74   LYS A CA  1 
ATOM 564  C C   . LYS A 1 77   ? 31.295  72.990 26.228  1.00 74.50  ? 74   LYS A C   1 
ATOM 565  O O   . LYS A 1 77   ? 32.475  72.700 26.366  1.00 74.50  ? 74   LYS A O   1 
ATOM 566  C CB  . LYS A 1 77   ? 29.799  73.909 24.423  1.00 57.09  ? 74   LYS A CB  1 
ATOM 567  C CG  . LYS A 1 77   ? 30.234  73.223 23.124  1.00 57.09  ? 74   LYS A CG  1 
ATOM 568  C CD  . LYS A 1 77   ? 29.159  73.421 22.043  1.00 57.09  ? 74   LYS A CD  1 
ATOM 569  C CE  . LYS A 1 77   ? 29.540  72.786 20.701  1.00 57.09  ? 74   LYS A CE  1 
ATOM 570  N NZ  . LYS A 1 77   ? 30.951  73.008 20.245  1.00 57.09  ? 74   LYS A NZ  1 
ATOM 571  N N   . ASP A 1 78   ? 30.309  72.275 26.771  1.00 40.98  ? 75   ASP A N   1 
ATOM 572  C CA  . ASP A 1 78   ? 30.577  71.046 27.539  1.00 40.98  ? 75   ASP A CA  1 
ATOM 573  C C   . ASP A 1 78   ? 30.975  69.924 26.608  1.00 40.98  ? 75   ASP A C   1 
ATOM 574  O O   . ASP A 1 78   ? 30.498  69.849 25.467  1.00 40.98  ? 75   ASP A O   1 
ATOM 575  C CB  . ASP A 1 78   ? 29.338  70.598 28.319  1.00 64.12  ? 75   ASP A CB  1 
ATOM 576  C CG  . ASP A 1 78   ? 29.169  71.325 29.635  1.00 64.12  ? 75   ASP A CG  1 
ATOM 577  O OD1 . ASP A 1 78   ? 28.040  71.325 30.177  1.00 64.12  ? 75   ASP A OD1 1 
ATOM 578  O OD2 . ASP A 1 78   ? 30.163  71.889 30.140  1.00 64.12  ? 75   ASP A OD2 1 
ATOM 579  N N   . LEU A 1 79   ? 31.829  69.032 27.080  1.00 51.33  ? 76   LEU A N   1 
ATOM 580  C CA  . LEU A 1 79   ? 32.062  67.795 26.345  1.00 51.33  ? 76   LEU A CA  1 
ATOM 581  C C   . LEU A 1 79   ? 31.364  66.591 27.018  1.00 51.33  ? 76   LEU A C   1 
ATOM 582  O O   . LEU A 1 79   ? 30.939  66.675 28.182  1.00 51.33  ? 76   LEU A O   1 
ATOM 583  C CB  . LEU A 1 79   ? 33.560  67.582 26.138  1.00 57.62  ? 76   LEU A CB  1 
ATOM 584  C CG  . LEU A 1 79   ? 34.249  68.544 25.157  1.00 57.62  ? 76   LEU A CG  1 
ATOM 585  C CD1 . LEU A 1 79   ? 35.714  68.138 24.928  1.00 57.62  ? 76   LEU A CD1 1 
ATOM 586  C CD2 . LEU A 1 79   ? 33.511  68.603 23.816  1.00 57.62  ? 76   LEU A CD2 1 
ATOM 587  N N   . LEU A 1 80   ? 31.229  65.484 26.285  1.00 40.50  ? 77   LEU A N   1 
ATOM 588  C CA  . LEU A 1 80   ? 30.495  64.331 26.805  1.00 40.50  ? 77   LEU A CA  1 
ATOM 589  C C   . LEU A 1 80   ? 31.333  63.070 26.956  1.00 40.50  ? 77   LEU A C   1 
ATOM 590  O O   . LEU A 1 80   ? 31.912  62.612 25.995  1.00 40.50  ? 77   LEU A O   1 
ATOM 591  C CB  . LEU A 1 80   ? 29.270  64.029 25.933  1.00 35.78  ? 77   LEU A CB  1 
ATOM 592  C CG  . LEU A 1 80   ? 28.432  62.830 26.431  1.00 35.78  ? 77   LEU A CG  1 
ATOM 593  C CD1 . LEU A 1 80   ? 27.791  63.105 27.786  1.00 35.78  ? 77   LEU A CD1 1 
ATOM 594  C CD2 . LEU A 1 80   ? 27.371  62.420 25.429  1.00 35.78  ? 77   LEU A CD2 1 
ATOM 595  N N   . PHE A 1 81   ? 31.381  62.495 28.156  1.00 47.58  ? 78   PHE A N   1 
ATOM 596  C CA  . PHE A 1 81   ? 32.055  61.205 28.337  1.00 47.58  ? 78   PHE A CA  1 
ATOM 597  C C   . PHE A 1 81   ? 31.059  60.044 28.423  1.00 47.58  ? 78   PHE A C   1 
ATOM 598  O O   . PHE A 1 81   ? 30.060  60.121 29.151  1.00 47.58  ? 78   PHE A O   1 
ATOM 599  C CB  . PHE A 1 81   ? 32.954  61.203 29.567  1.00 47.86  ? 78   PHE A CB  1 
ATOM 600  C CG  . PHE A 1 81   ? 33.559  59.862 29.856  1.00 47.86  ? 78   PHE A CG  1 
ATOM 601  C CD1 . PHE A 1 81   ? 34.419  59.261 28.942  1.00 47.86  ? 78   PHE A CD1 1 
ATOM 602  C CD2 . PHE A 1 81   ? 33.258  59.189 31.026  1.00 47.86  ? 78   PHE A CD2 1 
ATOM 603  C CE1 . PHE A 1 81   ? 34.963  58.011 29.188  1.00 47.86  ? 78   PHE A CE1 1 
ATOM 604  C CE2 . PHE A 1 81   ? 33.811  57.942 31.289  1.00 47.86  ? 78   PHE A CE2 1 
ATOM 605  C CZ  . PHE A 1 81   ? 34.660  57.356 30.371  1.00 47.86  ? 78   PHE A CZ  1 
ATOM 606  N N   . ILE A 1 82   ? 31.335  58.977 27.671  1.00 30.23  ? 79   ILE A N   1 
ATOM 607  C CA  . ILE A 1 82   ? 30.435  57.849 27.605  1.00 30.23  ? 79   ILE A CA  1 
ATOM 608  C C   . ILE A 1 82   ? 31.211  56.572 27.819  1.00 30.23  ? 79   ILE A C   1 
ATOM 609  O O   . ILE A 1 82   ? 32.190  56.320 27.137  1.00 30.23  ? 79   ILE A O   1 
ATOM 610  C CB  . ILE A 1 82   ? 29.713  57.810 26.261  1.00 21.63  ? 79   ILE A CB  1 
ATOM 611  C CG1 . ILE A 1 82   ? 28.696  58.965 26.174  1.00 21.63  ? 79   ILE A CG1 1 
ATOM 612  C CG2 . ILE A 1 82   ? 29.015  56.468 26.039  1.00 21.63  ? 79   ILE A CG2 1 
ATOM 613  C CD1 . ILE A 1 82   ? 27.264  58.631 26.514  1.00 21.63  ? 79   ILE A CD1 1 
ATOM 614  N N   . LEU A 1 83   ? 30.808  55.782 28.799  1.00 43.34  ? 80   LEU A N   1 
ATOM 615  C CA  . LEU A 1 83   ? 31.418  54.499 28.962  1.00 43.34  ? 80   LEU A CA  1 
ATOM 616  C C   . LEU A 1 83   ? 30.401  53.362 28.791  1.00 43.34  ? 80   LEU A C   1 
ATOM 617  O O   . LEU A 1 83   ? 29.406  53.261 29.516  1.00 43.34  ? 80   LEU A O   1 
ATOM 618  C CB  . LEU A 1 83   ? 32.185  54.402 30.285  1.00 31.22  ? 80   LEU A CB  1 
ATOM 619  C CG  . LEU A 1 83   ? 32.710  52.973 30.511  1.00 31.22  ? 80   LEU A CG  1 
ATOM 620  C CD1 . LEU A 1 83   ? 33.735  52.609 29.467  1.00 31.22  ? 80   LEU A CD1 1 
ATOM 621  C CD2 . LEU A 1 83   ? 33.286  52.759 31.875  1.00 31.22  ? 80   LEU A CD2 1 
ATOM 622  N N   . THR A 1 84   ? 30.684  52.519 27.809  1.00 28.25  ? 81   THR A N   1 
ATOM 623  C CA  . THR A 1 84   ? 29.928  51.319 27.506  1.00 28.25  ? 81   THR A CA  1 
ATOM 624  C C   . THR A 1 84   ? 30.134  50.158 28.516  1.00 28.25  ? 81   THR A C   1 
ATOM 625  O O   . THR A 1 84   ? 31.204  50.026 29.101  1.00 28.25  ? 81   THR A O   1 
ATOM 626  C CB  . THR A 1 84   ? 30.315  50.914 26.096  1.00 40.28  ? 81   THR A CB  1 
ATOM 627  O OG1 . THR A 1 84   ? 29.522  51.681 25.187  1.00 40.28  ? 81   THR A OG1 1 
ATOM 628  C CG2 . THR A 1 84   ? 30.101  49.464 25.831  1.00 40.28  ? 81   THR A CG2 1 
ATOM 629  N N   . ALA A 1 85   ? 29.098  49.335 28.719  1.00 36.29  ? 82   ALA A N   1 
ATOM 630  C CA  . ALA A 1 85   ? 29.204  48.113 29.550  1.00 36.29  ? 82   ALA A CA  1 
ATOM 631  C C   . ALA A 1 85   ? 30.237  47.108 29.064  1.00 36.29  ? 82   ALA A C   1 
ATOM 632  O O   . ALA A 1 85   ? 30.789  46.383 29.877  1.00 36.29  ? 82   ALA A O   1 
ATOM 633  C CB  . ALA A 1 85   ? 27.882  47.419 29.687  1.00 40.52  ? 82   ALA A CB  1 
ATOM 634  N N   . LYS A 1 86   ? 30.463  47.022 27.755  1.00 36.16  ? 83   LYS A N   1 
ATOM 635  C CA  . LYS A 1 86   ? 31.570  46.254 27.212  1.00 36.16  ? 83   LYS A CA  1 
ATOM 636  C C   . LYS A 1 86   ? 32.890  47.050 27.242  1.00 36.16  ? 83   LYS A C   1 
ATOM 637  O O   . LYS A 1 86   ? 33.854  46.688 26.556  1.00 36.16  ? 83   LYS A O   1 
ATOM 638  C CB  . LYS A 1 86   ? 31.240  45.799 25.786  1.00 31.83  ? 83   LYS A CB  1 
ATOM 639  C CG  . LYS A 1 86   ? 30.814  44.320 25.593  1.00 31.83  ? 83   LYS A CG  1 
ATOM 640  C CD  . LYS A 1 86   ? 29.802  44.248 24.467  1.00 31.83  ? 83   LYS A CD  1 
ATOM 641  C CE  . LYS A 1 86   ? 29.855  43.000 23.616  1.00 31.83  ? 83   LYS A CE  1 
ATOM 642  N NZ  . LYS A 1 86   ? 29.553  41.746 24.365  1.00 31.83  ? 83   LYS A NZ  1 
ATOM 643  N N   . TYR A 1 87   ? 32.932  48.122 28.037  1.00 36.33  ? 84   TYR A N   1 
ATOM 644  C CA  . TYR A 1 87   ? 34.156  48.959 28.268  1.00 36.33  ? 84   TYR A CA  1 
ATOM 645  C C   . TYR A 1 87   ? 34.712  49.815 27.105  1.00 36.33  ? 84   TYR A C   1 
ATOM 646  O O   . TYR A 1 87   ? 35.884  50.223 27.113  1.00 36.33  ? 84   TYR A O   1 
ATOM 647  C CB  . TYR A 1 87   ? 35.285  48.173 28.933  1.00 33.74  ? 84   TYR A CB  1 
ATOM 648  C CG  . TYR A 1 87   ? 34.828  47.367 30.082  1.00 33.74  ? 84   TYR A CG  1 
ATOM 649  C CD1 . TYR A 1 87   ? 34.431  46.055 29.899  1.00 33.74  ? 84   TYR A CD1 1 
ATOM 650  C CD2 . TYR A 1 87   ? 34.785  47.916 31.377  1.00 33.74  ? 84   TYR A CD2 1 
ATOM 651  C CE1 . TYR A 1 87   ? 34.006  45.293 30.963  1.00 33.74  ? 84   TYR A CE1 1 
ATOM 652  C CE2 . TYR A 1 87   ? 34.342  47.155 32.468  1.00 33.74  ? 84   TYR A CE2 1 
ATOM 653  C CZ  . TYR A 1 87   ? 33.958  45.836 32.238  1.00 33.74  ? 84   TYR A CZ  1 
ATOM 654  O OH  . TYR A 1 87   ? 33.515  45.041 33.270  1.00 33.74  ? 84   TYR A OH  1 
ATOM 655  N N   . ASN A 1 88   ? 33.852  50.138 26.149  1.00 60.43  ? 85   ASN A N   1 
ATOM 656  C CA  . ASN A 1 88   ? 34.183  51.157 25.166  1.00 60.43  ? 85   ASN A CA  1 
ATOM 657  C C   . ASN A 1 88   ? 34.078  52.536 25.803  1.00 60.43  ? 85   ASN A C   1 
ATOM 658  O O   . ASN A 1 88   ? 33.012  52.910 26.273  1.00 60.43  ? 85   ASN A O   1 
ATOM 659  C CB  . ASN A 1 88   ? 33.265  51.055 23.948  1.00 80.97  ? 85   ASN A CB  1 
ATOM 660  C CG  . ASN A 1 88   ? 33.192  49.646 23.386  1.00 80.97  ? 85   ASN A CG  1 
ATOM 661  O OD1 . ASN A 1 88   ? 32.570  48.764 23.972  1.00 80.97  ? 85   ASN A OD1 1 
ATOM 662  N ND2 . ASN A 1 88   ? 33.820  49.431 22.244  1.00 80.97  ? 85   ASN A ND2 1 
ATOM 663  N N   . ALA A 1 89   ? 35.195  53.265 25.860  1.00 55.14  ? 86   ALA A N   1 
ATOM 664  C CA  . ALA A 1 89   ? 35.194  54.678 26.265  1.00 55.14  ? 86   ALA A CA  1 
ATOM 665  C C   . ALA A 1 89   ? 35.168  55.578 25.055  1.00 55.14  ? 86   ALA A C   1 
ATOM 666  O O   . ALA A 1 89   ? 35.470  55.143 23.943  1.00 55.14  ? 86   ALA A O   1 
ATOM 667  C CB  . ALA A 1 89   ? 36.395  54.992 27.069  1.00 33.06  ? 86   ALA A CB  1 
ATOM 668  N N   . CYS A 1 90   ? 34.795  56.835 25.280  1.00 32.13  ? 87   CYS A N   1 
ATOM 669  C CA  . CYS A 1 90   ? 34.839  57.888 24.245  1.00 32.13  ? 87   CYS A CA  1 
ATOM 670  C C   . CYS A 1 90   ? 34.468  59.211 24.862  1.00 32.13  ? 87   CYS A C   1 
ATOM 671  O O   . CYS A 1 90   ? 33.809  59.237 25.881  1.00 32.13  ? 87   CYS A O   1 
ATOM 672  C CB  . CYS A 1 90   ? 33.925  57.584 23.054  1.00 55.26  ? 87   CYS A CB  1 
ATOM 673  S SG  . CYS A 1 90   ? 32.162  57.474 23.414  1.00 55.26  ? 87   CYS A SG  1 
ATOM 674  N N   . ILE A 1 91   ? 34.927  60.296 24.241  1.00 59.95  ? 88   ILE A N   1 
ATOM 675  C CA  . ILE A 1 91   ? 34.565  61.668 24.569  1.00 59.95  ? 88   ILE A CA  1 
ATOM 676  C C   . ILE A 1 91   ? 33.968  62.256 23.318  1.00 59.95  ? 88   ILE A C   1 
ATOM 677  O O   . ILE A 1 91   ? 34.595  62.226 22.261  1.00 59.95  ? 88   ILE A O   1 
ATOM 678  C CB  . ILE A 1 91   ? 35.797  62.504 24.788  1.00 26.30  ? 88   ILE A CB  1 
ATOM 679  C CG1 . ILE A 1 91   ? 36.540  62.131 26.072  1.00 26.30  ? 88   ILE A CG1 1 
ATOM 680  C CG2 . ILE A 1 91   ? 35.451  63.984 24.808  1.00 26.30  ? 88   ILE A CG2 1 
ATOM 681  C CD1 . ILE A 1 91   ? 37.646  63.124 26.402  1.00 26.30  ? 88   ILE A CD1 1 
ATOM 682  N N   . LEU A 1 92   ? 32.784  62.834 23.425  1.00 53.78  ? 89   LEU A N   1 
ATOM 683  C CA  . LEU A 1 92   ? 32.069  63.298 22.242  1.00 53.78  ? 89   LEU A CA  1 
ATOM 684  C C   . LEU A 1 92   ? 31.824  64.796 22.226  1.00 53.78  ? 89   LEU A C   1 
ATOM 685  O O   . LEU A 1 92   ? 31.722  65.445 23.279  1.00 53.78  ? 89   LEU A O   1 
ATOM 686  C CB  . LEU A 1 92   ? 30.741  62.555 22.111  1.00 36.90  ? 89   LEU A CB  1 
ATOM 687  C CG  . LEU A 1 92   ? 30.742  61.036 22.369  1.00 36.90  ? 89   LEU A CG  1 
ATOM 688  C CD1 . LEU A 1 92   ? 29.371  60.442 22.049  1.00 36.90  ? 89   LEU A CD1 1 
ATOM 689  C CD2 . LEU A 1 92   ? 31.805  60.329 21.580  1.00 36.90  ? 89   LEU A CD2 1 
ATOM 690  N N   . GLU A 1 93   ? 31.744  65.342 21.014  1.00 48.49  ? 90   GLU A N   1 
ATOM 691  C CA  . GLU A 1 93   ? 31.428  66.760 20.810  1.00 48.49  ? 90   GLU A CA  1 
ATOM 692  C C   . GLU A 1 93   ? 30.200  66.948 19.922  1.00 48.49  ? 90   GLU A C   1 
ATOM 693  O O   . GLU A 1 93   ? 29.989  66.196 18.964  1.00 48.49  ? 90   GLU A O   1 
ATOM 694  C CB  . GLU A 1 93   ? 32.620  67.534 20.251  1.00 68.08  ? 90   GLU A CB  1 
ATOM 695  C CG  . GLU A 1 93   ? 32.477  69.032 20.425  1.00 68.08  ? 90   GLU A CG  1 
ATOM 696  C CD  . GLU A 1 93   ? 33.254  69.850 19.413  1.00 68.08  ? 90   GLU A CD  1 
ATOM 697  O OE1 . GLU A 1 93   ? 34.371  69.436 19.017  1.00 68.08  ? 90   GLU A OE1 1 
ATOM 698  O OE2 . GLU A 1 93   ? 32.738  70.922 19.037  1.00 68.08  ? 90   GLU A OE2 1 
ATOM 699  N N   . TYR A 1 94   ? 29.399  67.958 20.261  1.00 66.16  ? 91   TYR A N   1 
ATOM 700  C CA  . TYR A 1 94   ? 28.208  68.288 19.498  1.00 66.16  ? 91   TYR A CA  1 
ATOM 701  C C   . TYR A 1 94   ? 28.535  69.355 18.473  1.00 66.16  ? 91   TYR A C   1 
ATOM 702  O O   . TYR A 1 94   ? 28.641  70.519 18.821  1.00 66.16  ? 91   TYR A O   1 
ATOM 703  C CB  . TYR A 1 94   ? 27.097  68.787 20.429  1.00 62.38  ? 91   TYR A CB  1 
ATOM 704  C CG  . TYR A 1 94   ? 25.802  69.069 19.709  1.00 62.38  ? 91   TYR A CG  1 
ATOM 705  C CD1 . TYR A 1 94   ? 24.882  68.056 19.485  1.00 62.38  ? 91   TYR A CD1 1 
ATOM 706  C CD2 . TYR A 1 94   ? 25.502  70.357 19.246  1.00 62.38  ? 91   TYR A CD2 1 
ATOM 707  C CE1 . TYR A 1 94   ? 23.701  68.306 18.811  1.00 62.38  ? 91   TYR A CE1 1 
ATOM 708  C CE2 . TYR A 1 94   ? 24.325  70.622 18.575  1.00 62.38  ? 91   TYR A CE2 1 
ATOM 709  C CZ  . TYR A 1 94   ? 23.428  69.590 18.349  1.00 62.38  ? 91   TYR A CZ  1 
ATOM 710  O OH  . TYR A 1 94   ? 22.241  69.840 17.688  1.00 62.38  ? 91   TYR A OH  1 
ATOM 711  N N   . LYS A 1 95   ? 28.700  68.964 17.214  1.00 77.02  ? 92   LYS A N   1 
ATOM 712  C CA  . LYS A 1 95   ? 29.000  69.927 16.150  1.00 77.02  ? 92   LYS A CA  1 
ATOM 713  C C   . LYS A 1 95   ? 27.756  70.175 15.295  1.00 77.02  ? 92   LYS A C   1 
ATOM 714  O O   . LYS A 1 95   ? 27.311  69.274 14.568  1.00 77.02  ? 92   LYS A O   1 
ATOM 715  C CB  . LYS A 1 95   ? 30.166  69.430 15.286  1.00 100.71 ? 92   LYS A CB  1 
ATOM 716  C CG  . LYS A 1 95   ? 30.768  70.480 14.350  1.00 100.71 ? 92   LYS A CG  1 
ATOM 717  C CD  . LYS A 1 95   ? 31.961  69.927 13.554  1.00 100.71 ? 92   LYS A CD  1 
ATOM 718  C CE  . LYS A 1 95   ? 33.275  69.984 14.345  1.00 100.71 ? 92   LYS A CE  1 
ATOM 719  N NZ  . LYS A 1 95   ? 34.383  69.201 13.710  1.00 100.71 ? 92   LYS A NZ  1 
ATOM 720  N N   . GLN A 1 96   ? 27.199  71.390 15.391  1.00 76.88  ? 93   GLN A N   1 
ATOM 721  C CA  . GLN A 1 96   ? 25.999  71.784 14.608  1.00 76.88  ? 93   GLN A CA  1 
ATOM 722  C C   . GLN A 1 96   ? 26.355  72.541 13.312  1.00 76.88  ? 93   GLN A C   1 
ATOM 723  O O   . GLN A 1 96   ? 25.525  73.260 12.760  1.00 76.88  ? 93   GLN A O   1 
ATOM 724  C CB  . GLN A 1 96   ? 25.014  72.594 15.478  1.00 132.77 ? 93   GLN A CB  1 
ATOM 725  C CG  . GLN A 1 96   ? 23.567  72.680 14.943  1.00 132.77 ? 93   GLN A CG  1 
ATOM 726  C CD  . GLN A 1 96   ? 22.521  72.954 16.030  1.00 132.77 ? 93   GLN A CD  1 
ATOM 727  O OE1 . GLN A 1 96   ? 22.777  73.665 17.007  1.00 132.77 ? 93   GLN A OE1 1 
ATOM 728  N NE2 . GLN A 1 96   ? 21.332  72.390 15.854  1.00 132.77 ? 93   GLN A NE2 1 
ATOM 729  N N   . SER A 1 97   ? 27.584  72.332 12.831  1.00 134.01 ? 94   SER A N   1 
ATOM 730  C CA  . SER A 1 97   ? 28.180  73.053 11.689  1.00 134.01 ? 94   SER A CA  1 
ATOM 731  C C   . SER A 1 97   ? 27.201  73.633 10.654  1.00 134.01 ? 94   SER A C   1 
ATOM 732  O O   . SER A 1 97   ? 27.116  74.852 10.491  1.00 134.01 ? 94   SER A O   1 
ATOM 733  C CB  . SER A 1 97   ? 29.246  72.188 10.995  1.00 110.52 ? 94   SER A CB  1 
ATOM 734  O OG  . SER A 1 97   ? 28.676  71.347 10.008  1.00 110.52 ? 94   SER A OG  1 
ATOM 735  N N   . GLY A 1 98   ? 26.471  72.761 9.962   1.00 99.07  ? 95   GLY A N   1 
ATOM 736  C CA  . GLY A 1 98   ? 25.545  73.207 8.928   1.00 99.07  ? 95   GLY A CA  1 
ATOM 737  C C   . GLY A 1 98   ? 24.121  73.373 9.422   1.00 99.07  ? 95   GLY A C   1 
ATOM 738  O O   . GLY A 1 98   ? 23.866  73.983 10.466  1.00 99.07  ? 95   GLY A O   1 
ATOM 739  N N   . GLU A 1 99   ? 23.192  72.848 8.632   1.00 115.69 ? 96   GLU A N   1 
ATOM 740  C CA  . GLU A 1 99   ? 21.805  72.706 9.032   1.00 115.69 ? 96   GLU A CA  1 
ATOM 741  C C   . GLU A 1 99   ? 21.606  71.246 9.414   1.00 115.69 ? 96   GLU A C   1 
ATOM 742  O O   . GLU A 1 99   ? 20.490  70.816 9.700   1.00 115.69 ? 96   GLU A O   1 
ATOM 743  C CB  . GLU A 1 99   ? 20.875  73.087 7.881   1.00 132.79 ? 96   GLU A CB  1 
ATOM 744  C CG  . GLU A 1 99   ? 20.853  74.584 7.556   1.00 132.79 ? 96   GLU A CG  1 
ATOM 745  C CD  . GLU A 1 99   ? 20.353  74.857 6.132   1.00 132.79 ? 96   GLU A CD  1 
ATOM 746  O OE1 . GLU A 1 99   ? 19.362  75.616 5.981   1.00 132.79 ? 96   GLU A OE1 1 
ATOM 747  O OE2 . GLU A 1 99   ? 20.950  74.309 5.158   1.00 132.79 ? 96   GLU A OE2 1 
ATOM 748  N N   . SER A 1 100  ? 22.702  70.487 9.394   1.00 114.29 ? 97   SER A N   1 
ATOM 749  C CA  . SER A 1 100  ? 22.727  69.120 9.891   1.00 114.29 ? 97   SER A CA  1 
ATOM 750  C C   . SER A 1 100  ? 23.595  69.076 11.147  1.00 114.29 ? 97   SER A C   1 
ATOM 751  O O   . SER A 1 100  ? 24.423  69.966 11.370  1.00 114.29 ? 97   SER A O   1 
ATOM 752  C CB  . SER A 1 100  ? 23.282  68.173 8.831   1.00 82.11  ? 97   SER A CB  1 
ATOM 753  O OG  . SER A 1 100  ? 24.697  68.091 8.932   1.00 82.11  ? 97   SER A OG  1 
ATOM 754  N N   . ILE A 1 101  ? 23.415  68.030 11.951  1.00 64.49  ? 98   ILE A N   1 
ATOM 755  C CA  . ILE A 1 101  ? 24.050  67.934 13.270  1.00 64.49  ? 98   ILE A CA  1 
ATOM 756  C C   . ILE A 1 101  ? 24.896  66.675 13.428  1.00 64.49  ? 98   ILE A C   1 
ATOM 757  O O   . ILE A 1 101  ? 24.463  65.581 13.074  1.00 64.49  ? 98   ILE A O   1 
ATOM 758  C CB  . ILE A 1 101  ? 22.992  68.009 14.408  1.00 59.86  ? 98   ILE A CB  1 
ATOM 759  C CG1 . ILE A 1 101  ? 21.741  67.202 14.027  1.00 59.86  ? 98   ILE A CG1 1 
ATOM 760  C CG2 . ILE A 1 101  ? 22.612  69.468 14.676  1.00 59.86  ? 98   ILE A CG2 1 
ATOM 761  C CD1 . ILE A 1 101  ? 20.447  67.694 14.671  1.00 59.86  ? 98   ILE A CD1 1 
ATOM 762  N N   . ASP A 1 102  ? 26.100  66.814 13.971  1.00 78.84  ? 99   ASP A N   1 
ATOM 763  C CA  . ASP A 1 102  ? 26.950  65.637 14.145  1.00 78.84  ? 99   ASP A CA  1 
ATOM 764  C C   . ASP A 1 102  ? 27.612  65.472 15.513  1.00 78.84  ? 99   ASP A C   1 
ATOM 765  O O   . ASP A 1 102  ? 27.863  66.456 16.227  1.00 78.84  ? 99   ASP A O   1 
ATOM 766  C CB  . ASP A 1 102  ? 27.980  65.559 13.024  1.00 88.95  ? 99   ASP A CB  1 
ATOM 767  C CG  . ASP A 1 102  ? 27.338  65.350 11.678  1.00 88.95  ? 99   ASP A CG  1 
ATOM 768  O OD1 . ASP A 1 102  ? 26.608  64.346 11.508  1.00 88.95  ? 99   ASP A OD1 1 
ATOM 769  O OD2 . ASP A 1 102  ? 27.550  66.202 10.796  1.00 88.95  ? 99   ASP A OD2 1 
ATOM 770  N N   . ILE A 1 103  ? 27.875  64.207 15.862  1.00 53.91  ? 100  ILE A N   1 
ATOM 771  C CA  . ILE A 1 103  ? 28.568  63.849 17.108  1.00 53.91  ? 100  ILE A CA  1 
ATOM 772  C C   . ILE A 1 103  ? 29.954  63.277 16.845  1.00 53.91  ? 100  ILE A C   1 
ATOM 773  O O   . ILE A 1 103  ? 30.110  62.107 16.488  1.00 53.91  ? 100  ILE A O   1 
ATOM 774  C CB  . ILE A 1 103  ? 27.752  62.889 17.966  1.00 47.43  ? 100  ILE A CB  1 
ATOM 775  C CG1 . ILE A 1 103  ? 26.347  63.438 18.154  1.00 47.43  ? 100  ILE A CG1 1 
ATOM 776  C CG2 . ILE A 1 103  ? 28.398  62.728 19.335  1.00 47.43  ? 100  ILE A CG2 1 
ATOM 777  C CD1 . ILE A 1 103  ? 25.404  62.397 18.620  1.00 47.43  ? 100  ILE A CD1 1 
ATOM 778  N N   . ILE A 1 104  ? 30.950  64.133 17.045  1.00 61.91  ? 101  ILE A N   1 
ATOM 779  C CA  . ILE A 1 104  ? 32.328  63.841 16.705  1.00 61.91  ? 101  ILE A CA  1 
ATOM 780  C C   . ILE A 1 104  ? 33.038  63.132 17.868  1.00 61.91  ? 101  ILE A C   1 
ATOM 781  O O   . ILE A 1 104  ? 32.792  63.423 19.039  1.00 61.91  ? 101  ILE A O   1 
ATOM 782  C CB  . ILE A 1 104  ? 33.061  65.141 16.248  1.00 95.92  ? 101  ILE A CB  1 
ATOM 783  C CG1 . ILE A 1 104  ? 34.390  64.832 15.556  1.00 95.92  ? 101  ILE A CG1 1 
ATOM 784  C CG2 . ILE A 1 104  ? 33.244  66.107 17.389  1.00 95.92  ? 101  ILE A CG2 1 
ATOM 785  C CD1 . ILE A 1 104  ? 34.299  64.863 14.039  1.00 95.92  ? 101  ILE A CD1 1 
ATOM 786  N N   . THR A 1 105  ? 33.900  62.183 17.529  1.00 81.09  ? 102  THR A N   1 
ATOM 787  C CA  . THR A 1 105  ? 34.668  61.459 18.522  1.00 81.09  ? 102  THR A CA  1 
ATOM 788  C C   . THR A 1 105  ? 36.006  62.130 18.735  1.00 81.09  ? 102  THR A C   1 
ATOM 789  O O   . THR A 1 105  ? 36.947  61.892 17.986  1.00 81.09  ? 102  THR A O   1 
ATOM 790  C CB  . THR A 1 105  ? 34.908  60.014 18.079  1.00 56.07  ? 102  THR A CB  1 
ATOM 791  O OG1 . THR A 1 105  ? 33.659  59.435 17.700  1.00 56.07  ? 102  THR A OG1 1 
ATOM 792  C CG2 . THR A 1 105  ? 35.522  59.197 19.198  1.00 56.07  ? 102  THR A CG2 1 
ATOM 793  N N   . ARG A 1 106  ? 36.087  62.954 19.773  1.00 63.47  ? 103  ARG A N   1 
ATOM 794  C CA  . ARG A 1 106  ? 37.322  63.663 20.124  1.00 63.47  ? 103  ARG A CA  1 
ATOM 795  C C   . ARG A 1 106  ? 38.379  62.723 20.653  1.00 63.47  ? 103  ARG A C   1 
ATOM 796  O O   . ARG A 1 106  ? 39.579  63.007 20.566  1.00 63.47  ? 103  ARG A O   1 
ATOM 797  C CB  . ARG A 1 106  ? 37.037  64.734 21.169  1.00 43.19  ? 103  ARG A CB  1 
ATOM 798  C CG  . ARG A 1 106  ? 36.518  66.017 20.580  1.00 43.19  ? 103  ARG A CG  1 
ATOM 799  C CD  . ARG A 1 106  ? 37.656  66.992 20.400  1.00 43.19  ? 103  ARG A CD  1 
ATOM 800  N NE  . ARG A 1 106  ? 37.308  68.342 20.842  1.00 43.19  ? 103  ARG A NE  1 
ATOM 801  C CZ  . ARG A 1 106  ? 37.929  68.976 21.840  1.00 43.19  ? 103  ARG A CZ  1 
ATOM 802  N NH1 . ARG A 1 106  ? 38.943  68.391 22.498  1.00 43.19  ? 103  ARG A NH1 1 
ATOM 803  N NH2 . ARG A 1 106  ? 37.550  70.211 22.184  1.00 43.19  ? 103  ARG A NH2 1 
ATOM 804  N N   . ALA A 1 107  ? 37.925  61.617 21.231  1.00 42.22  ? 104  ALA A N   1 
ATOM 805  C CA  . ALA A 1 107  ? 38.823  60.547 21.665  1.00 42.22  ? 104  ALA A CA  1 
ATOM 806  C C   . ALA A 1 107  ? 38.023  59.284 21.874  1.00 42.22  ? 104  ALA A C   1 
ATOM 807  O O   . ALA A 1 107  ? 36.788  59.307 21.763  1.00 42.22  ? 104  ALA A O   1 
ATOM 808  C CB  . ALA A 1 107  ? 39.518  60.924 22.941  1.00 15.36  ? 104  ALA A CB  1 
ATOM 809  N N   . HIS A 1 108  ? 38.719  58.188 22.174  1.00 49.05  ? 105  HIS A N   1 
ATOM 810  C CA  . HIS A 1 108  ? 38.084  56.893 22.374  1.00 49.05  ? 105  HIS A CA  1 
ATOM 811  C C   . HIS A 1 108  ? 39.119  55.792 22.453  1.00 49.05  ? 105  HIS A C   1 
ATOM 812  O O   . HIS A 1 108  ? 40.204  55.906 21.862  1.00 49.05  ? 105  HIS A O   1 
ATOM 813  C CB  . HIS A 1 108  ? 37.121  56.557 21.233  1.00 67.73  ? 105  HIS A CB  1 
ATOM 814  C CG  . HIS A 1 108  ? 37.777  55.856 20.090  1.00 67.73  ? 105  HIS A CG  1 
ATOM 815  N ND1 . HIS A 1 108  ? 38.547  56.519 19.156  1.00 67.73  ? 105  HIS A ND1 1 
ATOM 816  C CD2 . HIS A 1 108  ? 37.799  54.546 19.741  1.00 67.73  ? 105  HIS A CD2 1 
ATOM 817  C CE1 . HIS A 1 108  ? 39.004  55.647 18.275  1.00 67.73  ? 105  HIS A CE1 1 
ATOM 818  N NE2 . HIS A 1 108  ? 38.563  54.445 18.605  1.00 67.73  ? 105  HIS A NE2 1 
ATOM 819  N N   . GLY A 1 109  ? 38.730  54.723 23.159  1.00 57.13  ? 106  GLY A N   1 
ATOM 820  C CA  . GLY A 1 109  ? 39.510  53.515 23.383  1.00 57.13  ? 106  GLY A CA  1 
ATOM 821  C C   . GLY A 1 109  ? 38.794  52.556 24.322  1.00 57.13  ? 106  GLY A C   1 
ATOM 822  O O   . GLY A 1 109  ? 37.916  52.950 25.097  1.00 57.13  ? 106  GLY A O   1 
ATOM 823  N N   . ASN A 1 110  ? 39.175  51.286 24.261  1.00 38.57  ? 107  ASN A N   1 
ATOM 824  C CA  . ASN A 1 110  ? 38.599  50.289 25.129  1.00 38.57  ? 107  ASN A CA  1 
ATOM 825  C C   . ASN A 1 110  ? 39.365  50.090 26.468  1.00 38.57  ? 107  ASN A C   1 
ATOM 826  O O   . ASN A 1 110  ? 40.545  49.723 26.497  1.00 38.57  ? 107  ASN A O   1 
ATOM 827  C CB  . ASN A 1 110  ? 38.405  48.983 24.360  1.00 35.85  ? 107  ASN A CB  1 
ATOM 828  C CG  . ASN A 1 110  ? 37.509  48.006 25.105  1.00 35.85  ? 107  ASN A CG  1 
ATOM 829  O OD1 . ASN A 1 110  ? 37.728  47.734 26.298  1.00 35.85  ? 107  ASN A OD1 1 
ATOM 830  N ND2 . ASN A 1 110  ? 36.474  47.496 24.428  1.00 35.85  ? 107  ASN A ND2 1 
ATOM 831  N N   . VAL A 1 111  ? 38.665  50.292 27.581  1.00 33.29  ? 108  VAL A N   1 
ATOM 832  C CA  . VAL A 1 111  ? 39.319  50.321 28.903  1.00 33.29  ? 108  VAL A CA  1 
ATOM 833  C C   . VAL A 1 111  ? 39.167  49.033 29.726  1.00 33.29  ? 108  VAL A C   1 
ATOM 834  O O   . VAL A 1 111  ? 39.528  48.972 30.926  1.00 33.29  ? 108  VAL A O   1 
ATOM 835  C CB  . VAL A 1 111  ? 38.901  51.569 29.700  1.00 40.27  ? 108  VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 111  ? 39.141  52.820 28.851  1.00 40.27  ? 108  VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 111  ? 37.429  51.489 30.093  1.00 40.27  ? 108  VAL A CG2 1 
ATOM 838  N N   . GLN A 1 112  ? 38.649  47.994 29.074  1.00 68.62  ? 109  GLN A N   1 
ATOM 839  C CA  . GLN A 1 112  ? 38.634  46.656 29.642  1.00 68.62  ? 109  GLN A CA  1 
ATOM 840  C C   . GLN A 1 112  ? 39.993  46.276 30.263  1.00 68.62  ? 109  GLN A C   1 
ATOM 841  O O   . GLN A 1 112  ? 41.039  46.682 29.768  1.00 68.62  ? 109  GLN A O   1 
ATOM 842  C CB  . GLN A 1 112  ? 38.287  45.682 28.531  1.00 80.36  ? 109  GLN A CB  1 
ATOM 843  C CG  . GLN A 1 112  ? 37.909  44.308 28.991  1.00 80.36  ? 109  GLN A CG  1 
ATOM 844  C CD  . GLN A 1 112  ? 37.190  43.536 27.916  1.00 80.36  ? 109  GLN A CD  1 
ATOM 845  O OE1 . GLN A 1 112  ? 37.371  43.797 26.729  1.00 80.36  ? 109  GLN A OE1 1 
ATOM 846  N NE2 . GLN A 1 112  ? 36.362  42.577 28.325  1.00 80.36  ? 109  GLN A NE2 1 
ATOM 847  N N   . ASP A 1 113  ? 39.978  45.509 31.346  1.00 66.13  ? 110  ASP A N   1 
ATOM 848  C CA  . ASP A 1 113  ? 41.214  44.936 31.875  1.00 66.13  ? 110  ASP A CA  1 
ATOM 849  C C   . ASP A 1 113  ? 41.184  43.426 31.896  1.00 66.13  ? 110  ASP A C   1 
ATOM 850  O O   . ASP A 1 113  ? 40.235  42.826 32.368  1.00 66.13  ? 110  ASP A O   1 
ATOM 851  C CB  . ASP A 1 113  ? 41.521  45.455 33.269  1.00 57.35  ? 110  ASP A CB  1 
ATOM 852  C CG  . ASP A 1 113  ? 42.128  46.823 33.246  1.00 57.35  ? 110  ASP A CG  1 
ATOM 853  O OD1 . ASP A 1 113  ? 43.074  47.049 32.463  1.00 57.35  ? 110  ASP A OD1 1 
ATOM 854  O OD2 . ASP A 1 113  ? 41.676  47.678 34.028  1.00 57.35  ? 110  ASP A OD2 1 
ATOM 855  N N   . ARG A 1 114  ? 42.240  42.816 31.381  1.00 62.37  ? 111  ARG A N   1 
ATOM 856  C CA  . ARG A 1 114  ? 42.378  41.361 31.338  1.00 62.37  ? 111  ARG A CA  1 
ATOM 857  C C   . ARG A 1 114  ? 42.210  40.757 32.728  1.00 62.37  ? 111  ARG A C   1 
ATOM 858  O O   . ARG A 1 114  ? 41.677  39.668 32.876  1.00 62.37  ? 111  ARG A O   1 
ATOM 859  C CB  . ARG A 1 114  ? 43.758  41.012 30.767  1.00 121.26 ? 111  ARG A CB  1 
ATOM 860  C CG  . ARG A 1 114  ? 43.844  39.671 30.071  1.00 121.26 ? 111  ARG A CG  1 
ATOM 861  C CD  . ARG A 1 114  ? 42.817  39.560 28.965  1.00 121.26 ? 111  ARG A CD  1 
ATOM 862  N NE  . ARG A 1 114  ? 42.401  38.175 28.788  1.00 121.26 ? 111  ARG A NE  1 
ATOM 863  C CZ  . ARG A 1 114  ? 41.140  37.780 28.632  1.00 121.26 ? 111  ARG A CZ  1 
ATOM 864  N NH1 . ARG A 1 114  ? 40.152  38.669 28.639  1.00 121.26 ? 111  ARG A NH1 1 
ATOM 865  N NH2 . ARG A 1 114  ? 40.867  36.489 28.480  1.00 121.26 ? 111  ARG A NH2 1 
ATOM 866  N N   . ILE A 1 115  ? 42.668  41.478 33.747  1.00 94.31  ? 112  ILE A N   1 
ATOM 867  C CA  . ILE A 1 115  ? 42.448  41.072 35.137  1.00 94.31  ? 112  ILE A CA  1 
ATOM 868  C C   . ILE A 1 115  ? 41.150  41.649 35.715  1.00 94.31  ? 112  ILE A C   1 
ATOM 869  O O   . ILE A 1 115  ? 40.466  42.452 35.072  1.00 94.31  ? 112  ILE A O   1 
ATOM 870  C CB  . ILE A 1 115  ? 43.659  41.430 36.070  1.00 56.71  ? 112  ILE A CB  1 
ATOM 871  C CG1 . ILE A 1 115  ? 44.147  42.872 35.869  1.00 56.71  ? 112  ILE A CG1 1 
ATOM 872  C CG2 . ILE A 1 115  ? 44.805  40.471 35.848  1.00 56.71  ? 112  ILE A CG2 1 
ATOM 873  C CD1 . ILE A 1 115  ? 45.078  43.369 36.957  1.00 56.71  ? 112  ILE A CD1 1 
ATOM 874  N N   . GLY A 1 116  ? 40.798  41.210 36.920  1.00 55.80  ? 113  GLY A N   1 
ATOM 875  C CA  . GLY A 1 116  ? 39.754  41.885 37.697  1.00 55.80  ? 113  GLY A CA  1 
ATOM 876  C C   . GLY A 1 116  ? 38.319  41.444 37.537  1.00 55.80  ? 113  GLY A C   1 
ATOM 877  O O   . GLY A 1 116  ? 37.812  41.304 36.427  1.00 55.80  ? 113  GLY A O   1 
ATOM 878  N N   . ARG A 1 117  ? 37.677  41.241 38.684  1.00 46.66  ? 114  ARG A N   1 
ATOM 879  C CA  . ARG A 1 117  ? 36.257  40.891 38.764  1.00 46.66  ? 114  ARG A CA  1 
ATOM 880  C C   . ARG A 1 117  ? 35.359  42.143 38.812  1.00 46.66  ? 114  ARG A C   1 
ATOM 881  O O   . ARG A 1 117  ? 35.575  43.002 39.677  1.00 46.66  ? 114  ARG A O   1 
ATOM 882  C CB  . ARG A 1 117  ? 36.011  40.005 39.993  1.00 85.98  ? 114  ARG A CB  1 
ATOM 883  C CG  . ARG A 1 117  ? 36.832  40.379 41.229  1.00 85.98  ? 114  ARG A CG  1 
ATOM 884  C CD  . ARG A 1 117  ? 36.208  39.795 42.494  1.00 85.98  ? 114  ARG A CD  1 
ATOM 885  N NE  . ARG A 1 117  ? 37.100  39.849 43.664  1.00 85.98  ? 114  ARG A NE  1 
ATOM 886  C CZ  . ARG A 1 117  ? 36.840  40.481 44.815  1.00 85.98  ? 114  ARG A CZ  1 
ATOM 887  N NH1 . ARG A 1 117  ? 35.705  41.154 44.991  1.00 85.98  ? 114  ARG A NH1 1 
ATOM 888  N NH2 . ARG A 1 117  ? 37.726  40.436 45.807  1.00 85.98  ? 114  ARG A NH2 1 
ATOM 889  N N   . PRO A 1 118  ? 34.352  42.245 37.885  1.00 34.65  ? 115  PRO A N   1 
ATOM 890  C CA  . PRO A 1 118  ? 33.338  43.341 37.823  1.00 34.65  ? 115  PRO A CA  1 
ATOM 891  C C   . PRO A 1 118  ? 32.758  43.535 39.196  1.00 34.65  ? 115  PRO A C   1 
ATOM 892  O O   . PRO A 1 118  ? 32.279  42.588 39.801  1.00 34.65  ? 115  PRO A O   1 
ATOM 893  C CB  . PRO A 1 118  ? 32.247  42.787 36.921  1.00 34.16  ? 115  PRO A CB  1 
ATOM 894  C CG  . PRO A 1 118  ? 32.822  41.677 36.200  1.00 34.16  ? 115  PRO A CG  1 
ATOM 895  C CD  . PRO A 1 118  ? 34.114  41.244 36.829  1.00 34.16  ? 115  PRO A CD  1 
ATOM 896  N N   . SER A 1 119  ? 32.854  44.743 39.709  1.00 46.60  ? 116  SER A N   1 
ATOM 897  C CA  . SER A 1 119  ? 32.584  44.979 41.100  1.00 46.60  ? 116  SER A CA  1 
ATOM 898  C C   . SER A 1 119  ? 31.080  44.842 41.398  1.00 46.60  ? 116  SER A C   1 
ATOM 899  O O   . SER A 1 119  ? 30.236  44.952 40.489  1.00 46.60  ? 116  SER A O   1 
ATOM 900  C CB  . SER A 1 119  ? 33.071  46.379 41.422  1.00 56.94  ? 116  SER A CB  1 
ATOM 901  O OG  . SER A 1 119  ? 34.010  46.358 42.469  1.00 56.94  ? 116  SER A OG  1 
ATOM 902  N N   . GLU A 1 120  ? 30.748  44.589 42.660  1.00 115.08 ? 117  GLU A N   1 
ATOM 903  C CA  . GLU A 1 120  ? 29.366  44.704 43.090  1.00 115.08 ? 117  GLU A CA  1 
ATOM 904  C C   . GLU A 1 120  ? 29.081  46.170 43.342  1.00 115.08 ? 117  GLU A C   1 
ATOM 905  O O   . GLU A 1 120  ? 29.870  46.863 43.985  1.00 115.08 ? 117  GLU A O   1 
ATOM 906  C CB  . GLU A 1 120  ? 29.097  43.891 44.345  1.00 74.20  ? 117  GLU A CB  1 
ATOM 907  C CG  . GLU A 1 120  ? 27.608  43.669 44.610  1.00 74.20  ? 117  GLU A CG  1 
ATOM 908  C CD  . GLU A 1 120  ? 27.317  43.077 45.993  1.00 74.20  ? 117  GLU A CD  1 
ATOM 909  O OE1 . GLU A 1 120  ? 26.136  42.738 46.255  1.00 74.20  ? 117  GLU A OE1 1 
ATOM 910  O OE2 . GLU A 1 120  ? 28.266  42.954 46.818  1.00 74.20  ? 117  GLU A OE2 1 
ATOM 911  N N   . THR A 1 121  ? 27.921  46.600 42.859  1.00 47.03  ? 118  THR A N   1 
ATOM 912  C CA  . THR A 1 121  ? 27.513  48.019 42.670  1.00 47.03  ? 118  THR A CA  1 
ATOM 913  C C   . THR A 1 121  ? 27.915  48.558 41.302  1.00 47.03  ? 118  THR A C   1 
ATOM 914  O O   . THR A 1 121  ? 27.541  49.669 40.942  1.00 47.03  ? 118  THR A O   1 
ATOM 915  C CB  . THR A 1 121  ? 27.850  49.061 43.824  1.00 50.91  ? 118  THR A CB  1 
ATOM 916  O OG1 . THR A 1 121  ? 29.265  49.256 43.961  1.00 50.91  ? 118  THR A OG1 1 
ATOM 917  C CG2 . THR A 1 121  ? 27.227  48.673 45.158  1.00 50.91  ? 118  THR A CG2 1 
ATOM 918  N N   . GLY A 1 122  ? 28.674  47.770 40.552  1.00 33.64  ? 119  GLY A N   1 
ATOM 919  C CA  . GLY A 1 122  ? 28.852  47.971 39.114  1.00 33.64  ? 119  GLY A CA  1 
ATOM 920  C C   . GLY A 1 122  ? 29.874  49.011 38.702  1.00 33.64  ? 119  GLY A C   1 
ATOM 921  O O   . GLY A 1 122  ? 30.590  49.596 39.548  1.00 33.64  ? 119  GLY A O   1 
ATOM 922  N N   . ILE A 1 123  ? 29.941  49.254 37.395  1.00 22.07  ? 120  ILE A N   1 
ATOM 923  C CA  . ILE A 1 123  ? 30.770  50.321 36.878  1.00 22.07  ? 120  ILE A CA  1 
ATOM 924  C C   . ILE A 1 123  ? 30.374  51.670 37.469  1.00 22.07  ? 120  ILE A C   1 
ATOM 925  O O   . ILE A 1 123  ? 29.211  52.061 37.360  1.00 22.07  ? 120  ILE A O   1 
ATOM 926  C CB  . ILE A 1 123  ? 30.628  50.437 35.352  1.00 20.82  ? 120  ILE A CB  1 
ATOM 927  C CG1 . ILE A 1 123  ? 31.125  49.186 34.711  1.00 20.82  ? 120  ILE A CG1 1 
ATOM 928  C CG2 . ILE A 1 123  ? 31.410  51.668 34.809  1.00 20.82  ? 120  ILE A CG2 1 
ATOM 929  C CD1 . ILE A 1 123  ? 31.154  49.313 33.305  1.00 20.82  ? 120  ILE A CD1 1 
ATOM 930  N N   . ILE A 1 124  ? 31.329  52.370 38.068  1.00 51.87  ? 121  ILE A N   1 
ATOM 931  C CA  . ILE A 1 124  ? 31.162  53.780 38.393  1.00 51.87  ? 121  ILE A CA  1 
ATOM 932  C C   . ILE A 1 124  ? 32.177  54.595 37.610  1.00 51.87  ? 121  ILE A C   1 
ATOM 933  O O   . ILE A 1 124  ? 33.343  54.207 37.512  1.00 51.87  ? 121  ILE A O   1 
ATOM 934  C CB  . ILE A 1 124  ? 31.472  54.069 39.857  1.00 15.85  ? 121  ILE A CB  1 
ATOM 935  C CG1 . ILE A 1 124  ? 30.453  53.430 40.803  1.00 15.85  ? 121  ILE A CG1 1 
ATOM 936  C CG2 . ILE A 1 124  ? 31.478  55.552 40.084  1.00 15.85  ? 121  ILE A CG2 1 
ATOM 937  C CD1 . ILE A 1 124  ? 30.996  53.234 42.274  1.00 15.85  ? 121  ILE A CD1 1 
ATOM 938  N N   . GLY A 1 125  ? 31.759  55.744 37.096  1.00 35.48  ? 122  GLY A N   1 
ATOM 939  C CA  . GLY A 1 125  ? 32.673  56.630 36.374  1.00 35.48  ? 122  GLY A CA  1 
ATOM 940  C C   . GLY A 1 125  ? 32.519  58.022 36.933  1.00 35.48  ? 122  GLY A C   1 
ATOM 941  O O   . GLY A 1 125  ? 31.410  58.424 37.257  1.00 35.48  ? 122  GLY A O   1 
ATOM 942  N N   . ILE A 1 126  ? 33.605  58.766 37.081  1.00 25.38  ? 123  ILE A N   1 
ATOM 943  C CA  . ILE A 1 126  ? 33.519  60.061 37.759  1.00 25.38  ? 123  ILE A CA  1 
ATOM 944  C C   . ILE A 1 126  ? 34.548  61.019 37.202  1.00 25.38  ? 123  ILE A C   1 
ATOM 945  O O   . ILE A 1 126  ? 35.582  60.593 36.676  1.00 25.38  ? 123  ILE A O   1 
ATOM 946  C CB  . ILE A 1 126  ? 33.716  59.955 39.310  1.00 21.77  ? 123  ILE A CB  1 
ATOM 947  C CG1 . ILE A 1 126  ? 35.020  59.234 39.646  1.00 21.77  ? 123  ILE A CG1 1 
ATOM 948  C CG2 . ILE A 1 126  ? 32.551  59.258 39.961  1.00 21.77  ? 123  ILE A CG2 1 
ATOM 949  C CD1 . ILE A 1 126  ? 35.448  59.445 41.053  1.00 21.77  ? 123  ILE A CD1 1 
ATOM 950  N N   . ILE A 1 127  ? 34.284  62.313 37.311  1.00 40.43  ? 124  ILE A N   1 
ATOM 951  C CA  . ILE A 1 127  ? 35.222  63.288 36.769  1.00 40.43  ? 124  ILE A CA  1 
ATOM 952  C C   . ILE A 1 127  ? 35.490  64.365 37.779  1.00 40.43  ? 124  ILE A C   1 
ATOM 953  O O   . ILE A 1 127  ? 34.549  64.972 38.310  1.00 40.43  ? 124  ILE A O   1 
ATOM 954  C CB  . ILE A 1 127  ? 34.722  63.909 35.454  1.00 29.85  ? 124  ILE A CB  1 
ATOM 955  C CG1 . ILE A 1 127  ? 34.813  62.888 34.320  1.00 29.85  ? 124  ILE A CG1 1 
ATOM 956  C CG2 . ILE A 1 127  ? 35.561  65.110 35.076  1.00 29.85  ? 124  ILE A CG2 1 
ATOM 957  C CD1 . ILE A 1 127  ? 34.074  63.282 33.104  1.00 29.85  ? 124  ILE A CD1 1 
ATOM 958  N N   . ASP A 1 128  ? 36.785  64.582 38.028  1.00 42.56  ? 125  ASP A N   1 
ATOM 959  C CA  . ASP A 1 128  ? 37.306  65.586 38.958  1.00 42.56  ? 125  ASP A CA  1 
ATOM 960  C C   . ASP A 1 128  ? 36.847  67.013 38.577  1.00 42.56  ? 125  ASP A C   1 
ATOM 961  O O   . ASP A 1 128  ? 36.718  67.338 37.400  1.00 42.56  ? 125  ASP A O   1 
ATOM 962  C CB  . ASP A 1 128  ? 38.837  65.424 39.065  1.00 73.68  ? 125  ASP A CB  1 
ATOM 963  C CG  . ASP A 1 128  ? 39.583  66.741 39.073  1.00 73.68  ? 125  ASP A CG  1 
ATOM 964  O OD1 . ASP A 1 128  ? 39.602  67.434 40.111  1.00 73.68  ? 125  ASP A OD1 1 
ATOM 965  O OD2 . ASP A 1 128  ? 40.184  67.075 38.039  1.00 73.68  ? 125  ASP A OD2 1 
ATOM 966  N N   . PRO A 1 129  ? 36.560  67.849 39.587  1.00 37.73  ? 126  PRO A N   1 
ATOM 967  C CA  . PRO A 1 129  ? 36.122  69.213 39.337  1.00 37.73  ? 126  PRO A CA  1 
ATOM 968  C C   . PRO A 1 129  ? 37.088  69.993 38.456  1.00 37.73  ? 126  PRO A C   1 
ATOM 969  O O   . PRO A 1 129  ? 36.648  70.638 37.516  1.00 37.73  ? 126  PRO A O   1 
ATOM 970  C CB  . PRO A 1 129  ? 36.067  69.817 40.731  1.00 40.56  ? 126  PRO A CB  1 
ATOM 971  C CG  . PRO A 1 129  ? 35.840  68.632 41.651  1.00 40.56  ? 126  PRO A CG  1 
ATOM 972  C CD  . PRO A 1 129  ? 36.634  67.542 41.032  1.00 40.56  ? 126  PRO A CD  1 
ATOM 973  N N   . GLU A 1 130  ? 38.385  69.918 38.739  1.00 55.31  ? 127  GLU A N   1 
ATOM 974  C CA  . GLU A 1 130  ? 39.437  70.542 37.910  1.00 55.31  ? 127  GLU A CA  1 
ATOM 975  C C   . GLU A 1 130  ? 39.495  70.020 36.460  1.00 55.31  ? 127  GLU A C   1 
ATOM 976  O O   . GLU A 1 130  ? 40.329  70.477 35.676  1.00 55.31  ? 127  GLU A O   1 
ATOM 977  C CB  . GLU A 1 130  ? 40.827  70.323 38.550  1.00 99.28  ? 127  GLU A CB  1 
ATOM 978  C CG  . GLU A 1 130  ? 41.206  71.227 39.731  1.00 99.28  ? 127  GLU A CG  1 
ATOM 979  C CD  . GLU A 1 130  ? 42.516  70.788 40.422  1.00 99.28  ? 127  GLU A CD  1 
ATOM 980  O OE1 . GLU A 1 130  ? 42.604  69.627 40.902  1.00 99.28  ? 127  GLU A OE1 1 
ATOM 981  O OE2 . GLU A 1 130  ? 43.456  71.614 40.499  1.00 99.28  ? 127  GLU A OE2 1 
ATOM 982  N N   . CYS A 1 131  ? 38.639  69.068 36.099  1.00 47.43  ? 128  CYS A N   1 
ATOM 983  C CA  . CYS A 1 131  ? 38.765  68.359 34.819  1.00 47.43  ? 128  CYS A CA  1 
ATOM 984  C C   . CYS A 1 131  ? 40.152  67.736 34.584  1.00 47.43  ? 128  CYS A C   1 
ATOM 985  O O   . CYS A 1 131  ? 40.532  67.454 33.451  1.00 47.43  ? 128  CYS A O   1 
ATOM 986  C CB  . CYS A 1 131  ? 38.345  69.233 33.641  1.00 75.92  ? 128  CYS A CB  1 
ATOM 987  S SG  . CYS A 1 131  ? 36.575  69.324 33.481  1.00 75.92  ? 128  CYS A SG  1 
ATOM 988  N N   . ARG A 1 132  ? 40.905  67.497 35.652  1.00 64.22  ? 129  ARG A N   1 
ATOM 989  C CA  . ARG A 1 132  ? 42.243  66.935 35.501  1.00 64.22  ? 129  ARG A CA  1 
ATOM 990  C C   . ARG A 1 132  ? 42.203  65.488 35.001  1.00 64.22  ? 129  ARG A C   1 
ATOM 991  O O   . ARG A 1 132  ? 42.980  65.113 34.122  1.00 64.22  ? 129  ARG A O   1 
ATOM 992  C CB  . ARG A 1 132  ? 43.081  67.093 36.779  1.00 81.31  ? 129  ARG A CB  1 
ATOM 993  C CG  . ARG A 1 132  ? 43.663  68.503 36.966  1.00 81.31  ? 129  ARG A CG  1 
ATOM 994  C CD  . ARG A 1 132  ? 44.642  68.591 38.148  1.00 81.31  ? 129  ARG A CD  1 
ATOM 995  N NE  . ARG A 1 132  ? 45.966  68.019 37.841  1.00 81.31  ? 129  ARG A NE  1 
ATOM 996  C CZ  . ARG A 1 132  ? 46.897  67.667 38.743  1.00 81.31  ? 129  ARG A CZ  1 
ATOM 997  N NH1 . ARG A 1 132  ? 46.691  67.815 40.054  1.00 81.31  ? 129  ARG A NH1 1 
ATOM 998  N NH2 . ARG A 1 132  ? 48.057  67.158 38.326  1.00 81.31  ? 129  ARG A NH2 1 
ATOM 999  N N   . MET A 1 133  ? 41.275  64.684 35.513  1.00 77.04  ? 130  MET A N   1 
ATOM 1000 C CA  . MET A 1 133  ? 41.226  63.266 35.132  1.00 77.04  ? 130  MET A CA  1 
ATOM 1001 C C   . MET A 1 133  ? 39.851  62.630 35.207  1.00 77.04  ? 130  MET A C   1 
ATOM 1002 O O   . MET A 1 133  ? 38.896  63.214 35.726  1.00 77.04  ? 130  MET A O   1 
ATOM 1003 C CB  . MET A 1 133  ? 42.135  62.475 36.048  1.00 52.81  ? 130  MET A CB  1 
ATOM 1004 C CG  . MET A 1 133  ? 41.774  62.694 37.514  1.00 52.81  ? 130  MET A CG  1 
ATOM 1005 S SD  . MET A 1 133  ? 42.609  61.580 38.607  1.00 52.81  ? 130  MET A SD  1 
ATOM 1006 C CE  . MET A 1 133  ? 44.297  62.084 38.256  1.00 52.81  ? 130  MET A CE  1 
ATOM 1007 N N   . ILE A 1 134  ? 39.791  61.399 34.717  1.00 32.08  ? 131  ILE A N   1 
ATOM 1008 C CA  . ILE A 1 134  ? 38.590  60.590 34.780  1.00 32.08  ? 131  ILE A CA  1 
ATOM 1009 C C   . ILE A 1 134  ? 38.861  59.369 35.656  1.00 32.08  ? 131  ILE A C   1 
ATOM 1010 O O   . ILE A 1 134  ? 39.766  58.590 35.359  1.00 32.08  ? 131  ILE A O   1 
ATOM 1011 C CB  . ILE A 1 134  ? 38.180  60.077 33.392  1.00 41.94  ? 131  ILE A CB  1 
ATOM 1012 C CG1 . ILE A 1 134  ? 37.777  61.220 32.475  1.00 41.94  ? 131  ILE A CG1 1 
ATOM 1013 C CG2 . ILE A 1 134  ? 37.002  59.154 33.510  1.00 41.94  ? 131  ILE A CG2 1 
ATOM 1014 C CD1 . ILE A 1 134  ? 37.451  60.770 31.058  1.00 41.94  ? 131  ILE A CD1 1 
ATOM 1015 N N   . GLY A 1 135  ? 38.101  59.198 36.734  1.00 42.66  ? 132  GLY A N   1 
ATOM 1016 C CA  . GLY A 1 135  ? 38.269  58.040 37.562  1.00 42.66  ? 132  GLY A CA  1 
ATOM 1017 C C   . GLY A 1 135  ? 37.257  56.965 37.210  1.00 42.66  ? 132  GLY A C   1 
ATOM 1018 O O   . GLY A 1 135  ? 36.079  57.264 37.054  1.00 42.66  ? 132  GLY A O   1 
ATOM 1019 N N   . LEU A 1 136  ? 37.713  55.717 37.099  1.00 35.12  ? 133  LEU A N   1 
ATOM 1020 C CA  . LEU A 1 136  ? 36.835  54.595 36.801  1.00 35.12  ? 133  LEU A CA  1 
ATOM 1021 C C   . LEU A 1 136  ? 36.967  53.516 37.856  1.00 35.12  ? 133  LEU A C   1 
ATOM 1022 O O   . LEU A 1 136  ? 38.085  53.128 38.201  1.00 35.12  ? 133  LEU A O   1 
ATOM 1023 C CB  . LEU A 1 136  ? 37.194  53.981 35.445  1.00 27.53  ? 133  LEU A CB  1 
ATOM 1024 C CG  . LEU A 1 136  ? 36.561  54.518 34.174  1.00 27.53  ? 133  LEU A CG  1 
ATOM 1025 C CD1 . LEU A 1 136  ? 36.633  56.030 34.153  1.00 27.53  ? 133  LEU A CD1 1 
ATOM 1026 C CD2 . LEU A 1 136  ? 37.263  53.918 32.966  1.00 27.53  ? 133  LEU A CD2 1 
ATOM 1027 N N   . ARG A 1 137  ? 35.848  53.023 38.373  1.00 38.16  ? 134  ARG A N   1 
ATOM 1028 C CA  . ARG A 1 137  ? 35.897  51.858 39.219  1.00 38.16  ? 134  ARG A CA  1 
ATOM 1029 C C   . ARG A 1 137  ? 35.173  50.721 38.502  1.00 38.16  ? 134  ARG A C   1 
ATOM 1030 O O   . ARG A 1 137  ? 33.952  50.621 38.555  1.00 38.16  ? 134  ARG A O   1 
ATOM 1031 C CB  . ARG A 1 137  ? 35.280  52.153 40.564  1.00 28.87  ? 134  ARG A CB  1 
ATOM 1032 C CG  . ARG A 1 137  ? 35.539  51.107 41.661  1.00 28.87  ? 134  ARG A CG  1 
ATOM 1033 C CD  . ARG A 1 137  ? 35.001  49.740 41.369  1.00 28.87  ? 134  ARG A CD  1 
ATOM 1034 N NE  . ARG A 1 137  ? 33.547  49.712 41.246  1.00 28.87  ? 134  ARG A NE  1 
ATOM 1035 C CZ  . ARG A 1 137  ? 32.696  49.510 42.258  1.00 28.87  ? 134  ARG A CZ  1 
ATOM 1036 N NH1 . ARG A 1 137  ? 33.164  49.325 43.502  1.00 28.87  ? 134  ARG A NH1 1 
ATOM 1037 N NH2 . ARG A 1 137  ? 31.378  49.495 42.030  1.00 28.87  ? 134  ARG A NH2 1 
ATOM 1038 N N   . LEU A 1 138  ? 35.939  49.874 37.824  1.00 45.78  ? 135  LEU A N   1 
ATOM 1039 C CA  . LEU A 1 138  ? 35.395  48.794 37.018  1.00 45.78  ? 135  LEU A CA  1 
ATOM 1040 C C   . LEU A 1 138  ? 35.462  47.462 37.751  1.00 45.78  ? 135  LEU A C   1 
ATOM 1041 O O   . LEU A 1 138  ? 34.520  46.689 37.743  1.00 45.78  ? 135  LEU A O   1 
ATOM 1042 C CB  . LEU A 1 138  ? 36.184  48.685 35.702  1.00 29.13  ? 135  LEU A CB  1 
ATOM 1043 C CG  . LEU A 1 138  ? 36.293  49.969 34.874  1.00 29.13  ? 135  LEU A CG  1 
ATOM 1044 C CD1 . LEU A 1 138  ? 37.246  49.805 33.673  1.00 29.13  ? 135  LEU A CD1 1 
ATOM 1045 C CD2 . LEU A 1 138  ? 34.916  50.408 34.402  1.00 29.13  ? 135  LEU A CD2 1 
ATOM 1046 N N   . TYR A 1 139  ? 36.595  47.194 38.379  1.00 41.13  ? 136  TYR A N   1 
ATOM 1047 C CA  . TYR A 1 139  ? 36.852  45.889 38.937  1.00 41.13  ? 136  TYR A CA  1 
ATOM 1048 C C   . TYR A 1 139  ? 37.219  46.064 40.384  1.00 41.13  ? 136  TYR A C   1 
ATOM 1049 O O   . TYR A 1 139  ? 37.832  47.056 40.746  1.00 41.13  ? 136  TYR A O   1 
ATOM 1050 C CB  . TYR A 1 139  ? 38.027  45.255 38.191  1.00 31.53  ? 136  TYR A CB  1 
ATOM 1051 C CG  . TYR A 1 139  ? 37.874  45.191 36.669  1.00 31.53  ? 136  TYR A CG  1 
ATOM 1052 C CD1 . TYR A 1 139  ? 38.754  45.920 35.813  1.00 31.53  ? 136  TYR A CD1 1 
ATOM 1053 C CD2 . TYR A 1 139  ? 36.835  44.417 36.069  1.00 31.53  ? 136  TYR A CD2 1 
ATOM 1054 C CE1 . TYR A 1 139  ? 38.626  45.854 34.418  1.00 31.53  ? 136  TYR A CE1 1 
ATOM 1055 C CE2 . TYR A 1 139  ? 36.699  44.359 34.676  1.00 31.53  ? 136  TYR A CE2 1 
ATOM 1056 C CZ  . TYR A 1 139  ? 37.610  45.061 33.856  1.00 31.53  ? 136  TYR A CZ  1 
ATOM 1057 O OH  . TYR A 1 139  ? 37.461  44.998 32.474  1.00 31.53  ? 136  TYR A OH  1 
ATOM 1058 N N   . ASP A 1 140  ? 36.880  45.097 41.221  1.00 34.43  ? 137  ASP A N   1 
ATOM 1059 C CA  . ASP A 1 140  ? 37.288  45.135 42.624  1.00 34.43  ? 137  ASP A CA  1 
ATOM 1060 C C   . ASP A 1 140  ? 38.801  45.205 42.755  1.00 34.43  ? 137  ASP A C   1 
ATOM 1061 O O   . ASP A 1 140  ? 39.544  44.567 41.985  1.00 34.43  ? 137  ASP A O   1 
ATOM 1062 C CB  . ASP A 1 140  ? 36.745  43.921 43.362  1.00 59.24  ? 137  ASP A CB  1 
ATOM 1063 C CG  . ASP A 1 140  ? 35.349  44.135 43.865  1.00 59.24  ? 137  ASP A CG  1 
ATOM 1064 O OD1 . ASP A 1 140  ? 35.095  45.193 44.483  1.00 59.24  ? 137  ASP A OD1 1 
ATOM 1065 O OD2 . ASP A 1 140  ? 34.499  43.253 43.648  1.00 59.24  ? 137  ASP A OD2 1 
ATOM 1066 N N   . GLY A 1 141  ? 39.255  45.982 43.732  1.00 44.36  ? 138  GLY A N   1 
ATOM 1067 C CA  . GLY A 1 141  ? 40.676  46.128 44.020  1.00 44.36  ? 138  GLY A CA  1 
ATOM 1068 C C   . GLY A 1 141  ? 41.489  46.919 43.008  1.00 44.36  ? 138  GLY A C   1 
ATOM 1069 O O   . GLY A 1 141  ? 42.710  46.827 43.007  1.00 44.36  ? 138  GLY A O   1 
ATOM 1070 N N   . LEU A 1 142  ? 40.844  47.700 42.154  1.00 41.50  ? 139  LEU A N   1 
ATOM 1071 C CA  . LEU A 1 142  ? 41.556  48.432 41.111  1.00 41.50  ? 139  LEU A CA  1 
ATOM 1072 C C   . LEU A 1 142  ? 40.864  49.767 40.745  1.00 41.50  ? 139  LEU A C   1 
ATOM 1073 O O   . LEU A 1 142  ? 39.634  49.828 40.595  1.00 41.50  ? 139  LEU A O   1 
ATOM 1074 C CB  . LEU A 1 142  ? 41.656  47.547 39.863  1.00 22.39  ? 139  LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 142  ? 42.753  46.492 39.648  1.00 22.39  ? 139  LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 142  ? 42.237  45.568 38.601  1.00 22.39  ? 139  LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 142  ? 44.133  47.111 39.230  1.00 22.39  ? 139  LEU A CD2 1 
ATOM 1078 N N   . PHE A 1 143  ? 41.641  50.836 40.595  1.00 50.24  ? 140  PHE A N   1 
ATOM 1079 C CA  . PHE A 1 143  ? 41.064  52.137 40.248  1.00 50.24  ? 140  PHE A CA  1 
ATOM 1080 C C   . PHE A 1 143  ? 41.756  52.671 39.008  1.00 50.24  ? 140  PHE A C   1 
ATOM 1081 O O   . PHE A 1 143  ? 42.940  53.012 39.051  1.00 50.24  ? 140  PHE A O   1 
ATOM 1082 C CB  . PHE A 1 143  ? 41.191  53.131 41.416  1.00 32.75  ? 140  PHE A CB  1 
ATOM 1083 C CG  . PHE A 1 143  ? 40.503  54.477 41.172  1.00 32.75  ? 140  PHE A CG  1 
ATOM 1084 C CD1 . PHE A 1 143  ? 39.096  54.567 41.058  1.00 32.75  ? 140  PHE A CD1 1 
ATOM 1085 C CD2 . PHE A 1 143  ? 41.249  55.655 41.074  1.00 32.75  ? 140  PHE A CD2 1 
ATOM 1086 C CE1 . PHE A 1 143  ? 38.461  55.823 40.834  1.00 32.75  ? 140  PHE A CE1 1 
ATOM 1087 C CE2 . PHE A 1 143  ? 40.628  56.899 40.871  1.00 32.75  ? 140  PHE A CE2 1 
ATOM 1088 C CZ  . PHE A 1 143  ? 39.236  56.980 40.764  1.00 32.75  ? 140  PHE A CZ  1 
ATOM 1089 N N   . LYS A 1 144  ? 41.034  52.729 37.896  1.00 45.00  ? 141  LYS A N   1 
ATOM 1090 C CA  . LYS A 1 144  ? 41.675  53.130 36.656  1.00 45.00  ? 141  LYS A CA  1 
ATOM 1091 C C   . LYS A 1 144  ? 41.640  54.644 36.470  1.00 45.00  ? 141  LYS A C   1 
ATOM 1092 O O   . LYS A 1 144  ? 40.571  55.249 36.500  1.00 45.00  ? 141  LYS A O   1 
ATOM 1093 C CB  . LYS A 1 144  ? 41.078  52.410 35.444  1.00 26.46  ? 141  LYS A CB  1 
ATOM 1094 C CG  . LYS A 1 144  ? 41.936  52.583 34.195  1.00 26.46  ? 141  LYS A CG  1 
ATOM 1095 C CD  . LYS A 1 144  ? 41.402  51.880 32.986  1.00 26.46  ? 141  LYS A CD  1 
ATOM 1096 C CE  . LYS A 1 144  ? 41.730  50.377 33.050  1.00 26.46  ? 141  LYS A CE  1 
ATOM 1097 N NZ  . LYS A 1 144  ? 41.877  49.753 31.688  1.00 26.46  ? 141  LYS A NZ  1 
ATOM 1098 N N   . VAL A 1 145  ? 42.801  55.252 36.267  1.00 54.96  ? 142  VAL A N   1 
ATOM 1099 C CA  . VAL A 1 145  ? 42.858  56.683 36.041  1.00 54.96  ? 142  VAL A CA  1 
ATOM 1100 C C   . VAL A 1 145  ? 43.166  56.976 34.578  1.00 54.96  ? 142  VAL A C   1 
ATOM 1101 O O   . VAL A 1 145  ? 44.134  56.453 34.029  1.00 54.96  ? 142  VAL A O   1 
ATOM 1102 C CB  . VAL A 1 145  ? 43.930  57.359 36.927  1.00 40.41  ? 142  VAL A CB  1 
ATOM 1103 C CG1 . VAL A 1 145  ? 43.981  58.851 36.651  1.00 40.41  ? 142  VAL A CG1 1 
ATOM 1104 C CG2 . VAL A 1 145  ? 43.686  57.094 38.441  1.00 40.41  ? 142  VAL A CG2 1 
ATOM 1105 N N   . ILE A 1 146  ? 42.336  57.811 33.953  1.00 54.18  ? 143  ILE A N   1 
ATOM 1106 C CA  . ILE A 1 146  ? 42.603  58.338 32.616  1.00 54.18  ? 143  ILE A CA  1 
ATOM 1107 C C   . ILE A 1 146  ? 42.990  59.803 32.730  1.00 54.18  ? 143  ILE A C   1 
ATOM 1108 O O   . ILE A 1 146  ? 42.165  60.627 33.102  1.00 54.18  ? 143  ILE A O   1 
ATOM 1109 C CB  . ILE A 1 146  ? 41.362  58.259 31.738  1.00 42.08  ? 143  ILE A CB  1 
ATOM 1110 C CG1 . ILE A 1 146  ? 40.931  56.797 31.552  1.00 42.08  ? 143  ILE A CG1 1 
ATOM 1111 C CG2 . ILE A 1 146  ? 41.600  58.963 30.399  1.00 42.08  ? 143  ILE A CG2 1 
ATOM 1112 C CD1 . ILE A 1 146  ? 39.429  56.575 31.252  1.00 42.08  ? 143  ILE A CD1 1 
ATOM 1113 N N   . PRO A 1 147  ? 44.251  60.141 32.415  1.00 51.59  ? 144  PRO A N   1 
ATOM 1114 C CA  . PRO A 1 147  ? 44.658  61.547 32.443  1.00 51.59  ? 144  PRO A CA  1 
ATOM 1115 C C   . PRO A 1 147  ? 44.039  62.355 31.292  1.00 51.59  ? 144  PRO A C   1 
ATOM 1116 O O   . PRO A 1 147  ? 43.996  61.882 30.144  1.00 51.59  ? 144  PRO A O   1 
ATOM 1117 C CB  . PRO A 1 147  ? 46.187  61.477 32.307  1.00 68.44  ? 144  PRO A CB  1 
ATOM 1118 C CG  . PRO A 1 147  ? 46.551  60.054 32.499  1.00 68.44  ? 144  PRO A CG  1 
ATOM 1119 C CD  . PRO A 1 147  ? 45.373  59.271 32.031  1.00 68.44  ? 144  PRO A CD  1 
ATOM 1120 N N   . LEU A 1 148  ? 43.557  63.550 31.629  1.00 59.90  ? 145  LEU A N   1 
ATOM 1121 C CA  . LEU A 1 148  ? 42.928  64.468 30.685  1.00 59.90  ? 145  LEU A CA  1 
ATOM 1122 C C   . LEU A 1 148  ? 43.839  65.641 30.250  1.00 59.90  ? 145  LEU A C   1 
ATOM 1123 O O   . LEU A 1 148  ? 44.040  66.609 30.994  1.00 59.90  ? 145  LEU A O   1 
ATOM 1124 C CB  . LEU A 1 148  ? 41.628  65.009 31.287  1.00 53.57  ? 145  LEU A CB  1 
ATOM 1125 C CG  . LEU A 1 148  ? 40.283  64.424 30.835  1.00 53.57  ? 145  LEU A CG  1 
ATOM 1126 C CD1 . LEU A 1 148  ? 40.344  62.924 30.569  1.00 53.57  ? 145  LEU A CD1 1 
ATOM 1127 C CD2 . LEU A 1 148  ? 39.217  64.725 31.862  1.00 53.57  ? 145  LEU A CD2 1 
ATOM 1128 N N   . ASP A 1 149  ? 44.395  65.544 29.046  1.00 88.34  ? 146  ASP A N   1 
ATOM 1129 C CA  . ASP A 1 149  ? 45.137  66.654 28.436  1.00 88.34  ? 146  ASP A CA  1 
ATOM 1130 C C   . ASP A 1 149  ? 44.791  66.707 26.955  1.00 88.34  ? 146  ASP A C   1 
ATOM 1131 O O   . ASP A 1 149  ? 44.009  65.883 26.492  1.00 88.34  ? 146  ASP A O   1 
ATOM 1132 C CB  . ASP A 1 149  ? 46.654  66.553 28.687  1.00 84.60  ? 146  ASP A CB  1 
ATOM 1133 C CG  . ASP A 1 149  ? 47.119  65.130 28.946  1.00 84.60  ? 146  ASP A CG  1 
ATOM 1134 O OD1 . ASP A 1 149  ? 47.012  64.290 28.022  1.00 84.60  ? 146  ASP A OD1 1 
ATOM 1135 O OD2 . ASP A 1 149  ? 47.597  64.861 30.075  1.00 84.60  ? 146  ASP A OD2 1 
ATOM 1136 N N   . ARG A 1 150  ? 45.342  67.674 26.222  1.00 102.07 ? 147  ARG A N   1 
ATOM 1137 C CA  . ARG A 1 150  ? 44.944  67.894 24.826  1.00 102.07 ? 147  ARG A CA  1 
ATOM 1138 C C   . ARG A 1 150  ? 45.237  66.672 23.950  1.00 102.07 ? 147  ARG A C   1 
ATOM 1139 O O   . ARG A 1 150  ? 44.595  66.466 22.914  1.00 102.07 ? 147  ARG A O   1 
ATOM 1140 C CB  . ARG A 1 150  ? 45.596  69.161 24.260  1.00 154.78 ? 147  ARG A CB  1 
ATOM 1141 C CG  . ARG A 1 150  ? 44.736  69.912 23.239  1.00 154.78 ? 147  ARG A CG  1 
ATOM 1142 C CD  . ARG A 1 150  ? 45.120  69.578 21.798  1.00 154.78 ? 147  ARG A CD  1 
ATOM 1143 N NE  . ARG A 1 150  ? 44.192  70.154 20.822  1.00 154.78 ? 147  ARG A NE  1 
ATOM 1144 C CZ  . ARG A 1 150  ? 44.239  71.407 20.374  1.00 154.78 ? 147  ARG A CZ  1 
ATOM 1145 N NH1 . ARG A 1 150  ? 45.167  72.250 20.812  1.00 154.78 ? 147  ARG A NH1 1 
ATOM 1146 N NH2 . ARG A 1 150  ? 43.348  71.823 19.487  1.00 154.78 ? 147  ARG A NH2 1 
ATOM 1147 N N   . ASP A 1 151  ? 46.197  65.861 24.383  1.00 104.63 ? 148  ASP A N   1 
ATOM 1148 C CA  . ASP A 1 151  ? 46.481  64.595 23.734  1.00 104.63 ? 148  ASP A CA  1 
ATOM 1149 C C   . ASP A 1 151  ? 45.753  63.477 24.458  1.00 104.63 ? 148  ASP A C   1 
ATOM 1150 O O   . ASP A 1 151  ? 44.837  63.733 25.235  1.00 104.63 ? 148  ASP A O   1 
ATOM 1151 C CB  . ASP A 1 151  ? 47.984  64.350 23.713  1.00 111.57 ? 148  ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 151  ? 48.730  65.435 22.968  1.00 111.57 ? 148  ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 151  ? 48.104  66.142 22.143  1.00 111.57 ? 148  ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 151  ? 49.943  65.589 23.207  1.00 111.57 ? 148  ASP A OD2 1 
ATOM 1155 N N   . ASN A 1 152  ? 46.162  62.238 24.207  1.00 89.29  ? 149  ASN A N   1 
ATOM 1156 C CA  . ASN A 1 152  ? 45.516  61.071 24.806  1.00 89.29  ? 149  ASN A CA  1 
ATOM 1157 C C   . ASN A 1 152  ? 44.168  60.783 24.152  1.00 89.29  ? 149  ASN A C   1 
ATOM 1158 O O   . ASN A 1 152  ? 43.216  60.343 24.805  1.00 89.29  ? 149  ASN A O   1 
ATOM 1159 C CB  . ASN A 1 152  ? 45.369  61.243 26.322  1.00 54.80  ? 149  ASN A CB  1 
ATOM 1160 C CG  . ASN A 1 152  ? 45.184  59.916 27.044  1.00 54.80  ? 149  ASN A CG  1 
ATOM 1161 O OD1 . ASN A 1 152  ? 45.164  58.851 26.425  1.00 54.80  ? 149  ASN A OD1 1 
ATOM 1162 N ND2 . ASN A 1 152  ? 45.049  59.979 28.375  1.00 54.80  ? 149  ASN A ND2 1 
ATOM 1163 N N   . LYS A 1 153  ? 44.108  61.038 22.846  1.00 65.97  ? 150  LYS A N   1 
ATOM 1164 C CA  . LYS A 1 153  ? 42.934  60.747 22.028  1.00 65.97  ? 150  LYS A CA  1 
ATOM 1165 C C   . LYS A 1 153  ? 42.649  59.250 21.952  1.00 65.97  ? 150  LYS A C   1 
ATOM 1166 O O   . LYS A 1 153  ? 41.740  58.819 21.235  1.00 65.97  ? 150  LYS A O   1 
ATOM 1167 C CB  . LYS A 1 153  ? 43.109  61.302 20.614  1.00 73.65  ? 150  LYS A CB  1 
ATOM 1168 C CG  . LYS A 1 153  ? 43.024  62.805 20.510  1.00 73.65  ? 150  LYS A CG  1 
ATOM 1169 C CD  . LYS A 1 153  ? 43.385  63.263 19.101  1.00 73.65  ? 150  LYS A CD  1 
ATOM 1170 C CE  . LYS A 1 153  ? 43.415  64.783 18.996  1.00 73.65  ? 150  LYS A CE  1 
ATOM 1171 N NZ  . LYS A 1 153  ? 43.118  65.230 17.610  1.00 73.65  ? 150  LYS A NZ  1 
ATOM 1172 N N   . GLU A 1 154  ? 43.437  58.454 22.670  1.00 52.55  ? 151  GLU A N   1 
ATOM 1173 C CA  . GLU A 1 154  ? 43.155  57.020 22.793  1.00 52.55  ? 151  GLU A CA  1 
ATOM 1174 C C   . GLU A 1 154  ? 42.785  56.605 24.220  1.00 52.55  ? 151  GLU A C   1 
ATOM 1175 O O   . GLU A 1 154  ? 42.412  55.470 24.458  1.00 52.55  ? 151  GLU A O   1 
ATOM 1176 C CB  . GLU A 1 154  ? 44.313  56.190 22.247  1.00 85.14  ? 151  GLU A CB  1 
ATOM 1177 C CG  . GLU A 1 154  ? 44.267  56.021 20.745  1.00 85.14  ? 151  GLU A CG  1 
ATOM 1178 C CD  . GLU A 1 154  ? 45.609  55.625 20.172  1.00 85.14  ? 151  GLU A CD  1 
ATOM 1179 O OE1 . GLU A 1 154  ? 45.656  54.682 19.358  1.00 85.14  ? 151  GLU A OE1 1 
ATOM 1180 O OE2 . GLU A 1 154  ? 46.623  56.249 20.546  1.00 85.14  ? 151  GLU A OE2 1 
ATOM 1181 N N   . LEU A 1 155  ? 42.867  57.552 25.146  1.00 44.15  ? 152  LEU A N   1 
ATOM 1182 C CA  . LEU A 1 155  ? 42.616  57.319 26.567  1.00 44.15  ? 152  LEU A CA  1 
ATOM 1183 C C   . LEU A 1 155  ? 43.393  56.104 27.102  1.00 44.15  ? 152  LEU A C   1 
ATOM 1184 O O   . LEU A 1 155  ? 42.839  55.199 27.749  1.00 44.15  ? 152  LEU A O   1 
ATOM 1185 C CB  . LEU A 1 155  ? 41.110  57.232 26.867  1.00 37.72  ? 152  LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 155  ? 40.212  58.166 26.049  1.00 37.72  ? 152  LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 155  ? 38.911  57.481 25.673  1.00 37.72  ? 152  LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 155  ? 39.965  59.494 26.756  1.00 37.72  ? 152  LEU A CD2 1 
ATOM 1189 N N   . LYS A 1 156  ? 44.688  56.088 26.810  1.00 68.39  ? 153  LYS A N   1 
ATOM 1190 C CA  . LYS A 1 156  ? 45.601  55.253 27.552  1.00 68.39  ? 153  LYS A CA  1 
ATOM 1191 C C   . LYS A 1 156  ? 45.372  55.685 28.984  1.00 68.39  ? 153  LYS A C   1 
ATOM 1192 O O   . LYS A 1 156  ? 45.246  56.878 29.264  1.00 68.39  ? 153  LYS A O   1 
ATOM 1193 C CB  . LYS A 1 156  ? 47.045  55.525 27.146  1.00 74.28  ? 153  LYS A CB  1 
ATOM 1194 C CG  . LYS A 1 156  ? 47.356  55.201 25.702  1.00 74.28  ? 153  LYS A CG  1 
ATOM 1195 C CD  . LYS A 1 156  ? 48.505  56.064 25.218  1.00 74.28  ? 153  LYS A CD  1 
ATOM 1196 C CE  . LYS A 1 156  ? 48.858  55.784 23.769  1.00 74.28  ? 153  LYS A CE  1 
ATOM 1197 N NZ  . LYS A 1 156  ? 50.044  56.587 23.363  1.00 74.28  ? 153  LYS A NZ  1 
ATOM 1198 N N   . ALA A 1 157  ? 45.275  54.710 29.877  1.00 50.60  ? 154  ALA A N   1 
ATOM 1199 C CA  . ALA A 1 157  ? 44.997  54.965 31.285  1.00 50.60  ? 154  ALA A CA  1 
ATOM 1200 C C   . ALA A 1 157  ? 45.913  54.115 32.141  1.00 50.60  ? 154  ALA A C   1 
ATOM 1201 O O   . ALA A 1 157  ? 46.715  53.342 31.639  1.00 50.60  ? 154  ALA A O   1 
ATOM 1202 C CB  . ALA A 1 157  ? 43.562  54.633 31.580  1.00 76.99  ? 154  ALA A CB  1 
ATOM 1203 N N   . PHE A 1 158  ? 45.810  54.237 33.443  1.00 53.81  ? 155  PHE A N   1 
ATOM 1204 C CA  . PHE A 1 158  ? 46.588  53.365 34.275  1.00 53.81  ? 155  PHE A CA  1 
ATOM 1205 C C   . PHE A 1 158  ? 45.720  52.913 35.428  1.00 53.81  ? 155  PHE A C   1 
ATOM 1206 O O   . PHE A 1 158  ? 44.760  53.602 35.802  1.00 53.81  ? 155  PHE A O   1 
ATOM 1207 C CB  . PHE A 1 158  ? 47.889  54.033 34.730  1.00 46.45  ? 155  PHE A CB  1 
ATOM 1208 C CG  . PHE A 1 158  ? 47.701  55.290 35.546  1.00 46.45  ? 155  PHE A CG  1 
ATOM 1209 C CD1 . PHE A 1 158  ? 47.660  55.231 36.955  1.00 46.45  ? 155  PHE A CD1 1 
ATOM 1210 C CD2 . PHE A 1 158  ? 47.624  56.534 34.925  1.00 46.45  ? 155  PHE A CD2 1 
ATOM 1211 C CE1 . PHE A 1 158  ? 47.505  56.396 37.735  1.00 46.45  ? 155  PHE A CE1 1 
ATOM 1212 C CE2 . PHE A 1 158  ? 47.462  57.697 35.677  1.00 46.45  ? 155  PHE A CE2 1 
ATOM 1213 C CZ  . PHE A 1 158  ? 47.411  57.630 37.099  1.00 46.45  ? 155  PHE A CZ  1 
ATOM 1214 N N   . ASN A 1 159  ? 46.021  51.737 35.961  1.00 31.31  ? 156  ASN A N   1 
ATOM 1215 C CA  . ASN A 1 159  ? 45.341  51.277 37.133  1.00 31.31  ? 156  ASN A CA  1 
ATOM 1216 C C   . ASN A 1 159  ? 46.188  51.695 38.335  1.00 31.31  ? 156  ASN A C   1 
ATOM 1217 O O   . ASN A 1 159  ? 47.347  52.020 38.164  1.00 31.31  ? 156  ASN A O   1 
ATOM 1218 C CB  . ASN A 1 159  ? 45.145  49.770 37.056  1.00 60.12  ? 156  ASN A CB  1 
ATOM 1219 C CG  . ASN A 1 159  ? 44.177  49.365 35.966  1.00 60.12  ? 156  ASN A CG  1 
ATOM 1220 O OD1 . ASN A 1 159  ? 44.522  48.581 35.082  1.00 60.12  ? 156  ASN A OD1 1 
ATOM 1221 N ND2 . ASN A 1 159  ? 42.958  49.883 36.025  1.00 60.12  ? 156  ASN A ND2 1 
ATOM 1222 N N   . ILE A 1 160  ? 45.572  51.768 39.509  1.00 42.15  ? 157  ILE A N   1 
ATOM 1223 C CA  . ILE A 1 160  ? 46.267  51.885 40.766  1.00 42.15  ? 157  ILE A CA  1 
ATOM 1224 C C   . ILE A 1 160  ? 45.656  50.845 41.684  1.00 42.15  ? 157  ILE A C   1 
ATOM 1225 O O   . ILE A 1 160  ? 44.426  50.737 41.770  1.00 42.15  ? 157  ILE A O   1 
ATOM 1226 C CB  . ILE A 1 160  ? 46.031  53.234 41.430  1.00 24.30  ? 157  ILE A CB  1 
ATOM 1227 C CG1 . ILE A 1 160  ? 46.539  54.361 40.551  1.00 24.30  ? 157  ILE A CG1 1 
ATOM 1228 C CG2 . ILE A 1 160  ? 46.736  53.303 42.766  1.00 24.30  ? 157  ILE A CG2 1 
ATOM 1229 C CD1 . ILE A 1 160  ? 45.977  55.757 40.965  1.00 24.30  ? 157  ILE A CD1 1 
ATOM 1230 N N   . ARG A 1 161  ? 46.475  50.077 42.395  1.00 65.99  ? 158  ARG A N   1 
ATOM 1231 C CA  . ARG A 1 161  ? 45.893  49.120 43.311  1.00 65.99  ? 158  ARG A CA  1 
ATOM 1232 C C   . ARG A 1 161  ? 45.001  49.864 44.294  1.00 65.99  ? 158  ARG A C   1 
ATOM 1233 O O   . ARG A 1 161  ? 45.383  50.902 44.816  1.00 65.99  ? 158  ARG A O   1 
ATOM 1234 C CB  . ARG A 1 161  ? 46.950  48.320 44.048  1.00 72.50  ? 158  ARG A CB  1 
ATOM 1235 C CG  . ARG A 1 161  ? 46.348  47.097 44.674  1.00 72.50  ? 158  ARG A CG  1 
ATOM 1236 C CD  . ARG A 1 161  ? 46.852  46.909 46.052  1.00 72.50  ? 158  ARG A CD  1 
ATOM 1237 N NE  . ARG A 1 161  ? 48.161  46.284 46.022  1.00 72.50  ? 158  ARG A NE  1 
ATOM 1238 C CZ  . ARG A 1 161  ? 48.365  44.980 46.183  1.00 72.50  ? 158  ARG A CZ  1 
ATOM 1239 N NH1 . ARG A 1 161  ? 47.337  44.162 46.404  1.00 72.50  ? 158  ARG A NH1 1 
ATOM 1240 N NH2 . ARG A 1 161  ? 49.605  44.502 46.135  1.00 72.50  ? 158  ARG A NH2 1 
ATOM 1241 N N   . LEU A 1 162  ? 43.796  49.351 44.502  1.00 40.80  ? 159  LEU A N   1 
ATOM 1242 C CA  . LEU A 1 162  ? 42.923  49.868 45.558  1.00 40.80  ? 159  LEU A CA  1 
ATOM 1243 C C   . LEU A 1 162  ? 42.941  48.888 46.710  1.00 40.80  ? 159  LEU A C   1 
ATOM 1244 O O   . LEU A 1 162  ? 42.381  47.777 46.625  1.00 40.80  ? 159  LEU A O   1 
ATOM 1245 C CB  . LEU A 1 162  ? 41.473  50.087 45.066  1.00 40.64  ? 159  LEU A CB  1 
ATOM 1246 C CG  . LEU A 1 162  ? 40.810  51.364 45.619  1.00 40.64  ? 159  LEU A CG  1 
ATOM 1247 C CD1 . LEU A 1 162  ? 39.467  51.649 44.995  1.00 40.64  ? 159  LEU A CD1 1 
ATOM 1248 C CD2 . LEU A 1 162  ? 40.662  51.313 47.115  1.00 40.64  ? 159  LEU A CD2 1 
ATOM 1249 N N   . GLU A 1 163  ? 43.583  49.293 47.795  1.00 48.44  ? 160  GLU A N   1 
ATOM 1250 C CA  . GLU A 1 163  ? 43.743  48.392 48.944  1.00 48.44  ? 160  GLU A CA  1 
ATOM 1251 C C   . GLU A 1 163  ? 42.381  47.833 49.406  1.00 48.44  ? 160  GLU A C   1 
ATOM 1252 O O   . GLU A 1 163  ? 42.288  46.692 49.849  1.00 48.44  ? 160  GLU A O   1 
ATOM 1253 C CB  . GLU A 1 163  ? 44.485  49.122 50.072  1.00 82.35  ? 160  GLU A CB  1 
ATOM 1254 C CG  . GLU A 1 163  ? 45.397  48.248 50.941  1.00 82.35  ? 160  GLU A CG  1 
ATOM 1255 C CD  . GLU A 1 163  ? 46.232  47.249 50.142  1.00 82.35  ? 160  GLU A CD  1 
ATOM 1256 O OE1 . GLU A 1 163  ? 47.128  47.661 49.359  1.00 82.35  ? 160  GLU A OE1 1 
ATOM 1257 O OE2 . GLU A 1 163  ? 45.989  46.036 50.320  1.00 82.35  ? 160  GLU A OE2 1 
ATOM 1258 N N   . GLU A 1 164  ? 41.330  48.642 49.228  1.00 52.76  ? 161  GLU A N   1 
ATOM 1259 C CA  . GLU A 1 164  ? 39.955  48.345 49.664  1.00 52.76  ? 161  GLU A CA  1 
ATOM 1260 C C   . GLU A 1 164  ? 39.113  47.497 48.693  1.00 52.76  ? 161  GLU A C   1 
ATOM 1261 O O   . GLU A 1 164  ? 38.528  47.967 47.698  1.00 52.76  ? 161  GLU A O   1 
ATOM 1262 C CB  . GLU A 1 164  ? 39.238  49.628 50.074  1.00 54.62  ? 161  GLU A CB  1 
ATOM 1263 C CG  . GLU A 1 164  ? 39.604  50.119 51.481  1.00 54.62  ? 161  GLU A CG  1 
ATOM 1264 C CD  . GLU A 1 164  ? 41.006  50.744 51.618  1.00 54.62  ? 161  GLU A CD  1 
ATOM 1265 O OE1 . GLU A 1 164  ? 41.592  51.205 50.619  1.00 54.62  ? 161  GLU A OE1 1 
ATOM 1266 O OE2 . GLU A 1 164  ? 41.525  50.783 52.755  1.00 54.62  ? 161  GLU A OE2 1 
ATOM 1267 N N   . LEU A 1 165  ? 39.126  46.212 49.031  1.00 29.05  ? 162  LEU A N   1 
ATOM 1268 C CA  . LEU A 1 165  ? 38.378  45.099 48.440  1.00 29.05  ? 162  LEU A CA  1 
ATOM 1269 C C   . LEU A 1 165  ? 37.011  45.389 47.772  1.00 29.05  ? 162  LEU A C   1 
ATOM 1270 O O   . LEU A 1 165  ? 36.730  44.835 46.704  1.00 29.05  ? 162  LEU A O   1 
ATOM 1271 C CB  . LEU A 1 165  ? 38.198  44.028 49.551  1.00 90.66  ? 162  LEU A CB  1 
ATOM 1272 C CG  . LEU A 1 165  ? 38.628  44.273 51.037  1.00 90.66  ? 162  LEU A CG  1 
ATOM 1273 C CD1 . LEU A 1 165  ? 38.037  45.528 51.712  1.00 90.66  ? 162  LEU A CD1 1 
ATOM 1274 C CD2 . LEU A 1 165  ? 38.385  43.058 51.931  1.00 90.66  ? 162  LEU A CD2 1 
ATOM 1275 N N   . HIS A 1 166  ? 36.171  46.226 48.410  1.00 50.67  ? 163  HIS A N   1 
ATOM 1276 C CA  . HIS A 1 166  ? 34.695  46.286 48.169  1.00 50.67  ? 163  HIS A CA  1 
ATOM 1277 C C   . HIS A 1 166  ? 34.121  47.736 48.355  1.00 50.67  ? 163  HIS A C   1 
ATOM 1278 O O   . HIS A 1 166  ? 33.551  48.102 49.378  1.00 50.67  ? 163  HIS A O   1 
ATOM 1279 C CB  . HIS A 1 166  ? 34.021  45.214 49.068  1.00 82.68  ? 163  HIS A CB  1 
ATOM 1280 C CG  . HIS A 1 166  ? 32.519  45.204 49.052  1.00 82.68  ? 163  HIS A CG  1 
ATOM 1281 N ND1 . HIS A 1 166  ? 31.768  45.429 47.916  1.00 82.68  ? 163  HIS A ND1 1 
ATOM 1282 C CD2 . HIS A 1 166  ? 31.628  44.938 50.038  1.00 82.68  ? 163  HIS A CD2 1 
ATOM 1283 C CE1 . HIS A 1 166  ? 30.481  45.334 48.210  1.00 82.68  ? 163  HIS A CE1 1 
ATOM 1284 N NE2 . HIS A 1 166  ? 30.369  45.038 49.493  1.00 82.68  ? 163  HIS A NE2 1 
ATOM 1285 N N   . VAL A 1 167  ? 34.317  48.568 47.349  1.00 35.95  ? 164  VAL A N   1 
ATOM 1286 C CA  . VAL A 1 167  ? 33.869  49.942 47.381  1.00 35.95  ? 164  VAL A CA  1 
ATOM 1287 C C   . VAL A 1 167  ? 32.371  50.067 47.078  1.00 35.95  ? 164  VAL A C   1 
ATOM 1288 O O   . VAL A 1 167  ? 31.882  49.519 46.073  1.00 35.95  ? 164  VAL A O   1 
ATOM 1289 C CB  . VAL A 1 167  ? 34.665  50.789 46.349  1.00 23.52  ? 164  VAL A CB  1 
ATOM 1290 C CG1 . VAL A 1 167  ? 34.128  52.230 46.261  1.00 23.52  ? 164  VAL A CG1 1 
ATOM 1291 C CG2 . VAL A 1 167  ? 36.133  50.824 46.726  1.00 23.52  ? 164  VAL A CG2 1 
ATOM 1292 N N   . ILE A 1 168  ? 31.648  50.816 47.914  1.00 44.13  ? 165  ILE A N   1 
ATOM 1293 C CA  . ILE A 1 168  ? 30.222  51.019 47.669  1.00 44.13  ? 165  ILE A CA  1 
ATOM 1294 C C   . ILE A 1 168  ? 29.878  52.128 46.655  1.00 44.13  ? 165  ILE A C   1 
ATOM 1295 O O   . ILE A 1 168  ? 29.118  51.873 45.709  1.00 44.13  ? 165  ILE A O   1 
ATOM 1296 C CB  . ILE A 1 168  ? 29.392  51.092 48.970  1.00 25.52  ? 165  ILE A CB  1 
ATOM 1297 C CG1 . ILE A 1 168  ? 28.921  49.677 49.367  1.00 25.52  ? 165  ILE A CG1 1 
ATOM 1298 C CG2 . ILE A 1 168  ? 28.096  51.939 48.760  1.00 25.52  ? 165  ILE A CG2 1 
ATOM 1299 C CD1 . ILE A 1 168  ? 29.917  48.866 49.932  1.00 25.52  ? 165  ILE A CD1 1 
ATOM 1300 N N   . ASP A 1 169  ? 30.457  53.321 46.850  1.00 40.36  ? 166  ASP A N   1 
ATOM 1301 C CA  . ASP A 1 169  ? 30.259  54.503 45.968  1.00 40.36  ? 166  ASP A CA  1 
ATOM 1302 C C   . ASP A 1 169  ? 31.534  55.376 46.048  1.00 40.36  ? 166  ASP A C   1 
ATOM 1303 O O   . ASP A 1 169  ? 32.281  55.271 47.047  1.00 40.36  ? 166  ASP A O   1 
ATOM 1304 C CB  . ASP A 1 169  ? 29.003  55.282 46.410  1.00 32.06  ? 166  ASP A CB  1 
ATOM 1305 C CG  . ASP A 1 169  ? 28.501  56.276 45.364  1.00 32.06  ? 166  ASP A CG  1 
ATOM 1306 O OD1 . ASP A 1 169  ? 28.765  56.075 44.144  1.00 32.06  ? 166  ASP A OD1 1 
ATOM 1307 O OD2 . ASP A 1 169  ? 27.825  57.275 45.766  1.00 32.06  ? 166  ASP A OD2 1 
ATOM 1308 N N   . VAL A 1 170  ? 31.804  56.184 45.008  1.00 41.99  ? 167  VAL A N   1 
ATOM 1309 C CA  . VAL A 1 170  ? 32.980  57.101 44.963  1.00 41.99  ? 167  VAL A CA  1 
ATOM 1310 C C   . VAL A 1 170  ? 32.689  58.431 44.270  1.00 41.99  ? 167  VAL A C   1 
ATOM 1311 O O   . VAL A 1 170  ? 32.112  58.442 43.176  1.00 41.99  ? 167  VAL A O   1 
ATOM 1312 C CB  . VAL A 1 170  ? 34.139  56.560 44.058  1.00 39.45  ? 167  VAL A CB  1 
ATOM 1313 C CG1 . VAL A 1 170  ? 35.483  56.752 44.712  1.00 39.45  ? 167  VAL A CG1 1 
ATOM 1314 C CG2 . VAL A 1 170  ? 33.918  55.130 43.616  1.00 39.45  ? 167  VAL A CG2 1 
ATOM 1315 N N   . LYS A 1 171  ? 33.129  59.547 44.840  1.00 30.88  ? 168  LYS A N   1 
ATOM 1316 C CA  . LYS A 1 171  ? 33.205  60.810 44.047  1.00 30.88  ? 168  LYS A CA  1 
ATOM 1317 C C   . LYS A 1 171  ? 34.507  61.548 44.321  1.00 30.88  ? 168  LYS A C   1 
ATOM 1318 O O   . LYS A 1 171  ? 35.038  61.431 45.424  1.00 30.88  ? 168  LYS A O   1 
ATOM 1319 C CB  . LYS A 1 171  ? 32.050  61.788 44.356  1.00 33.79  ? 168  LYS A CB  1 
ATOM 1320 C CG  . LYS A 1 171  ? 30.700  61.180 44.409  1.00 33.79  ? 168  LYS A CG  1 
ATOM 1321 C CD  . LYS A 1 171  ? 29.750  61.807 43.381  1.00 33.79  ? 168  LYS A CD  1 
ATOM 1322 C CE  . LYS A 1 171  ? 28.674  60.822 42.875  1.00 33.79  ? 168  LYS A CE  1 
ATOM 1323 N NZ  . LYS A 1 171  ? 28.294  59.798 43.908  1.00 33.79  ? 168  LYS A NZ  1 
ATOM 1324 N N   . PHE A 1 172  ? 35.004  62.329 43.362  1.00 47.76  ? 169  PHE A N   1 
ATOM 1325 C CA  . PHE A 1 172  ? 36.040  63.332 43.655  1.00 47.76  ? 169  PHE A CA  1 
ATOM 1326 C C   . PHE A 1 172  ? 35.484  64.484 44.501  1.00 47.76  ? 169  PHE A C   1 
ATOM 1327 O O   . PHE A 1 172  ? 34.450  65.068 44.150  1.00 47.76  ? 169  PHE A O   1 
ATOM 1328 C CB  . PHE A 1 172  ? 36.537  63.944 42.364  1.00 36.75  ? 169  PHE A CB  1 
ATOM 1329 C CG  . PHE A 1 172  ? 37.372  63.038 41.554  1.00 36.75  ? 169  PHE A CG  1 
ATOM 1330 C CD1 . PHE A 1 172  ? 36.853  62.437 40.411  1.00 36.75  ? 169  PHE A CD1 1 
ATOM 1331 C CD2 . PHE A 1 172  ? 38.685  62.795 41.904  1.00 36.75  ? 169  PHE A CD2 1 
ATOM 1332 C CE1 . PHE A 1 172  ? 37.641  61.593 39.612  1.00 36.75  ? 169  PHE A CE1 1 
ATOM 1333 C CE2 . PHE A 1 172  ? 39.486  61.954 41.125  1.00 36.75  ? 169  PHE A CE2 1 
ATOM 1334 C CZ  . PHE A 1 172  ? 38.963  61.349 39.969  1.00 36.75  ? 169  PHE A CZ  1 
ATOM 1335 N N   . LEU A 1 173  ? 36.170  64.833 45.587  1.00 38.58  ? 170  LEU A N   1 
ATOM 1336 C CA  . LEU A 1 173  ? 35.771  65.974 46.424  1.00 38.58  ? 170  LEU A CA  1 
ATOM 1337 C C   . LEU A 1 173  ? 36.053  67.315 45.759  1.00 38.58  ? 170  LEU A C   1 
ATOM 1338 O O   . LEU A 1 173  ? 37.038  67.462 45.037  1.00 38.58  ? 170  LEU A O   1 
ATOM 1339 C CB  . LEU A 1 173  ? 36.487  65.934 47.748  1.00 38.12  ? 170  LEU A CB  1 
ATOM 1340 C CG  . LEU A 1 173  ? 36.074  64.767 48.636  1.00 38.12  ? 170  LEU A CG  1 
ATOM 1341 C CD1 . LEU A 1 173  ? 36.984  64.682 49.878  1.00 38.12  ? 170  LEU A CD1 1 
ATOM 1342 C CD2 . LEU A 1 173  ? 34.606  64.836 49.018  1.00 38.12  ? 170  LEU A CD2 1 
ATOM 1343 N N   . TYR A 1 174  ? 35.182  68.296 45.999  1.00 54.16  ? 171  TYR A N   1 
ATOM 1344 C CA  . TYR A 1 174  ? 35.377  69.641 45.466  1.00 54.16  ? 171  TYR A CA  1 
ATOM 1345 C C   . TYR A 1 174  ? 36.393  70.427 46.297  1.00 54.16  ? 171  TYR A C   1 
ATOM 1346 O O   . TYR A 1 174  ? 36.575  70.161 47.513  1.00 54.16  ? 171  TYR A O   1 
ATOM 1347 C CB  . TYR A 1 174  ? 34.059  70.393 45.452  1.00 42.77  ? 171  TYR A CB  1 
ATOM 1348 C CG  . TYR A 1 174  ? 33.191  70.135 44.246  1.00 42.77  ? 171  TYR A CG  1 
ATOM 1349 C CD1 . TYR A 1 174  ? 32.181  69.157 44.273  1.00 42.77  ? 171  TYR A CD1 1 
ATOM 1350 C CD2 . TYR A 1 174  ? 33.362  70.885 43.073  1.00 42.77  ? 171  TYR A CD2 1 
ATOM 1351 C CE1 . TYR A 1 174  ? 31.391  68.934 43.166  1.00 42.77  ? 171  TYR A CE1 1 
ATOM 1352 C CE2 . TYR A 1 174  ? 32.588  70.668 41.968  1.00 42.77  ? 171  TYR A CE2 1 
ATOM 1353 C CZ  . TYR A 1 174  ? 31.608  69.694 42.021  1.00 42.77  ? 171  TYR A CZ  1 
ATOM 1354 O OH  . TYR A 1 174  ? 30.841  69.498 40.912  1.00 42.77  ? 171  TYR A OH  1 
ATOM 1355 N N   . GLY A 1 175  ? 37.044  71.389 45.636  1.00 57.56  ? 172  GLY A N   1 
ATOM 1356 C CA  . GLY A 1 175  ? 37.942  72.339 46.303  1.00 57.56  ? 172  GLY A CA  1 
ATOM 1357 C C   . GLY A 1 175  ? 39.201  71.715 46.884  1.00 57.56  ? 172  GLY A C   1 
ATOM 1358 O O   . GLY A 1 175  ? 39.636  72.062 47.994  1.00 57.56  ? 172  GLY A O   1 
ATOM 1359 N N   . CYS A 1 176  ? 39.792  70.794 46.128  1.00 110.93 ? 173  CYS A N   1 
ATOM 1360 C CA  . CYS A 1 176  ? 40.994  70.098 46.574  1.00 110.93 ? 173  CYS A CA  1 
ATOM 1361 C C   . CYS A 1 176  ? 42.237  70.503 45.791  1.00 110.93 ? 173  CYS A C   1 
ATOM 1362 O O   . CYS A 1 176  ? 42.205  70.615 44.562  1.00 110.93 ? 173  CYS A O   1 
ATOM 1363 C CB  . CYS A 1 176  ? 40.777  68.584 46.524  1.00 48.60  ? 173  CYS A CB  1 
ATOM 1364 S SG  . CYS A 1 176  ? 40.036  67.973 48.028  1.00 48.60  ? 173  CYS A SG  1 
ATOM 1365 N N   . GLN A 1 177  ? 43.336  70.711 46.510  1.00 75.35  ? 174  GLN A N   1 
ATOM 1366 C CA  . GLN A 1 177  ? 44.578  71.181 45.888  1.00 75.35  ? 174  GLN A CA  1 
ATOM 1367 C C   . GLN A 1 177  ? 45.301  70.050 45.171  1.00 75.35  ? 174  GLN A C   1 
ATOM 1368 O O   . GLN A 1 177  ? 46.502  70.101 44.948  1.00 75.35  ? 174  GLN A O   1 
ATOM 1369 C CB  . GLN A 1 177  ? 45.483  71.865 46.918  1.00 99.55  ? 174  GLN A CB  1 
ATOM 1370 C CG  . GLN A 1 177  ? 45.072  73.310 47.240  1.00 99.55  ? 174  GLN A CG  1 
ATOM 1371 C CD  . GLN A 1 177  ? 45.479  73.755 48.640  1.00 99.55  ? 174  GLN A CD  1 
ATOM 1372 O OE1 . GLN A 1 177  ? 45.376  72.997 49.604  1.00 99.55  ? 174  GLN A OE1 1 
ATOM 1373 N NE2 . GLN A 1 177  ? 45.932  74.995 48.755  1.00 99.55  ? 174  GLN A NE2 1 
ATOM 1374 N N   . ALA A 1 178  ? 44.527  69.034 44.817  1.00 75.24  ? 175  ALA A N   1 
ATOM 1375 C CA  . ALA A 1 178  ? 44.948  67.881 44.038  1.00 75.24  ? 175  ALA A CA  1 
ATOM 1376 C C   . ALA A 1 178  ? 43.764  66.920 44.057  1.00 75.24  ? 175  ALA A C   1 
ATOM 1377 O O   . ALA A 1 178  ? 43.065  66.817 45.068  1.00 75.24  ? 175  ALA A O   1 
ATOM 1378 C CB  . ALA A 1 178  ? 46.186  67.218 44.638  1.00 43.99  ? 175  ALA A CB  1 
ATOM 1379 N N   . PRO A 1 179  ? 43.546  66.196 42.953  1.00 49.16  ? 176  PRO A N   1 
ATOM 1380 C CA  . PRO A 1 179  ? 42.403  65.304 42.895  1.00 49.16  ? 176  PRO A CA  1 
ATOM 1381 C C   . PRO A 1 179  ? 42.386  64.417 44.136  1.00 49.16  ? 176  PRO A C   1 
ATOM 1382 O O   . PRO A 1 179  ? 43.392  63.788 44.463  1.00 49.16  ? 176  PRO A O   1 
ATOM 1383 C CB  . PRO A 1 179  ? 42.683  64.471 41.652  1.00 56.92  ? 176  PRO A CB  1 
ATOM 1384 C CG  . PRO A 1 179  ? 43.515  65.344 40.812  1.00 56.92  ? 176  PRO A CG  1 
ATOM 1385 C CD  . PRO A 1 179  ? 44.371  66.108 41.741  1.00 56.92  ? 176  PRO A CD  1 
ATOM 1386 N N   . THR A 1 180  ? 41.261  64.416 44.837  1.00 46.11  ? 177  THR A N   1 
ATOM 1387 C CA  . THR A 1 180  ? 41.098  63.650 46.060  1.00 46.11  ? 177  THR A CA  1 
ATOM 1388 C C   . THR A 1 180  ? 39.831  62.838 45.915  1.00 46.11  ? 177  THR A C   1 
ATOM 1389 O O   . THR A 1 180  ? 38.759  63.347 45.532  1.00 46.11  ? 177  THR A O   1 
ATOM 1390 C CB  . THR A 1 180  ? 40.982  64.547 47.322  1.00 50.53  ? 177  THR A CB  1 
ATOM 1391 O OG1 . THR A 1 180  ? 42.255  65.106 47.671  1.00 50.53  ? 177  THR A OG1 1 
ATOM 1392 C CG2 . THR A 1 180  ? 40.481  63.756 48.488  1.00 50.53  ? 177  THR A CG2 1 
ATOM 1393 N N   . ILE A 1 181  ? 39.957  61.566 46.238  1.00 53.74  ? 178  ILE A N   1 
ATOM 1394 C CA  . ILE A 1 181  ? 38.852  60.668 46.104  1.00 53.74  ? 178  ILE A CA  1 
ATOM 1395 C C   . ILE A 1 181  ? 38.133  60.489 47.434  1.00 53.74  ? 178  ILE A C   1 
ATOM 1396 O O   . ILE A 1 181  ? 38.759  60.508 48.510  1.00 53.74  ? 178  ILE A O   1 
ATOM 1397 C CB  . ILE A 1 181  ? 39.329  59.352 45.475  1.00 48.88  ? 178  ILE A CB  1 
ATOM 1398 C CG1 . ILE A 1 181  ? 38.369  58.968 44.385  1.00 48.88  ? 178  ILE A CG1 1 
ATOM 1399 C CG2 . ILE A 1 181  ? 39.534  58.236 46.489  1.00 48.88  ? 178  ILE A CG2 1 
ATOM 1400 C CD1 . ILE A 1 181  ? 38.486  59.856 43.228  1.00 48.88  ? 178  ILE A CD1 1 
ATOM 1401 N N   . CYS A 1 182  ? 36.816  60.337 47.361  1.00 39.71  ? 179  CYS A N   1 
ATOM 1402 C CA  . CYS A 1 182  ? 36.040  60.027 48.551  1.00 39.71  ? 179  CYS A CA  1 
ATOM 1403 C C   . CYS A 1 182  ? 35.123  58.828 48.346  1.00 39.71  ? 179  CYS A C   1 
ATOM 1404 O O   . CYS A 1 182  ? 34.384  58.738 47.352  1.00 39.71  ? 179  CYS A O   1 
ATOM 1405 C CB  . CYS A 1 182  ? 35.250  61.239 49.032  1.00 44.67  ? 179  CYS A CB  1 
ATOM 1406 S SG  . CYS A 1 182  ? 34.383  60.924 50.601  1.00 44.67  ? 179  CYS A SG  1 
ATOM 1407 N N   . PHE A 1 183  ? 35.163  57.905 49.301  1.00 30.22  ? 180  PHE A N   1 
ATOM 1408 C CA  . PHE A 1 183  ? 34.447  56.643 49.132  1.00 30.22  ? 180  PHE A CA  1 
ATOM 1409 C C   . PHE A 1 183  ? 34.024  55.863 50.401  1.00 30.22  ? 180  PHE A C   1 
ATOM 1410 O O   . PHE A 1 183  ? 34.722  55.842 51.422  1.00 30.22  ? 180  PHE A O   1 
ATOM 1411 C CB  . PHE A 1 183  ? 35.244  55.723 48.192  1.00 35.56  ? 180  PHE A CB  1 
ATOM 1412 C CG  . PHE A 1 183  ? 36.492  55.171 48.797  1.00 35.56  ? 180  PHE A CG  1 
ATOM 1413 C CD1 . PHE A 1 183  ? 36.490  53.924 49.395  1.00 35.56  ? 180  PHE A CD1 1 
ATOM 1414 C CD2 . PHE A 1 183  ? 37.663  55.873 48.740  1.00 35.56  ? 180  PHE A CD2 1 
ATOM 1415 C CE1 . PHE A 1 183  ? 37.660  53.392 49.944  1.00 35.56  ? 180  PHE A CE1 1 
ATOM 1416 C CE2 . PHE A 1 183  ? 38.821  55.359 49.280  1.00 35.56  ? 180  PHE A CE2 1 
ATOM 1417 C CZ  . PHE A 1 183  ? 38.822  54.114 49.882  1.00 35.56  ? 180  PHE A CZ  1 
ATOM 1418 N N   . VAL A 1 184  ? 32.873  55.211 50.289  1.00 39.69  ? 181  VAL A N   1 
ATOM 1419 C CA  . VAL A 1 184  ? 32.381  54.330 51.309  1.00 39.69  ? 181  VAL A CA  1 
ATOM 1420 C C   . VAL A 1 184  ? 32.791  52.953 50.871  1.00 39.69  ? 181  VAL A C   1 
ATOM 1421 O O   . VAL A 1 184  ? 32.521  52.552 49.737  1.00 39.69  ? 181  VAL A O   1 
ATOM 1422 C CB  . VAL A 1 184  ? 30.857  54.357 51.352  1.00 35.91  ? 181  VAL A CB  1 
ATOM 1423 C CG1 . VAL A 1 184  ? 30.346  53.436 52.418  1.00 35.91  ? 181  VAL A CG1 1 
ATOM 1424 C CG2 . VAL A 1 184  ? 30.369  55.747 51.595  1.00 35.91  ? 181  VAL A CG2 1 
ATOM 1425 N N   . TYR A 1 185  ? 33.428  52.204 51.752  1.00 49.16  ? 182  TYR A N   1 
ATOM 1426 C CA  . TYR A 1 185  ? 33.716  50.826 51.414  1.00 49.16  ? 182  TYR A CA  1 
ATOM 1427 C C   . TYR A 1 185  ? 33.308  49.911 52.523  1.00 49.16  ? 182  TYR A C   1 
ATOM 1428 O O   . TYR A 1 185  ? 33.002  50.365 53.624  1.00 49.16  ? 182  TYR A O   1 
ATOM 1429 C CB  . TYR A 1 185  ? 35.181  50.651 51.130  1.00 40.74  ? 182  TYR A CB  1 
ATOM 1430 C CG  . TYR A 1 185  ? 36.055  50.956 52.316  1.00 40.74  ? 182  TYR A CG  1 
ATOM 1431 C CD1 . TYR A 1 185  ? 36.627  49.925 53.060  1.00 40.74  ? 182  TYR A CD1 1 
ATOM 1432 C CD2 . TYR A 1 185  ? 36.327  52.271 52.684  1.00 40.74  ? 182  TYR A CD2 1 
ATOM 1433 C CE1 . TYR A 1 185  ? 37.455  50.204 54.147  1.00 40.74  ? 182  TYR A CE1 1 
ATOM 1434 C CE2 . TYR A 1 185  ? 37.151  52.567 53.754  1.00 40.74  ? 182  TYR A CE2 1 
ATOM 1435 C CZ  . TYR A 1 185  ? 37.718  51.526 54.485  1.00 40.74  ? 182  TYR A CZ  1 
ATOM 1436 O OH  . TYR A 1 185  ? 38.534  51.797 55.547  1.00 40.74  ? 182  TYR A OH  1 
ATOM 1437 N N   . GLN A 1 186  ? 33.314  48.618 52.222  1.00 81.87  ? 183  GLN A N   1 
ATOM 1438 C CA  . GLN A 1 186  ? 32.949  47.611 53.193  1.00 81.87  ? 183  GLN A CA  1 
ATOM 1439 C C   . GLN A 1 186  ? 34.100  46.647 53.495  1.00 81.87  ? 183  GLN A C   1 
ATOM 1440 O O   . GLN A 1 186  ? 34.805  46.176 52.601  1.00 81.87  ? 183  GLN A O   1 
ATOM 1441 C CB  . GLN A 1 186  ? 31.710  46.858 52.728  1.00 49.69  ? 183  GLN A CB  1 
ATOM 1442 C CG  . GLN A 1 186  ? 30.848  46.355 53.861  1.00 49.69  ? 183  GLN A CG  1 
ATOM 1443 C CD  . GLN A 1 186  ? 29.713  45.475 53.362  1.00 49.69  ? 183  GLN A CD  1 
ATOM 1444 O OE1 . GLN A 1 186  ? 28.836  45.915 52.587  1.00 49.69  ? 183  GLN A OE1 1 
ATOM 1445 N NE2 . GLN A 1 186  ? 29.730  44.201 53.783  1.00 49.69  ? 183  GLN A NE2 1 
ATOM 1446 N N   . ASP A 1 187  ? 34.306  46.423 54.785  1.00 55.97  ? 184  ASP A N   1 
ATOM 1447 C CA  . ASP A 1 187  ? 35.129  45.348 55.311  1.00 55.97  ? 184  ASP A CA  1 
ATOM 1448 C C   . ASP A 1 187  ? 34.361  44.845 56.539  1.00 55.97  ? 184  ASP A C   1 
ATOM 1449 O O   . ASP A 1 187  ? 33.419  45.519 56.995  1.00 55.97  ? 184  ASP A O   1 
ATOM 1450 C CB  . ASP A 1 187  ? 36.530  45.854 55.668  1.00 52.94  ? 184  ASP A CB  1 
ATOM 1451 C CG  . ASP A 1 187  ? 36.527  46.921 56.743  1.00 52.94  ? 184  ASP A CG  1 
ATOM 1452 O OD1 . ASP A 1 187  ? 35.513  47.057 57.446  1.00 52.94  ? 184  ASP A OD1 1 
ATOM 1453 O OD2 . ASP A 1 187  ? 37.551  47.630 56.905  1.00 52.94  ? 184  ASP A OD2 1 
ATOM 1454 N N   . PRO A 1 188  ? 34.715  43.658 57.078  1.00 86.27  ? 185  PRO A N   1 
ATOM 1455 C CA  . PRO A 1 188  ? 34.015  43.341 58.329  1.00 86.27  ? 185  PRO A CA  1 
ATOM 1456 C C   . PRO A 1 188  ? 34.295  44.487 59.271  1.00 86.27  ? 185  PRO A C   1 
ATOM 1457 O O   . PRO A 1 188  ? 35.366  45.078 59.182  1.00 86.27  ? 185  PRO A O   1 
ATOM 1458 C CB  . PRO A 1 188  ? 34.720  42.089 58.825  1.00 42.34  ? 185  PRO A CB  1 
ATOM 1459 C CG  . PRO A 1 188  ? 35.313  41.468 57.584  1.00 42.34  ? 185  PRO A CG  1 
ATOM 1460 C CD  . PRO A 1 188  ? 35.677  42.608 56.684  1.00 42.34  ? 185  PRO A CD  1 
ATOM 1461 N N   . GLN A 1 189  ? 33.350  44.804 60.148  1.00 69.68  ? 186  GLN A N   1 
ATOM 1462 C CA  . GLN A 1 189  ? 33.438  45.986 61.026  1.00 69.68  ? 186  GLN A CA  1 
ATOM 1463 C C   . GLN A 1 189  ? 32.496  47.082 60.510  1.00 69.68  ? 186  GLN A C   1 
ATOM 1464 O O   . GLN A 1 189  ? 32.417  48.192 61.068  1.00 69.68  ? 186  GLN A O   1 
ATOM 1465 C CB  . GLN A 1 189  ? 34.881  46.520 61.143  1.00 63.16  ? 186  GLN A CB  1 
ATOM 1466 C CG  . GLN A 1 189  ? 35.825  45.689 62.026  1.00 63.16  ? 186  GLN A CG  1 
ATOM 1467 C CD  . GLN A 1 189  ? 37.173  45.431 61.347  1.00 63.16  ? 186  GLN A CD  1 
ATOM 1468 O OE1 . GLN A 1 189  ? 38.019  46.330 61.241  1.00 63.16  ? 186  GLN A OE1 1 
ATOM 1469 N NE2 . GLN A 1 189  ? 37.374  44.197 60.882  1.00 63.16  ? 186  GLN A NE2 1 
ATOM 1470 N N   . GLY A 1 190  ? 31.787  46.747 59.437  1.00 62.32  ? 187  GLY A N   1 
ATOM 1471 C CA  . GLY A 1 190  ? 30.847  47.654 58.817  1.00 62.32  ? 187  GLY A CA  1 
ATOM 1472 C C   . GLY A 1 190  ? 31.496  48.488 57.737  1.00 62.32  ? 187  GLY A C   1 
ATOM 1473 O O   . GLY A 1 190  ? 32.526  48.109 57.164  1.00 62.32  ? 187  GLY A O   1 
ATOM 1474 N N   . ARG A 1 191  ? 30.889  49.633 57.458  1.00 54.46  ? 188  ARG A N   1 
ATOM 1475 C CA  . ARG A 1 191  ? 31.347  50.475 56.376  1.00 54.46  ? 188  ARG A CA  1 
ATOM 1476 C C   . ARG A 1 191  ? 32.040  51.690 56.930  1.00 54.46  ? 188  ARG A C   1 
ATOM 1477 O O   . ARG A 1 191  ? 31.871  52.024 58.097  1.00 54.46  ? 188  ARG A O   1 
ATOM 1478 C CB  . ARG A 1 191  ? 30.182  50.842 55.474  1.00 37.28  ? 188  ARG A CB  1 
ATOM 1479 C CG  . ARG A 1 191  ? 29.493  49.604 54.902  1.00 37.28  ? 188  ARG A CG  1 
ATOM 1480 C CD  . ARG A 1 191  ? 28.356  49.951 53.937  1.00 37.28  ? 188  ARG A CD  1 
ATOM 1481 N NE  . ARG A 1 191  ? 27.861  48.776 53.223  1.00 37.28  ? 188  ARG A NE  1 
ATOM 1482 C CZ  . ARG A 1 191  ? 26.837  48.784 52.376  1.00 37.28  ? 188  ARG A CZ  1 
ATOM 1483 N NH1 . ARG A 1 191  ? 26.161  49.893 52.122  1.00 37.28  ? 188  ARG A NH1 1 
ATOM 1484 N NH2 . ARG A 1 191  ? 26.473  47.666 51.779  1.00 37.28  ? 188  ARG A NH2 1 
ATOM 1485 N N   . HIS A 1 192  ? 32.849  52.324 56.089  1.00 46.56  ? 189  HIS A N   1 
ATOM 1486 C CA  . HIS A 1 192  ? 33.690  53.443 56.482  1.00 46.56  ? 189  HIS A CA  1 
ATOM 1487 C C   . HIS A 1 192  ? 33.771  54.384 55.301  1.00 46.56  ? 189  HIS A C   1 
ATOM 1488 O O   . HIS A 1 192  ? 33.452  53.984 54.179  1.00 46.56  ? 189  HIS A O   1 
ATOM 1489 C CB  . HIS A 1 192  ? 35.098  52.945 56.832  1.00 49.52  ? 189  HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 192  ? 35.105  51.687 57.645  1.00 49.52  ? 189  HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 192  ? 35.004  51.688 59.023  1.00 49.52  ? 189  HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 192  ? 35.165  50.386 57.271  1.00 49.52  ? 189  HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 192  ? 35.007  50.441 59.461  1.00 49.52  ? 189  HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 192  ? 35.105  49.632 58.418  1.00 49.52  ? 189  HIS A NE2 1 
ATOM 1495 N N   . VAL A 1 193  ? 34.186  55.626 55.545  1.00 49.47  ? 190  VAL A N   1 
ATOM 1496 C CA  . VAL A 1 193  ? 34.419  56.603 54.484  1.00 49.47  ? 190  VAL A CA  1 
ATOM 1497 C C   . VAL A 1 193  ? 35.877  57.051 54.549  1.00 49.47  ? 190  VAL A C   1 
ATOM 1498 O O   . VAL A 1 193  ? 36.416  57.308 55.624  1.00 49.47  ? 190  VAL A O   1 
ATOM 1499 C CB  . VAL A 1 193  ? 33.444  57.804 54.550  1.00 28.99  ? 190  VAL A CB  1 
ATOM 1500 C CG1 . VAL A 1 193  ? 33.443  58.450 55.929  1.00 28.99  ? 190  VAL A CG1 1 
ATOM 1501 C CG2 . VAL A 1 193  ? 33.768  58.873 53.472  1.00 28.99  ? 190  VAL A CG2 1 
ATOM 1502 N N   . LYS A 1 194  ? 36.514  57.121 53.382  1.00 49.83  ? 191  LYS A N   1 
ATOM 1503 C CA  . LYS A 1 194  ? 37.945  57.311 53.309  1.00 49.83  ? 191  LYS A CA  1 
ATOM 1504 C C   . LYS A 1 194  ? 38.316  58.279 52.191  1.00 49.83  ? 191  LYS A C   1 
ATOM 1505 O O   . LYS A 1 194  ? 37.501  58.576 51.310  1.00 49.83  ? 191  LYS A O   1 
ATOM 1506 C CB  . LYS A 1 194  ? 38.620  55.960 53.116  1.00 51.25  ? 191  LYS A CB  1 
ATOM 1507 C CG  . LYS A 1 194  ? 40.000  55.907 53.708  1.00 51.25  ? 191  LYS A CG  1 
ATOM 1508 C CD  . LYS A 1 194  ? 40.699  54.595 53.415  1.00 51.25  ? 191  LYS A CD  1 
ATOM 1509 C CE  . LYS A 1 194  ? 42.202  54.814 53.425  1.00 51.25  ? 191  LYS A CE  1 
ATOM 1510 N NZ  . LYS A 1 194  ? 42.940  53.547 53.212  1.00 51.25  ? 191  LYS A NZ  1 
ATOM 1511 N N   . THR A 1 195  ? 39.549  58.781 52.241  1.00 47.02  ? 192  THR A N   1 
ATOM 1512 C CA  . THR A 1 195  ? 40.057  59.685 51.200  1.00 47.02  ? 192  THR A CA  1 
ATOM 1513 C C   . THR A 1 195  ? 41.383  59.206 50.600  1.00 47.02  ? 192  THR A C   1 
ATOM 1514 O O   . THR A 1 195  ? 42.162  58.504 51.254  1.00 47.02  ? 192  THR A O   1 
ATOM 1515 C CB  . THR A 1 195  ? 40.231  61.092 51.772  1.00 48.75  ? 192  THR A CB  1 
ATOM 1516 O OG1 . THR A 1 195  ? 40.849  60.985 53.059  1.00 48.75  ? 192  THR A OG1 1 
ATOM 1517 C CG2 . THR A 1 195  ? 38.883  61.783 51.932  1.00 48.75  ? 192  THR A CG2 1 
ATOM 1518 N N   . TYR A 1 196  ? 41.616  59.540 49.338  1.00 50.43  ? 193  TYR A N   1 
ATOM 1519 C CA  . TYR A 1 196  ? 42.934  59.325 48.729  1.00 50.43  ? 193  TYR A CA  1 
ATOM 1520 C C   . TYR A 1 196  ? 43.156  60.461 47.779  1.00 50.43  ? 193  TYR A C   1 
ATOM 1521 O O   . TYR A 1 196  ? 42.274  60.782 46.987  1.00 50.43  ? 193  TYR A O   1 
ATOM 1522 C CB  . TYR A 1 196  ? 43.041  58.037 47.901  1.00 48.08  ? 193  TYR A CB  1 
ATOM 1523 C CG  . TYR A 1 196  ? 43.108  56.708 48.617  1.00 48.08  ? 193  TYR A CG  1 
ATOM 1524 C CD1 . TYR A 1 196  ? 42.187  55.701 48.324  1.00 48.08  ? 193  TYR A CD1 1 
ATOM 1525 C CD2 . TYR A 1 196  ? 44.105  56.421 49.543  1.00 48.08  ? 193  TYR A CD2 1 
ATOM 1526 C CE1 . TYR A 1 196  ? 42.237  54.449 48.966  1.00 48.08  ? 193  TYR A CE1 1 
ATOM 1527 C CE2 . TYR A 1 196  ? 44.163  55.161 50.193  1.00 48.08  ? 193  TYR A CE2 1 
ATOM 1528 C CZ  . TYR A 1 196  ? 43.228  54.193 49.894  1.00 48.08  ? 193  TYR A CZ  1 
ATOM 1529 O OH  . TYR A 1 196  ? 43.269  52.969 50.502  1.00 48.08  ? 193  TYR A OH  1 
ATOM 1530 N N   . GLU A 1 197  ? 44.330  61.070 47.838  1.00 40.31  ? 194  GLU A N   1 
ATOM 1531 C CA  . GLU A 1 197  ? 44.695  62.034 46.811  1.00 40.31  ? 194  GLU A CA  1 
ATOM 1532 C C   . GLU A 1 197  ? 45.115  61.223 45.565  1.00 40.31  ? 194  GLU A C   1 
ATOM 1533 O O   . GLU A 1 197  ? 45.669  60.139 45.690  1.00 40.31  ? 194  GLU A O   1 
ATOM 1534 C CB  . GLU A 1 197  ? 45.774  63.009 47.328  1.00 79.89  ? 194  GLU A CB  1 
ATOM 1535 C CG  . GLU A 1 197  ? 45.229  63.921 48.468  1.00 79.89  ? 194  GLU A CG  1 
ATOM 1536 C CD  . GLU A 1 197  ? 46.261  64.842 49.147  1.00 79.89  ? 194  GLU A CD  1 
ATOM 1537 O OE1 . GLU A 1 197  ? 47.280  65.188 48.509  1.00 79.89  ? 194  GLU A OE1 1 
ATOM 1538 O OE2 . GLU A 1 197  ? 46.030  65.235 50.320  1.00 79.89  ? 194  GLU A OE2 1 
ATOM 1539 N N   . VAL A 1 198  ? 44.818  61.703 44.365  1.00 65.72  ? 195  VAL A N   1 
ATOM 1540 C CA  . VAL A 1 198  ? 45.347  61.003 43.201  1.00 65.72  ? 195  VAL A CA  1 
ATOM 1541 C C   . VAL A 1 198  ? 46.575  61.707 42.671  1.00 65.72  ? 195  VAL A C   1 
ATOM 1542 O O   . VAL A 1 198  ? 46.465  62.796 42.108  1.00 65.72  ? 195  VAL A O   1 
ATOM 1543 C CB  . VAL A 1 198  ? 44.323  60.782 42.062  1.00 44.32  ? 195  VAL A CB  1 
ATOM 1544 C CG1 . VAL A 1 198  ? 44.988  60.023 40.934  1.00 44.32  ? 195  VAL A CG1 1 
ATOM 1545 C CG2 . VAL A 1 198  ? 43.121  59.969 42.573  1.00 44.32  ? 195  VAL A CG2 1 
ATOM 1546 N N   . SER A 1 199  ? 47.737  61.075 42.872  1.00 68.97  ? 196  SER A N   1 
ATOM 1547 C CA  . SER A 1 199  ? 49.007  61.544 42.312  1.00 68.97  ? 196  SER A CA  1 
ATOM 1548 C C   . SER A 1 199  ? 49.214  60.852 40.989  1.00 68.97  ? 196  SER A C   1 
ATOM 1549 O O   . SER A 1 199  ? 49.713  59.723 40.931  1.00 68.97  ? 196  SER A O   1 
ATOM 1550 C CB  . SER A 1 199  ? 50.184  61.258 43.249  1.00 122.93 ? 196  SER A CB  1 
ATOM 1551 O OG  . SER A 1 199  ? 51.386  61.812 42.738  1.00 122.93 ? 196  SER A OG  1 
ATOM 1552 N N   . LEU A 1 200  ? 48.794  61.528 39.926  1.00 70.33  ? 197  LEU A N   1 
ATOM 1553 C CA  . LEU A 1 200  ? 48.943  60.989 38.581  1.00 70.33  ? 197  LEU A CA  1 
ATOM 1554 C C   . LEU A 1 200  ? 50.360  61.169 38.103  1.00 70.33  ? 197  LEU A C   1 
ATOM 1555 O O   . LEU A 1 200  ? 50.794  60.453 37.208  1.00 70.33  ? 197  LEU A O   1 
ATOM 1556 C CB  . LEU A 1 200  ? 47.945  61.611 37.596  1.00 64.44  ? 197  LEU A CB  1 
ATOM 1557 C CG  . LEU A 1 200  ? 48.089  63.060 37.132  1.00 64.44  ? 197  LEU A CG  1 
ATOM 1558 C CD1 . LEU A 1 200  ? 46.914  63.430 36.212  1.00 64.44  ? 197  LEU A CD1 1 
ATOM 1559 C CD2 . LEU A 1 200  ? 48.227  64.049 38.331  1.00 64.44  ? 197  LEU A CD2 1 
ATOM 1560 N N   . ARG A 1 201  ? 51.065  62.127 38.709  1.00 80.55  ? 198  ARG A N   1 
ATOM 1561 C CA  . ARG A 1 201  ? 52.490  62.321 38.482  1.00 80.55  ? 198  ARG A CA  1 
ATOM 1562 C C   . ARG A 1 201  ? 53.256  60.995 38.549  1.00 80.55  ? 198  ARG A C   1 
ATOM 1563 O O   . ARG A 1 201  ? 54.000  60.657 37.629  1.00 80.55  ? 198  ARG A O   1 
ATOM 1564 C CB  . ARG A 1 201  ? 53.070  63.326 39.485  1.00 109.11 ? 198  ARG A CB  1 
ATOM 1565 C CG  . ARG A 1 201  ? 54.599  63.485 39.390  1.00 109.11 ? 198  ARG A CG  1 
ATOM 1566 C CD  . ARG A 1 201  ? 55.072  64.392 38.228  1.00 109.11 ? 198  ARG A CD  1 
ATOM 1567 N NE  . ARG A 1 201  ? 54.013  64.755 37.279  1.00 109.11 ? 198  ARG A NE  1 
ATOM 1568 C CZ  . ARG A 1 201  ? 54.193  65.475 36.171  1.00 109.11 ? 198  ARG A CZ  1 
ATOM 1569 N NH1 . ARG A 1 201  ? 55.400  65.916 35.838  1.00 109.11 ? 198  ARG A NH1 1 
ATOM 1570 N NH2 . ARG A 1 201  ? 53.159  65.753 35.390  1.00 109.11 ? 198  ARG A NH2 1 
ATOM 1571 N N   . GLU A 1 202  ? 53.040  60.243 39.630  1.00 51.32  ? 199  GLU A N   1 
ATOM 1572 C CA  . GLU A 1 202  ? 53.747  58.988 39.881  1.00 51.32  ? 199  GLU A CA  1 
ATOM 1573 C C   . GLU A 1 202  ? 52.805  57.783 40.033  1.00 51.32  ? 199  GLU A C   1 
ATOM 1574 O O   . GLU A 1 202  ? 53.232  56.700 40.477  1.00 51.32  ? 199  GLU A O   1 
ATOM 1575 C CB  . GLU A 1 202  ? 54.610  59.136 41.127  1.00 84.77  ? 199  GLU A CB  1 
ATOM 1576 C CG  . GLU A 1 202  ? 53.795  59.453 42.364  1.00 84.77  ? 199  GLU A CG  1 
ATOM 1577 C CD  . GLU A 1 202  ? 54.612  60.112 43.442  1.00 84.77  ? 199  GLU A CD  1 
ATOM 1578 O OE1 . GLU A 1 202  ? 54.266  59.953 44.633  1.00 84.77  ? 199  GLU A OE1 1 
ATOM 1579 O OE2 . GLU A 1 202  ? 55.600  60.795 43.098  1.00 84.77  ? 199  GLU A OE2 1 
ATOM 1580 N N   . LYS A 1 203  ? 51.531  57.982 39.686  1.00 48.28  ? 200  LYS A N   1 
ATOM 1581 C CA  . LYS A 1 203  ? 50.541  56.899 39.667  1.00 48.28  ? 200  LYS A CA  1 
ATOM 1582 C C   . LYS A 1 203  ? 50.235  56.169 41.004  1.00 48.28  ? 200  LYS A C   1 
ATOM 1583 O O   . LYS A 1 203  ? 49.854  55.000 40.968  1.00 48.28  ? 200  LYS A O   1 
ATOM 1584 C CB  . LYS A 1 203  ? 50.932  55.857 38.600  1.00 50.74  ? 200  LYS A CB  1 
ATOM 1585 C CG  . LYS A 1 203  ? 51.218  56.439 37.221  1.00 50.74  ? 200  LYS A CG  1 
ATOM 1586 C CD  . LYS A 1 203  ? 51.796  55.373 36.277  1.00 50.74  ? 200  LYS A CD  1 
ATOM 1587 C CE  . LYS A 1 203  ? 52.327  56.005 34.984  1.00 50.74  ? 200  LYS A CE  1 
ATOM 1588 N NZ  . LYS A 1 203  ? 51.353  56.056 33.839  1.00 50.74  ? 200  LYS A NZ  1 
ATOM 1589 N N   . GLU A 1 204  ? 50.396  56.829 42.159  1.00 49.86  ? 201  GLU A N   1 
ATOM 1590 C CA  . GLU A 1 204  ? 50.050  56.235 43.493  1.00 49.86  ? 201  GLU A CA  1 
ATOM 1591 C C   . GLU A 1 204  ? 48.721  56.817 44.027  1.00 49.86  ? 201  GLU A C   1 
ATOM 1592 O O   . GLU A 1 204  ? 47.889  57.275 43.243  1.00 49.86  ? 201  GLU A O   1 
ATOM 1593 C CB  . GLU A 1 204  ? 51.150  56.486 44.544  1.00 107.99 ? 201  GLU A CB  1 
ATOM 1594 C CG  . GLU A 1 204  ? 52.613  56.432 44.080  1.00 107.99 ? 201  GLU A CG  1 
ATOM 1595 C CD  . GLU A 1 204  ? 53.587  57.036 45.107  1.00 107.99 ? 201  GLU A CD  1 
ATOM 1596 O OE1 . GLU A 1 204  ? 53.136  57.471 46.191  1.00 107.99 ? 201  GLU A OE1 1 
ATOM 1597 O OE2 . GLU A 1 204  ? 54.808  57.086 44.829  1.00 107.99 ? 201  GLU A OE2 1 
ATOM 1598 N N   . PHE A 1 205  ? 48.549  56.809 45.355  1.00 77.65  ? 202  PHE A N   1 
ATOM 1599 C CA  . PHE A 1 205  ? 47.391  57.425 46.027  1.00 77.65  ? 202  PHE A CA  1 
ATOM 1600 C C   . PHE A 1 205  ? 47.776  58.421 47.125  1.00 77.65  ? 202  PHE A C   1 
ATOM 1601 O O   . PHE A 1 205  ? 46.993  59.313 47.484  1.00 77.65  ? 202  PHE A O   1 
ATOM 1602 C CB  . PHE A 1 205  ? 46.494  56.365 46.674  1.00 73.02  ? 202  PHE A CB  1 
ATOM 1603 C CG  . PHE A 1 205  ? 45.384  55.860 45.792  1.00 73.02  ? 202  PHE A CG  1 
ATOM 1604 C CD1 . PHE A 1 205  ? 45.115  54.500 45.715  1.00 73.02  ? 202  PHE A CD1 1 
ATOM 1605 C CD2 . PHE A 1 205  ? 44.594  56.734 45.056  1.00 73.02  ? 202  PHE A CD2 1 
ATOM 1606 C CE1 . PHE A 1 205  ? 44.083  54.022 44.915  1.00 73.02  ? 202  PHE A CE1 1 
ATOM 1607 C CE2 . PHE A 1 205  ? 43.561  56.259 44.253  1.00 73.02  ? 202  PHE A CE2 1 
ATOM 1608 C CZ  . PHE A 1 205  ? 43.310  54.903 44.184  1.00 73.02  ? 202  PHE A CZ  1 
ATOM 1609 N N   . ASN A 1 206  ? 48.963  58.250 47.689  1.00 83.59  ? 203  ASN A N   1 
ATOM 1610 C CA  . ASN A 1 206  ? 49.387  59.068 48.828  1.00 83.59  ? 203  ASN A CA  1 
ATOM 1611 C C   . ASN A 1 206  ? 48.473  58.885 50.037  1.00 83.59  ? 203  ASN A C   1 
ATOM 1612 O O   . ASN A 1 206  ? 47.934  57.792 50.259  1.00 83.59  ? 203  ASN A O   1 
ATOM 1613 C CB  . ASN A 1 206  ? 49.483  60.541 48.423  1.00 72.71  ? 203  ASN A CB  1 
ATOM 1614 C CG  . ASN A 1 206  ? 50.370  60.743 47.210  1.00 72.71  ? 203  ASN A CG  1 
ATOM 1615 O OD1 . ASN A 1 206  ? 51.088  59.823 46.793  1.00 72.71  ? 203  ASN A OD1 1 
ATOM 1616 N ND2 . ASN A 1 206  ? 50.330  61.943 46.636  1.00 72.71  ? 203  ASN A ND2 1 
ATOM 1617 N N   . LYS A 1 207  ? 48.322  59.942 50.829  1.00 64.79  ? 204  LYS A N   1 
ATOM 1618 C CA  . LYS A 1 207  ? 47.383  59.922 51.936  1.00 64.79  ? 204  LYS A CA  1 
ATOM 1619 C C   . LYS A 1 207  ? 46.128  60.691 51.488  1.00 64.79  ? 204  LYS A C   1 
ATOM 1620 O O   . LYS A 1 207  ? 46.090  61.230 50.373  1.00 64.79  ? 204  LYS A O   1 
ATOM 1621 C CB  . LYS A 1 207  ? 48.026  60.524 53.184  1.00 95.67  ? 204  LYS A CB  1 
ATOM 1622 C CG  . LYS A 1 207  ? 47.655  59.812 54.473  1.00 95.67  ? 204  LYS A CG  1 
ATOM 1623 C CD  . LYS A 1 207  ? 48.373  60.419 55.679  1.00 95.67  ? 204  LYS A CD  1 
ATOM 1624 C CE  . LYS A 1 207  ? 47.812  59.886 56.997  1.00 95.67  ? 204  LYS A CE  1 
ATOM 1625 N NZ  . LYS A 1 207  ? 48.347  60.638 58.170  1.00 95.67  ? 204  LYS A NZ  1 
ATOM 1626 N N   . GLY A 1 208  ? 45.098  60.707 52.328  1.00 63.79  ? 205  GLY A N   1 
ATOM 1627 C CA  . GLY A 1 208  ? 43.929  61.535 52.088  1.00 63.79  ? 205  GLY A CA  1 
ATOM 1628 C C   . GLY A 1 208  ? 43.994  62.816 52.903  1.00 63.79  ? 205  GLY A C   1 
ATOM 1629 O O   . GLY A 1 208  ? 44.799  62.912 53.832  1.00 63.79  ? 205  GLY A O   1 
ATOM 1630 N N   . PRO A 1 209  ? 43.158  63.820 52.555  1.00 65.81  ? 206  PRO A N   1 
ATOM 1631 C CA  . PRO A 1 209  ? 43.103  65.058 53.305  1.00 65.81  ? 206  PRO A CA  1 
ATOM 1632 C C   . PRO A 1 209  ? 42.247  64.952 54.559  1.00 65.81  ? 206  PRO A C   1 
ATOM 1633 O O   . PRO A 1 209  ? 41.997  65.967 55.208  1.00 65.81  ? 206  PRO A O   1 
ATOM 1634 C CB  . PRO A 1 209  ? 42.450  66.039 52.326  1.00 54.97  ? 206  PRO A CB  1 
ATOM 1635 C CG  . PRO A 1 209  ? 42.204  65.283 51.079  1.00 54.97  ? 206  PRO A CG  1 
ATOM 1636 C CD  . PRO A 1 209  ? 42.231  63.859 51.420  1.00 54.97  ? 206  PRO A CD  1 
ATOM 1637 N N   . TRP A 1 210  ? 41.766  63.757 54.887  1.00 50.71  ? 207  TRP A N   1 
ATOM 1638 C CA  . TRP A 1 210  ? 41.131  63.563 56.182  1.00 50.71  ? 207  TRP A CA  1 
ATOM 1639 C C   . TRP A 1 210  ? 40.776  62.152 56.552  1.00 50.71  ? 207  TRP A C   1 
ATOM 1640 O O   . TRP A 1 210  ? 40.196  61.436 55.764  1.00 50.71  ? 207  TRP A O   1 
ATOM 1641 C CB  . TRP A 1 210  ? 39.941  64.507 56.393  1.00 66.68  ? 207  TRP A CB  1 
ATOM 1642 C CG  . TRP A 1 210  ? 38.687  64.214 55.650  1.00 66.68  ? 207  TRP A CG  1 
ATOM 1643 C CD1 . TRP A 1 210  ? 37.826  63.159 55.847  1.00 66.68  ? 207  TRP A CD1 1 
ATOM 1644 C CD2 . TRP A 1 210  ? 38.093  65.033 54.642  1.00 66.68  ? 207  TRP A CD2 1 
ATOM 1645 N NE1 . TRP A 1 210  ? 36.740  63.263 54.994  1.00 66.68  ? 207  TRP A NE1 1 
ATOM 1646 C CE2 . TRP A 1 210  ? 36.880  64.403 54.246  1.00 66.68  ? 207  TRP A CE2 1 
ATOM 1647 C CE3 . TRP A 1 210  ? 38.468  66.230 54.024  1.00 66.68  ? 207  TRP A CE3 1 
ATOM 1648 C CZ2 . TRP A 1 210  ? 36.045  64.935 53.263  1.00 66.68  ? 207  TRP A CZ2 1 
ATOM 1649 C CZ3 . TRP A 1 210  ? 37.632  66.763 53.043  1.00 66.68  ? 207  TRP A CZ3 1 
ATOM 1650 C CH2 . TRP A 1 210  ? 36.433  66.116 52.677  1.00 66.68  ? 207  TRP A CH2 1 
ATOM 1651 N N   . LYS A 1 211  ? 41.137  61.798 57.786  1.00 57.82  ? 208  LYS A N   1 
ATOM 1652 C CA  . LYS A 1 211  ? 40.935  60.496 58.430  1.00 57.82  ? 208  LYS A CA  1 
ATOM 1653 C C   . LYS A 1 211  ? 39.726  59.663 57.997  1.00 57.82  ? 208  LYS A C   1 
ATOM 1654 O O   . LYS A 1 211  ? 38.685  60.185 57.602  1.00 57.82  ? 208  LYS A O   1 
ATOM 1655 C CB  . LYS A 1 211  ? 40.861  60.681 59.957  1.00 100.18 ? 208  LYS A CB  1 
ATOM 1656 C CG  . LYS A 1 211  ? 41.805  61.736 60.554  1.00 100.18 ? 208  LYS A CG  1 
ATOM 1657 C CD  . LYS A 1 211  ? 43.163  61.164 60.998  1.00 100.18 ? 208  LYS A CD  1 
ATOM 1658 C CE  . LYS A 1 211  ? 44.115  60.933 59.825  1.00 100.18 ? 208  LYS A CE  1 
ATOM 1659 N NZ  . LYS A 1 211  ? 44.102  62.054 58.816  1.00 100.18 ? 208  LYS A NZ  1 
ATOM 1660 N N   . GLN A 1 212  ? 39.889  58.352 58.101  1.00 50.71  ? 209  GLN A N   1 
ATOM 1661 C CA  . GLN A 1 212  ? 38.814  57.404 57.895  1.00 50.71  ? 209  GLN A CA  1 
ATOM 1662 C C   . GLN A 1 212  ? 37.777  57.547 59.014  1.00 50.71  ? 209  GLN A C   1 
ATOM 1663 O O   . GLN A 1 212  ? 38.135  57.772 60.176  1.00 50.71  ? 209  GLN A O   1 
ATOM 1664 C CB  . GLN A 1 212  ? 39.388  55.991 57.853  1.00 83.60  ? 209  GLN A CB  1 
ATOM 1665 C CG  . GLN A 1 212  ? 38.361  54.882 57.824  1.00 83.60  ? 209  GLN A CG  1 
ATOM 1666 C CD  . GLN A 1 212  ? 38.996  53.511 57.921  1.00 83.60  ? 209  GLN A CD  1 
ATOM 1667 O OE1 . GLN A 1 212  ? 39.912  53.185 57.162  1.00 83.60  ? 209  GLN A OE1 1 
ATOM 1668 N NE2 . GLN A 1 212  ? 38.511  52.697 58.855  1.00 83.60  ? 209  GLN A NE2 1 
ATOM 1669 N N   . GLU A 1 213  ? 36.498  57.433 58.663  1.00 43.05  ? 210  GLU A N   1 
ATOM 1670 C CA  . GLU A 1 213  ? 35.422  57.498 59.648  1.00 43.05  ? 210  GLU A CA  1 
ATOM 1671 C C   . GLU A 1 213  ? 34.403  56.423 59.364  1.00 43.05  ? 210  GLU A C   1 
ATOM 1672 O O   . GLU A 1 213  ? 34.215  56.048 58.214  1.00 43.05  ? 210  GLU A O   1 
ATOM 1673 C CB  . GLU A 1 213  ? 34.756  58.872 59.657  1.00 73.16  ? 210  GLU A CB  1 
ATOM 1674 C CG  . GLU A 1 213  ? 35.577  59.961 60.337  1.00 73.16  ? 210  GLU A CG  1 
ATOM 1675 C CD  . GLU A 1 213  ? 36.000  59.583 61.741  1.00 73.16  ? 210  GLU A CD  1 
ATOM 1676 O OE1 . GLU A 1 213  ? 35.358  58.685 62.344  1.00 73.16  ? 210  GLU A OE1 1 
ATOM 1677 O OE2 . GLU A 1 213  ? 36.982  60.181 62.238  1.00 73.16  ? 210  GLU A OE2 1 
ATOM 1678 N N   . ASN A 1 214  ? 33.762  55.916 60.414  1.00 48.14  ? 211  ASN A N   1 
ATOM 1679 C CA  . ASN A 1 214  ? 32.706  54.924 60.264  1.00 48.14  ? 211  ASN A CA  1 
ATOM 1680 C C   . ASN A 1 214  ? 31.415  55.524 59.754  1.00 48.14  ? 211  ASN A C   1 
ATOM 1681 O O   . ASN A 1 214  ? 31.084  56.675 60.030  1.00 48.14  ? 211  ASN A O   1 
ATOM 1682 C CB  . ASN A 1 214  ? 32.467  54.209 61.581  1.00 64.32  ? 211  ASN A CB  1 
ATOM 1683 C CG  . ASN A 1 214  ? 33.708  53.519 62.076  1.00 64.32  ? 211  ASN A CG  1 
ATOM 1684 O OD1 . ASN A 1 214  ? 34.501  53.003 61.285  1.00 64.32  ? 211  ASN A OD1 1 
ATOM 1685 N ND2 . ASN A 1 214  ? 33.898  53.517 63.381  1.00 64.32  ? 211  ASN A ND2 1 
ATOM 1686 N N   . VAL A 1 215  ? 30.693  54.748 58.967  1.00 50.26  ? 212  VAL A N   1 
ATOM 1687 C CA  . VAL A 1 215  ? 29.392  55.181 58.506  1.00 50.26  ? 212  VAL A CA  1 
ATOM 1688 C C   . VAL A 1 215  ? 28.405  54.053 58.708  1.00 50.26  ? 212  VAL A C   1 
ATOM 1689 O O   . VAL A 1 215  ? 28.775  52.914 58.975  1.00 50.26  ? 212  VAL A O   1 
ATOM 1690 C CB  . VAL A 1 215  ? 29.394  55.724 57.032  1.00 31.12  ? 212  VAL A CB  1 
ATOM 1691 C CG1 . VAL A 1 215  ? 30.237  56.964 56.919  1.00 31.12  ? 212  VAL A CG1 1 
ATOM 1692 C CG2 . VAL A 1 215  ? 29.877  54.677 56.003  1.00 31.12  ? 212  VAL A CG2 1 
ATOM 1693 N N   . GLU A 1 216  ? 27.138  54.407 58.605  1.00 36.96  ? 213  GLU A N   1 
ATOM 1694 C CA  . GLU A 1 216  ? 26.034  53.481 58.735  1.00 36.96  ? 213  GLU A CA  1 
ATOM 1695 C C   . GLU A 1 216  ? 26.192  52.174 57.932  1.00 36.96  ? 213  GLU A C   1 
ATOM 1696 O O   . GLU A 1 216  ? 26.712  52.150 56.786  1.00 36.96  ? 213  GLU A O   1 
ATOM 1697 C CB  . GLU A 1 216  ? 24.824  54.216 58.234  1.00 45.91  ? 213  GLU A CB  1 
ATOM 1698 C CG  . GLU A 1 216  ? 23.558  53.637 58.673  1.00 45.91  ? 213  GLU A CG  1 
ATOM 1699 C CD  . GLU A 1 216  ? 22.535  53.768 57.595  1.00 45.91  ? 213  GLU A CD  1 
ATOM 1700 O OE1 . GLU A 1 216  ? 22.247  54.929 57.194  1.00 45.91  ? 213  GLU A OE1 1 
ATOM 1701 O OE2 . GLU A 1 216  ? 22.039  52.700 57.153  1.00 45.91  ? 213  GLU A OE2 1 
ATOM 1702 N N   . ALA A 1 217  ? 25.723  51.084 58.528  1.00 49.45  ? 214  ALA A N   1 
ATOM 1703 C CA  . ALA A 1 217  ? 25.670  49.785 57.837  1.00 49.45  ? 214  ALA A CA  1 
ATOM 1704 C C   . ALA A 1 217  ? 25.138  49.863 56.383  1.00 49.45  ? 214  ALA A C   1 
ATOM 1705 O O   . ALA A 1 217  ? 25.684  49.210 55.498  1.00 49.45  ? 214  ALA A O   1 
ATOM 1706 C CB  . ALA A 1 217  ? 24.858  48.766 58.663  1.00 31.89  ? 214  ALA A CB  1 
ATOM 1707 N N   . GLU A 1 218  ? 24.092  50.659 56.145  1.00 43.51  ? 215  GLU A N   1 
ATOM 1708 C CA  . GLU A 1 218  ? 23.474  50.736 54.807  1.00 43.51  ? 215  GLU A CA  1 
ATOM 1709 C C   . GLU A 1 218  ? 23.812  52.004 54.024  1.00 43.51  ? 215  GLU A C   1 
ATOM 1710 O O   . GLU A 1 218  ? 23.144  52.304 53.043  1.00 43.51  ? 215  GLU A O   1 
ATOM 1711 C CB  . GLU A 1 218  ? 21.956  50.566 54.885  1.00 77.99  ? 215  GLU A CB  1 
ATOM 1712 C CG  . GLU A 1 218  ? 21.502  49.226 55.408  1.00 77.99  ? 215  GLU A CG  1 
ATOM 1713 C CD  . GLU A 1 218  ? 21.985  48.083 54.554  1.00 77.99  ? 215  GLU A CD  1 
ATOM 1714 O OE1 . GLU A 1 218  ? 21.689  48.081 53.340  1.00 77.99  ? 215  GLU A OE1 1 
ATOM 1715 O OE2 . GLU A 1 218  ? 22.659  47.184 55.098  1.00 77.99  ? 215  GLU A OE2 1 
ATOM 1716 N N   . ALA A 1 219  ? 24.832  52.744 54.455  1.00 37.85  ? 216  ALA A N   1 
ATOM 1717 C CA  . ALA A 1 219  ? 25.298  53.923 53.728  1.00 37.85  ? 216  ALA A CA  1 
ATOM 1718 C C   . ALA A 1 219  ? 25.553  53.531 52.311  1.00 37.85  ? 216  ALA A C   1 
ATOM 1719 O O   . ALA A 1 219  ? 26.264  52.571 52.074  1.00 37.85  ? 216  ALA A O   1 
ATOM 1720 C CB  . ALA A 1 219  ? 26.616  54.450 54.330  1.00 32.80  ? 216  ALA A CB  1 
ATOM 1721 N N   . SER A 1 220  ? 25.024  54.272 51.350  1.00 29.05  ? 217  SER A N   1 
ATOM 1722 C CA  . SER A 1 220  ? 25.297  53.903 49.980  1.00 29.05  ? 217  SER A CA  1 
ATOM 1723 C C   . SER A 1 220  ? 25.465  55.000 48.913  1.00 29.05  ? 217  SER A C   1 
ATOM 1724 O O   . SER A 1 220  ? 25.755  54.664 47.766  1.00 29.05  ? 217  SER A O   1 
ATOM 1725 C CB  . SER A 1 220  ? 24.237  52.950 49.537  1.00 27.48  ? 217  SER A CB  1 
ATOM 1726 O OG  . SER A 1 220  ? 23.065  53.669 49.351  1.00 27.48  ? 217  SER A OG  1 
ATOM 1727 N N   . MET A 1 221  ? 25.256  56.274 49.232  1.00 31.00  ? 218  MET A N   1 
ATOM 1728 C CA  . MET A 1 221  ? 25.423  57.329 48.231  1.00 31.00  ? 218  MET A CA  1 
ATOM 1729 C C   . MET A 1 221  ? 26.441  58.341 48.739  1.00 31.00  ? 218  MET A C   1 
ATOM 1730 O O   . MET A 1 221  ? 26.354  58.803 49.872  1.00 31.00  ? 218  MET A O   1 
ATOM 1731 C CB  . MET A 1 221  ? 24.114  58.046 47.954  1.00 63.14  ? 218  MET A CB  1 
ATOM 1732 C CG  . MET A 1 221  ? 22.987  57.162 47.515  1.00 63.14  ? 218  MET A CG  1 
ATOM 1733 S SD  . MET A 1 221  ? 22.054  57.878 46.135  1.00 63.14  ? 218  MET A SD  1 
ATOM 1734 C CE  . MET A 1 221  ? 22.852  57.013 44.779  1.00 63.14  ? 218  MET A CE  1 
ATOM 1735 N N   . VAL A 1 222  ? 27.421  58.685 47.918  1.00 45.70  ? 219  VAL A N   1 
ATOM 1736 C CA  . VAL A 1 222  ? 28.334  59.772 48.275  1.00 45.70  ? 219  VAL A CA  1 
ATOM 1737 C C   . VAL A 1 222  ? 27.971  60.943 47.381  1.00 45.70  ? 219  VAL A C   1 
ATOM 1738 O O   . VAL A 1 222  ? 27.782  60.769 46.181  1.00 45.70  ? 219  VAL A O   1 
ATOM 1739 C CB  . VAL A 1 222  ? 29.812  59.396 48.027  1.00 31.57  ? 219  VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 222  ? 30.745  60.537 48.405  1.00 31.57  ? 219  VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 222  ? 30.192  58.079 48.744  1.00 31.57  ? 219  VAL A CG2 1 
ATOM 1742 N N   . ILE A 1 223  ? 27.817  62.120 47.970  1.00 43.25  ? 220  ILE A N   1 
ATOM 1743 C CA  . ILE A 1 223  ? 27.657  63.363 47.192  1.00 43.25  ? 220  ILE A CA  1 
ATOM 1744 C C   . ILE A 1 223  ? 28.783  64.315 47.551  1.00 43.25  ? 220  ILE A C   1 
ATOM 1745 O O   . ILE A 1 223  ? 29.069  64.550 48.717  1.00 43.25  ? 220  ILE A O   1 
ATOM 1746 C CB  . ILE A 1 223  ? 26.290  64.055 47.433  1.00 24.36  ? 220  ILE A CB  1 
ATOM 1747 C CG1 . ILE A 1 223  ? 25.132  63.048 47.274  1.00 24.36  ? 220  ILE A CG1 1 
ATOM 1748 C CG2 . ILE A 1 223  ? 26.118  65.224 46.528  1.00 24.36  ? 220  ILE A CG2 1 
ATOM 1749 C CD1 . ILE A 1 223  ? 23.786  63.502 47.930  1.00 24.36  ? 220  ILE A CD1 1 
ATOM 1750 N N   . ALA A 1 224  ? 29.443  64.818 46.526  1.00 38.62  ? 221  ALA A N   1 
ATOM 1751 C CA  . ALA A 1 224  ? 30.466  65.830 46.696  1.00 38.62  ? 221  ALA A CA  1 
ATOM 1752 C C   . ALA A 1 224  ? 29.827  67.215 46.571  1.00 38.62  ? 221  ALA A C   1 
ATOM 1753 O O   . ALA A 1 224  ? 29.312  67.623 45.522  1.00 38.62  ? 221  ALA A O   1 
ATOM 1754 C CB  . ALA A 1 224  ? 31.611  65.636 45.695  1.00 33.99  ? 221  ALA A CB  1 
ATOM 1755 N N   . VAL A 1 225  ? 29.843  67.918 47.692  1.00 43.08  ? 222  VAL A N   1 
ATOM 1756 C CA  . VAL A 1 225  ? 29.276  69.238 47.776  1.00 43.08  ? 222  VAL A CA  1 
ATOM 1757 C C   . VAL A 1 225  ? 30.295  70.265 47.277  1.00 43.08  ? 222  VAL A C   1 
ATOM 1758 O O   . VAL A 1 225  ? 31.490  70.153 47.581  1.00 43.08  ? 222  VAL A O   1 
ATOM 1759 C CB  . VAL A 1 225  ? 28.855  69.504 49.193  1.00 38.96  ? 222  VAL A CB  1 
ATOM 1760 C CG1 . VAL A 1 225  ? 27.896  70.688 49.229  1.00 38.96  ? 222  VAL A CG1 1 
ATOM 1761 C CG2 . VAL A 1 225  ? 28.197  68.239 49.750  1.00 38.96  ? 222  VAL A CG2 1 
ATOM 1762 N N   . PRO A 1 226  ? 29.831  71.237 46.472  1.00 41.99  ? 223  PRO A N   1 
ATOM 1763 C CA  . PRO A 1 226  ? 30.721  72.193 45.822  1.00 41.99  ? 223  PRO A CA  1 
ATOM 1764 C C   . PRO A 1 226  ? 31.337  73.282 46.739  1.00 41.99  ? 223  PRO A C   1 
ATOM 1765 O O   . PRO A 1 226  ? 30.974  73.417 47.920  1.00 41.99  ? 223  PRO A O   1 
ATOM 1766 C CB  . PRO A 1 226  ? 29.842  72.808 44.713  1.00 56.04  ? 223  PRO A CB  1 
ATOM 1767 C CG  . PRO A 1 226  ? 28.594  72.011 44.686  1.00 56.04  ? 223  PRO A CG  1 
ATOM 1768 C CD  . PRO A 1 226  ? 28.437  71.477 46.077  1.00 56.04  ? 223  PRO A CD  1 
ATOM 1769 N N   . GLU A 1 227  ? 32.245  74.051 46.138  1.00 180.95 ? 224  GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227  ? 33.229  74.891 46.831  1.00 180.95 ? 224  GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227  ? 32.798  75.753 48.025  1.00 180.95 ? 224  GLU A C   1 
ATOM 1772 O O   . GLU A 1 227  ? 33.539  75.837 49.006  1.00 180.95 ? 224  GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227  ? 33.999  75.749 45.821  1.00 93.53  ? 224  GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227  ? 35.477  75.391 45.704  1.00 93.53  ? 224  GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227  ? 36.322  76.013 46.812  1.00 93.53  ? 224  GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227  ? 36.042  75.767 48.009  1.00 93.53  ? 224  GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227  ? 37.283  76.743 46.483  1.00 93.53  ? 224  GLU A OE2 1 
ATOM 1778 N N   . PRO A 1 228  ? 31.616  76.391 47.962  1.00 77.03  ? 225  PRO A N   1 
ATOM 1779 C CA  . PRO A 1 228  ? 31.273  77.243 49.118  1.00 77.03  ? 225  PRO A CA  1 
ATOM 1780 C C   . PRO A 1 228  ? 31.226  76.426 50.397  1.00 77.03  ? 225  PRO A C   1 
ATOM 1781 O O   . PRO A 1 228  ? 31.415  76.970 51.481  1.00 77.03  ? 225  PRO A O   1 
ATOM 1782 C CB  . PRO A 1 228  ? 29.867  77.755 48.802  1.00 56.16  ? 225  PRO A CB  1 
ATOM 1783 C CG  . PRO A 1 228  ? 29.699  77.532 47.305  1.00 56.16  ? 225  PRO A CG  1 
ATOM 1784 C CD  . PRO A 1 228  ? 30.568  76.373 46.927  1.00 56.16  ? 225  PRO A CD  1 
ATOM 1785 N N   . PHE A 1 229  ? 30.987  75.125 50.253  1.00 49.07  ? 226  PHE A N   1 
ATOM 1786 C CA  . PHE A 1 229  ? 30.863  74.217 51.386  1.00 49.07  ? 226  PHE A CA  1 
ATOM 1787 C C   . PHE A 1 229  ? 31.962  73.160 51.444  1.00 49.07  ? 226  PHE A C   1 
ATOM 1788 O O   . PHE A 1 229  ? 32.612  72.994 52.478  1.00 49.07  ? 226  PHE A O   1 
ATOM 1789 C CB  . PHE A 1 229  ? 29.546  73.469 51.308  1.00 82.74  ? 226  PHE A CB  1 
ATOM 1790 C CG  . PHE A 1 229  ? 28.356  74.277 51.680  1.00 82.74  ? 226  PHE A CG  1 
ATOM 1791 C CD1 . PHE A 1 229  ? 27.624  74.942 50.705  1.00 82.74  ? 226  PHE A CD1 1 
ATOM 1792 C CD2 . PHE A 1 229  ? 27.929  74.327 52.996  1.00 82.74  ? 226  PHE A CD2 1 
ATOM 1793 C CE1 . PHE A 1 229  ? 26.493  75.667 51.042  1.00 82.74  ? 226  PHE A CE1 1 
ATOM 1794 C CE2 . PHE A 1 229  ? 26.800  75.047 53.346  1.00 82.74  ? 226  PHE A CE2 1 
ATOM 1795 C CZ  . PHE A 1 229  ? 26.079  75.718 52.366  1.00 82.74  ? 226  PHE A CZ  1 
ATOM 1796 N N   . GLY A 1 230  ? 32.132  72.415 50.350  1.00 42.05  ? 227  GLY A N   1 
ATOM 1797 C CA  . GLY A 1 230  ? 33.079  71.300 50.326  1.00 42.05  ? 227  GLY A CA  1 
ATOM 1798 C C   . GLY A 1 230  ? 32.589  70.091 51.120  1.00 42.05  ? 227  GLY A C   1 
ATOM 1799 O O   . GLY A 1 230  ? 31.417  70.026 51.507  1.00 42.05  ? 227  GLY A O   1 
ATOM 1800 N N   . GLY A 1 231  ? 33.481  69.131 51.355  1.00 64.38  ? 228  GLY A N   1 
ATOM 1801 C CA  . GLY A 1 231  ? 33.116  67.891 52.021  1.00 64.38  ? 228  GLY A CA  1 
ATOM 1802 C C   . GLY A 1 231  ? 32.101  67.046 51.264  1.00 64.38  ? 228  GLY A C   1 
ATOM 1803 O O   . GLY A 1 231  ? 31.760  67.328 50.104  1.00 64.38  ? 228  GLY A O   1 
ATOM 1804 N N   . ALA A 1 232  ? 31.603  66.015 51.940  1.00 40.38  ? 229  ALA A N   1 
ATOM 1805 C CA  . ALA A 1 232  ? 30.731  65.049 51.317  1.00 40.38  ? 229  ALA A CA  1 
ATOM 1806 C C   . ALA A 1 232  ? 29.461  64.862 52.087  1.00 40.38  ? 229  ALA A C   1 
ATOM 1807 O O   . ALA A 1 232  ? 29.450  64.982 53.315  1.00 40.38  ? 229  ALA A O   1 
ATOM 1808 C CB  . ALA A 1 232  ? 31.451  63.694 51.183  1.00 33.01  ? 229  ALA A CB  1 
ATOM 1809 N N   . ILE A 1 233  ? 28.392  64.526 51.374  1.00 38.97  ? 230  ILE A N   1 
ATOM 1810 C CA  . ILE A 1 233  ? 27.214  63.977 52.051  1.00 38.97  ? 230  ILE A CA  1 
ATOM 1811 C C   . ILE A 1 233  ? 27.159  62.495 51.820  1.00 38.97  ? 230  ILE A C   1 
ATOM 1812 O O   . ILE A 1 233  ? 27.360  62.034 50.692  1.00 38.97  ? 230  ILE A O   1 
ATOM 1813 C CB  . ILE A 1 233  ? 25.923  64.583 51.541  1.00 47.36  ? 230  ILE A CB  1 
ATOM 1814 C CG1 . ILE A 1 233  ? 25.749  65.955 52.151  1.00 47.36  ? 230  ILE A CG1 1 
ATOM 1815 C CG2 . ILE A 1 233  ? 24.748  63.741 51.949  1.00 47.36  ? 230  ILE A CG2 1 
ATOM 1816 C CD1 . ILE A 1 233  ? 24.935  66.877 51.279  1.00 47.36  ? 230  ILE A CD1 1 
ATOM 1817 N N   . ILE A 1 234  ? 26.886  61.757 52.883  1.00 42.07  ? 231  ILE A N   1 
ATOM 1818 C CA  . ILE A 1 234  ? 26.675  60.330 52.751  1.00 42.07  ? 231  ILE A CA  1 
ATOM 1819 C C   . ILE A 1 234  ? 25.250  59.893 53.109  1.00 42.07  ? 231  ILE A C   1 
ATOM 1820 O O   . ILE A 1 234  ? 24.865  59.867 54.283  1.00 42.07  ? 231  ILE A O   1 
ATOM 1821 C CB  . ILE A 1 234  ? 27.711  59.545 53.565  1.00 26.92  ? 231  ILE A CB  1 
ATOM 1822 C CG1 . ILE A 1 234  ? 29.102  59.841 53.045  1.00 26.92  ? 231  ILE A CG1 1 
ATOM 1823 C CG2 . ILE A 1 234  ? 27.488  58.044 53.424  1.00 26.92  ? 231  ILE A CG2 1 
ATOM 1824 C CD1 . ILE A 1 234  ? 30.109  59.567 54.077  1.00 26.92  ? 231  ILE A CD1 1 
ATOM 1825 N N   . ILE A 1 235  ? 24.475  59.519 52.103  1.00 45.37  ? 232  ILE A N   1 
ATOM 1826 C CA  . ILE A 1 235  ? 23.104  59.093 52.353  1.00 45.37  ? 232  ILE A CA  1 
ATOM 1827 C C   . ILE A 1 235  ? 23.025  57.608 52.676  1.00 45.37  ? 232  ILE A C   1 
ATOM 1828 O O   . ILE A 1 235  ? 23.560  56.785 51.940  1.00 45.37  ? 232  ILE A O   1 
ATOM 1829 C CB  . ILE A 1 235  ? 22.166  59.432 51.175  1.00 33.34  ? 232  ILE A CB  1 
ATOM 1830 C CG1 . ILE A 1 235  ? 22.324  60.893 50.787  1.00 33.34  ? 232  ILE A CG1 1 
ATOM 1831 C CG2 . ILE A 1 235  ? 20.695  59.124 51.548  1.00 33.34  ? 232  ILE A CG2 1 
ATOM 1832 C CD1 . ILE A 1 235  ? 21.177  61.442 50.055  1.00 33.34  ? 232  ILE A CD1 1 
ATOM 1833 N N   . GLY A 1 236  ? 22.357  57.279 53.774  1.00 38.19  ? 233  GLY A N   1 
ATOM 1834 C CA  . GLY A 1 236  ? 22.207  55.892 54.217  1.00 38.19  ? 233  GLY A CA  1 
ATOM 1835 C C   . GLY A 1 236  ? 20.758  55.462 54.413  1.00 38.19  ? 233  GLY A C   1 
ATOM 1836 O O   . GLY A 1 236  ? 19.832  56.081 53.859  1.00 38.19  ? 233  GLY A O   1 
ATOM 1837 N N   . GLN A 1 237  ? 20.543  54.376 55.152  1.00 63.17  ? 234  GLN A N   1 
ATOM 1838 C CA  . GLN A 1 237  ? 19.210  54.106 55.687  1.00 63.17  ? 234  GLN A CA  1 
ATOM 1839 C C   . GLN A 1 237  ? 19.043  54.882 56.991  1.00 63.17  ? 234  GLN A C   1 
ATOM 1840 O O   . GLN A 1 237  ? 20.006  55.133 57.713  1.00 63.17  ? 234  GLN A O   1 
ATOM 1841 C CB  . GLN A 1 237  ? 18.952  52.609 55.893  1.00 71.45  ? 234  GLN A CB  1 
ATOM 1842 C CG  . GLN A 1 237  ? 18.255  51.929 54.728  1.00 71.45  ? 234  GLN A CG  1 
ATOM 1843 C CD  . GLN A 1 237  ? 16.879  52.544 54.387  1.00 71.45  ? 234  GLN A CD  1 
ATOM 1844 O OE1 . GLN A 1 237  ? 16.531  53.666 54.823  1.00 71.45  ? 234  GLN A OE1 1 
ATOM 1845 N NE2 . GLN A 1 237  ? 16.093  51.805 53.595  1.00 71.45  ? 234  GLN A NE2 1 
ATOM 1846 N N   . GLU A 1 238  ? 17.829  55.305 57.279  1.00 65.23  ? 235  GLU A N   1 
ATOM 1847 C CA  . GLU A 1 238  ? 17.542  56.041 58.528  1.00 65.23  ? 235  GLU A CA  1 
ATOM 1848 C C   . GLU A 1 238  ? 18.485  57.175 58.997  1.00 65.23  ? 235  GLU A C   1 
ATOM 1849 O O   . GLU A 1 238  ? 18.157  57.856 59.963  1.00 65.23  ? 235  GLU A O   1 
ATOM 1850 C CB  . GLU A 1 238  ? 17.271  55.068 59.682  1.00 71.21  ? 235  GLU A CB  1 
ATOM 1851 C CG  . GLU A 1 238  ? 18.501  54.500 60.332  1.00 71.21  ? 235  GLU A CG  1 
ATOM 1852 C CD  . GLU A 1 238  ? 18.150  53.396 61.281  1.00 71.21  ? 235  GLU A CD  1 
ATOM 1853 O OE1 . GLU A 1 238  ? 16.985  52.920 61.201  1.00 71.21  ? 235  GLU A OE1 1 
ATOM 1854 O OE2 . GLU A 1 238  ? 19.036  53.019 62.095  1.00 71.21  ? 235  GLU A OE2 1 
ATOM 1855 N N   . SER A 1 239  ? 19.612  57.398 58.321  1.00 45.28  ? 236  SER A N   1 
ATOM 1856 C CA  . SER A 1 239  ? 20.513  58.510 58.669  1.00 45.28  ? 236  SER A CA  1 
ATOM 1857 C C   . SER A 1 239  ? 21.159  59.178 57.456  1.00 45.28  ? 236  SER A C   1 
ATOM 1858 O O   . SER A 1 239  ? 21.521  58.485 56.531  1.00 45.28  ? 236  SER A O   1 
ATOM 1859 C CB  . SER A 1 239  ? 21.611  57.983 59.571  1.00 52.13  ? 236  SER A CB  1 
ATOM 1860 O OG  . SER A 1 239  ? 22.219  56.858 58.952  1.00 52.13  ? 236  SER A OG  1 
ATOM 1861 N N   . ILE A 1 240  ? 21.292  60.511 57.472  1.00 36.42  ? 237  ILE A N   1 
ATOM 1862 C CA  . ILE A 1 240  ? 22.080  61.297 56.477  1.00 36.42  ? 237  ILE A CA  1 
ATOM 1863 C C   . ILE A 1 240  ? 23.125  62.169 57.206  1.00 36.42  ? 237  ILE A C   1 
ATOM 1864 O O   . ILE A 1 240  ? 22.787  62.854 58.199  1.00 36.42  ? 237  ILE A O   1 
ATOM 1865 C CB  . ILE A 1 240  ? 21.201  62.302 55.676  1.00 29.17  ? 237  ILE A CB  1 
ATOM 1866 C CG1 . ILE A 1 240  ? 20.244  61.576 54.727  1.00 29.17  ? 237  ILE A CG1 1 
ATOM 1867 C CG2 . ILE A 1 240  ? 22.077  63.293 54.893  1.00 29.17  ? 237  ILE A CG2 1 
ATOM 1868 C CD1 . ILE A 1 240  ? 19.153  62.452 54.141  1.00 29.17  ? 237  ILE A CD1 1 
ATOM 1869 N N   . THR A 1 241  ? 24.373  62.171 56.721  1.00 43.10  ? 238  THR A N   1 
ATOM 1870 C CA  . THR A 1 241  ? 25.440  62.868 57.420  1.00 43.10  ? 238  THR A CA  1 
ATOM 1871 C C   . THR A 1 241  ? 26.356  63.630 56.485  1.00 43.10  ? 238  THR A C   1 
ATOM 1872 O O   . THR A 1 241  ? 26.629  63.194 55.346  1.00 43.10  ? 238  THR A O   1 
ATOM 1873 C CB  . THR A 1 241  ? 26.344  61.910 58.188  1.00 37.31  ? 238  THR A CB  1 
ATOM 1874 O OG1 . THR A 1 241  ? 27.157  61.213 57.252  1.00 37.31  ? 238  THR A OG1 1 
ATOM 1875 C CG2 . THR A 1 241  ? 25.576  60.901 58.984  1.00 37.31  ? 238  THR A CG2 1 
ATOM 1876 N N   . TYR A 1 242  ? 26.860  64.755 56.994  1.00 48.74  ? 239  TYR A N   1 
ATOM 1877 C CA  . TYR A 1 242  ? 27.842  65.573 56.291  1.00 48.74  ? 239  TYR A CA  1 
ATOM 1878 C C   . TYR A 1 242  ? 29.201  65.329 56.888  1.00 48.74  ? 239  TYR A C   1 
ATOM 1879 O O   . TYR A 1 242  ? 29.337  65.237 58.109  1.00 48.74  ? 239  TYR A O   1 
ATOM 1880 C CB  . TYR A 1 242  ? 27.506  67.051 56.413  1.00 49.19  ? 239  TYR A CB  1 
ATOM 1881 C CG  . TYR A 1 242  ? 28.527  67.947 55.778  1.00 49.19  ? 239  TYR A CG  1 
ATOM 1882 C CD1 . TYR A 1 242  ? 28.615  68.053 54.388  1.00 49.19  ? 239  TYR A CD1 1 
ATOM 1883 C CD2 . TYR A 1 242  ? 29.418  68.699 56.559  1.00 49.19  ? 239  TYR A CD2 1 
ATOM 1884 C CE1 . TYR A 1 242  ? 29.558  68.896 53.775  1.00 49.19  ? 239  TYR A CE1 1 
ATOM 1885 C CE2 . TYR A 1 242  ? 30.365  69.547 55.967  1.00 49.19  ? 239  TYR A CE2 1 
ATOM 1886 C CZ  . TYR A 1 242  ? 30.424  69.638 54.566  1.00 49.19  ? 239  TYR A CZ  1 
ATOM 1887 O OH  . TYR A 1 242  ? 31.351  70.451 53.953  1.00 49.19  ? 239  TYR A OH  1 
ATOM 1888 N N   . HIS A 1 243  ? 30.204  65.236 56.024  1.00 48.49  ? 240  HIS A N   1 
ATOM 1889 C CA  . HIS A 1 243  ? 31.589  64.993 56.439  1.00 48.49  ? 240  HIS A CA  1 
ATOM 1890 C C   . HIS A 1 243  ? 32.509  65.997 55.798  1.00 48.49  ? 240  HIS A C   1 
ATOM 1891 O O   . HIS A 1 243  ? 32.355  66.323 54.620  1.00 48.49  ? 240  HIS A O   1 
ATOM 1892 C CB  . HIS A 1 243  ? 32.043  63.607 56.013  1.00 37.17  ? 240  HIS A CB  1 
ATOM 1893 C CG  . HIS A 1 243  ? 31.410  62.508 56.792  1.00 37.17  ? 240  HIS A CG  1 
ATOM 1894 N ND1 . HIS A 1 243  ? 32.083  61.812 57.767  1.00 37.17  ? 240  HIS A ND1 1 
ATOM 1895 C CD2 . HIS A 1 243  ? 30.158  61.995 56.757  1.00 37.17  ? 240  HIS A CD2 1 
ATOM 1896 C CE1 . HIS A 1 243  ? 31.274  60.907 58.296  1.00 37.17  ? 240  HIS A CE1 1 
ATOM 1897 N NE2 . HIS A 1 243  ? 30.100  60.995 57.697  1.00 37.17  ? 240  HIS A NE2 1 
ATOM 1898 N N   . ASN A 1 244  ? 33.476  66.481 56.568  1.00 59.25  ? 241  ASN A N   1 
ATOM 1899 C CA  . ASN A 1 244  ? 34.453  67.416 56.033  1.00 59.25  ? 241  ASN A CA  1 
ATOM 1900 C C   . ASN A 1 244  ? 35.554  67.763 57.009  1.00 59.25  ? 241  ASN A C   1 
ATOM 1901 O O   . ASN A 1 244  ? 35.351  68.561 57.927  1.00 59.25  ? 241  ASN A O   1 
ATOM 1902 C CB  . ASN A 1 244  ? 33.768  68.695 55.564  1.00 45.22  ? 241  ASN A CB  1 
ATOM 1903 C CG  . ASN A 1 244  ? 34.724  69.656 54.954  1.00 45.22  ? 241  ASN A CG  1 
ATOM 1904 O OD1 . ASN A 1 244  ? 35.951  69.477 55.030  1.00 45.22  ? 241  ASN A OD1 1 
ATOM 1905 N ND2 . ASN A 1 244  ? 34.184  70.688 54.332  1.00 45.22  ? 241  ASN A ND2 1 
ATOM 1906 N N   . GLY A 1 245  ? 36.731  67.198 56.775  1.00 74.47  ? 242  GLY A N   1 
ATOM 1907 C CA  . GLY A 1 245  ? 37.844  67.364 57.693  1.00 74.47  ? 242  GLY A CA  1 
ATOM 1908 C C   . GLY A 1 245  ? 37.362  66.897 59.049  1.00 74.47  ? 242  GLY A C   1 
ATOM 1909 O O   . GLY A 1 245  ? 36.812  65.799 59.167  1.00 74.47  ? 242  GLY A O   1 
ATOM 1910 N N   . ASP A 1 246  ? 37.522  67.746 60.059  1.00 83.70  ? 243  ASP A N   1 
ATOM 1911 C CA  . ASP A 1 246  ? 37.087  67.406 61.408  1.00 83.70  ? 243  ASP A CA  1 
ATOM 1912 C C   . ASP A 1 246  ? 35.606  67.749 61.665  1.00 83.70  ? 243  ASP A C   1 
ATOM 1913 O O   . ASP A 1 246  ? 35.014  67.285 62.647  1.00 83.70  ? 243  ASP A O   1 
ATOM 1914 C CB  . ASP A 1 246  ? 38.001  68.059 62.449  1.00 133.68 ? 243  ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 246  ? 38.166  67.207 63.699  1.00 133.68 ? 243  ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 246  ? 37.581  66.096 63.765  1.00 133.68 ? 243  ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 246  ? 38.890  67.651 64.619  1.00 133.68 ? 243  ASP A OD2 1 
ATOM 1918 N N   . LYS A 1 247  ? 35.015  68.544 60.774  1.00 53.17  ? 244  LYS A N   1 
ATOM 1919 C CA  . LYS A 1 247  ? 33.578  68.844 60.828  1.00 53.17  ? 244  LYS A CA  1 
ATOM 1920 C C   . LYS A 1 247  ? 32.662  67.630 60.507  1.00 53.17  ? 244  LYS A C   1 
ATOM 1921 O O   . LYS A 1 247  ? 32.837  66.939 59.485  1.00 53.17  ? 244  LYS A O   1 
ATOM 1922 C CB  . LYS A 1 247  ? 33.272  70.041 59.923  1.00 66.05  ? 244  LYS A CB  1 
ATOM 1923 C CG  . LYS A 1 247  ? 31.802  70.375 59.759  1.00 66.05  ? 244  LYS A CG  1 
ATOM 1924 C CD  . LYS A 1 247  ? 31.138  70.765 61.064  1.00 66.05  ? 244  LYS A CD  1 
ATOM 1925 C CE  . LYS A 1 247  ? 29.868  71.561 60.806  1.00 66.05  ? 244  LYS A CE  1 
ATOM 1926 N NZ  . LYS A 1 247  ? 30.121  72.723 59.892  1.00 66.05  ? 244  LYS A NZ  1 
ATOM 1927 N N   . TYR A 1 248  ? 31.693  67.382 61.389  1.00 64.08  ? 245  TYR A N   1 
ATOM 1928 C CA  . TYR A 1 248  ? 30.771  66.251 61.243  1.00 64.08  ? 245  TYR A CA  1 
ATOM 1929 C C   . TYR A 1 248  ? 29.361  66.626 61.629  1.00 64.08  ? 245  TYR A C   1 
ATOM 1930 O O   . TYR A 1 248  ? 29.117  67.067 62.751  1.00 64.08  ? 245  TYR A O   1 
ATOM 1931 C CB  . TYR A 1 248  ? 31.211  65.067 62.118  1.00 66.47  ? 245  TYR A CB  1 
ATOM 1932 C CG  . TYR A 1 248  ? 30.206  63.917 62.214  1.00 66.47  ? 245  TYR A CG  1 
ATOM 1933 C CD1 . TYR A 1 248  ? 30.106  62.966 61.199  1.00 66.47  ? 245  TYR A CD1 1 
ATOM 1934 C CD2 . TYR A 1 248  ? 29.379  63.777 63.325  1.00 66.47  ? 245  TYR A CD2 1 
ATOM 1935 C CE1 . TYR A 1 248  ? 29.213  61.917 61.281  1.00 66.47  ? 245  TYR A CE1 1 
ATOM 1936 C CE2 . TYR A 1 248  ? 28.474  62.729 63.418  1.00 66.47  ? 245  TYR A CE2 1 
ATOM 1937 C CZ  . TYR A 1 248  ? 28.396  61.800 62.386  1.00 66.47  ? 245  TYR A CZ  1 
ATOM 1938 O OH  . TYR A 1 248  ? 27.499  60.754 62.457  1.00 66.47  ? 245  TYR A OH  1 
ATOM 1939 N N   . LEU A 1 249  ? 28.430  66.429 60.702  1.00 53.91  ? 246  LEU A N   1 
ATOM 1940 C CA  . LEU A 1 249  ? 27.022  66.615 61.014  1.00 53.91  ? 246  LEU A CA  1 
ATOM 1941 C C   . LEU A 1 249  ? 26.210  65.414 60.626  1.00 53.91  ? 246  LEU A C   1 
ATOM 1942 O O   . LEU A 1 249  ? 26.579  64.692 59.708  1.00 53.91  ? 246  LEU A O   1 
ATOM 1943 C CB  . LEU A 1 249  ? 26.472  67.892 60.389  1.00 80.59  ? 246  LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 249  ? 26.347  68.998 61.439  1.00 80.59  ? 246  LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 249  ? 26.227  70.368 60.800  1.00 80.59  ? 246  LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 249  ? 25.168  68.710 62.380  1.00 80.59  ? 246  LEU A CD2 1 
ATOM 1947 N N   . ALA A 1 250  ? 25.117  65.197 61.349  1.00 46.64  ? 247  ALA A N   1 
ATOM 1948 C CA  . ALA A 1 250  ? 24.298  64.005 61.185  1.00 46.64  ? 247  ALA A CA  1 
ATOM 1949 C C   . ALA A 1 250  ? 22.830  64.262 61.512  1.00 46.64  ? 247  ALA A C   1 
ATOM 1950 O O   . ALA A 1 250  ? 22.519  65.008 62.440  1.00 46.64  ? 247  ALA A O   1 
ATOM 1951 C CB  . ALA A 1 250  ? 24.833  62.876 62.045  1.00 43.57  ? 247  ALA A CB  1 
ATOM 1952 N N   . ILE A 1 251  ? 21.939  63.649 60.731  1.00 59.77  ? 248  ILE A N   1 
ATOM 1953 C CA  . ILE A 1 251  ? 20.507  63.602 61.039  1.00 59.77  ? 248  ILE A CA  1 
ATOM 1954 C C   . ILE A 1 251  ? 19.940  62.199 60.853  1.00 59.77  ? 248  ILE A C   1 
ATOM 1955 O O   . ILE A 1 251  ? 20.428  61.409 60.038  1.00 59.77  ? 248  ILE A O   1 
ATOM 1956 C CB  . ILE A 1 251  ? 19.663  64.587 60.182  1.00 47.88  ? 248  ILE A CB  1 
ATOM 1957 C CG1 . ILE A 1 251  ? 19.860  64.316 58.681  1.00 47.88  ? 248  ILE A CG1 1 
ATOM 1958 C CG2 . ILE A 1 251  ? 19.979  66.031 60.548  1.00 47.88  ? 248  ILE A CG2 1 
ATOM 1959 C CD1 . ILE A 1 251  ? 18.746  64.844 57.775  1.00 47.88  ? 248  ILE A CD1 1 
ATOM 1960 N N   . ALA A 1 252  ? 18.884  61.921 61.606  1.00 57.08  ? 249  ALA A N   1 
ATOM 1961 C CA  . ALA A 1 252  ? 18.186  60.648 61.567  1.00 57.08  ? 249  ALA A CA  1 
ATOM 1962 C C   . ALA A 1 252  ? 16.703  60.896 61.439  1.00 57.08  ? 249  ALA A C   1 
ATOM 1963 O O   . ALA A 1 252  ? 15.952  60.489 62.320  1.00 57.08  ? 249  ALA A O   1 
ATOM 1964 C CB  . ALA A 1 252  ? 18.449  59.868 62.852  1.00 16.19  ? 249  ALA A CB  1 
ATOM 1965 N N   . PRO A 1 253  ? 16.264  61.548 60.347  1.00 49.23  ? 250  PRO A N   1 
ATOM 1966 C CA  . PRO A 1 253  ? 14.850  61.903 60.257  1.00 49.23  ? 250  PRO A CA  1 
ATOM 1967 C C   . PRO A 1 253  ? 13.986  60.667 60.031  1.00 49.23  ? 250  PRO A C   1 
ATOM 1968 O O   . PRO A 1 253  ? 14.247  59.888 59.110  1.00 49.23  ? 250  PRO A O   1 
ATOM 1969 C CB  . PRO A 1 253  ? 14.794  62.815 59.036  1.00 46.78  ? 250  PRO A CB  1 
ATOM 1970 C CG  . PRO A 1 253  ? 15.898  62.342 58.173  1.00 46.78  ? 250  PRO A CG  1 
ATOM 1971 C CD  . PRO A 1 253  ? 16.996  61.954 59.134  1.00 46.78  ? 250  PRO A CD  1 
ATOM 1972 N N   . PRO A 1 254  ? 12.953  60.479 60.863  1.00 54.45  ? 251  PRO A N   1 
ATOM 1973 C CA  . PRO A 1 254  ? 12.209  59.238 60.725  1.00 54.45  ? 251  PRO A CA  1 
ATOM 1974 C C   . PRO A 1 254  ? 11.617  58.987 59.333  1.00 54.45  ? 251  PRO A C   1 
ATOM 1975 O O   . PRO A 1 254  ? 11.530  57.816 58.942  1.00 54.45  ? 251  PRO A O   1 
ATOM 1976 C CB  . PRO A 1 254  ? 11.116  59.376 61.788  1.00 53.83  ? 251  PRO A CB  1 
ATOM 1977 C CG  . PRO A 1 254  ? 11.715  60.293 62.777  1.00 53.83  ? 251  PRO A CG  1 
ATOM 1978 C CD  . PRO A 1 254  ? 12.403  61.309 61.942  1.00 53.83  ? 251  PRO A CD  1 
ATOM 1979 N N   . ILE A 1 255  ? 11.253  60.042 58.589  1.00 53.10  ? 252  ILE A N   1 
ATOM 1980 C CA  . ILE A 1 255  ? 10.568  59.846 57.290  1.00 53.10  ? 252  ILE A CA  1 
ATOM 1981 C C   . ILE A 1 255  ? 11.343  58.938 56.343  1.00 53.10  ? 252  ILE A C   1 
ATOM 1982 O O   . ILE A 1 255  ? 10.771  58.050 55.723  1.00 53.10  ? 252  ILE A O   1 
ATOM 1983 C CB  . ILE A 1 255  ? 10.291  61.129 56.520  1.00 54.57  ? 252  ILE A CB  1 
ATOM 1984 C CG1 . ILE A 1 255  ? 10.561  62.349 57.393  1.00 54.57  ? 252  ILE A CG1 1 
ATOM 1985 C CG2 . ILE A 1 255  ? 8.867   61.074 55.932  1.00 54.57  ? 252  ILE A CG2 1 
ATOM 1986 C CD1 . ILE A 1 255  ? 10.123  63.679 56.756  1.00 54.57  ? 252  ILE A CD1 1 
ATOM 1987 N N   . ILE A 1 256  ? 12.645  59.189 56.259  1.00 50.22  ? 253  ILE A N   1 
ATOM 1988 C CA  . ILE A 1 256  ? 13.609  58.411 55.493  1.00 50.22  ? 253  ILE A CA  1 
ATOM 1989 C C   . ILE A 1 256  ? 13.603  56.925 55.820  1.00 50.22  ? 253  ILE A C   1 
ATOM 1990 O O   . ILE A 1 256  ? 13.923  56.103 54.955  1.00 50.22  ? 253  ILE A O   1 
ATOM 1991 C CB  . ILE A 1 256  ? 15.017  58.987 55.743  1.00 68.34  ? 253  ILE A CB  1 
ATOM 1992 C CG1 . ILE A 1 256  ? 15.543  59.645 54.494  1.00 68.34  ? 253  ILE A CG1 1 
ATOM 1993 C CG2 . ILE A 1 256  ? 16.007  57.942 56.199  1.00 68.34  ? 253  ILE A CG2 1 
ATOM 1994 C CD1 . ILE A 1 256  ? 16.970  59.976 54.650  1.00 68.34  ? 253  ILE A CD1 1 
ATOM 1995 N N   . LYS A 1 257  ? 13.218  56.584 57.052  1.00 48.14  ? 254  LYS A N   1 
ATOM 1996 C CA  . LYS A 1 257  ? 13.437  55.225 57.573  1.00 48.14  ? 254  LYS A CA  1 
ATOM 1997 C C   . LYS A 1 257  ? 12.779  54.120 56.769  1.00 48.14  ? 254  LYS A C   1 
ATOM 1998 O O   . LYS A 1 257  ? 13.299  53.016 56.756  1.00 48.14  ? 254  LYS A O   1 
ATOM 1999 C CB  . LYS A 1 257  ? 13.101  55.098 59.066  1.00 62.24  ? 254  LYS A CB  1 
ATOM 2000 C CG  . LYS A 1 257  ? 13.814  53.931 59.775  1.00 62.24  ? 254  LYS A CG  1 
ATOM 2001 C CD  . LYS A 1 257  ? 12.896  52.713 59.962  1.00 62.24  ? 254  LYS A CD  1 
ATOM 2002 C CE  . LYS A 1 257  ? 13.462  51.694 60.940  1.00 62.24  ? 254  LYS A CE  1 
ATOM 2003 N NZ  . LYS A 1 257  ? 13.968  52.316 62.226  1.00 62.24  ? 254  LYS A NZ  1 
ATOM 2004 N N   . GLN A 1 258  ? 11.708  54.420 56.044  1.00 60.80  ? 255  GLN A N   1 
ATOM 2005 C CA  . GLN A 1 258  ? 11.082  53.408 55.207  1.00 60.80  ? 255  GLN A CA  1 
ATOM 2006 C C   . GLN A 1 258  ? 11.935  53.433 53.927  1.00 60.80  ? 255  GLN A C   1 
ATOM 2007 O O   . GLN A 1 258  ? 13.132  53.710 53.993  1.00 60.80  ? 255  GLN A O   1 
ATOM 2008 C CB  . GLN A 1 258  ? 9.634   53.774 54.897  1.00 64.39  ? 255  GLN A CB  1 
ATOM 2009 C CG  . GLN A 1 258  ? 8.935   54.537 56.010  1.00 64.39  ? 255  GLN A CG  1 
ATOM 2010 C CD  . GLN A 1 258  ? 7.759   55.352 55.508  1.00 64.39  ? 255  GLN A CD  1 
ATOM 2011 O OE1 . GLN A 1 258  ? 7.140   55.014 54.499  1.00 64.39  ? 255  GLN A OE1 1 
ATOM 2012 N NE2 . GLN A 1 258  ? 7.444   56.433 56.213  1.00 64.39  ? 255  GLN A NE2 1 
ATOM 2013 N N   . SER A 1 259  ? 11.334  53.155 52.772  1.00 41.43  ? 256  SER A N   1 
ATOM 2014 C CA  . SER A 1 259  ? 12.058  53.170 51.494  1.00 41.43  ? 256  SER A CA  1 
ATOM 2015 C C   . SER A 1 259  ? 13.504  53.701 51.449  1.00 41.43  ? 256  SER A C   1 
ATOM 2016 O O   . SER A 1 259  ? 13.783  54.815 51.902  1.00 41.43  ? 256  SER A O   1 
ATOM 2017 C CB  . SER A 1 259  ? 11.239  53.896 50.449  1.00 49.26  ? 256  SER A CB  1 
ATOM 2018 O OG  . SER A 1 259  ? 11.446  53.276 49.203  1.00 49.26  ? 256  SER A OG  1 
ATOM 2019 N N   . THR A 1 260  ? 14.406  52.898 50.868  1.00 52.57  ? 257  THR A N   1 
ATOM 2020 C CA  . THR A 1 260  ? 15.771  53.340 50.549  1.00 52.57  ? 257  THR A CA  1 
ATOM 2021 C C   . THR A 1 260  ? 15.777  54.444 49.512  1.00 52.57  ? 257  THR A C   1 
ATOM 2022 O O   . THR A 1 260  ? 15.016  54.413 48.521  1.00 52.57  ? 257  THR A O   1 
ATOM 2023 C CB  . THR A 1 260  ? 16.647  52.208 49.970  1.00 34.63  ? 257  THR A CB  1 
ATOM 2024 O OG1 . THR A 1 260  ? 16.655  51.108 50.875  1.00 34.63  ? 257  THR A OG1 1 
ATOM 2025 C CG2 . THR A 1 260  ? 18.074  52.670 49.740  1.00 34.63  ? 257  THR A CG2 1 
ATOM 2026 N N   . ILE A 1 261  ? 16.673  55.399 49.747  1.00 42.40  ? 258  ILE A N   1 
ATOM 2027 C CA  . ILE A 1 261  ? 16.906  56.483 48.843  1.00 42.40  ? 258  ILE A CA  1 
ATOM 2028 C C   . ILE A 1 261  ? 17.816  55.962 47.731  1.00 42.40  ? 258  ILE A C   1 
ATOM 2029 O O   . ILE A 1 261  ? 18.922  55.465 47.989  1.00 42.40  ? 258  ILE A O   1 
ATOM 2030 C CB  . ILE A 1 261  ? 17.505  57.662 49.619  1.00 18.58  ? 258  ILE A CB  1 
ATOM 2031 C CG1 . ILE A 1 261  ? 16.421  58.393 50.383  1.00 18.58  ? 258  ILE A CG1 1 
ATOM 2032 C CG2 . ILE A 1 261  ? 18.130  58.688 48.722  1.00 18.58  ? 258  ILE A CG2 1 
ATOM 2033 C CD1 . ILE A 1 261  ? 16.994  59.315 51.407  1.00 18.58  ? 258  ILE A CD1 1 
ATOM 2034 N N   . VAL A 1 262  ? 17.334  56.068 46.493  1.00 51.75  ? 259  VAL A N   1 
ATOM 2035 C CA  . VAL A 1 262  ? 17.996  55.503 45.312  1.00 51.75  ? 259  VAL A CA  1 
ATOM 2036 C C   . VAL A 1 262  ? 18.709  56.533 44.409  1.00 51.75  ? 259  VAL A C   1 
ATOM 2037 O O   . VAL A 1 262  ? 19.691  56.180 43.747  1.00 51.75  ? 259  VAL A O   1 
ATOM 2038 C CB  . VAL A 1 262  ? 17.020  54.611 44.473  1.00 69.64  ? 259  VAL A CB  1 
ATOM 2039 C CG1 . VAL A 1 262  ? 15.774  55.378 44.044  1.00 69.64  ? 259  VAL A CG1 1 
ATOM 2040 C CG2 . VAL A 1 262  ? 17.712  54.036 43.239  1.00 69.64  ? 259  VAL A CG2 1 
ATOM 2041 N N   . CYS A 1 263  ? 18.234  57.781 44.360  1.00 49.83  ? 260  CYS A N   1 
ATOM 2042 C CA  . CYS A 1 263  ? 18.936  58.815 43.567  1.00 49.83  ? 260  CYS A CA  1 
ATOM 2043 C C   . CYS A 1 263  ? 18.896  60.237 44.117  1.00 49.83  ? 260  CYS A C   1 
ATOM 2044 O O   . CYS A 1 263  ? 18.119  60.536 45.021  1.00 49.83  ? 260  CYS A O   1 
ATOM 2045 C CB  . CYS A 1 263  ? 18.490  58.794 42.112  1.00 33.24  ? 260  CYS A CB  1 
ATOM 2046 S SG  . CYS A 1 263  ? 16.757  59.148 41.845  1.00 33.24  ? 260  CYS A SG  1 
ATOM 2047 N N   . HIS A 1 264  ? 19.769  61.092 43.573  1.00 33.86  ? 261  HIS A N   1 
ATOM 2048 C CA  . HIS A 1 264  ? 19.876  62.512 43.955  1.00 33.86  ? 261  HIS A CA  1 
ATOM 2049 C C   . HIS A 1 264  ? 20.235  63.453 42.798  1.00 33.86  ? 261  HIS A C   1 
ATOM 2050 O O   . HIS A 1 264  ? 20.651  63.032 41.724  1.00 33.86  ? 261  HIS A O   1 
ATOM 2051 C CB  . HIS A 1 264  ? 20.841  62.717 45.117  1.00 45.03  ? 261  HIS A CB  1 
ATOM 2052 C CG  . HIS A 1 264  ? 22.245  62.353 44.793  1.00 45.03  ? 261  HIS A CG  1 
ATOM 2053 N ND1 . HIS A 1 264  ? 23.123  63.239 44.202  1.00 45.03  ? 261  HIS A ND1 1 
ATOM 2054 C CD2 . HIS A 1 264  ? 22.923  61.190 44.946  1.00 45.03  ? 261  HIS A CD2 1 
ATOM 2055 C CE1 . HIS A 1 264  ? 24.283  62.637 44.012  1.00 45.03  ? 261  HIS A CE1 1 
ATOM 2056 N NE2 . HIS A 1 264  ? 24.189  61.396 44.459  1.00 45.03  ? 261  HIS A NE2 1 
ATOM 2057 N N   . ASN A 1 265  ? 20.019  64.736 43.015  1.00 44.45  ? 262  ASN A N   1 
ATOM 2058 C CA  . ASN A 1 265  ? 20.363  65.742 42.030  1.00 44.45  ? 262  ASN A CA  1 
ATOM 2059 C C   . ASN A 1 265  ? 20.581  67.060 42.749  1.00 44.45  ? 262  ASN A C   1 
ATOM 2060 O O   . ASN A 1 265  ? 19.977  67.303 43.821  1.00 44.45  ? 262  ASN A O   1 
ATOM 2061 C CB  . ASN A 1 265  ? 19.264  65.890 41.012  1.00 46.60  ? 262  ASN A CB  1 
ATOM 2062 C CG  . ASN A 1 265  ? 19.613  66.866 39.936  1.00 46.60  ? 262  ASN A CG  1 
ATOM 2063 O OD1 . ASN A 1 265  ? 20.526  66.641 39.159  1.00 46.60  ? 262  ASN A OD1 1 
ATOM 2064 N ND2 . ASN A 1 265  ? 18.889  67.959 39.878  1.00 46.60  ? 262  ASN A ND2 1 
ATOM 2065 N N   . ARG A 1 266  ? 21.477  67.878 42.193  1.00 40.60  ? 263  ARG A N   1 
ATOM 2066 C CA  . ARG A 1 266  ? 21.793  69.187 42.771  1.00 40.60  ? 263  ARG A CA  1 
ATOM 2067 C C   . ARG A 1 266  ? 20.987  70.262 42.052  1.00 40.60  ? 263  ARG A C   1 
ATOM 2068 O O   . ARG A 1 266  ? 21.044  70.381 40.829  1.00 40.60  ? 263  ARG A O   1 
ATOM 2069 C CB  . ARG A 1 266  ? 23.303  69.457 42.748  1.00 40.74  ? 263  ARG A CB  1 
ATOM 2070 C CG  . ARG A 1 266  ? 23.687  70.873 42.949  1.00 40.74  ? 263  ARG A CG  1 
ATOM 2071 C CD  . ARG A 1 266  ? 25.088  71.108 43.488  1.00 40.74  ? 263  ARG A CD  1 
ATOM 2072 N NE  . ARG A 1 266  ? 26.156  70.485 42.724  1.00 40.74  ? 263  ARG A NE  1 
ATOM 2073 C CZ  . ARG A 1 266  ? 26.330  70.557 41.404  1.00 40.74  ? 263  ARG A CZ  1 
ATOM 2074 N NH1 . ARG A 1 266  ? 25.474  71.211 40.635  1.00 40.74  ? 263  ARG A NH1 1 
ATOM 2075 N NH2 . ARG A 1 266  ? 27.366  69.940 40.842  1.00 40.74  ? 263  ARG A NH2 1 
ATOM 2076 N N   . VAL A 1 267  ? 20.224  71.005 42.852  1.00 55.97  ? 264  VAL A N   1 
ATOM 2077 C CA  . VAL A 1 267  ? 19.268  72.018 42.419  1.00 55.97  ? 264  VAL A CA  1 
ATOM 2078 C C   . VAL A 1 267  ? 19.949  73.373 42.211  1.00 55.97  ? 264  VAL A C   1 
ATOM 2079 O O   . VAL A 1 267  ? 19.880  73.973 41.133  1.00 55.97  ? 264  VAL A O   1 
ATOM 2080 C CB  . VAL A 1 267  ? 18.153  72.158 43.495  1.00 39.39  ? 264  VAL A CB  1 
ATOM 2081 C CG1 . VAL A 1 267  ? 17.328  73.447 43.299  1.00 39.39  ? 264  VAL A CG1 1 
ATOM 2082 C CG2 . VAL A 1 267  ? 17.251  70.913 43.490  1.00 39.39  ? 264  VAL A CG2 1 
ATOM 2083 N N   . ASP A 1 268  ? 20.596  73.823 43.279  1.00 60.77  ? 265  ASP A N   1 
ATOM 2084 C CA  . ASP A 1 268  ? 21.270  75.094 43.349  1.00 60.77  ? 265  ASP A CA  1 
ATOM 2085 C C   . ASP A 1 268  ? 22.753  74.795 43.304  1.00 60.77  ? 265  ASP A C   1 
ATOM 2086 O O   . ASP A 1 268  ? 23.252  74.090 44.175  1.00 60.77  ? 265  ASP A O   1 
ATOM 2087 C CB  . ASP A 1 268  ? 20.956  75.769 44.692  1.00 49.71  ? 265  ASP A CB  1 
ATOM 2088 C CG  . ASP A 1 268  ? 19.471  76.137 44.856  1.00 49.71  ? 265  ASP A CG  1 
ATOM 2089 O OD1 . ASP A 1 268  ? 18.776  76.428 43.844  1.00 49.71  ? 265  ASP A OD1 1 
ATOM 2090 O OD2 . ASP A 1 268  ? 18.994  76.161 46.016  1.00 49.71  ? 265  ASP A OD2 1 
ATOM 2091 N N   . PRO A 1 269  ? 23.476  75.352 42.321  1.00 47.22  ? 266  PRO A N   1 
ATOM 2092 C CA  . PRO A 1 269  ? 24.943  75.200 42.199  1.00 47.22  ? 266  PRO A CA  1 
ATOM 2093 C C   . PRO A 1 269  ? 25.736  75.464 43.481  1.00 47.22  ? 266  PRO A C   1 
ATOM 2094 O O   . PRO A 1 269  ? 26.867  75.042 43.572  1.00 47.22  ? 266  PRO A O   1 
ATOM 2095 C CB  . PRO A 1 269  ? 25.320  76.251 41.160  1.00 34.44  ? 266  PRO A CB  1 
ATOM 2096 C CG  . PRO A 1 269  ? 24.065  76.408 40.316  1.00 34.44  ? 266  PRO A CG  1 
ATOM 2097 C CD  . PRO A 1 269  ? 22.903  76.203 41.262  1.00 34.44  ? 266  PRO A CD  1 
ATOM 2098 N N   . ASN A 1 270  ? 25.157  76.163 44.453  1.00 61.84  ? 267  ASN A N   1 
ATOM 2099 C CA  . ASN A 1 270  ? 25.739  76.265 45.807  1.00 61.84  ? 267  ASN A CA  1 
ATOM 2100 C C   . ASN A 1 270  ? 25.811  74.925 46.532  1.00 61.84  ? 267  ASN A C   1 
ATOM 2101 O O   . ASN A 1 270  ? 26.589  74.766 47.482  1.00 61.84  ? 267  ASN A O   1 
ATOM 2102 C CB  . ASN A 1 270  ? 24.898  77.181 46.679  1.00 107.88 ? 267  ASN A CB  1 
ATOM 2103 C CG  . ASN A 1 270  ? 24.672  78.509 46.056  1.00 107.88 ? 267  ASN A CG  1 
ATOM 2104 O OD1 . ASN A 1 270  ? 25.522  79.385 46.144  1.00 107.88 ? 267  ASN A OD1 1 
ATOM 2105 N ND2 . ASN A 1 270  ? 23.520  78.679 45.413  1.00 107.88 ? 267  ASN A ND2 1 
ATOM 2106 N N   . GLY A 1 271  ? 24.970  73.982 46.103  1.00 46.03  ? 268  GLY A N   1 
ATOM 2107 C CA  . GLY A 1 271  ? 24.752  72.740 46.825  1.00 46.03  ? 268  GLY A CA  1 
ATOM 2108 C C   . GLY A 1 271  ? 24.087  73.063 48.151  1.00 46.03  ? 268  GLY A C   1 
ATOM 2109 O O   . GLY A 1 271  ? 24.349  72.434 49.171  1.00 46.03  ? 268  GLY A O   1 
ATOM 2110 N N   . SER A 1 272  ? 23.235  74.072 48.136  1.00 46.75  ? 269  SER A N   1 
ATOM 2111 C CA  . SER A 1 272  ? 22.480  74.425 49.315  1.00 46.75  ? 269  SER A CA  1 
ATOM 2112 C C   . SER A 1 272  ? 21.201  73.617 49.286  1.00 46.75  ? 269  SER A C   1 
ATOM 2113 O O   . SER A 1 272  ? 20.508  73.492 50.297  1.00 46.75  ? 269  SER A O   1 
ATOM 2114 C CB  . SER A 1 272  ? 22.203  75.917 49.326  1.00 66.37  ? 269  SER A CB  1 
ATOM 2115 O OG  . SER A 1 272  ? 22.113  76.397 48.000  1.00 66.37  ? 269  SER A OG  1 
ATOM 2116 N N   . ARG A 1 273  ? 20.919  73.042 48.119  1.00 48.54  ? 270  ARG A N   1 
ATOM 2117 C CA  . ARG A 1 273  ? 19.709  72.261 47.907  1.00 48.54  ? 270  ARG A CA  1 
ATOM 2118 C C   . ARG A 1 273  ? 19.860  71.076 46.929  1.00 48.54  ? 270  ARG A C   1 
ATOM 2119 O O   . ARG A 1 273  ? 20.295  71.241 45.792  1.00 48.54  ? 270  ARG A O   1 
ATOM 2120 C CB  . ARG A 1 273  ? 18.598  73.181 47.416  1.00 36.32  ? 270  ARG A CB  1 
ATOM 2121 C CG  . ARG A 1 273  ? 17.890  74.040 48.482  1.00 36.32  ? 270  ARG A CG  1 
ATOM 2122 C CD  . ARG A 1 273  ? 16.569  74.553 47.945  1.00 36.32  ? 270  ARG A CD  1 
ATOM 2123 N NE  . ARG A 1 273  ? 16.791  75.249 46.698  1.00 36.32  ? 270  ARG A NE  1 
ATOM 2124 C CZ  . ARG A 1 273  ? 15.833  75.688 45.893  1.00 36.32  ? 270  ARG A CZ  1 
ATOM 2125 N NH1 . ARG A 1 273  ? 14.547  75.530 46.203  1.00 36.32  ? 270  ARG A NH1 1 
ATOM 2126 N NH2 . ARG A 1 273  ? 16.163  76.307 44.770  1.00 36.32  ? 270  ARG A NH2 1 
ATOM 2127 N N   . TYR A 1 274  ? 19.461  69.892 47.396  1.00 52.81  ? 271  TYR A N   1 
ATOM 2128 C CA  . TYR A 1 274  ? 19.437  68.643 46.618  1.00 52.81  ? 271  TYR A CA  1 
ATOM 2129 C C   . TYR A 1 274  ? 18.078  67.986 46.645  1.00 52.81  ? 271  TYR A C   1 
ATOM 2130 O O   . TYR A 1 274  ? 17.404  67.984 47.675  1.00 52.81  ? 271  TYR A O   1 
ATOM 2131 C CB  . TYR A 1 274  ? 20.430  67.627 47.193  1.00 42.53  ? 271  TYR A CB  1 
ATOM 2132 C CG  . TYR A 1 274  ? 21.856  67.987 46.914  1.00 42.53  ? 271  TYR A CG  1 
ATOM 2133 C CD1 . TYR A 1 274  ? 22.543  68.877 47.733  1.00 42.53  ? 271  TYR A CD1 1 
ATOM 2134 C CD2 . TYR A 1 274  ? 22.512  67.469 45.805  1.00 42.53  ? 271  TYR A CD2 1 
ATOM 2135 C CE1 . TYR A 1 274  ? 23.854  69.222 47.460  1.00 42.53  ? 271  TYR A CE1 1 
ATOM 2136 C CE2 . TYR A 1 274  ? 23.802  67.812 45.530  1.00 42.53  ? 271  TYR A CE2 1 
ATOM 2137 C CZ  . TYR A 1 274  ? 24.468  68.688 46.354  1.00 42.53  ? 271  TYR A CZ  1 
ATOM 2138 O OH  . TYR A 1 274  ? 25.763  69.022 46.066  1.00 42.53  ? 271  TYR A OH  1 
ATOM 2139 N N   . LEU A 1 275  ? 17.697  67.418 45.506  1.00 33.95  ? 272  LEU A N   1 
ATOM 2140 C CA  . LEU A 1 275  ? 16.551  66.525 45.401  1.00 33.95  ? 272  LEU A CA  1 
ATOM 2141 C C   . LEU A 1 275  ? 17.014  65.095 45.691  1.00 33.95  ? 272  LEU A C   1 
ATOM 2142 O O   . LEU A 1 275  ? 18.067  64.684 45.205  1.00 33.95  ? 272  LEU A O   1 
ATOM 2143 C CB  . LEU A 1 275  ? 16.009  66.594 43.980  1.00 24.25  ? 272  LEU A CB  1 
ATOM 2144 C CG  . LEU A 1 275  ? 15.187  67.825 43.560  1.00 24.25  ? 272  LEU A CG  1 
ATOM 2145 C CD1 . LEU A 1 275  ? 15.020  67.874 42.035  1.00 24.25  ? 272  LEU A CD1 1 
ATOM 2146 C CD2 . LEU A 1 275  ? 13.830  67.873 44.222  1.00 24.25  ? 272  LEU A CD2 1 
ATOM 2147 N N   . LEU A 1 276  ? 16.240  64.357 46.488  1.00 25.41  ? 273  LEU A N   1 
ATOM 2148 C CA  . LEU A 1 276  ? 16.445  62.917 46.760  1.00 25.41  ? 273  LEU A CA  1 
ATOM 2149 C C   . LEU A 1 276  ? 15.228  62.133 46.319  1.00 25.41  ? 273  LEU A C   1 
ATOM 2150 O O   . LEU A 1 276  ? 14.107  62.564 46.557  1.00 25.41  ? 273  LEU A O   1 
ATOM 2151 C CB  . LEU A 1 276  ? 16.609  62.675 48.256  1.00 15.73  ? 273  LEU A CB  1 
ATOM 2152 C CG  . LEU A 1 276  ? 17.754  63.499 48.902  1.00 15.73  ? 273  LEU A CG  1 
ATOM 2153 C CD1 . LEU A 1 276  ? 18.006  63.154 50.404  1.00 15.73  ? 273  LEU A CD1 1 
ATOM 2154 C CD2 . LEU A 1 276  ? 19.088  63.424 48.116  1.00 15.73  ? 273  LEU A CD2 1 
ATOM 2155 N N   . GLY A 1 277  ? 15.449  60.962 45.708  1.00 38.52  ? 274  GLY A N   1 
ATOM 2156 C CA  . GLY A 1 277  ? 14.364  60.021 45.336  1.00 38.52  ? 274  GLY A CA  1 
ATOM 2157 C C   . GLY A 1 277  ? 14.411  58.626 45.958  1.00 38.52  ? 274  GLY A C   1 
ATOM 2158 O O   . GLY A 1 277  ? 15.446  57.972 45.921  1.00 38.52  ? 274  GLY A O   1 
ATOM 2159 N N   . ASP A 1 278  ? 13.269  58.208 46.522  1.00 29.91  ? 275  ASP A N   1 
ATOM 2160 C CA  . ASP A 1 278  ? 12.905  56.851 47.067  1.00 29.91  ? 275  ASP A CA  1 
ATOM 2161 C C   . ASP A 1 278  ? 12.605  55.700 46.101  1.00 29.91  ? 275  ASP A C   1 
ATOM 2162 O O   . ASP A 1 278  ? 12.266  55.931 44.958  1.00 29.91  ? 275  ASP A O   1 
ATOM 2163 C CB  . ASP A 1 278  ? 11.560  56.976 47.788  1.00 54.92  ? 275  ASP A CB  1 
ATOM 2164 C CG  . ASP A 1 278  ? 11.714  57.067 49.241  1.00 54.92  ? 275  ASP A CG  1 
ATOM 2165 O OD1 . ASP A 1 278  ? 12.847  56.890 49.726  1.00 54.92  ? 275  ASP A OD1 1 
ATOM 2166 O OD2 . ASP A 1 278  ? 10.715  57.322 49.921  1.00 54.92  ? 275  ASP A OD2 1 
ATOM 2167 N N   . MET A 1 279  ? 12.605  54.467 46.625  1.00 36.43  ? 276  MET A N   1 
ATOM 2168 C CA  . MET A 1 279  ? 12.052  53.319 45.908  1.00 36.43  ? 276  MET A CA  1 
ATOM 2169 C C   . MET A 1 279  ? 10.536  53.406 45.832  1.00 36.43  ? 276  MET A C   1 
ATOM 2170 O O   . MET A 1 279  ? 9.924   52.876 44.909  1.00 36.43  ? 276  MET A O   1 
ATOM 2171 C CB  . MET A 1 279  ? 12.542  51.993 46.481  1.00 68.57  ? 276  MET A CB  1 
ATOM 2172 C CG  . MET A 1 279  ? 13.604  51.303 45.616  1.00 68.57  ? 276  MET A CG  1 
ATOM 2173 S SD  . MET A 1 279  ? 15.025  50.556 46.509  1.00 68.57  ? 276  MET A SD  1 
ATOM 2174 C CE  . MET A 1 279  ? 14.272  49.545 47.804  1.00 68.57  ? 276  MET A CE  1 
ATOM 2175 N N   . GLU A 1 280  ? 9.944   54.121 46.782  1.00 30.94  ? 277  GLU A N   1 
ATOM 2176 C CA  . GLU A 1 280  ? 8.503   54.307 46.808  1.00 30.94  ? 277  GLU A CA  1 
ATOM 2177 C C   . GLU A 1 280  ? 8.127   55.570 46.025  1.00 30.94  ? 277  GLU A C   1 
ATOM 2178 O O   . GLU A 1 280  ? 6.963   55.972 46.010  1.00 30.94  ? 277  GLU A O   1 
ATOM 2179 C CB  . GLU A 1 280  ? 7.999   54.408 48.248  1.00 58.94  ? 277  GLU A CB  1 
ATOM 2180 C CG  . GLU A 1 280  ? 7.428   53.111 48.798  1.00 58.94  ? 277  GLU A CG  1 
ATOM 2181 C CD  . GLU A 1 280  ? 7.897   52.820 50.210  1.00 58.94  ? 277  GLU A CD  1 
ATOM 2182 O OE1 . GLU A 1 280  ? 7.449   53.519 51.143  1.00 58.94  ? 277  GLU A OE1 1 
ATOM 2183 O OE2 . GLU A 1 280  ? 8.714   51.891 50.387  1.00 58.94  ? 277  GLU A OE2 1 
ATOM 2184 N N   . GLY A 1 281  ? 9.113   56.192 45.377  1.00 30.98  ? 278  GLY A N   1 
ATOM 2185 C CA  . GLY A 1 281  ? 8.874   57.400 44.602  1.00 30.98  ? 278  GLY A CA  1 
ATOM 2186 C C   . GLY A 1 281  ? 8.499   58.634 45.421  1.00 30.98  ? 278  GLY A C   1 
ATOM 2187 O O   . GLY A 1 281  ? 7.999   59.584 44.857  1.00 30.98  ? 278  GLY A O   1 
ATOM 2188 N N   . ARG A 1 282  ? 8.823   58.654 46.709  1.00 22.18  ? 279  ARG A N   1 
ATOM 2189 C CA  . ARG A 1 282  ? 8.558   59.838 47.512  1.00 22.18  ? 279  ARG A CA  1 
ATOM 2190 C C   . ARG A 1 282  ? 9.729   60.727 47.064  1.00 22.18  ? 279  ARG A C   1 
ATOM 2191 O O   . ARG A 1 282  ? 10.816  60.209 46.812  1.00 22.18  ? 279  ARG A O   1 
ATOM 2192 C CB  . ARG A 1 282  ? 8.654   59.524 49.001  1.00 50.97  ? 279  ARG A CB  1 
ATOM 2193 C CG  . ARG A 1 282  ? 7.523   58.654 49.527  1.00 50.97  ? 279  ARG A CG  1 
ATOM 2194 C CD  . ARG A 1 282  ? 7.690   58.370 51.011  1.00 50.97  ? 279  ARG A CD  1 
ATOM 2195 N NE  . ARG A 1 282  ? 6.569   57.605 51.550  1.00 50.97  ? 279  ARG A NE  1 
ATOM 2196 C CZ  . ARG A 1 282  ? 6.495   56.278 51.536  1.00 50.97  ? 279  ARG A CZ  1 
ATOM 2197 N NH1 . ARG A 1 282  ? 7.478   55.562 51.008  1.00 50.97  ? 279  ARG A NH1 1 
ATOM 2198 N NH2 . ARG A 1 282  ? 5.437   55.666 52.050  1.00 50.97  ? 279  ARG A NH2 1 
ATOM 2199 N N   . LEU A 1 283  ? 9.536   62.040 46.949  1.00 30.00  ? 280  LEU A N   1 
ATOM 2200 C CA  . LEU A 1 283  ? 10.615  62.908 46.504  1.00 30.00  ? 280  LEU A CA  1 
ATOM 2201 C C   . LEU A 1 283  ? 10.950  63.790 47.677  1.00 30.00  ? 280  LEU A C   1 
ATOM 2202 O O   . LEU A 1 283  ? 10.053  64.151 48.436  1.00 30.00  ? 280  LEU A O   1 
ATOM 2203 C CB  . LEU A 1 283  ? 10.195  63.700 45.282  1.00 27.47  ? 280  LEU A CB  1 
ATOM 2204 C CG  . LEU A 1 283  ? 11.181  64.762 44.870  1.00 27.47  ? 280  LEU A CG  1 
ATOM 2205 C CD1 . LEU A 1 283  ? 12.365  64.128 44.188  1.00 27.47  ? 280  LEU A CD1 1 
ATOM 2206 C CD2 . LEU A 1 283  ? 10.492  65.750 43.946  1.00 27.47  ? 280  LEU A CD2 1 
ATOM 2207 N N   . PHE A 1 284  ? 12.225  64.080 47.889  1.00 45.10  ? 281  PHE A N   1 
ATOM 2208 C CA  . PHE A 1 284  ? 12.607  64.876 49.050  1.00 45.10  ? 281  PHE A CA  1 
ATOM 2209 C C   . PHE A 1 284  ? 13.482  66.025 48.631  1.00 45.10  ? 281  PHE A C   1 
ATOM 2210 O O   . PHE A 1 284  ? 14.212  65.931 47.649  1.00 45.10  ? 281  PHE A O   1 
ATOM 2211 C CB  . PHE A 1 284  ? 13.382  64.065 50.078  1.00 29.87  ? 281  PHE A CB  1 
ATOM 2212 C CG  . PHE A 1 284  ? 12.609  62.940 50.715  1.00 29.87  ? 281  PHE A CG  1 
ATOM 2213 C CD1 . PHE A 1 284  ? 12.645  61.649 50.167  1.00 29.87  ? 281  PHE A CD1 1 
ATOM 2214 C CD2 . PHE A 1 284  ? 11.932  63.140 51.915  1.00 29.87  ? 281  PHE A CD2 1 
ATOM 2215 C CE1 . PHE A 1 284  ? 11.984  60.570 50.774  1.00 29.87  ? 281  PHE A CE1 1 
ATOM 2216 C CE2 . PHE A 1 284  ? 11.237  62.085 52.536  1.00 29.87  ? 281  PHE A CE2 1 
ATOM 2217 C CZ  . PHE A 1 284  ? 11.266  60.789 51.963  1.00 29.87  ? 281  PHE A CZ  1 
ATOM 2218 N N   . MET A 1 285  ? 13.400  67.107 49.396  1.00 37.77  ? 282  MET A N   1 
ATOM 2219 C CA  . MET A 1 285  ? 14.289  68.231 49.248  1.00 37.77  ? 282  MET A CA  1 
ATOM 2220 C C   . MET A 1 285  ? 15.310  68.111 50.348  1.00 37.77  ? 282  MET A C   1 
ATOM 2221 O O   . MET A 1 285  ? 14.958  67.969 51.508  1.00 37.77  ? 282  MET A O   1 
ATOM 2222 C CB  . MET A 1 285  ? 13.523  69.526 49.434  1.00 34.20  ? 282  MET A CB  1 
ATOM 2223 C CG  . MET A 1 285  ? 14.305  70.783 49.055  1.00 34.20  ? 282  MET A CG  1 
ATOM 2224 S SD  . MET A 1 285  ? 14.534  70.982 47.255  1.00 34.20  ? 282  MET A SD  1 
ATOM 2225 C CE  . MET A 1 285  ? 16.309  70.947 47.287  1.00 34.20  ? 282  MET A CE  1 
ATOM 2226 N N   . LEU A 1 286  ? 16.576  68.151 49.997  1.00 31.43  ? 283  LEU A N   1 
ATOM 2227 C CA  . LEU A 1 286  ? 17.582  68.186 51.029  1.00 31.43  ? 283  LEU A CA  1 
ATOM 2228 C C   . LEU A 1 286  ? 18.183  69.590 51.048  1.00 31.43  ? 283  LEU A C   1 
ATOM 2229 O O   . LEU A 1 286  ? 18.746  70.049 50.040  1.00 31.43  ? 283  LEU A O   1 
ATOM 2230 C CB  . LEU A 1 286  ? 18.659  67.115 50.818  1.00 31.46  ? 283  LEU A CB  1 
ATOM 2231 C CG  . LEU A 1 286  ? 19.861  67.238 51.757  1.00 31.46  ? 283  LEU A CG  1 
ATOM 2232 C CD1 . LEU A 1 286  ? 19.481  67.139 53.243  1.00 31.46  ? 283  LEU A CD1 1 
ATOM 2233 C CD2 . LEU A 1 286  ? 20.952  66.198 51.427  1.00 31.46  ? 283  LEU A CD2 1 
ATOM 2234 N N   . LEU A 1 287  ? 18.038  70.269 52.192  1.00 38.96  ? 284  LEU A N   1 
ATOM 2235 C CA  . LEU A 1 287  ? 18.509  71.647 52.357  1.00 38.96  ? 284  LEU A CA  1 
ATOM 2236 C C   . LEU A 1 287  ? 19.688  71.726 53.301  1.00 38.96  ? 284  LEU A C   1 
ATOM 2237 O O   . LEU A 1 287  ? 19.677  71.140 54.391  1.00 38.96  ? 284  LEU A O   1 
ATOM 2238 C CB  . LEU A 1 287  ? 17.377  72.536 52.850  1.00 24.47  ? 284  LEU A CB  1 
ATOM 2239 C CG  . LEU A 1 287  ? 16.084  72.466 52.003  1.00 24.47  ? 284  LEU A CG  1 
ATOM 2240 C CD1 . LEU A 1 287  ? 14.951  71.679 52.693  1.00 24.47  ? 284  LEU A CD1 1 
ATOM 2241 C CD2 . LEU A 1 287  ? 15.591  73.828 51.574  1.00 24.47  ? 284  LEU A CD2 1 
ATOM 2242 N N   . LEU A 1 288  ? 20.720  72.434 52.859  1.00 37.68  ? 285  LEU A N   1 
ATOM 2243 C CA  . LEU A 1 288  ? 21.890  72.684 53.690  1.00 37.68  ? 285  LEU A CA  1 
ATOM 2244 C C   . LEU A 1 288  ? 21.866  74.131 54.187  1.00 37.68  ? 285  LEU A C   1 
ATOM 2245 O O   . LEU A 1 288  ? 21.751  75.065 53.379  1.00 37.68  ? 285  LEU A O   1 
ATOM 2246 C CB  . LEU A 1 288  ? 23.197  72.426 52.906  1.00 54.44  ? 285  LEU A CB  1 
ATOM 2247 C CG  . LEU A 1 288  ? 23.489  71.144 52.092  1.00 54.44  ? 285  LEU A CG  1 
ATOM 2248 C CD1 . LEU A 1 288  ? 24.983  70.925 52.006  1.00 54.44  ? 285  LEU A CD1 1 
ATOM 2249 C CD2 . LEU A 1 288  ? 22.839  69.897 52.660  1.00 54.44  ? 285  LEU A CD2 1 
ATOM 2250 N N   . GLU A 1 289  ? 22.006  74.332 55.499  1.00 47.13  ? 286  GLU A N   1 
ATOM 2251 C CA  . GLU A 1 289  ? 21.955  75.691 56.071  1.00 47.13  ? 286  GLU A CA  1 
ATOM 2252 C C   . GLU A 1 289  ? 23.330  76.387 56.205  1.00 47.13  ? 286  GLU A C   1 
ATOM 2253 O O   . GLU A 1 289  ? 24.205  75.923 56.982  1.00 47.13  ? 286  GLU A O   1 
ATOM 2254 C CB  . GLU A 1 289  ? 21.255  75.633 57.421  1.00 89.07  ? 286  GLU A CB  1 
ATOM 2255 C CG  . GLU A 1 289  ? 20.618  76.923 57.859  1.00 89.07  ? 286  GLU A CG  1 
ATOM 2256 C CD  . GLU A 1 289  ? 19.834  76.753 59.150  1.00 89.07  ? 286  GLU A CD  1 
ATOM 2257 O OE1 . GLU A 1 289  ? 19.550  77.781 59.801  1.00 89.07  ? 286  GLU A OE1 1 
ATOM 2258 O OE2 . GLU A 1 289  ? 19.507  75.598 59.516  1.00 89.07  ? 286  GLU A OE2 1 
ATOM 2259 N N   . LYS A 1 290  ? 23.499  77.490 55.457  1.00 75.66  ? 287  LYS A N   1 
ATOM 2260 C CA  . LYS A 1 290  ? 24.748  78.293 55.446  1.00 75.66  ? 287  LYS A CA  1 
ATOM 2261 C C   . LYS A 1 290  ? 24.782  79.263 56.617  1.00 75.66  ? 287  LYS A C   1 
ATOM 2262 O O   . LYS A 1 290  ? 23.830  80.018 56.816  1.00 75.66  ? 287  LYS A O   1 
ATOM 2263 C CB  . LYS A 1 290  ? 24.916  79.125 54.158  1.00 81.26  ? 287  LYS A CB  1 
ATOM 2264 C CG  . LYS A 1 290  ? 24.251  78.568 52.921  1.00 81.26  ? 287  LYS A CG  1 
ATOM 2265 C CD  . LYS A 1 290  ? 24.272  79.545 51.751  1.00 81.26  ? 287  LYS A CD  1 
ATOM 2266 C CE  . LYS A 1 290  ? 23.208  79.133 50.722  1.00 81.26  ? 287  LYS A CE  1 
ATOM 2267 N NZ  . LYS A 1 290  ? 23.102  80.036 49.533  1.00 81.26  ? 287  LYS A NZ  1 
ATOM 2268 N N   . GLU A 1 291  ? 25.879  79.261 57.374  1.00 101.54 ? 288  GLU A N   1 
ATOM 2269 C CA  . GLU A 1 291  ? 26.084  80.243 58.445  1.00 101.54 ? 288  GLU A CA  1 
ATOM 2270 C C   . GLU A 1 291  ? 27.296  81.131 58.219  1.00 101.54 ? 288  GLU A C   1 
ATOM 2271 O O   . GLU A 1 291  ? 28.427  80.758 58.551  1.00 101.54 ? 288  GLU A O   1 
ATOM 2272 C CB  . GLU A 1 291  ? 26.167  79.574 59.815  1.00 150.62 ? 288  GLU A CB  1 
ATOM 2273 C CG  . GLU A 1 291  ? 24.822  79.419 60.488  1.00 150.62 ? 288  GLU A CG  1 
ATOM 2274 C CD  . GLU A 1 291  ? 24.217  80.731 60.963  1.00 150.62 ? 288  GLU A CD  1 
ATOM 2275 O OE1 . GLU A 1 291  ? 24.651  81.817 60.508  1.00 150.62 ? 288  GLU A OE1 1 
ATOM 2276 O OE2 . GLU A 1 291  ? 23.290  80.669 61.796  1.00 150.62 ? 288  GLU A OE2 1 
ATOM 2277 N N   . GLU A 1 292  ? 27.031  82.311 57.656  1.00 108.13 ? 289  GLU A N   1 
ATOM 2278 C CA  . GLU A 1 292  ? 28.048  83.328 57.397  1.00 108.13 ? 289  GLU A CA  1 
ATOM 2279 C C   . GLU A 1 292  ? 28.616  83.853 58.714  1.00 108.13 ? 289  GLU A C   1 
ATOM 2280 O O   . GLU A 1 292  ? 27.935  83.838 59.746  1.00 108.13 ? 289  GLU A O   1 
ATOM 2281 C CB  . GLU A 1 292  ? 27.463  84.475 56.563  1.00 127.64 ? 289  GLU A CB  1 
ATOM 2282 C CG  . GLU A 1 292  ? 28.506  85.256 55.758  1.00 127.64 ? 289  GLU A CG  1 
ATOM 2283 C CD  . GLU A 1 292  ? 27.932  86.450 55.010  1.00 127.64 ? 289  GLU A CD  1 
ATOM 2284 O OE1 . GLU A 1 292  ? 28.545  87.538 55.067  1.00 127.64 ? 289  GLU A OE1 1 
ATOM 2285 O OE2 . GLU A 1 292  ? 26.874  86.308 54.362  1.00 127.64 ? 289  GLU A OE2 1 
ATOM 2286 N N   . GLN A 1 293  ? 29.866  84.305 58.675  1.00 117.06 ? 290  GLN A N   1 
ATOM 2287 C CA  . GLN A 1 293  ? 30.568  84.722 59.891  1.00 117.06 ? 290  GLN A CA  1 
ATOM 2288 C C   . GLN A 1 293  ? 30.219  86.132 59.429  1.00 117.06 ? 290  GLN A C   1 
ATOM 2289 O O   . GLN A 1 293  ? 29.059  86.400 59.097  1.00 117.06 ? 290  GLN A O   1 
ATOM 2290 C CB  . GLN A 1 293  ? 31.591  83.670 60.280  1.00 114.81 ? 290  GLN A CB  1 
ATOM 2291 C CG  . GLN A 1 293  ? 31.011  82.364 60.700  1.00 114.81 ? 290  GLN A CG  1 
ATOM 2292 C CD  . GLN A 1 293  ? 32.094  81.400 61.052  1.00 114.81 ? 290  GLN A CD  1 
ATOM 2293 O OE1 . GLN A 1 293  ? 32.263  80.381 60.391  1.00 114.81 ? 290  GLN A OE1 1 
ATOM 2294 N NE2 . GLN A 1 293  ? 32.869  81.729 62.080  1.00 114.81 ? 290  GLN A NE2 1 
ATOM 2295 N N   . MET A 1 294  ? 31.228  87.006 59.374  1.00 190.47 ? 291  MET A N   1 
ATOM 2296 C CA  . MET A 1 294  ? 31.061  88.444 59.093  1.00 190.47 ? 291  MET A CA  1 
ATOM 2297 C C   . MET A 1 294  ? 32.540  88.046 59.060  1.00 190.47 ? 291  MET A C   1 
ATOM 2298 O O   . MET A 1 294  ? 33.089  87.604 60.072  1.00 190.47 ? 291  MET A O   1 
ATOM 2299 C CB  . MET A 1 294  ? 31.575  89.197 60.338  1.00 118.41 ? 291  MET A CB  1 
ATOM 2300 C CG  . MET A 1 294  ? 31.033  88.751 61.691  1.00 118.41 ? 291  MET A CG  1 
ATOM 2301 S SD  . MET A 1 294  ? 32.355  88.710 62.933  1.00 118.41 ? 291  MET A SD  1 
ATOM 2302 C CE  . MET A 1 294  ? 32.564  90.456 63.291  1.00 118.41 ? 291  MET A CE  1 
ATOM 2303 N N   . ASP A 1 295  ? 33.165  88.204 57.888  1.00 116.31 ? 292  ASP A N   1 
ATOM 2304 C CA  . ASP A 1 295  ? 34.552  87.801 57.655  1.00 116.31 ? 292  ASP A CA  1 
ATOM 2305 C C   . ASP A 1 295  ? 35.213  86.421 57.631  1.00 116.31 ? 292  ASP A C   1 
ATOM 2306 O O   . ASP A 1 295  ? 36.251  86.241 56.994  1.00 116.31 ? 292  ASP A O   1 
ATOM 2307 C CB  . ASP A 1 295  ? 35.570  88.850 58.117  1.00 149.33 ? 292  ASP A CB  1 
ATOM 2308 C CG  . ASP A 1 295  ? 35.069  90.276 57.938  1.00 149.33 ? 292  ASP A CG  1 
ATOM 2309 O OD1 . ASP A 1 295  ? 35.807  91.091 57.338  1.00 149.33 ? 292  ASP A OD1 1 
ATOM 2310 O OD2 . ASP A 1 295  ? 33.943  90.586 58.395  1.00 149.33 ? 292  ASP A OD2 1 
ATOM 2311 N N   . GLY A 1 296  ? 34.613  85.455 58.322  1.00 128.06 ? 293  GLY A N   1 
ATOM 2312 C CA  . GLY A 1 296  ? 35.118  84.076 58.330  1.00 128.06 ? 293  GLY A CA  1 
ATOM 2313 C C   . GLY A 1 296  ? 34.492  83.162 57.279  1.00 128.06 ? 293  GLY A C   1 
ATOM 2314 O O   . GLY A 1 296  ? 34.597  81.935 57.379  1.00 128.06 ? 293  GLY A O   1 
ATOM 2315 N N   . THR A 1 297  ? 33.859  83.770 56.268  1.00 134.74 ? 294  THR A N   1 
ATOM 2316 C CA  . THR A 1 297  ? 33.146  83.071 55.177  1.00 134.74 ? 294  THR A CA  1 
ATOM 2317 C C   . THR A 1 297  ? 31.978  82.215 55.691  1.00 134.74 ? 294  THR A C   1 
ATOM 2318 O O   . THR A 1 297  ? 31.470  82.440 56.800  1.00 134.74 ? 294  THR A O   1 
ATOM 2319 C CB  . THR A 1 297  ? 34.089  82.228 54.246  1.00 142.95 ? 294  THR A CB  1 
ATOM 2320 O OG1 . THR A 1 297  ? 35.416  82.769 54.257  1.00 142.95 ? 294  THR A OG1 1 
ATOM 2321 C CG2 . THR A 1 297  ? 33.566  82.212 52.807  1.00 142.95 ? 294  THR A CG2 1 
ATOM 2322 N N   . VAL A 1 298  ? 31.581  81.226 54.885  1.00 69.30  ? 295  VAL A N   1 
ATOM 2323 C CA  . VAL A 1 298  ? 30.322  80.489 55.070  1.00 69.30  ? 295  VAL A CA  1 
ATOM 2324 C C   . VAL A 1 298  ? 30.557  79.070 55.567  1.00 69.30  ? 295  VAL A C   1 
ATOM 2325 O O   . VAL A 1 298  ? 31.386  78.346 55.012  1.00 69.30  ? 295  VAL A O   1 
ATOM 2326 C CB  . VAL A 1 298  ? 29.460  80.468 53.764  1.00 126.68 ? 295  VAL A CB  1 
ATOM 2327 C CG1 . VAL A 1 298  ? 28.778  81.814 53.541  1.00 126.68 ? 295  VAL A CG1 1 
ATOM 2328 C CG2 . VAL A 1 298  ? 30.302  80.085 52.539  1.00 126.68 ? 295  VAL A CG2 1 
ATOM 2329 N N   . THR A 1 299  ? 29.825  78.682 56.611  1.00 90.32  ? 296  THR A N   1 
ATOM 2330 C CA  . THR A 1 299  ? 29.936  77.339 57.201  1.00 90.32  ? 296  THR A CA  1 
ATOM 2331 C C   . THR A 1 299  ? 28.571  76.608 57.219  1.00 90.32  ? 296  THR A C   1 
ATOM 2332 O O   . THR A 1 299  ? 27.530  77.217 56.967  1.00 90.32  ? 296  THR A O   1 
ATOM 2333 C CB  . THR A 1 299  ? 30.619  77.407 58.604  1.00 78.07  ? 296  THR A CB  1 
ATOM 2334 O OG1 . THR A 1 299  ? 31.692  76.460 58.660  1.00 78.07  ? 296  THR A OG1 1 
ATOM 2335 C CG2 . THR A 1 299  ? 29.623  77.194 59.780  1.00 78.07  ? 296  THR A CG2 1 
ATOM 2336 N N   . LEU A 1 300  ? 28.567  75.309 57.501  1.00 64.87  ? 297  LEU A N   1 
ATOM 2337 C CA  . LEU A 1 300  ? 27.318  74.563 57.457  1.00 64.87  ? 297  LEU A CA  1 
ATOM 2338 C C   . LEU A 1 300  ? 26.665  74.358 58.848  1.00 64.87  ? 297  LEU A C   1 
ATOM 2339 O O   . LEU A 1 300  ? 27.164  73.584 59.683  1.00 64.87  ? 297  LEU A O   1 
ATOM 2340 C CB  . LEU A 1 300  ? 27.551  73.239 56.731  1.00 82.94  ? 297  LEU A CB  1 
ATOM 2341 C CG  . LEU A 1 300  ? 26.356  72.579 56.055  1.00 82.94  ? 297  LEU A CG  1 
ATOM 2342 C CD1 . LEU A 1 300  ? 26.842  71.752 54.897  1.00 82.94  ? 297  LEU A CD1 1 
ATOM 2343 C CD2 . LEU A 1 300  ? 25.587  71.710 57.034  1.00 82.94  ? 297  LEU A CD2 1 
ATOM 2344 N N   . LYS A 1 301  ? 25.543  75.032 59.098  1.00 54.65  ? 298  LYS A N   1 
ATOM 2345 C CA  . LYS A 1 301  ? 24.962  74.953 60.438  1.00 54.65  ? 298  LYS A CA  1 
ATOM 2346 C C   . LYS A 1 301  ? 24.178  73.673 60.669  1.00 54.65  ? 298  LYS A C   1 
ATOM 2347 O O   . LYS A 1 301  ? 24.277  73.067 61.754  1.00 54.65  ? 298  LYS A O   1 
ATOM 2348 C CB  . LYS A 1 301  ? 24.101  76.171 60.790  1.00 79.63  ? 298  LYS A CB  1 
ATOM 2349 C CG  . LYS A 1 301  ? 23.698  76.194 62.286  1.00 79.63  ? 298  LYS A CG  1 
ATOM 2350 C CD  . LYS A 1 301  ? 22.978  77.480 62.742  1.00 79.63  ? 298  LYS A CD  1 
ATOM 2351 C CE  . LYS A 1 301  ? 21.545  77.575 62.234  1.00 79.63  ? 298  LYS A CE  1 
ATOM 2352 N NZ  . LYS A 1 301  ? 20.775  76.293 62.394  1.00 79.63  ? 298  LYS A NZ  1 
ATOM 2353 N N   . ASP A 1 302  ? 23.389  73.270 59.666  1.00 59.76  ? 299  ASP A N   1 
ATOM 2354 C CA  . ASP A 1 302  ? 22.583  72.068 59.775  1.00 59.76  ? 299  ASP A CA  1 
ATOM 2355 C C   . ASP A 1 302  ? 22.128  71.523 58.428  1.00 59.76  ? 299  ASP A C   1 
ATOM 2356 O O   . ASP A 1 302  ? 22.323  72.164 57.389  1.00 59.76  ? 299  ASP A O   1 
ATOM 2357 C CB  . ASP A 1 302  ? 21.376  72.332 60.676  1.00 104.75 ? 299  ASP A CB  1 
ATOM 2358 C CG  . ASP A 1 302  ? 21.260  71.322 61.784  1.00 104.75 ? 299  ASP A CG  1 
ATOM 2359 O OD1 . ASP A 1 302  ? 20.968  70.146 61.489  1.00 104.75 ? 299  ASP A OD1 1 
ATOM 2360 O OD2 . ASP A 1 302  ? 21.471  71.706 62.952  1.00 104.75 ? 299  ASP A OD2 1 
ATOM 2361 N N   . LEU A 1 303  ? 21.542  70.321 58.473  1.00 64.69  ? 300  LEU A N   1 
ATOM 2362 C CA  . LEU A 1 303  ? 20.884  69.682 57.340  1.00 64.69  ? 300  LEU A CA  1 
ATOM 2363 C C   . LEU A 1 303  ? 19.427  69.475 57.705  1.00 64.69  ? 300  LEU A C   1 
ATOM 2364 O O   . LEU A 1 303  ? 19.088  69.277 58.877  1.00 64.69  ? 300  LEU A O   1 
ATOM 2365 C CB  . LEU A 1 303  ? 21.482  68.294 57.036  1.00 40.56  ? 300  LEU A CB  1 
ATOM 2366 C CG  . LEU A 1 303  ? 22.966  68.033 56.832  1.00 40.56  ? 300  LEU A CG  1 
ATOM 2367 C CD1 . LEU A 1 303  ? 23.213  66.646 56.282  1.00 40.56  ? 300  LEU A CD1 1 
ATOM 2368 C CD2 . LEU A 1 303  ? 23.497  69.027 55.892  1.00 40.56  ? 300  LEU A CD2 1 
ATOM 2369 N N   . ARG A 1 304  ? 18.580  69.479 56.681  1.00 36.86  ? 301  ARG A N   1 
ATOM 2370 C CA  . ARG A 1 304  ? 17.146  69.348 56.828  1.00 36.86  ? 301  ARG A CA  1 
ATOM 2371 C C   . ARG A 1 304  ? 16.549  68.719 55.534  1.00 36.86  ? 301  ARG A C   1 
ATOM 2372 O O   . ARG A 1 304  ? 17.035  68.953 54.410  1.00 36.86  ? 301  ARG A O   1 
ATOM 2373 C CB  . ARG A 1 304  ? 16.570  70.741 57.078  1.00 42.44  ? 301  ARG A CB  1 
ATOM 2374 C CG  . ARG A 1 304  ? 15.211  70.806 57.689  1.00 42.44  ? 301  ARG A CG  1 
ATOM 2375 C CD  . ARG A 1 304  ? 14.858  72.235 58.095  1.00 42.44  ? 301  ARG A CD  1 
ATOM 2376 N NE  . ARG A 1 304  ? 15.187  73.224 57.064  1.00 42.44  ? 301  ARG A NE  1 
ATOM 2377 C CZ  . ARG A 1 304  ? 14.346  73.641 56.120  1.00 42.44  ? 301  ARG A CZ  1 
ATOM 2378 N NH1 . ARG A 1 304  ? 13.093  73.165 56.066  1.00 42.44  ? 301  ARG A NH1 1 
ATOM 2379 N NH2 . ARG A 1 304  ? 14.770  74.534 55.226  1.00 42.44  ? 301  ARG A NH2 1 
ATOM 2380 N N   . VAL A 1 305  ? 15.501  67.923 55.716  1.00 37.16  ? 302  VAL A N   1 
ATOM 2381 C CA  . VAL A 1 305  ? 14.870  67.203 54.640  1.00 37.16  ? 302  VAL A CA  1 
ATOM 2382 C C   . VAL A 1 305  ? 13.395  67.551 54.721  1.00 37.16  ? 302  VAL A C   1 
ATOM 2383 O O   . VAL A 1 305  ? 12.854  67.623 55.821  1.00 37.16  ? 302  VAL A O   1 
ATOM 2384 C CB  . VAL A 1 305  ? 15.055  65.667 54.859  1.00 32.37  ? 302  VAL A CB  1 
ATOM 2385 C CG1 . VAL A 1 305  ? 13.973  64.871 54.201  1.00 32.37  ? 302  VAL A CG1 1 
ATOM 2386 C CG2 . VAL A 1 305  ? 16.379  65.216 54.334  1.00 32.37  ? 302  VAL A CG2 1 
ATOM 2387 N N   . GLU A 1 306  ? 12.728  67.783 53.592  1.00 40.05  ? 303  GLU A N   1 
ATOM 2388 C CA  . GLU A 1 306  ? 11.285  67.962 53.633  1.00 40.05  ? 303  GLU A CA  1 
ATOM 2389 C C   . GLU A 1 306  ? 10.673  67.173 52.506  1.00 40.05  ? 303  GLU A C   1 
ATOM 2390 O O   . GLU A 1 306  ? 11.163  67.229 51.369  1.00 40.05  ? 303  GLU A O   1 
ATOM 2391 C CB  . GLU A 1 306  ? 10.916  69.433 53.511  1.00 70.48  ? 303  GLU A CB  1 
ATOM 2392 C CG  . GLU A 1 306  ? 11.419  70.253 54.667  1.00 70.48  ? 303  GLU A CG  1 
ATOM 2393 C CD  . GLU A 1 306  ? 10.947  71.685 54.640  1.00 70.48  ? 303  GLU A CD  1 
ATOM 2394 O OE1 . GLU A 1 306  ? 10.958  72.309 53.552  1.00 70.48  ? 303  GLU A OE1 1 
ATOM 2395 O OE2 . GLU A 1 306  ? 10.591  72.185 55.731  1.00 70.48  ? 303  GLU A OE2 1 
ATOM 2396 N N   . LEU A 1 307  ? 9.614   66.428 52.822  1.00 32.55  ? 304  LEU A N   1 
ATOM 2397 C CA  . LEU A 1 307  ? 8.899   65.623 51.821  1.00 32.55  ? 304  LEU A CA  1 
ATOM 2398 C C   . LEU A 1 307  ? 8.045   66.466 50.890  1.00 32.55  ? 304  LEU A C   1 
ATOM 2399 O O   . LEU A 1 307  ? 7.006   67.004 51.289  1.00 32.55  ? 304  LEU A O   1 
ATOM 2400 C CB  . LEU A 1 307  ? 8.053   64.533 52.502  1.00 31.42  ? 304  LEU A CB  1 
ATOM 2401 C CG  . LEU A 1 307  ? 6.849   63.969 51.739  1.00 31.42  ? 304  LEU A CG  1 
ATOM 2402 C CD1 . LEU A 1 307  ? 7.273   63.403 50.414  1.00 31.42  ? 304  LEU A CD1 1 
ATOM 2403 C CD2 . LEU A 1 307  ? 6.131   62.937 52.545  1.00 31.42  ? 304  LEU A CD2 1 
ATOM 2404 N N   . LEU A 1 308  ? 8.464   66.574 49.643  1.00 29.34  ? 305  LEU A N   1 
ATOM 2405 C CA  . LEU A 1 308  ? 7.710   67.403 48.723  1.00 29.34  ? 305  LEU A CA  1 
ATOM 2406 C C   . LEU A 1 308  ? 6.505   66.659 48.144  1.00 29.34  ? 305  LEU A C   1 
ATOM 2407 O O   . LEU A 1 308  ? 5.505   67.289 47.745  1.00 29.34  ? 305  LEU A O   1 
ATOM 2408 C CB  . LEU A 1 308  ? 8.581   67.956 47.594  1.00 32.46  ? 305  LEU A CB  1 
ATOM 2409 C CG  . LEU A 1 308  ? 10.043  68.339 47.818  1.00 32.46  ? 305  LEU A CG  1 
ATOM 2410 C CD1 . LEU A 1 308  ? 10.630  68.700 46.477  1.00 32.46  ? 305  LEU A CD1 1 
ATOM 2411 C CD2 . LEU A 1 308  ? 10.181  69.481 48.744  1.00 32.46  ? 305  LEU A CD2 1 
ATOM 2412 N N   . GLY A 1 309  ? 6.577   65.338 48.069  1.00 47.50  ? 306  GLY A N   1 
ATOM 2413 C CA  . GLY A 1 309  ? 5.454   64.587 47.497  1.00 47.50  ? 306  GLY A CA  1 
ATOM 2414 C C   . GLY A 1 309  ? 5.900   63.313 46.830  1.00 47.50  ? 306  GLY A C   1 
ATOM 2415 O O   . GLY A 1 309  ? 6.823   62.646 47.304  1.00 47.50  ? 306  GLY A O   1 
ATOM 2416 N N   . GLU A 1 310  ? 5.284   62.969 45.710  1.00 25.36  ? 307  GLU A N   1 
ATOM 2417 C CA  . GLU A 1 310  ? 5.656   61.718 45.082  1.00 25.36  ? 307  GLU A CA  1 
ATOM 2418 C C   . GLU A 1 310  ? 5.688   61.764 43.564  1.00 25.36  ? 307  GLU A C   1 
ATOM 2419 O O   . GLU A 1 310  ? 4.752   62.228 42.902  1.00 25.36  ? 307  GLU A O   1 
ATOM 2420 C CB  . GLU A 1 310  ? 4.798   60.588 45.604  1.00 42.50  ? 307  GLU A CB  1 
ATOM 2421 C CG  . GLU A 1 310  ? 3.602   60.318 44.820  1.00 42.50  ? 307  GLU A CG  1 
ATOM 2422 C CD  . GLU A 1 310  ? 3.003   58.976 45.176  1.00 42.50  ? 307  GLU A CD  1 
ATOM 2423 O OE1 . GLU A 1 310  ? 2.366   58.367 44.275  1.00 42.50  ? 307  GLU A OE1 1 
ATOM 2424 O OE2 . GLU A 1 310  ? 3.173   58.533 46.346  1.00 42.50  ? 307  GLU A OE2 1 
ATOM 2425 N N   . THR A 1 311  ? 6.787   61.306 42.996  1.00 42.04  ? 308  THR A N   1 
ATOM 2426 C CA  . THR A 1 311  ? 6.927   61.430 41.576  1.00 42.04  ? 308  THR A CA  1 
ATOM 2427 C C   . THR A 1 311  ? 6.418   60.163 40.990  1.00 42.04  ? 308  THR A C   1 
ATOM 2428 O O   . THR A 1 311  ? 5.210   59.885 41.137  1.00 42.04  ? 308  THR A O   1 
ATOM 2429 C CB  . THR A 1 311  ? 8.026   62.443 41.156  1.00 36.93  ? 308  THR A CB  1 
ATOM 2430 O OG1 . THR A 1 311  ? 9.288   61.924 41.585  1.00 36.93  ? 308  THR A OG1 1 
ATOM 2431 C CG2 . THR A 1 311  ? 7.811   63.823 41.712  1.00 36.93  ? 308  THR A CG2 1 
ATOM 2432 N N   . SER A 1 312  ? 7.272   59.411 40.304  1.00 15.71  ? 309  SER A N   1 
ATOM 2433 C CA  . SER A 1 312  ? 6.957   57.985 40.101  1.00 15.71  ? 309  SER A CA  1 
ATOM 2434 C C   . SER A 1 312  ? 8.377   57.413 40.267  1.00 15.71  ? 309  SER A C   1 
ATOM 2435 O O   . SER A 1 312  ? 9.372   58.144 40.194  1.00 15.71  ? 309  SER A O   1 
ATOM 2436 C CB  . SER A 1 312  ? 6.741   58.402 38.627  1.00 17.09  ? 309  SER A CB  1 
ATOM 2437 O OG  . SER A 1 312  ? 7.802   58.000 37.787  1.00 17.09  ? 309  SER A OG  1 
ATOM 2438 N N   . ILE A 1 313  ? 8.498   56.111 40.449  1.00 28.47  ? 310  ILE A N   1 
ATOM 2439 C CA  . ILE A 1 313  ? 9.801   55.592 40.829  1.00 28.47  ? 310  ILE A CA  1 
ATOM 2440 C C   . ILE A 1 313  ? 10.940  55.943 39.878  1.00 28.47  ? 310  ILE A C   1 
ATOM 2441 O O   . ILE A 1 313  ? 10.905  55.607 38.692  1.00 28.47  ? 310  ILE A O   1 
ATOM 2442 C CB  . ILE A 1 313  ? 9.754   54.110 41.110  1.00 17.71  ? 310  ILE A CB  1 
ATOM 2443 C CG1 . ILE A 1 313  ? 8.526   53.807 42.007  1.00 17.71  ? 310  ILE A CG1 1 
ATOM 2444 C CG2 . ILE A 1 313  ? 11.085  53.665 41.805  1.00 17.71  ? 310  ILE A CG2 1 
ATOM 2445 C CD1 . ILE A 1 313  ? 8.398   52.337 42.487  1.00 17.71  ? 310  ILE A CD1 1 
ATOM 2446 N N   . ALA A 1 314  ? 11.960  56.614 40.408  1.00 11.44  ? 311  ALA A N   1 
ATOM 2447 C CA  . ALA A 1 314  ? 12.955  57.298 39.555  1.00 11.44  ? 311  ALA A CA  1 
ATOM 2448 C C   . ALA A 1 314  ? 14.264  56.570 39.444  1.00 11.44  ? 311  ALA A C   1 
ATOM 2449 O O   . ALA A 1 314  ? 14.829  56.183 40.457  1.00 11.44  ? 311  ALA A O   1 
ATOM 2450 C CB  . ALA A 1 314  ? 13.217  58.737 40.108  1.00 9.92   ? 311  ALA A CB  1 
ATOM 2451 N N   . GLU A 1 315  ? 14.789  56.402 38.243  1.00 33.47  ? 312  GLU A N   1 
ATOM 2452 C CA  . GLU A 1 315  ? 16.189  56.030 38.139  1.00 33.47  ? 312  GLU A CA  1 
ATOM 2453 C C   . GLU A 1 315  ? 17.008  57.299 38.266  1.00 33.47  ? 312  GLU A C   1 
ATOM 2454 O O   . GLU A 1 315  ? 18.145  57.289 38.733  1.00 33.47  ? 312  GLU A O   1 
ATOM 2455 C CB  . GLU A 1 315  ? 16.491  55.356 36.820  1.00 52.82  ? 312  GLU A CB  1 
ATOM 2456 C CG  . GLU A 1 315  ? 16.592  53.882 36.976  1.00 52.82  ? 312  GLU A CG  1 
ATOM 2457 C CD  . GLU A 1 315  ? 17.971  53.386 37.396  1.00 52.82  ? 312  GLU A CD  1 
ATOM 2458 O OE1 . GLU A 1 315  ? 18.997  53.858 36.858  1.00 52.82  ? 312  GLU A OE1 1 
ATOM 2459 O OE2 . GLU A 1 315  ? 18.024  52.471 38.237  1.00 52.82  ? 312  GLU A OE2 1 
ATOM 2460 N N   . CYS A 1 316  ? 16.345  58.396 37.941  1.00 63.29  ? 313  CYS A N   1 
ATOM 2461 C CA  . CYS A 1 316  ? 16.947  59.531 37.335  1.00 63.29  ? 313  CYS A CA  1 
ATOM 2462 C C   . CYS A 1 316  ? 16.170  60.761 37.762  1.00 63.29  ? 313  CYS A C   1 
ATOM 2463 O O   . CYS A 1 316  ? 14.952  60.860 37.537  1.00 63.29  ? 313  CYS A O   1 
ATOM 2464 C CB  . CYS A 1 316  ? 16.735  59.358 35.847  1.00 60.53  ? 313  CYS A CB  1 
ATOM 2465 S SG  . CYS A 1 316  ? 18.052  59.841 34.904  1.00 60.53  ? 313  CYS A SG  1 
ATOM 2466 N N   . LEU A 1 317  ? 16.876  61.718 38.339  1.00 31.56  ? 314  LEU A N   1 
ATOM 2467 C CA  . LEU A 1 317  ? 16.253  62.979 38.707  1.00 31.56  ? 314  LEU A CA  1 
ATOM 2468 C C   . LEU A 1 317  ? 17.085  64.186 38.238  1.00 31.56  ? 314  LEU A C   1 
ATOM 2469 O O   . LEU A 1 317  ? 18.263  64.297 38.533  1.00 31.56  ? 314  LEU A O   1 
ATOM 2470 C CB  . LEU A 1 317  ? 16.141  62.972 40.207  1.00 26.68  ? 314  LEU A CB  1 
ATOM 2471 C CG  . LEU A 1 317  ? 14.878  63.133 40.988  1.00 26.68  ? 314  LEU A CG  1 
ATOM 2472 C CD1 . LEU A 1 317  ? 13.706  62.413 40.404  1.00 26.68  ? 314  LEU A CD1 1 
ATOM 2473 C CD2 . LEU A 1 317  ? 15.258  62.577 42.343  1.00 26.68  ? 314  LEU A CD2 1 
ATOM 2474 N N   . THR A 1 318  ? 16.487  65.085 37.488  1.00 26.87  ? 315  THR A N   1 
ATOM 2475 C CA  . THR A 1 318  ? 17.227  66.260 36.975  1.00 26.87  ? 315  THR A CA  1 
ATOM 2476 C C   . THR A 1 318  ? 16.486  67.599 37.160  1.00 26.87  ? 315  THR A C   1 
ATOM 2477 O O   . THR A 1 318  ? 15.498  67.875 36.451  1.00 26.87  ? 315  THR A O   1 
ATOM 2478 C CB  . THR A 1 318  ? 17.575  66.092 35.505  1.00 41.71  ? 315  THR A CB  1 
ATOM 2479 O OG1 . THR A 1 318  ? 18.600  65.116 35.395  1.00 41.71  ? 315  THR A OG1 1 
ATOM 2480 C CG2 . THR A 1 318  ? 18.131  67.357 34.959  1.00 41.71  ? 315  THR A CG2 1 
ATOM 2481 N N   . TYR A 1 319  ? 16.952  68.404 38.117  1.00 33.76  ? 316  TYR A N   1 
ATOM 2482 C CA  . TYR A 1 319  ? 16.498  69.772 38.197  1.00 33.76  ? 316  TYR A CA  1 
ATOM 2483 C C   . TYR A 1 319  ? 16.796  70.496 36.881  1.00 33.76  ? 316  TYR A C   1 
ATOM 2484 O O   . TYR A 1 319  ? 17.923  70.474 36.388  1.00 33.76  ? 316  TYR A O   1 
ATOM 2485 C CB  . TYR A 1 319  ? 17.078  70.535 39.388  1.00 40.46  ? 316  TYR A CB  1 
ATOM 2486 C CG  . TYR A 1 319  ? 16.299  71.823 39.642  1.00 40.46  ? 316  TYR A CG  1 
ATOM 2487 C CD1 . TYR A 1 319  ? 15.009  71.787 40.196  1.00 40.46  ? 316  TYR A CD1 1 
ATOM 2488 C CD2 . TYR A 1 319  ? 16.841  73.076 39.293  1.00 40.46  ? 316  TYR A CD2 1 
ATOM 2489 C CE1 . TYR A 1 319  ? 14.289  72.957 40.398  1.00 40.46  ? 316  TYR A CE1 1 
ATOM 2490 C CE2 . TYR A 1 319  ? 16.135  74.249 39.493  1.00 40.46  ? 316  TYR A CE2 1 
ATOM 2491 C CZ  . TYR A 1 319  ? 14.862  74.187 40.042  1.00 40.46  ? 316  TYR A CZ  1 
ATOM 2492 O OH  . TYR A 1 319  ? 14.157  75.356 40.225  1.00 40.46  ? 316  TYR A OH  1 
ATOM 2493 N N   . LEU A 1 320  ? 15.754  71.080 36.299  1.00 57.37  ? 317  LEU A N   1 
ATOM 2494 C CA  . LEU A 1 320  ? 15.893  71.860 35.084  1.00 57.37  ? 317  LEU A CA  1 
ATOM 2495 C C   . LEU A 1 320  ? 15.869  73.356 35.433  1.00 57.37  ? 317  LEU A C   1 
ATOM 2496 O O   . LEU A 1 320  ? 16.759  73.863 36.134  1.00 57.37  ? 317  LEU A O   1 
ATOM 2497 C CB  . LEU A 1 320  ? 14.790  71.503 34.086  1.00 42.06  ? 317  LEU A CB  1 
ATOM 2498 C CG  . LEU A 1 320  ? 14.570  70.073 33.544  1.00 42.06  ? 317  LEU A CG  1 
ATOM 2499 C CD1 . LEU A 1 320  ? 13.936  70.088 32.138  1.00 42.06  ? 317  LEU A CD1 1 
ATOM 2500 C CD2 . LEU A 1 320  ? 15.843  69.303 33.494  1.00 42.06  ? 317  LEU A CD2 1 
ATOM 2501 N N   . ASP A 1 321  ? 14.851  74.063 34.975  1.00 60.80  ? 318  ASP A N   1 
ATOM 2502 C CA  . ASP A 1 321  ? 14.767  75.470 35.282  1.00 60.80  ? 318  ASP A CA  1 
ATOM 2503 C C   . ASP A 1 321  ? 13.452  75.796 35.958  1.00 60.80  ? 318  ASP A C   1 
ATOM 2504 O O   . ASP A 1 321  ? 12.433  75.181 35.662  1.00 60.80  ? 318  ASP A O   1 
ATOM 2505 C CB  . ASP A 1 321  ? 14.916  76.296 34.006  1.00 122.02 ? 318  ASP A CB  1 
ATOM 2506 C CG  . ASP A 1 321  ? 15.633  77.609 34.242  1.00 122.02 ? 318  ASP A CG  1 
ATOM 2507 O OD1 . ASP A 1 321  ? 15.662  78.083 35.401  1.00 122.02 ? 318  ASP A OD1 1 
ATOM 2508 O OD2 . ASP A 1 321  ? 16.171  78.166 33.262  1.00 122.02 ? 318  ASP A OD2 1 
ATOM 2509 N N   . ASN A 1 322  ? 13.484  76.755 36.880  1.00 47.62  ? 319  ASN A N   1 
ATOM 2510 C CA  . ASN A 1 322  ? 12.262  77.366 37.377  1.00 47.62  ? 319  ASN A CA  1 
ATOM 2511 C C   . ASN A 1 322  ? 11.308  76.393 38.050  1.00 47.62  ? 319  ASN A C   1 
ATOM 2512 O O   . ASN A 1 322  ? 10.092  76.448 37.809  1.00 47.62  ? 319  ASN A O   1 
ATOM 2513 C CB  . ASN A 1 322  ? 11.541  78.085 36.227  1.00 66.74  ? 319  ASN A CB  1 
ATOM 2514 C CG  . ASN A 1 322  ? 12.345  79.253 35.668  1.00 66.74  ? 319  ASN A CG  1 
ATOM 2515 O OD1 . ASN A 1 322  ? 12.571  80.256 36.356  1.00 66.74  ? 319  ASN A OD1 1 
ATOM 2516 N ND2 . ASN A 1 322  ? 12.767  79.133 34.406  1.00 66.74  ? 319  ASN A ND2 1 
ATOM 2517 N N   . GLY A 1 323  ? 11.841  75.502 38.889  1.00 35.57  ? 320  GLY A N   1 
ATOM 2518 C CA  . GLY A 1 323  ? 10.986  74.513 39.591  1.00 35.57  ? 320  GLY A CA  1 
ATOM 2519 C C   . GLY A 1 323  ? 10.478  73.350 38.702  1.00 35.57  ? 320  GLY A C   1 
ATOM 2520 O O   . GLY A 1 323  ? 9.506   72.651 39.044  1.00 35.57  ? 320  GLY A O   1 
ATOM 2521 N N   . VAL A 1 324  ? 11.133  73.135 37.566  1.00 44.87  ? 321  VAL A N   1 
ATOM 2522 C CA  . VAL A 1 324  ? 10.773  72.029 36.742  1.00 44.87  ? 321  VAL A CA  1 
ATOM 2523 C C   . VAL A 1 324  ? 11.779  70.888 36.857  1.00 44.87  ? 321  VAL A C   1 
ATOM 2524 O O   . VAL A 1 324  ? 12.993  71.083 36.836  1.00 44.87  ? 321  VAL A O   1 
ATOM 2525 C CB  . VAL A 1 324  ? 10.537  72.474 35.332  1.00 50.73  ? 321  VAL A CB  1 
ATOM 2526 C CG1 . VAL A 1 324  ? 10.385  71.269 34.387  1.00 50.73  ? 321  VAL A CG1 1 
ATOM 2527 C CG2 . VAL A 1 324  ? 9.296   73.352 35.325  1.00 50.73  ? 321  VAL A CG2 1 
ATOM 2528 N N   . VAL A 1 325  ? 11.247  69.690 37.028  1.00 32.87  ? 322  VAL A N   1 
ATOM 2529 C CA  . VAL A 1 325  ? 12.073  68.523 37.213  1.00 32.87  ? 322  VAL A CA  1 
ATOM 2530 C C   . VAL A 1 325  ? 11.750  67.453 36.153  1.00 32.87  ? 322  VAL A C   1 
ATOM 2531 O O   . VAL A 1 325  ? 10.573  67.186 35.849  1.00 32.87  ? 322  VAL A O   1 
ATOM 2532 C CB  . VAL A 1 325  ? 11.921  67.959 38.626  1.00 27.88  ? 322  VAL A CB  1 
ATOM 2533 C CG1 . VAL A 1 325  ? 12.930  66.867 38.844  1.00 27.88  ? 322  VAL A CG1 1 
ATOM 2534 C CG2 . VAL A 1 325  ? 12.145  69.046 39.659  1.00 27.88  ? 322  VAL A CG2 1 
ATOM 2535 N N   . PHE A 1 326  ? 12.792  66.868 35.570  1.00 25.82  ? 323  PHE A N   1 
ATOM 2536 C CA  . PHE A 1 326  ? 12.543  65.684 34.763  1.00 25.82  ? 323  PHE A CA  1 
ATOM 2537 C C   . PHE A 1 326  ? 12.774  64.480 35.640  1.00 25.82  ? 323  PHE A C   1 
ATOM 2538 O O   . PHE A 1 326  ? 13.787  64.431 36.282  1.00 25.82  ? 323  PHE A O   1 
ATOM 2539 C CB  . PHE A 1 326  ? 13.405  65.620 33.495  1.00 27.00  ? 323  PHE A CB  1 
ATOM 2540 C CG  . PHE A 1 326  ? 13.256  64.324 32.735  1.00 27.00  ? 323  PHE A CG  1 
ATOM 2541 C CD1 . PHE A 1 326  ? 12.130  64.091 31.935  1.00 27.00  ? 323  PHE A CD1 1 
ATOM 2542 C CD2 . PHE A 1 326  ? 14.234  63.337 32.817  1.00 27.00  ? 323  PHE A CD2 1 
ATOM 2543 C CE1 . PHE A 1 326  ? 11.987  62.883 31.219  1.00 27.00  ? 323  PHE A CE1 1 
ATOM 2544 C CE2 . PHE A 1 326  ? 14.099  62.166 32.121  1.00 27.00  ? 323  PHE A CE2 1 
ATOM 2545 C CZ  . PHE A 1 326  ? 12.959  61.927 31.335  1.00 27.00  ? 323  PHE A CZ  1 
ATOM 2546 N N   . VAL A 1 327  ? 11.811  63.556 35.690  1.00 27.91  ? 324  VAL A N   1 
ATOM 2547 C CA  . VAL A 1 327  ? 11.921  62.316 36.469  1.00 27.91  ? 324  VAL A CA  1 
ATOM 2548 C C   . VAL A 1 327  ? 12.144  61.146 35.542  1.00 27.91  ? 324  VAL A C   1 
ATOM 2549 O O   . VAL A 1 327  ? 11.199  60.696 34.892  1.00 27.91  ? 324  VAL A O   1 
ATOM 2550 C CB  . VAL A 1 327  ? 10.624  62.010 37.226  1.00 28.76  ? 324  VAL A CB  1 
ATOM 2551 C CG1 . VAL A 1 327  ? 10.789  60.754 38.076  1.00 28.76  ? 324  VAL A CG1 1 
ATOM 2552 C CG2 . VAL A 1 327  ? 10.242  63.182 38.098  1.00 28.76  ? 324  VAL A CG2 1 
ATOM 2553 N N   . GLY A 1 328  ? 13.373  60.650 35.462  1.00 22.89  ? 325  GLY A N   1 
ATOM 2554 C CA  . GLY A 1 328  ? 13.647  59.503 34.579  1.00 22.89  ? 325  GLY A CA  1 
ATOM 2555 C C   . GLY A 1 328  ? 13.267  58.241 35.336  1.00 22.89  ? 325  GLY A C   1 
ATOM 2556 O O   . GLY A 1 328  ? 13.742  58.024 36.466  1.00 22.89  ? 325  GLY A O   1 
ATOM 2557 N N   . SER A 1 329  ? 12.387  57.429 34.759  1.00 25.63  ? 326  SER A N   1 
ATOM 2558 C CA  . SER A 1 329  ? 11.863  56.270 35.467  1.00 25.63  ? 326  SER A CA  1 
ATOM 2559 C C   . SER A 1 329  ? 12.176  55.010 34.699  1.00 25.63  ? 326  SER A C   1 
ATOM 2560 O O   . SER A 1 329  ? 12.164  54.993 33.472  1.00 25.63  ? 326  SER A O   1 
ATOM 2561 C CB  . SER A 1 329  ? 10.362  56.403 35.668  1.00 29.03  ? 326  SER A CB  1 
ATOM 2562 O OG  . SER A 1 329  ? 9.772   55.214 36.153  1.00 29.03  ? 326  SER A OG  1 
ATOM 2563 N N   . ARG A 1 330  ? 12.478  53.956 35.434  1.00 37.77  ? 327  ARG A N   1 
ATOM 2564 C CA  . ARG A 1 330  ? 12.819  52.674 34.857  1.00 37.77  ? 327  ARG A CA  1 
ATOM 2565 C C   . ARG A 1 330  ? 11.604  51.730 35.009  1.00 37.77  ? 327  ARG A C   1 
ATOM 2566 O O   . ARG A 1 330  ? 11.268  50.996 34.102  1.00 37.77  ? 327  ARG A O   1 
ATOM 2567 C CB  . ARG A 1 330  ? 14.008  52.155 35.640  1.00 30.79  ? 327  ARG A CB  1 
ATOM 2568 C CG  . ARG A 1 330  ? 14.822  51.162 34.970  1.00 30.79  ? 327  ARG A CG  1 
ATOM 2569 C CD  . ARG A 1 330  ? 16.083  50.796 35.777  1.00 30.79  ? 327  ARG A CD  1 
ATOM 2570 N NE  . ARG A 1 330  ? 15.839  49.938 36.923  1.00 30.79  ? 327  ARG A NE  1 
ATOM 2571 C CZ  . ARG A 1 330  ? 15.346  48.686 36.866  1.00 30.79  ? 327  ARG A CZ  1 
ATOM 2572 N NH1 . ARG A 1 330  ? 14.980  48.093 35.725  1.00 30.79  ? 327  ARG A NH1 1 
ATOM 2573 N NH2 . ARG A 1 330  ? 15.186  47.998 37.986  1.00 30.79  ? 327  ARG A NH2 1 
ATOM 2574 N N   . LEU A 1 331  ? 10.937  51.785 36.158  1.00 26.94  ? 328  LEU A N   1 
ATOM 2575 C CA  . LEU A 1 331  ? 9.844   50.896 36.478  1.00 26.94  ? 328  LEU A CA  1 
ATOM 2576 C C   . LEU A 1 331  ? 8.479   51.476 36.185  1.00 26.94  ? 328  LEU A C   1 
ATOM 2577 O O   . LEU A 1 331  ? 7.494   50.753 36.285  1.00 26.94  ? 328  LEU A O   1 
ATOM 2578 C CB  . LEU A 1 331  ? 9.890   50.525 37.954  1.00 11.96  ? 328  LEU A CB  1 
ATOM 2579 C CG  . LEU A 1 331  ? 11.234  49.996 38.480  1.00 11.96  ? 328  LEU A CG  1 
ATOM 2580 C CD1 . LEU A 1 331  ? 11.277  49.784 40.024  1.00 11.96  ? 328  LEU A CD1 1 
ATOM 2581 C CD2 . LEU A 1 331  ? 11.664  48.735 37.676  1.00 11.96  ? 328  LEU A CD2 1 
ATOM 2582 N N   . GLY A 1 332  ? 8.423   52.777 35.865  1.00 22.98  ? 329  GLY A N   1 
ATOM 2583 C CA  . GLY A 1 332  ? 7.183   53.474 35.502  1.00 22.98  ? 329  GLY A CA  1 
ATOM 2584 C C   . GLY A 1 332  ? 7.349   54.524 34.402  1.00 22.98  ? 329  GLY A C   1 
ATOM 2585 O O   . GLY A 1 332  ? 8.453   54.679 33.855  1.00 22.98  ? 329  GLY A O   1 
ATOM 2586 N N   . ASP A 1 333  ? 6.266   55.239 34.059  1.00 22.62  ? 330  ASP A N   1 
ATOM 2587 C CA  . ASP A 1 333  ? 6.354   56.241 33.017  1.00 22.62  ? 330  ASP A CA  1 
ATOM 2588 C C   . ASP A 1 333  ? 7.306   57.362 33.436  1.00 22.62  ? 330  ASP A C   1 
ATOM 2589 O O   . ASP A 1 333  ? 7.433   57.672 34.623  1.00 22.62  ? 330  ASP A O   1 
ATOM 2590 C CB  . ASP A 1 333  ? 4.988   56.797 32.695  1.00 37.52  ? 330  ASP A CB  1 
ATOM 2591 C CG  . ASP A 1 333  ? 4.263   56.011 31.597  1.00 37.52  ? 330  ASP A CG  1 
ATOM 2592 O OD1 . ASP A 1 333  ? 4.653   54.885 31.181  1.00 37.52  ? 330  ASP A OD1 1 
ATOM 2593 O OD2 . ASP A 1 333  ? 3.254   56.550 31.127  1.00 37.52  ? 330  ASP A OD2 1 
ATOM 2594 N N   . SER A 1 334  ? 8.011   57.971 32.492  1.00 22.35  ? 331  SER A N   1 
ATOM 2595 C CA  . SER A 1 334  ? 8.858   59.089 32.875  1.00 22.35  ? 331  SER A CA  1 
ATOM 2596 C C   . SER A 1 334  ? 7.953   60.340 32.982  1.00 22.35  ? 331  SER A C   1 
ATOM 2597 O O   . SER A 1 334  ? 6.737   60.280 32.632  1.00 22.35  ? 331  SER A O   1 
ATOM 2598 C CB  . SER A 1 334  ? 9.967   59.278 31.849  1.00 27.19  ? 331  SER A CB  1 
ATOM 2599 O OG  . SER A 1 334  ? 11.166  58.783 32.374  1.00 27.19  ? 331  SER A OG  1 
ATOM 2600 N N   . GLN A 1 335  ? 8.498   61.462 33.448  1.00 36.31  ? 332  GLN A N   1 
ATOM 2601 C CA  . GLN A 1 335  ? 7.653   62.624 33.616  1.00 36.31  ? 332  GLN A CA  1 
ATOM 2602 C C   . GLN A 1 335  ? 8.385   63.938 33.900  1.00 36.31  ? 332  GLN A C   1 
ATOM 2603 O O   . GLN A 1 335  ? 9.510   63.966 34.419  1.00 36.31  ? 332  GLN A O   1 
ATOM 2604 C CB  . GLN A 1 335  ? 6.569   62.333 34.669  1.00 28.09  ? 332  GLN A CB  1 
ATOM 2605 C CG  . GLN A 1 335  ? 7.035   62.357 36.089  1.00 28.09  ? 332  GLN A CG  1 
ATOM 2606 C CD  . GLN A 1 335  ? 6.122   61.613 37.070  1.00 28.09  ? 332  GLN A CD  1 
ATOM 2607 O OE1 . GLN A 1 335  ? 6.547   61.250 38.184  1.00 28.09  ? 332  GLN A OE1 1 
ATOM 2608 N NE2 . GLN A 1 335  ? 4.878   61.418 36.694  1.00 28.09  ? 332  GLN A NE2 1 
ATOM 2609 N N   . LEU A 1 336  ? 7.711   65.024 33.538  1.00 34.46  ? 333  LEU A N   1 
ATOM 2610 C CA  . LEU A 1 336  ? 8.140   66.384 33.846  1.00 34.46  ? 333  LEU A CA  1 
ATOM 2611 C C   . LEU A 1 336  ? 7.288   66.797 35.000  1.00 34.46  ? 333  LEU A C   1 
ATOM 2612 O O   . LEU A 1 336  ? 6.099   66.575 35.005  1.00 34.46  ? 333  LEU A O   1 
ATOM 2613 C CB  . LEU A 1 336  ? 7.831   67.300 32.674  1.00 34.10  ? 333  LEU A CB  1 
ATOM 2614 C CG  . LEU A 1 336  ? 8.972   68.094 32.084  1.00 34.10  ? 333  LEU A CG  1 
ATOM 2615 C CD1 . LEU A 1 336  ? 10.299  67.494 32.373  1.00 34.10  ? 333  LEU A CD1 1 
ATOM 2616 C CD2 . LEU A 1 336  ? 8.734   68.152 30.610  1.00 34.10  ? 333  LEU A CD2 1 
ATOM 2617 N N   . VAL A 1 337  ? 7.880   67.392 36.004  1.00 47.48  ? 334  VAL A N   1 
ATOM 2618 C CA  . VAL A 1 337  ? 7.116   67.652 37.194  1.00 47.48  ? 334  VAL A CA  1 
ATOM 2619 C C   . VAL A 1 337  ? 7.481   69.055 37.678  1.00 47.48  ? 334  VAL A C   1 
ATOM 2620 O O   . VAL A 1 337  ? 8.644   69.440 37.649  1.00 47.48  ? 334  VAL A O   1 
ATOM 2621 C CB  . VAL A 1 337  ? 7.348   66.503 38.206  1.00 52.02  ? 334  VAL A CB  1 
ATOM 2622 C CG1 . VAL A 1 337  ? 8.393   66.850 39.239  1.00 52.02  ? 334  VAL A CG1 1 
ATOM 2623 C CG2 . VAL A 1 337  ? 6.070   66.107 38.830  1.00 52.02  ? 334  VAL A CG2 1 
ATOM 2624 N N   . LYS A 1 338  ? 6.466   69.840 38.027  1.00 36.95  ? 335  LYS A N   1 
ATOM 2625 C CA  . LYS A 1 338  ? 6.655   71.204 38.503  1.00 36.95  ? 335  LYS A CA  1 
ATOM 2626 C C   . LYS A 1 338  ? 6.701   71.134 40.011  1.00 36.95  ? 335  LYS A C   1 
ATOM 2627 O O   . LYS A 1 338  ? 5.879   70.444 40.621  1.00 36.95  ? 335  LYS A O   1 
ATOM 2628 C CB  . LYS A 1 338  ? 5.519   72.118 38.029  1.00 85.29  ? 335  LYS A CB  1 
ATOM 2629 C CG  . LYS A 1 338  ? 5.415   73.465 38.758  1.00 85.29  ? 335  LYS A CG  1 
ATOM 2630 C CD  . LYS A 1 338  ? 6.579   74.446 38.446  1.00 85.29  ? 335  LYS A CD  1 
ATOM 2631 C CE  . LYS A 1 338  ? 6.294   75.335 37.213  1.00 85.29  ? 335  LYS A CE  1 
ATOM 2632 N NZ  . LYS A 1 338  ? 4.940   76.018 37.279  1.00 85.29  ? 335  LYS A NZ  1 
ATOM 2633 N N   . LEU A 1 339  ? 7.683   71.810 40.598  1.00 40.13  ? 336  LEU A N   1 
ATOM 2634 C CA  . LEU A 1 339  ? 7.778   71.931 42.043  1.00 40.13  ? 336  LEU A CA  1 
ATOM 2635 C C   . LEU A 1 339  ? 7.244   73.276 42.468  1.00 40.13  ? 336  LEU A C   1 
ATOM 2636 O O   . LEU A 1 339  ? 7.651   74.306 41.940  1.00 40.13  ? 336  LEU A O   1 
ATOM 2637 C CB  . LEU A 1 339  ? 9.224   71.804 42.516  1.00 30.44  ? 336  LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 339  ? 9.925   70.456 42.351  1.00 30.44  ? 336  LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 339  ? 11.087  70.396 43.309  1.00 30.44  ? 336  LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 339  ? 8.976   69.260 42.580  1.00 30.44  ? 336  LEU A CD2 1 
ATOM 2641 N N   . ASN A 1 340  ? 6.340   73.269 43.440  1.00 44.75  ? 337  ASN A N   1 
ATOM 2642 C CA  . ASN A 1 340  ? 5.721   74.499 43.897  1.00 44.75  ? 337  ASN A CA  1 
ATOM 2643 C C   . ASN A 1 340  ? 6.200   74.887 45.260  1.00 44.75  ? 337  ASN A C   1 
ATOM 2644 O O   . ASN A 1 340  ? 6.621   74.035 46.023  1.00 44.75  ? 337  ASN A O   1 
ATOM 2645 C CB  . ASN A 1 340  ? 4.211   74.345 43.900  1.00 30.31  ? 337  ASN A CB  1 
ATOM 2646 C CG  . ASN A 1 340  ? 3.636   74.369 42.513  1.00 30.31  ? 337  ASN A CG  1 
ATOM 2647 O OD1 . ASN A 1 340  ? 4.124   75.066 41.618  1.00 30.31  ? 337  ASN A OD1 1 
ATOM 2648 N ND2 . ASN A 1 340  ? 2.588   73.597 42.316  1.00 30.31  ? 337  ASN A ND2 1 
ATOM 2649 N N   . VAL A 1 341  ? 6.126   76.178 45.566  1.00 43.42  ? 338  VAL A N   1 
ATOM 2650 C CA  . VAL A 1 341  ? 6.483   76.665 46.897  1.00 43.42  ? 338  VAL A CA  1 
ATOM 2651 C C   . VAL A 1 341  ? 5.404   76.294 47.883  1.00 43.42  ? 338  VAL A C   1 
ATOM 2652 O O   . VAL A 1 341  ? 5.690   75.732 48.931  1.00 43.42  ? 338  VAL A O   1 
ATOM 2653 C CB  . VAL A 1 341  ? 6.647   78.175 46.934  1.00 35.21  ? 338  VAL A CB  1 
ATOM 2654 C CG1 . VAL A 1 341  ? 7.119   78.599 48.333  1.00 35.21  ? 338  VAL A CG1 1 
ATOM 2655 C CG2 . VAL A 1 341  ? 7.592   78.626 45.810  1.00 35.21  ? 338  VAL A CG2 1 
ATOM 2656 N N   . ASP A 1 342  ? 4.165   76.626 47.538  1.00 45.87  ? 339  ASP A N   1 
ATOM 2657 C CA  . ASP A 1 342  ? 3.029   76.284 48.385  1.00 45.87  ? 339  ASP A CA  1 
ATOM 2658 C C   . ASP A 1 342  ? 2.544   74.857 48.074  1.00 45.87  ? 339  ASP A C   1 
ATOM 2659 O O   . ASP A 1 342  ? 2.510   74.436 46.915  1.00 45.87  ? 339  ASP A O   1 
ATOM 2660 C CB  . ASP A 1 342  ? 1.886   77.305 48.199  1.00 38.79  ? 339  ASP A CB  1 
ATOM 2661 C CG  . ASP A 1 342  ? 2.329   78.760 48.434  1.00 38.79  ? 339  ASP A CG  1 
ATOM 2662 O OD1 . ASP A 1 342  ? 2.761   79.086 49.569  1.00 38.79  ? 339  ASP A OD1 1 
ATOM 2663 O OD2 . ASP A 1 342  ? 2.225   79.578 47.489  1.00 38.79  ? 339  ASP A OD2 1 
ATOM 2664 N N   . SER A 1 343  ? 2.181   74.113 49.110  1.00 45.82  ? 340  SER A N   1 
ATOM 2665 C CA  . SER A 1 343  ? 1.678   72.762 48.931  1.00 45.82  ? 340  SER A CA  1 
ATOM 2666 C C   . SER A 1 343  ? 0.258   72.890 48.459  1.00 45.82  ? 340  SER A C   1 
ATOM 2667 O O   . SER A 1 343  ? -0.499  73.607 49.080  1.00 45.82  ? 340  SER A O   1 
ATOM 2668 C CB  . SER A 1 343  ? 1.663   72.060 50.272  1.00 31.81  ? 340  SER A CB  1 
ATOM 2669 O OG  . SER A 1 343  ? 0.568   72.531 51.026  1.00 31.81  ? 340  SER A OG  1 
ATOM 2670 N N   . ASN A 1 344  ? -0.127  72.208 47.387  1.00 65.95  ? 341  ASN A N   1 
ATOM 2671 C CA  . ASN A 1 344  ? -1.507  72.299 46.896  1.00 65.95  ? 341  ASN A CA  1 
ATOM 2672 C C   . ASN A 1 344  ? -2.515  71.467 47.707  1.00 65.95  ? 341  ASN A C   1 
ATOM 2673 O O   . ASN A 1 344  ? -2.265  71.114 48.865  1.00 65.95  ? 341  ASN A O   1 
ATOM 2674 C CB  . ASN A 1 344  ? -1.578  71.954 45.399  1.00 77.58  ? 341  ASN A CB  1 
ATOM 2675 C CG  . ASN A 1 344  ? -1.577  70.435 45.121  1.00 77.58  ? 341  ASN A CG  1 
ATOM 2676 O OD1 . ASN A 1 344  ? -1.163  69.615 45.955  1.00 77.58  ? 341  ASN A OD1 1 
ATOM 2677 N ND2 . ASN A 1 344  ? -2.040  70.068 43.931  1.00 77.58  ? 341  ASN A ND2 1 
ATOM 2678 N N   . GLU A 1 345  ? -3.661  71.189 47.086  1.00 68.63  ? 342  GLU A N   1 
ATOM 2679 C CA  . GLU A 1 345  ? -4.583  70.133 47.497  1.00 68.63  ? 342  GLU A CA  1 
ATOM 2680 C C   . GLU A 1 345  ? -3.818  68.814 47.752  1.00 68.63  ? 342  GLU A C   1 
ATOM 2681 O O   . GLU A 1 345  ? -2.696  68.617 47.246  1.00 68.63  ? 342  GLU A O   1 
ATOM 2682 C CB  . GLU A 1 345  ? -5.602  69.946 46.380  1.00 143.86 ? 342  GLU A CB  1 
ATOM 2683 C CG  . GLU A 1 345  ? -6.873  69.226 46.757  1.00 143.86 ? 342  GLU A CG  1 
ATOM 2684 C CD  . GLU A 1 345  ? -7.926  69.347 45.674  1.00 143.86 ? 342  GLU A CD  1 
ATOM 2685 O OE1 . GLU A 1 345  ? -8.915  68.588 45.714  1.00 143.86 ? 342  GLU A OE1 1 
ATOM 2686 O OE2 . GLU A 1 345  ? -7.763  70.204 44.778  1.00 143.86 ? 342  GLU A OE2 1 
ATOM 2687 N N   . GLN A 1 346  ? -4.409  67.913 48.538  1.00 76.83  ? 343  GLN A N   1 
ATOM 2688 C CA  . GLN A 1 346  ? -3.734  66.657 48.923  1.00 76.83  ? 343  GLN A CA  1 
ATOM 2689 C C   . GLN A 1 346  ? -2.441  66.913 49.697  1.00 76.83  ? 343  GLN A C   1 
ATOM 2690 O O   . GLN A 1 346  ? -1.877  65.990 50.288  1.00 76.83  ? 343  GLN A O   1 
ATOM 2691 C CB  . GLN A 1 346  ? -3.437  65.759 47.712  1.00 104.42 ? 343  GLN A CB  1 
ATOM 2692 C CG  . GLN A 1 346  ? -4.654  65.346 46.884  1.00 104.42 ? 343  GLN A CG  1 
ATOM 2693 C CD  . GLN A 1 346  ? -4.752  66.070 45.545  1.00 104.42 ? 343  GLN A CD  1 
ATOM 2694 O OE1 . GLN A 1 346  ? -4.302  67.203 45.394  1.00 104.42 ? 343  GLN A OE1 1 
ATOM 2695 N NE2 . GLN A 1 346  ? -5.354  65.408 44.566  1.00 104.42 ? 343  GLN A NE2 1 
ATOM 2696 N N   . GLY A 1 347  ? -1.981  68.166 49.687  1.00 45.78  ? 344  GLY A N   1 
ATOM 2697 C CA  . GLY A 1 347  ? -0.794  68.577 50.438  1.00 45.78  ? 344  GLY A CA  1 
ATOM 2698 C C   . GLY A 1 347  ? 0.491   68.210 49.731  1.00 45.78  ? 344  GLY A C   1 
ATOM 2699 O O   . GLY A 1 347  ? 1.452   67.805 50.379  1.00 45.78  ? 344  GLY A O   1 
ATOM 2700 N N   . SER A 1 348  ? 0.498   68.363 48.403  1.00 55.69  ? 345  SER A N   1 
ATOM 2701 C CA  . SER A 1 348  ? 1.664   68.035 47.581  1.00 55.69  ? 345  SER A CA  1 
ATOM 2702 C C   . SER A 1 348  ? 2.362   69.267 46.968  1.00 55.69  ? 345  SER A C   1 
ATOM 2703 O O   . SER A 1 348  ? 1.708   70.179 46.443  1.00 55.69  ? 345  SER A O   1 
ATOM 2704 C CB  . SER A 1 348  ? 1.276   67.037 46.484  1.00 43.61  ? 345  SER A CB  1 
ATOM 2705 O OG  . SER A 1 348  ? 2.265   66.948 45.462  1.00 43.61  ? 345  SER A OG  1 
ATOM 2706 N N   . TYR A 1 349  ? 3.698   69.265 47.029  1.00 32.02  ? 346  TYR A N   1 
ATOM 2707 C CA  . TYR A 1 349  ? 4.503   70.336 46.457  1.00 32.02  ? 346  TYR A CA  1 
ATOM 2708 C C   . TYR A 1 349  ? 4.818   70.036 45.015  1.00 32.02  ? 346  TYR A C   1 
ATOM 2709 O O   . TYR A 1 349  ? 5.359   70.895 44.280  1.00 32.02  ? 346  TYR A O   1 
ATOM 2710 C CB  . TYR A 1 349  ? 5.774   70.516 47.254  1.00 41.70  ? 346  TYR A CB  1 
ATOM 2711 C CG  . TYR A 1 349  ? 5.473   71.016 48.640  1.00 41.70  ? 346  TYR A CG  1 
ATOM 2712 C CD1 . TYR A 1 349  ? 5.253   70.131 49.681  1.00 41.70  ? 346  TYR A CD1 1 
ATOM 2713 C CD2 . TYR A 1 349  ? 5.381   72.382 48.903  1.00 41.70  ? 346  TYR A CD2 1 
ATOM 2714 C CE1 . TYR A 1 349  ? 4.970   70.582 50.937  1.00 41.70  ? 346  TYR A CE1 1 
ATOM 2715 C CE2 . TYR A 1 349  ? 5.107   72.846 50.171  1.00 41.70  ? 346  TYR A CE2 1 
ATOM 2716 C CZ  . TYR A 1 349  ? 4.902   71.939 51.183  1.00 41.70  ? 346  TYR A CZ  1 
ATOM 2717 O OH  . TYR A 1 349  ? 4.613   72.383 52.446  1.00 41.70  ? 346  TYR A OH  1 
ATOM 2718 N N   . VAL A 1 350  ? 4.456   68.808 44.623  1.00 47.98  ? 347  VAL A N   1 
ATOM 2719 C CA  . VAL A 1 350  ? 4.784   68.261 43.317  1.00 47.98  ? 347  VAL A CA  1 
ATOM 2720 C C   . VAL A 1 350  ? 3.528   68.139 42.469  1.00 47.98  ? 347  VAL A C   1 
ATOM 2721 O O   . VAL A 1 350  ? 2.527   67.539 42.884  1.00 47.98  ? 347  VAL A O   1 
ATOM 2722 C CB  . VAL A 1 350  ? 5.488   66.861 43.405  1.00 32.79  ? 347  VAL A CB  1 
ATOM 2723 C CG1 . VAL A 1 350  ? 6.181   66.573 42.133  1.00 32.79  ? 347  VAL A CG1 1 
ATOM 2724 C CG2 . VAL A 1 350  ? 6.505   66.782 44.545  1.00 32.79  ? 347  VAL A CG2 1 
ATOM 2725 N N   . VAL A 1 351  ? 3.585   68.721 41.281  1.00 38.23  ? 348  VAL A N   1 
ATOM 2726 C CA  . VAL A 1 351  ? 2.491   68.646 40.336  1.00 38.23  ? 348  VAL A CA  1 
ATOM 2727 C C   . VAL A 1 351  ? 3.047   68.225 38.989  1.00 38.23  ? 348  VAL A C   1 
ATOM 2728 O O   . VAL A 1 351  ? 4.015   68.825 38.497  1.00 38.23  ? 348  VAL A O   1 
ATOM 2729 C CB  . VAL A 1 351  ? 1.822   70.017 40.164  1.00 38.93  ? 348  VAL A CB  1 
ATOM 2730 C CG1 . VAL A 1 351  ? 0.646   69.939 39.136  1.00 38.93  ? 348  VAL A CG1 1 
ATOM 2731 C CG2 . VAL A 1 351  ? 1.372   70.564 41.529  1.00 38.93  ? 348  VAL A CG2 1 
ATOM 2732 N N   . ALA A 1 352  ? 2.426   67.218 38.381  1.00 44.89  ? 349  ALA A N   1 
ATOM 2733 C CA  . ALA A 1 352  ? 2.923   66.665 37.130  1.00 44.89  ? 349  ALA A CA  1 
ATOM 2734 C C   . ALA A 1 352  ? 2.480   67.527 35.961  1.00 44.89  ? 349  ALA A C   1 
ATOM 2735 O O   . ALA A 1 352  ? 1.332   67.920 35.892  1.00 44.89  ? 349  ALA A O   1 
ATOM 2736 C CB  . ALA A 1 352  ? 2.445   65.237 36.962  1.00 6.39   ? 349  ALA A CB  1 
ATOM 2737 N N   . MET A 1 353  ? 3.412   67.840 35.068  1.00 39.95  ? 350  MET A N   1 
ATOM 2738 C CA  . MET A 1 353  ? 3.112   68.583 33.861  1.00 39.95  ? 350  MET A CA  1 
ATOM 2739 C C   . MET A 1 353  ? 3.000   67.617 32.711  1.00 39.95  ? 350  MET A C   1 
ATOM 2740 O O   . MET A 1 353  ? 2.050   67.683 31.933  1.00 39.95  ? 350  MET A O   1 
ATOM 2741 C CB  . MET A 1 353  ? 4.202   69.600 33.556  1.00 57.04  ? 350  MET A CB  1 
ATOM 2742 C CG  . MET A 1 353  ? 4.512   70.564 34.691  1.00 57.04  ? 350  MET A CG  1 
ATOM 2743 S SD  . MET A 1 353  ? 6.143   71.337 34.505  1.00 57.04  ? 350  MET A SD  1 
ATOM 2744 C CE  . MET A 1 353  ? 6.016   72.110 32.871  1.00 57.04  ? 350  MET A CE  1 
ATOM 2745 N N   . GLU A 1 354  ? 3.976   66.718 32.588  1.00 43.32  ? 351  GLU A N   1 
ATOM 2746 C CA  . GLU A 1 354  ? 4.015   65.783 31.465  1.00 43.32  ? 351  GLU A CA  1 
ATOM 2747 C C   . GLU A 1 354  ? 4.375   64.347 31.869  1.00 43.32  ? 351  GLU A C   1 
ATOM 2748 O O   . GLU A 1 354  ? 5.050   64.135 32.870  1.00 43.32  ? 351  GLU A O   1 
ATOM 2749 C CB  . GLU A 1 354  ? 4.931   66.300 30.362  1.00 61.09  ? 351  GLU A CB  1 
ATOM 2750 C CG  . GLU A 1 354  ? 4.586   65.700 29.033  1.00 61.09  ? 351  GLU A CG  1 
ATOM 2751 C CD  . GLU A 1 354  ? 5.329   66.324 27.882  1.00 61.09  ? 351  GLU A CD  1 
ATOM 2752 O OE1 . GLU A 1 354  ? 6.219   67.173 28.097  1.00 61.09  ? 351  GLU A OE1 1 
ATOM 2753 O OE2 . GLU A 1 354  ? 5.019   65.945 26.738  1.00 61.09  ? 351  GLU A OE2 1 
ATOM 2754 N N   . THR A 1 355  ? 3.918   63.379 31.070  1.00 35.29  ? 352  THR A N   1 
ATOM 2755 C CA  . THR A 1 355  ? 4.097   61.947 31.342  1.00 35.29  ? 352  THR A CA  1 
ATOM 2756 C C   . THR A 1 355  ? 4.638   61.213 30.132  1.00 35.29  ? 352  THR A C   1 
ATOM 2757 O O   . THR A 1 355  ? 4.050   61.300 29.077  1.00 35.29  ? 352  THR A O   1 
ATOM 2758 C CB  . THR A 1 355  ? 2.738   61.354 31.630  1.00 34.68  ? 352  THR A CB  1 
ATOM 2759 O OG1 . THR A 1 355  ? 2.300   61.837 32.903  1.00 34.68  ? 352  THR A OG1 1 
ATOM 2760 C CG2 . THR A 1 355  ? 2.808   59.842 31.626  1.00 34.68  ? 352  THR A CG2 1 
ATOM 2761 N N   . PHE A 1 356  ? 5.738   60.483 30.260  1.00 34.77  ? 353  PHE A N   1 
ATOM 2762 C CA  . PHE A 1 356  ? 6.269   59.753 29.098  1.00 34.77  ? 353  PHE A CA  1 
ATOM 2763 C C   . PHE A 1 356  ? 6.185   58.241 29.199  1.00 34.77  ? 353  PHE A C   1 
ATOM 2764 O O   . PHE A 1 356  ? 6.665   57.638 30.155  1.00 34.77  ? 353  PHE A O   1 
ATOM 2765 C CB  . PHE A 1 356  ? 7.677   60.178 28.769  1.00 40.90  ? 353  PHE A CB  1 
ATOM 2766 C CG  . PHE A 1 356  ? 7.859   61.650 28.756  1.00 40.90  ? 353  PHE A CG  1 
ATOM 2767 C CD1 . PHE A 1 356  ? 8.372   62.308 29.883  1.00 40.90  ? 353  PHE A CD1 1 
ATOM 2768 C CD2 . PHE A 1 356  ? 7.507   62.392 27.632  1.00 40.90  ? 353  PHE A CD2 1 
ATOM 2769 C CE1 . PHE A 1 356  ? 8.541   63.689 29.880  1.00 40.90  ? 353  PHE A CE1 1 
ATOM 2770 C CE2 . PHE A 1 356  ? 7.665   63.772 27.619  1.00 40.90  ? 353  PHE A CE2 1 
ATOM 2771 C CZ  . PHE A 1 356  ? 8.182   64.428 28.736  1.00 40.90  ? 353  PHE A CZ  1 
ATOM 2772 N N   . THR A 1 357  ? 5.555   57.669 28.184  1.00 37.37  ? 354  THR A N   1 
ATOM 2773 C CA  . THR A 1 357  ? 5.278   56.274 28.046  1.00 37.37  ? 354  THR A CA  1 
ATOM 2774 C C   . THR A 1 357  ? 6.505   55.402 28.230  1.00 37.37  ? 354  THR A C   1 
ATOM 2775 O O   . THR A 1 357  ? 7.457   55.490 27.462  1.00 37.37  ? 354  THR A O   1 
ATOM 2776 C CB  . THR A 1 357  ? 4.648   56.034 26.658  1.00 42.15  ? 354  THR A CB  1 
ATOM 2777 O OG1 . THR A 1 357  ? 3.226   56.135 26.767  1.00 42.15  ? 354  THR A OG1 1 
ATOM 2778 C CG2 . THR A 1 357  ? 4.989   54.680 26.098  1.00 42.15  ? 354  THR A CG2 1 
ATOM 2779 N N   . ASN A 1 358  ? 6.485   54.565 29.265  1.00 19.29  ? 355  ASN A N   1 
ATOM 2780 C CA  . ASN A 1 358  ? 7.479   53.498 29.393  1.00 19.29  ? 355  ASN A CA  1 
ATOM 2781 C C   . ASN A 1 358  ? 6.800   52.160 29.413  1.00 19.29  ? 355  ASN A C   1 
ATOM 2782 O O   . ASN A 1 358  ? 6.005   51.895 30.308  1.00 19.29  ? 355  ASN A O   1 
ATOM 2783 C CB  . ASN A 1 358  ? 8.278   53.606 30.685  1.00 28.05  ? 355  ASN A CB  1 
ATOM 2784 C CG  . ASN A 1 358  ? 9.378   52.572 30.744  1.00 28.05  ? 355  ASN A CG  1 
ATOM 2785 O OD1 . ASN A 1 358  ? 9.689   51.917 29.738  1.00 28.05  ? 355  ASN A OD1 1 
ATOM 2786 N ND2 . ASN A 1 358  ? 9.977   52.413 31.910  1.00 28.05  ? 355  ASN A ND2 1 
ATOM 2787 N N   . LEU A 1 359  ? 7.127   51.291 28.463  1.00 24.93  ? 356  LEU A N   1 
ATOM 2788 C CA  . LEU A 1 359  ? 6.610   49.901 28.542  1.00 24.93  ? 356  LEU A CA  1 
ATOM 2789 C C   . LEU A 1 359  ? 7.260   49.133 29.682  1.00 24.93  ? 356  LEU A C   1 
ATOM 2790 O O   . LEU A 1 359  ? 7.081   47.945 29.783  1.00 24.93  ? 356  LEU A O   1 
ATOM 2791 C CB  . LEU A 1 359  ? 6.697   49.148 27.202  1.00 12.77  ? 356  LEU A CB  1 
ATOM 2792 C CG  . LEU A 1 359  ? 5.999   49.937 26.117  1.00 12.77  ? 356  LEU A CG  1 
ATOM 2793 C CD1 . LEU A 1 359  ? 6.094   49.179 24.826  1.00 12.77  ? 356  LEU A CD1 1 
ATOM 2794 C CD2 . LEU A 1 359  ? 4.531   50.230 26.447  1.00 12.77  ? 356  LEU A CD2 1 
ATOM 2795 N N   . GLY A 1 360  ? 7.989   49.862 30.534  1.00 46.17  ? 357  GLY A N   1 
ATOM 2796 C CA  . GLY A 1 360  ? 8.395   49.451 31.908  1.00 46.17  ? 357  GLY A CA  1 
ATOM 2797 C C   . GLY A 1 360  ? 9.233   48.267 31.680  1.00 46.17  ? 357  GLY A C   1 
ATOM 2798 O O   . GLY A 1 360  ? 9.641   48.075 30.560  1.00 46.17  ? 357  GLY A O   1 
ATOM 2799 N N   . PRO A 1 361  ? 9.505   47.471 32.717  1.00 23.46  ? 358  PRO A N   1 
ATOM 2800 C CA  . PRO A 1 361  ? 9.874   46.086 32.422  1.00 23.46  ? 358  PRO A CA  1 
ATOM 2801 C C   . PRO A 1 361  ? 8.655   45.351 31.877  1.00 23.46  ? 358  PRO A C   1 
ATOM 2802 O O   . PRO A 1 361  ? 7.648   45.247 32.557  1.00 23.46  ? 358  PRO A O   1 
ATOM 2803 C CB  . PRO A 1 361  ? 10.276  45.507 33.792  1.00 16.90  ? 358  PRO A CB  1 
ATOM 2804 C CG  . PRO A 1 361  ? 10.411  46.574 34.689  1.00 16.90  ? 358  PRO A CG  1 
ATOM 2805 C CD  . PRO A 1 361  ? 9.564   47.731 34.159  1.00 16.90  ? 358  PRO A CD  1 
ATOM 2806 N N   . ILE A 1 362  ? 8.719   44.883 30.642  1.00 25.61  ? 359  ILE A N   1 
ATOM 2807 C CA  . ILE A 1 362  ? 7.716   43.950 30.175  1.00 25.61  ? 359  ILE A CA  1 
ATOM 2808 C C   . ILE A 1 362  ? 7.978   42.626 30.916  1.00 25.61  ? 359  ILE A C   1 
ATOM 2809 O O   . ILE A 1 362  ? 8.976   41.946 30.658  1.00 25.61  ? 359  ILE A O   1 
ATOM 2810 C CB  . ILE A 1 362  ? 7.816   43.773 28.681  1.00 17.97  ? 359  ILE A CB  1 
ATOM 2811 C CG1 . ILE A 1 362  ? 7.757   45.156 28.012  1.00 17.97  ? 359  ILE A CG1 1 
ATOM 2812 C CG2 . ILE A 1 362  ? 6.757   42.812 28.196  1.00 17.97  ? 359  ILE A CG2 1 
ATOM 2813 C CD1 . ILE A 1 362  ? 7.592   45.213 26.500  1.00 17.97  ? 359  ILE A CD1 1 
ATOM 2814 N N   . VAL A 1 363  ? 7.117   42.314 31.884  1.00 22.49  ? 360  VAL A N   1 
ATOM 2815 C CA  . VAL A 1 363  ? 7.313   41.157 32.763  1.00 22.49  ? 360  VAL A CA  1 
ATOM 2816 C C   . VAL A 1 363  ? 6.779   39.898 32.105  1.00 22.49  ? 360  VAL A C   1 
ATOM 2817 O O   . VAL A 1 363  ? 7.372   38.874 32.193  1.00 22.49  ? 360  VAL A O   1 
ATOM 2818 C CB  . VAL A 1 363  ? 6.631   41.383 34.148  1.00 19.30  ? 360  VAL A CB  1 
ATOM 2819 C CG1 . VAL A 1 363  ? 6.318   40.097 34.826  1.00 19.30  ? 360  VAL A CG1 1 
ATOM 2820 C CG2 . VAL A 1 363  ? 7.485   42.290 35.048  1.00 19.30  ? 360  VAL A CG2 1 
ATOM 2821 N N   . ASP A 1 364  ? 5.667   40.002 31.412  1.00 21.49  ? 361  ASP A N   1 
ATOM 2822 C CA  . ASP A 1 364  ? 5.052   38.906 30.675  1.00 21.49  ? 361  ASP A CA  1 
ATOM 2823 C C   . ASP A 1 364  ? 4.100   39.575 29.642  1.00 21.49  ? 361  ASP A C   1 
ATOM 2824 O O   . ASP A 1 364  ? 3.730   40.746 29.800  1.00 21.49  ? 361  ASP A O   1 
ATOM 2825 C CB  . ASP A 1 364  ? 4.279   38.059 31.670  1.00 37.74  ? 361  ASP A CB  1 
ATOM 2826 C CG  . ASP A 1 364  ? 3.464   36.971 31.029  1.00 37.74  ? 361  ASP A CG  1 
ATOM 2827 O OD1 . ASP A 1 364  ? 3.687   36.626 29.849  1.00 37.74  ? 361  ASP A OD1 1 
ATOM 2828 O OD2 . ASP A 1 364  ? 2.597   36.431 31.736  1.00 37.74  ? 361  ASP A OD2 1 
ATOM 2829 N N   . MET A 1 365  ? 3.716   38.865 28.586  1.00 24.34  ? 362  MET A N   1 
ATOM 2830 C CA  . MET A 1 365  ? 2.813   39.435 27.574  1.00 24.34  ? 362  MET A CA  1 
ATOM 2831 C C   . MET A 1 365  ? 2.096   38.350 26.769  1.00 24.34  ? 362  MET A C   1 
ATOM 2832 O O   . MET A 1 365  ? 2.388   37.187 26.935  1.00 24.34  ? 362  MET A O   1 
ATOM 2833 C CB  . MET A 1 365  ? 3.599   40.352 26.626  1.00 30.97  ? 362  MET A CB  1 
ATOM 2834 C CG  . MET A 1 365  ? 4.508   39.608 25.665  1.00 30.97  ? 362  MET A CG  1 
ATOM 2835 S SD  . MET A 1 365  ? 5.785   40.646 24.953  1.00 30.97  ? 362  MET A SD  1 
ATOM 2836 C CE  . MET A 1 365  ? 6.294   39.708 23.521  1.00 30.97  ? 362  MET A CE  1 
ATOM 2837 N N   . CYS A 1 366  ? 1.179   38.734 25.883  1.00 32.69  ? 363  CYS A N   1 
ATOM 2838 C CA  . CYS A 1 366  ? 0.629   37.807 24.899  1.00 32.69  ? 363  CYS A CA  1 
ATOM 2839 C C   . CYS A 1 366  ? -0.054  38.558 23.762  1.00 32.69  ? 363  CYS A C   1 
ATOM 2840 O O   . CYS A 1 366  ? -0.511  39.680 23.981  1.00 32.69  ? 363  CYS A O   1 
ATOM 2841 C CB  . CYS A 1 366  ? -0.332  36.831 25.553  1.00 43.99  ? 363  CYS A CB  1 
ATOM 2842 S SG  . CYS A 1 366  ? -1.766  37.626 26.119  1.00 43.99  ? 363  CYS A SG  1 
ATOM 2843 N N   . VAL A 1 367  ? -0.124  37.955 22.563  1.00 35.62  ? 364  VAL A N   1 
ATOM 2844 C CA  . VAL A 1 367  ? -0.765  38.601 21.395  1.00 35.62  ? 364  VAL A CA  1 
ATOM 2845 C C   . VAL A 1 367  ? -2.248  38.265 21.190  1.00 35.62  ? 364  VAL A C   1 
ATOM 2846 O O   . VAL A 1 367  ? -2.636  37.100 21.017  1.00 35.62  ? 364  VAL A O   1 
ATOM 2847 C CB  . VAL A 1 367  ? -0.022  38.285 20.081  1.00 25.87  ? 364  VAL A CB  1 
ATOM 2848 C CG1 . VAL A 1 367  ? -0.810  38.775 18.889  1.00 25.87  ? 364  VAL A CG1 1 
ATOM 2849 C CG2 . VAL A 1 367  ? 1.327   38.936 20.080  1.00 25.87  ? 364  VAL A CG2 1 
ATOM 2850 N N   . VAL A 1 368  ? -3.094  39.275 21.154  1.00 41.64  ? 365  VAL A N   1 
ATOM 2851 C CA  . VAL A 1 368  ? -4.479  38.978 20.874  1.00 41.64  ? 365  VAL A CA  1 
ATOM 2852 C C   . VAL A 1 368  ? -5.033  39.783 19.721  1.00 41.64  ? 365  VAL A C   1 
ATOM 2853 O O   . VAL A 1 368  ? -4.855  41.002 19.666  1.00 41.64  ? 365  VAL A O   1 
ATOM 2854 C CB  . VAL A 1 368  ? -5.329  39.188 22.116  1.00 29.82  ? 365  VAL A CB  1 
ATOM 2855 C CG1 . VAL A 1 368  ? -6.840  39.107 21.793  1.00 29.82  ? 365  VAL A CG1 1 
ATOM 2856 C CG2 . VAL A 1 368  ? -4.933  38.155 23.153  1.00 29.82  ? 365  VAL A CG2 1 
ATOM 2857 N N   . ASP A 1 369  ? -5.713  39.091 18.801  1.00 73.71  ? 366  ASP A N   1 
ATOM 2858 C CA  . ASP A 1 369  ? -6.535  39.756 17.790  1.00 73.71  ? 366  ASP A CA  1 
ATOM 2859 C C   . ASP A 1 369  ? -7.676  40.452 18.524  1.00 73.71  ? 366  ASP A C   1 
ATOM 2860 O O   . ASP A 1 369  ? -8.775  39.923 18.632  1.00 73.71  ? 366  ASP A O   1 
ATOM 2861 C CB  . ASP A 1 369  ? -7.046  38.751 16.753  1.00 106.08 ? 366  ASP A CB  1 
ATOM 2862 C CG  . ASP A 1 369  ? -6.018  38.451 15.659  1.00 106.08 ? 366  ASP A CG  1 
ATOM 2863 O OD1 . ASP A 1 369  ? -4.833  38.802 15.826  1.00 106.08 ? 366  ASP A OD1 1 
ATOM 2864 O OD2 . ASP A 1 369  ? -6.395  37.864 14.621  1.00 106.08 ? 366  ASP A OD2 1 
ATOM 2865 N N   . LEU A 1 370  ? -7.392  41.639 19.051  1.00 125.32 ? 367  LEU A N   1 
ATOM 2866 C CA  . LEU A 1 370  ? -8.253  42.244 20.063  1.00 125.32 ? 367  LEU A CA  1 
ATOM 2867 C C   . LEU A 1 370  ? -9.643  42.628 19.597  1.00 125.32 ? 367  LEU A C   1 
ATOM 2868 O O   . LEU A 1 370  ? -10.637 42.195 20.187  1.00 125.32 ? 367  LEU A O   1 
ATOM 2869 C CB  . LEU A 1 370  ? -7.567  43.425 20.753  1.00 59.97  ? 367  LEU A CB  1 
ATOM 2870 C CG  . LEU A 1 370  ? -7.041  43.017 22.131  1.00 59.97  ? 367  LEU A CG  1 
ATOM 2871 C CD1 . LEU A 1 370  ? -6.475  44.232 22.852  1.00 59.97  ? 367  LEU A CD1 1 
ATOM 2872 C CD2 . LEU A 1 370  ? -8.132  42.319 22.973  1.00 59.97  ? 367  LEU A CD2 1 
ATOM 2873 N N   . GLU A 1 371  ? -9.713  43.436 18.547  1.00 130.31 ? 368  GLU A N   1 
ATOM 2874 C CA  . GLU A 1 371  ? -11.001 43.834 18.007  1.00 130.31 ? 368  GLU A CA  1 
ATOM 2875 C C   . GLU A 1 371  ? -11.433 42.929 16.833  1.00 130.31 ? 368  GLU A C   1 
ATOM 2876 O O   . GLU A 1 371  ? -11.979 43.395 15.831  1.00 130.31 ? 368  GLU A O   1 
ATOM 2877 C CB  . GLU A 1 371  ? -11.011 45.333 17.665  1.00 111.30 ? 368  GLU A CB  1 
ATOM 2878 C CG  . GLU A 1 371  ? -11.100 46.260 18.897  1.00 111.30 ? 368  GLU A CG  1 
ATOM 2879 C CD  . GLU A 1 371  ? -12.446 46.195 19.654  1.00 111.30 ? 368  GLU A CD  1 
ATOM 2880 O OE1 . GLU A 1 371  ? -12.454 46.471 20.875  1.00 111.30 ? 368  GLU A OE1 1 
ATOM 2881 O OE2 . GLU A 1 371  ? -13.492 45.880 19.040  1.00 111.30 ? 368  GLU A OE2 1 
ATOM 2882 N N   . ARG A 1 372  ? -11.185 41.627 16.994  1.00 115.58 ? 369  ARG A N   1 
ATOM 2883 C CA  . ARG A 1 372  ? -11.599 40.575 16.048  1.00 115.58 ? 369  ARG A CA  1 
ATOM 2884 C C   . ARG A 1 372  ? -11.303 40.893 14.579  1.00 115.58 ? 369  ARG A C   1 
ATOM 2885 O O   . ARG A 1 372  ? -12.166 40.760 13.707  1.00 115.58 ? 369  ARG A O   1 
ATOM 2886 C CB  . ARG A 1 372  ? -13.072 40.195 16.257  1.00 143.25 ? 369  ARG A CB  1 
ATOM 2887 C CG  . ARG A 1 372  ? -13.489 40.091 17.726  1.00 143.25 ? 369  ARG A CG  1 
ATOM 2888 C CD  . ARG A 1 372  ? -14.581 39.053 17.947  1.00 143.25 ? 369  ARG A CD  1 
ATOM 2889 N NE  . ARG A 1 372  ? -15.691 39.187 17.005  1.00 143.25 ? 369  ARG A NE  1 
ATOM 2890 C CZ  . ARG A 1 372  ? -16.777 38.420 17.007  1.00 143.25 ? 369  ARG A CZ  1 
ATOM 2891 N NH1 . ARG A 1 372  ? -16.918 37.457 17.909  1.00 143.25 ? 369  ARG A NH1 1 
ATOM 2892 N NH2 . ARG A 1 372  ? -17.728 38.619 16.106  1.00 143.25 ? 369  ARG A NH2 1 
ATOM 2893 N N   . GLN A 1 373  ? -10.072 41.332 14.334  1.00 130.57 ? 370  GLN A N   1 
ATOM 2894 C CA  . GLN A 1 373  ? -9.546  41.573 12.994  1.00 130.57 ? 370  GLN A CA  1 
ATOM 2895 C C   . GLN A 1 373  ? -8.281  40.750 12.874  1.00 130.57 ? 370  GLN A C   1 
ATOM 2896 O O   . GLN A 1 373  ? -7.598  40.540 13.875  1.00 130.57 ? 370  GLN A O   1 
ATOM 2897 C CB  . GLN A 1 373  ? -9.166  43.042 12.824  1.00 110.39 ? 370  GLN A CB  1 
ATOM 2898 C CG  . GLN A 1 373  ? -10.172 44.041 13.345  1.00 110.39 ? 370  GLN A CG  1 
ATOM 2899 C CD  . GLN A 1 373  ? -9.517  45.322 13.799  1.00 110.39 ? 370  GLN A CD  1 
ATOM 2900 O OE1 . GLN A 1 373  ? -9.133  45.470 14.966  1.00 110.39 ? 370  GLN A OE1 1 
ATOM 2901 N NE2 . GLN A 1 373  ? -9.387  46.265 12.880  1.00 110.39 ? 370  GLN A NE2 1 
ATOM 2902 N N   . GLY A 1 374  ? -7.952  40.296 11.665  1.00 47.34  ? 371  GLY A N   1 
ATOM 2903 C CA  . GLY A 1 374  ? -6.718  39.528 11.446  1.00 47.34  ? 371  GLY A CA  1 
ATOM 2904 C C   . GLY A 1 374  ? -5.394  40.194 11.852  1.00 47.34  ? 371  GLY A C   1 
ATOM 2905 O O   . GLY A 1 374  ? -4.355  39.829 11.322  1.00 47.34  ? 371  GLY A O   1 
ATOM 2906 N N   . GLN A 1 375  ? -5.407  41.141 12.793  1.00 85.94  ? 372  GLN A N   1 
ATOM 2907 C CA  . GLN A 1 375  ? -4.187  41.918 13.123  1.00 85.94  ? 372  GLN A CA  1 
ATOM 2908 C C   . GLN A 1 375  ? -3.155  41.287 14.090  1.00 85.94  ? 372  GLN A C   1 
ATOM 2909 O O   . GLN A 1 375  ? -2.443  40.329 13.752  1.00 85.94  ? 372  GLN A O   1 
ATOM 2910 C CB  . GLN A 1 375  ? -4.519  43.369 13.547  1.00 87.30  ? 372  GLN A CB  1 
ATOM 2911 C CG  . GLN A 1 375  ? -5.895  43.591 14.207  1.00 87.30  ? 372  GLN A CG  1 
ATOM 2912 C CD  . GLN A 1 375  ? -5.957  43.265 15.705  1.00 87.30  ? 372  GLN A CD  1 
ATOM 2913 O OE1 . GLN A 1 375  ? -5.182  42.458 16.218  1.00 87.30  ? 372  GLN A OE1 1 
ATOM 2914 N NE2 . GLN A 1 375  ? -6.909  43.890 16.404  1.00 87.30  ? 372  GLN A NE2 1 
ATOM 2915 N N   . GLY A 1 376  ? -3.057  41.857 15.280  1.00 103.68 ? 373  GLY A N   1 
ATOM 2916 C CA  . GLY A 1 376  ? -2.001  41.519 16.206  1.00 103.68 ? 373  GLY A CA  1 
ATOM 2917 C C   . GLY A 1 376  ? -1.835  42.654 17.184  1.00 103.68 ? 373  GLY A C   1 
ATOM 2918 O O   . GLY A 1 376  ? -1.187  43.660 16.894  1.00 103.68 ? 373  GLY A O   1 
ATOM 2919 N N   . GLN A 1 377  ? -2.462  42.490 18.336  1.00 40.50  ? 374  GLN A N   1 
ATOM 2920 C CA  . GLN A 1 377  ? -2.342  43.416 19.435  1.00 40.50  ? 374  GLN A CA  1 
ATOM 2921 C C   . GLN A 1 377  ? -1.483  42.786 20.536  1.00 40.50  ? 374  GLN A C   1 
ATOM 2922 O O   . GLN A 1 377  ? -1.773  41.693 21.037  1.00 40.50  ? 374  GLN A O   1 
ATOM 2923 C CB  . GLN A 1 377  ? -3.732  43.683 19.975  1.00 54.17  ? 374  GLN A CB  1 
ATOM 2924 C CG  . GLN A 1 377  ? -4.627  44.436 19.035  1.00 54.17  ? 374  GLN A CG  1 
ATOM 2925 C CD  . GLN A 1 377  ? -4.902  45.819 19.552  1.00 54.17  ? 374  GLN A CD  1 
ATOM 2926 O OE1 . GLN A 1 377  ? -6.046  46.273 19.594  1.00 54.17  ? 374  GLN A OE1 1 
ATOM 2927 N NE2 . GLN A 1 377  ? -3.846  46.489 20.008  1.00 54.17  ? 374  GLN A NE2 1 
ATOM 2928 N N   . LEU A 1 378  ? -0.433  43.467 20.941  1.00 43.04  ? 375  LEU A N   1 
ATOM 2929 C CA  . LEU A 1 378  ? 0.327   42.979 22.074  1.00 43.04  ? 375  LEU A CA  1 
ATOM 2930 C C   . LEU A 1 378  ? -0.227  43.491 23.403  1.00 43.04  ? 375  LEU A C   1 
ATOM 2931 O O   . LEU A 1 378  ? -0.539  44.669 23.517  1.00 43.04  ? 375  LEU A O   1 
ATOM 2932 C CB  . LEU A 1 378  ? 1.761   43.421 21.921  1.00 30.68  ? 375  LEU A CB  1 
ATOM 2933 C CG  . LEU A 1 378  ? 2.766   42.824 22.879  1.00 30.68  ? 375  LEU A CG  1 
ATOM 2934 C CD1 . LEU A 1 378  ? 2.242   41.481 23.379  1.00 30.68  ? 375  LEU A CD1 1 
ATOM 2935 C CD2 . LEU A 1 378  ? 4.078   42.659 22.159  1.00 30.68  ? 375  LEU A CD2 1 
ATOM 2936 N N   . VAL A 1 379  ? -0.369  42.621 24.401  1.00 35.90  ? 376  VAL A N   1 
ATOM 2937 C CA  . VAL A 1 379  ? -0.785  43.072 25.750  1.00 35.90  ? 376  VAL A CA  1 
ATOM 2938 C C   . VAL A 1 379  ? 0.231   42.656 26.795  1.00 35.90  ? 376  VAL A C   1 
ATOM 2939 O O   . VAL A 1 379  ? 0.525   41.470 26.930  1.00 35.90  ? 376  VAL A O   1 
ATOM 2940 C CB  . VAL A 1 379  ? -2.142  42.518 26.189  1.00 32.52  ? 376  VAL A CB  1 
ATOM 2941 C CG1 . VAL A 1 379  ? -2.529  43.131 27.489  1.00 32.52  ? 376  VAL A CG1 1 
ATOM 2942 C CG2 . VAL A 1 379  ? -3.224  42.798 25.157  1.00 32.52  ? 376  VAL A CG2 1 
ATOM 2943 N N   . THR A 1 380  ? 0.759   43.633 27.533  1.00 25.64  ? 377  THR A N   1 
ATOM 2944 C CA  . THR A 1 380  ? 1.889   43.372 28.405  1.00 25.64  ? 377  THR A CA  1 
ATOM 2945 C C   . THR A 1 380  ? 1.545   43.634 29.832  1.00 25.64  ? 377  THR A C   1 
ATOM 2946 O O   . THR A 1 380  ? 0.806   44.569 30.125  1.00 25.64  ? 377  THR A O   1 
ATOM 2947 C CB  . THR A 1 380  ? 3.071   44.310 28.126  1.00 23.33  ? 377  THR A CB  1 
ATOM 2948 O OG1 . THR A 1 380  ? 2.689   45.656 28.475  1.00 23.33  ? 377  THR A OG1 1 
ATOM 2949 C CG2 . THR A 1 380  ? 3.523   44.222 26.673  1.00 23.33  ? 377  THR A CG2 1 
ATOM 2950 N N   . CYS A 1 381  ? 2.117   42.817 30.709  1.00 23.68  ? 378  CYS A N   1 
ATOM 2951 C CA  . CYS A 1 381  ? 2.246   43.110 32.120  1.00 23.68  ? 378  CYS A CA  1 
ATOM 2952 C C   . CYS A 1 381  ? 3.464   44.017 32.259  1.00 23.68  ? 378  CYS A C   1 
ATOM 2953 O O   . CYS A 1 381  ? 4.571   43.563 32.055  1.00 23.68  ? 378  CYS A O   1 
ATOM 2954 C CB  . CYS A 1 381  ? 2.487   41.807 32.855  1.00 25.06  ? 378  CYS A CB  1 
ATOM 2955 S SG  . CYS A 1 381  ? 1.050   40.731 32.812  1.00 25.06  ? 378  CYS A SG  1 
ATOM 2956 N N   . SER A 1 382  ? 3.276   45.288 32.598  1.00 29.71  ? 379  SER A N   1 
ATOM 2957 C CA  . SER A 1 382  ? 4.386   46.244 32.588  1.00 29.71  ? 379  SER A CA  1 
ATOM 2958 C C   . SER A 1 382  ? 4.549   46.925 33.918  1.00 29.71  ? 379  SER A C   1 
ATOM 2959 O O   . SER A 1 382  ? 3.594   47.104 34.652  1.00 29.71  ? 379  SER A O   1 
ATOM 2960 C CB  . SER A 1 382  ? 4.179   47.320 31.519  1.00 24.24  ? 379  SER A CB  1 
ATOM 2961 O OG  . SER A 1 382  ? 4.456   46.856 30.218  1.00 24.24  ? 379  SER A OG  1 
ATOM 2962 N N   . GLY A 1 383  ? 5.771   47.337 34.213  1.00 22.09  ? 380  GLY A N   1 
ATOM 2963 C CA  . GLY A 1 383  ? 6.067   48.111 35.410  1.00 22.09  ? 380  GLY A CA  1 
ATOM 2964 C C   . GLY A 1 383  ? 6.099   47.299 36.658  1.00 22.09  ? 380  GLY A C   1 
ATOM 2965 O O   . GLY A 1 383  ? 6.047   46.070 36.627  1.00 22.09  ? 380  GLY A O   1 
ATOM 2966 N N   . ALA A 1 384  ? 6.173   47.980 37.788  1.00 34.99  ? 381  ALA A N   1 
ATOM 2967 C CA  . ALA A 1 384  ? 6.272   47.292 39.069  1.00 34.99  ? 381  ALA A CA  1 
ATOM 2968 C C   . ALA A 1 384  ? 5.748   48.198 40.178  1.00 34.99  ? 381  ALA A C   1 
ATOM 2969 O O   . ALA A 1 384  ? 5.704   49.440 40.034  1.00 34.99  ? 381  ALA A O   1 
ATOM 2970 C CB  . ALA A 1 384  ? 7.698   46.874 39.335  1.00 27.45  ? 381  ALA A CB  1 
ATOM 2971 N N   . PHE A 1 385  ? 5.324   47.558 41.268  1.00 33.14  ? 382  PHE A N   1 
ATOM 2972 C CA  . PHE A 1 385  ? 4.676   48.216 42.388  1.00 33.14  ? 382  PHE A CA  1 
ATOM 2973 C C   . PHE A 1 385  ? 3.606   49.197 41.892  1.00 33.14  ? 382  PHE A C   1 
ATOM 2974 O O   . PHE A 1 385  ? 2.919   48.898 40.887  1.00 33.14  ? 382  PHE A O   1 
ATOM 2975 C CB  . PHE A 1 385  ? 5.746   48.886 43.182  1.00 11.51  ? 382  PHE A CB  1 
ATOM 2976 C CG  . PHE A 1 385  ? 6.980   48.043 43.348  1.00 11.51  ? 382  PHE A CG  1 
ATOM 2977 C CD1 . PHE A 1 385  ? 8.160   48.363 42.671  1.00 11.51  ? 382  PHE A CD1 1 
ATOM 2978 C CD2 . PHE A 1 385  ? 6.982   46.922 44.199  1.00 11.51  ? 382  PHE A CD2 1 
ATOM 2979 C CE1 . PHE A 1 385  ? 9.326   47.592 42.820  1.00 11.51  ? 382  PHE A CE1 1 
ATOM 2980 C CE2 . PHE A 1 385  ? 8.149   46.131 44.330  1.00 11.51  ? 382  PHE A CE2 1 
ATOM 2981 C CZ  . PHE A 1 385  ? 9.309   46.462 43.622  1.00 11.51  ? 382  PHE A CZ  1 
ATOM 2982 N N   . LYS A 1 386  ? 3.464   50.363 42.542  1.00 25.69  ? 383  LYS A N   1 
ATOM 2983 C CA  . LYS A 1 386  ? 2.452   51.368 42.098  1.00 25.69  ? 383  LYS A CA  1 
ATOM 2984 C C   . LYS A 1 386  ? 2.544   51.783 40.643  1.00 25.69  ? 383  LYS A C   1 
ATOM 2985 O O   . LYS A 1 386  ? 1.581   52.318 40.142  1.00 25.69  ? 383  LYS A O   1 
ATOM 2986 C CB  . LYS A 1 386  ? 2.438   52.651 42.965  1.00 17.35  ? 383  LYS A CB  1 
ATOM 2987 C CG  . LYS A 1 386  ? 3.518   53.722 42.585  1.00 17.35  ? 383  LYS A CG  1 
ATOM 2988 C CD  . LYS A 1 386  ? 3.735   54.694 43.752  1.00 17.35  ? 383  LYS A CD  1 
ATOM 2989 C CE  . LYS A 1 386  ? 4.787   55.738 43.508  1.00 17.35  ? 383  LYS A CE  1 
ATOM 2990 N NZ  . LYS A 1 386  ? 4.485   56.261 42.177  1.00 17.35  ? 383  LYS A NZ  1 
ATOM 2991 N N   . GLU A 1 387  ? 3.675   51.564 39.973  1.00 22.18  ? 384  GLU A N   1 
ATOM 2992 C CA  . GLU A 1 387  ? 3.750   51.853 38.532  1.00 22.18  ? 384  GLU A CA  1 
ATOM 2993 C C   . GLU A 1 387  ? 3.224   50.711 37.653  1.00 22.18  ? 384  GLU A C   1 
ATOM 2994 O O   . GLU A 1 387  ? 3.224   50.811 36.418  1.00 22.18  ? 384  GLU A O   1 
ATOM 2995 C CB  . GLU A 1 387  ? 5.181   52.193 38.100  1.00 27.75  ? 384  GLU A CB  1 
ATOM 2996 C CG  . GLU A 1 387  ? 5.974   53.101 39.038  1.00 27.75  ? 384  GLU A CG  1 
ATOM 2997 C CD  . GLU A 1 387  ? 5.361   54.504 39.225  1.00 27.75  ? 384  GLU A CD  1 
ATOM 2998 O OE1 . GLU A 1 387  ? 4.342   54.844 38.573  1.00 27.75  ? 384  GLU A OE1 1 
ATOM 2999 O OE2 . GLU A 1 387  ? 5.906   55.271 40.047  1.00 27.75  ? 384  GLU A OE2 1 
ATOM 3000 N N   . GLY A 1 388  ? 2.828   49.600 38.268  1.00 24.03  ? 385  GLY A N   1 
ATOM 3001 C CA  . GLY A 1 388  ? 2.361   48.448 37.499  1.00 24.03  ? 385  GLY A CA  1 
ATOM 3002 C C   . GLY A 1 388  ? 1.181   48.840 36.613  1.00 24.03  ? 385  GLY A C   1 
ATOM 3003 O O   . GLY A 1 388  ? 0.411   49.752 36.943  1.00 24.03  ? 385  GLY A O   1 
ATOM 3004 N N   . SER A 1 389  ? 1.044   48.155 35.483  1.00 19.70  ? 386  SER A N   1 
ATOM 3005 C CA  . SER A 1 389  ? 0.010   48.443 34.531  1.00 19.70  ? 386  SER A CA  1 
ATOM 3006 C C   . SER A 1 389  ? -0.067  47.312 33.524  1.00 19.70  ? 386  SER A C   1 
ATOM 3007 O O   . SER A 1 389  ? 0.786   46.390 33.531  1.00 19.70  ? 386  SER A O   1 
ATOM 3008 C CB  . SER A 1 389  ? 0.368   49.722 33.754  1.00 33.62  ? 386  SER A CB  1 
ATOM 3009 O OG  . SER A 1 389  ? 1.269   49.436 32.692  1.00 33.62  ? 386  SER A OG  1 
ATOM 3010 N N   . LEU A 1 390  ? -1.093  47.401 32.668  1.00 30.20  ? 387  LEU A N   1 
ATOM 3011 C CA  . LEU A 1 390  ? -1.123  46.682 31.411  1.00 30.20  ? 387  LEU A CA  1 
ATOM 3012 C C   . LEU A 1 390  ? -0.886  47.658 30.290  1.00 30.20  ? 387  LEU A C   1 
ATOM 3013 O O   . LEU A 1 390  ? -1.249  48.855 30.380  1.00 30.20  ? 387  LEU A O   1 
ATOM 3014 C CB  . LEU A 1 390  ? -2.466  45.998 31.187  1.00 22.00  ? 387  LEU A CB  1 
ATOM 3015 C CG  . LEU A 1 390  ? -2.993  45.094 32.322  1.00 22.00  ? 387  LEU A CG  1 
ATOM 3016 C CD1 . LEU A 1 390  ? -4.412  44.667 31.976  1.00 22.00  ? 387  LEU A CD1 1 
ATOM 3017 C CD2 . LEU A 1 390  ? -2.127  43.860 32.650  1.00 22.00  ? 387  LEU A CD2 1 
ATOM 3018 N N   . ARG A 1 391  ? -0.271  47.178 29.217  1.00 29.60  ? 388  ARG A N   1 
ATOM 3019 C CA  . ARG A 1 391  ? -0.195  48.038 28.046  1.00 29.60  ? 388  ARG A CA  1 
ATOM 3020 C C   . ARG A 1 391  ? -0.747  47.309 26.819  1.00 29.60  ? 388  ARG A C   1 
ATOM 3021 O O   . ARG A 1 391  ? -0.420  46.132 26.592  1.00 29.60  ? 388  ARG A O   1 
ATOM 3022 C CB  . ARG A 1 391  ? 1.228   48.544 27.794  1.00 22.09  ? 388  ARG A CB  1 
ATOM 3023 C CG  . ARG A 1 391  ? 1.905   49.220 28.944  1.00 22.09  ? 388  ARG A CG  1 
ATOM 3024 C CD  . ARG A 1 391  ? 1.309   50.562 29.346  1.00 22.09  ? 388  ARG A CD  1 
ATOM 3025 N NE  . ARG A 1 391  ? 2.017   51.159 30.505  1.00 22.09  ? 388  ARG A NE  1 
ATOM 3026 C CZ  . ARG A 1 391  ? 2.595   52.359 30.502  1.00 22.09  ? 388  ARG A CZ  1 
ATOM 3027 N NH1 . ARG A 1 391  ? 2.540   53.115 29.414  1.00 22.09  ? 388  ARG A NH1 1 
ATOM 3028 N NH2 . ARG A 1 391  ? 3.232   52.813 31.559  1.00 22.09  ? 388  ARG A NH2 1 
ATOM 3029 N N   . ILE A 1 392  ? -1.578  47.989 26.041  1.00 41.77  ? 389  ILE A N   1 
ATOM 3030 C CA  . ILE A 1 392  ? -2.015  47.421 24.775  1.00 41.77  ? 389  ILE A CA  1 
ATOM 3031 C C   . ILE A 1 392  ? -1.306  48.048 23.573  1.00 41.77  ? 389  ILE A C   1 
ATOM 3032 O O   . ILE A 1 392  ? -1.540  49.211 23.234  1.00 41.77  ? 389  ILE A O   1 
ATOM 3033 C CB  . ILE A 1 392  ? -3.541  47.508 24.599  1.00 20.84  ? 389  ILE A CB  1 
ATOM 3034 C CG1 . ILE A 1 392  ? -4.245  46.941 25.824  1.00 20.84  ? 389  ILE A CG1 1 
ATOM 3035 C CG2 . ILE A 1 392  ? -3.944  46.686 23.413  1.00 20.84  ? 389  ILE A CG2 1 
ATOM 3036 C CD1 . ILE A 1 392  ? -4.265  47.856 27.017  1.00 20.84  ? 389  ILE A CD1 1 
ATOM 3037 N N   . ILE A 1 393  ? -0.440  47.295 22.925  1.00 34.53  ? 390  ILE A N   1 
ATOM 3038 C CA  . ILE A 1 393  ? 0.288   47.867 21.803  1.00 34.53  ? 390  ILE A CA  1 
ATOM 3039 C C   . ILE A 1 393  ? -0.374  47.554 20.458  1.00 34.53  ? 390  ILE A C   1 
ATOM 3040 O O   . ILE A 1 393  ? -0.521  46.376 20.112  1.00 34.53  ? 390  ILE A O   1 
ATOM 3041 C CB  . ILE A 1 393  ? 1.733   47.422 21.778  1.00 38.52  ? 390  ILE A CB  1 
ATOM 3042 C CG1 . ILE A 1 393  ? 2.486   48.028 22.954  1.00 38.52  ? 390  ILE A CG1 1 
ATOM 3043 C CG2 . ILE A 1 393  ? 2.391   47.935 20.509  1.00 38.52  ? 390  ILE A CG2 1 
ATOM 3044 C CD1 . ILE A 1 393  ? 2.501   47.194 24.224  1.00 38.52  ? 390  ILE A CD1 1 
ATOM 3045 N N   . ARG A 1 394  ? -0.800  48.592 19.730  1.00 55.82  ? 391  ARG A N   1 
ATOM 3046 C CA  . ARG A 1 394  ? -1.466  48.427 18.420  1.00 55.82  ? 391  ARG A CA  1 
ATOM 3047 C C   . ARG A 1 394  ? -0.599  48.967 17.292  1.00 55.82  ? 391  ARG A C   1 
ATOM 3048 O O   . ARG A 1 394  ? 0.047   50.016 17.405  1.00 55.82  ? 391  ARG A O   1 
ATOM 3049 C CB  . ARG A 1 394  ? -2.842  49.110 18.377  1.00 91.78  ? 391  ARG A CB  1 
ATOM 3050 C CG  . ARG A 1 394  ? -3.726  48.696 17.194  1.00 91.78  ? 391  ARG A CG  1 
ATOM 3051 C CD  . ARG A 1 394  ? -4.959  49.620 17.019  1.00 91.78  ? 391  ARG A CD  1 
ATOM 3052 N NE  . ARG A 1 394  ? -6.114  49.298 17.884  1.00 91.78  ? 391  ARG A NE  1 
ATOM 3053 C CZ  . ARG A 1 394  ? -7.192  48.579 17.527  1.00 91.78  ? 391  ARG A CZ  1 
ATOM 3054 N NH1 . ARG A 1 394  ? -7.308  48.062 16.302  1.00 91.78  ? 391  ARG A NH1 1 
ATOM 3055 N NH2 . ARG A 1 394  ? -8.167  48.366 18.406  1.00 91.78  ? 391  ARG A NH2 1 
ATOM 3056 N N   . ASN A 1 395  ? -0.593  48.235 16.193  1.00 59.17  ? 392  ASN A N   1 
ATOM 3057 C CA  . ASN A 1 395  ? 0.123   48.665 15.004  1.00 59.17  ? 392  ASN A CA  1 
ATOM 3058 C C   . ASN A 1 395  ? -0.729  49.520 14.055  1.00 59.17  ? 392  ASN A C   1 
ATOM 3059 O O   . ASN A 1 395  ? -1.904  49.222 13.809  1.00 59.17  ? 392  ASN A O   1 
ATOM 3060 C CB  . ASN A 1 395  ? 0.660   47.449 14.274  1.00 76.64  ? 392  ASN A CB  1 
ATOM 3061 C CG  . ASN A 1 395  ? 1.992   47.707 13.663  1.00 76.64  ? 392  ASN A CG  1 
ATOM 3062 O OD1 . ASN A 1 395  ? 2.290   48.831 13.250  1.00 76.64  ? 392  ASN A OD1 1 
ATOM 3063 N ND2 . ASN A 1 395  ? 2.822   46.669 13.603  1.00 76.64  ? 392  ASN A ND2 1 
ATOM 3064 N N   . GLY A 1 396  ? -0.139  50.584 13.525  1.00 53.93  ? 393  GLY A N   1 
ATOM 3065 C CA  . GLY A 1 396  ? -0.860  51.447 12.603  1.00 53.93  ? 393  GLY A CA  1 
ATOM 3066 C C   . GLY A 1 396  ? -1.846  52.399 13.250  1.00 53.93  ? 393  GLY A C   1 
ATOM 3067 O O   . GLY A 1 396  ? -1.902  52.544 14.471  1.00 53.93  ? 393  GLY A O   1 
ATOM 3068 N N   . ILE A 1 397  ? -2.615  53.074 12.407  1.00 42.54  ? 394  ILE A N   1 
ATOM 3069 C CA  . ILE A 1 397  ? -3.564  54.076 12.853  1.00 42.54  ? 394  ILE A CA  1 
ATOM 3070 C C   . ILE A 1 397  ? -4.889  53.534 12.410  1.00 42.54  ? 394  ILE A C   1 
ATOM 3071 O O   . ILE A 1 397  ? -5.002  53.079 11.264  1.00 42.54  ? 394  ILE A O   1 
ATOM 3072 C CB  . ILE A 1 397  ? -3.371  55.439 12.124  1.00 29.70  ? 394  ILE A CB  1 
ATOM 3073 C CG1 . ILE A 1 397  ? -1.905  55.863 12.064  1.00 29.70  ? 394  ILE A CG1 1 
ATOM 3074 C CG2 . ILE A 1 397  ? -4.199  56.504 12.763  1.00 29.70  ? 394  ILE A CG2 1 
ATOM 3075 C CD1 . ILE A 1 397  ? -1.388  56.430 13.325  1.00 29.70  ? 394  ILE A CD1 1 
ATOM 3076 N N   . GLY A 1 398  ? -5.887  53.599 13.294  1.00 54.42  ? 395  GLY A N   1 
ATOM 3077 C CA  . GLY A 1 398  ? -7.229  53.098 12.994  1.00 54.42  ? 395  GLY A CA  1 
ATOM 3078 C C   . GLY A 1 398  ? -8.239  54.221 12.849  1.00 54.42  ? 395  GLY A C   1 
ATOM 3079 O O   . GLY A 1 398  ? -7.972  55.371 13.242  1.00 54.42  ? 395  GLY A O   1 
ATOM 3080 N N   . ILE A 1 399  ? -9.393  53.878 12.267  1.00 72.31  ? 396  ILE A N   1 
ATOM 3081 C CA  . ILE A 1 399  ? -10.525 54.797 12.066  1.00 72.31  ? 396  ILE A CA  1 
ATOM 3082 C C   . ILE A 1 399  ? -11.848 54.062 12.362  1.00 72.31  ? 396  ILE A C   1 
ATOM 3083 O O   . ILE A 1 399  ? -12.068 52.943 11.866  1.00 72.31  ? 396  ILE A O   1 
ATOM 3084 C CB  . ILE A 1 399  ? -10.569 55.400 10.608  1.00 75.01  ? 396  ILE A CB  1 
ATOM 3085 C CG1 . ILE A 1 399  ? -10.665 54.298 9.549   1.00 75.01  ? 396  ILE A CG1 1 
ATOM 3086 C CG2 . ILE A 1 399  ? -9.356  56.279 10.313  1.00 75.01  ? 396  ILE A CG2 1 
ATOM 3087 C CD1 . ILE A 1 399  ? -11.724 54.548 8.502   1.00 75.01  ? 396  ILE A CD1 1 
ATOM 3088 N N   . HIS A 1 400  ? -12.723 54.683 13.162  1.00 104.47 ? 397  HIS A N   1 
ATOM 3089 C CA  . HIS A 1 400  ? -13.974 54.033 13.605  1.00 104.47 ? 397  HIS A CA  1 
ATOM 3090 C C   . HIS A 1 400  ? -15.146 54.390 12.700  1.00 104.47 ? 397  HIS A C   1 
ATOM 3091 O O   . HIS A 1 400  ? -15.447 55.565 12.522  1.00 104.47 ? 397  HIS A O   1 
ATOM 3092 C CB  . HIS A 1 400  ? -14.303 54.377 15.070  1.00 120.02 ? 397  HIS A CB  1 
ATOM 3093 C CG  . HIS A 1 400  ? -13.422 53.694 16.080  1.00 120.02 ? 397  HIS A CG  1 
ATOM 3094 N ND1 . HIS A 1 400  ? -13.862 52.650 16.869  1.00 120.02 ? 397  HIS A ND1 1 
ATOM 3095 C CD2 . HIS A 1 400  ? -12.135 53.920 16.441  1.00 120.02 ? 397  HIS A CD2 1 
ATOM 3096 C CE1 . HIS A 1 400  ? -12.882 52.258 17.664  1.00 120.02 ? 397  HIS A CE1 1 
ATOM 3097 N NE2 . HIS A 1 400  ? -11.823 53.011 17.424  1.00 120.02 ? 397  HIS A NE2 1 
ATOM 3098 N N   . GLU A 1 401  ? -15.802 53.367 12.149  1.00 169.11 ? 398  GLU A N   1 
ATOM 3099 C CA  . GLU A 1 401  ? -16.850 53.538 11.131  1.00 169.11 ? 398  GLU A CA  1 
ATOM 3100 C C   . GLU A 1 401  ? -18.214 53.927 11.707  1.00 169.11 ? 398  GLU A C   1 
ATOM 3101 O O   . GLU A 1 401  ? -18.910 53.089 12.287  1.00 169.11 ? 398  GLU A O   1 
ATOM 3102 C CB  . GLU A 1 401  ? -16.993 52.269 10.269  1.00 103.20 ? 398  GLU A CB  1 
ATOM 3103 C CG  . GLU A 1 401  ? -15.759 51.916 9.429   1.00 103.20 ? 398  GLU A CG  1 
ATOM 3104 C CD  . GLU A 1 401  ? -16.040 50.893 8.328   1.00 103.20 ? 398  GLU A CD  1 
ATOM 3105 O OE1 . GLU A 1 401  ? -15.068 50.346 7.764   1.00 103.20 ? 398  GLU A OE1 1 
ATOM 3106 O OE2 . GLU A 1 401  ? -17.227 50.638 8.018   1.00 103.20 ? 398  GLU A OE2 1 
ATOM 3107 N N   . HIS A 1 402  ? -18.586 55.197 11.533  1.00 106.39 ? 399  HIS A N   1 
ATOM 3108 C CA  . HIS A 1 402  ? -19.910 55.693 11.936  1.00 106.39 ? 399  HIS A CA  1 
ATOM 3109 C C   . HIS A 1 402  ? -20.957 55.264 10.910  1.00 106.39 ? 399  HIS A C   1 
ATOM 3110 O O   . HIS A 1 402  ? -21.869 54.505 11.245  1.00 106.39 ? 399  HIS A O   1 
ATOM 3111 C CB  . HIS A 1 402  ? -19.931 57.222 12.127  1.00 102.65 ? 399  HIS A CB  1 
ATOM 3112 C CG  . HIS A 1 402  ? -18.852 57.744 13.029  1.00 102.65 ? 399  HIS A CG  1 
ATOM 3113 N ND1 . HIS A 1 402  ? -18.350 59.024 12.920  1.00 102.65 ? 399  HIS A ND1 1 
ATOM 3114 C CD2 . HIS A 1 402  ? -18.167 57.158 14.042  1.00 102.65 ? 399  HIS A CD2 1 
ATOM 3115 C CE1 . HIS A 1 402  ? -17.410 59.208 13.832  1.00 102.65 ? 399  HIS A CE1 1 
ATOM 3116 N NE2 . HIS A 1 402  ? -17.275 58.089 14.521  1.00 102.65 ? 399  HIS A NE2 1 
ATOM 3117 N N   . ALA A 1 403  ? -20.813 55.740 9.668   1.00 133.31 ? 400  ALA A N   1 
ATOM 3118 C CA  . ALA A 1 403  ? -21.702 55.344 8.568   1.00 133.31 ? 400  ALA A CA  1 
ATOM 3119 C C   . ALA A 1 403  ? -20.976 54.714 7.385   1.00 133.31 ? 400  ALA A C   1 
ATOM 3120 O O   . ALA A 1 403  ? -19.834 55.064 7.072   1.00 133.31 ? 400  ALA A O   1 
ATOM 3121 C CB  . ALA A 1 403  ? -22.539 56.502 8.099   1.00 58.40  ? 400  ALA A CB  1 
ATOM 3122 N N   . SER A 1 404  ? -21.674 53.790 6.731   1.00 121.44 ? 401  SER A N   1 
ATOM 3123 C CA  . SER A 1 404  ? -21.163 53.090 5.564   1.00 121.44 ? 401  SER A CA  1 
ATOM 3124 C C   . SER A 1 404  ? -22.284 52.953 4.531   1.00 121.44 ? 401  SER A C   1 
ATOM 3125 O O   . SER A 1 404  ? -23.129 52.057 4.618   1.00 121.44 ? 401  SER A O   1 
ATOM 3126 C CB  . SER A 1 404  ? -20.591 51.719 5.960   1.00 113.83 ? 401  SER A CB  1 
ATOM 3127 O OG  . SER A 1 404  ? -19.645 51.243 5.015   1.00 113.83 ? 401  SER A OG  1 
ATOM 3128 N N   . ILE A 1 405  ? -22.306 53.887 3.583   1.00 157.37 ? 402  ILE A N   1 
ATOM 3129 C CA  . ILE A 1 405  ? -23.176 53.799 2.421   1.00 157.37 ? 402  ILE A CA  1 
ATOM 3130 C C   . ILE A 1 405  ? -22.334 53.214 1.308   1.00 157.37 ? 402  ILE A C   1 
ATOM 3131 O O   . ILE A 1 405  ? -21.296 53.773 0.952   1.00 157.37 ? 402  ILE A O   1 
ATOM 3132 C CB  . ILE A 1 405  ? -23.697 55.190 1.961   1.00 91.06  ? 402  ILE A CB  1 
ATOM 3133 C CG1 . ILE A 1 405  ? -24.616 55.833 3.007   1.00 91.06  ? 402  ILE A CG1 1 
ATOM 3134 C CG2 . ILE A 1 405  ? -24.429 55.074 0.624   1.00 91.06  ? 402  ILE A CG2 1 
ATOM 3135 C CD1 . ILE A 1 405  ? -23.917 56.789 3.948   1.00 91.06  ? 402  ILE A CD1 1 
ATOM 3136 N N   . ASP A 1 406  ? -22.764 52.078 0.771   1.00 140.09 ? 403  ASP A N   1 
ATOM 3137 C CA  . ASP A 1 406  ? -22.070 51.483 -0.367  1.00 140.09 ? 403  ASP A CA  1 
ATOM 3138 C C   . ASP A 1 406  ? -22.538 52.129 -1.673  1.00 140.09 ? 403  ASP A C   1 
ATOM 3139 O O   . ASP A 1 406  ? -23.712 52.489 -1.804  1.00 140.09 ? 403  ASP A O   1 
ATOM 3140 C CB  . ASP A 1 406  ? -22.239 49.957 -0.395  1.00 162.56 ? 403  ASP A CB  1 
ATOM 3141 C CG  . ASP A 1 406  ? -23.689 49.524 -0.481  1.00 162.56 ? 403  ASP A CG  1 
ATOM 3142 O OD1 . ASP A 1 406  ? -24.532 50.096 0.245   1.00 162.56 ? 403  ASP A OD1 1 
ATOM 3143 O OD2 . ASP A 1 406  ? -23.981 48.601 -1.270  1.00 162.56 ? 403  ASP A OD2 1 
ATOM 3144 N N   . LEU A 1 407  ? -21.604 52.282 -2.618  1.00 115.08 ? 404  LEU A N   1 
ATOM 3145 C CA  . LEU A 1 407  ? -21.843 52.962 -3.900  1.00 115.08 ? 404  LEU A CA  1 
ATOM 3146 C C   . LEU A 1 407  ? -20.621 52.824 -4.824  1.00 115.08 ? 404  LEU A C   1 
ATOM 3147 O O   . LEU A 1 407  ? -19.666 53.597 -4.710  1.00 115.08 ? 404  LEU A O   1 
ATOM 3148 C CB  . LEU A 1 407  ? -22.178 54.445 -3.677  1.00 124.50 ? 404  LEU A CB  1 
ATOM 3149 C CG  . LEU A 1 407  ? -23.284 55.094 -4.514  1.00 124.50 ? 404  LEU A CG  1 
ATOM 3150 C CD1 . LEU A 1 407  ? -24.670 54.503 -4.218  1.00 124.50 ? 404  LEU A CD1 1 
ATOM 3151 C CD2 . LEU A 1 407  ? -23.300 56.578 -4.246  1.00 124.50 ? 404  LEU A CD2 1 
ATOM 3152 N N   . PRO A 1 408  ? -20.646 51.823 -5.732  1.00 108.88 ? 405  PRO A N   1 
ATOM 3153 C CA  . PRO A 1 408  ? -19.593 51.491 -6.714  1.00 108.88 ? 405  PRO A CA  1 
ATOM 3154 C C   . PRO A 1 408  ? -19.002 52.664 -7.510  1.00 108.88 ? 405  PRO A C   1 
ATOM 3155 O O   . PRO A 1 408  ? -19.639 53.712 -7.645  1.00 108.88 ? 405  PRO A O   1 
ATOM 3156 C CB  . PRO A 1 408  ? -20.311 50.546 -7.682  1.00 118.20 ? 405  PRO A CB  1 
ATOM 3157 C CG  . PRO A 1 408  ? -21.350 49.889 -6.859  1.00 118.20 ? 405  PRO A CG  1 
ATOM 3158 C CD  . PRO A 1 408  ? -21.783 50.883 -5.819  1.00 118.20 ? 405  PRO A CD  1 
ATOM 3159 N N   . GLY A 1 409  ? -17.779 52.466 -8.012  1.00 109.04 ? 406  GLY A N   1 
ATOM 3160 C CA  . GLY A 1 409  ? -17.148 53.327 -9.028  1.00 109.04 ? 406  GLY A CA  1 
ATOM 3161 C C   . GLY A 1 409  ? -17.034 54.838 -8.829  1.00 109.04 ? 406  GLY A C   1 
ATOM 3162 O O   . GLY A 1 409  ? -17.095 55.591 -9.811  1.00 109.04 ? 406  GLY A O   1 
ATOM 3163 N N   . ILE A 1 410  ? -16.870 55.275 -7.575  1.00 71.43  ? 407  ILE A N   1 
ATOM 3164 C CA  . ILE A 1 410  ? -16.570 56.674 -7.234  1.00 71.43  ? 407  ILE A CA  1 
ATOM 3165 C C   . ILE A 1 410  ? -15.179 57.060 -7.753  1.00 71.43  ? 407  ILE A C   1 
ATOM 3166 O O   . ILE A 1 410  ? -14.233 56.274 -7.671  1.00 71.43  ? 407  ILE A O   1 
ATOM 3167 C CB  . ILE A 1 410  ? -16.638 56.909 -5.706  1.00 79.50  ? 407  ILE A CB  1 
ATOM 3168 C CG1 . ILE A 1 410  ? -17.967 56.379 -5.162  1.00 79.50  ? 407  ILE A CG1 1 
ATOM 3169 C CG2 . ILE A 1 410  ? -16.458 58.393 -5.368  1.00 79.50  ? 407  ILE A CG2 1 
ATOM 3170 C CD1 . ILE A 1 410  ? -18.098 56.384 -3.632  1.00 79.50  ? 407  ILE A CD1 1 
ATOM 3171 N N   . LYS A 1 411  ? -15.059 58.267 -8.297  1.00 77.64  ? 408  LYS A N   1 
ATOM 3172 C CA  . LYS A 1 411  ? -13.764 58.732 -8.775  1.00 77.64  ? 408  LYS A CA  1 
ATOM 3173 C C   . LYS A 1 411  ? -13.396 60.140 -8.299  1.00 77.64  ? 408  LYS A C   1 
ATOM 3174 O O   . LYS A 1 411  ? -12.755 60.896 -9.018  1.00 77.64  ? 408  LYS A O   1 
ATOM 3175 C CB  . LYS A 1 411  ? -13.653 58.579 -10.305 1.00 83.06  ? 408  LYS A CB  1 
ATOM 3176 C CG  . LYS A 1 411  ? -13.861 57.142 -10.792 1.00 83.06  ? 408  LYS A CG  1 
ATOM 3177 C CD  . LYS A 1 411  ? -12.730 56.655 -11.673 1.00 83.06  ? 408  LYS A CD  1 
ATOM 3178 C CE  . LYS A 1 411  ? -12.768 55.135 -11.810 1.00 83.06  ? 408  LYS A CE  1 
ATOM 3179 N NZ  . LYS A 1 411  ? -11.495 54.586 -12.363 1.00 83.06  ? 408  LYS A NZ  1 
ATOM 3180 N N   . GLY A 1 412  ? -13.774 60.477 -7.072  1.00 70.68  ? 409  GLY A N   1 
ATOM 3181 C CA  . GLY A 1 412  ? -13.428 61.780 -6.511  1.00 70.68  ? 409  GLY A CA  1 
ATOM 3182 C C   . GLY A 1 412  ? -14.472 62.241 -5.527  1.00 70.68  ? 409  GLY A C   1 
ATOM 3183 O O   . GLY A 1 412  ? -15.648 61.917 -5.696  1.00 70.68  ? 409  GLY A O   1 
ATOM 3184 N N   . LEU A 1 413  ? -14.039 62.988 -4.500  1.00 71.13  ? 410  LEU A N   1 
ATOM 3185 C CA  . LEU A 1 413  ? -14.916 63.462 -3.402  1.00 71.13  ? 410  LEU A CA  1 
ATOM 3186 C C   . LEU A 1 413  ? -14.577 64.848 -2.868  1.00 71.13  ? 410  LEU A C   1 
ATOM 3187 O O   . LEU A 1 413  ? -13.411 65.153 -2.583  1.00 71.13  ? 410  LEU A O   1 
ATOM 3188 C CB  . LEU A 1 413  ? -14.906 62.501 -2.215  1.00 73.01  ? 410  LEU A CB  1 
ATOM 3189 C CG  . LEU A 1 413  ? -15.504 61.100 -2.279  1.00 73.01  ? 410  LEU A CG  1 
ATOM 3190 C CD1 . LEU A 1 413  ? -15.794 60.660 -0.845  1.00 73.01  ? 410  LEU A CD1 1 
ATOM 3191 C CD2 . LEU A 1 413  ? -16.771 61.016 -3.120  1.00 73.01  ? 410  LEU A CD2 1 
ATOM 3192 N N   . TRP A 1 414  ? -15.622 65.664 -2.709  1.00 79.82  ? 411  TRP A N   1 
ATOM 3193 C CA  . TRP A 1 414  ? -15.497 67.033 -2.199  1.00 79.82  ? 411  TRP A CA  1 
ATOM 3194 C C   . TRP A 1 414  ? -16.630 67.401 -1.245  1.00 79.82  ? 411  TRP A C   1 
ATOM 3195 O O   . TRP A 1 414  ? -17.805 67.155 -1.553  1.00 79.82  ? 411  TRP A O   1 
ATOM 3196 C CB  . TRP A 1 414  ? -15.457 68.043 -3.342  1.00 81.60  ? 411  TRP A CB  1 
ATOM 3197 C CG  . TRP A 1 414  ? -14.437 67.745 -4.360  1.00 81.60  ? 411  TRP A CG  1 
ATOM 3198 C CD1 . TRP A 1 414  ? -13.163 68.233 -4.425  1.00 81.60  ? 411  TRP A CD1 1 
ATOM 3199 C CD2 . TRP A 1 414  ? -14.593 66.868 -5.462  1.00 81.60  ? 411  TRP A CD2 1 
ATOM 3200 N NE1 . TRP A 1 414  ? -12.514 67.711 -5.514  1.00 81.60  ? 411  TRP A NE1 1 
ATOM 3201 C CE2 . TRP A 1 414  ? -13.372 66.865 -6.168  1.00 81.60  ? 411  TRP A CE2 1 
ATOM 3202 C CE3 . TRP A 1 414  ? -15.652 66.076 -5.927  1.00 81.60  ? 411  TRP A CE3 1 
ATOM 3203 C CZ2 . TRP A 1 414  ? -13.179 66.103 -7.320  1.00 81.60  ? 411  TRP A CZ2 1 
ATOM 3204 C CZ3 . TRP A 1 414  ? -15.462 65.314 -7.066  1.00 81.60  ? 411  TRP A CZ3 1 
ATOM 3205 C CH2 . TRP A 1 414  ? -14.232 65.333 -7.753  1.00 81.60  ? 411  TRP A CH2 1 
ATOM 3206 N N   . PRO A 1 415  ? -16.273 68.011 -0.093  1.00 117.24 ? 412  PRO A N   1 
ATOM 3207 C CA  . PRO A 1 415  ? -17.202 68.347 0.994   1.00 117.24 ? 412  PRO A CA  1 
ATOM 3208 C C   . PRO A 1 415  ? -17.964 69.647 0.713   1.00 117.24 ? 412  PRO A C   1 
ATOM 3209 O O   . PRO A 1 415  ? -17.403 70.550 0.087   1.00 117.24 ? 412  PRO A O   1 
ATOM 3210 C CB  . PRO A 1 415  ? -16.268 68.516 2.194   1.00 78.65  ? 412  PRO A CB  1 
ATOM 3211 C CG  . PRO A 1 415  ? -14.937 68.949 1.609   1.00 78.65  ? 412  PRO A CG  1 
ATOM 3212 C CD  . PRO A 1 415  ? -14.882 68.437 0.200   1.00 78.65  ? 412  PRO A CD  1 
ATOM 3213 N N   . LEU A 1 416  ? -19.217 69.756 1.163   1.00 83.43  ? 413  LEU A N   1 
ATOM 3214 C CA  . LEU A 1 416  ? -20.044 70.933 0.784   1.00 83.43  ? 413  LEU A CA  1 
ATOM 3215 C C   . LEU A 1 416  ? -21.029 71.482 1.839   1.00 83.43  ? 413  LEU A C   1 
ATOM 3216 O O   . LEU A 1 416  ? -21.644 70.733 2.594   1.00 83.43  ? 413  LEU A O   1 
ATOM 3217 C CB  . LEU A 1 416  ? -20.754 70.682 -0.552  1.00 137.01 ? 413  LEU A CB  1 
ATOM 3218 C CG  . LEU A 1 416  ? -21.047 71.888 -1.444  1.00 137.01 ? 413  LEU A CG  1 
ATOM 3219 C CD1 . LEU A 1 416  ? -19.758 72.583 -1.853  1.00 137.01 ? 413  LEU A CD1 1 
ATOM 3220 C CD2 . LEU A 1 416  ? -21.830 71.457 -2.671  1.00 137.01 ? 413  LEU A CD2 1 
ATOM 3221 N N   . ARG A 1 417  ? -21.186 72.800 1.849   1.00 98.15  ? 414  ARG A N   1 
ATOM 3222 C CA  . ARG A 1 417  ? -21.817 73.496 2.959   1.00 98.15  ? 414  ARG A CA  1 
ATOM 3223 C C   . ARG A 1 417  ? -22.872 74.526 2.511   1.00 98.15  ? 414  ARG A C   1 
ATOM 3224 O O   . ARG A 1 417  ? -22.534 75.579 1.962   1.00 98.15  ? 414  ARG A O   1 
ATOM 3225 C CB  . ARG A 1 417  ? -20.712 74.140 3.801   1.00 89.06  ? 414  ARG A CB  1 
ATOM 3226 C CG  . ARG A 1 417  ? -21.147 75.257 4.709   1.00 89.06  ? 414  ARG A CG  1 
ATOM 3227 C CD  . ARG A 1 417  ? -20.096 75.594 5.764   1.00 89.06  ? 414  ARG A CD  1 
ATOM 3228 N NE  . ARG A 1 417  ? -18.725 75.722 5.261   1.00 89.06  ? 414  ARG A NE  1 
ATOM 3229 C CZ  . ARG A 1 417  ? -18.262 76.750 4.561   1.00 89.06  ? 414  ARG A CZ  1 
ATOM 3230 N NH1 . ARG A 1 417  ? -19.064 77.751 4.235   1.00 89.06  ? 414  ARG A NH1 1 
ATOM 3231 N NH2 . ARG A 1 417  ? -16.995 76.763 4.177   1.00 89.06  ? 414  ARG A NH2 1 
ATOM 3232 N N   . SER A 1 418  ? -24.146 74.222 2.769   1.00 120.72 ? 415  SER A N   1 
ATOM 3233 C CA  . SER A 1 418  ? -25.269 75.069 2.326   1.00 120.72 ? 415  SER A CA  1 
ATOM 3234 C C   . SER A 1 418  ? -25.578 76.286 3.228   1.00 120.72 ? 415  SER A C   1 
ATOM 3235 O O   . SER A 1 418  ? -26.745 76.568 3.539   1.00 120.72 ? 415  SER A O   1 
ATOM 3236 C CB  . SER A 1 418  ? -26.532 74.219 2.110   1.00 114.74 ? 415  SER A CB  1 
ATOM 3237 O OG  . SER A 1 418  ? -26.535 73.594 0.836   1.00 114.74 ? 415  SER A OG  1 
ATOM 3238 N N   . ASP A 1 419  ? -24.525 77.006 3.622   1.00 178.00 ? 416  ASP A N   1 
ATOM 3239 C CA  . ASP A 1 419  ? -24.636 78.233 4.420   1.00 178.00 ? 416  ASP A CA  1 
ATOM 3240 C C   . ASP A 1 419  ? -23.325 79.025 4.368   1.00 178.00 ? 416  ASP A C   1 
ATOM 3241 O O   . ASP A 1 419  ? -22.270 78.493 4.723   1.00 178.00 ? 416  ASP A O   1 
ATOM 3242 C CB  . ASP A 1 419  ? -25.000 77.908 5.876   1.00 179.56 ? 416  ASP A CB  1 
ATOM 3243 C CG  . ASP A 1 419  ? -25.372 79.146 6.690   1.00 179.56 ? 416  ASP A CG  1 
ATOM 3244 O OD1 . ASP A 1 419  ? -25.284 79.081 7.937   1.00 179.56 ? 416  ASP A OD1 1 
ATOM 3245 O OD2 . ASP A 1 419  ? -25.756 80.178 6.097   1.00 179.56 ? 416  ASP A OD2 1 
ATOM 3246 N N   . PRO A 1 420  ? -23.384 80.297 3.921   1.00 149.95 ? 417  PRO A N   1 
ATOM 3247 C CA  . PRO A 1 420  ? -22.190 81.151 3.873   1.00 149.95 ? 417  PRO A CA  1 
ATOM 3248 C C   . PRO A 1 420  ? -21.715 81.630 5.252   1.00 149.95 ? 417  PRO A C   1 
ATOM 3249 O O   . PRO A 1 420  ? -20.762 82.414 5.340   1.00 149.95 ? 417  PRO A O   1 
ATOM 3250 C CB  . PRO A 1 420  ? -22.644 82.353 3.025   1.00 161.26 ? 417  PRO A CB  1 
ATOM 3251 C CG  . PRO A 1 420  ? -23.984 81.982 2.462   1.00 161.26 ? 417  PRO A CG  1 
ATOM 3252 C CD  . PRO A 1 420  ? -24.571 80.999 3.408   1.00 161.26 ? 417  PRO A CD  1 
ATOM 3253 N N   . ASN A 1 421  ? -22.367 81.155 6.312   1.00 192.12 ? 418  ASN A N   1 
ATOM 3254 C CA  . ASN A 1 421  ? -22.073 81.599 7.674   1.00 192.12 ? 418  ASN A CA  1 
ATOM 3255 C C   . ASN A 1 421  ? -21.085 80.695 8.416   1.00 192.12 ? 418  ASN A C   1 
ATOM 3256 O O   . ASN A 1 421  ? -19.982 81.124 8.764   1.00 192.12 ? 418  ASN A O   1 
ATOM 3257 C CB  . ASN A 1 421  ? -23.369 81.735 8.490   1.00 188.54 ? 418  ASN A CB  1 
ATOM 3258 C CG  . ASN A 1 421  ? -24.416 82.605 7.804   1.00 188.54 ? 418  ASN A CG  1 
ATOM 3259 O OD1 . ASN A 1 421  ? -24.099 83.625 7.191   1.00 188.54 ? 418  ASN A OD1 1 
ATOM 3260 N ND2 . ASN A 1 421  ? -25.675 82.206 7.921   1.00 188.54 ? 418  ASN A ND2 1 
ATOM 3261 N N   . ARG A 1 422  ? -21.493 79.445 8.634   1.00 200.23 ? 419  ARG A N   1 
ATOM 3262 C CA  . ARG A 1 422  ? -20.788 78.489 9.503   1.00 200.23 ? 419  ARG A CA  1 
ATOM 3263 C C   . ARG A 1 422  ? -19.528 77.865 8.889   1.00 200.23 ? 419  ARG A C   1 
ATOM 3264 O O   . ARG A 1 422  ? -19.067 78.278 7.822   1.00 200.23 ? 419  ARG A O   1 
ATOM 3265 C CB  . ARG A 1 422  ? -21.752 77.373 9.931   1.00 103.68 ? 419  ARG A CB  1 
ATOM 3266 C CG  . ARG A 1 422  ? -22.431 76.683 8.757   1.00 103.68 ? 419  ARG A CG  1 
ATOM 3267 C CD  . ARG A 1 422  ? -23.358 75.596 9.217   1.00 103.68 ? 419  ARG A CD  1 
ATOM 3268 N NE  . ARG A 1 422  ? -24.579 76.114 9.830   1.00 103.68 ? 419  ARG A NE  1 
ATOM 3269 C CZ  . ARG A 1 422  ? -25.383 75.397 10.613  1.00 103.68 ? 419  ARG A CZ  1 
ATOM 3270 N NH1 . ARG A 1 422  ? -25.096 74.129 10.889  1.00 103.68 ? 419  ARG A NH1 1 
ATOM 3271 N NH2 . ARG A 1 422  ? -26.473 75.949 11.134  1.00 103.68 ? 419  ARG A NH2 1 
ATOM 3272 N N   . GLU A 1 423  ? -18.980 76.872 9.592   1.00 164.57 ? 420  GLU A N   1 
ATOM 3273 C CA  . GLU A 1 423  ? -17.870 76.055 9.097   1.00 164.57 ? 420  GLU A CA  1 
ATOM 3274 C C   . GLU A 1 423  ? -18.262 74.575 9.114   1.00 164.57 ? 420  GLU A C   1 
ATOM 3275 O O   . GLU A 1 423  ? -17.416 73.700 8.900   1.00 164.57 ? 420  GLU A O   1 
ATOM 3276 C CB  . GLU A 1 423  ? -16.592 76.311 9.913   1.00 90.67  ? 420  GLU A CB  1 
ATOM 3277 C CG  . GLU A 1 423  ? -15.943 77.674 9.633   1.00 90.67  ? 420  GLU A CG  1 
ATOM 3278 C CD  . GLU A 1 423  ? -15.462 78.400 10.892  1.00 90.67  ? 420  GLU A CD  1 
ATOM 3279 O OE1 . GLU A 1 423  ? -14.681 77.810 11.664  1.00 90.67  ? 420  GLU A OE1 1 
ATOM 3280 O OE2 . GLU A 1 423  ? -15.859 79.572 11.099  1.00 90.67  ? 420  GLU A OE2 1 
ATOM 3281 N N   . THR A 1 424  ? -19.548 74.308 9.366   1.00 196.88 ? 421  THR A N   1 
ATOM 3282 C CA  . THR A 1 424  ? -20.100 72.948 9.285   1.00 196.88 ? 421  THR A CA  1 
ATOM 3283 C C   . THR A 1 424  ? -20.823 72.728 7.955   1.00 196.88 ? 421  THR A C   1 
ATOM 3284 O O   . THR A 1 424  ? -21.701 73.499 7.567   1.00 196.88 ? 421  THR A O   1 
ATOM 3285 C CB  . THR A 1 424  ? -21.039 72.558 10.489  1.00 92.56  ? 421  THR A CB  1 
ATOM 3286 O OG1 . THR A 1 424  ? -22.422 72.604 10.099  1.00 92.56  ? 421  THR A OG1 1 
ATOM 3287 C CG2 . THR A 1 424  ? -20.794 73.440 11.721  1.00 92.56  ? 421  THR A CG2 1 
ATOM 3288 N N   . TYR A 1 425  ? -20.439 71.657 7.274   1.00 118.73 ? 422  TYR A N   1 
ATOM 3289 C CA  . TYR A 1 425  ? -20.957 71.321 5.959   1.00 118.73 ? 422  TYR A CA  1 
ATOM 3290 C C   . TYR A 1 425  ? -22.177 70.392 6.081   1.00 118.73 ? 422  TYR A C   1 
ATOM 3291 O O   . TYR A 1 425  ? -22.410 69.800 7.140   1.00 118.73 ? 422  TYR A O   1 
ATOM 3292 C CB  . TYR A 1 425  ? -19.837 70.667 5.130   1.00 115.75 ? 422  TYR A CB  1 
ATOM 3293 C CG  . TYR A 1 425  ? -18.587 71.523 4.930   1.00 115.75 ? 422  TYR A CG  1 
ATOM 3294 C CD1 . TYR A 1 425  ? -17.866 72.033 6.023   1.00 115.75 ? 422  TYR A CD1 1 
ATOM 3295 C CD2 . TYR A 1 425  ? -18.108 71.799 3.648   1.00 115.75 ? 422  TYR A CD2 1 
ATOM 3296 C CE1 . TYR A 1 425  ? -16.712 72.813 5.838   1.00 115.75 ? 422  TYR A CE1 1 
ATOM 3297 C CE2 . TYR A 1 425  ? -16.955 72.577 3.451   1.00 115.75 ? 422  TYR A CE2 1 
ATOM 3298 C CZ  . TYR A 1 425  ? -16.263 73.080 4.547   1.00 115.75 ? 422  TYR A CZ  1 
ATOM 3299 O OH  . TYR A 1 425  ? -15.129 73.842 4.351   1.00 115.75 ? 422  TYR A OH  1 
ATOM 3300 N N   . ASP A 1 426  ? -22.958 70.279 5.006   1.00 97.65  ? 423  ASP A N   1 
ATOM 3301 C CA  . ASP A 1 426  ? -24.166 69.438 5.012   1.00 97.65  ? 423  ASP A CA  1 
ATOM 3302 C C   . ASP A 1 426  ? -24.483 68.772 3.662   1.00 97.65  ? 423  ASP A C   1 
ATOM 3303 O O   . ASP A 1 426  ? -25.580 68.218 3.467   1.00 97.65  ? 423  ASP A O   1 
ATOM 3304 C CB  . ASP A 1 426  ? -25.383 70.230 5.532   1.00 108.42 ? 423  ASP A CB  1 
ATOM 3305 C CG  . ASP A 1 426  ? -25.876 71.293 4.550   1.00 108.42 ? 423  ASP A CG  1 
ATOM 3306 O OD1 . ASP A 1 426  ? -27.097 71.569 4.545   1.00 108.42 ? 423  ASP A OD1 1 
ATOM 3307 O OD2 . ASP A 1 426  ? -25.050 71.857 3.798   1.00 108.42 ? 423  ASP A OD2 1 
ATOM 3308 N N   . THR A 1 427  ? -23.506 68.820 2.753   1.00 111.53 ? 424  THR A N   1 
ATOM 3309 C CA  . THR A 1 427  ? -23.627 68.281 1.398   1.00 111.53 ? 424  THR A CA  1 
ATOM 3310 C C   . THR A 1 427  ? -22.374 67.514 1.018   1.00 111.53 ? 424  THR A C   1 
ATOM 3311 O O   . THR A 1 427  ? -21.259 67.952 1.318   1.00 111.53 ? 424  THR A O   1 
ATOM 3312 C CB  . THR A 1 427  ? -23.774 69.412 0.377   1.00 92.63  ? 424  THR A CB  1 
ATOM 3313 O OG1 . THR A 1 427  ? -24.795 70.320 0.803   1.00 92.63  ? 424  THR A OG1 1 
ATOM 3314 C CG2 . THR A 1 427  ? -24.108 68.873 -1.007  1.00 92.63  ? 424  THR A CG2 1 
ATOM 3315 N N   . LEU A 1 428  ? -22.549 66.376 0.354   1.00 104.60 ? 425  LEU A N   1 
ATOM 3316 C CA  . LEU A 1 428  ? -21.400 65.643 -0.167  1.00 104.60 ? 425  LEU A CA  1 
ATOM 3317 C C   . LEU A 1 428  ? -21.484 65.488 -1.671  1.00 104.60 ? 425  LEU A C   1 
ATOM 3318 O O   . LEU A 1 428  ? -22.575 65.387 -2.232  1.00 104.60 ? 425  LEU A O   1 
ATOM 3319 C CB  . LEU A 1 428  ? -21.232 64.281 0.512   1.00 122.23 ? 425  LEU A CB  1 
ATOM 3320 C CG  . LEU A 1 428  ? -19.827 63.658 0.415   1.00 122.23 ? 425  LEU A CG  1 
ATOM 3321 C CD1 . LEU A 1 428  ? -18.726 64.619 0.896   1.00 122.23 ? 425  LEU A CD1 1 
ATOM 3322 C CD2 . LEU A 1 428  ? -19.756 62.334 1.174   1.00 122.23 ? 425  LEU A CD2 1 
ATOM 3323 N N   . VAL A 1 429  ? -20.323 65.476 -2.318  1.00 127.31 ? 426  VAL A N   1 
ATOM 3324 C CA  . VAL A 1 429  ? -20.268 65.405 -3.766  1.00 127.31 ? 426  VAL A CA  1 
ATOM 3325 C C   . VAL A 1 429  ? -19.477 64.194 -4.239  1.00 127.31 ? 426  VAL A C   1 
ATOM 3326 O O   . VAL A 1 429  ? -18.286 64.059 -3.952  1.00 127.31 ? 426  VAL A O   1 
ATOM 3327 C CB  . VAL A 1 429  ? -19.748 66.722 -4.374  1.00 132.65 ? 426  VAL A CB  1 
ATOM 3328 C CG1 . VAL A 1 429  ? -19.294 66.532 -5.819  1.00 132.65 ? 426  VAL A CG1 1 
ATOM 3329 C CG2 . VAL A 1 429  ? -20.839 67.782 -4.290  1.00 132.65 ? 426  VAL A CG2 1 
ATOM 3330 N N   . LEU A 1 430  ? -20.180 63.318 -4.957  1.00 110.23 ? 427  LEU A N   1 
ATOM 3331 C CA  . LEU A 1 430  ? -19.614 62.100 -5.531  1.00 110.23 ? 427  LEU A CA  1 
ATOM 3332 C C   . LEU A 1 430  ? -19.546 62.205 -7.047  1.00 110.23 ? 427  LEU A C   1 
ATOM 3333 O O   . LEU A 1 430  ? -20.550 62.029 -7.735  1.00 110.23 ? 427  LEU A O   1 
ATOM 3334 C CB  . LEU A 1 430  ? -20.448 60.869 -5.137  1.00 101.07 ? 427  LEU A CB  1 
ATOM 3335 C CG  . LEU A 1 430  ? -20.157 60.142 -3.816  1.00 101.07 ? 427  LEU A CG  1 
ATOM 3336 C CD1 . LEU A 1 430  ? -20.380 61.047 -2.613  1.00 101.07 ? 427  LEU A CD1 1 
ATOM 3337 C CD2 . LEU A 1 430  ? -20.999 58.892 -3.692  1.00 101.07 ? 427  LEU A CD2 1 
ATOM 3338 N N   . SER A 1 431  ? -18.357 62.504 -7.559  1.00 108.84 ? 428  SER A N   1 
ATOM 3339 C CA  . SER A 1 431  ? -18.132 62.481 -8.991  1.00 108.84 ? 428  SER A CA  1 
ATOM 3340 C C   . SER A 1 431  ? -17.933 61.043 -9.447  1.00 108.84 ? 428  SER A C   1 
ATOM 3341 O O   . SER A 1 431  ? -17.116 60.303 -8.892  1.00 108.84 ? 428  SER A O   1 
ATOM 3342 C CB  . SER A 1 431  ? -16.923 63.329 -9.375  1.00 125.79 ? 428  SER A CB  1 
ATOM 3343 O OG  . SER A 1 431  ? -15.717 62.730 -8.935  1.00 125.79 ? 428  SER A OG  1 
ATOM 3344 N N   . PHE A 1 432  ? -18.707 60.655 -10.450 1.00 81.63  ? 429  PHE A N   1 
ATOM 3345 C CA  . PHE A 1 432  ? -18.573 59.352 -11.069 1.00 81.63  ? 429  PHE A CA  1 
ATOM 3346 C C   . PHE A 1 432  ? -17.995 59.512 -12.456 1.00 81.63  ? 429  PHE A C   1 
ATOM 3347 O O   . PHE A 1 432  ? -17.922 60.620 -12.992 1.00 81.63  ? 429  PHE A O   1 
ATOM 3348 C CB  . PHE A 1 432  ? -19.923 58.628 -11.131 1.00 109.06 ? 429  PHE A CB  1 
ATOM 3349 C CG  . PHE A 1 432  ? -20.507 58.346 -9.787  1.00 109.06 ? 429  PHE A CG  1 
ATOM 3350 C CD1 . PHE A 1 432  ? -21.502 59.160 -9.267  1.00 109.06 ? 429  PHE A CD1 1 
ATOM 3351 C CD2 . PHE A 1 432  ? -20.040 57.282 -9.025  1.00 109.06 ? 429  PHE A CD2 1 
ATOM 3352 C CE1 . PHE A 1 432  ? -22.036 58.914 -8.013  1.00 109.06 ? 429  PHE A CE1 1 
ATOM 3353 C CE2 . PHE A 1 432  ? -20.565 57.027 -7.768  1.00 109.06 ? 429  PHE A CE2 1 
ATOM 3354 C CZ  . PHE A 1 432  ? -21.568 57.845 -7.260  1.00 109.06 ? 429  PHE A CZ  1 
ATOM 3355 N N   . VAL A 1 433  ? -17.589 58.381 -13.017 1.00 95.55  ? 430  VAL A N   1 
ATOM 3356 C CA  . VAL A 1 433  ? -16.989 58.292 -14.337 1.00 95.55  ? 430  VAL A CA  1 
ATOM 3357 C C   . VAL A 1 433  ? -17.548 59.311 -15.320 1.00 95.55  ? 430  VAL A C   1 
ATOM 3358 O O   . VAL A 1 433  ? -16.834 60.213 -15.756 1.00 95.55  ? 430  VAL A O   1 
ATOM 3359 C CB  . VAL A 1 433  ? -17.171 56.880 -14.911 1.00 70.88  ? 430  VAL A CB  1 
ATOM 3360 C CG1 . VAL A 1 433  ? -16.384 56.727 -16.229 1.00 70.88  ? 430  VAL A CG1 1 
ATOM 3361 C CG2 . VAL A 1 433  ? -16.780 55.809 -13.844 1.00 70.88  ? 430  VAL A CG2 1 
ATOM 3362 N N   . GLY A 1 434  ? -18.823 59.168 -15.662 1.00 85.32  ? 431  GLY A N   1 
ATOM 3363 C CA  . GLY A 1 434  ? -19.427 60.049 -16.647 1.00 85.32  ? 431  GLY A CA  1 
ATOM 3364 C C   . GLY A 1 434  ? -20.337 61.079 -16.025 1.00 85.32  ? 431  GLY A C   1 
ATOM 3365 O O   . GLY A 1 434  ? -20.699 62.069 -16.666 1.00 85.32  ? 431  GLY A O   1 
ATOM 3366 N N   . GLN A 1 435  ? -20.699 60.845 -14.768 1.00 121.07 ? 432  GLN A N   1 
ATOM 3367 C CA  . GLN A 1 435  ? -21.749 61.609 -14.117 1.00 121.07 ? 432  GLN A CA  1 
ATOM 3368 C C   . GLN A 1 435  ? -21.272 62.396 -12.902 1.00 121.07 ? 432  GLN A C   1 
ATOM 3369 O O   . GLN A 1 435  ? -20.071 62.527 -12.655 1.00 121.07 ? 432  GLN A O   1 
ATOM 3370 C CB  . GLN A 1 435  ? -22.895 60.678 -13.712 1.00 107.46 ? 432  GLN A CB  1 
ATOM 3371 C CG  . GLN A 1 435  ? -23.818 60.267 -14.858 1.00 107.46 ? 432  GLN A CG  1 
ATOM 3372 C CD  . GLN A 1 435  ? -25.276 60.102 -14.423 1.00 107.46 ? 432  GLN A CD  1 
ATOM 3373 O OE1 . GLN A 1 435  ? -26.189 60.546 -15.118 1.00 107.46 ? 432  GLN A OE1 1 
ATOM 3374 N NE2 . GLN A 1 435  ? -25.494 59.475 -13.266 1.00 107.46 ? 432  GLN A NE2 1 
ATOM 3375 N N   . THR A 1 436  ? -22.245 62.941 -12.175 1.00 177.02 ? 433  THR A N   1 
ATOM 3376 C CA  . THR A 1 436  ? -22.042 63.594 -10.888 1.00 177.02 ? 433  THR A CA  1 
ATOM 3377 C C   . THR A 1 436  ? -23.379 63.583 -10.143 1.00 177.02 ? 433  THR A C   1 
ATOM 3378 O O   . THR A 1 436  ? -24.375 64.106 -10.644 1.00 177.02 ? 433  THR A O   1 
ATOM 3379 C CB  . THR A 1 436  ? -21.548 65.052 -11.050 1.00 81.67  ? 433  THR A CB  1 
ATOM 3380 O OG1 . THR A 1 436  ? -20.365 65.080 -11.855 1.00 81.67  ? 433  THR A OG1 1 
ATOM 3381 C CG2 . THR A 1 436  ? -21.246 65.685 -9.688  1.00 81.67  ? 433  THR A CG2 1 
ATOM 3382 N N   . ARG A 1 437  ? -23.402 62.963 -8.963  1.00 120.16 ? 434  ARG A N   1 
ATOM 3383 C CA  . ARG A 1 437  ? -24.578 63.009 -8.086  1.00 120.16 ? 434  ARG A CA  1 
ATOM 3384 C C   . ARG A 1 437  ? -24.246 63.605 -6.723  1.00 120.16 ? 434  ARG A C   1 
ATOM 3385 O O   . ARG A 1 437  ? -23.252 63.247 -6.093  1.00 120.16 ? 434  ARG A O   1 
ATOM 3386 C CB  . ARG A 1 437  ? -25.251 61.638 -7.952  1.00 125.88 ? 434  ARG A CB  1 
ATOM 3387 C CG  . ARG A 1 437  ? -26.306 61.356 -9.029  1.00 125.88 ? 434  ARG A CG  1 
ATOM 3388 C CD  . ARG A 1 437  ? -26.931 59.985 -8.845  1.00 125.88 ? 434  ARG A CD  1 
ATOM 3389 N NE  . ARG A 1 437  ? -25.947 58.913 -9.009  1.00 125.88 ? 434  ARG A NE  1 
ATOM 3390 C CZ  . ARG A 1 437  ? -25.865 57.832 -8.235  1.00 125.88 ? 434  ARG A CZ  1 
ATOM 3391 N NH1 . ARG A 1 437  ? -26.701 57.660 -7.218  1.00 125.88 ? 434  ARG A NH1 1 
ATOM 3392 N NH2 . ARG A 1 437  ? -24.933 56.922 -8.470  1.00 125.88 ? 434  ARG A NH2 1 
ATOM 3393 N N   . VAL A 1 438  ? -25.094 64.533 -6.298  1.00 124.63 ? 435  VAL A N   1 
ATOM 3394 C CA  . VAL A 1 438  ? -24.891 65.314 -5.087  1.00 124.63 ? 435  VAL A CA  1 
ATOM 3395 C C   . VAL A 1 438  ? -25.654 64.657 -3.940  1.00 124.63 ? 435  VAL A C   1 
ATOM 3396 O O   . VAL A 1 438  ? -26.647 63.965 -4.173  1.00 124.63 ? 435  VAL A O   1 
ATOM 3397 C CB  . VAL A 1 438  ? -25.409 66.757 -5.276  1.00 133.81 ? 435  VAL A CB  1 
ATOM 3398 C CG1 . VAL A 1 438  ? -24.677 67.700 -4.357  1.00 133.81 ? 435  VAL A CG1 1 
ATOM 3399 C CG2 . VAL A 1 438  ? -25.244 67.213 -6.725  1.00 133.81 ? 435  VAL A CG2 1 
ATOM 3400 N N   . LEU A 1 439  ? -25.192 64.879 -2.710  1.00 200.23 ? 436  LEU A N   1 
ATOM 3401 C CA  . LEU A 1 439  ? -25.854 64.341 -1.519  1.00 200.23 ? 436  LEU A CA  1 
ATOM 3402 C C   . LEU A 1 439  ? -26.199 65.424 -0.501  1.00 200.23 ? 436  LEU A C   1 
ATOM 3403 O O   . LEU A 1 439  ? -25.422 66.372 -0.300  1.00 200.23 ? 436  LEU A O   1 
ATOM 3404 C CB  . LEU A 1 439  ? -24.995 63.265 -0.844  1.00 102.85 ? 436  LEU A CB  1 
ATOM 3405 C CG  . LEU A 1 439  ? -24.470 62.054 -1.625  1.00 102.85 ? 436  LEU A CG  1 
ATOM 3406 C CD1 . LEU A 1 439  ? -23.666 61.135 -0.713  1.00 102.85 ? 436  LEU A CD1 1 
ATOM 3407 C CD2 . LEU A 1 439  ? -25.577 61.271 -2.312  1.00 102.85 ? 436  LEU A CD2 1 
ATOM 3408 N N   . MET A 1 440  ? -27.370 65.266 0.135   1.00 112.44 ? 437  MET A N   1 
ATOM 3409 C CA  . MET A 1 440  ? -27.814 66.156 1.209   1.00 112.44 ? 437  MET A CA  1 
ATOM 3410 C C   . MET A 1 440  ? -27.553 65.455 2.549   1.00 112.44 ? 437  MET A C   1 
ATOM 3411 O O   . MET A 1 440  ? -27.301 64.247 2.581   1.00 112.44 ? 437  MET A O   1 
ATOM 3412 C CB  . MET A 1 440  ? -29.303 66.479 1.017   1.00 200.23 ? 437  MET A CB  1 
ATOM 3413 C CG  . MET A 1 440  ? -29.876 67.567 1.921   1.00 200.23 ? 437  MET A CG  1 
ATOM 3414 S SD  . MET A 1 440  ? -30.628 66.928 3.439   1.00 200.23 ? 437  MET A SD  1 
ATOM 3415 C CE  . MET A 1 440  ? -32.117 66.155 2.808   1.00 200.23 ? 437  MET A CE  1 
ATOM 3416 N N   . LEU A 1 441  ? -27.596 66.203 3.648   1.00 200.23 ? 438  LEU A N   1 
ATOM 3417 C CA  . LEU A 1 441  ? -27.402 65.610 4.970   1.00 200.23 ? 438  LEU A CA  1 
ATOM 3418 C C   . LEU A 1 441  ? -28.351 66.170 6.027   1.00 200.23 ? 438  LEU A C   1 
ATOM 3419 O O   . LEU A 1 441  ? -28.213 67.320 6.449   1.00 200.23 ? 438  LEU A O   1 
ATOM 3420 C CB  . LEU A 1 441  ? -25.944 65.756 5.419   1.00 87.08  ? 438  LEU A CB  1 
ATOM 3421 C CG  . LEU A 1 441  ? -24.867 65.023 4.613   1.00 87.08  ? 438  LEU A CG  1 
ATOM 3422 C CD1 . LEU A 1 441  ? -23.492 65.539 4.970   1.00 87.08  ? 438  LEU A CD1 1 
ATOM 3423 C CD2 . LEU A 1 441  ? -24.940 63.525 4.839   1.00 87.08  ? 438  LEU A CD2 1 
ATOM 3424 N N   . ASN A 1 442  ? -29.314 65.350 6.444   1.00 190.02 ? 439  ASN A N   1 
ATOM 3425 C CA  . ASN A 1 442  ? -30.265 65.732 7.489   1.00 190.02 ? 439  ASN A CA  1 
ATOM 3426 C C   . ASN A 1 442  ? -29.613 65.707 8.871   1.00 190.02 ? 439  ASN A C   1 
ATOM 3427 O O   . ASN A 1 442  ? -29.845 66.592 9.699   1.00 190.02 ? 439  ASN A O   1 
ATOM 3428 C CB  . ASN A 1 442  ? -31.496 64.816 7.459   1.00 125.88 ? 439  ASN A CB  1 
ATOM 3429 C CG  . ASN A 1 442  ? -32.716 65.427 8.162   1.00 125.88 ? 439  ASN A CG  1 
ATOM 3430 O OD1 . ASN A 1 442  ? -33.546 64.707 8.733   1.00 125.88 ? 439  ASN A OD1 1 
ATOM 3431 N ND2 . ASN A 1 442  ? -32.834 66.753 8.108   1.00 125.88 ? 439  ASN A ND2 1 
ATOM 3432 N N   . GLY A 1 443  ? -28.801 64.682 9.107   1.00 99.25  ? 440  GLY A N   1 
ATOM 3433 C CA  . GLY A 1 443  ? -27.999 64.576 10.313  1.00 99.25  ? 440  GLY A CA  1 
ATOM 3434 C C   . GLY A 1 443  ? -27.093 63.385 10.132  1.00 99.25  ? 440  GLY A C   1 
ATOM 3435 O O   . GLY A 1 443  ? -25.937 63.520 9.720   1.00 99.25  ? 440  GLY A O   1 
ATOM 3436 N N   . GLU A 1 444  ? -27.642 62.212 10.432  1.00 111.89 ? 441  GLU A N   1 
ATOM 3437 C CA  . GLU A 1 444  ? -26.980 60.941 10.175  1.00 111.89 ? 441  GLU A CA  1 
ATOM 3438 C C   . GLU A 1 444  ? -27.602 60.330 8.917   1.00 111.89 ? 441  GLU A C   1 
ATOM 3439 O O   . GLU A 1 444  ? -27.326 59.180 8.564   1.00 111.89 ? 441  GLU A O   1 
ATOM 3440 C CB  . GLU A 1 444  ? -27.117 60.005 11.383  1.00 156.69 ? 441  GLU A CB  1 
ATOM 3441 C CG  . GLU A 1 444  ? -26.789 60.653 12.745  1.00 156.69 ? 441  GLU A CG  1 
ATOM 3442 C CD  . GLU A 1 444  ? -25.316 60.551 13.160  1.00 156.69 ? 441  GLU A CD  1 
ATOM 3443 O OE1 . GLU A 1 444  ? -24.894 61.335 14.042  1.00 156.69 ? 441  GLU A OE1 1 
ATOM 3444 O OE2 . GLU A 1 444  ? -24.584 59.686 12.630  1.00 156.69 ? 441  GLU A OE2 1 
ATOM 3445 N N   . GLU A 1 445  ? -28.434 61.128 8.245   1.00 154.63 ? 442  GLU A N   1 
ATOM 3446 C CA  . GLU A 1 445  ? -29.094 60.732 7.002   1.00 154.63 ? 442  GLU A CA  1 
ATOM 3447 C C   . GLU A 1 445  ? -28.441 61.311 5.750   1.00 154.63 ? 442  GLU A C   1 
ATOM 3448 O O   . GLU A 1 445  ? -27.807 62.368 5.795   1.00 154.63 ? 442  GLU A O   1 
ATOM 3449 C CB  . GLU A 1 445  ? -30.579 61.101 7.031   1.00 126.61 ? 442  GLU A CB  1 
ATOM 3450 C CG  . GLU A 1 445  ? -31.469 60.044 7.665   1.00 126.61 ? 442  GLU A CG  1 
ATOM 3451 C CD  . GLU A 1 445  ? -31.629 58.784 6.815   1.00 126.61 ? 442  GLU A CD  1 
ATOM 3452 O OE1 . GLU A 1 445  ? -30.698 58.416 6.059   1.00 126.61 ? 442  GLU A OE1 1 
ATOM 3453 O OE2 . GLU A 1 445  ? -32.699 58.149 6.919   1.00 126.61 ? 442  GLU A OE2 1 
ATOM 3454 N N   . VAL A 1 446  ? -28.624 60.613 4.632   1.00 85.82  ? 443  VAL A N   1 
ATOM 3455 C CA  . VAL A 1 446  ? -27.930 60.923 3.384   1.00 85.82  ? 443  VAL A CA  1 
ATOM 3456 C C   . VAL A 1 446  ? -28.858 60.661 2.184   1.00 85.82  ? 443  VAL A C   1 
ATOM 3457 O O   . VAL A 1 446  ? -29.031 59.515 1.754   1.00 85.82  ? 443  VAL A O   1 
ATOM 3458 C CB  . VAL A 1 446  ? -26.627 60.063 3.236   1.00 108.83 ? 443  VAL A CB  1 
ATOM 3459 C CG1 . VAL A 1 446  ? -25.773 60.576 2.101   1.00 108.83 ? 443  VAL A CG1 1 
ATOM 3460 C CG2 . VAL A 1 446  ? -25.807 60.028 4.534   1.00 108.83 ? 443  VAL A CG2 1 
ATOM 3461 N N   . GLU A 1 447  ? -29.456 61.729 1.659   1.00 184.30 ? 444  GLU A N   1 
ATOM 3462 C CA  . GLU A 1 447  ? -30.367 61.647 0.515   1.00 184.30 ? 444  GLU A CA  1 
ATOM 3463 C C   . GLU A 1 447  ? -29.711 62.261 -0.726  1.00 184.30 ? 444  GLU A C   1 
ATOM 3464 O O   . GLU A 1 447  ? -28.806 63.088 -0.596  1.00 184.30 ? 444  GLU A O   1 
ATOM 3465 C CB  . GLU A 1 447  ? -31.674 62.373 0.833   1.00 185.46 ? 444  GLU A CB  1 
ATOM 3466 C CG  . GLU A 1 447  ? -32.810 62.079 -0.136  1.00 185.46 ? 444  GLU A CG  1 
ATOM 3467 C CD  . GLU A 1 447  ? -33.544 63.333 -0.582  1.00 185.46 ? 444  GLU A CD  1 
ATOM 3468 O OE1 . GLU A 1 447  ? -33.356 64.399 0.045   1.00 185.46 ? 444  GLU A OE1 1 
ATOM 3469 O OE2 . GLU A 1 447  ? -34.309 63.251 -1.567  1.00 185.46 ? 444  GLU A OE2 1 
ATOM 3470 N N   . GLU A 1 448  ? -30.176 61.871 -1.917  1.00 100.28 ? 445  GLU A N   1 
ATOM 3471 C CA  . GLU A 1 448  ? -29.489 62.225 -3.178  1.00 100.28 ? 445  GLU A CA  1 
ATOM 3472 C C   . GLU A 1 448  ? -30.239 63.116 -4.193  1.00 100.28 ? 445  GLU A C   1 
ATOM 3473 O O   . GLU A 1 448  ? -30.518 62.693 -5.317  1.00 100.28 ? 445  GLU A O   1 
ATOM 3474 C CB  . GLU A 1 448  ? -28.884 60.980 -3.861  1.00 167.55 ? 445  GLU A CB  1 
ATOM 3475 C CG  . GLU A 1 448  ? -29.582 59.660 -3.562  1.00 167.55 ? 445  GLU A CG  1 
ATOM 3476 C CD  . GLU A 1 448  ? -28.710 58.463 -3.874  1.00 167.55 ? 445  GLU A CD  1 
ATOM 3477 O OE1 . GLU A 1 448  ? -28.457 57.657 -2.955  1.00 167.55 ? 445  GLU A OE1 1 
ATOM 3478 O OE2 . GLU A 1 448  ? -28.268 58.334 -5.034  1.00 167.55 ? 445  GLU A OE2 1 
ATOM 3479 N N   . THR A 1 449  ? -30.539 64.348 -3.799  1.00 163.16 ? 446  THR A N   1 
ATOM 3480 C CA  . THR A 1 449  ? -30.997 65.356 -4.752  1.00 163.16 ? 446  THR A CA  1 
ATOM 3481 C C   . THR A 1 449  ? -29.823 66.248 -5.164  1.00 163.16 ? 446  THR A C   1 
ATOM 3482 O O   . THR A 1 449  ? -28.732 66.169 -4.571  1.00 163.16 ? 446  THR A O   1 
ATOM 3483 C CB  . THR A 1 449  ? -32.167 66.200 -4.204  1.00 163.28 ? 446  THR A CB  1 
ATOM 3484 O OG1 . THR A 1 449  ? -31.838 66.682 -2.897  1.00 163.28 ? 446  THR A OG1 1 
ATOM 3485 C CG2 . THR A 1 449  ? -33.448 65.371 -4.132  1.00 163.28 ? 446  THR A CG2 1 
ATOM 3486 N N   . GLU A 1 450  ? -30.043 67.085 -6.184  1.00 95.62  ? 447  GLU A N   1 
ATOM 3487 C CA  . GLU A 1 450  ? -28.969 67.905 -6.749  1.00 95.62  ? 447  GLU A CA  1 
ATOM 3488 C C   . GLU A 1 450  ? -29.172 69.396 -6.478  1.00 95.62  ? 447  GLU A C   1 
ATOM 3489 O O   . GLU A 1 450  ? -30.229 69.803 -6.002  1.00 95.62  ? 447  GLU A O   1 
ATOM 3490 C CB  . GLU A 1 450  ? -28.818 67.628 -8.252  1.00 178.32 ? 447  GLU A CB  1 
ATOM 3491 C CG  . GLU A 1 450  ? -30.122 67.734 -9.042  1.00 178.32 ? 447  GLU A CG  1 
ATOM 3492 C CD  . GLU A 1 450  ? -30.381 66.533 -9.938  1.00 178.32 ? 447  GLU A CD  1 
ATOM 3493 O OE1 . GLU A 1 450  ? -29.738 65.475 -9.748  1.00 178.32 ? 447  GLU A OE1 1 
ATOM 3494 O OE2 . GLU A 1 450  ? -31.249 66.644 -10.829 1.00 178.32 ? 447  GLU A OE2 1 
ATOM 3495 N N   . LEU A 1 451  ? -28.146 70.197 -6.765  1.00 175.54 ? 448  LEU A N   1 
ATOM 3496 C CA  . LEU A 1 451  ? -28.220 71.648 -6.590  1.00 175.54 ? 448  LEU A CA  1 
ATOM 3497 C C   . LEU A 1 451  ? -28.560 72.340 -7.904  1.00 175.54 ? 448  LEU A C   1 
ATOM 3498 O O   . LEU A 1 451  ? -27.972 72.033 -8.945  1.00 175.54 ? 448  LEU A O   1 
ATOM 3499 C CB  . LEU A 1 451  ? -26.908 72.201 -6.011  1.00 82.27  ? 448  LEU A CB  1 
ATOM 3500 C CG  . LEU A 1 451  ? -26.766 72.541 -4.517  1.00 82.27  ? 448  LEU A CG  1 
ATOM 3501 C CD1 . LEU A 1 451  ? -27.401 71.509 -3.556  1.00 82.27  ? 448  LEU A CD1 1 
ATOM 3502 C CD2 . LEU A 1 451  ? -25.288 72.750 -4.198  1.00 82.27  ? 448  LEU A CD2 1 
ATOM 3503 N N   . MET A 1 452  ? -29.513 73.271 -7.840  1.00 157.95 ? 449  MET A N   1 
ATOM 3504 C CA  . MET A 1 452  ? -29.990 74.004 -9.013  1.00 157.95 ? 449  MET A CA  1 
ATOM 3505 C C   . MET A 1 452  ? -28.919 75.008 -9.449  1.00 157.95 ? 449  MET A C   1 
ATOM 3506 O O   . MET A 1 452  ? -28.947 76.187 -9.077  1.00 157.95 ? 449  MET A O   1 
ATOM 3507 C CB  . MET A 1 452  ? -31.329 74.701 -8.715  1.00 142.28 ? 449  MET A CB  1 
ATOM 3508 C CG  . MET A 1 452  ? -32.501 74.329 -9.650  1.00 142.28 ? 449  MET A CG  1 
ATOM 3509 S SD  . MET A 1 452  ? -32.409 74.942 -11.358 1.00 142.28 ? 449  MET A SD  1 
ATOM 3510 C CE  . MET A 1 452  ? -31.885 73.478 -12.266 1.00 142.28 ? 449  MET A CE  1 
ATOM 3511 N N   . GLY A 1 453  ? -27.974 74.509 -10.239 1.00 155.89 ? 450  GLY A N   1 
ATOM 3512 C CA  . GLY A 1 453  ? -26.803 75.265 -10.671 1.00 155.89 ? 450  GLY A CA  1 
ATOM 3513 C C   . GLY A 1 453  ? -25.627 74.333 -10.909 1.00 155.89 ? 450  GLY A C   1 
ATOM 3514 O O   . GLY A 1 453  ? -24.566 74.763 -11.367 1.00 155.89 ? 450  GLY A O   1 
ATOM 3515 N N   . PHE A 1 454  ? -25.831 73.051 -10.601 1.00 158.26 ? 451  PHE A N   1 
ATOM 3516 C CA  . PHE A 1 454  ? -24.814 72.014 -10.764 1.00 158.26 ? 451  PHE A CA  1 
ATOM 3517 C C   . PHE A 1 454  ? -25.185 71.040 -11.870 1.00 158.26 ? 451  PHE A C   1 
ATOM 3518 O O   . PHE A 1 454  ? -26.327 70.580 -11.939 1.00 158.26 ? 451  PHE A O   1 
ATOM 3519 C CB  . PHE A 1 454  ? -24.626 71.246 -9.453  1.00 92.04  ? 451  PHE A CB  1 
ATOM 3520 C CG  . PHE A 1 454  ? -23.490 71.751 -8.604  1.00 92.04  ? 451  PHE A CG  1 
ATOM 3521 C CD1 . PHE A 1 454  ? -23.380 73.106 -8.282  1.00 92.04  ? 451  PHE A CD1 1 
ATOM 3522 C CD2 . PHE A 1 454  ? -22.533 70.866 -8.108  1.00 92.04  ? 451  PHE A CD2 1 
ATOM 3523 C CE1 . PHE A 1 454  ? -22.324 73.578 -7.487  1.00 92.04  ? 451  PHE A CE1 1 
ATOM 3524 C CE2 . PHE A 1 454  ? -21.471 71.326 -7.313  1.00 92.04  ? 451  PHE A CE2 1 
ATOM 3525 C CZ  . PHE A 1 454  ? -21.370 72.688 -7.001  1.00 92.04  ? 451  PHE A CZ  1 
ATOM 3526 N N   . VAL A 1 455  ? -24.220 70.730 -12.735 1.00 74.01  ? 452  VAL A N   1 
ATOM 3527 C CA  . VAL A 1 455  ? -24.423 69.696 -13.740 1.00 74.01  ? 452  VAL A CA  1 
ATOM 3528 C C   . VAL A 1 455  ? -24.310 68.331 -13.092 1.00 74.01  ? 452  VAL A C   1 
ATOM 3529 O O   . VAL A 1 455  ? -23.647 68.177 -12.068 1.00 74.01  ? 452  VAL A O   1 
ATOM 3530 C CB  . VAL A 1 455  ? -23.438 69.780 -14.927 1.00 58.59  ? 452  VAL A CB  1 
ATOM 3531 C CG1 . VAL A 1 455  ? -23.688 71.029 -15.722 1.00 58.59  ? 452  VAL A CG1 1 
ATOM 3532 C CG2 . VAL A 1 455  ? -21.970 69.677 -14.470 1.00 58.59  ? 452  VAL A CG2 1 
ATOM 3533 N N   . ASP A 1 456  ? -24.957 67.355 -13.714 1.00 92.33  ? 453  ASP A N   1 
ATOM 3534 C CA  . ASP A 1 456  ? -25.063 66.009 -13.192 1.00 92.33  ? 453  ASP A CA  1 
ATOM 3535 C C   . ASP A 1 456  ? -24.748 64.989 -14.275 1.00 92.33  ? 453  ASP A C   1 
ATOM 3536 O O   . ASP A 1 456  ? -24.520 63.814 -13.978 1.00 92.33  ? 453  ASP A O   1 
ATOM 3537 C CB  . ASP A 1 456  ? -26.470 65.780 -12.637 1.00 150.14 ? 453  ASP A CB  1 
ATOM 3538 C CG  . ASP A 1 456  ? -27.532 66.539 -13.412 1.00 150.14 ? 453  ASP A CG  1 
ATOM 3539 O OD1 . ASP A 1 456  ? -27.763 66.206 -14.593 1.00 150.14 ? 453  ASP A OD1 1 
ATOM 3540 O OD2 . ASP A 1 456  ? -28.132 67.473 -12.838 1.00 150.14 ? 453  ASP A OD2 1 
ATOM 3541 N N   . ASP A 1 457  ? -24.734 65.449 -15.527 1.00 132.12 ? 454  ASP A N   1 
ATOM 3542 C CA  . ASP A 1 457  ? -24.432 64.596 -16.681 1.00 132.12 ? 454  ASP A CA  1 
ATOM 3543 C C   . ASP A 1 457  ? -22.947 64.591 -17.081 1.00 132.12 ? 454  ASP A C   1 
ATOM 3544 O O   . ASP A 1 457  ? -22.523 63.780 -17.910 1.00 132.12 ? 454  ASP A O   1 
ATOM 3545 C CB  . ASP A 1 457  ? -25.339 64.932 -17.884 1.00 126.48 ? 454  ASP A CB  1 
ATOM 3546 C CG  . ASP A 1 457  ? -25.495 66.437 -18.125 1.00 126.48 ? 454  ASP A CG  1 
ATOM 3547 O OD1 . ASP A 1 457  ? -26.542 66.832 -18.688 1.00 126.48 ? 454  ASP A OD1 1 
ATOM 3548 O OD2 . ASP A 1 457  ? -24.585 67.221 -17.768 1.00 126.48 ? 454  ASP A OD2 1 
ATOM 3549 N N   . GLN A 1 458  ? -22.172 65.497 -16.484 1.00 120.11 ? 455  GLN A N   1 
ATOM 3550 C CA  . GLN A 1 458  ? -20.724 65.577 -16.694 1.00 120.11 ? 455  GLN A CA  1 
ATOM 3551 C C   . GLN A 1 458  ? -19.977 65.105 -15.444 1.00 120.11 ? 455  GLN A C   1 
ATOM 3552 O O   . GLN A 1 458  ? -20.577 64.965 -14.376 1.00 120.11 ? 455  GLN A O   1 
ATOM 3553 C CB  . GLN A 1 458  ? -20.312 67.013 -17.034 1.00 140.04 ? 455  GLN A CB  1 
ATOM 3554 C CG  . GLN A 1 458  ? -21.110 67.668 -18.157 1.00 140.04 ? 455  GLN A CG  1 
ATOM 3555 C CD  . GLN A 1 458  ? -20.612 67.307 -19.550 1.00 140.04 ? 455  GLN A CD  1 
ATOM 3556 O OE1 . GLN A 1 458  ? -20.806 68.069 -20.497 1.00 140.04 ? 455  GLN A OE1 1 
ATOM 3557 N NE2 . GLN A 1 458  ? -19.973 66.149 -19.682 1.00 140.04 ? 455  GLN A NE2 1 
ATOM 3558 N N   . GLN A 1 459  ? -18.675 64.857 -15.570 1.00 111.16 ? 456  GLN A N   1 
ATOM 3559 C CA  . GLN A 1 459  ? -17.874 64.469 -14.413 1.00 111.16 ? 456  GLN A CA  1 
ATOM 3560 C C   . GLN A 1 459  ? -17.168 65.658 -13.760 1.00 111.16 ? 456  GLN A C   1 
ATOM 3561 O O   . GLN A 1 459  ? -16.529 66.474 -14.433 1.00 111.16 ? 456  GLN A O   1 
ATOM 3562 C CB  . GLN A 1 459  ? -16.865 63.378 -14.760 1.00 152.57 ? 456  GLN A CB  1 
ATOM 3563 C CG  . GLN A 1 459  ? -16.002 62.971 -13.573 1.00 152.57 ? 456  GLN A CG  1 
ATOM 3564 C CD  . GLN A 1 459  ? -14.982 61.915 -13.913 1.00 152.57 ? 456  GLN A CD  1 
ATOM 3565 O OE1 . GLN A 1 459  ? -14.942 60.862 -13.286 1.00 152.57 ? 456  GLN A OE1 1 
ATOM 3566 N NE2 . GLN A 1 459  ? -14.149 62.187 -14.907 1.00 152.57 ? 456  GLN A NE2 1 
ATOM 3567 N N   . THR A 1 460  ? -17.288 65.728 -12.438 1.00 95.50  ? 457  THR A N   1 
ATOM 3568 C CA  . THR A 1 460  ? -16.752 66.818 -11.647 1.00 95.50  ? 457  THR A CA  1 
ATOM 3569 C C   . THR A 1 460  ? -15.304 66.511 -11.278 1.00 95.50  ? 457  THR A C   1 
ATOM 3570 O O   . THR A 1 460  ? -14.997 65.400 -10.852 1.00 95.50  ? 457  THR A O   1 
ATOM 3571 C CB  . THR A 1 460  ? -17.609 66.992 -10.374 1.00 80.98  ? 457  THR A CB  1 
ATOM 3572 O OG1 . THR A 1 460  ? -18.854 67.628 -10.706 1.00 80.98  ? 457  THR A OG1 1 
ATOM 3573 C CG2 . THR A 1 460  ? -16.891 67.808 -9.328  1.00 80.98  ? 457  THR A CG2 1 
ATOM 3574 N N   . PHE A 1 461  ? -14.419 67.490 -11.465 1.00 61.02  ? 458  PHE A N   1 
ATOM 3575 C CA  . PHE A 1 461  ? -13.008 67.396 -11.021 1.00 61.02  ? 458  PHE A CA  1 
ATOM 3576 C C   . PHE A 1 461  ? -12.724 68.231 -9.772  1.00 61.02  ? 458  PHE A C   1 
ATOM 3577 O O   . PHE A 1 461  ? -11.638 68.172 -9.204  1.00 61.02  ? 458  PHE A O   1 
ATOM 3578 C CB  . PHE A 1 461  ? -12.017 67.819 -12.126 1.00 95.49  ? 458  PHE A CB  1 
ATOM 3579 C CG  . PHE A 1 461  ? -12.032 66.939 -13.345 1.00 95.49  ? 458  PHE A CG  1 
ATOM 3580 C CD1 . PHE A 1 461  ? -12.199 65.558 -13.237 1.00 95.49  ? 458  PHE A CD1 1 
ATOM 3581 C CD2 . PHE A 1 461  ? -11.851 67.492 -14.607 1.00 95.49  ? 458  PHE A CD2 1 
ATOM 3582 C CE1 . PHE A 1 461  ? -12.217 64.743 -14.371 1.00 95.49  ? 458  PHE A CE1 1 
ATOM 3583 C CE2 . PHE A 1 461  ? -11.857 66.691 -15.747 1.00 95.49  ? 458  PHE A CE2 1 
ATOM 3584 C CZ  . PHE A 1 461  ? -12.044 65.312 -15.629 1.00 95.49  ? 458  PHE A CZ  1 
ATOM 3585 N N   . PHE A 1 462  ? -13.691 69.040 -9.371  1.00 60.33  ? 459  PHE A N   1 
ATOM 3586 C CA  . PHE A 1 462  ? -13.574 69.822 -8.154  1.00 60.33  ? 459  PHE A CA  1 
ATOM 3587 C C   . PHE A 1 462  ? -14.939 70.298 -7.681  1.00 60.33  ? 459  PHE A C   1 
ATOM 3588 O O   . PHE A 1 462  ? -15.835 70.554 -8.490  1.00 60.33  ? 459  PHE A O   1 
ATOM 3589 C CB  . PHE A 1 462  ? -12.598 71.012 -8.294  1.00 66.13  ? 459  PHE A CB  1 
ATOM 3590 C CG  . PHE A 1 462  ? -12.265 71.644 -6.979  1.00 66.13  ? 459  PHE A CG  1 
ATOM 3591 C CD1 . PHE A 1 462  ? -11.285 71.092 -6.158  1.00 66.13  ? 459  PHE A CD1 1 
ATOM 3592 C CD2 . PHE A 1 462  ? -12.983 72.739 -6.513  1.00 66.13  ? 459  PHE A CD2 1 
ATOM 3593 C CE1 . PHE A 1 462  ? -11.002 71.649 -4.901  1.00 66.13  ? 459  PHE A CE1 1 
ATOM 3594 C CE2 . PHE A 1 462  ? -12.707 73.293 -5.266  1.00 66.13  ? 459  PHE A CE2 1 
ATOM 3595 C CZ  . PHE A 1 462  ? -11.715 72.750 -4.463  1.00 66.13  ? 459  PHE A CZ  1 
ATOM 3596 N N   . CYS A 1 463  ? -15.082 70.403 -6.363  1.00 175.92 ? 460  CYS A N   1 
ATOM 3597 C CA  . CYS A 1 463  ? -16.272 70.954 -5.738  1.00 175.92 ? 460  CYS A CA  1 
ATOM 3598 C C   . CYS A 1 463  ? -15.914 71.534 -4.368  1.00 175.92 ? 460  CYS A C   1 
ATOM 3599 O O   . CYS A 1 463  ? -15.785 70.811 -3.381  1.00 175.92 ? 460  CYS A O   1 
ATOM 3600 C CB  . CYS A 1 463  ? -17.362 69.884 -5.635  1.00 169.66 ? 460  CYS A CB  1 
ATOM 3601 S SG  . CYS A 1 463  ? -18.621 70.222 -4.412  1.00 169.66 ? 460  CYS A SG  1 
ATOM 3602 N N   . GLY A 1 464  ? -15.737 72.847 -4.321  1.00 82.67  ? 461  GLY A N   1 
ATOM 3603 C CA  . GLY A 1 464  ? -15.401 73.527 -3.065  1.00 82.67  ? 461  GLY A CA  1 
ATOM 3604 C C   . GLY A 1 464  ? -16.313 74.693 -2.721  1.00 82.67  ? 461  GLY A C   1 
ATOM 3605 O O   . GLY A 1 464  ? -17.413 74.816 -3.271  1.00 82.67  ? 461  GLY A O   1 
ATOM 3606 N N   . ASN A 1 465  ? -15.849 75.535 -1.796  1.00 200.23 ? 462  ASN A N   1 
ATOM 3607 C CA  . ASN A 1 465  ? -16.513 76.791 -1.440  1.00 200.23 ? 462  ASN A CA  1 
ATOM 3608 C C   . ASN A 1 465  ? -15.579 77.952 -1.742  1.00 200.23 ? 462  ASN A C   1 
ATOM 3609 O O   . ASN A 1 465  ? -14.404 77.914 -1.363  1.00 200.23 ? 462  ASN A O   1 
ATOM 3610 C CB  . ASN A 1 465  ? -16.880 76.818 0.046   1.00 114.05 ? 462  ASN A CB  1 
ATOM 3611 C CG  . ASN A 1 465  ? -17.537 75.534 0.515   1.00 114.05 ? 462  ASN A CG  1 
ATOM 3612 O OD1 . ASN A 1 465  ? -17.042 74.869 1.420   1.00 114.05 ? 462  ASN A OD1 1 
ATOM 3613 N ND2 . ASN A 1 465  ? -18.655 75.181 -0.098  1.00 114.05 ? 462  ASN A ND2 1 
ATOM 3614 N N   . VAL A 1 466  ? -16.088 78.985 -2.413  1.00 85.98  ? 463  VAL A N   1 
ATOM 3615 C CA  . VAL A 1 466  ? -15.219 80.096 -2.839  1.00 85.98  ? 463  VAL A CA  1 
ATOM 3616 C C   . VAL A 1 466  ? -15.402 81.393 -2.031  1.00 85.98  ? 463  VAL A C   1 
ATOM 3617 O O   . VAL A 1 466  ? -15.199 81.399 -0.813  1.00 85.98  ? 463  VAL A O   1 
ATOM 3618 C CB  . VAL A 1 466  ? -15.265 80.329 -4.382  1.00 121.69 ? 463  VAL A CB  1 
ATOM 3619 C CG1 . VAL A 1 466  ? -14.207 79.479 -5.090  1.00 121.69 ? 463  VAL A CG1 1 
ATOM 3620 C CG2 . VAL A 1 466  ? -16.656 80.043 -4.935  1.00 121.69 ? 463  VAL A CG2 1 
ATOM 3621 N N   . ALA A 1 467  ? -15.762 82.480 -2.711  1.00 125.76 ? 464  ALA A N   1 
ATOM 3622 C CA  . ALA A 1 467  ? -15.948 83.782 -2.073  1.00 125.76 ? 464  ALA A CA  1 
ATOM 3623 C C   . ALA A 1 467  ? -17.313 84.379 -2.432  1.00 125.76 ? 464  ALA A C   1 
ATOM 3624 O O   . ALA A 1 467  ? -17.906 84.012 -3.453  1.00 125.76 ? 464  ALA A O   1 
ATOM 3625 C CB  . ALA A 1 467  ? -14.817 84.730 -2.463  1.00 104.77 ? 464  ALA A CB  1 
ATOM 3626 N N   . HIS A 1 468  ? -17.798 85.292 -1.585  1.00 101.86 ? 465  HIS A N   1 
ATOM 3627 C CA  . HIS A 1 468  ? -19.096 85.966 -1.766  1.00 101.86 ? 465  HIS A CA  1 
ATOM 3628 C C   . HIS A 1 468  ? -20.229 84.961 -1.940  1.00 101.86 ? 465  HIS A C   1 
ATOM 3629 O O   . HIS A 1 468  ? -20.798 84.848 -3.028  1.00 101.86 ? 465  HIS A O   1 
ATOM 3630 C CB  . HIS A 1 468  ? -19.091 86.945 -2.961  1.00 136.30 ? 465  HIS A CB  1 
ATOM 3631 C CG  . HIS A 1 468  ? -17.775 87.619 -3.197  1.00 136.30 ? 465  HIS A CG  1 
ATOM 3632 N ND1 . HIS A 1 468  ? -16.842 87.135 -4.090  1.00 136.30 ? 465  HIS A ND1 1 
ATOM 3633 C CD2 . HIS A 1 468  ? -17.236 88.739 -2.661  1.00 136.30 ? 465  HIS A CD2 1 
ATOM 3634 C CE1 . HIS A 1 468  ? -15.782 87.922 -4.088  1.00 136.30 ? 465  HIS A CE1 1 
ATOM 3635 N NE2 . HIS A 1 468  ? -15.997 88.905 -3.232  1.00 136.30 ? 465  HIS A NE2 1 
ATOM 3636 N N   . GLN A 1 469  ? -20.534 84.223 -0.873  1.00 118.33 ? 466  GLN A N   1 
ATOM 3637 C CA  . GLN A 1 469  ? -21.693 83.311 -0.832  1.00 118.33 ? 466  GLN A CA  1 
ATOM 3638 C C   . GLN A 1 469  ? -21.757 82.355 -2.041  1.00 118.33 ? 466  GLN A C   1 
ATOM 3639 O O   . GLN A 1 469  ? -22.821 82.187 -2.646  1.00 118.33 ? 466  GLN A O   1 
ATOM 3640 C CB  . GLN A 1 469  ? -23.008 84.116 -0.727  1.00 155.84 ? 466  GLN A CB  1 
ATOM 3641 C CG  . GLN A 1 469  ? -22.961 85.369 0.168   1.00 155.84 ? 466  GLN A CG  1 
ATOM 3642 C CD  . GLN A 1 469  ? -23.783 86.529 -0.389  1.00 155.84 ? 466  GLN A CD  1 
ATOM 3643 O OE1 . GLN A 1 469  ? -24.897 86.342 -0.888  1.00 155.84 ? 466  GLN A OE1 1 
ATOM 3644 N NE2 . GLN A 1 469  ? -23.231 87.735 -0.304  1.00 155.84 ? 466  GLN A NE2 1 
ATOM 3645 N N   . GLN A 1 470  ? -20.627 81.728 -2.380  1.00 173.40 ? 467  GLN A N   1 
ATOM 3646 C CA  . GLN A 1 470  ? -20.507 80.966 -3.637  1.00 173.40 ? 467  GLN A CA  1 
ATOM 3647 C C   . GLN A 1 470  ? -19.919 79.550 -3.540  1.00 173.40 ? 467  GLN A C   1 
ATOM 3648 O O   . GLN A 1 470  ? -19.123 79.251 -2.645  1.00 173.40 ? 467  GLN A O   1 
ATOM 3649 C CB  . GLN A 1 470  ? -19.745 81.785 -4.683  1.00 91.18  ? 467  GLN A CB  1 
ATOM 3650 C CG  . GLN A 1 470  ? -20.629 82.749 -5.441  1.00 91.18  ? 467  GLN A CG  1 
ATOM 3651 C CD  . GLN A 1 470  ? -19.856 83.831 -6.145  1.00 91.18  ? 467  GLN A CD  1 
ATOM 3652 O OE1 . GLN A 1 470  ? -20.436 84.663 -6.851  1.00 91.18  ? 467  GLN A OE1 1 
ATOM 3653 N NE2 . GLN A 1 470  ? -18.542 83.838 -5.960  1.00 91.18  ? 467  GLN A NE2 1 
ATOM 3654 N N   . LEU A 1 471  ? -20.313 78.705 -4.499  1.00 127.46 ? 468  LEU A N   1 
ATOM 3655 C CA  . LEU A 1 471  ? -19.972 77.271 -4.536  1.00 127.46 ? 468  LEU A CA  1 
ATOM 3656 C C   . LEU A 1 471  ? -19.584 76.765 -5.936  1.00 127.46 ? 468  LEU A C   1 
ATOM 3657 O O   . LEU A 1 471  ? -20.446 76.576 -6.802  1.00 127.46 ? 468  LEU A O   1 
ATOM 3658 C CB  . LEU A 1 471  ? -21.127 76.424 -3.980  1.00 100.58 ? 468  LEU A CB  1 
ATOM 3659 C CG  . LEU A 1 471  ? -22.553 76.971 -4.095  1.00 100.58 ? 468  LEU A CG  1 
ATOM 3660 C CD1 . LEU A 1 471  ? -23.565 75.906 -4.510  1.00 100.58 ? 468  LEU A CD1 1 
ATOM 3661 C CD2 . LEU A 1 471  ? -22.929 77.606 -2.772  1.00 100.58 ? 468  LEU A CD2 1 
ATOM 3662 N N   . ILE A 1 472  ? -18.289 76.518 -6.132  1.00 111.72 ? 469  ILE A N   1 
ATOM 3663 C CA  . ILE A 1 472  ? -17.740 76.186 -7.457  1.00 111.72 ? 469  ILE A CA  1 
ATOM 3664 C C   . ILE A 1 472  ? -17.821 74.706 -7.833  1.00 111.72 ? 469  ILE A C   1 
ATOM 3665 O O   . ILE A 1 472  ? -17.607 73.822 -7.000  1.00 111.72 ? 469  ILE A O   1 
ATOM 3666 C CB  . ILE A 1 472  ? -16.269 76.708 -7.651  1.00 60.42  ? 469  ILE A CB  1 
ATOM 3667 C CG1 . ILE A 1 472  ? -15.721 76.265 -9.012  1.00 60.42  ? 469  ILE A CG1 1 
ATOM 3668 C CG2 . ILE A 1 472  ? -15.342 76.274 -6.496  1.00 60.42  ? 469  ILE A CG2 1 
ATOM 3669 C CD1 . ILE A 1 472  ? -14.467 76.991 -9.437  1.00 60.42  ? 469  ILE A CD1 1 
ATOM 3670 N N   . GLN A 1 473  ? -18.140 74.454 -9.097  1.00 93.26  ? 470  GLN A N   1 
ATOM 3671 C CA  . GLN A 1 473  ? -18.012 73.131 -9.686  1.00 93.26  ? 470  GLN A CA  1 
ATOM 3672 C C   . GLN A 1 473  ? -17.114 73.308 -10.899 1.00 93.26  ? 470  GLN A C   1 
ATOM 3673 O O   . GLN A 1 473  ? -17.391 74.156 -11.751 1.00 93.26  ? 470  GLN A O   1 
ATOM 3674 C CB  . GLN A 1 473  ? -19.383 72.594 -10.105 1.00 78.33  ? 470  GLN A CB  1 
ATOM 3675 C CG  . GLN A 1 473  ? -19.394 71.150 -10.598 1.00 78.33  ? 470  GLN A CG  1 
ATOM 3676 C CD  . GLN A 1 473  ? -20.753 70.722 -11.167 1.00 78.33  ? 470  GLN A CD  1 
ATOM 3677 O OE1 . GLN A 1 473  ? -21.550 71.558 -11.600 1.00 78.33  ? 470  GLN A OE1 1 
ATOM 3678 N NE2 . GLN A 1 473  ? -21.014 69.412 -11.172 1.00 78.33  ? 470  GLN A NE2 1 
ATOM 3679 N N   . ILE A 1 474  ? -16.022 72.545 -10.960 1.00 83.95  ? 471  ILE A N   1 
ATOM 3680 C CA  . ILE A 1 474  ? -15.178 72.526 -12.153 1.00 83.95  ? 471  ILE A CA  1 
ATOM 3681 C C   . ILE A 1 474  ? -15.382 71.195 -12.855 1.00 83.95  ? 471  ILE A C   1 
ATOM 3682 O O   . ILE A 1 474  ? -14.609 70.263 -12.666 1.00 83.95  ? 471  ILE A O   1 
ATOM 3683 C CB  . ILE A 1 474  ? -13.668 72.764 -11.856 1.00 57.49  ? 471  ILE A CB  1 
ATOM 3684 C CG1 . ILE A 1 474  ? -13.440 74.102 -11.134 1.00 57.49  ? 471  ILE A CG1 1 
ATOM 3685 C CG2 . ILE A 1 474  ? -12.847 72.723 -13.153 1.00 57.49  ? 471  ILE A CG2 1 
ATOM 3686 C CD1 . ILE A 1 474  ? -11.967 74.374 -10.755 1.00 57.49  ? 471  ILE A CD1 1 
ATOM 3687 N N   . THR A 1 475  ? -16.451 71.108 -13.644 1.00 119.08 ? 472  THR A N   1 
ATOM 3688 C CA  . THR A 1 475  ? -16.714 69.938 -14.474 1.00 119.08 ? 472  THR A CA  1 
ATOM 3689 C C   . THR A 1 475  ? -15.740 69.977 -15.656 1.00 119.08 ? 472  THR A C   1 
ATOM 3690 O O   . THR A 1 475  ? -15.153 71.024 -15.953 1.00 119.08 ? 472  THR A O   1 
ATOM 3691 C CB  . THR A 1 475  ? -18.229 69.852 -14.896 1.00 122.30 ? 472  THR A CB  1 
ATOM 3692 O OG1 . THR A 1 475  ? -18.683 68.495 -14.827 1.00 122.30 ? 472  THR A OG1 1 
ATOM 3693 C CG2 . THR A 1 475  ? -18.501 70.426 -16.294 1.00 122.30 ? 472  THR A CG2 1 
ATOM 3694 N N   . SER A 1 476  ? -15.550 68.832 -16.304 1.00 114.47 ? 473  SER A N   1 
ATOM 3695 C CA  . SER A 1 476  ? -14.575 68.702 -17.389 1.00 114.47 ? 473  SER A CA  1 
ATOM 3696 C C   . SER A 1 476  ? -14.944 69.529 -18.620 1.00 114.47 ? 473  SER A C   1 
ATOM 3697 O O   . SER A 1 476  ? -14.073 69.899 -19.414 1.00 114.47 ? 473  SER A O   1 
ATOM 3698 C CB  . SER A 1 476  ? -14.405 67.231 -17.779 1.00 60.74  ? 473  SER A CB  1 
ATOM 3699 O OG  . SER A 1 476  ? -15.371 66.826 -18.731 1.00 60.74  ? 473  SER A OG  1 
ATOM 3700 N N   . ALA A 1 477  ? -16.241 69.798 -18.767 1.00 121.08 ? 474  ALA A N   1 
ATOM 3701 C CA  . ALA A 1 477  ? -16.773 70.560 -19.891 1.00 121.08 ? 474  ALA A CA  1 
ATOM 3702 C C   . ALA A 1 477  ? -16.566 72.057 -19.712 1.00 121.08 ? 474  ALA A C   1 
ATOM 3703 O O   . ALA A 1 477  ? -16.205 72.748 -20.663 1.00 121.08 ? 474  ALA A O   1 
ATOM 3704 C CB  . ALA A 1 477  ? -18.245 70.252 -20.090 1.00 71.60  ? 474  ALA A CB  1 
ATOM 3705 N N   . SER A 1 478  ? -16.794 72.550 -18.494 1.00 95.67  ? 475  SER A N   1 
ATOM 3706 C CA  . SER A 1 478  ? -16.726 73.982 -18.197 1.00 95.67  ? 475  SER A CA  1 
ATOM 3707 C C   . SER A 1 478  ? -16.621 74.218 -16.701 1.00 95.67  ? 475  SER A C   1 
ATOM 3708 O O   . SER A 1 478  ? -17.153 73.441 -15.915 1.00 95.67  ? 475  SER A O   1 
ATOM 3709 C CB  . SER A 1 478  ? -17.980 74.686 -18.723 1.00 77.14  ? 475  SER A CB  1 
ATOM 3710 O OG  . SER A 1 478  ? -19.136 74.281 -18.006 1.00 77.14  ? 475  SER A OG  1 
ATOM 3711 N N   . VAL A 1 479  ? -15.951 75.295 -16.305 1.00 86.70  ? 476  VAL A N   1 
ATOM 3712 C CA  . VAL A 1 479  ? -15.952 75.686 -14.901 1.00 86.70  ? 476  VAL A CA  1 
ATOM 3713 C C   . VAL A 1 479  ? -17.215 76.522 -14.619 1.00 86.70  ? 476  VAL A C   1 
ATOM 3714 O O   . VAL A 1 479  ? -17.402 77.597 -15.193 1.00 86.70  ? 476  VAL A O   1 
ATOM 3715 C CB  . VAL A 1 479  ? -14.603 76.361 -14.451 1.00 56.37  ? 476  VAL A CB  1 
ATOM 3716 C CG1 . VAL A 1 479  ? -13.473 76.030 -15.421 1.00 56.37  ? 476  VAL A CG1 1 
ATOM 3717 C CG2 . VAL A 1 479  ? -14.719 77.884 -14.264 1.00 56.37  ? 476  VAL A CG2 1 
ATOM 3718 N N   . ARG A 1 480  ? -18.099 75.995 -13.774 1.00 73.12  ? 477  ARG A N   1 
ATOM 3719 C CA  . ARG A 1 480  ? -19.355 76.679 -13.422 1.00 73.12  ? 477  ARG A CA  1 
ATOM 3720 C C   . ARG A 1 480  ? -19.226 77.557 -12.170 1.00 73.12  ? 477  ARG A C   1 
ATOM 3721 O O   . ARG A 1 480  ? -18.314 77.363 -11.351 1.00 73.12  ? 477  ARG A O   1 
ATOM 3722 C CB  . ARG A 1 480  ? -20.489 75.665 -13.239 1.00 100.84 ? 477  ARG A CB  1 
ATOM 3723 C CG  . ARG A 1 480  ? -20.875 74.951 -14.515 1.00 100.84 ? 477  ARG A CG  1 
ATOM 3724 C CD  . ARG A 1 480  ? -21.581 73.638 -14.233 1.00 100.84 ? 477  ARG A CD  1 
ATOM 3725 N NE  . ARG A 1 480  ? -22.951 73.809 -13.746 1.00 100.84 ? 477  ARG A NE  1 
ATOM 3726 C CZ  . ARG A 1 480  ? -24.001 74.110 -14.512 1.00 100.84 ? 477  ARG A CZ  1 
ATOM 3727 N NH1 . ARG A 1 480  ? -23.856 74.295 -15.820 1.00 100.84 ? 477  ARG A NH1 1 
ATOM 3728 N NH2 . ARG A 1 480  ? -25.205 74.237 -13.972 1.00 100.84 ? 477  ARG A NH2 1 
ATOM 3729 N N   . LEU A 1 481  ? -20.124 78.531 -12.030 1.00 107.95 ? 478  LEU A N   1 
ATOM 3730 C CA  . LEU A 1 481  ? -20.192 79.322 -10.802 1.00 107.95 ? 478  LEU A CA  1 
ATOM 3731 C C   . LEU A 1 481  ? -21.633 79.509 -10.339 1.00 107.95 ? 478  LEU A C   1 
ATOM 3732 O O   . LEU A 1 481  ? -22.474 79.996 -11.093 1.00 107.95 ? 478  LEU A O   1 
ATOM 3733 C CB  . LEU A 1 481  ? -19.478 80.676 -10.951 1.00 115.85 ? 478  LEU A CB  1 
ATOM 3734 C CG  . LEU A 1 481  ? -18.963 81.314 -9.647  1.00 115.85 ? 478  LEU A CG  1 
ATOM 3735 C CD1 . LEU A 1 481  ? -17.755 80.557 -9.100  1.00 115.85 ? 478  LEU A CD1 1 
ATOM 3736 C CD2 . LEU A 1 481  ? -18.610 82.778 -9.839  1.00 115.85 ? 478  LEU A CD2 1 
ATOM 3737 N N   . VAL A 1 482  ? -21.902 79.099 -9.100  1.00 109.71 ? 479  VAL A N   1 
ATOM 3738 C CA  . VAL A 1 482  ? -23.231 79.198 -8.488  1.00 109.71 ? 479  VAL A CA  1 
ATOM 3739 C C   . VAL A 1 482  ? -23.166 80.096 -7.256  1.00 109.71 ? 479  VAL A C   1 
ATOM 3740 O O   . VAL A 1 482  ? -22.221 80.002 -6.470  1.00 109.71 ? 479  VAL A O   1 
ATOM 3741 C CB  . VAL A 1 482  ? -23.765 77.807 -8.047  1.00 101.05 ? 479  VAL A CB  1 
ATOM 3742 C CG1 . VAL A 1 482  ? -25.257 77.874 -7.704  1.00 101.05 ? 479  VAL A CG1 1 
ATOM 3743 C CG2 . VAL A 1 482  ? -23.493 76.749 -9.118  1.00 101.05 ? 479  VAL A CG2 1 
ATOM 3744 N N   . SER A 1 483  ? -24.159 80.971 -7.101  1.00 132.57 ? 480  SER A N   1 
ATOM 3745 C CA  . SER A 1 483  ? -24.353 81.712 -5.851  1.00 132.57 ? 480  SER A CA  1 
ATOM 3746 C C   . SER A 1 483  ? -25.285 80.912 -4.934  1.00 132.57 ? 480  SER A C   1 
ATOM 3747 O O   . SER A 1 483  ? -26.218 80.255 -5.409  1.00 132.57 ? 480  SER A O   1 
ATOM 3748 C CB  . SER A 1 483  ? -24.907 83.119 -6.115  1.00 97.03  ? 480  SER A CB  1 
ATOM 3749 O OG  . SER A 1 483  ? -23.879 84.058 -6.389  1.00 97.03  ? 480  SER A OG  1 
ATOM 3750 N N   . GLN A 1 484  ? -25.016 80.954 -3.630  1.00 200.23 ? 481  GLN A N   1 
ATOM 3751 C CA  . GLN A 1 484  ? -25.816 80.211 -2.658  1.00 200.23 ? 481  GLN A CA  1 
ATOM 3752 C C   . GLN A 1 484  ? -27.130 80.937 -2.379  1.00 200.23 ? 481  GLN A C   1 
ATOM 3753 O O   . GLN A 1 484  ? -28.212 80.380 -2.597  1.00 200.23 ? 481  GLN A O   1 
ATOM 3754 C CB  . GLN A 1 484  ? -25.043 79.991 -1.351  1.00 117.07 ? 481  GLN A CB  1 
ATOM 3755 C CG  . GLN A 1 484  ? -25.179 78.580 -0.727  1.00 117.07 ? 481  GLN A CG  1 
ATOM 3756 C CD  . GLN A 1 484  ? -26.619 78.135 -0.433  1.00 117.07 ? 481  GLN A CD  1 
ATOM 3757 O OE1 . GLN A 1 484  ? -27.416 77.888 -1.345  1.00 117.07 ? 481  GLN A OE1 1 
ATOM 3758 N NE2 . GLN A 1 484  ? -26.940 77.999 0.851   1.00 117.07 ? 481  GLN A NE2 1 
ATOM 3759 N N   . GLU A 1 485  ? -27.024 82.178 -1.898  1.00 152.31 ? 482  GLU A N   1 
ATOM 3760 C CA  . GLU A 1 485  ? -28.192 83.017 -1.621  1.00 152.31 ? 482  GLU A CA  1 
ATOM 3761 C C   . GLU A 1 485  ? -29.001 83.218 -2.918  1.00 152.31 ? 482  GLU A C   1 
ATOM 3762 O O   . GLU A 1 485  ? -30.164 82.804 -2.979  1.00 152.31 ? 482  GLU A O   1 
ATOM 3763 C CB  . GLU A 1 485  ? -27.768 84.345 -0.968  1.00 125.40 ? 482  GLU A CB  1 
ATOM 3764 C CG  . GLU A 1 485  ? -28.650 84.806 0.190   1.00 125.40 ? 482  GLU A CG  1 
ATOM 3765 C CD  . GLU A 1 485  ? -29.857 85.618 -0.255  1.00 125.40 ? 482  GLU A CD  1 
ATOM 3766 O OE1 . GLU A 1 485  ? -30.840 85.021 -0.745  1.00 125.40 ? 482  GLU A OE1 1 
ATOM 3767 O OE2 . GLU A 1 485  ? -29.827 86.858 -0.094  1.00 125.40 ? 482  GLU A OE2 1 
ATOM 3768 N N   . PRO A 1 486  ? -28.390 83.835 -3.960  1.00 200.23 ? 483  PRO A N   1 
ATOM 3769 C CA  . PRO A 1 486  ? -28.999 83.776 -5.296  1.00 200.23 ? 483  PRO A CA  1 
ATOM 3770 C C   . PRO A 1 486  ? -28.677 82.459 -6.038  1.00 200.23 ? 483  PRO A C   1 
ATOM 3771 O O   . PRO A 1 486  ? -27.665 82.368 -6.739  1.00 200.23 ? 483  PRO A O   1 
ATOM 3772 C CB  . PRO A 1 486  ? -28.387 84.991 -6.025  1.00 161.70 ? 483  PRO A CB  1 
ATOM 3773 C CG  . PRO A 1 486  ? -27.448 85.664 -5.027  1.00 161.70 ? 483  PRO A CG  1 
ATOM 3774 C CD  . PRO A 1 486  ? -27.160 84.650 -3.971  1.00 161.70 ? 483  PRO A CD  1 
ATOM 3775 N N   . LYS A 1 487  ? -29.554 81.465 -5.888  1.00 159.90 ? 484  LYS A N   1 
ATOM 3776 C CA  . LYS A 1 487  ? -29.352 80.113 -6.433  1.00 159.90 ? 484  LYS A CA  1 
ATOM 3777 C C   . LYS A 1 487  ? -29.346 80.042 -7.971  1.00 159.90 ? 484  LYS A C   1 
ATOM 3778 O O   . LYS A 1 487  ? -30.308 79.567 -8.580  1.00 159.90 ? 484  LYS A O   1 
ATOM 3779 C CB  . LYS A 1 487  ? -30.403 79.155 -5.836  1.00 124.80 ? 484  LYS A CB  1 
ATOM 3780 C CG  . LYS A 1 487  ? -30.230 77.666 -6.175  1.00 124.80 ? 484  LYS A CG  1 
ATOM 3781 C CD  . LYS A 1 487  ? -28.785 77.188 -6.024  1.00 124.80 ? 484  LYS A CD  1 
ATOM 3782 C CE  . LYS A 1 487  ? -28.318 77.168 -4.574  1.00 124.80 ? 484  LYS A CE  1 
ATOM 3783 N NZ  . LYS A 1 487  ? -26.833 77.164 -4.505  1.00 124.80 ? 484  LYS A NZ  1 
ATOM 3784 N N   . ALA A 1 488  ? -28.254 80.501 -8.589  1.00 105.93 ? 485  ALA A N   1 
ATOM 3785 C CA  . ALA A 1 488  ? -28.154 80.553 -10.058 1.00 105.93 ? 485  ALA A CA  1 
ATOM 3786 C C   . ALA A 1 488  ? -26.719 80.592 -10.593 1.00 105.93 ? 485  ALA A C   1 
ATOM 3787 O O   . ALA A 1 488  ? -25.797 81.062 -9.914  1.00 105.93 ? 485  ALA A O   1 
ATOM 3788 C CB  . ALA A 1 488  ? -28.963 81.738 -10.619 1.00 158.94 ? 485  ALA A CB  1 
ATOM 3789 N N   . LEU A 1 489  ? -26.557 80.108 -11.825 1.00 176.43 ? 486  LEU A N   1 
ATOM 3790 C CA  . LEU A 1 489  ? -25.282 80.150 -12.547 1.00 176.43 ? 486  LEU A CA  1 
ATOM 3791 C C   . LEU A 1 489  ? -24.855 81.599 -12.835 1.00 176.43 ? 486  LEU A C   1 
ATOM 3792 O O   . LEU A 1 489  ? -25.236 82.179 -13.855 1.00 176.43 ? 486  LEU A O   1 
ATOM 3793 C CB  . LEU A 1 489  ? -25.378 79.326 -13.847 1.00 123.67 ? 486  LEU A CB  1 
ATOM 3794 C CG  . LEU A 1 489  ? -24.138 79.133 -14.733 1.00 123.67 ? 486  LEU A CG  1 
ATOM 3795 C CD1 . LEU A 1 489  ? -23.214 78.052 -14.186 1.00 123.67 ? 486  LEU A CD1 1 
ATOM 3796 C CD2 . LEU A 1 489  ? -24.553 78.794 -16.148 1.00 123.67 ? 486  LEU A CD2 1 
ATOM 3797 N N   . VAL A 1 490  ? -24.062 82.171 -11.930 1.00 177.23 ? 487  VAL A N   1 
ATOM 3798 C CA  . VAL A 1 490  ? -23.629 83.577 -12.026 1.00 177.23 ? 487  VAL A CA  1 
ATOM 3799 C C   . VAL A 1 490  ? -22.601 83.867 -13.136 1.00 177.23 ? 487  VAL A C   1 
ATOM 3800 O O   . VAL A 1 490  ? -22.229 85.024 -13.354 1.00 177.23 ? 487  VAL A O   1 
ATOM 3801 C CB  . VAL A 1 490  ? -23.136 84.147 -10.656 1.00 102.23 ? 487  VAL A CB  1 
ATOM 3802 C CG1 . VAL A 1 490  ? -24.318 84.526 -9.777  1.00 102.23 ? 487  VAL A CG1 1 
ATOM 3803 C CG2 . VAL A 1 490  ? -22.234 83.160 -9.935  1.00 102.23 ? 487  VAL A CG2 1 
ATOM 3804 N N   . SER A 1 491  ? -22.154 82.810 -13.816 1.00 137.54 ? 488  SER A N   1 
ATOM 3805 C CA  . SER A 1 491  ? -21.312 82.879 -15.022 1.00 137.54 ? 488  SER A CA  1 
ATOM 3806 C C   . SER A 1 491  ? -20.795 81.478 -15.352 1.00 137.54 ? 488  SER A C   1 
ATOM 3807 O O   . SER A 1 491  ? -21.000 80.542 -14.577 1.00 137.54 ? 488  SER A O   1 
ATOM 3808 C CB  . SER A 1 491  ? -20.149 83.876 -14.876 1.00 183.47 ? 488  SER A CB  1 
ATOM 3809 O OG  . SER A 1 491  ? -19.278 83.519 -13.818 1.00 183.47 ? 488  SER A OG  1 
ATOM 3810 N N   . GLU A 1 492  ? -20.138 81.336 -16.503 1.00 155.44 ? 489  GLU A N   1 
ATOM 3811 C CA  . GLU A 1 492  ? -19.595 80.046 -16.936 1.00 155.44 ? 489  GLU A CA  1 
ATOM 3812 C C   . GLU A 1 492  ? -18.469 80.226 -17.952 1.00 155.44 ? 489  GLU A C   1 
ATOM 3813 O O   . GLU A 1 492  ? -18.653 80.829 -19.014 1.00 155.44 ? 489  GLU A O   1 
ATOM 3814 C CB  . GLU A 1 492  ? -20.706 79.162 -17.511 1.00 75.25  ? 489  GLU A CB  1 
ATOM 3815 C CG  . GLU A 1 492  ? -20.418 77.668 -17.540 1.00 75.25  ? 489  GLU A CG  1 
ATOM 3816 C CD  . GLU A 1 492  ? -21.654 76.859 -17.942 1.00 75.25  ? 489  GLU A CD  1 
ATOM 3817 O OE1 . GLU A 1 492  ? -22.616 77.467 -18.469 1.00 75.25  ? 489  GLU A OE1 1 
ATOM 3818 O OE2 . GLU A 1 492  ? -21.674 75.622 -17.734 1.00 75.25  ? 489  GLU A OE2 1 
ATOM 3819 N N   . TRP A 1 493  ? -17.300 79.703 -17.600 1.00 130.07 ? 490  TRP A N   1 
ATOM 3820 C CA  . TRP A 1 493  ? -16.133 79.725 -18.468 1.00 130.07 ? 490  TRP A CA  1 
ATOM 3821 C C   . TRP A 1 493  ? -16.042 78.398 -19.209 1.00 130.07 ? 490  TRP A C   1 
ATOM 3822 O O   . TRP A 1 493  ? -16.260 77.341 -18.622 1.00 130.07 ? 490  TRP A O   1 
ATOM 3823 C CB  . TRP A 1 493  ? -14.869 79.946 -17.633 1.00 104.63 ? 490  TRP A CB  1 
ATOM 3824 C CG  . TRP A 1 493  ? -13.605 80.173 -18.422 1.00 104.63 ? 490  TRP A CG  1 
ATOM 3825 C CD1 . TRP A 1 493  ? -13.026 81.377 -18.706 1.00 104.63 ? 490  TRP A CD1 1 
ATOM 3826 C CD2 . TRP A 1 493  ? -12.750 79.172 -18.996 1.00 104.63 ? 490  TRP A CD2 1 
ATOM 3827 N NE1 . TRP A 1 493  ? -11.873 81.191 -19.434 1.00 104.63 ? 490  TRP A NE1 1 
ATOM 3828 C CE2 . TRP A 1 493  ? -11.681 79.848 -19.626 1.00 104.63 ? 490  TRP A CE2 1 
ATOM 3829 C CE3 . TRP A 1 493  ? -12.784 77.770 -19.041 1.00 104.63 ? 490  TRP A CE3 1 
ATOM 3830 C CZ2 . TRP A 1 493  ? -10.656 79.170 -20.297 1.00 104.63 ? 490  TRP A CZ2 1 
ATOM 3831 C CZ3 . TRP A 1 493  ? -11.769 77.096 -19.714 1.00 104.63 ? 490  TRP A CZ3 1 
ATOM 3832 C CH2 . TRP A 1 493  ? -10.719 77.798 -20.330 1.00 104.63 ? 490  TRP A CH2 1 
ATOM 3833 N N   . LYS A 1 494  ? -15.722 78.468 -20.497 1.00 131.11 ? 491  LYS A N   1 
ATOM 3834 C CA  . LYS A 1 494  ? -15.466 77.283 -21.314 1.00 131.11 ? 491  LYS A CA  1 
ATOM 3835 C C   . LYS A 1 494  ? -14.193 77.527 -22.141 1.00 131.11 ? 491  LYS A C   1 
ATOM 3836 O O   . LYS A 1 494  ? -13.717 78.663 -22.221 1.00 131.11 ? 491  LYS A O   1 
ATOM 3837 C CB  . LYS A 1 494  ? -16.676 76.980 -22.206 1.00 93.71  ? 491  LYS A CB  1 
ATOM 3838 C CG  . LYS A 1 494  ? -16.839 75.509 -22.589 1.00 93.71  ? 491  LYS A CG  1 
ATOM 3839 C CD  . LYS A 1 494  ? -17.803 75.311 -23.766 1.00 93.71  ? 491  LYS A CD  1 
ATOM 3840 C CE  . LYS A 1 494  ? -19.263 75.277 -23.326 1.00 93.71  ? 491  LYS A CE  1 
ATOM 3841 N NZ  . LYS A 1 494  ? -20.158 74.975 -24.482 1.00 93.71  ? 491  LYS A NZ  1 
ATOM 3842 N N   . GLU A 1 495  ? -13.632 76.470 -22.729 1.00 92.02  ? 492  GLU A N   1 
ATOM 3843 C CA  . GLU A 1 495  ? -12.381 76.579 -23.493 1.00 92.02  ? 492  GLU A CA  1 
ATOM 3844 C C   . GLU A 1 495  ? -12.638 77.211 -24.857 1.00 92.02  ? 492  GLU A C   1 
ATOM 3845 O O   . GLU A 1 495  ? -13.537 76.760 -25.571 1.00 92.02  ? 492  GLU A O   1 
ATOM 3846 C CB  . GLU A 1 495  ? -11.727 75.200 -23.671 1.00 113.80 ? 492  GLU A CB  1 
ATOM 3847 C CG  . GLU A 1 495  ? -10.189 75.209 -23.832 1.00 113.80 ? 492  GLU A CG  1 
ATOM 3848 C CD  . GLU A 1 495  ? -9.693  75.458 -25.259 1.00 113.80 ? 492  GLU A CD  1 
ATOM 3849 O OE1 . GLU A 1 495  ? -10.422 75.148 -26.226 1.00 113.80 ? 492  GLU A OE1 1 
ATOM 3850 O OE2 . GLU A 1 495  ? -8.552  75.951 -25.409 1.00 113.80 ? 492  GLU A OE2 1 
ATOM 3851 N N   . PRO A 1 496  ? -11.851 78.250 -25.225 1.00 104.77 ? 493  PRO A N   1 
ATOM 3852 C CA  . PRO A 1 496  ? -12.014 78.917 -26.513 1.00 104.77 ? 493  PRO A CA  1 
ATOM 3853 C C   . PRO A 1 496  ? -12.518 78.012 -27.642 1.00 104.77 ? 493  PRO A C   1 
ATOM 3854 O O   . PRO A 1 496  ? -13.400 78.424 -28.389 1.00 104.77 ? 493  PRO A O   1 
ATOM 3855 C CB  . PRO A 1 496  ? -10.609 79.441 -26.803 1.00 87.73  ? 493  PRO A CB  1 
ATOM 3856 C CG  . PRO A 1 496  ? -10.068 79.786 -25.437 1.00 87.73  ? 493  PRO A CG  1 
ATOM 3857 C CD  . PRO A 1 496  ? -10.771 78.880 -24.437 1.00 87.73  ? 493  PRO A CD  1 
ATOM 3858 N N   . GLN A 1 497  ? -11.999 76.790 -27.742 1.00 83.97  ? 494  GLN A N   1 
ATOM 3859 C CA  . GLN A 1 497  ? -12.387 75.873 -28.831 1.00 83.97  ? 494  GLN A CA  1 
ATOM 3860 C C   . GLN A 1 497  ? -13.248 74.673 -28.408 1.00 83.97  ? 494  GLN A C   1 
ATOM 3861 O O   . GLN A 1 497  ? -13.356 73.682 -29.150 1.00 83.97  ? 494  GLN A O   1 
ATOM 3862 C CB  . GLN A 1 497  ? -11.148 75.368 -29.559 1.00 128.25 ? 494  GLN A CB  1 
ATOM 3863 C CG  . GLN A 1 497  ? -10.289 76.448 -30.154 1.00 128.25 ? 494  GLN A CG  1 
ATOM 3864 C CD  . GLN A 1 497  ? -8.906  75.942 -30.457 1.00 128.25 ? 494  GLN A CD  1 
ATOM 3865 O OE1 . GLN A 1 497  ? -8.736  74.990 -31.222 1.00 128.25 ? 494  GLN A OE1 1 
ATOM 3866 N NE2 . GLN A 1 497  ? -7.901  76.566 -29.850 1.00 128.25 ? 494  GLN A NE2 1 
ATOM 3867 N N   . ALA A 1 498  ? -13.854 74.773 -27.224 1.00 86.13  ? 495  ALA A N   1 
ATOM 3868 C CA  . ALA A 1 498  ? -14.661 73.701 -26.636 1.00 86.13  ? 495  ALA A CA  1 
ATOM 3869 C C   . ALA A 1 498  ? -13.878 72.406 -26.323 1.00 86.13  ? 495  ALA A C   1 
ATOM 3870 O O   . ALA A 1 498  ? -14.479 71.341 -26.141 1.00 86.13  ? 495  ALA A O   1 
ATOM 3871 C CB  . ALA A 1 498  ? -15.901 73.410 -27.500 1.00 90.99  ? 495  ALA A CB  1 
ATOM 3872 N N   . LYS A 1 499  ? -12.548 72.502 -26.248 1.00 126.26 ? 496  LYS A N   1 
ATOM 3873 C CA  . LYS A 1 499  ? -11.712 71.391 -25.774 1.00 126.26 ? 496  LYS A CA  1 
ATOM 3874 C C   . LYS A 1 499  ? -12.016 71.119 -24.296 1.00 126.26 ? 496  LYS A C   1 
ATOM 3875 O O   . LYS A 1 499  ? -12.409 72.028 -23.556 1.00 126.26 ? 496  LYS A O   1 
ATOM 3876 C CB  . LYS A 1 499  ? -10.216 71.703 -25.944 1.00 65.21  ? 496  LYS A CB  1 
ATOM 3877 C CG  . LYS A 1 499  ? -9.675  71.659 -27.361 1.00 65.21  ? 496  LYS A CG  1 
ATOM 3878 C CD  . LYS A 1 499  ? -8.184  72.072 -27.421 1.00 65.21  ? 496  LYS A CD  1 
ATOM 3879 C CE  . LYS A 1 499  ? -7.986  73.534 -27.838 1.00 65.21  ? 496  LYS A CE  1 
ATOM 3880 N NZ  . LYS A 1 499  ? -6.581  73.872 -28.263 1.00 65.21  ? 496  LYS A NZ  1 
ATOM 3881 N N   . ASN A 1 500  ? -11.833 69.873 -23.866 1.00 118.08 ? 497  ASN A N   1 
ATOM 3882 C CA  . ASN A 1 500  ? -12.115 69.492 -22.479 1.00 118.08 ? 497  ASN A CA  1 
ATOM 3883 C C   . ASN A 1 500  ? -11.012 69.859 -21.495 1.00 118.08 ? 497  ASN A C   1 
ATOM 3884 O O   . ASN A 1 500  ? -9.824  69.741 -21.809 1.00 118.08 ? 497  ASN A O   1 
ATOM 3885 C CB  . ASN A 1 500  ? -12.413 67.994 -22.382 1.00 92.48  ? 497  ASN A CB  1 
ATOM 3886 C CG  . ASN A 1 500  ? -13.689 67.608 -23.101 1.00 92.48  ? 497  ASN A CG  1 
ATOM 3887 O OD1 . ASN A 1 500  ? -14.555 68.447 -23.349 1.00 92.48  ? 497  ASN A OD1 1 
ATOM 3888 N ND2 . ASN A 1 500  ? -13.814 66.335 -23.438 1.00 92.48  ? 497  ASN A ND2 1 
ATOM 3889 N N   . ILE A 1 501  ? -11.423 70.309 -20.309 1.00 125.19 ? 498  ILE A N   1 
ATOM 3890 C CA  . ILE A 1 501  ? -10.507 70.534 -19.189 1.00 125.19 ? 498  ILE A CA  1 
ATOM 3891 C C   . ILE A 1 501  ? -9.936  69.181 -18.727 1.00 125.19 ? 498  ILE A C   1 
ATOM 3892 O O   . ILE A 1 501  ? -10.667 68.188 -18.622 1.00 125.19 ? 498  ILE A O   1 
ATOM 3893 C CB  . ILE A 1 501  ? -11.197 71.277 -18.008 1.00 80.57  ? 498  ILE A CB  1 
ATOM 3894 C CG1 . ILE A 1 501  ? -11.799 72.612 -18.468 1.00 80.57  ? 498  ILE A CG1 1 
ATOM 3895 C CG2 . ILE A 1 501  ? -10.209 71.532 -16.874 1.00 80.57  ? 498  ILE A CG2 1 
ATOM 3896 C CD1 . ILE A 1 501  ? -12.913 73.156 -17.563 1.00 80.57  ? 498  ILE A CD1 1 
ATOM 3897 N N   . SER A 1 502  ? -8.628  69.161 -18.469 1.00 70.43  ? 499  SER A N   1 
ATOM 3898 C CA  . SER A 1 502  ? -7.884  67.939 -18.149 1.00 70.43  ? 499  SER A CA  1 
ATOM 3899 C C   . SER A 1 502  ? -7.614  67.795 -16.661 1.00 70.43  ? 499  SER A C   1 
ATOM 3900 O O   . SER A 1 502  ? -8.002  66.800 -16.055 1.00 70.43  ? 499  SER A O   1 
ATOM 3901 C CB  . SER A 1 502  ? -6.550  67.912 -18.902 1.00 59.66  ? 499  SER A CB  1 
ATOM 3902 O OG  . SER A 1 502  ? -6.696  67.268 -20.150 1.00 59.66  ? 499  SER A OG  1 
ATOM 3903 N N   . VAL A 1 503  ? -6.941  68.783 -16.083 1.00 117.82 ? 500  VAL A N   1 
ATOM 3904 C CA  . VAL A 1 503  ? -6.578  68.736 -14.679 1.00 117.82 ? 500  VAL A CA  1 
ATOM 3905 C C   . VAL A 1 503  ? -7.161  69.940 -13.961 1.00 117.82 ? 500  VAL A C   1 
ATOM 3906 O O   . VAL A 1 503  ? -7.027  71.071 -14.431 1.00 117.82 ? 500  VAL A O   1 
ATOM 3907 C CB  . VAL A 1 503  ? -5.046  68.700 -14.504 1.00 61.24  ? 500  VAL A CB  1 
ATOM 3908 C CG1 . VAL A 1 503  ? -4.658  68.885 -13.059 1.00 61.24  ? 500  VAL A CG1 1 
ATOM 3909 C CG2 . VAL A 1 503  ? -4.468  67.390 -15.049 1.00 61.24  ? 500  VAL A CG2 1 
ATOM 3910 N N   . ALA A 1 504  ? -7.811  69.686 -12.828 1.00 107.44 ? 501  ALA A N   1 
ATOM 3911 C CA  . ALA A 1 504  ? -8.364  70.748 -11.986 1.00 107.44 ? 501  ALA A CA  1 
ATOM 3912 C C   . ALA A 1 504  ? -7.307  71.383 -11.068 1.00 107.44 ? 501  ALA A C   1 
ATOM 3913 O O   . ALA A 1 504  ? -6.129  71.026 -11.125 1.00 107.44 ? 501  ALA A O   1 
ATOM 3914 C CB  . ALA A 1 504  ? -9.540  70.216 -11.176 1.00 78.30  ? 501  ALA A CB  1 
ATOM 3915 N N   . SER A 1 505  ? -7.741  72.331 -10.238 1.00 136.54 ? 502  SER A N   1 
ATOM 3916 C CA  . SER A 1 505  ? -6.868  73.041 -9.304  1.00 136.54 ? 502  SER A CA  1 
ATOM 3917 C C   . SER A 1 505  ? -7.599  74.282 -8.799  1.00 136.54 ? 502  SER A C   1 
ATOM 3918 O O   . SER A 1 505  ? -7.823  75.222 -9.558  1.00 136.54 ? 502  SER A O   1 
ATOM 3919 C CB  . SER A 1 505  ? -5.548  73.420 -9.984  1.00 65.55  ? 502  SER A CB  1 
ATOM 3920 O OG  . SER A 1 505  ? -4.741  74.225 -9.155  1.00 65.55  ? 502  SER A OG  1 
ATOM 3921 N N   . CYS A 1 506  ? -7.974  74.275 -7.519  1.00 123.03 ? 503  CYS A N   1 
ATOM 3922 C CA  . CYS A 1 506  ? -8.868  75.302 -6.960  1.00 123.03 ? 503  CYS A CA  1 
ATOM 3923 C C   . CYS A 1 506  ? -8.791  75.399 -5.430  1.00 123.03 ? 503  CYS A C   1 
ATOM 3924 O O   . CYS A 1 506  ? -9.184  74.466 -4.723  1.00 123.03 ? 503  CYS A O   1 
ATOM 3925 C CB  . CYS A 1 506  ? -10.316 75.018 -7.399  1.00 149.43 ? 503  CYS A CB  1 
ATOM 3926 S SG  . CYS A 1 506  ? -11.554 76.295 -7.030  1.00 149.43 ? 503  CYS A SG  1 
ATOM 3927 N N   . ASN A 1 507  ? -8.301  76.530 -4.923  1.00 169.14 ? 504  ASN A N   1 
ATOM 3928 C CA  . ASN A 1 507  ? -8.234  76.748 -3.474  1.00 169.14 ? 504  ASN A CA  1 
ATOM 3929 C C   . ASN A 1 507  ? -9.534  77.259 -2.827  1.00 169.14 ? 504  ASN A C   1 
ATOM 3930 O O   . ASN A 1 507  ? -10.298 76.474 -2.258  1.00 169.14 ? 504  ASN A O   1 
ATOM 3931 C CB  . ASN A 1 507  ? -7.011  77.597 -3.063  1.00 96.00  ? 504  ASN A CB  1 
ATOM 3932 C CG  . ASN A 1 507  ? -6.855  78.888 -3.874  1.00 96.00  ? 504  ASN A CG  1 
ATOM 3933 O OD1 . ASN A 1 507  ? -7.816  79.622 -4.118  1.00 96.00  ? 504  ASN A OD1 1 
ATOM 3934 N ND2 . ASN A 1 507  ? -5.616  79.183 -4.257  1.00 96.00  ? 504  ASN A ND2 1 
ATOM 3935 N N   . SER A 1 508  ? -9.771  78.568 -2.927  1.00 101.42 ? 505  SER A N   1 
ATOM 3936 C CA  . SER A 1 508  ? -10.907 79.245 -2.292  1.00 101.42 ? 505  SER A CA  1 
ATOM 3937 C C   . SER A 1 508  ? -11.159 80.583 -2.993  1.00 101.42 ? 505  SER A C   1 
ATOM 3938 O O   . SER A 1 508  ? -12.278 81.099 -2.995  1.00 101.42 ? 505  SER A O   1 
ATOM 3939 C CB  . SER A 1 508  ? -10.622 79.481 -0.802  1.00 99.34  ? 505  SER A CB  1 
ATOM 3940 O OG  . SER A 1 508  ? -11.815 79.673 -0.068  1.00 99.34  ? 505  SER A OG  1 
ATOM 3941 N N   . SER A 1 509  ? -10.100 81.129 -3.586  1.00 164.17 ? 506  SER A N   1 
ATOM 3942 C CA  . SER A 1 509  ? -10.149 82.423 -4.258  1.00 164.17 ? 506  SER A CA  1 
ATOM 3943 C C   . SER A 1 509  ? -9.427  82.372 -5.608  1.00 164.17 ? 506  SER A C   1 
ATOM 3944 O O   . SER A 1 509  ? -9.293  83.393 -6.289  1.00 164.17 ? 506  SER A O   1 
ATOM 3945 C CB  . SER A 1 509  ? -9.514  83.495 -3.367  1.00 158.62 ? 506  SER A CB  1 
ATOM 3946 O OG  . SER A 1 509  ? -9.864  83.313 -2.002  1.00 158.62 ? 506  SER A OG  1 
ATOM 3947 N N   . GLN A 1 510  ? -8.975  81.175 -5.988  1.00 200.23 ? 507  GLN A N   1 
ATOM 3948 C CA  . GLN A 1 510  ? -8.157  80.975 -7.191  1.00 200.23 ? 507  GLN A CA  1 
ATOM 3949 C C   . GLN A 1 510  ? -8.486  79.683 -7.954  1.00 200.23 ? 507  GLN A C   1 
ATOM 3950 O O   . GLN A 1 510  ? -8.866  78.679 -7.351  1.00 200.23 ? 507  GLN A O   1 
ATOM 3951 C CB  . GLN A 1 510  ? -6.677  80.955 -6.817  1.00 87.44  ? 507  GLN A CB  1 
ATOM 3952 C CG  . GLN A 1 510  ? -6.129  82.236 -6.222  1.00 87.44  ? 507  GLN A CG  1 
ATOM 3953 C CD  . GLN A 1 510  ? -4.640  82.379 -6.457  1.00 87.44  ? 507  GLN A CD  1 
ATOM 3954 O OE1 . GLN A 1 510  ? -4.059  83.426 -6.196  1.00 87.44  ? 507  GLN A OE1 1 
ATOM 3955 N NE2 . GLN A 1 510  ? -4.014  81.325 -6.961  1.00 87.44  ? 507  GLN A NE2 1 
ATOM 3956 N N   . VAL A 1 511  ? -8.314  79.720 -9.278  1.00 136.69 ? 508  VAL A N   1 
ATOM 3957 C CA  . VAL A 1 511  ? -8.561  78.571 -10.175 1.00 136.69 ? 508  VAL A CA  1 
ATOM 3958 C C   . VAL A 1 511  ? -7.393  78.410 -11.166 1.00 136.69 ? 508  VAL A C   1 
ATOM 3959 O O   . VAL A 1 511  ? -6.870  79.397 -11.678 1.00 136.69 ? 508  VAL A O   1 
ATOM 3960 C CB  . VAL A 1 511  ? -9.940  78.710 -10.941 1.00 89.04  ? 508  VAL A CB  1 
ATOM 3961 C CG1 . VAL A 1 511  ? -10.060 77.740 -12.117 1.00 89.04  ? 508  VAL A CG1 1 
ATOM 3962 C CG2 . VAL A 1 511  ? -11.117 78.512 -10.000 1.00 89.04  ? 508  VAL A CG2 1 
ATOM 3963 N N   . VAL A 1 512  ? -6.976  77.167 -11.406 1.00 93.87  ? 509  VAL A N   1 
ATOM 3964 C CA  . VAL A 1 512  ? -5.966  76.843 -12.427 1.00 93.87  ? 509  VAL A CA  1 
ATOM 3965 C C   . VAL A 1 512  ? -6.274  75.529 -13.145 1.00 93.87  ? 509  VAL A C   1 
ATOM 3966 O O   . VAL A 1 512  ? -5.889  74.463 -12.669 1.00 93.87  ? 509  VAL A O   1 
ATOM 3967 C CB  . VAL A 1 512  ? -4.554  76.651 -11.837 1.00 42.58  ? 509  VAL A CB  1 
ATOM 3968 C CG1 . VAL A 1 512  ? -3.535  76.635 -12.960 1.00 42.58  ? 509  VAL A CG1 1 
ATOM 3969 C CG2 . VAL A 1 512  ? -4.222  77.722 -10.768 1.00 42.58  ? 509  VAL A CG2 1 
ATOM 3970 N N   . VAL A 1 513  ? -6.943  75.590 -14.291 1.00 66.17  ? 510  VAL A N   1 
ATOM 3971 C CA  . VAL A 1 513  ? -7.215  74.359 -15.027 1.00 66.17  ? 510  VAL A CA  1 
ATOM 3972 C C   . VAL A 1 513  ? -6.098  74.057 -16.030 1.00 66.17  ? 510  VAL A C   1 
ATOM 3973 O O   . VAL A 1 513  ? -5.144  74.830 -16.154 1.00 66.17  ? 510  VAL A O   1 
ATOM 3974 C CB  . VAL A 1 513  ? -8.627  74.332 -15.695 1.00 63.90  ? 510  VAL A CB  1 
ATOM 3975 C CG1 . VAL A 1 513  ? -9.735  74.417 -14.642 1.00 63.90  ? 510  VAL A CG1 1 
ATOM 3976 C CG2 . VAL A 1 513  ? -8.777  75.428 -16.723 1.00 63.90  ? 510  VAL A CG2 1 
ATOM 3977 N N   . ALA A 1 514  ? -6.195  72.916 -16.703 1.00 79.54  ? 511  ALA A N   1 
ATOM 3978 C CA  . ALA A 1 514  ? -5.324  72.621 -17.835 1.00 79.54  ? 511  ALA A CA  1 
ATOM 3979 C C   . ALA A 1 514  ? -6.108  71.884 -18.891 1.00 79.54  ? 511  ALA A C   1 
ATOM 3980 O O   . ALA A 1 514  ? -6.930  71.022 -18.581 1.00 79.54  ? 511  ALA A O   1 
ATOM 3981 C CB  . ALA A 1 514  ? -4.114  71.799 -17.421 1.00 37.20  ? 511  ALA A CB  1 
ATOM 3982 N N   . VAL A 1 515  ? -5.859  72.254 -20.140 1.00 81.26  ? 512  VAL A N   1 
ATOM 3983 C CA  . VAL A 1 515  ? -6.361  71.527 -21.286 1.00 81.26  ? 512  VAL A CA  1 
ATOM 3984 C C   . VAL A 1 515  ? -5.061  71.057 -21.913 1.00 81.26  ? 512  VAL A C   1 
ATOM 3985 O O   . VAL A 1 515  ? -4.276  71.874 -22.383 1.00 81.26  ? 512  VAL A O   1 
ATOM 3986 C CB  . VAL A 1 515  ? -7.207  72.460 -22.191 1.00 62.57  ? 512  VAL A CB  1 
ATOM 3987 C CG1 . VAL A 1 515  ? -7.499  71.824 -23.551 1.00 62.57  ? 512  VAL A CG1 1 
ATOM 3988 C CG2 . VAL A 1 515  ? -8.513  72.868 -21.468 1.00 62.57  ? 512  VAL A CG2 1 
ATOM 3989 N N   . GLY A 1 516  ? -4.833  69.742 -21.857 1.00 78.87  ? 513  GLY A N   1 
ATOM 3990 C CA  . GLY A 1 516  ? -3.505  69.112 -22.003 1.00 78.87  ? 513  GLY A CA  1 
ATOM 3991 C C   . GLY A 1 516  ? -2.248  69.824 -21.531 1.00 78.87  ? 513  GLY A C   1 
ATOM 3992 O O   . GLY A 1 516  ? -1.878  69.712 -20.359 1.00 78.87  ? 513  GLY A O   1 
ATOM 3993 N N   . ARG A 1 517  ? -1.612  70.579 -22.428 1.00 89.81  ? 514  ARG A N   1 
ATOM 3994 C CA  . ARG A 1 517  ? -0.279  71.190 -22.189 1.00 89.81  ? 514  ARG A CA  1 
ATOM 3995 C C   . ARG A 1 517  ? -0.658  72.639 -21.860 1.00 89.81  ? 514  ARG A C   1 
ATOM 3996 O O   . ARG A 1 517  ? 0.115   73.357 -21.224 1.00 89.81  ? 514  ARG A O   1 
ATOM 3997 C CB  . ARG A 1 517  ? 0.145   71.066 -23.670 1.00 120.54 ? 514  ARG A CB  1 
ATOM 3998 C CG  . ARG A 1 517  ? 1.304   70.104 -23.957 1.00 120.54 ? 514  ARG A CG  1 
ATOM 3999 C CD  . ARG A 1 517  ? 1.474   69.798 -25.455 1.00 120.54 ? 514  ARG A CD  1 
ATOM 4000 N NE  . ARG A 1 517  ? 0.343   69.035 -25.995 1.00 120.54 ? 514  ARG A NE  1 
ATOM 4001 C CZ  . ARG A 1 517  ? 0.163   67.718 -25.857 1.00 120.54 ? 514  ARG A CZ  1 
ATOM 4002 N NH1 . ARG A 1 517  ? 1.044   66.972 -25.200 1.00 120.54 ? 514  ARG A NH1 1 
ATOM 4003 N NH2 . ARG A 1 517  ? -0.908  67.138 -26.382 1.00 120.54 ? 514  ARG A NH2 1 
ATOM 4004 N N   . ALA A 1 518  ? -1.852  73.056 -22.281 1.00 83.85  ? 515  ALA A N   1 
ATOM 4005 C CA  . ALA A 1 518  ? -2.307  74.437 -22.106 1.00 83.85  ? 515  ALA A CA  1 
ATOM 4006 C C   . ALA A 1 518  ? -2.847  74.677 -20.704 1.00 83.85  ? 515  ALA A C   1 
ATOM 4007 O O   . ALA A 1 518  ? -3.446  73.788 -20.096 1.00 83.85  ? 515  ALA A O   1 
ATOM 4008 C CB  . ALA A 1 518  ? -3.351  74.805 -23.164 1.00 108.62 ? 515  ALA A CB  1 
ATOM 4009 N N   . LEU A 1 519  ? -2.627  75.888 -20.204 1.00 100.14 ? 516  LEU A N   1 
ATOM 4010 C CA  . LEU A 1 519  ? -3.082  76.289 -18.878 1.00 100.14 ? 516  LEU A CA  1 
ATOM 4011 C C   . LEU A 1 519  ? -3.798  77.650 -18.938 1.00 100.14 ? 516  LEU A C   1 
ATOM 4012 O O   . LEU A 1 519  ? -3.388  78.530 -19.692 1.00 100.14 ? 516  LEU A O   1 
ATOM 4013 C CB  . LEU A 1 519  ? -1.884  76.353 -17.919 1.00 63.27  ? 516  LEU A CB  1 
ATOM 4014 C CG  . LEU A 1 519  ? -1.139  75.063 -17.533 1.00 63.27  ? 516  LEU A CG  1 
ATOM 4015 C CD1 . LEU A 1 519  ? 0.297   75.347 -17.072 1.00 63.27  ? 516  LEU A CD1 1 
ATOM 4016 C CD2 . LEU A 1 519  ? -1.908  74.251 -16.475 1.00 63.27  ? 516  LEU A CD2 1 
ATOM 4017 N N   . TYR A 1 520  ? -4.869  77.813 -18.162 1.00 106.50 ? 517  TYR A N   1 
ATOM 4018 C CA  . TYR A 1 520  ? -5.563  79.100 -18.049 1.00 106.50 ? 517  TYR A CA  1 
ATOM 4019 C C   . TYR A 1 520  ? -5.803  79.435 -16.579 1.00 106.50 ? 517  TYR A C   1 
ATOM 4020 O O   . TYR A 1 520  ? -6.472  78.673 -15.881 1.00 106.50 ? 517  TYR A O   1 
ATOM 4021 C CB  . TYR A 1 520  ? -6.924  79.078 -18.765 1.00 92.04  ? 517  TYR A CB  1 
ATOM 4022 C CG  . TYR A 1 520  ? -6.912  78.675 -20.228 1.00 92.04  ? 517  TYR A CG  1 
ATOM 4023 C CD1 . TYR A 1 520  ? -6.878  77.327 -20.599 1.00 92.04  ? 517  TYR A CD1 1 
ATOM 4024 C CD2 . TYR A 1 520  ? -6.971  79.637 -21.246 1.00 92.04  ? 517  TYR A CD2 1 
ATOM 4025 C CE1 . TYR A 1 520  ? -6.874  76.947 -21.937 1.00 92.04  ? 517  TYR A CE1 1 
ATOM 4026 C CE2 . TYR A 1 520  ? -6.974  79.259 -22.600 1.00 92.04  ? 517  TYR A CE2 1 
ATOM 4027 C CZ  . TYR A 1 520  ? -6.923  77.910 -22.929 1.00 92.04  ? 517  TYR A CZ  1 
ATOM 4028 O OH  . TYR A 1 520  ? -6.926  77.501 -24.240 1.00 92.04  ? 517  TYR A OH  1 
ATOM 4029 N N   . TYR A 1 521  ? -5.269  80.569 -16.112 1.00 127.94 ? 518  TYR A N   1 
ATOM 4030 C CA  . TYR A 1 521  ? -5.517  81.061 -14.741 1.00 127.94 ? 518  TYR A CA  1 
ATOM 4031 C C   . TYR A 1 521  ? -6.671  82.062 -14.721 1.00 127.94 ? 518  TYR A C   1 
ATOM 4032 O O   . TYR A 1 521  ? -6.545  83.170 -15.235 1.00 127.94 ? 518  TYR A O   1 
ATOM 4033 C CB  . TYR A 1 521  ? -4.229  81.655 -14.123 1.00 107.00 ? 518  TYR A CB  1 
ATOM 4034 C CG  . TYR A 1 521  ? -4.381  82.494 -12.854 1.00 107.00 ? 518  TYR A CG  1 
ATOM 4035 C CD1 . TYR A 1 521  ? -3.699  83.704 -12.718 1.00 107.00 ? 518  TYR A CD1 1 
ATOM 4036 C CD2 . TYR A 1 521  ? -5.181  82.076 -11.790 1.00 107.00 ? 518  TYR A CD2 1 
ATOM 4037 C CE1 . TYR A 1 521  ? -3.821  84.483 -11.561 1.00 107.00 ? 518  TYR A CE1 1 
ATOM 4038 C CE2 . TYR A 1 521  ? -5.314  82.850 -10.633 1.00 107.00 ? 518  TYR A CE2 1 
ATOM 4039 C CZ  . TYR A 1 521  ? -4.631  84.051 -10.525 1.00 107.00 ? 518  TYR A CZ  1 
ATOM 4040 O OH  . TYR A 1 521  ? -4.757  84.820 -9.385  1.00 107.00 ? 518  TYR A OH  1 
ATOM 4041 N N   . LEU A 1 522  ? -7.794  81.651 -14.134 1.00 126.28 ? 519  LEU A N   1 
ATOM 4042 C CA  . LEU A 1 522  ? -8.984  82.501 -14.013 1.00 126.28 ? 519  LEU A CA  1 
ATOM 4043 C C   . LEU A 1 522  ? -9.111  83.029 -12.579 1.00 126.28 ? 519  LEU A C   1 
ATOM 4044 O O   . LEU A 1 522  ? -8.261  82.730 -11.735 1.00 126.28 ? 519  LEU A O   1 
ATOM 4045 C CB  . LEU A 1 522  ? -10.256 81.737 -14.417 1.00 136.48 ? 519  LEU A CB  1 
ATOM 4046 C CG  . LEU A 1 522  ? -10.253 80.655 -15.507 1.00 136.48 ? 519  LEU A CG  1 
ATOM 4047 C CD1 . LEU A 1 522  ? -11.635 80.032 -15.595 1.00 136.48 ? 519  LEU A CD1 1 
ATOM 4048 C CD2 . LEU A 1 522  ? -9.801  81.163 -16.871 1.00 136.48 ? 519  LEU A CD2 1 
ATOM 4049 N N   . GLN A 1 523  ? -10.156 83.813 -12.299 1.00 121.83 ? 520  GLN A N   1 
ATOM 4050 C CA  . GLN A 1 523  ? -10.378 84.316 -10.936 1.00 121.83 ? 520  GLN A CA  1 
ATOM 4051 C C   . GLN A 1 523  ? -11.854 84.470 -10.555 1.00 121.83 ? 520  GLN A C   1 
ATOM 4052 O O   . GLN A 1 523  ? -12.685 84.821 -11.394 1.00 121.83 ? 520  GLN A O   1 
ATOM 4053 C CB  . GLN A 1 523  ? -9.606  85.620 -10.698 1.00 143.39 ? 520  GLN A CB  1 
ATOM 4054 C CG  . GLN A 1 523  ? -9.074  85.742 -9.274  1.00 143.39 ? 520  GLN A CG  1 
ATOM 4055 C CD  . GLN A 1 523  ? -7.762  86.502 -9.181  1.00 143.39 ? 520  GLN A CD  1 
ATOM 4056 O OE1 . GLN A 1 523  ? -7.091  86.746 -10.187 1.00 143.39 ? 520  GLN A OE1 1 
ATOM 4057 N NE2 . GLN A 1 523  ? -7.386  86.873 -7.963  1.00 143.39 ? 520  GLN A NE2 1 
ATOM 4058 N N   . ILE A 1 524  ? -12.159 84.193 -9.283  1.00 150.51 ? 521  ILE A N   1 
ATOM 4059 C CA  . ILE A 1 524  ? -13.515 84.332 -8.741  1.00 150.51 ? 521  ILE A CA  1 
ATOM 4060 C C   . ILE A 1 524  ? -13.707 85.681 -8.020  1.00 150.51 ? 521  ILE A C   1 
ATOM 4061 O O   . ILE A 1 524  ? -14.146 85.729 -6.864  1.00 150.51 ? 521  ILE A O   1 
ATOM 4062 C CB  . ILE A 1 524  ? -13.909 83.172 -7.765  1.00 116.60 ? 521  ILE A CB  1 
ATOM 4063 C CG1 . ILE A 1 524  ? -13.102 81.890 -8.017  1.00 116.60 ? 521  ILE A CG1 1 
ATOM 4064 C CG2 . ILE A 1 524  ? -15.425 82.933 -7.810  1.00 116.60 ? 521  ILE A CG2 1 
ATOM 4065 C CD1 . ILE A 1 524  ? -13.844 80.800 -8.767  1.00 116.60 ? 521  ILE A CD1 1 
ATOM 4066 N N   . HIS A 1 525  ? -13.365 86.775 -8.698  1.00 200.23 ? 522  HIS A N   1 
ATOM 4067 C CA  . HIS A 1 525  ? -13.691 88.102 -8.185  1.00 200.23 ? 522  HIS A CA  1 
ATOM 4068 C C   . HIS A 1 525  ? -15.157 88.384 -8.477  1.00 200.23 ? 522  HIS A C   1 
ATOM 4069 O O   . HIS A 1 525  ? -15.644 88.042 -9.554  1.00 200.23 ? 522  HIS A O   1 
ATOM 4070 C CB  . HIS A 1 525  ? -12.773 89.174 -8.757  1.00 84.40  ? 522  HIS A CB  1 
ATOM 4071 C CG  . HIS A 1 525  ? -11.471 89.304 -8.022  1.00 84.40  ? 522  HIS A CG  1 
ATOM 4072 N ND1 . HIS A 1 525  ? -11.362 89.943 -6.804  1.00 84.40  ? 522  HIS A ND1 1 
ATOM 4073 C CD2 . HIS A 1 525  ? -10.223 88.871 -8.329  1.00 84.40  ? 522  HIS A CD2 1 
ATOM 4074 C CE1 . HIS A 1 525  ? -10.105 89.902 -6.394  1.00 84.40  ? 522  HIS A CE1 1 
ATOM 4075 N NE2 . HIS A 1 525  ? -9.393  89.258 -7.301  1.00 84.40  ? 522  HIS A NE2 1 
ATOM 4076 N N   . PRO A 1 526  ? -15.848 89.045 -7.529  1.00 187.07 ? 523  PRO A N   1 
ATOM 4077 C CA  . PRO A 1 526  ? -17.280 88.882 -7.278  1.00 187.07 ? 523  PRO A CA  1 
ATOM 4078 C C   . PRO A 1 526  ? -18.130 88.455 -8.476  1.00 187.07 ? 523  PRO A C   1 
ATOM 4079 O O   . PRO A 1 526  ? -18.188 89.162 -9.487  1.00 187.07 ? 523  PRO A O   1 
ATOM 4080 C CB  . PRO A 1 526  ? -17.703 90.264 -6.768  1.00 116.15 ? 523  PRO A CB  1 
ATOM 4081 C CG  . PRO A 1 526  ? -16.489 90.785 -6.069  1.00 116.15 ? 523  PRO A CG  1 
ATOM 4082 C CD  . PRO A 1 526  ? -15.271 90.088 -6.658  1.00 116.15 ? 523  PRO A CD  1 
ATOM 4083 N N   . GLN A 1 527  ? -18.750 87.280 -8.350  1.00 95.56  ? 524  GLN A N   1 
ATOM 4084 C CA  . GLN A 1 527  ? -19.865 86.847 -9.210  1.00 95.56  ? 524  GLN A CA  1 
ATOM 4085 C C   . GLN A 1 527  ? -19.524 86.649 -10.688 1.00 95.56  ? 524  GLN A C   1 
ATOM 4086 O O   . GLN A 1 527  ? -20.425 86.601 -11.542 1.00 95.56  ? 524  GLN A O   1 
ATOM 4087 C CB  . GLN A 1 527  ? -21.060 87.802 -9.068  1.00 133.98 ? 524  GLN A CB  1 
ATOM 4088 C CG  . GLN A 1 527  ? -21.524 88.019 -7.639  1.00 133.98 ? 524  GLN A CG  1 
ATOM 4089 C CD  . GLN A 1 527  ? -22.084 89.408 -7.427  1.00 133.98 ? 524  GLN A CD  1 
ATOM 4090 O OE1 . GLN A 1 527  ? -23.237 89.683 -7.758  1.00 133.98 ? 524  GLN A OE1 1 
ATOM 4091 N NE2 . GLN A 1 527  ? -21.269 90.293 -6.864  1.00 133.98 ? 524  GLN A NE2 1 
ATOM 4092 N N   . GLU A 1 528  ? -18.232 86.535 -10.988 1.00 90.75  ? 525  GLU A N   1 
ATOM 4093 C CA  . GLU A 1 528  ? -17.782 86.280 -12.357 1.00 90.75  ? 525  GLU A CA  1 
ATOM 4094 C C   . GLU A 1 528  ? -16.449 85.565 -12.390 1.00 90.75  ? 525  GLU A C   1 
ATOM 4095 O O   . GLU A 1 528  ? -15.580 85.798 -11.545 1.00 90.75  ? 525  GLU A O   1 
ATOM 4096 C CB  . GLU A 1 528  ? -17.695 87.573 -13.165 1.00 101.76 ? 525  GLU A CB  1 
ATOM 4097 C CG  . GLU A 1 528  ? -16.922 88.673 -12.472 1.00 101.76 ? 525  GLU A CG  1 
ATOM 4098 C CD  . GLU A 1 528  ? -16.664 89.835 -13.380 1.00 101.76 ? 525  GLU A CD  1 
ATOM 4099 O OE1 . GLU A 1 528  ? -15.808 89.685 -14.273 1.00 101.76 ? 525  GLU A OE1 1 
ATOM 4100 O OE2 . GLU A 1 528  ? -17.315 90.890 -13.203 1.00 101.76 ? 525  GLU A OE2 1 
ATOM 4101 N N   . LEU A 1 529  ? -16.305 84.704 -13.392 1.00 140.60 ? 526  LEU A N   1 
ATOM 4102 C CA  . LEU A 1 529  ? -15.082 83.953 -13.615 1.00 140.60 ? 526  LEU A CA  1 
ATOM 4103 C C   . LEU A 1 529  ? -14.182 84.717 -14.594 1.00 140.60 ? 526  LEU A C   1 
ATOM 4104 O O   . LEU A 1 529  ? -14.400 84.681 -15.808 1.00 140.60 ? 526  LEU A O   1 
ATOM 4105 C CB  . LEU A 1 529  ? -15.424 82.550 -14.138 1.00 119.69 ? 526  LEU A CB  1 
ATOM 4106 C CG  . LEU A 1 529  ? -16.345 81.667 -13.280 1.00 119.69 ? 526  LEU A CG  1 
ATOM 4107 C CD1 . LEU A 1 529  ? -17.170 80.741 -14.150 1.00 119.69 ? 526  LEU A CD1 1 
ATOM 4108 C CD2 . LEU A 1 529  ? -15.571 80.874 -12.233 1.00 119.69 ? 526  LEU A CD2 1 
ATOM 4109 N N   . ARG A 1 530  ? -13.173 85.406 -14.058 1.00 125.03 ? 527  ARG A N   1 
ATOM 4110 C CA  . ARG A 1 530  ? -12.338 86.325 -14.843 1.00 125.03 ? 527  ARG A CA  1 
ATOM 4111 C C   . ARG A 1 530  ? -10.962 85.754 -15.174 1.00 125.03 ? 527  ARG A C   1 
ATOM 4112 O O   . ARG A 1 530  ? -10.125 85.602 -14.285 1.00 125.03 ? 527  ARG A O   1 
ATOM 4113 C CB  . ARG A 1 530  ? -12.175 87.653 -14.094 1.00 145.20 ? 527  ARG A CB  1 
ATOM 4114 C CG  . ARG A 1 530  ? -11.855 88.857 -14.978 1.00 145.20 ? 527  ARG A CG  1 
ATOM 4115 C CD  . ARG A 1 530  ? -11.630 90.130 -14.156 1.00 145.20 ? 527  ARG A CD  1 
ATOM 4116 N NE  . ARG A 1 530  ? -12.771 90.477 -13.300 1.00 145.20 ? 527  ARG A NE  1 
ATOM 4117 C CZ  . ARG A 1 530  ? -12.820 90.279 -11.982 1.00 145.20 ? 527  ARG A CZ  1 
ATOM 4118 N NH1 . ARG A 1 530  ? -11.789 89.731 -11.349 1.00 145.20 ? 527  ARG A NH1 1 
ATOM 4119 N NH2 . ARG A 1 530  ? -13.901 90.625 -11.293 1.00 145.20 ? 527  ARG A NH2 1 
ATOM 4120 N N   . GLN A 1 531  ? -10.738 85.467 -16.459 1.00 148.53 ? 528  GLN A N   1 
ATOM 4121 C CA  . GLN A 1 531  ? -9.447  84.970 -16.961 1.00 148.53 ? 528  GLN A CA  1 
ATOM 4122 C C   . GLN A 1 531  ? -8.326  85.996 -16.787 1.00 148.53 ? 528  GLN A C   1 
ATOM 4123 O O   . GLN A 1 531  ? -8.555  87.203 -16.864 1.00 148.53 ? 528  GLN A O   1 
ATOM 4124 C CB  . GLN A 1 531  ? -9.551  84.528 -18.430 1.00 160.74 ? 528  GLN A CB  1 
ATOM 4125 C CG  . GLN A 1 531  ? -8.244  83.975 -19.020 1.00 160.74 ? 528  GLN A CG  1 
ATOM 4126 C CD  . GLN A 1 531  ? -8.445  83.149 -20.274 1.00 160.74 ? 528  GLN A CD  1 
ATOM 4127 O OE1 . GLN A 1 531  ? -9.386  82.361 -20.373 1.00 160.74 ? 528  GLN A OE1 1 
ATOM 4128 N NE2 . GLN A 1 531  ? -7.544  83.313 -21.235 1.00 160.74 ? 528  GLN A NE2 1 
ATOM 4129 N N   . ILE A 1 532  ? -7.116  85.494 -16.560 1.00 87.47  ? 529  ILE A N   1 
ATOM 4130 C CA  . ILE A 1 532  ? -5.985  86.325 -16.186 1.00 87.47  ? 529  ILE A CA  1 
ATOM 4131 C C   . ILE A 1 532  ? -4.727  85.957 -16.968 1.00 87.47  ? 529  ILE A C   1 
ATOM 4132 O O   . ILE A 1 532  ? -3.961  86.841 -17.355 1.00 87.47  ? 529  ILE A O   1 
ATOM 4133 C CB  . ILE A 1 532  ? -5.691  86.234 -14.650 1.00 74.82  ? 529  ILE A CB  1 
ATOM 4134 C CG1 . ILE A 1 532  ? -6.815  86.873 -13.808 1.00 74.82  ? 529  ILE A CG1 1 
ATOM 4135 C CG2 . ILE A 1 532  ? -4.292  86.801 -14.310 1.00 74.82  ? 529  ILE A CG2 1 
ATOM 4136 C CD1 . ILE A 1 532  ? -6.806  88.392 -13.764 1.00 74.82  ? 529  ILE A CD1 1 
ATOM 4137 N N   . SER A 1 533  ? -4.509  84.665 -17.200 1.00 84.38  ? 530  SER A N   1 
ATOM 4138 C CA  . SER A 1 533  ? -3.239  84.205 -17.773 1.00 84.38  ? 530  SER A CA  1 
ATOM 4139 C C   . SER A 1 533  ? -3.411  83.079 -18.793 1.00 84.38  ? 530  SER A C   1 
ATOM 4140 O O   . SER A 1 533  ? -4.505  82.538 -18.940 1.00 84.38  ? 530  SER A O   1 
ATOM 4141 C CB  . SER A 1 533  ? -2.275  83.765 -16.656 1.00 158.31 ? 530  SER A CB  1 
ATOM 4142 O OG  . SER A 1 533  ? -1.990  84.822 -15.749 1.00 158.31 ? 530  SER A OG  1 
ATOM 4143 N N   . HIS A 1 534  ? -2.321  82.761 -19.504 1.00 104.86 ? 531  HIS A N   1 
ATOM 4144 C CA  . HIS A 1 534  ? -2.219  81.587 -20.389 1.00 104.86 ? 531  HIS A CA  1 
ATOM 4145 C C   . HIS A 1 534  ? -0.786  81.287 -20.840 1.00 104.86 ? 531  HIS A C   1 
ATOM 4146 O O   . HIS A 1 534  ? -0.147  82.089 -21.525 1.00 104.86 ? 531  HIS A O   1 
ATOM 4147 C CB  . HIS A 1 534  ? -3.129  81.691 -21.622 1.00 154.04 ? 531  HIS A CB  1 
ATOM 4148 C CG  . HIS A 1 534  ? -3.035  80.505 -22.534 1.00 154.04 ? 531  HIS A CG  1 
ATOM 4149 N ND1 . HIS A 1 534  ? -3.687  79.317 -22.280 1.00 154.04 ? 531  HIS A ND1 1 
ATOM 4150 C CD2 . HIS A 1 534  ? -2.346  80.316 -23.684 1.00 154.04 ? 531  HIS A CD2 1 
ATOM 4151 C CE1 . HIS A 1 534  ? -3.413  78.451 -23.240 1.00 154.04 ? 531  HIS A CE1 1 
ATOM 4152 N NE2 . HIS A 1 534  ? -2.601  79.032 -24.104 1.00 154.04 ? 531  HIS A NE2 1 
ATOM 4153 N N   . THR A 1 535  ? -0.304  80.116 -20.444 1.00 85.70  ? 532  THR A N   1 
ATOM 4154 C CA  . THR A 1 535  ? 0.925   79.542 -20.974 1.00 85.70  ? 532  THR A CA  1 
ATOM 4155 C C   . THR A 1 535  ? 0.621   78.109 -21.387 1.00 85.70  ? 532  THR A C   1 
ATOM 4156 O O   . THR A 1 535  ? -0.437  77.567 -21.048 1.00 85.70  ? 532  THR A O   1 
ATOM 4157 C CB  . THR A 1 535  ? 2.091   79.606 -19.953 1.00 82.83  ? 532  THR A CB  1 
ATOM 4158 O OG1 . THR A 1 535  ? 2.381   80.977 -19.664 1.00 82.83  ? 532  THR A OG1 1 
ATOM 4159 C CG2 . THR A 1 535  ? 3.366   78.963 -20.499 1.00 82.83  ? 532  THR A CG2 1 
ATOM 4160 N N   . GLU A 1 536  ? 1.549   77.529 -22.144 1.00 60.13  ? 533  GLU A N   1 
ATOM 4161 C CA  . GLU A 1 536  ? 1.463   76.169 -22.663 1.00 60.13  ? 533  GLU A CA  1 
ATOM 4162 C C   . GLU A 1 536  ? 2.725   75.429 -22.218 1.00 60.13  ? 533  GLU A C   1 
ATOM 4163 O O   . GLU A 1 536  ? 3.835   75.982 -22.267 1.00 60.13  ? 533  GLU A O   1 
ATOM 4164 C CB  . GLU A 1 536  ? 1.359   76.205 -24.192 1.00 127.63 ? 533  GLU A CB  1 
ATOM 4165 C CG  . GLU A 1 536  ? 0.443   75.152 -24.805 1.00 127.63 ? 533  GLU A CG  1 
ATOM 4166 C CD  . GLU A 1 536  ? -0.088  75.558 -26.174 1.00 127.63 ? 533  GLU A CD  1 
ATOM 4167 O OE1 . GLU A 1 536  ? -0.229  74.672 -27.046 1.00 127.63 ? 533  GLU A OE1 1 
ATOM 4168 O OE2 . GLU A 1 536  ? -0.364  76.761 -26.382 1.00 127.63 ? 533  GLU A OE2 1 
ATOM 4169 N N   . MET A 1 537  ? 2.551   74.187 -21.762 1.00 49.98  ? 534  MET A N   1 
ATOM 4170 C CA  . MET A 1 537  ? 3.662   73.417 -21.207 1.00 49.98  ? 534  MET A CA  1 
ATOM 4171 C C   . MET A 1 537  ? 4.396   72.620 -22.252 1.00 49.98  ? 534  MET A C   1 
ATOM 4172 O O   . MET A 1 537  ? 3.829   72.239 -23.291 1.00 49.98  ? 534  MET A O   1 
ATOM 4173 C CB  . MET A 1 537  ? 3.200   72.517 -20.060 1.00 112.72 ? 534  MET A CB  1 
ATOM 4174 C CG  . MET A 1 537  ? 3.122   73.215 -18.705 1.00 112.72 ? 534  MET A CG  1 
ATOM 4175 S SD  . MET A 1 537  ? 4.575   74.206 -18.269 1.00 112.72 ? 534  MET A SD  1 
ATOM 4176 C CE  . MET A 1 537  ? 5.908   73.003 -18.291 1.00 112.72 ? 534  MET A CE  1 
ATOM 4177 N N   . GLU A 1 538  ? 5.672   72.379 -21.977 1.00 61.73  ? 535  GLU A N   1 
ATOM 4178 C CA  . GLU A 1 538  ? 6.510   71.628 -22.891 1.00 61.73  ? 535  GLU A CA  1 
ATOM 4179 C C   . GLU A 1 538  ? 5.931   70.228 -23.084 1.00 61.73  ? 535  GLU A C   1 
ATOM 4180 O O   . GLU A 1 538  ? 6.168   69.595 -24.112 1.00 61.73  ? 535  GLU A O   1 
ATOM 4181 C CB  . GLU A 1 538  ? 7.944   71.559 -22.378 1.00 97.18  ? 535  GLU A CB  1 
ATOM 4182 C CG  . GLU A 1 538  ? 8.955   71.278 -23.466 1.00 97.18  ? 535  GLU A CG  1 
ATOM 4183 C CD  . GLU A 1 538  ? 10.190  70.577 -22.949 1.00 97.18  ? 535  GLU A CD  1 
ATOM 4184 O OE1 . GLU A 1 538  ? 10.799  69.809 -23.726 1.00 97.18  ? 535  GLU A OE1 1 
ATOM 4185 O OE2 . GLU A 1 538  ? 10.553  70.787 -21.773 1.00 97.18  ? 535  GLU A OE2 1 
ATOM 4186 N N   . HIS A 1 539  ? 5.170   69.747 -22.096 1.00 66.15  ? 536  HIS A N   1 
ATOM 4187 C CA  . HIS A 1 539  ? 4.480   68.454 -22.199 1.00 66.15  ? 536  HIS A CA  1 
ATOM 4188 C C   . HIS A 1 539  ? 3.082   68.485 -21.601 1.00 66.15  ? 536  HIS A C   1 
ATOM 4189 O O   . HIS A 1 539  ? 2.631   69.509 -21.080 1.00 66.15  ? 536  HIS A O   1 
ATOM 4190 C CB  . HIS A 1 539  ? 5.309   67.324 -21.574 1.00 72.46  ? 536  HIS A CB  1 
ATOM 4191 C CG  . HIS A 1 539  ? 6.709   67.270 -22.086 1.00 72.46  ? 536  HIS A CG  1 
ATOM 4192 N ND1 . HIS A 1 539  ? 7.057   66.577 -23.224 1.00 72.46  ? 536  HIS A ND1 1 
ATOM 4193 C CD2 . HIS A 1 539  ? 7.842   67.874 -21.649 1.00 72.46  ? 536  HIS A CD2 1 
ATOM 4194 C CE1 . HIS A 1 539  ? 8.350   66.732 -23.450 1.00 72.46  ? 536  HIS A CE1 1 
ATOM 4195 N NE2 . HIS A 1 539  ? 8.849   67.517 -22.511 1.00 72.46  ? 536  HIS A NE2 1 
ATOM 4196 N N   . GLU A 1 540  ? 2.391   67.353 -21.694 1.00 67.41  ? 537  GLU A N   1 
ATOM 4197 C CA  . GLU A 1 540  ? 1.058   67.245 -21.147 1.00 67.41  ? 537  GLU A CA  1 
ATOM 4198 C C   . GLU A 1 540  ? 1.116   67.294 -19.625 1.00 67.41  ? 537  GLU A C   1 
ATOM 4199 O O   . GLU A 1 540  ? 2.045   66.764 -19.016 1.00 67.41  ? 537  GLU A O   1 
ATOM 4200 C CB  . GLU A 1 540  ? 0.405   65.966 -21.626 1.00 96.50  ? 537  GLU A CB  1 
ATOM 4201 C CG  . GLU A 1 540  ? -0.984  66.191 -22.144 1.00 96.50  ? 537  GLU A CG  1 
ATOM 4202 C CD  . GLU A 1 540  ? -1.842  64.984 -21.948 1.00 96.50  ? 537  GLU A CD  1 
ATOM 4203 O OE1 . GLU A 1 540  ? -2.917  65.129 -21.332 1.00 96.50  ? 537  GLU A OE1 1 
ATOM 4204 O OE2 . GLU A 1 540  ? -1.432  63.886 -22.385 1.00 96.50  ? 537  GLU A OE2 1 
ATOM 4205 N N   . VAL A 1 541  ? 0.133   67.960 -19.026 1.00 52.06  ? 538  VAL A N   1 
ATOM 4206 C CA  . VAL A 1 541  ? 0.066   68.137 -17.572 1.00 52.06  ? 538  VAL A CA  1 
ATOM 4207 C C   . VAL A 1 541  ? -0.623  66.943 -16.908 1.00 52.06  ? 538  VAL A C   1 
ATOM 4208 O O   . VAL A 1 541  ? -1.737  66.573 -17.284 1.00 52.06  ? 538  VAL A O   1 
ATOM 4209 C CB  . VAL A 1 541  ? -0.693  69.419 -17.199 1.00 74.22  ? 538  VAL A CB  1 
ATOM 4210 C CG1 . VAL A 1 541  ? -0.786  69.574 -15.682 1.00 74.22  ? 538  VAL A CG1 1 
ATOM 4211 C CG2 . VAL A 1 541  ? -0.023  70.609 -17.821 1.00 74.22  ? 538  VAL A CG2 1 
ATOM 4212 N N   . ALA A 1 542  ? 0.049   66.365 -15.910 1.00 60.50  ? 539  ALA A N   1 
ATOM 4213 C CA  . ALA A 1 542  ? -0.475  65.227 -15.164 1.00 60.50  ? 539  ALA A CA  1 
ATOM 4214 C C   . ALA A 1 542  ? -1.218  65.667 -13.916 1.00 60.50  ? 539  ALA A C   1 
ATOM 4215 O O   . ALA A 1 542  ? -2.299  65.170 -13.636 1.00 60.50  ? 539  ALA A O   1 
ATOM 4216 C CB  . ALA A 1 542  ? 0.641   64.295 -14.794 1.00 28.98  ? 539  ALA A CB  1 
ATOM 4217 N N   . CYS A 1 543  ? -0.639  66.606 -13.175 1.00 71.36  ? 540  CYS A N   1 
ATOM 4218 C CA  . CYS A 1 543  ? -1.222  67.059 -11.917 1.00 71.36  ? 540  CYS A CA  1 
ATOM 4219 C C   . CYS A 1 543  ? -0.840  68.503 -11.601 1.00 71.36  ? 540  CYS A C   1 
ATOM 4220 O O   . CYS A 1 543  ? 0.184   69.020 -12.080 1.00 71.36  ? 540  CYS A O   1 
ATOM 4221 C CB  . CYS A 1 543  ? -0.799  66.139 -10.770 1.00 72.82  ? 540  CYS A CB  1 
ATOM 4222 S SG  . CYS A 1 543  ? 0.976   65.780 -10.752 1.00 72.82  ? 540  CYS A SG  1 
ATOM 4223 N N   . LEU A 1 544  ? -1.681  69.132 -10.780 1.00 129.68 ? 541  LEU A N   1 
ATOM 4224 C CA  . LEU A 1 544  ? -1.547  70.527 -10.382 1.00 129.68 ? 541  LEU A CA  1 
ATOM 4225 C C   . LEU A 1 544  ? -2.051  70.704 -8.963  1.00 129.68 ? 541  LEU A C   1 
ATOM 4226 O O   . LEU A 1 544  ? -2.998  70.029 -8.553  1.00 129.68 ? 541  LEU A O   1 
ATOM 4227 C CB  . LEU A 1 544  ? -2.418  71.406 -11.273 1.00 55.25  ? 541  LEU A CB  1 
ATOM 4228 C CG  . LEU A 1 544  ? -2.111  71.641 -12.749 1.00 55.25  ? 541  LEU A CG  1 
ATOM 4229 C CD1 . LEU A 1 544  ? -3.363  72.190 -13.401 1.00 55.25  ? 541  LEU A CD1 1 
ATOM 4230 C CD2 . LEU A 1 544  ? -0.912  72.579 -12.949 1.00 55.25  ? 541  LEU A CD2 1 
ATOM 4231 N N   . ASP A 1 545  ? -1.446  71.624 -8.221  1.00 124.57 ? 542  ASP A N   1 
ATOM 4232 C CA  . ASP A 1 545  ? -1.992  72.007 -6.922  1.00 124.57 ? 542  ASP A CA  1 
ATOM 4233 C C   . ASP A 1 545  ? -1.697  73.446 -6.552  1.00 124.57 ? 542  ASP A C   1 
ATOM 4234 O O   . ASP A 1 545  ? -0.572  73.928 -6.719  1.00 124.57 ? 542  ASP A O   1 
ATOM 4235 C CB  . ASP A 1 545  ? -1.498  71.081 -5.807  1.00 128.49 ? 542  ASP A CB  1 
ATOM 4236 C CG  . ASP A 1 545  ? -2.085  71.437 -4.450  1.00 128.49 ? 542  ASP A CG  1 
ATOM 4237 O OD1 . ASP A 1 545  ? -1.306  71.835 -3.563  1.00 128.49 ? 542  ASP A OD1 1 
ATOM 4238 O OD2 . ASP A 1 545  ? -3.319  71.337 -4.274  1.00 128.49 ? 542  ASP A OD2 1 
ATOM 4239 N N   . ILE A 1 546  ? -2.722  74.121 -6.040  1.00 149.43 ? 543  ILE A N   1 
ATOM 4240 C CA  . ILE A 1 546  ? -2.565  75.458 -5.473  1.00 149.43 ? 543  ILE A CA  1 
ATOM 4241 C C   . ILE A 1 546  ? -3.377  75.675 -4.199  1.00 149.43 ? 543  ILE A C   1 
ATOM 4242 O O   . ILE A 1 546  ? -4.608  75.595 -4.194  1.00 149.43 ? 543  ILE A O   1 
ATOM 4243 C CB  . ILE A 1 546  ? -2.832  76.589 -6.499  1.00 54.96  ? 543  ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 546  ? -4.114  76.335 -7.308  1.00 54.96  ? 543  ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 546  ? -1.651  76.710 -7.442  1.00 54.96  ? 543  ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 546  ? -5.384  76.891 -6.717  1.00 54.96  ? 543  ILE A CD1 1 
ATOM 4247 N N   . THR A 1 547  ? -2.650  75.915 -3.117  1.00 160.01 ? 544  THR A N   1 
ATOM 4248 C CA  . THR A 1 547  ? -3.222  76.300 -1.839  1.00 160.01 ? 544  THR A CA  1 
ATOM 4249 C C   . THR A 1 547  ? -2.245  77.279 -1.187  1.00 160.01 ? 544  THR A C   1 
ATOM 4250 O O   . THR A 1 547  ? -1.091  76.920 -0.923  1.00 160.01 ? 544  THR A O   1 
ATOM 4251 C CB  . THR A 1 547  ? -3.486  75.082 -0.919  1.00 85.63  ? 544  THR A CB  1 
ATOM 4252 O OG1 . THR A 1 547  ? -2.458  74.105 -1.108  1.00 85.63  ? 544  THR A OG1 1 
ATOM 4253 C CG2 . THR A 1 547  ? -4.840  74.442 -1.221  1.00 85.63  ? 544  THR A CG2 1 
ATOM 4254 N N   . PRO A 1 548  ? -2.697  78.528 -0.951  1.00 151.74 ? 545  PRO A N   1 
ATOM 4255 C CA  . PRO A 1 548  ? -1.865  79.589 -0.385  1.00 151.74 ? 545  PRO A CA  1 
ATOM 4256 C C   . PRO A 1 548  ? -1.151  79.138 0.882   1.00 151.74 ? 545  PRO A C   1 
ATOM 4257 O O   . PRO A 1 548  ? -1.729  78.425 1.705   1.00 151.74 ? 545  PRO A O   1 
ATOM 4258 C CB  . PRO A 1 548  ? -2.876  80.701 -0.070  1.00 127.12 ? 545  PRO A CB  1 
ATOM 4259 C CG  . PRO A 1 548  ? -4.228  80.047 -0.164  1.00 127.12 ? 545  PRO A CG  1 
ATOM 4260 C CD  . PRO A 1 548  ? -4.066  79.006 -1.203  1.00 127.12 ? 545  PRO A CD  1 
ATOM 4261 N N   . LEU A 1 549  ? 0.102   79.551 1.025   1.00 189.69 ? 546  LEU A N   1 
ATOM 4262 C CA  . LEU A 1 549  ? 0.935   79.085 2.121   1.00 189.69 ? 546  LEU A CA  1 
ATOM 4263 C C   . LEU A 1 549  ? 1.415   80.230 3.018   1.00 189.69 ? 546  LEU A C   1 
ATOM 4264 O O   . LEU A 1 549  ? 2.566   80.666 2.926   1.00 189.69 ? 546  LEU A O   1 
ATOM 4265 C CB  . LEU A 1 549  ? 2.110   78.258 1.575   1.00 117.96 ? 546  LEU A CB  1 
ATOM 4266 C CG  . LEU A 1 549  ? 1.761   77.029 0.725   1.00 117.96 ? 546  LEU A CG  1 
ATOM 4267 C CD1 . LEU A 1 549  ? 3.002   76.432 0.079   1.00 117.96 ? 546  LEU A CD1 1 
ATOM 4268 C CD2 . LEU A 1 549  ? 1.015   75.979 1.544   1.00 117.96 ? 546  LEU A CD2 1 
ATOM 4269 N N   . GLY A 1 550  ? 0.515   80.721 3.871   1.00 127.65 ? 547  GLY A N   1 
ATOM 4270 C CA  . GLY A 1 550  ? 0.859   81.716 4.893   1.00 127.65 ? 547  GLY A CA  1 
ATOM 4271 C C   . GLY A 1 550  ? 0.609   83.176 4.541   1.00 127.65 ? 547  GLY A C   1 
ATOM 4272 O O   . GLY A 1 550  ? -0.469  83.712 4.814   1.00 127.65 ? 547  GLY A O   1 
ATOM 4273 N N   . ASP A 1 551  ? 1.610   83.811 3.928   1.00 192.60 ? 548  ASP A N   1 
ATOM 4274 C CA  . ASP A 1 551  ? 1.622   85.261 3.668   1.00 192.60 ? 548  ASP A CA  1 
ATOM 4275 C C   . ASP A 1 551  ? 0.433   85.795 2.854   1.00 192.60 ? 548  ASP A C   1 
ATOM 4276 O O   . ASP A 1 551  ? 0.305   87.004 2.645   1.00 192.60 ? 548  ASP A O   1 
ATOM 4277 C CB  . ASP A 1 551  ? 2.945   85.667 3.005   1.00 131.33 ? 548  ASP A CB  1 
ATOM 4278 C CG  . ASP A 1 551  ? 4.151   85.382 3.883   1.00 131.33 ? 548  ASP A CG  1 
ATOM 4279 O OD1 . ASP A 1 551  ? 4.205   85.899 5.021   1.00 131.33 ? 548  ASP A OD1 1 
ATOM 4280 O OD2 . ASP A 1 551  ? 5.048   84.644 3.426   1.00 131.33 ? 548  ASP A OD2 1 
ATOM 4281 N N   . SER A 1 552  ? -0.425  84.885 2.400   1.00 183.40 ? 549  SER A N   1 
ATOM 4282 C CA  . SER A 1 552  ? -1.669  85.236 1.727   1.00 183.40 ? 549  SER A CA  1 
ATOM 4283 C C   . SER A 1 552  ? -2.749  84.223 2.093   1.00 183.40 ? 549  SER A C   1 
ATOM 4284 O O   . SER A 1 552  ? -2.458  83.041 2.296   1.00 183.40 ? 549  SER A O   1 
ATOM 4285 C CB  . SER A 1 552  ? -1.469  85.283 0.212   1.00 163.77 ? 549  SER A CB  1 
ATOM 4286 O OG  . SER A 1 552  ? -1.065  84.021 -0.294  1.00 163.77 ? 549  SER A OG  1 
ATOM 4287 N N   . ASN A 1 553  ? -3.991  84.693 2.177   1.00 143.02 ? 550  ASN A N   1 
ATOM 4288 C CA  . ASN A 1 553  ? -5.117  83.854 2.586   1.00 143.02 ? 550  ASN A CA  1 
ATOM 4289 C C   . ASN A 1 553  ? -6.141  83.685 1.462   1.00 143.02 ? 550  ASN A C   1 
ATOM 4290 O O   . ASN A 1 553  ? -7.038  84.514 1.296   1.00 143.02 ? 550  ASN A O   1 
ATOM 4291 C CB  . ASN A 1 553  ? -5.788  84.429 3.844   1.00 200.23 ? 550  ASN A CB  1 
ATOM 4292 C CG  . ASN A 1 553  ? -4.785  84.859 4.907   1.00 200.23 ? 550  ASN A CG  1 
ATOM 4293 O OD1 . ASN A 1 553  ? -3.813  84.159 5.186   1.00 200.23 ? 550  ASN A OD1 1 
ATOM 4294 N ND2 . ASN A 1 553  ? -5.028  86.017 5.510   1.00 200.23 ? 550  ASN A ND2 1 
ATOM 4295 N N   . GLY A 1 554  ? -6.000  82.610 0.691   1.00 160.33 ? 551  GLY A N   1 
ATOM 4296 C CA  . GLY A 1 554  ? -6.895  82.343 -0.435  1.00 160.33 ? 551  GLY A CA  1 
ATOM 4297 C C   . GLY A 1 554  ? -6.261  82.614 -1.788  1.00 160.33 ? 551  GLY A C   1 
ATOM 4298 O O   . GLY A 1 554  ? -6.614  81.977 -2.779  1.00 160.33 ? 551  GLY A O   1 
ATOM 4299 N N   . LEU A 1 555  ? -5.322  83.559 -1.822  1.00 79.61  ? 552  LEU A N   1 
ATOM 4300 C CA  . LEU A 1 555  ? -4.642  83.972 -3.059  1.00 79.61  ? 552  LEU A CA  1 
ATOM 4301 C C   . LEU A 1 555  ? -3.240  83.343 -3.172  1.00 79.61  ? 552  LEU A C   1 
ATOM 4302 O O   . LEU A 1 555  ? -2.254  83.862 -2.633  1.00 79.61  ? 552  LEU A O   1 
ATOM 4303 C CB  . LEU A 1 555  ? -4.566  85.510 -3.149  1.00 95.84  ? 552  LEU A CB  1 
ATOM 4304 C CG  . LEU A 1 555  ? -4.440  86.207 -4.513  1.00 95.84  ? 552  LEU A CG  1 
ATOM 4305 C CD1 . LEU A 1 555  ? -5.819  86.393 -5.158  1.00 95.84  ? 552  LEU A CD1 1 
ATOM 4306 C CD2 . LEU A 1 555  ? -3.706  87.554 -4.396  1.00 95.84  ? 552  LEU A CD2 1 
ATOM 4307 N N   . SER A 1 556  ? -3.172  82.222 -3.885  1.00 93.04  ? 553  SER A N   1 
ATOM 4308 C CA  . SER A 1 556  ? -1.949  81.433 -3.990  1.00 93.04  ? 553  SER A CA  1 
ATOM 4309 C C   . SER A 1 556  ? -0.918  82.067 -4.934  1.00 93.04  ? 553  SER A C   1 
ATOM 4310 O O   . SER A 1 556  ? -1.202  82.266 -6.113  1.00 93.04  ? 553  SER A O   1 
ATOM 4311 C CB  . SER A 1 556  ? -2.279  79.996 -4.412  1.00 108.23 ? 553  SER A CB  1 
ATOM 4312 O OG  . SER A 1 556  ? -1.138  79.162 -4.338  1.00 108.23 ? 553  SER A OG  1 
ATOM 4313 N N   . PRO A 1 557  ? 0.278   82.402 -4.404  1.00 89.50  ? 554  PRO A N   1 
ATOM 4314 C CA  . PRO A 1 557  ? 1.364   83.026 -5.167  1.00 89.50  ? 554  PRO A CA  1 
ATOM 4315 C C   . PRO A 1 557  ? 2.154   82.060 -6.051  1.00 89.50  ? 554  PRO A C   1 
ATOM 4316 O O   . PRO A 1 557  ? 2.872   82.514 -6.942  1.00 89.50  ? 554  PRO A O   1 
ATOM 4317 C CB  . PRO A 1 557  ? 2.289   83.595 -4.073  1.00 146.71 ? 554  PRO A CB  1 
ATOM 4318 C CG  . PRO A 1 557  ? 1.571   83.390 -2.765  1.00 146.71 ? 554  PRO A CG  1 
ATOM 4319 C CD  . PRO A 1 557  ? 0.659   82.232 -2.991  1.00 146.71 ? 554  PRO A CD  1 
ATOM 4320 N N   . LEU A 1 558  ? 2.021   80.754 -5.805  1.00 113.90 ? 555  LEU A N   1 
ATOM 4321 C CA  . LEU A 1 558  ? 2.811   79.725 -6.506  1.00 113.90 ? 555  LEU A CA  1 
ATOM 4322 C C   . LEU A 1 558  ? 1.971   78.583 -7.113  1.00 113.90 ? 555  LEU A C   1 
ATOM 4323 O O   . LEU A 1 558  ? 0.782   78.465 -6.811  1.00 113.90 ? 555  LEU A O   1 
ATOM 4324 C CB  . LEU A 1 558  ? 3.870   79.146 -5.565  1.00 79.22  ? 555  LEU A CB  1 
ATOM 4325 C CG  . LEU A 1 558  ? 5.037   80.005 -5.090  1.00 79.22  ? 555  LEU A CG  1 
ATOM 4326 C CD1 . LEU A 1 558  ? 6.076   79.061 -4.552  1.00 79.22  ? 555  LEU A CD1 1 
ATOM 4327 C CD2 . LEU A 1 558  ? 5.635   80.871 -6.206  1.00 79.22  ? 555  LEU A CD2 1 
ATOM 4328 N N   . CYS A 1 559  ? 2.596   77.748 -7.955  1.00 158.77 ? 556  CYS A N   1 
ATOM 4329 C CA  . CYS A 1 559  ? 1.913   76.628 -8.633  1.00 158.77 ? 556  CYS A CA  1 
ATOM 4330 C C   . CYS A 1 559  ? 2.772   75.361 -8.670  1.00 158.77 ? 556  CYS A C   1 
ATOM 4331 O O   . CYS A 1 559  ? 3.932   75.398 -9.088  1.00 158.77 ? 556  CYS A O   1 
ATOM 4332 C CB  . CYS A 1 559  ? 1.528   77.024 -10.065 1.00 115.77 ? 556  CYS A CB  1 
ATOM 4333 S SG  . CYS A 1 559  ? -0.158  76.573 -10.635 1.00 115.77 ? 556  CYS A SG  1 
ATOM 4334 N N   . ALA A 1 560  ? 2.194   74.245 -8.230  1.00 69.27  ? 557  ALA A N   1 
ATOM 4335 C CA  . ALA A 1 560  ? 2.858   72.946 -8.290  1.00 69.27  ? 557  ALA A CA  1 
ATOM 4336 C C   . ALA A 1 560  ? 2.412   72.213 -9.560  1.00 69.27  ? 557  ALA A C   1 
ATOM 4337 O O   . ALA A 1 560  ? 1.211   72.213 -9.886  1.00 69.27  ? 557  ALA A O   1 
ATOM 4338 C CB  . ALA A 1 560  ? 2.510   72.134 -7.062  1.00 165.70 ? 557  ALA A CB  1 
ATOM 4339 N N   . ILE A 1 561  ? 3.356   71.592 -10.276 1.00 69.30  ? 558  ILE A N   1 
ATOM 4340 C CA  . ILE A 1 561  ? 2.999   70.923 -11.541 1.00 69.30  ? 558  ILE A CA  1 
ATOM 4341 C C   . ILE A 1 561  ? 3.770   69.647 -11.889 1.00 69.30  ? 558  ILE A C   1 
ATOM 4342 O O   . ILE A 1 561  ? 5.000   69.574 -11.736 1.00 69.30  ? 558  ILE A O   1 
ATOM 4343 C CB  . ILE A 1 561  ? 3.012   71.912 -12.757 1.00 93.28  ? 558  ILE A CB  1 
ATOM 4344 C CG1 . ILE A 1 561  ? 2.468   71.233 -14.025 1.00 93.28  ? 558  ILE A CG1 1 
ATOM 4345 C CG2 . ILE A 1 561  ? 4.407   72.479 -12.988 1.00 93.28  ? 558  ILE A CG2 1 
ATOM 4346 C CD1 . ILE A 1 561  ? 2.003   72.187 -15.102 1.00 93.28  ? 558  ILE A CD1 1 
ATOM 4347 N N   . GLY A 1 562  ? 3.018   68.660 -12.380 1.00 66.85  ? 559  GLY A N   1 
ATOM 4348 C CA  . GLY A 1 562  ? 3.594   67.405 -12.881 1.00 66.85  ? 559  GLY A CA  1 
ATOM 4349 C C   . GLY A 1 562  ? 3.400   67.189 -14.374 1.00 66.85  ? 559  GLY A C   1 
ATOM 4350 O O   . GLY A 1 562  ? 2.277   67.292 -14.895 1.00 66.85  ? 559  GLY A O   1 
ATOM 4351 N N   . LEU A 1 563  ? 4.501   66.887 -15.059 1.00 137.05 ? 560  LEU A N   1 
ATOM 4352 C CA  . LEU A 1 563  ? 4.473   66.669 -16.504 1.00 137.05 ? 560  LEU A CA  1 
ATOM 4353 C C   . LEU A 1 563  ? 4.468   65.201 -16.891 1.00 137.05 ? 560  LEU A C   1 
ATOM 4354 O O   . LEU A 1 563  ? 4.546   64.331 -16.035 1.00 137.05 ? 560  LEU A O   1 
ATOM 4355 C CB  . LEU A 1 563  ? 5.603   67.425 -17.207 1.00 58.14  ? 560  LEU A CB  1 
ATOM 4356 C CG  . LEU A 1 563  ? 5.346   68.918 -17.461 1.00 58.14  ? 560  LEU A CG  1 
ATOM 4357 C CD1 . LEU A 1 563  ? 6.166   69.374 -18.662 1.00 58.14  ? 560  LEU A CD1 1 
ATOM 4358 C CD2 . LEU A 1 563  ? 3.860   69.243 -17.670 1.00 58.14  ? 560  LEU A CD2 1 
ATOM 4359 N N   . TRP A 1 564  ? 4.396   64.941 -18.191 1.00 73.91  ? 561  TRP A N   1 
ATOM 4360 C CA  . TRP A 1 564  ? 3.994   63.638 -18.711 1.00 73.91  ? 561  TRP A CA  1 
ATOM 4361 C C   . TRP A 1 564  ? 5.048   62.827 -19.439 1.00 73.91  ? 561  TRP A C   1 
ATOM 4362 O O   . TRP A 1 564  ? 4.903   61.607 -19.547 1.00 73.91  ? 561  TRP A O   1 
ATOM 4363 C CB  . TRP A 1 564  ? 2.874   63.823 -19.712 1.00 55.83  ? 561  TRP A CB  1 
ATOM 4364 C CG  . TRP A 1 564  ? 1.520   63.414 -19.296 1.00 55.83  ? 561  TRP A CG  1 
ATOM 4365 C CD1 . TRP A 1 564  ? 0.702   64.059 -18.427 1.00 55.83  ? 561  TRP A CD1 1 
ATOM 4366 C CD2 . TRP A 1 564  ? 0.781   62.303 -19.798 1.00 55.83  ? 561  TRP A CD2 1 
ATOM 4367 N NE1 . TRP A 1 564  ? -0.498  63.410 -18.333 1.00 55.83  ? 561  TRP A NE1 1 
ATOM 4368 C CE2 . TRP A 1 564  ? -0.482  62.327 -19.168 1.00 55.83  ? 561  TRP A CE2 1 
ATOM 4369 C CE3 . TRP A 1 564  ? 1.062   61.286 -20.721 1.00 55.83  ? 561  TRP A CE3 1 
ATOM 4370 C CZ2 . TRP A 1 564  ? -1.471  61.365 -19.423 1.00 55.83  ? 561  TRP A CZ2 1 
ATOM 4371 C CZ3 . TRP A 1 564  ? 0.081   60.329 -20.980 1.00 55.83  ? 561  TRP A CZ3 1 
ATOM 4372 C CH2 . TRP A 1 564  ? -1.172  60.377 -20.330 1.00 55.83  ? 561  TRP A CH2 1 
ATOM 4373 N N   . THR A 1 565  ? 6.061   63.471 -20.007 1.00 76.50  ? 562  THR A N   1 
ATOM 4374 C CA  . THR A 1 565  ? 7.019   62.702 -20.792 1.00 76.50  ? 562  THR A CA  1 
ATOM 4375 C C   . THR A 1 565  ? 8.356   62.743 -20.105 1.00 76.50  ? 562  THR A C   1 
ATOM 4376 O O   . THR A 1 565  ? 9.018   61.717 -19.979 1.00 76.50  ? 562  THR A O   1 
ATOM 4377 C CB  . THR A 1 565  ? 7.082   63.156 -22.279 1.00 80.68  ? 562  THR A CB  1 
ATOM 4378 O OG1 . THR A 1 565  ? 5.810   62.929 -22.880 1.00 80.68  ? 562  THR A OG1 1 
ATOM 4379 C CG2 . THR A 1 565  ? 8.098   62.351 -23.071 1.00 80.68  ? 562  THR A CG2 1 
ATOM 4380 N N   . ASP A 1 566  ? 8.736   63.923 -19.632 1.00 97.43  ? 563  ASP A N   1 
ATOM 4381 C CA  . ASP A 1 566  ? 9.985   64.074 -18.903 1.00 97.43  ? 563  ASP A CA  1 
ATOM 4382 C C   . ASP A 1 566  ? 9.810   63.741 -17.415 1.00 97.43  ? 563  ASP A C   1 
ATOM 4383 O O   . ASP A 1 566  ? 10.727  63.955 -16.618 1.00 97.43  ? 563  ASP A O   1 
ATOM 4384 C CB  . ASP A 1 566  ? 10.569  65.479 -19.110 1.00 79.08  ? 563  ASP A CB  1 
ATOM 4385 C CG  . ASP A 1 566  ? 9.727   66.574 -18.468 1.00 79.08  ? 563  ASP A CG  1 
ATOM 4386 O OD1 . ASP A 1 566  ? 8.663   66.271 -17.879 1.00 79.08  ? 563  ASP A OD1 1 
ATOM 4387 O OD2 . ASP A 1 566  ? 10.141  67.754 -18.550 1.00 79.08  ? 563  ASP A OD2 1 
ATOM 4388 N N   . ILE A 1 567  ? 8.628   63.228 -17.058 1.00 77.98  ? 564  ILE A N   1 
ATOM 4389 C CA  . ILE A 1 567  ? 8.335   62.731 -15.711 1.00 77.98  ? 564  ILE A CA  1 
ATOM 4390 C C   . ILE A 1 567  ? 8.984   63.650 -14.678 1.00 77.98  ? 564  ILE A C   1 
ATOM 4391 O O   . ILE A 1 567  ? 9.897   63.264 -13.942 1.00 77.98  ? 564  ILE A O   1 
ATOM 4392 C CB  . ILE A 1 567  ? 8.764   61.232 -15.525 1.00 79.69  ? 564  ILE A CB  1 
ATOM 4393 C CG1 . ILE A 1 567  ? 7.977   60.315 -16.458 1.00 79.69  ? 564  ILE A CG1 1 
ATOM 4394 C CG2 . ILE A 1 567  ? 8.503   60.747 -14.109 1.00 79.69  ? 564  ILE A CG2 1 
ATOM 4395 C CD1 . ILE A 1 567  ? 8.589   60.120 -17.814 1.00 79.69  ? 564  ILE A CD1 1 
ATOM 4396 N N   . SER A 1 568  ? 8.506   64.882 -14.646 1.00 64.48  ? 565  SER A N   1 
ATOM 4397 C CA  . SER A 1 568  ? 9.158   65.906 -13.881 1.00 64.48  ? 565  SER A CA  1 
ATOM 4398 C C   . SER A 1 568  ? 8.162   66.781 -13.130 1.00 64.48  ? 565  SER A C   1 
ATOM 4399 O O   . SER A 1 568  ? 7.024   67.005 -13.582 1.00 64.48  ? 565  SER A O   1 
ATOM 4400 C CB  . SER A 1 568  ? 10.005  66.766 -14.828 1.00 77.87  ? 565  SER A CB  1 
ATOM 4401 O OG  . SER A 1 568  ? 9.193   67.520 -15.718 1.00 77.87  ? 565  SER A OG  1 
ATOM 4402 N N   . ALA A 1 569  ? 8.597   67.297 -11.984 1.00 66.39  ? 566  ALA A N   1 
ATOM 4403 C CA  . ALA A 1 569  ? 7.765   68.223 -11.219 1.00 66.39  ? 566  ALA A CA  1 
ATOM 4404 C C   . ALA A 1 569  ? 8.372   69.623 -11.210 1.00 66.39  ? 566  ALA A C   1 
ATOM 4405 O O   . ALA A 1 569  ? 9.594   69.780 -11.280 1.00 66.39  ? 566  ALA A O   1 
ATOM 4406 C CB  . ALA A 1 569  ? 7.571   67.712 -9.818  1.00 121.35 ? 566  ALA A CB  1 
ATOM 4407 N N   . ARG A 1 570  ? 7.516   70.640 -11.140 1.00 66.87  ? 567  ARG A N   1 
ATOM 4408 C CA  . ARG A 1 570  ? 7.999   72.026 -11.166 1.00 66.87  ? 567  ARG A CA  1 
ATOM 4409 C C   . ARG A 1 570  ? 7.199   73.040 -10.319 1.00 66.87  ? 567  ARG A C   1 
ATOM 4410 O O   . ARG A 1 570  ? 6.059   72.778 -9.889  1.00 66.87  ? 567  ARG A O   1 
ATOM 4411 C CB  . ARG A 1 570  ? 8.228   72.541 -12.617 1.00 102.91 ? 567  ARG A CB  1 
ATOM 4412 C CG  . ARG A 1 570  ? 7.468   71.818 -13.747 1.00 102.91 ? 567  ARG A CG  1 
ATOM 4413 C CD  . ARG A 1 570  ? 8.363   71.000 -14.709 1.00 102.91 ? 567  ARG A CD  1 
ATOM 4414 N NE  . ARG A 1 570  ? 8.575   71.678 -15.997 1.00 102.91 ? 567  ARG A NE  1 
ATOM 4415 C CZ  . ARG A 1 570  ? 9.018   71.095 -17.115 1.00 102.91 ? 567  ARG A CZ  1 
ATOM 4416 N NH1 . ARG A 1 570  ? 9.308   69.800 -17.138 1.00 102.91 ? 567  ARG A NH1 1 
ATOM 4417 N NH2 . ARG A 1 570  ? 9.172   71.813 -18.221 1.00 102.91 ? 567  ARG A NH2 1 
ATOM 4418 N N   . ILE A 1 571  ? 7.843   74.182 -10.072 1.00 115.88 ? 568  ILE A N   1 
ATOM 4419 C CA  . ILE A 1 571  ? 7.268   75.305 -9.338  1.00 115.88 ? 568  ILE A CA  1 
ATOM 4420 C C   . ILE A 1 571  ? 7.055   76.434 -10.329 1.00 115.88 ? 568  ILE A C   1 
ATOM 4421 O O   . ILE A 1 571  ? 7.996   76.835 -11.013 1.00 115.88 ? 568  ILE A O   1 
ATOM 4422 C CB  . ILE A 1 571  ? 8.247   75.868 -8.259  1.00 140.97 ? 568  ILE A CB  1 
ATOM 4423 C CG1 . ILE A 1 571  ? 9.221   74.799 -7.721  1.00 140.97 ? 568  ILE A CG1 1 
ATOM 4424 C CG2 . ILE A 1 571  ? 7.484   76.686 -7.177  1.00 140.97 ? 568  ILE A CG2 1 
ATOM 4425 C CD1 . ILE A 1 571  ? 8.585   73.647 -6.969  1.00 140.97 ? 568  ILE A CD1 1 
ATOM 4426 N N   . LEU A 1 572  ? 5.833   76.953 -10.407 1.00 200.23 ? 569  LEU A N   1 
ATOM 4427 C CA  . LEU A 1 572  ? 5.546   78.098 -11.280 1.00 200.23 ? 569  LEU A CA  1 
ATOM 4428 C C   . LEU A 1 572  ? 5.102   79.328 -10.470 1.00 200.23 ? 569  LEU A C   1 
ATOM 4429 O O   . LEU A 1 572  ? 4.868   79.231 -9.262  1.00 200.23 ? 569  LEU A O   1 
ATOM 4430 C CB  . LEU A 1 572  ? 4.520   77.732 -12.375 1.00 106.90 ? 569  LEU A CB  1 
ATOM 4431 C CG  . LEU A 1 572  ? 4.692   76.503 -13.298 1.00 106.90 ? 569  LEU A CG  1 
ATOM 4432 C CD1 . LEU A 1 572  ? 3.660   76.536 -14.430 1.00 106.90 ? 569  LEU A CD1 1 
ATOM 4433 C CD2 . LEU A 1 572  ? 6.106   76.329 -13.878 1.00 106.90 ? 569  LEU A CD2 1 
ATOM 4434 N N   . LYS A 1 573  ? 5.014   80.482 -11.133 1.00 180.91 ? 570  LYS A N   1 
ATOM 4435 C CA  . LYS A 1 573  ? 4.562   81.721 -10.496 1.00 180.91 ? 570  LYS A CA  1 
ATOM 4436 C C   . LYS A 1 573  ? 3.275   82.232 -11.154 1.00 180.91 ? 570  LYS A C   1 
ATOM 4437 O O   . LYS A 1 573  ? 3.318   82.839 -12.224 1.00 180.91 ? 570  LYS A O   1 
ATOM 4438 C CB  . LYS A 1 573  ? 5.663   82.781 -10.554 1.00 110.29 ? 570  LYS A CB  1 
ATOM 4439 C CG  . LYS A 1 573  ? 5.437   83.966 -9.626  1.00 110.29 ? 570  LYS A CG  1 
ATOM 4440 C CD  . LYS A 1 573  ? 6.148   85.191 -10.153 1.00 110.29 ? 570  LYS A CD  1 
ATOM 4441 C CE  . LYS A 1 573  ? 5.481   85.695 -11.427 1.00 110.29 ? 570  LYS A CE  1 
ATOM 4442 N NZ  . LYS A 1 573  ? 6.473   86.116 -12.460 1.00 110.29 ? 570  LYS A NZ  1 
ATOM 4443 N N   . LEU A 1 574  ? 2.145   82.001 -10.482 1.00 146.02 ? 571  LEU A N   1 
ATOM 4444 C CA  . LEU A 1 574  ? 0.793   82.147 -11.063 1.00 146.02 ? 571  LEU A CA  1 
ATOM 4445 C C   . LEU A 1 574  ? 0.439   83.466 -11.749 1.00 146.02 ? 571  LEU A C   1 
ATOM 4446 O O   . LEU A 1 574  ? -0.251  83.452 -12.774 1.00 146.02 ? 571  LEU A O   1 
ATOM 4447 C CB  . LEU A 1 574  ? -0.298  81.784 -10.046 1.00 180.93 ? 571  LEU A CB  1 
ATOM 4448 C CG  . LEU A 1 574  ? -0.809  80.337 -10.046 1.00 180.93 ? 571  LEU A CG  1 
ATOM 4449 C CD1 . LEU A 1 574  ? -1.685  80.091 -8.837  1.00 180.93 ? 571  LEU A CD1 1 
ATOM 4450 C CD2 . LEU A 1 574  ? -1.573  80.004 -11.319 1.00 180.93 ? 571  LEU A CD2 1 
ATOM 4451 N N   . PRO A 1 575  ? 0.873   84.609 -11.190 1.00 157.43 ? 572  PRO A N   1 
ATOM 4452 C CA  . PRO A 1 575  ? 0.637   85.822 -11.974 1.00 157.43 ? 572  PRO A CA  1 
ATOM 4453 C C   . PRO A 1 575  ? 1.098   85.692 -13.441 1.00 157.43 ? 572  PRO A C   1 
ATOM 4454 O O   . PRO A 1 575  ? 0.428   86.220 -14.334 1.00 157.43 ? 572  PRO A O   1 
ATOM 4455 C CB  . PRO A 1 575  ? 1.455   86.878 -11.228 1.00 132.43 ? 572  PRO A CB  1 
ATOM 4456 C CG  . PRO A 1 575  ? 1.476   86.391 -9.804  1.00 132.43 ? 572  PRO A CG  1 
ATOM 4457 C CD  . PRO A 1 575  ? 1.525   84.897 -9.895  1.00 132.43 ? 572  PRO A CD  1 
ATOM 4458 N N   . SER A 1 576  ? 2.198   84.960 -13.669 1.00 121.31 ? 573  SER A N   1 
ATOM 4459 C CA  . SER A 1 576  ? 2.834   84.819 -14.997 1.00 121.31 ? 573  SER A CA  1 
ATOM 4460 C C   . SER A 1 576  ? 2.856   83.402 -15.585 1.00 121.31 ? 573  SER A C   1 
ATOM 4461 O O   . SER A 1 576  ? 2.647   83.241 -16.786 1.00 121.31 ? 573  SER A O   1 
ATOM 4462 C CB  . SER A 1 576  ? 4.277   85.347 -14.966 1.00 76.13  ? 573  SER A CB  1 
ATOM 4463 O OG  . SER A 1 576  ? 5.143   84.434 -14.304 1.00 76.13  ? 573  SER A OG  1 
ATOM 4464 N N   . PHE A 1 577  ? 3.139   82.403 -14.740 1.00 96.10  ? 574  PHE A N   1 
ATOM 4465 C CA  . PHE A 1 577  ? 3.347   80.980 -15.120 1.00 96.10  ? 574  PHE A CA  1 
ATOM 4466 C C   . PHE A 1 577  ? 4.808   80.662 -15.487 1.00 96.10  ? 574  PHE A C   1 
ATOM 4467 O O   . PHE A 1 577  ? 5.127   79.530 -15.854 1.00 96.10  ? 574  PHE A O   1 
ATOM 4468 C CB  . PHE A 1 577  ? 2.416   80.513 -16.263 1.00 73.90  ? 574  PHE A CB  1 
ATOM 4469 C CG  . PHE A 1 577  ? 0.962   80.283 -15.862 1.00 73.90  ? 574  PHE A CG  1 
ATOM 4470 C CD1 . PHE A 1 577  ? 0.209   79.310 -16.508 1.00 73.90  ? 574  PHE A CD1 1 
ATOM 4471 C CD2 . PHE A 1 577  ? 0.337   81.049 -14.876 1.00 73.90  ? 574  PHE A CD2 1 
ATOM 4472 C CE1 . PHE A 1 577  ? -1.140  79.093 -16.165 1.00 73.90  ? 574  PHE A CE1 1 
ATOM 4473 C CE2 . PHE A 1 577  ? -1.010  80.828 -14.538 1.00 73.90  ? 574  PHE A CE2 1 
ATOM 4474 C CZ  . PHE A 1 577  ? -1.740  79.847 -15.182 1.00 73.90  ? 574  PHE A CZ  1 
ATOM 4475 N N   . GLU A 1 578  ? 5.685   81.658 -15.387 1.00 91.97  ? 575  GLU A N   1 
ATOM 4476 C CA  . GLU A 1 578  ? 7.086   81.507 -15.788 1.00 91.97  ? 575  GLU A CA  1 
ATOM 4477 C C   . GLU A 1 578  ? 7.772   80.365 -15.031 1.00 91.97  ? 575  GLU A C   1 
ATOM 4478 O O   . GLU A 1 578  ? 7.594   80.232 -13.824 1.00 91.97  ? 575  GLU A O   1 
ATOM 4479 C CB  . GLU A 1 578  ? 7.849   82.827 -15.610 1.00 95.81  ? 575  GLU A CB  1 
ATOM 4480 C CG  . GLU A 1 578  ? 8.002   83.266 -14.170 1.00 95.81  ? 575  GLU A CG  1 
ATOM 4481 C CD  . GLU A 1 578  ? 9.069   84.315 -13.989 1.00 95.81  ? 575  GLU A CD  1 
ATOM 4482 O OE1 . GLU A 1 578  ? 8.778   85.507 -14.231 1.00 95.81  ? 575  GLU A OE1 1 
ATOM 4483 O OE2 . GLU A 1 578  ? 10.196  83.950 -13.589 1.00 95.81  ? 575  GLU A OE2 1 
ATOM 4484 N N   . LEU A 1 579  ? 8.545   79.550 -15.750 1.00 79.48  ? 576  LEU A N   1 
ATOM 4485 C CA  . LEU A 1 579  ? 9.153   78.338 -15.193 1.00 79.48  ? 576  LEU A CA  1 
ATOM 4486 C C   . LEU A 1 579  ? 10.370  78.625 -14.328 1.00 79.48  ? 576  LEU A C   1 
ATOM 4487 O O   . LEU A 1 579  ? 11.425  79.000 -14.843 1.00 79.48  ? 576  LEU A O   1 
ATOM 4488 C CB  . LEU A 1 579  ? 9.528   77.345 -16.310 1.00 112.72 ? 576  LEU A CB  1 
ATOM 4489 C CG  . LEU A 1 579  ? 10.265  76.014 -16.010 1.00 112.72 ? 576  LEU A CG  1 
ATOM 4490 C CD1 . LEU A 1 579  ? 11.808  76.119 -16.028 1.00 112.72 ? 576  LEU A CD1 1 
ATOM 4491 C CD2 . LEU A 1 579  ? 9.780   75.318 -14.719 1.00 112.72 ? 576  LEU A CD2 1 
ATOM 4492 N N   . LEU A 1 580  ? 10.227  78.405 -13.022 1.00 133.91 ? 577  LEU A N   1 
ATOM 4493 C CA  . LEU A 1 580  ? 11.312  78.613 -12.055 1.00 133.91 ? 577  LEU A CA  1 
ATOM 4494 C C   . LEU A 1 580  ? 12.220  77.387 -11.923 1.00 133.91 ? 577  LEU A C   1 
ATOM 4495 O O   . LEU A 1 580  ? 13.201  77.259 -12.664 1.00 133.91 ? 577  LEU A O   1 
ATOM 4496 C CB  . LEU A 1 580  ? 10.755  79.022 -10.690 1.00 74.11  ? 577  LEU A CB  1 
ATOM 4497 C CG  . LEU A 1 580  ? 10.035  80.377 -10.624 1.00 74.11  ? 577  LEU A CG  1 
ATOM 4498 C CD1 . LEU A 1 580  ? 8.524   80.268 -10.873 1.00 74.11  ? 577  LEU A CD1 1 
ATOM 4499 C CD2 . LEU A 1 580  ? 10.312  81.033 -9.275  1.00 74.11  ? 577  LEU A CD2 1 
ATOM 4500 N N   . HIS A 1 581  ? 11.903  76.496 -10.980 1.00 100.02 ? 578  HIS A N   1 
ATOM 4501 C CA  . HIS A 1 581  ? 12.631  75.228 -10.865 1.00 100.02 ? 578  HIS A CA  1 
ATOM 4502 C C   . HIS A 1 581  ? 11.816  73.985 -11.212 1.00 100.02 ? 578  HIS A C   1 
ATOM 4503 O O   . HIS A 1 581  ? 10.711  73.773 -10.706 1.00 100.02 ? 578  HIS A O   1 
ATOM 4504 C CB  . HIS A 1 581  ? 13.305  75.050 -9.500  1.00 155.95 ? 578  HIS A CB  1 
ATOM 4505 C CG  . HIS A 1 581  ? 14.185  73.838 -9.432  1.00 155.95 ? 578  HIS A CG  1 
ATOM 4506 N ND1 . HIS A 1 581  ? 15.268  73.659 -10.269 1.00 155.95 ? 578  HIS A ND1 1 
ATOM 4507 C CD2 . HIS A 1 581  ? 14.127  72.733 -8.652  1.00 155.95 ? 578  HIS A CD2 1 
ATOM 4508 C CE1 . HIS A 1 581  ? 15.847  72.503 -9.998  1.00 155.95 ? 578  HIS A CE1 1 
ATOM 4509 N NE2 . HIS A 1 581  ? 15.173  71.921 -9.023  1.00 155.95 ? 578  HIS A NE2 1 
ATOM 4510 N N   . LYS A 1 582  ? 12.414  73.173 -12.079 1.00 109.81 ? 579  LYS A N   1 
ATOM 4511 C CA  . LYS A 1 582  ? 11.862  71.906 -12.520 1.00 109.81 ? 579  LYS A CA  1 
ATOM 4512 C C   . LYS A 1 582  ? 12.823  70.774 -12.169 1.00 109.81 ? 579  LYS A C   1 
ATOM 4513 O O   . LYS A 1 582  ? 14.044  70.951 -12.217 1.00 109.81 ? 579  LYS A O   1 
ATOM 4514 C CB  . LYS A 1 582  ? 11.613  71.931 -14.030 1.00 121.15 ? 579  LYS A CB  1 
ATOM 4515 C CG  . LYS A 1 582  ? 12.811  72.355 -14.882 1.00 121.15 ? 579  LYS A CG  1 
ATOM 4516 C CD  . LYS A 1 582  ? 12.666  71.870 -16.313 1.00 121.15 ? 579  LYS A CD  1 
ATOM 4517 C CE  . LYS A 1 582  ? 12.671  70.349 -16.375 1.00 121.15 ? 579  LYS A CE  1 
ATOM 4518 N NZ  . LYS A 1 582  ? 12.427  69.800 -17.740 1.00 121.15 ? 579  LYS A NZ  1 
ATOM 4519 N N   . GLU A 1 583  ? 12.260  69.614 -11.827 1.00 113.34 ? 580  GLU A N   1 
ATOM 4520 C CA  . GLU A 1 583  ? 13.042  68.445 -11.421 1.00 113.34 ? 580  GLU A CA  1 
ATOM 4521 C C   . GLU A 1 583  ? 12.583  67.153 -12.107 1.00 113.34 ? 580  GLU A C   1 
ATOM 4522 O O   . GLU A 1 583  ? 11.484  66.646 -11.850 1.00 113.34 ? 580  GLU A O   1 
ATOM 4523 C CB  . GLU A 1 583  ? 13.047  68.303 -9.887  1.00 137.40 ? 580  GLU A CB  1 
ATOM 4524 C CG  . GLU A 1 583  ? 13.680  67.018 -9.329  1.00 137.40 ? 580  GLU A CG  1 
ATOM 4525 C CD  . GLU A 1 583  ? 15.157  66.848 -9.671  1.00 137.40 ? 580  GLU A CD  1 
ATOM 4526 O OE1 . GLU A 1 583  ? 15.844  67.849 -9.983  1.00 137.40 ? 580  GLU A OE1 1 
ATOM 4527 O OE2 . GLU A 1 583  ? 15.635  65.694 -9.617  1.00 137.40 ? 580  GLU A OE2 1 
ATOM 4528 N N   . MET A 1 584  ? 13.448  66.647 -12.989 1.00 116.81 ? 581  MET A N   1 
ATOM 4529 C CA  . MET A 1 584  ? 13.259  65.362 -13.657 1.00 116.81 ? 581  MET A CA  1 
ATOM 4530 C C   . MET A 1 584  ? 13.484  64.226 -12.684 1.00 116.81 ? 581  MET A C   1 
ATOM 4531 O O   . MET A 1 584  ? 14.543  64.112 -12.072 1.00 116.81 ? 581  MET A O   1 
ATOM 4532 C CB  . MET A 1 584  ? 14.213  65.196 -14.849 1.00 117.32 ? 581  MET A CB  1 
ATOM 4533 C CG  . MET A 1 584  ? 13.737  65.832 -16.145 1.00 117.32 ? 581  MET A CG  1 
ATOM 4534 S SD  . MET A 1 584  ? 14.356  67.507 -16.396 1.00 117.32 ? 581  MET A SD  1 
ATOM 4535 C CE  . MET A 1 584  ? 15.866  67.213 -17.337 1.00 117.32 ? 581  MET A CE  1 
ATOM 4536 N N   . LEU A 1 585  ? 12.466  63.397 -12.539 1.00 98.63  ? 582  LEU A N   1 
ATOM 4537 C CA  . LEU A 1 585  ? 12.588  62.158 -11.801 1.00 98.63  ? 582  LEU A CA  1 
ATOM 4538 C C   . LEU A 1 585  ? 12.928  61.076 -12.823 1.00 98.63  ? 582  LEU A C   1 
ATOM 4539 O O   . LEU A 1 585  ? 12.993  61.339 -14.029 1.00 98.63  ? 582  LEU A O   1 
ATOM 4540 C CB  . LEU A 1 585  ? 11.281  61.853 -11.045 1.00 63.72  ? 582  LEU A CB  1 
ATOM 4541 C CG  . LEU A 1 585  ? 10.483  63.041 -10.448 1.00 63.72  ? 582  LEU A CG  1 
ATOM 4542 C CD1 . LEU A 1 585  ? 9.071   62.658 -10.043 1.00 63.72  ? 582  LEU A CD1 1 
ATOM 4543 C CD2 . LEU A 1 585  ? 11.195  63.707 -9.264  1.00 63.72  ? 582  LEU A CD2 1 
ATOM 4544 N N   . GLY A 1 586  ? 13.171  59.868 -12.340 1.00 76.19  ? 583  GLY A N   1 
ATOM 4545 C CA  . GLY A 1 586  ? 13.467  58.745 -13.220 1.00 76.19  ? 583  GLY A CA  1 
ATOM 4546 C C   . GLY A 1 586  ? 12.209  58.037 -13.698 1.00 76.19  ? 583  GLY A C   1 
ATOM 4547 O O   . GLY A 1 586  ? 11.085  58.452 -13.388 1.00 76.19  ? 583  GLY A O   1 
ATOM 4548 N N   . GLY A 1 587  ? 12.407  56.963 -14.460 1.00 79.22  ? 584  GLY A N   1 
ATOM 4549 C CA  . GLY A 1 587  ? 11.305  56.162 -14.989 1.00 79.22  ? 584  GLY A CA  1 
ATOM 4550 C C   . GLY A 1 587  ? 10.448  56.908 -15.999 1.00 79.22  ? 584  GLY A C   1 
ATOM 4551 O O   . GLY A 1 587  ? 10.712  58.079 -16.333 1.00 79.22  ? 584  GLY A O   1 
ATOM 4552 N N   . GLU A 1 588  ? 9.422   56.216 -16.487 1.00 119.92 ? 585  GLU A N   1 
ATOM 4553 C CA  . GLU A 1 588  ? 8.478   56.786 -17.448 1.00 119.92 ? 585  GLU A CA  1 
ATOM 4554 C C   . GLU A 1 588  ? 7.024   56.745 -16.950 1.00 119.92 ? 585  GLU A C   1 
ATOM 4555 O O   . GLU A 1 588  ? 6.104   57.135 -17.670 1.00 119.92 ? 585  GLU A O   1 
ATOM 4556 C CB  . GLU A 1 588  ? 8.635   56.148 -18.844 1.00 119.71 ? 585  GLU A CB  1 
ATOM 4557 C CG  . GLU A 1 588  ? 8.442   54.630 -18.911 1.00 119.71 ? 585  GLU A CG  1 
ATOM 4558 C CD  . GLU A 1 588  ? 9.661   53.848 -18.459 1.00 119.71 ? 585  GLU A CD  1 
ATOM 4559 O OE1 . GLU A 1 588  ? 10.791  54.378 -18.537 1.00 119.71 ? 585  GLU A OE1 1 
ATOM 4560 O OE2 . GLU A 1 588  ? 9.481   52.692 -18.029 1.00 119.71 ? 585  GLU A OE2 1 
ATOM 4561 N N   . ILE A 1 589  ? 6.839   56.272 -15.717 1.00 60.71  ? 586  ILE A N   1 
ATOM 4562 C CA  . ILE A 1 589  ? 5.546   56.279 -15.032 1.00 60.71  ? 586  ILE A CA  1 
ATOM 4563 C C   . ILE A 1 589  ? 5.251   57.734 -14.622 1.00 60.71  ? 586  ILE A C   1 
ATOM 4564 O O   . ILE A 1 589  ? 6.106   58.426 -14.030 1.00 60.71  ? 586  ILE A O   1 
ATOM 4565 C CB  . ILE A 1 589  ? 5.523   55.324 -13.783 1.00 50.82  ? 586  ILE A CB  1 
ATOM 4566 C CG1 . ILE A 1 589  ? 5.943   53.891 -14.140 1.00 50.82  ? 586  ILE A CG1 1 
ATOM 4567 C CG2 . ILE A 1 589  ? 4.134   55.249 -13.146 1.00 50.82  ? 586  ILE A CG2 1 
ATOM 4568 C CD1 . ILE A 1 589  ? 4.825   53.024 -14.756 1.00 50.82  ? 586  ILE A CD1 1 
ATOM 4569 N N   . ILE A 1 590  ? 4.043   58.181 -14.966 1.00 46.83  ? 587  ILE A N   1 
ATOM 4570 C CA  . ILE A 1 590  ? 3.594   59.561 -14.790 1.00 46.83  ? 587  ILE A CA  1 
ATOM 4571 C C   . ILE A 1 590  ? 3.485   59.955 -13.314 1.00 46.83  ? 587  ILE A C   1 
ATOM 4572 O O   . ILE A 1 590  ? 3.226   59.100 -12.473 1.00 46.83  ? 587  ILE A O   1 
ATOM 4573 C CB  . ILE A 1 590  ? 2.198   59.778 -15.480 1.00 83.67  ? 587  ILE A CB  1 
ATOM 4574 C CG1 . ILE A 1 590  ? 1.238   58.589 -15.223 1.00 83.67  ? 587  ILE A CG1 1 
ATOM 4575 C CG2 . ILE A 1 590  ? 2.354   60.083 -16.974 1.00 83.67  ? 587  ILE A CG2 1 
ATOM 4576 C CD1 . ILE A 1 590  ? 1.627   57.212 -15.858 1.00 83.67  ? 587  ILE A CD1 1 
ATOM 4577 N N   . PRO A 1 591  ? 3.735   61.234 -12.984 1.00 56.30  ? 588  PRO A N   1 
ATOM 4578 C CA  . PRO A 1 591  ? 3.221   61.787 -11.733 1.00 56.30  ? 588  PRO A CA  1 
ATOM 4579 C C   . PRO A 1 591  ? 1.706   61.577 -11.606 1.00 56.30  ? 588  PRO A C   1 
ATOM 4580 O O   . PRO A 1 591  ? 0.981   61.836 -12.551 1.00 56.30  ? 588  PRO A O   1 
ATOM 4581 C CB  . PRO A 1 591  ? 3.530   63.279 -11.871 1.00 61.61  ? 588  PRO A CB  1 
ATOM 4582 C CG  . PRO A 1 591  ? 4.756   63.316 -12.694 1.00 61.61  ? 588  PRO A CG  1 
ATOM 4583 C CD  . PRO A 1 591  ? 4.583   62.203 -13.696 1.00 61.61  ? 588  PRO A CD  1 
ATOM 4584 N N   . ARG A 1 592  ? 1.231   61.099 -10.458 1.00 43.74  ? 589  ARG A N   1 
ATOM 4585 C CA  . ARG A 1 592  ? -0.220  60.981 -10.223 1.00 43.74  ? 589  ARG A CA  1 
ATOM 4586 C C   . ARG A 1 592  ? -0.766  62.206 -9.502  1.00 43.74  ? 589  ARG A C   1 
ATOM 4587 O O   . ARG A 1 592  ? -1.704  62.849 -9.969  1.00 43.74  ? 589  ARG A O   1 
ATOM 4588 C CB  . ARG A 1 592  ? -0.584  59.711 -9.444  1.00 77.78  ? 589  ARG A CB  1 
ATOM 4589 C CG  . ARG A 1 592  ? -1.928  59.113 -9.863  1.00 77.78  ? 589  ARG A CG  1 
ATOM 4590 C CD  . ARG A 1 592  ? -3.126  59.930 -9.398  1.00 77.78  ? 589  ARG A CD  1 
ATOM 4591 N NE  . ARG A 1 592  ? -4.306  59.683 -10.228 1.00 77.78  ? 589  ARG A NE  1 
ATOM 4592 C CZ  . ARG A 1 592  ? -5.437  60.389 -10.186 1.00 77.78  ? 589  ARG A CZ  1 
ATOM 4593 N NH1 . ARG A 1 592  ? -5.581  61.408 -9.344  1.00 77.78  ? 589  ARG A NH1 1 
ATOM 4594 N NH2 . ARG A 1 592  ? -6.437  60.077 -10.996 1.00 77.78  ? 589  ARG A NH2 1 
ATOM 4595 N N   . SER A 1 593  ? -0.179  62.519 -8.356  1.00 49.70  ? 590  SER A N   1 
ATOM 4596 C CA  . SER A 1 593  ? -0.577  63.707 -7.645  1.00 49.70  ? 590  SER A CA  1 
ATOM 4597 C C   . SER A 1 593  ? 0.629   64.507 -7.192  1.00 49.70  ? 590  SER A C   1 
ATOM 4598 O O   . SER A 1 593  ? 1.738   63.969 -7.061  1.00 49.70  ? 590  SER A O   1 
ATOM 4599 C CB  . SER A 1 593  ? -1.473  63.366 -6.465  1.00 60.99  ? 590  SER A CB  1 
ATOM 4600 O OG  . SER A 1 593  ? -2.185  64.528 -6.092  1.00 60.99  ? 590  SER A OG  1 
ATOM 4601 N N   . ILE A 1 594  ? 0.389   65.802 -6.995  1.00 65.12  ? 591  ILE A N   1 
ATOM 4602 C CA  . ILE A 1 594  ? 1.370   66.728 -6.444  1.00 65.12  ? 591  ILE A CA  1 
ATOM 4603 C C   . ILE A 1 594  ? 0.645   67.649 -5.461  1.00 65.12  ? 591  ILE A C   1 
ATOM 4604 O O   . ILE A 1 594  ? -0.521  67.989 -5.682  1.00 65.12  ? 591  ILE A O   1 
ATOM 4605 C CB  . ILE A 1 594  ? 2.116   67.518 -7.563  1.00 86.40  ? 591  ILE A CB  1 
ATOM 4606 C CG1 . ILE A 1 594  ? 3.463   68.029 -7.047  1.00 86.40  ? 591  ILE A CG1 1 
ATOM 4607 C CG2 . ILE A 1 594  ? 1.240   68.641 -8.162  1.00 86.40  ? 591  ILE A CG2 1 
ATOM 4608 C CD1 . ILE A 1 594  ? 4.476   68.278 -8.133  1.00 86.40  ? 591  ILE A CD1 1 
ATOM 4609 N N   . LEU A 1 595  ? 1.303   68.015 -4.362  1.00 125.87 ? 592  LEU A N   1 
ATOM 4610 C CA  . LEU A 1 595  ? 0.646   68.813 -3.324  1.00 125.87 ? 592  LEU A CA  1 
ATOM 4611 C C   . LEU A 1 595  ? 1.635   69.637 -2.518  1.00 125.87 ? 592  LEU A C   1 
ATOM 4612 O O   . LEU A 1 595  ? 2.688   69.134 -2.107  1.00 125.87 ? 592  LEU A O   1 
ATOM 4613 C CB  . LEU A 1 595  ? -0.180  67.916 -2.384  1.00 88.26  ? 592  LEU A CB  1 
ATOM 4614 C CG  . LEU A 1 595  ? -1.064  68.526 -1.281  1.00 88.26  ? 592  LEU A CG  1 
ATOM 4615 C CD1 . LEU A 1 595  ? -2.325  69.188 -1.827  1.00 88.26  ? 592  LEU A CD1 1 
ATOM 4616 C CD2 . LEU A 1 595  ? -1.439  67.467 -0.246  1.00 88.26  ? 592  LEU A CD2 1 
ATOM 4617 N N   . MET A 1 596  ? 1.276   70.902 -2.299  1.00 132.32 ? 593  MET A N   1 
ATOM 4618 C CA  . MET A 1 596  ? 2.050   71.818 -1.457  1.00 132.32 ? 593  MET A CA  1 
ATOM 4619 C C   . MET A 1 596  ? 1.330   72.186 -0.144  1.00 132.32 ? 593  MET A C   1 
ATOM 4620 O O   . MET A 1 596  ? 0.211   72.709 -0.162  1.00 132.32 ? 593  MET A O   1 
ATOM 4621 C CB  . MET A 1 596  ? 2.441   73.072 -2.248  1.00 87.78  ? 593  MET A CB  1 
ATOM 4622 C CG  . MET A 1 596  ? 1.371   73.598 -3.206  1.00 87.78  ? 593  MET A CG  1 
ATOM 4623 S SD  . MET A 1 596  ? 1.755   75.234 -3.884  1.00 87.78  ? 593  MET A SD  1 
ATOM 4624 C CE  . MET A 1 596  ? 3.397   74.947 -4.546  1.00 87.78  ? 593  MET A CE  1 
ATOM 4625 N N   . THR A 1 597  ? 1.982   71.903 0.986   1.00 124.27 ? 594  THR A N   1 
ATOM 4626 C CA  . THR A 1 597  ? 1.406   72.138 2.324   1.00 124.27 ? 594  THR A CA  1 
ATOM 4627 C C   . THR A 1 597  ? 2.422   72.668 3.350   1.00 124.27 ? 594  THR A C   1 
ATOM 4628 O O   . THR A 1 597  ? 3.636   72.527 3.170   1.00 124.27 ? 594  THR A O   1 
ATOM 4629 C CB  . THR A 1 597  ? 0.745   70.861 2.902   1.00 66.71  ? 594  THR A CB  1 
ATOM 4630 O OG1 . THR A 1 597  ? 1.554   69.719 2.585   1.00 66.71  ? 594  THR A OG1 1 
ATOM 4631 C CG2 . THR A 1 597  ? -0.668  70.661 2.347   1.00 66.71  ? 594  THR A CG2 1 
ATOM 4632 N N   . THR A 1 598  ? 1.899   73.270 4.423   1.00 110.16 ? 595  THR A N   1 
ATOM 4633 C CA  . THR A 1 598  ? 2.697   73.860 5.515   1.00 110.16 ? 595  THR A CA  1 
ATOM 4634 C C   . THR A 1 598  ? 2.538   73.020 6.784   1.00 110.16 ? 595  THR A C   1 
ATOM 4635 O O   . THR A 1 598  ? 1.413   72.744 7.206   1.00 110.16 ? 595  THR A O   1 
ATOM 4636 C CB  . THR A 1 598  ? 2.249   75.323 5.826   1.00 153.02 ? 595  THR A CB  1 
ATOM 4637 O OG1 . THR A 1 598  ? 2.441   76.159 4.677   1.00 153.02 ? 595  THR A OG1 1 
ATOM 4638 C CG2 . THR A 1 598  ? 3.029   75.902 7.005   1.00 153.02 ? 595  THR A CG2 1 
ATOM 4639 N N   . PHE A 1 599  ? 3.654   72.629 7.397   1.00 153.49 ? 596  PHE A N   1 
ATOM 4640 C CA  . PHE A 1 599  ? 3.592   71.845 8.632   1.00 153.49 ? 596  PHE A CA  1 
ATOM 4641 C C   . PHE A 1 599  ? 4.285   72.492 9.819   1.00 153.49 ? 596  PHE A C   1 
ATOM 4642 O O   . PHE A 1 599  ? 3.666   72.692 10.872  1.00 153.49 ? 596  PHE A O   1 
ATOM 4643 C CB  . PHE A 1 599  ? 4.126   70.428 8.417   1.00 111.19 ? 596  PHE A CB  1 
ATOM 4644 C CG  . PHE A 1 599  ? 3.177   69.531 7.676   1.00 111.19 ? 596  PHE A CG  1 
ATOM 4645 C CD1 . PHE A 1 599  ? 3.665   68.531 6.832   1.00 111.19 ? 596  PHE A CD1 1 
ATOM 4646 C CD2 . PHE A 1 599  ? 1.792   69.686 7.809   1.00 111.19 ? 596  PHE A CD2 1 
ATOM 4647 C CE1 . PHE A 1 599  ? 2.793   67.690 6.133   1.00 111.19 ? 596  PHE A CE1 1 
ATOM 4648 C CE2 . PHE A 1 599  ? 0.910   68.861 7.111   1.00 111.19 ? 596  PHE A CE2 1 
ATOM 4649 C CZ  . PHE A 1 599  ? 1.412   67.856 6.273   1.00 111.19 ? 596  PHE A CZ  1 
ATOM 4650 N N   . GLU A 1 600  ? 5.569   72.804 9.647   1.00 120.99 ? 597  GLU A N   1 
ATOM 4651 C CA  . GLU A 1 600  ? 6.362   73.437 10.694  1.00 120.99 ? 597  GLU A CA  1 
ATOM 4652 C C   . GLU A 1 600  ? 7.402   74.386 10.097  1.00 120.99 ? 597  GLU A C   1 
ATOM 4653 O O   . GLU A 1 600  ? 7.059   75.252 9.281   1.00 120.99 ? 597  GLU A O   1 
ATOM 4654 C CB  . GLU A 1 600  ? 7.007   72.375 11.600  1.00 167.07 ? 597  GLU A CB  1 
ATOM 4655 C CG  . GLU A 1 600  ? 6.097   71.876 12.731  1.00 167.07 ? 597  GLU A CG  1 
ATOM 4656 C CD  . GLU A 1 600  ? 6.620   70.632 13.437  1.00 167.07 ? 597  GLU A CD  1 
ATOM 4657 O OE1 . GLU A 1 600  ? 7.696   70.119 13.058  1.00 167.07 ? 597  GLU A OE1 1 
ATOM 4658 O OE2 . GLU A 1 600  ? 5.944   70.162 14.378  1.00 167.07 ? 597  GLU A OE2 1 
ATOM 4659 N N   . SER A 1 601  ? 8.659   74.223 10.520  1.00 156.95 ? 598  SER A N   1 
ATOM 4660 C CA  . SER A 1 601  ? 9.792   75.007 10.016  1.00 156.95 ? 598  SER A CA  1 
ATOM 4661 C C   . SER A 1 601  ? 10.353  74.363 8.746   1.00 156.95 ? 598  SER A C   1 
ATOM 4662 O O   . SER A 1 601  ? 11.566  74.164 8.612   1.00 156.95 ? 598  SER A O   1 
ATOM 4663 C CB  . SER A 1 601  ? 10.898  75.141 11.079  1.00 128.03 ? 598  SER A CB  1 
ATOM 4664 O OG  . SER A 1 601  ? 10.390  75.519 12.348  1.00 128.03 ? 598  SER A OG  1 
ATOM 4665 N N   . SER A 1 602  ? 9.444   74.019 7.836   1.00 200.10 ? 599  SER A N   1 
ATOM 4666 C CA  . SER A 1 602  ? 9.760   73.530 6.495   1.00 200.10 ? 599  SER A CA  1 
ATOM 4667 C C   . SER A 1 602  ? 8.456   73.552 5.692   1.00 200.10 ? 599  SER A C   1 
ATOM 4668 O O   . SER A 1 602  ? 7.449   72.965 6.106   1.00 200.10 ? 599  SER A O   1 
ATOM 4669 C CB  . SER A 1 602  ? 10.365  72.109 6.521   1.00 91.79  ? 599  SER A CB  1 
ATOM 4670 O OG  . SER A 1 602  ? 11.732  72.092 6.917   1.00 91.79  ? 599  SER A OG  1 
ATOM 4671 N N   . HIS A 1 603  ? 8.462   74.272 4.573   1.00 180.54 ? 600  HIS A N   1 
ATOM 4672 C CA  . HIS A 1 603  ? 7.306   74.308 3.685   1.00 180.54 ? 600  HIS A CA  1 
ATOM 4673 C C   . HIS A 1 603  ? 7.447   73.202 2.651   1.00 180.54 ? 600  HIS A C   1 
ATOM 4674 O O   . HIS A 1 603  ? 8.405   73.177 1.878   1.00 180.54 ? 600  HIS A O   1 
ATOM 4675 C CB  . HIS A 1 603  ? 7.146   75.681 3.027   1.00 103.22 ? 600  HIS A CB  1 
ATOM 4676 C CG  . HIS A 1 603  ? 6.686   76.753 3.969   1.00 103.22 ? 600  HIS A CG  1 
ATOM 4677 N ND1 . HIS A 1 603  ? 5.540   76.639 4.729   1.00 103.22 ? 600  HIS A ND1 1 
ATOM 4678 C CD2 . HIS A 1 603  ? 7.212   77.967 4.262   1.00 103.22 ? 600  HIS A CD2 1 
ATOM 4679 C CE1 . HIS A 1 603  ? 5.387   77.731 5.457   1.00 103.22 ? 600  HIS A CE1 1 
ATOM 4680 N NE2 . HIS A 1 603  ? 6.387   78.553 5.193   1.00 103.22 ? 600  HIS A NE2 1 
ATOM 4681 N N   . TYR A 1 604  ? 6.485   72.284 2.656   1.00 94.41  ? 601  TYR A N   1 
ATOM 4682 C CA  . TYR A 1 604  ? 6.606   71.025 1.929   1.00 94.41  ? 601  TYR A CA  1 
ATOM 4683 C C   . TYR A 1 604  ? 5.821   70.978 0.623   1.00 94.41  ? 601  TYR A C   1 
ATOM 4684 O O   . TYR A 1 604  ? 4.628   71.295 0.576   1.00 94.41  ? 601  TYR A O   1 
ATOM 4685 C CB  . TYR A 1 604  ? 6.178   69.858 2.821   1.00 140.52 ? 601  TYR A CB  1 
ATOM 4686 C CG  . TYR A 1 604  ? 7.115   69.576 3.974   1.00 140.52 ? 601  TYR A CG  1 
ATOM 4687 C CD1 . TYR A 1 604  ? 6.800   69.990 5.272   1.00 140.52 ? 601  TYR A CD1 1 
ATOM 4688 C CD2 . TYR A 1 604  ? 8.316   68.883 3.773   1.00 140.52 ? 601  TYR A CD2 1 
ATOM 4689 C CE1 . TYR A 1 604  ? 7.658   69.724 6.345   1.00 140.52 ? 601  TYR A CE1 1 
ATOM 4690 C CE2 . TYR A 1 604  ? 9.183   68.613 4.838   1.00 140.52 ? 601  TYR A CE2 1 
ATOM 4691 C CZ  . TYR A 1 604  ? 8.845   69.035 6.119   1.00 140.52 ? 601  TYR A CZ  1 
ATOM 4692 O OH  . TYR A 1 604  ? 9.695   68.775 7.168   1.00 140.52 ? 601  TYR A OH  1 
ATOM 4693 N N   . LEU A 1 605  ? 6.515   70.570 -0.433  1.00 111.48 ? 602  LEU A N   1 
ATOM 4694 C CA  . LEU A 1 605  ? 5.892   70.267 -1.712  1.00 111.48 ? 602  LEU A CA  1 
ATOM 4695 C C   . LEU A 1 605  ? 6.354   68.902 -2.216  1.00 111.48 ? 602  LEU A C   1 
ATOM 4696 O O   . LEU A 1 605  ? 7.518   68.702 -2.586  1.00 111.48 ? 602  LEU A O   1 
ATOM 4697 C CB  . LEU A 1 605  ? 6.169   71.369 -2.734  1.00 123.79 ? 602  LEU A CB  1 
ATOM 4698 C CG  . LEU A 1 605  ? 5.755   71.184 -4.198  1.00 123.79 ? 602  LEU A CG  1 
ATOM 4699 C CD1 . LEU A 1 605  ? 4.391   70.544 -4.367  1.00 123.79 ? 602  LEU A CD1 1 
ATOM 4700 C CD2 . LEU A 1 605  ? 5.784   72.530 -4.887  1.00 123.79 ? 602  LEU A CD2 1 
ATOM 4701 N N   . LEU A 1 606  ? 5.412   67.970 -2.228  1.00 82.52  ? 603  LEU A N   1 
ATOM 4702 C CA  . LEU A 1 606  ? 5.693   66.581 -2.587  1.00 82.52  ? 603  LEU A CA  1 
ATOM 4703 C C   . LEU A 1 606  ? 4.810   66.080 -3.732  1.00 82.52  ? 603  LEU A C   1 
ATOM 4704 O O   . LEU A 1 606  ? 3.763   66.672 -4.051  1.00 82.52  ? 603  LEU A O   1 
ATOM 4705 C CB  . LEU A 1 606  ? 5.579   65.673 -1.355  1.00 106.42 ? 603  LEU A CB  1 
ATOM 4706 C CG  . LEU A 1 606  ? 4.722   66.198 -0.193  1.00 106.42 ? 603  LEU A CG  1 
ATOM 4707 C CD1 . LEU A 1 606  ? 3.205   66.015 -0.412  1.00 106.42 ? 603  LEU A CD1 1 
ATOM 4708 C CD2 . LEU A 1 606  ? 5.172   65.560 1.107   1.00 106.42 ? 603  LEU A CD2 1 
ATOM 4709 N N   . CYS A 1 607  ? 5.260   64.988 -4.343  1.00 66.07  ? 604  CYS A N   1 
ATOM 4710 C CA  . CYS A 1 607  ? 4.636   64.438 -5.534  1.00 66.07  ? 604  CYS A CA  1 
ATOM 4711 C C   . CYS A 1 607  ? 4.757   62.910 -5.523  1.00 66.07  ? 604  CYS A C   1 
ATOM 4712 O O   . CYS A 1 607  ? 5.836   62.364 -5.254  1.00 66.07  ? 604  CYS A O   1 
ATOM 4713 C CB  . CYS A 1 607  ? 5.267   65.066 -6.797  1.00 90.18  ? 604  CYS A CB  1 
ATOM 4714 S SG  . CYS A 1 607  ? 5.460   64.019 -8.292  1.00 90.18  ? 604  CYS A SG  1 
ATOM 4715 N N   . ALA A 1 608  ? 3.639   62.240 -5.810  1.00 55.43  ? 605  ALA A N   1 
ATOM 4716 C CA  . ALA A 1 608  ? 3.571   60.777 -5.833  1.00 55.43  ? 605  ALA A CA  1 
ATOM 4717 C C   . ALA A 1 608  ? 3.380   60.262 -7.241  1.00 55.43  ? 605  ALA A C   1 
ATOM 4718 O O   . ALA A 1 608  ? 2.529   60.771 -7.979  1.00 55.43  ? 605  ALA A O   1 
ATOM 4719 C CB  . ALA A 1 608  ? 2.430   60.297 -4.957  1.00 48.38  ? 605  ALA A CB  1 
ATOM 4720 N N   . LEU A 1 609  ? 4.159   59.242 -7.596  1.00 61.43  ? 606  LEU A N   1 
ATOM 4721 C CA  . LEU A 1 609  ? 4.072   58.623 -8.912  1.00 61.43  ? 606  LEU A CA  1 
ATOM 4722 C C   . LEU A 1 609  ? 2.930   57.638 -9.045  1.00 61.43  ? 606  LEU A C   1 
ATOM 4723 O O   . LEU A 1 609  ? 2.040   57.577 -8.203  1.00 61.43  ? 606  LEU A O   1 
ATOM 4724 C CB  . LEU A 1 609  ? 5.383   57.958 -9.280  1.00 92.24  ? 606  LEU A CB  1 
ATOM 4725 C CG  . LEU A 1 609  ? 6.545   58.935 -9.365  1.00 92.24  ? 606  LEU A CG  1 
ATOM 4726 C CD1 . LEU A 1 609  ? 7.625   58.270 -10.171 1.00 92.24  ? 606  LEU A CD1 1 
ATOM 4727 C CD2 . LEU A 1 609  ? 6.151   60.266 -9.993  1.00 92.24  ? 606  LEU A CD2 1 
ATOM 4728 N N   . GLY A 1 610  ? 2.956   56.860 -10.116 1.00 46.04  ? 607  GLY A N   1 
ATOM 4729 C CA  . GLY A 1 610  ? 1.782   56.090 -10.499 1.00 46.04  ? 607  GLY A CA  1 
ATOM 4730 C C   . GLY A 1 610  ? 1.914   54.616 -10.218 1.00 46.04  ? 607  GLY A C   1 
ATOM 4731 O O   . GLY A 1 610  ? 0.963   53.865 -10.393 1.00 46.04  ? 607  GLY A O   1 
ATOM 4732 N N   . ASP A 1 611  ? 3.098   54.199 -9.789  1.00 104.27 ? 608  ASP A N   1 
ATOM 4733 C CA  . ASP A 1 611  ? 3.337   52.803 -9.455  1.00 104.27 ? 608  ASP A CA  1 
ATOM 4734 C C   . ASP A 1 611  ? 3.285   52.584 -7.950  1.00 104.27 ? 608  ASP A C   1 
ATOM 4735 O O   . ASP A 1 611  ? 3.468   51.470 -7.472  1.00 104.27 ? 608  ASP A O   1 
ATOM 4736 C CB  . ASP A 1 611  ? 4.687   52.356 -9.999  1.00 71.84  ? 608  ASP A CB  1 
ATOM 4737 C CG  . ASP A 1 611  ? 5.843   53.156 -9.425  1.00 71.84  ? 608  ASP A CG  1 
ATOM 4738 O OD1 . ASP A 1 611  ? 6.999   52.846 -9.790  1.00 71.84  ? 608  ASP A OD1 1 
ATOM 4739 O OD2 . ASP A 1 611  ? 5.601   54.090 -8.619  1.00 71.84  ? 608  ASP A OD2 1 
ATOM 4740 N N   . GLY A 1 612  ? 3.048   53.658 -7.209  1.00 66.26  ? 609  GLY A N   1 
ATOM 4741 C CA  . GLY A 1 612  ? 2.953   53.599 -5.757  1.00 66.26  ? 609  GLY A CA  1 
ATOM 4742 C C   . GLY A 1 612  ? 4.200   54.156 -5.099  1.00 66.26  ? 609  GLY A C   1 
ATOM 4743 O O   . GLY A 1 612  ? 4.364   54.081 -3.876  1.00 66.26  ? 609  GLY A O   1 
ATOM 4744 N N   . ALA A 1 613  ? 5.087   54.709 -5.917  1.00 71.30  ? 610  ALA A N   1 
ATOM 4745 C CA  . ALA A 1 613  ? 6.301   55.339 -5.416  1.00 71.30  ? 610  ALA A CA  1 
ATOM 4746 C C   . ALA A 1 613  ? 6.022   56.766 -4.995  1.00 71.30  ? 610  ALA A C   1 
ATOM 4747 O O   . ALA A 1 613  ? 5.042   57.365 -5.421  1.00 71.30  ? 610  ALA A O   1 
ATOM 4748 C CB  . ALA A 1 613  ? 7.399   55.303 -6.478  1.00 114.84 ? 610  ALA A CB  1 
ATOM 4749 N N   . LEU A 1 614  ? 6.889   57.313 -4.158  1.00 60.01  ? 611  LEU A N   1 
ATOM 4750 C CA  . LEU A 1 614  ? 6.802   58.724 -3.820  1.00 60.01  ? 611  LEU A CA  1 
ATOM 4751 C C   . LEU A 1 614  ? 8.184   59.342 -3.640  1.00 60.01  ? 611  LEU A C   1 
ATOM 4752 O O   . LEU A 1 614  ? 9.161   58.633 -3.356  1.00 60.01  ? 611  LEU A O   1 
ATOM 4753 C CB  . LEU A 1 614  ? 5.942   58.913 -2.573  1.00 54.22  ? 611  LEU A CB  1 
ATOM 4754 C CG  . LEU A 1 614  ? 5.803   60.271 -1.901  1.00 54.22  ? 611  LEU A CG  1 
ATOM 4755 C CD1 . LEU A 1 614  ? 4.413   60.399 -1.297  1.00 54.22  ? 611  LEU A CD1 1 
ATOM 4756 C CD2 . LEU A 1 614  ? 6.890   60.413 -0.847  1.00 54.22  ? 611  LEU A CD2 1 
ATOM 4757 N N   . PHE A 1 615  ? 8.249   60.657 -3.858  1.00 81.36  ? 612  PHE A N   1 
ATOM 4758 C CA  . PHE A 1 615  ? 9.414   61.488 -3.562  1.00 81.36  ? 612  PHE A CA  1 
ATOM 4759 C C   . PHE A 1 615  ? 8.886   62.734 -2.861  1.00 81.36  ? 612  PHE A C   1 
ATOM 4760 O O   . PHE A 1 615  ? 7.797   63.235 -3.192  1.00 81.36  ? 612  PHE A O   1 
ATOM 4761 C CB  . PHE A 1 615  ? 10.140  61.918 -4.842  1.00 110.92 ? 612  PHE A CB  1 
ATOM 4762 C CG  . PHE A 1 615  ? 10.395  60.802 -5.820  1.00 110.92 ? 612  PHE A CG  1 
ATOM 4763 C CD1 . PHE A 1 615  ? 9.456   60.483 -6.795  1.00 110.92 ? 612  PHE A CD1 1 
ATOM 4764 C CD2 . PHE A 1 615  ? 11.590  60.088 -5.789  1.00 110.92 ? 612  PHE A CD2 1 
ATOM 4765 C CE1 . PHE A 1 615  ? 9.700   59.456 -7.706  1.00 110.92 ? 612  PHE A CE1 1 
ATOM 4766 C CE2 . PHE A 1 615  ? 11.843  59.061 -6.704  1.00 110.92 ? 612  PHE A CE2 1 
ATOM 4767 C CZ  . PHE A 1 615  ? 10.897  58.744 -7.660  1.00 110.92 ? 612  PHE A CZ  1 
ATOM 4768 N N   . TYR A 1 616  ? 9.653   63.239 -1.901  1.00 186.20 ? 613  TYR A N   1 
ATOM 4769 C CA  . TYR A 1 616  ? 9.227   64.395 -1.109  1.00 186.20 ? 613  TYR A CA  1 
ATOM 4770 C C   . TYR A 1 616  ? 10.213  65.546 -1.193  1.00 186.20 ? 613  TYR A C   1 
ATOM 4771 O O   . TYR A 1 616  ? 11.419  65.322 -1.307  1.00 186.20 ? 613  TYR A O   1 
ATOM 4772 C CB  . TYR A 1 616  ? 8.956   64.006 0.358   1.00 160.88 ? 613  TYR A CB  1 
ATOM 4773 C CG  . TYR A 1 616  ? 10.016  63.159 1.066   1.00 160.88 ? 613  TYR A CG  1 
ATOM 4774 C CD1 . TYR A 1 616  ? 10.103  63.164 2.462   1.00 160.88 ? 613  TYR A CD1 1 
ATOM 4775 C CD2 . TYR A 1 616  ? 10.915  62.350 0.355   1.00 160.88 ? 613  TYR A CD2 1 
ATOM 4776 C CE1 . TYR A 1 616  ? 11.049  62.391 3.130   1.00 160.88 ? 613  TYR A CE1 1 
ATOM 4777 C CE2 . TYR A 1 616  ? 11.865  61.578 1.014   1.00 160.88 ? 613  TYR A CE2 1 
ATOM 4778 C CZ  . TYR A 1 616  ? 11.926  61.602 2.400   1.00 160.88 ? 613  TYR A CZ  1 
ATOM 4779 O OH  . TYR A 1 616  ? 12.864  60.838 3.059   1.00 160.88 ? 613  TYR A OH  1 
ATOM 4780 N N   . PHE A 1 617  ? 9.693   66.773 -1.148  1.00 56.30  ? 614  PHE A N   1 
ATOM 4781 C CA  . PHE A 1 617  ? 10.544  67.959 -1.225  1.00 56.30  ? 614  PHE A CA  1 
ATOM 4782 C C   . PHE A 1 617  ? 10.140  69.113 -0.314  1.00 56.30  ? 614  PHE A C   1 
ATOM 4783 O O   . PHE A 1 617  ? 9.004   69.590 -0.349  1.00 56.30  ? 614  PHE A O   1 
ATOM 4784 C CB  . PHE A 1 617  ? 10.669  68.453 -2.675  1.00 113.80 ? 614  PHE A CB  1 
ATOM 4785 C CG  . PHE A 1 617  ? 11.486  67.548 -3.553  1.00 113.80 ? 614  PHE A CG  1 
ATOM 4786 C CD1 . PHE A 1 617  ? 10.869  66.731 -4.495  1.00 113.80 ? 614  PHE A CD1 1 
ATOM 4787 C CD2 . PHE A 1 617  ? 12.874  67.498 -3.427  1.00 113.80 ? 614  PHE A CD2 1 
ATOM 4788 C CE1 . PHE A 1 617  ? 11.628  65.877 -5.308  1.00 113.80 ? 614  PHE A CE1 1 
ATOM 4789 C CE2 . PHE A 1 617  ? 13.639  66.652 -4.234  1.00 113.80 ? 614  PHE A CE2 1 
ATOM 4790 C CZ  . PHE A 1 617  ? 13.015  65.840 -5.176  1.00 113.80 ? 614  PHE A CZ  1 
ATOM 4791 N N   . GLY A 1 618  ? 11.099  69.545 0.502   1.00 103.74 ? 615  GLY A N   1 
ATOM 4792 C CA  . GLY A 1 618  ? 11.004  70.806 1.223   1.00 103.74 ? 615  GLY A CA  1 
ATOM 4793 C C   . GLY A 1 618  ? 11.369  71.917 0.255   1.00 103.74 ? 615  GLY A C   1 
ATOM 4794 O O   . GLY A 1 618  ? 12.123  71.696 -0.707  1.00 103.74 ? 615  GLY A O   1 
ATOM 4795 N N   . LEU A 1 619  ? 10.834  73.109 0.507   1.00 190.76 ? 616  LEU A N   1 
ATOM 4796 C CA  . LEU A 1 619  ? 10.997  74.242 -0.401  1.00 190.76 ? 616  LEU A CA  1 
ATOM 4797 C C   . LEU A 1 619  ? 10.621  75.554 0.281   1.00 190.76 ? 616  LEU A C   1 
ATOM 4798 O O   . LEU A 1 619  ? 9.731   75.583 1.135   1.00 190.76 ? 616  LEU A O   1 
ATOM 4799 C CB  . LEU A 1 619  ? 10.105  74.045 -1.629  1.00 173.13 ? 616  LEU A CB  1 
ATOM 4800 C CG  . LEU A 1 619  ? 10.560  74.610 -2.969  1.00 173.13 ? 616  LEU A CG  1 
ATOM 4801 C CD1 . LEU A 1 619  ? 11.278  73.538 -3.782  1.00 173.13 ? 616  LEU A CD1 1 
ATOM 4802 C CD2 . LEU A 1 619  ? 9.344   75.105 -3.716  1.00 173.13 ? 616  LEU A CD2 1 
ATOM 4803 N N   . ASN A 1 620  ? 11.299  76.636 -0.098  1.00 136.24 ? 617  ASN A N   1 
ATOM 4804 C CA  . ASN A 1 620  ? 10.918  77.970 0.355   1.00 136.24 ? 617  ASN A CA  1 
ATOM 4805 C C   . ASN A 1 620  ? 9.679   78.367 -0.430  1.00 136.24 ? 617  ASN A C   1 
ATOM 4806 O O   . ASN A 1 620  ? 9.620   78.110 -1.634  1.00 136.24 ? 617  ASN A O   1 
ATOM 4807 C CB  . ASN A 1 620  ? 12.035  78.999 0.086   1.00 113.69 ? 617  ASN A CB  1 
ATOM 4808 C CG  . ASN A 1 620  ? 13.446  78.413 0.212   1.00 113.69 ? 617  ASN A CG  1 
ATOM 4809 O OD1 . ASN A 1 620  ? 13.778  77.756 1.202   1.00 113.69 ? 617  ASN A OD1 1 
ATOM 4810 N ND2 . ASN A 1 620  ? 14.284  78.668 -0.791  1.00 113.69 ? 617  ASN A ND2 1 
ATOM 4811 N N   . ILE A 1 621  ? 8.684   78.968 0.223   1.00 176.23 ? 618  ILE A N   1 
ATOM 4812 C CA  . ILE A 1 621  ? 7.614   79.626 -0.540  1.00 176.23 ? 618  ILE A CA  1 
ATOM 4813 C C   . ILE A 1 621  ? 8.200   80.918 -1.104  1.00 176.23 ? 618  ILE A C   1 
ATOM 4814 O O   . ILE A 1 621  ? 7.575   81.610 -1.909  1.00 176.23 ? 618  ILE A O   1 
ATOM 4815 C CB  . ILE A 1 621  ? 6.290   79.880 0.265   1.00 130.18 ? 618  ILE A CB  1 
ATOM 4816 C CG1 . ILE A 1 621  ? 6.411   81.075 1.222   1.00 130.18 ? 618  ILE A CG1 1 
ATOM 4817 C CG2 . ILE A 1 621  ? 5.834   78.614 0.986   1.00 130.18 ? 618  ILE A CG2 1 
ATOM 4818 C CD1 . ILE A 1 621  ? 5.120   81.890 1.363   1.00 130.18 ? 618  ILE A CD1 1 
ATOM 4819 N N   . GLU A 1 622  ? 9.426   81.204 -0.670  1.00 200.23 ? 619  GLU A N   1 
ATOM 4820 C CA  . GLU A 1 622  ? 10.201  82.349 -1.117  1.00 200.23 ? 619  GLU A CA  1 
ATOM 4821 C C   . GLU A 1 622  ? 10.761  82.128 -2.528  1.00 200.23 ? 619  GLU A C   1 
ATOM 4822 O O   . GLU A 1 622  ? 10.550  82.956 -3.415  1.00 200.23 ? 619  GLU A O   1 
ATOM 4823 C CB  . GLU A 1 622  ? 11.336  82.639 -0.123  1.00 127.78 ? 619  GLU A CB  1 
ATOM 4824 C CG  . GLU A 1 622  ? 10.910  82.767 1.348   1.00 127.78 ? 619  GLU A CG  1 
ATOM 4825 C CD  . GLU A 1 622  ? 10.217  84.092 1.667   1.00 127.78 ? 619  GLU A CD  1 
ATOM 4826 O OE1 . GLU A 1 622  ? 9.168   84.388 1.051   1.00 127.78 ? 619  GLU A OE1 1 
ATOM 4827 O OE2 . GLU A 1 622  ? 10.714  84.832 2.548   1.00 127.78 ? 619  GLU A OE2 1 
ATOM 4828 N N   . THR A 1 623  ? 11.471  81.017 -2.731  1.00 144.51 ? 620  THR A N   1 
ATOM 4829 C CA  . THR A 1 623  ? 12.060  80.701 -4.044  1.00 144.51 ? 620  THR A CA  1 
ATOM 4830 C C   . THR A 1 623  ? 11.683  79.296 -4.581  1.00 144.51 ? 620  THR A C   1 
ATOM 4831 O O   . THR A 1 623  ? 10.559  79.098 -5.066  1.00 144.51 ? 620  THR A O   1 
ATOM 4832 C CB  . THR A 1 623  ? 13.608  80.979 -4.090  1.00 92.10  ? 620  THR A CB  1 
ATOM 4833 O OG1 . THR A 1 623  ? 14.289  80.211 -3.082  1.00 92.10  ? 620  THR A OG1 1 
ATOM 4834 C CG2 . THR A 1 623  ? 13.901  82.477 -3.904  1.00 92.10  ? 620  THR A CG2 1 
ATOM 4835 N N   . GLY A 1 624  ? 12.607  78.334 -4.496  1.00 191.96 ? 621  GLY A N   1 
ATOM 4836 C CA  . GLY A 1 624  ? 12.354  76.980 -5.007  1.00 191.96 ? 621  GLY A CA  1 
ATOM 4837 C C   . GLY A 1 624  ? 13.561  76.064 -5.125  1.00 191.96 ? 621  GLY A C   1 
ATOM 4838 O O   . GLY A 1 624  ? 13.991  75.724 -6.232  1.00 191.96 ? 621  GLY A O   1 
ATOM 4839 N N   . LEU A 1 625  ? 14.090  75.645 -3.979  1.00 194.49 ? 622  LEU A N   1 
ATOM 4840 C CA  . LEU A 1 625  ? 15.268  74.782 -3.935  1.00 194.49 ? 622  LEU A CA  1 
ATOM 4841 C C   . LEU A 1 625  ? 14.910  73.351 -3.537  1.00 194.49 ? 622  LEU A C   1 
ATOM 4842 O O   . LEU A 1 625  ? 14.108  73.135 -2.623  1.00 194.49 ? 622  LEU A O   1 
ATOM 4843 C CB  . LEU A 1 625  ? 16.317  75.349 -2.967  1.00 121.39 ? 622  LEU A CB  1 
ATOM 4844 C CG  . LEU A 1 625  ? 17.299  76.443 -3.419  1.00 121.39 ? 622  LEU A CG  1 
ATOM 4845 C CD1 . LEU A 1 625  ? 16.611  77.791 -3.722  1.00 121.39 ? 622  LEU A CD1 1 
ATOM 4846 C CD2 . LEU A 1 625  ? 18.405  76.616 -2.369  1.00 121.39 ? 622  LEU A CD2 1 
ATOM 4847 N N   . LEU A 1 626  ? 15.516  72.385 -4.224  1.00 153.74 ? 623  LEU A N   1 
ATOM 4848 C CA  . LEU A 1 626  ? 15.323  70.963 -3.921  1.00 153.74 ? 623  LEU A CA  1 
ATOM 4849 C C   . LEU A 1 626  ? 15.979  70.554 -2.595  1.00 153.74 ? 623  LEU A C   1 
ATOM 4850 O O   . LEU A 1 626  ? 17.204  70.622 -2.453  1.00 153.74 ? 623  LEU A O   1 
ATOM 4851 C CB  . LEU A 1 626  ? 15.868  70.077 -5.056  1.00 111.42 ? 623  LEU A CB  1 
ATOM 4852 C CG  . LEU A 1 626  ? 15.273  70.128 -6.468  1.00 111.42 ? 623  LEU A CG  1 
ATOM 4853 C CD1 . LEU A 1 626  ? 16.155  69.337 -7.404  1.00 111.42 ? 623  LEU A CD1 1 
ATOM 4854 C CD2 . LEU A 1 626  ? 13.839  69.620 -6.539  1.00 111.42 ? 623  LEU A CD2 1 
ATOM 4855 N N   . SER A 1 627  ? 15.159  70.125 -1.637  1.00 154.43 ? 624  SER A N   1 
ATOM 4856 C CA  . SER A 1 627  ? 15.660  69.632 -0.358  1.00 154.43 ? 624  SER A CA  1 
ATOM 4857 C C   . SER A 1 627  ? 15.694  68.108 -0.335  1.00 154.43 ? 624  SER A C   1 
ATOM 4858 O O   . SER A 1 627  ? 16.055  67.488 -1.335  1.00 154.43 ? 624  SER A O   1 
ATOM 4859 C CB  . SER A 1 627  ? 14.835  70.198 0.792   1.00 101.19 ? 624  SER A CB  1 
ATOM 4860 O OG  . SER A 1 627  ? 14.950  71.610 0.821   1.00 101.19 ? 624  SER A OG  1 
ATOM 4861 N N   . ASP A 1 628  ? 15.326  67.510 0.797   1.00 166.25 ? 625  ASP A N   1 
ATOM 4862 C CA  . ASP A 1 628  ? 15.392  66.054 0.983   1.00 166.25 ? 625  ASP A CA  1 
ATOM 4863 C C   . ASP A 1 628  ? 14.743  65.278 -0.158  1.00 166.25 ? 625  ASP A C   1 
ATOM 4864 O O   . ASP A 1 628  ? 13.714  65.689 -0.690  1.00 166.25 ? 625  ASP A O   1 
ATOM 4865 C CB  . ASP A 1 628  ? 14.757  65.647 2.317   1.00 137.93 ? 625  ASP A CB  1 
ATOM 4866 C CG  . ASP A 1 628  ? 15.579  66.084 3.521   1.00 137.93 ? 625  ASP A CG  1 
ATOM 4867 O OD1 . ASP A 1 628  ? 16.473  66.945 3.363   1.00 137.93 ? 625  ASP A OD1 1 
ATOM 4868 O OD2 . ASP A 1 628  ? 15.324  65.565 4.632   1.00 137.93 ? 625  ASP A OD2 1 
ATOM 4869 N N   . ARG A 1 629  ? 15.363  64.160 -0.528  1.00 167.15 ? 626  ARG A N   1 
ATOM 4870 C CA  . ARG A 1 629  ? 14.900  63.343 -1.649  1.00 167.15 ? 626  ARG A CA  1 
ATOM 4871 C C   . ARG A 1 629  ? 15.316  61.878 -1.479  1.00 167.15 ? 626  ARG A C   1 
ATOM 4872 O O   . ARG A 1 629  ? 16.462  61.504 -1.764  1.00 167.15 ? 626  ARG A O   1 
ATOM 4873 C CB  . ARG A 1 629  ? 15.401  63.930 -2.986  1.00 114.17 ? 626  ARG A CB  1 
ATOM 4874 C CG  . ARG A 1 629  ? 15.033  63.132 -4.248  1.00 114.17 ? 626  ARG A CG  1 
ATOM 4875 C CD  . ARG A 1 629  ? 16.268  62.495 -4.883  1.00 114.17 ? 626  ARG A CD  1 
ATOM 4876 N NE  . ARG A 1 629  ? 15.963  61.519 -5.934  1.00 114.17 ? 626  ARG A NE  1 
ATOM 4877 C CZ  . ARG A 1 629  ? 15.526  61.816 -7.157  1.00 114.17 ? 626  ARG A CZ  1 
ATOM 4878 N NH1 . ARG A 1 629  ? 15.293  63.075 -7.514  1.00 114.17 ? 626  ARG A NH1 1 
ATOM 4879 N NH2 . ARG A 1 629  ? 15.301  60.841 -8.028  1.00 114.17 ? 626  ARG A NH2 1 
ATOM 4880 N N   . LYS A 1 630  ? 14.379  61.066 -0.986  1.00 134.83 ? 627  LYS A N   1 
ATOM 4881 C CA  . LYS A 1 630  ? 14.536  59.607 -0.943  1.00 134.83 ? 627  LYS A CA  1 
ATOM 4882 C C   . LYS A 1 630  ? 13.252  58.931 -1.408  1.00 134.83 ? 627  LYS A C   1 
ATOM 4883 O O   . LYS A 1 630  ? 12.173  59.175 -0.860  1.00 134.83 ? 627  LYS A O   1 
ATOM 4884 C CB  . LYS A 1 630  ? 14.935  59.099 0.452   1.00 79.43  ? 627  LYS A CB  1 
ATOM 4885 C CG  . LYS A 1 630  ? 16.235  59.689 0.999   1.00 79.43  ? 627  LYS A CG  1 
ATOM 4886 C CD  . LYS A 1 630  ? 16.889  58.825 2.074   1.00 79.43  ? 627  LYS A CD  1 
ATOM 4887 C CE  . LYS A 1 630  ? 18.046  59.567 2.750   1.00 79.43  ? 627  LYS A CE  1 
ATOM 4888 N NZ  . LYS A 1 630  ? 18.932  58.652 3.537   1.00 79.43  ? 627  LYS A NZ  1 
ATOM 4889 N N   . LYS A 1 631  ? 13.384  58.093 -2.433  1.00 128.60 ? 628  LYS A N   1 
ATOM 4890 C CA  . LYS A 1 631  ? 12.268  57.335 -2.992  1.00 128.60 ? 628  LYS A CA  1 
ATOM 4891 C C   . LYS A 1 631  ? 11.702  56.378 -1.937  1.00 128.60 ? 628  LYS A C   1 
ATOM 4892 O O   . LYS A 1 631  ? 12.210  55.267 -1.762  1.00 128.60 ? 628  LYS A O   1 
ATOM 4893 C CB  . LYS A 1 631  ? 12.730  56.573 -4.249  1.00 94.79  ? 628  LYS A CB  1 
ATOM 4894 C CG  . LYS A 1 631  ? 11.628  55.864 -5.042  1.00 94.79  ? 628  LYS A CG  1 
ATOM 4895 C CD  . LYS A 1 631  ? 12.191  55.150 -6.270  1.00 94.79  ? 628  LYS A CD  1 
ATOM 4896 C CE  . LYS A 1 631  ? 11.093  54.701 -7.230  1.00 94.79  ? 628  LYS A CE  1 
ATOM 4897 N NZ  . LYS A 1 631  ? 10.372  53.479 -6.763  1.00 94.79  ? 628  LYS A NZ  1 
ATOM 4898 N N   . VAL A 1 632  ? 10.667  56.831 -1.227  1.00 118.88 ? 629  VAL A N   1 
ATOM 4899 C CA  . VAL A 1 632  ? 9.990   56.016 -0.209  1.00 118.88 ? 629  VAL A CA  1 
ATOM 4900 C C   . VAL A 1 632  ? 8.664   55.480 -0.738  1.00 118.88 ? 629  VAL A C   1 
ATOM 4901 O O   . VAL A 1 632  ? 7.687   56.219 -0.848  1.00 118.88 ? 629  VAL A O   1 
ATOM 4902 C CB  . VAL A 1 632  ? 9.778   56.782 1.131   1.00 95.09  ? 629  VAL A CB  1 
ATOM 4903 C CG1 . VAL A 1 632  ? 11.099  56.923 1.879   1.00 95.09  ? 629  VAL A CG1 1 
ATOM 4904 C CG2 . VAL A 1 632  ? 9.144   58.150 0.894   1.00 95.09  ? 629  VAL A CG2 1 
ATOM 4905 N N   . THR A 1 633  ? 8.644   54.193 -1.075  1.00 88.37  ? 630  THR A N   1 
ATOM 4906 C CA  . THR A 1 633  ? 7.469   53.592 -1.689  1.00 88.37  ? 630  THR A CA  1 
ATOM 4907 C C   . THR A 1 633  ? 6.395   53.323 -0.654  1.00 88.37  ? 630  THR A C   1 
ATOM 4908 O O   . THR A 1 633  ? 6.693   53.077 0.511   1.00 88.37  ? 630  THR A O   1 
ATOM 4909 C CB  . THR A 1 633  ? 7.783   52.282 -2.454  1.00 86.72  ? 630  THR A CB  1 
ATOM 4910 O OG1 . THR A 1 633  ? 7.564   51.151 -1.604  1.00 86.72  ? 630  THR A OG1 1 
ATOM 4911 C CG2 . THR A 1 633  ? 9.220   52.276 -3.003  1.00 86.72  ? 630  THR A CG2 1 
ATOM 4912 N N   . LEU A 1 634  ? 5.144   53.391 -1.095  1.00 63.52  ? 631  LEU A N   1 
ATOM 4913 C CA  . LEU A 1 634  ? 4.000   53.069 -0.251  1.00 63.52  ? 631  LEU A CA  1 
ATOM 4914 C C   . LEU A 1 634  ? 3.325   51.841 -0.844  1.00 63.52  ? 631  LEU A C   1 
ATOM 4915 O O   . LEU A 1 634  ? 3.889   50.752 -0.759  1.00 63.52  ? 631  LEU A O   1 
ATOM 4916 C CB  . LEU A 1 634  ? 3.045   54.268 -0.097  1.00 48.22  ? 631  LEU A CB  1 
ATOM 4917 C CG  . LEU A 1 634  ? 3.678   55.564 0.433   1.00 48.22  ? 631  LEU A CG  1 
ATOM 4918 C CD1 . LEU A 1 634  ? 2.628   56.542 0.883   1.00 48.22  ? 631  LEU A CD1 1 
ATOM 4919 C CD2 . LEU A 1 634  ? 4.651   55.311 1.588   1.00 48.22  ? 631  LEU A CD2 1 
ATOM 4920 N N   . GLY A 1 635  ? 2.149   51.998 -1.449  1.00 61.57  ? 632  GLY A N   1 
ATOM 4921 C CA  . GLY A 1 635  ? 1.516   50.888 -2.168  1.00 61.57  ? 632  GLY A CA  1 
ATOM 4922 C C   . GLY A 1 635  ? 2.077   50.558 -3.559  1.00 61.57  ? 632  GLY A C   1 
ATOM 4923 O O   . GLY A 1 635  ? 3.264   50.806 -3.869  1.00 61.57  ? 632  GLY A O   1 
ATOM 4924 N N   . THR A 1 636  ? 1.231   49.959 -4.392  1.00 104.47 ? 633  THR A N   1 
ATOM 4925 C CA  . THR A 1 636  ? 1.568   49.744 -5.798  1.00 104.47 ? 633  THR A CA  1 
ATOM 4926 C C   . THR A 1 636  ? 0.554   50.452 -6.690  1.00 104.47 ? 633  THR A C   1 
ATOM 4927 O O   . THR A 1 636  ? 0.735   50.539 -7.903  1.00 104.47 ? 633  THR A O   1 
ATOM 4928 C CB  . THR A 1 636  ? 1.681   48.254 -6.175  1.00 142.36 ? 633  THR A CB  1 
ATOM 4929 O OG1 . THR A 1 636  ? 0.456   47.583 -5.856  1.00 142.36 ? 633  THR A OG1 1 
ATOM 4930 C CG2 . THR A 1 636  ? 2.858   47.596 -5.444  1.00 142.36 ? 633  THR A CG2 1 
ATOM 4931 N N   . GLN A 1 637  ? -0.512  50.958 -6.077  1.00 94.57  ? 634  GLN A N   1 
ATOM 4932 C CA  . GLN A 1 637  ? -1.464  51.803 -6.781  1.00 94.57  ? 634  GLN A CA  1 
ATOM 4933 C C   . GLN A 1 637  ? -1.016  53.263 -6.786  1.00 94.57  ? 634  GLN A C   1 
ATOM 4934 O O   . GLN A 1 637  ? -0.471  53.758 -5.784  1.00 94.57  ? 634  GLN A O   1 
ATOM 4935 C CB  . GLN A 1 637  ? -2.876  51.656 -6.202  1.00 105.65 ? 634  GLN A CB  1 
ATOM 4936 C CG  . GLN A 1 637  ? -3.468  50.266 -6.404  1.00 105.65 ? 634  GLN A CG  1 
ATOM 4937 C CD  . GLN A 1 637  ? -3.345  49.773 -7.840  1.00 105.65 ? 634  GLN A CD  1 
ATOM 4938 O OE1 . GLN A 1 637  ? -4.203  50.054 -8.676  1.00 105.65 ? 634  GLN A OE1 1 
ATOM 4939 N NE2 . GLN A 1 637  ? -2.279  49.027 -8.128  1.00 105.65 ? 634  GLN A NE2 1 
ATOM 4940 N N   . PRO A 1 638  ? -1.236  53.959 -7.920  1.00 96.26  ? 635  PRO A N   1 
ATOM 4941 C CA  . PRO A 1 638  ? -0.883  55.363 -7.982  1.00 96.26  ? 635  PRO A CA  1 
ATOM 4942 C C   . PRO A 1 638  ? -1.522  56.070 -6.802  1.00 96.26  ? 635  PRO A C   1 
ATOM 4943 O O   . PRO A 1 638  ? -2.735  55.995 -6.626  1.00 96.26  ? 635  PRO A O   1 
ATOM 4944 C CB  . PRO A 1 638  ? -1.505  55.828 -9.312  1.00 65.28  ? 635  PRO A CB  1 
ATOM 4945 C CG  . PRO A 1 638  ? -2.415  54.738 -9.749  1.00 65.28  ? 635  PRO A CG  1 
ATOM 4946 C CD  . PRO A 1 638  ? -1.840  53.496 -9.183  1.00 65.28  ? 635  PRO A CD  1 
ATOM 4947 N N   . THR A 1 639  ? -0.694  56.710 -5.987  1.00 59.00  ? 636  THR A N   1 
ATOM 4948 C CA  . THR A 1 639  ? -1.145  57.374 -4.771  1.00 59.00  ? 636  THR A CA  1 
ATOM 4949 C C   . THR A 1 639  ? -1.815  58.730 -5.031  1.00 59.00  ? 636  THR A C   1 
ATOM 4950 O O   . THR A 1 639  ? -1.392  59.485 -5.904  1.00 59.00  ? 636  THR A O   1 
ATOM 4951 C CB  . THR A 1 639  ? 0.028   57.543 -3.806  1.00 66.06  ? 636  THR A CB  1 
ATOM 4952 O OG1 . THR A 1 639  ? 0.595   56.256 -3.537  1.00 66.06  ? 636  THR A OG1 1 
ATOM 4953 C CG2 . THR A 1 639  ? -0.423  58.156 -2.514  1.00 66.06  ? 636  THR A CG2 1 
ATOM 4954 N N   . VAL A 1 640  ? -2.858  59.028 -4.264  1.00 63.58  ? 637  VAL A N   1 
ATOM 4955 C CA  . VAL A 1 640  ? -3.527  60.324 -4.324  1.00 63.58  ? 637  VAL A CA  1 
ATOM 4956 C C   . VAL A 1 640  ? -3.465  61.043 -2.967  1.00 63.58  ? 637  VAL A C   1 
ATOM 4957 O O   . VAL A 1 640  ? -3.829  60.475 -1.936  1.00 63.58  ? 637  VAL A O   1 
ATOM 4958 C CB  . VAL A 1 640  ? -4.980  60.151 -4.799  1.00 52.28  ? 637  VAL A CB  1 
ATOM 4959 C CG1 . VAL A 1 640  ? -5.839  61.386 -4.486  1.00 52.28  ? 637  VAL A CG1 1 
ATOM 4960 C CG2 . VAL A 1 640  ? -4.987  59.845 -6.277  1.00 52.28  ? 637  VAL A CG2 1 
ATOM 4961 N N   . LEU A 1 641  ? -3.020  62.295 -2.993  1.00 63.46  ? 638  LEU A N   1 
ATOM 4962 C CA  . LEU A 1 641  ? -2.715  63.074 -1.784  1.00 63.46  ? 638  LEU A CA  1 
ATOM 4963 C C   . LEU A 1 641  ? -3.802  64.088 -1.423  1.00 63.46  ? 638  LEU A C   1 
ATOM 4964 O O   . LEU A 1 641  ? -4.392  64.696 -2.305  1.00 63.46  ? 638  LEU A O   1 
ATOM 4965 C CB  . LEU A 1 641  ? -1.370  63.797 -1.960  1.00 64.53  ? 638  LEU A CB  1 
ATOM 4966 C CG  . LEU A 1 641  ? -0.048  63.034 -1.749  1.00 64.53  ? 638  LEU A CG  1 
ATOM 4967 C CD1 . LEU A 1 641  ? -0.176  61.568 -2.036  1.00 64.53  ? 638  LEU A CD1 1 
ATOM 4968 C CD2 . LEU A 1 641  ? 1.084   63.604 -2.590  1.00 64.53  ? 638  LEU A CD2 1 
ATOM 4969 N N   . ARG A 1 642  ? -4.059  64.261 -0.125  1.00 89.35  ? 639  ARG A N   1 
ATOM 4970 C CA  . ARG A 1 642  ? -5.065  65.215 0.364   1.00 89.35  ? 639  ARG A CA  1 
ATOM 4971 C C   . ARG A 1 642  ? -4.616  65.905 1.664   1.00 89.35  ? 639  ARG A C   1 
ATOM 4972 O O   . ARG A 1 642  ? -3.606  65.521 2.266   1.00 89.35  ? 639  ARG A O   1 
ATOM 4973 C CB  . ARG A 1 642  ? -6.435  64.533 0.519   1.00 119.12 ? 639  ARG A CB  1 
ATOM 4974 C CG  . ARG A 1 642  ? -7.617  65.474 0.792   1.00 119.12 ? 639  ARG A CG  1 
ATOM 4975 C CD  . ARG A 1 642  ? -7.912  66.421 -0.375  1.00 119.12 ? 639  ARG A CD  1 
ATOM 4976 N NE  . ARG A 1 642  ? -8.681  65.784 -1.450  1.00 119.12 ? 639  ARG A NE  1 
ATOM 4977 C CZ  . ARG A 1 642  ? -9.978  65.993 -1.695  1.00 119.12 ? 639  ARG A CZ  1 
ATOM 4978 N NH1 . ARG A 1 642  ? -10.691 66.834 -0.951  1.00 119.12 ? 639  ARG A NH1 1 
ATOM 4979 N NH2 . ARG A 1 642  ? -10.575 65.357 -2.695  1.00 119.12 ? 639  ARG A NH2 1 
ATOM 4980 N N   . THR A 1 643  ? -5.346  66.954 2.054   1.00 139.56 ? 640  THR A N   1 
ATOM 4981 C CA  . THR A 1 643  ? -5.121  67.670 3.315   1.00 139.56 ? 640  THR A CA  1 
ATOM 4982 C C   . THR A 1 643  ? -6.362  67.565 4.195   1.00 139.56 ? 640  THR A C   1 
ATOM 4983 O O   . THR A 1 643  ? -7.486  67.675 3.702   1.00 139.56 ? 640  THR A O   1 
ATOM 4984 C CB  . THR A 1 643  ? -4.823  69.165 3.095   1.00 112.61 ? 640  THR A CB  1 
ATOM 4985 O OG1 . THR A 1 643  ? -4.185  69.350 1.830   1.00 112.61 ? 640  THR A OG1 1 
ATOM 4986 C CG2 . THR A 1 643  ? -3.915  69.696 4.196   1.00 112.61 ? 640  THR A CG2 1 
ATOM 4987 N N   . PHE A 1 644  ? -6.149  67.366 5.495   1.00 175.57 ? 641  PHE A N   1 
ATOM 4988 C CA  . PHE A 1 644  ? -7.245  67.228 6.458   1.00 175.57 ? 641  PHE A CA  1 
ATOM 4989 C C   . PHE A 1 644  ? -6.922  67.851 7.816   1.00 175.57 ? 641  PHE A C   1 
ATOM 4990 O O   . PHE A 1 644  ? -5.763  67.870 8.234   1.00 175.57 ? 641  PHE A O   1 
ATOM 4991 C CB  . PHE A 1 644  ? -7.629  65.753 6.630   1.00 179.19 ? 641  PHE A CB  1 
ATOM 4992 C CG  . PHE A 1 644  ? -6.534  64.897 7.210   1.00 179.19 ? 641  PHE A CG  1 
ATOM 4993 C CD1 . PHE A 1 644  ? -6.481  64.646 8.577   1.00 179.19 ? 641  PHE A CD1 1 
ATOM 4994 C CD2 . PHE A 1 644  ? -5.564  64.333 6.391   1.00 179.19 ? 641  PHE A CD2 1 
ATOM 4995 C CE1 . PHE A 1 644  ? -5.472  63.855 9.121   1.00 179.19 ? 641  PHE A CE1 1 
ATOM 4996 C CE2 . PHE A 1 644  ? -4.551  63.543 6.928   1.00 179.19 ? 641  PHE A CE2 1 
ATOM 4997 C CZ  . PHE A 1 644  ? -4.507  63.302 8.294   1.00 179.19 ? 641  PHE A CZ  1 
ATOM 4998 N N   . ARG A 1 645  ? -7.960  68.344 8.494   1.00 148.06 ? 642  ARG A N   1 
ATOM 4999 C CA  . ARG A 1 645  ? -7.835  68.948 9.826   1.00 148.06 ? 642  ARG A CA  1 
ATOM 5000 C C   . ARG A 1 645  ? -7.888  67.861 10.910  1.00 148.06 ? 642  ARG A C   1 
ATOM 5001 O O   . ARG A 1 645  ? -8.745  66.972 10.860  1.00 148.06 ? 642  ARG A O   1 
ATOM 5002 C CB  . ARG A 1 645  ? -8.942  69.994 10.038  1.00 133.83 ? 642  ARG A CB  1 
ATOM 5003 C CG  . ARG A 1 645  ? -8.725  70.976 11.197  1.00 133.83 ? 642  ARG A CG  1 
ATOM 5004 C CD  . ARG A 1 645  ? -9.990  71.796 11.471  1.00 133.83 ? 642  ARG A CD  1 
ATOM 5005 N NE  . ARG A 1 645  ? -11.090 70.971 11.986  1.00 133.83 ? 642  ARG A NE  1 
ATOM 5006 C CZ  . ARG A 1 645  ? -12.373 71.339 12.035  1.00 133.83 ? 642  ARG A CZ  1 
ATOM 5007 N NH1 . ARG A 1 645  ? -12.757 72.533 11.597  1.00 133.83 ? 642  ARG A NH1 1 
ATOM 5008 N NH2 . ARG A 1 645  ? -13.280 70.503 12.522  1.00 133.83 ? 642  ARG A NH2 1 
ATOM 5009 N N   . SER A 1 646  ? -6.968  67.941 11.877  1.00 158.59 ? 643  SER A N   1 
ATOM 5010 C CA  . SER A 1 646  ? -6.857  66.946 12.958  1.00 158.59 ? 643  SER A CA  1 
ATOM 5011 C C   . SER A 1 646  ? -6.768  67.578 14.359  1.00 158.59 ? 643  SER A C   1 
ATOM 5012 O O   . SER A 1 646  ? -7.720  68.213 14.829  1.00 158.59 ? 643  SER A O   1 
ATOM 5013 C CB  . SER A 1 646  ? -5.658  66.020 12.710  1.00 142.31 ? 643  SER A CB  1 
ATOM 5014 O OG  . SER A 1 646  ? -4.435  66.736 12.780  1.00 142.31 ? 643  SER A OG  1 
ATOM 5015 N N   . LEU A 1 647  ? -5.625  67.383 15.017  1.00 114.31 ? 644  LEU A N   1 
ATOM 5016 C CA  . LEU A 1 647  ? -5.327  67.988 16.318  1.00 114.31 ? 644  LEU A CA  1 
ATOM 5017 C C   . LEU A 1 647  ? -4.942  69.468 16.137  1.00 114.31 ? 644  LEU A C   1 
ATOM 5018 O O   . LEU A 1 647  ? -5.692  70.232 15.517  1.00 114.31 ? 644  LEU A O   1 
ATOM 5019 C CB  . LEU A 1 647  ? -4.228  67.187 17.052  1.00 95.26  ? 644  LEU A CB  1 
ATOM 5020 C CG  . LEU A 1 647  ? -2.965  66.699 16.305  1.00 95.26  ? 644  LEU A CG  1 
ATOM 5021 C CD1 . LEU A 1 647  ? -1.742  66.684 17.233  1.00 95.26  ? 644  LEU A CD1 1 
ATOM 5022 C CD2 . LEU A 1 647  ? -3.161  65.334 15.612  1.00 95.26  ? 644  LEU A CD2 1 
ATOM 5023 N N   . SER A 1 648  ? -3.786  69.866 16.675  1.00 171.12 ? 645  SER A N   1 
ATOM 5024 C CA  . SER A 1 648  ? -3.248  71.212 16.472  1.00 171.12 ? 645  SER A CA  1 
ATOM 5025 C C   . SER A 1 648  ? -2.778  71.361 15.024  1.00 171.12 ? 645  SER A C   1 
ATOM 5026 O O   . SER A 1 648  ? -3.399  72.077 14.234  1.00 171.12 ? 645  SER A O   1 
ATOM 5027 C CB  . SER A 1 648  ? -2.110  71.509 17.460  1.00 101.03 ? 645  SER A CB  1 
ATOM 5028 O OG  . SER A 1 648  ? -0.934  70.775 17.144  1.00 101.03 ? 645  SER A OG  1 
ATOM 5029 N N   . THR A 1 649  ? -1.692  70.669 14.685  1.00 183.05 ? 646  THR A N   1 
ATOM 5030 C CA  . THR A 1 649  ? -1.219  70.588 13.307  1.00 183.05 ? 646  THR A CA  1 
ATOM 5031 C C   . THR A 1 649  ? -2.149  69.694 12.488  1.00 183.05 ? 646  THR A C   1 
ATOM 5032 O O   . THR A 1 649  ? -2.594  68.645 12.962  1.00 183.05 ? 646  THR A O   1 
ATOM 5033 C CB  . THR A 1 649  ? 0.244   70.077 13.215  1.00 102.75 ? 646  THR A CB  1 
ATOM 5034 O OG1 . THR A 1 649  ? 0.474   69.074 14.219  1.00 102.75 ? 646  THR A OG1 1 
ATOM 5035 C CG2 . THR A 1 649  ? 1.238   71.243 13.395  1.00 102.75 ? 646  THR A CG2 1 
ATOM 5036 N N   . THR A 1 650  ? -2.447  70.134 11.268  1.00 122.07 ? 647  THR A N   1 
ATOM 5037 C CA  . THR A 1 650  ? -3.353  69.424 10.361  1.00 122.07 ? 647  THR A CA  1 
ATOM 5038 C C   . THR A 1 650  ? -2.553  68.797 9.195   1.00 122.07 ? 647  THR A C   1 
ATOM 5039 O O   . THR A 1 650  ? -1.736  69.472 8.567   1.00 122.07 ? 647  THR A O   1 
ATOM 5040 C CB  . THR A 1 650  ? -4.480  70.368 9.850   1.00 87.26  ? 647  THR A CB  1 
ATOM 5041 O OG1 . THR A 1 650  ? -3.990  71.191 8.785   1.00 87.26  ? 647  THR A OG1 1 
ATOM 5042 C CG2 . THR A 1 650  ? -5.010  71.263 10.973  1.00 87.26  ? 647  THR A CG2 1 
ATOM 5043 N N   . ASN A 1 651  ? -2.796  67.516 8.905   1.00 102.13 ? 648  ASN A N   1 
ATOM 5044 C CA  . ASN A 1 651  ? -1.851  66.711 8.108   1.00 102.13 ? 648  ASN A CA  1 
ATOM 5045 C C   . ASN A 1 651  ? -2.276  66.182 6.725   1.00 102.13 ? 648  ASN A C   1 
ATOM 5046 O O   . ASN A 1 651  ? -3.275  66.628 6.154   1.00 102.13 ? 648  ASN A O   1 
ATOM 5047 C CB  . ASN A 1 651  ? -1.282  65.576 8.969   1.00 129.48 ? 648  ASN A CB  1 
ATOM 5048 C CG  . ASN A 1 651  ? -0.149  66.040 9.859   1.00 129.48 ? 648  ASN A CG  1 
ATOM 5049 O OD1 . ASN A 1 651  ? 0.911   66.448 9.380   1.00 129.48 ? 648  ASN A OD1 1 
ATOM 5050 N ND2 . ASN A 1 651  ? -0.367  65.983 11.162  1.00 129.48 ? 648  ASN A ND2 1 
ATOM 5051 N N   . VAL A 1 652  ? -1.488  65.226 6.213   1.00 97.23  ? 649  VAL A N   1 
ATOM 5052 C CA  . VAL A 1 652  ? -1.621  64.664 4.854   1.00 97.23  ? 649  VAL A CA  1 
ATOM 5053 C C   . VAL A 1 652  ? -1.850  63.142 4.804   1.00 97.23  ? 649  VAL A C   1 
ATOM 5054 O O   . VAL A 1 652  ? -1.080  62.350 5.358   1.00 97.23  ? 649  VAL A O   1 
ATOM 5055 C CB  . VAL A 1 652  ? -0.407  65.054 3.973   1.00 124.36 ? 649  VAL A CB  1 
ATOM 5056 C CG1 . VAL A 1 652  ? -0.187  64.062 2.835   1.00 124.36 ? 649  VAL A CG1 1 
ATOM 5057 C CG2 . VAL A 1 652  ? -0.593  66.458 3.431   1.00 124.36 ? 649  VAL A CG2 1 
ATOM 5058 N N   . PHE A 1 653  ? -2.914  62.767 4.103   1.00 70.35  ? 650  PHE A N   1 
ATOM 5059 C CA  . PHE A 1 653  ? -3.364  61.392 3.935   1.00 70.35  ? 650  PHE A CA  1 
ATOM 5060 C C   . PHE A 1 653  ? -3.163  60.900 2.493   1.00 70.35  ? 650  PHE A C   1 
ATOM 5061 O O   . PHE A 1 653  ? -3.859  61.336 1.574   1.00 70.35  ? 650  PHE A O   1 
ATOM 5062 C CB  . PHE A 1 653  ? -4.842  61.354 4.276   1.00 61.85  ? 650  PHE A CB  1 
ATOM 5063 C CG  . PHE A 1 653  ? -5.455  59.988 4.256   1.00 61.85  ? 650  PHE A CG  1 
ATOM 5064 C CD1 . PHE A 1 653  ? -5.712  59.321 5.441   1.00 61.85  ? 650  PHE A CD1 1 
ATOM 5065 C CD2 . PHE A 1 653  ? -5.852  59.398 3.060   1.00 61.85  ? 650  PHE A CD2 1 
ATOM 5066 C CE1 . PHE A 1 653  ? -6.326  58.063 5.430   1.00 61.85  ? 650  PHE A CE1 1 
ATOM 5067 C CE2 . PHE A 1 653  ? -6.467  58.145 3.041   1.00 61.85  ? 650  PHE A CE2 1 
ATOM 5068 C CZ  . PHE A 1 653  ? -6.703  57.476 4.226   1.00 61.85  ? 650  PHE A CZ  1 
ATOM 5069 N N   . ALA A 1 654  ? -2.215  59.984 2.320   1.00 41.62  ? 651  ALA A N   1 
ATOM 5070 C CA  . ALA A 1 654  ? -1.924  59.332 1.046   1.00 41.62  ? 651  ALA A CA  1 
ATOM 5071 C C   . ALA A 1 654  ? -2.840  58.133 0.709   1.00 41.62  ? 651  ALA A C   1 
ATOM 5072 O O   . ALA A 1 654  ? -2.720  57.085 1.339   1.00 41.62  ? 651  ALA A O   1 
ATOM 5073 C CB  . ALA A 1 654  ? -0.467  58.877 1.050   1.00 66.86  ? 651  ALA A CB  1 
ATOM 5074 N N   . CYS A 1 655  ? -3.709  58.271 -0.299  1.00 45.01  ? 652  CYS A N   1 
ATOM 5075 C CA  . CYS A 1 655  ? -4.571  57.157 -0.736  1.00 45.01  ? 652  CYS A CA  1 
ATOM 5076 C C   . CYS A 1 655  ? -3.908  56.189 -1.724  1.00 45.01  ? 652  CYS A C   1 
ATOM 5077 O O   . CYS A 1 655  ? -3.256  56.577 -2.709  1.00 45.01  ? 652  CYS A O   1 
ATOM 5078 C CB  . CYS A 1 655  ? -5.864  57.647 -1.352  1.00 70.67  ? 652  CYS A CB  1 
ATOM 5079 S SG  . CYS A 1 655  ? -6.713  58.786 -0.361  1.00 70.67  ? 652  CYS A SG  1 
ATOM 5080 N N   . SER A 1 656  ? -4.136  54.913 -1.464  1.00 41.59  ? 653  SER A N   1 
ATOM 5081 C CA  . SER A 1 656  ? -3.429  53.845 -2.143  1.00 41.59  ? 653  SER A CA  1 
ATOM 5082 C C   . SER A 1 656  ? -4.072  52.530 -1.699  1.00 41.59  ? 653  SER A C   1 
ATOM 5083 O O   . SER A 1 656  ? -5.041  52.543 -0.915  1.00 41.59  ? 653  SER A O   1 
ATOM 5084 C CB  . SER A 1 656  ? -1.939  53.866 -1.767  1.00 59.81  ? 653  SER A CB  1 
ATOM 5085 O OG  . SER A 1 656  ? -1.285  52.704 -2.236  1.00 59.81  ? 653  SER A OG  1 
ATOM 5086 N N   . ASP A 1 657  ? -3.547  51.420 -2.210  1.00 70.77  ? 654  ASP A N   1 
ATOM 5087 C CA  . ASP A 1 657  ? -3.847  50.107 -1.689  1.00 70.77  ? 654  ASP A CA  1 
ATOM 5088 C C   . ASP A 1 657  ? -3.109  49.924 -0.364  1.00 70.77  ? 654  ASP A C   1 
ATOM 5089 O O   . ASP A 1 657  ? -3.379  48.970 0.367   1.00 70.77  ? 654  ASP A O   1 
ATOM 5090 C CB  . ASP A 1 657  ? -3.390  49.043 -2.676  1.00 64.05  ? 654  ASP A CB  1 
ATOM 5091 C CG  . ASP A 1 657  ? -1.886  49.078 -2.920  1.00 64.05  ? 654  ASP A CG  1 
ATOM 5092 O OD1 . ASP A 1 657  ? -1.302  50.178 -3.024  1.00 64.05  ? 654  ASP A OD1 1 
ATOM 5093 O OD2 . ASP A 1 657  ? -1.285  47.998 -3.020  1.00 64.05  ? 654  ASP A OD2 1 
ATOM 5094 N N   . ARG A 1 658  ? -2.165  50.827 -0.066  1.00 73.63  ? 655  ARG A N   1 
ATOM 5095 C CA  . ARG A 1 658  ? -1.513  50.864 1.251   1.00 73.63  ? 655  ARG A CA  1 
ATOM 5096 C C   . ARG A 1 658  ? -1.692  52.226 1.934   1.00 73.63  ? 655  ARG A C   1 
ATOM 5097 O O   . ARG A 1 658  ? -0.746  53.002 2.008   1.00 73.63  ? 655  ARG A O   1 
ATOM 5098 C CB  . ARG A 1 658  ? -0.030  50.494 1.149   1.00 92.50  ? 655  ARG A CB  1 
ATOM 5099 C CG  . ARG A 1 658  ? 0.508   49.789 2.390   1.00 92.50  ? 655  ARG A CG  1 
ATOM 5100 C CD  . ARG A 1 658  ? 2.041   49.748 2.441   1.00 92.50  ? 655  ARG A CD  1 
ATOM 5101 N NE  . ARG A 1 658  ? 2.630   49.363 1.160   1.00 92.50  ? 655  ARG A NE  1 
ATOM 5102 C CZ  . ARG A 1 658  ? 2.776   48.111 0.733   1.00 92.50  ? 655  ARG A CZ  1 
ATOM 5103 N NH1 . ARG A 1 658  ? 2.379   47.090 1.485   1.00 92.50  ? 655  ARG A NH1 1 
ATOM 5104 N NH2 . ARG A 1 658  ? 3.319   47.881 -0.456  1.00 92.50  ? 655  ARG A NH2 1 
ATOM 5105 N N   . PRO A 1 659  ? -2.909  52.515 2.434   1.00 66.75  ? 656  PRO A N   1 
ATOM 5106 C CA  . PRO A 1 659  ? -3.287  53.752 3.114   1.00 66.75  ? 656  PRO A CA  1 
ATOM 5107 C C   . PRO A 1 659  ? -2.273  54.223 4.132   1.00 66.75  ? 656  PRO A C   1 
ATOM 5108 O O   . PRO A 1 659  ? -2.079  53.575 5.167   1.00 66.75  ? 656  PRO A O   1 
ATOM 5109 C CB  . PRO A 1 659  ? -4.568  53.364 3.833   1.00 43.46  ? 656  PRO A CB  1 
ATOM 5110 C CG  . PRO A 1 659  ? -5.184  52.388 2.933   1.00 43.46  ? 656  PRO A CG  1 
ATOM 5111 C CD  . PRO A 1 659  ? -4.054  51.602 2.329   1.00 43.46  ? 656  PRO A CD  1 
ATOM 5112 N N   . THR A 1 660  ? -1.640  55.353 3.835   1.00 46.00  ? 657  THR A N   1 
ATOM 5113 C CA  . THR A 1 660  ? -0.595  55.914 4.681   1.00 46.00  ? 657  THR A CA  1 
ATOM 5114 C C   . THR A 1 660  ? -0.969  57.322 5.123   1.00 46.00  ? 657  THR A C   1 
ATOM 5115 O O   . THR A 1 660  ? -1.721  58.016 4.453   1.00 46.00  ? 657  THR A O   1 
ATOM 5116 C CB  . THR A 1 660  ? 0.717   55.936 3.937   1.00 65.25  ? 657  THR A CB  1 
ATOM 5117 O OG1 . THR A 1 660  ? 0.922   54.654 3.323   1.00 65.25  ? 657  THR A OG1 1 
ATOM 5118 C CG2 . THR A 1 660  ? 1.862   56.223 4.882   1.00 65.25  ? 657  THR A CG2 1 
ATOM 5119 N N   . VAL A 1 661  ? -0.489  57.722 6.289   1.00 43.83  ? 658  VAL A N   1 
ATOM 5120 C CA  . VAL A 1 661  ? -0.725  59.058 6.780   1.00 43.83  ? 658  VAL A CA  1 
ATOM 5121 C C   . VAL A 1 661  ? 0.617   59.678 7.037   1.00 43.83  ? 658  VAL A C   1 
ATOM 5122 O O   . VAL A 1 661  ? 1.514   59.009 7.561   1.00 43.83  ? 658  VAL A O   1 
ATOM 5123 C CB  . VAL A 1 661  ? -1.514  59.059 8.069   1.00 48.52  ? 658  VAL A CB  1 
ATOM 5124 C CG1 . VAL A 1 661  ? -1.452  60.450 8.713   1.00 48.52  ? 658  VAL A CG1 1 
ATOM 5125 C CG2 . VAL A 1 661  ? -2.952  58.676 7.794   1.00 48.52  ? 658  VAL A CG2 1 
ATOM 5126 N N   . ILE A 1 662  ? 0.763   60.941 6.631   1.00 119.19 ? 659  ILE A N   1 
ATOM 5127 C CA  . ILE A 1 662  ? 2.019   61.674 6.790   1.00 119.19 ? 659  ILE A CA  1 
ATOM 5128 C C   . ILE A 1 662  ? 1.904   62.767 7.858   1.00 119.19 ? 659  ILE A C   1 
ATOM 5129 O O   . ILE A 1 662  ? 1.226   63.782 7.661   1.00 119.19 ? 659  ILE A O   1 
ATOM 5130 C CB  . ILE A 1 662  ? 2.557   62.225 5.446   1.00 101.14 ? 659  ILE A CB  1 
ATOM 5131 C CG1 . ILE A 1 662  ? 2.737   61.083 4.434   1.00 101.14 ? 659  ILE A CG1 1 
ATOM 5132 C CG2 . ILE A 1 662  ? 3.892   62.898 5.664   1.00 101.14 ? 659  ILE A CG2 1 
ATOM 5133 C CD1 . ILE A 1 662  ? 2.910   61.526 2.991   1.00 101.14 ? 659  ILE A CD1 1 
ATOM 5134 N N   . TYR A 1 663  ? 2.577   62.516 8.985   1.00 107.85 ? 660  TYR A N   1 
ATOM 5135 C CA  . TYR A 1 663  ? 2.562   63.361 10.181  1.00 107.85 ? 660  TYR A CA  1 
ATOM 5136 C C   . TYR A 1 663  ? 3.876   64.144 10.310  1.00 107.85 ? 660  TYR A C   1 
ATOM 5137 O O   . TYR A 1 663  ? 4.484   64.539 9.313   1.00 107.85 ? 660  TYR A O   1 
ATOM 5138 C CB  . TYR A 1 663  ? 2.376   62.496 11.444  1.00 181.43 ? 660  TYR A CB  1 
ATOM 5139 C CG  . TYR A 1 663  ? 0.950   62.189 11.868  1.00 181.43 ? 660  TYR A CG  1 
ATOM 5140 C CD1 . TYR A 1 663  ? 0.443   60.892 11.792  1.00 181.43 ? 660  TYR A CD1 1 
ATOM 5141 C CD2 . TYR A 1 663  ? 0.119   63.185 12.386  1.00 181.43 ? 660  TYR A CD2 1 
ATOM 5142 C CE1 . TYR A 1 663  ? -0.870  60.597 12.197  1.00 181.43 ? 660  TYR A CE1 1 
ATOM 5143 C CE2 . TYR A 1 663  ? -1.196  62.901 12.793  1.00 181.43 ? 660  TYR A CE2 1 
ATOM 5144 C CZ  . TYR A 1 663  ? -1.682  61.605 12.696  1.00 181.43 ? 660  TYR A CZ  1 
ATOM 5145 O OH  . TYR A 1 663  ? -2.971  61.317 13.096  1.00 181.43 ? 660  TYR A OH  1 
ATOM 5146 N N   . SER A 1 664  ? 4.308   64.347 11.555  1.00 200.23 ? 661  SER A N   1 
ATOM 5147 C CA  . SER A 1 664  ? 5.565   65.029 11.853  1.00 200.23 ? 661  SER A CA  1 
ATOM 5148 C C   . SER A 1 664  ? 6.296   64.485 13.081  1.00 200.23 ? 661  SER A C   1 
ATOM 5149 O O   . SER A 1 664  ? 5.739   64.416 14.181  1.00 200.23 ? 661  SER A O   1 
ATOM 5150 C CB  . SER A 1 664  ? 5.337   66.523 12.013  1.00 64.18  ? 661  SER A CB  1 
ATOM 5151 O OG  . SER A 1 664  ? 4.996   67.110 10.778  1.00 64.18  ? 661  SER A OG  1 
ATOM 5152 N N   . SER A 1 665  ? 7.556   64.117 12.868  1.00 179.56 ? 662  SER A N   1 
ATOM 5153 C CA  . SER A 1 665  ? 8.425   63.553 13.895  1.00 179.56 ? 662  SER A CA  1 
ATOM 5154 C C   . SER A 1 665  ? 9.023   64.679 14.749  1.00 179.56 ? 662  SER A C   1 
ATOM 5155 O O   . SER A 1 665  ? 8.354   65.683 15.010  1.00 179.56 ? 662  SER A O   1 
ATOM 5156 C CB  . SER A 1 665  ? 9.508   62.705 13.205  1.00 79.99  ? 662  SER A CB  1 
ATOM 5157 O OG  . SER A 1 665  ? 10.648  62.483 14.013  1.00 79.99  ? 662  SER A OG  1 
ATOM 5158 N N   . ASN A 1 666  ? 10.263  64.491 15.204  1.00 160.08 ? 663  ASN A N   1 
ATOM 5159 C CA  . ASN A 1 666  ? 11.076  65.559 15.783  1.00 160.08 ? 663  ASN A CA  1 
ATOM 5160 C C   . ASN A 1 666  ? 10.831  66.841 14.990  1.00 160.08 ? 663  ASN A C   1 
ATOM 5161 O O   . ASN A 1 666  ? 10.385  67.851 15.533  1.00 160.08 ? 663  ASN A O   1 
ATOM 5162 C CB  . ASN A 1 666  ? 12.561  65.139 15.765  1.00 164.93 ? 663  ASN A CB  1 
ATOM 5163 C CG  . ASN A 1 666  ? 13.531  66.322 15.744  1.00 164.93 ? 663  ASN A CG  1 
ATOM 5164 O OD1 . ASN A 1 666  ? 13.983  66.787 16.792  1.00 164.93 ? 663  ASN A OD1 1 
ATOM 5165 N ND2 . ASN A 1 666  ? 13.872  66.793 14.545  1.00 164.93 ? 663  ASN A ND2 1 
ATOM 5166 N N   . HIS A 1 667  ? 11.105  66.756 13.692  1.00 89.22  ? 664  HIS A N   1 
ATOM 5167 C CA  . HIS A 1 667  ? 10.782  67.781 12.714  1.00 89.22  ? 664  HIS A CA  1 
ATOM 5168 C C   . HIS A 1 667  ? 10.823  67.103 11.351  1.00 89.22  ? 664  HIS A C   1 
ATOM 5169 O O   . HIS A 1 667  ? 10.948  67.758 10.317  1.00 89.22  ? 664  HIS A O   1 
ATOM 5170 C CB  . HIS A 1 667  ? 11.788  68.930 12.770  1.00 146.19 ? 664  HIS A CB  1 
ATOM 5171 C CG  . HIS A 1 667  ? 11.248  70.224 12.250  1.00 146.19 ? 664  HIS A CG  1 
ATOM 5172 N ND1 . HIS A 1 667  ? 10.858  70.393 10.938  1.00 146.19 ? 664  HIS A ND1 1 
ATOM 5173 C CD2 . HIS A 1 667  ? 11.030  71.410 12.865  1.00 146.19 ? 664  HIS A CD2 1 
ATOM 5174 C CE1 . HIS A 1 667  ? 10.424  71.628 10.768  1.00 146.19 ? 664  HIS A CE1 1 
ATOM 5175 N NE2 . HIS A 1 667  ? 10.518  72.265 11.921  1.00 146.19 ? 664  HIS A NE2 1 
ATOM 5176 N N   . LYS A 1 668  ? 10.747  65.773 11.383  1.00 73.32  ? 665  LYS A N   1 
ATOM 5177 C CA  . LYS A 1 668  ? 10.602  64.941 10.204  1.00 73.32  ? 665  LYS A CA  1 
ATOM 5178 C C   . LYS A 1 668  ? 9.102   64.710 9.964   1.00 73.32  ? 665  LYS A C   1 
ATOM 5179 O O   . LYS A 1 668  ? 8.253   65.287 10.652  1.00 73.32  ? 665  LYS A O   1 
ATOM 5180 C CB  . LYS A 1 668  ? 11.322  63.609 10.440  1.00 85.91  ? 665  LYS A CB  1 
ATOM 5181 C CG  . LYS A 1 668  ? 12.200  63.116 9.279   1.00 85.91  ? 665  LYS A CG  1 
ATOM 5182 C CD  . LYS A 1 668  ? 13.093  61.926 9.668   1.00 85.91  ? 665  LYS A CD  1 
ATOM 5183 C CE  . LYS A 1 668  ? 13.767  62.098 11.048  1.00 85.91  ? 665  LYS A CE  1 
ATOM 5184 N NZ  . LYS A 1 668  ? 14.502  63.395 11.234  1.00 85.91  ? 665  LYS A NZ  1 
ATOM 5185 N N   . LEU A 1 669  ? 8.778   63.881 8.977   1.00 70.39  ? 666  LEU A N   1 
ATOM 5186 C CA  . LEU A 1 669  ? 7.391   63.523 8.668   1.00 70.39  ? 666  LEU A CA  1 
ATOM 5187 C C   . LEU A 1 669  ? 7.218   62.027 8.899   1.00 70.39  ? 666  LEU A C   1 
ATOM 5188 O O   . LEU A 1 669  ? 8.010   61.219 8.388   1.00 70.39  ? 666  LEU A O   1 
ATOM 5189 C CB  . LEU A 1 669  ? 7.063   63.869 7.219   1.00 95.57  ? 666  LEU A CB  1 
ATOM 5190 C CG  . LEU A 1 669  ? 7.425   65.257 6.676   1.00 95.57  ? 666  LEU A CG  1 
ATOM 5191 C CD1 . LEU A 1 669  ? 8.297   65.124 5.424   1.00 95.57  ? 666  LEU A CD1 1 
ATOM 5192 C CD2 . LEU A 1 669  ? 6.178   66.097 6.409   1.00 95.57  ? 666  LEU A CD2 1 
ATOM 5193 N N   . VAL A 1 670  ? 6.201   61.665 9.684   1.00 128.02 ? 667  VAL A N   1 
ATOM 5194 C CA  . VAL A 1 670  ? 5.984   60.271 10.108  1.00 128.02 ? 667  VAL A CA  1 
ATOM 5195 C C   . VAL A 1 670  ? 5.311   59.472 9.004   1.00 128.02 ? 667  VAL A C   1 
ATOM 5196 O O   . VAL A 1 670  ? 4.404   59.968 8.335   1.00 128.02 ? 667  VAL A O   1 
ATOM 5197 C CB  . VAL A 1 670  ? 5.125   60.157 11.413  1.00 157.50 ? 667  VAL A CB  1 
ATOM 5198 C CG1 . VAL A 1 670  ? 5.025   58.704 11.891  1.00 157.50 ? 667  VAL A CG1 1 
ATOM 5199 C CG2 . VAL A 1 670  ? 5.694   61.023 12.522  1.00 157.50 ? 667  VAL A CG2 1 
ATOM 5200 N N   . PHE A 1 671  ? 5.771   58.238 8.815   1.00 111.57 ? 668  PHE A N   1 
ATOM 5201 C CA  . PHE A 1 671  ? 5.129   57.309 7.899   1.00 111.57 ? 668  PHE A CA  1 
ATOM 5202 C C   . PHE A 1 671  ? 4.535   56.137 8.654   1.00 111.57 ? 668  PHE A C   1 
ATOM 5203 O O   . PHE A 1 671  ? 5.250   55.218 9.080   1.00 111.57 ? 668  PHE A O   1 
ATOM 5204 C CB  . PHE A 1 671  ? 6.111   56.833 6.834   1.00 85.87  ? 668  PHE A CB  1 
ATOM 5205 C CG  . PHE A 1 671  ? 6.206   57.746 5.648   1.00 85.87  ? 668  PHE A CG  1 
ATOM 5206 C CD1 . PHE A 1 671  ? 5.720   59.058 5.708   1.00 85.87  ? 668  PHE A CD1 1 
ATOM 5207 C CD2 . PHE A 1 671  ? 6.808   57.308 4.474   1.00 85.87  ? 668  PHE A CD2 1 
ATOM 5208 C CE1 . PHE A 1 671  ? 5.808   59.911 4.622   1.00 85.87  ? 668  PHE A CE1 1 
ATOM 5209 C CE2 . PHE A 1 671  ? 6.910   58.156 3.377   1.00 85.87  ? 668  PHE A CE2 1 
ATOM 5210 C CZ  . PHE A 1 671  ? 6.403   59.464 3.453   1.00 85.87  ? 668  PHE A CZ  1 
ATOM 5211 N N   . SER A 1 672  ? 3.218   56.187 8.831   1.00 56.36  ? 669  SER A N   1 
ATOM 5212 C CA  . SER A 1 672  ? 2.497   55.092 9.490   1.00 56.36  ? 669  SER A CA  1 
ATOM 5213 C C   . SER A 1 672  ? 1.390   54.500 8.624   1.00 56.36  ? 669  SER A C   1 
ATOM 5214 O O   . SER A 1 672  ? 0.712   55.214 7.893   1.00 56.36  ? 669  SER A O   1 
ATOM 5215 C CB  . SER A 1 672  ? 1.933   55.553 10.837  1.00 153.95 ? 669  SER A CB  1 
ATOM 5216 O OG  . SER A 1 672  ? 2.965   56.062 11.664  1.00 153.95 ? 669  SER A OG  1 
ATOM 5217 N N   . ASN A 1 673  ? 1.217   53.187 8.712   1.00 44.00  ? 670  ASN A N   1 
ATOM 5218 C CA  . ASN A 1 673  ? 0.029   52.546 8.146   1.00 44.00  ? 670  ASN A CA  1 
ATOM 5219 C C   . ASN A 1 673  ? -1.283  53.076 8.750   1.00 44.00  ? 670  ASN A C   1 
ATOM 5220 O O   . ASN A 1 673  ? -1.344  53.388 9.941   1.00 44.00  ? 670  ASN A O   1 
ATOM 5221 C CB  . ASN A 1 673  ? 0.129   51.021 8.257   1.00 79.21  ? 670  ASN A CB  1 
ATOM 5222 C CG  . ASN A 1 673  ? 0.842   50.384 7.056   1.00 79.21  ? 670  ASN A CG  1 
ATOM 5223 O OD1 . ASN A 1 673  ? 0.716   50.844 5.916   1.00 79.21  ? 670  ASN A OD1 1 
ATOM 5224 N ND2 . ASN A 1 673  ? 1.572   49.308 7.311   1.00 79.21  ? 670  ASN A ND2 1 
ATOM 5225 N N   . VAL A 1 674  ? -2.284  53.263 7.886   1.00 55.86  ? 671  VAL A N   1 
ATOM 5226 C CA  . VAL A 1 674  ? -3.700  53.335 8.280   1.00 55.86  ? 671  VAL A CA  1 
ATOM 5227 C C   . VAL A 1 674  ? -4.231  51.925 8.193   1.00 55.86  ? 671  VAL A C   1 
ATOM 5228 O O   . VAL A 1 674  ? -3.888  51.195 7.262   1.00 55.86  ? 671  VAL A O   1 
ATOM 5229 C CB  . VAL A 1 674  ? -4.547  54.183 7.304   1.00 36.52  ? 671  VAL A CB  1 
ATOM 5230 C CG1 . VAL A 1 674  ? -6.054  53.926 7.496   1.00 36.52  ? 671  VAL A CG1 1 
ATOM 5231 C CG2 . VAL A 1 674  ? -4.243  55.618 7.474   1.00 36.52  ? 671  VAL A CG2 1 
ATOM 5232 N N   . ASN A 1 675  ? -5.073  51.548 9.145   1.00 46.34  ? 672  ASN A N   1 
ATOM 5233 C CA  . ASN A 1 675  ? -5.594  50.182 9.210   1.00 46.34  ? 672  ASN A CA  1 
ATOM 5234 C C   . ASN A 1 675  ? -6.868  49.980 8.362   1.00 46.34  ? 672  ASN A C   1 
ATOM 5235 O O   . ASN A 1 675  ? -7.956  49.761 8.897   1.00 46.34  ? 672  ASN A O   1 
ATOM 5236 C CB  . ASN A 1 675  ? -5.860  49.778 10.664  1.00 59.02  ? 672  ASN A CB  1 
ATOM 5237 C CG  . ASN A 1 675  ? -4.599  49.761 11.529  1.00 59.02  ? 672  ASN A CG  1 
ATOM 5238 O OD1 . ASN A 1 675  ? -3.465  49.693 11.040  1.00 59.02  ? 672  ASN A OD1 1 
ATOM 5239 N ND2 . ASN A 1 675  ? -4.808  49.814 12.838  1.00 59.02  ? 672  ASN A ND2 1 
ATOM 5240 N N   . LEU A 1 676  ? -6.725  50.068 7.042   1.00 64.87  ? 673  LEU A N   1 
ATOM 5241 C CA  . LEU A 1 676  ? -7.857  49.924 6.128   1.00 64.87  ? 673  LEU A CA  1 
ATOM 5242 C C   . LEU A 1 676  ? -7.514  49.110 4.876   1.00 64.87  ? 673  LEU A C   1 
ATOM 5243 O O   . LEU A 1 676  ? -6.342  48.819 4.613   1.00 64.87  ? 673  LEU A O   1 
ATOM 5244 C CB  . LEU A 1 676  ? -8.413  51.295 5.753   1.00 40.15  ? 673  LEU A CB  1 
ATOM 5245 C CG  . LEU A 1 676  ? -9.273  52.005 6.806   1.00 40.15  ? 673  LEU A CG  1 
ATOM 5246 C CD1 . LEU A 1 676  ? -9.679  53.357 6.304   1.00 40.15  ? 673  LEU A CD1 1 
ATOM 5247 C CD2 . LEU A 1 676  ? -10.514 51.157 7.124   1.00 40.15  ? 673  LEU A CD2 1 
ATOM 5248 N N   . LYS A 1 677  ? -8.547  48.742 4.117   1.00 118.60 ? 674  LYS A N   1 
ATOM 5249 C CA  . LYS A 1 677  ? -8.405  47.832 2.976   1.00 118.60 ? 674  LYS A CA  1 
ATOM 5250 C C   . LYS A 1 677  ? -7.665  48.491 1.801   1.00 118.60 ? 674  LYS A C   1 
ATOM 5251 O O   . LYS A 1 677  ? -6.580  48.053 1.405   1.00 118.60 ? 674  LYS A O   1 
ATOM 5252 C CB  . LYS A 1 677  ? -9.787  47.299 2.553   1.00 80.33  ? 674  LYS A CB  1 
ATOM 5253 C CG  . LYS A 1 677  ? -9.769  46.181 1.504   1.00 80.33  ? 674  LYS A CG  1 
ATOM 5254 C CD  . LYS A 1 677  ? -9.258  44.849 2.059   1.00 80.33  ? 674  LYS A CD  1 
ATOM 5255 C CE  . LYS A 1 677  ? -8.718  43.962 0.938   1.00 80.33  ? 674  LYS A CE  1 
ATOM 5256 N NZ  . LYS A 1 677  ? -8.696  42.517 1.323   1.00 80.33  ? 674  LYS A NZ  1 
ATOM 5257 N N   . GLU A 1 678  ? -8.273  49.540 1.260   1.00 85.56  ? 675  GLU A N   1 
ATOM 5258 C CA  . GLU A 1 678  ? -7.692  50.366 0.225   1.00 85.56  ? 675  GLU A CA  1 
ATOM 5259 C C   . GLU A 1 678  ? -8.569  51.596 0.158   1.00 85.56  ? 675  GLU A C   1 
ATOM 5260 O O   . GLU A 1 678  ? -9.789  51.490 0.072   1.00 85.56  ? 675  GLU A O   1 
ATOM 5261 C CB  . GLU A 1 678  ? -7.679  49.652 -1.133  1.00 145.89 ? 675  GLU A CB  1 
ATOM 5262 C CG  . GLU A 1 678  ? -7.373  50.582 -2.318  1.00 145.89 ? 675  GLU A CG  1 
ATOM 5263 C CD  . GLU A 1 678  ? -7.211  49.866 -3.655  1.00 145.89 ? 675  GLU A CD  1 
ATOM 5264 O OE1 . GLU A 1 678  ? -7.719  48.735 -3.812  1.00 145.89 ? 675  GLU A OE1 1 
ATOM 5265 O OE2 . GLU A 1 678  ? -6.577  50.450 -4.562  1.00 145.89 ? 675  GLU A OE2 1 
ATOM 5266 N N   . VAL A 1 679  ? -7.940  52.761 0.225   1.00 62.69  ? 676  VAL A N   1 
ATOM 5267 C CA  . VAL A 1 679  ? -8.618  54.024 -0.004  1.00 62.69  ? 676  VAL A CA  1 
ATOM 5268 C C   . VAL A 1 679  ? -8.181  54.572 -1.359  1.00 62.69  ? 676  VAL A C   1 
ATOM 5269 O O   . VAL A 1 679  ? -7.001  54.478 -1.724  1.00 62.69  ? 676  VAL A O   1 
ATOM 5270 C CB  . VAL A 1 679  ? -8.318  55.043 1.117   1.00 51.08  ? 676  VAL A CB  1 
ATOM 5271 C CG1 . VAL A 1 679  ? -9.005  56.348 0.861   1.00 51.08  ? 676  VAL A CG1 1 
ATOM 5272 C CG2 . VAL A 1 679  ? -8.771  54.495 2.441   1.00 51.08  ? 676  VAL A CG2 1 
ATOM 5273 N N   . ASN A 1 680  ? -9.152  55.121 -2.095  1.00 56.78  ? 677  ASN A N   1 
ATOM 5274 C CA  . ASN A 1 680  ? -8.914  55.714 -3.408  1.00 56.78  ? 677  ASN A CA  1 
ATOM 5275 C C   . ASN A 1 680  ? -9.012  57.226 -3.363  1.00 56.78  ? 677  ASN A C   1 
ATOM 5276 O O   . ASN A 1 680  ? -8.195  57.914 -3.971  1.00 56.78  ? 677  ASN A O   1 
ATOM 5277 C CB  . ASN A 1 680  ? -9.854  55.132 -4.469  1.00 84.99  ? 677  ASN A CB  1 
ATOM 5278 C CG  . ASN A 1 680  ? -9.521  53.692 -4.822  1.00 84.99  ? 677  ASN A CG  1 
ATOM 5279 O OD1 . ASN A 1 680  ? -8.387  53.241 -4.674  1.00 84.99  ? 677  ASN A OD1 1 
ATOM 5280 N ND2 . ASN A 1 680  ? -10.517 52.962 -5.290  1.00 84.99  ? 677  ASN A ND2 1 
ATOM 5281 N N   . TYR A 1 681  ? -9.997  57.738 -2.632  1.00 69.73  ? 678  TYR A N   1 
ATOM 5282 C CA  . TYR A 1 681  ? -10.118 59.173 -2.399  1.00 69.73  ? 678  TYR A CA  1 
ATOM 5283 C C   . TYR A 1 681  ? -10.644 59.407 -0.985  1.00 69.73  ? 678  TYR A C   1 
ATOM 5284 O O   . TYR A 1 681  ? -11.370 58.565 -0.423  1.00 69.73  ? 678  TYR A O   1 
ATOM 5285 C CB  . TYR A 1 681  ? -11.037 59.825 -3.448  1.00 63.41  ? 678  TYR A CB  1 
ATOM 5286 C CG  . TYR A 1 681  ? -10.758 59.348 -4.863  1.00 63.41  ? 678  TYR A CG  1 
ATOM 5287 C CD1 . TYR A 1 681  ? -11.393 58.215 -5.375  1.00 63.41  ? 678  TYR A CD1 1 
ATOM 5288 C CD2 . TYR A 1 681  ? -9.831  60.014 -5.676  1.00 63.41  ? 678  TYR A CD2 1 
ATOM 5289 C CE1 . TYR A 1 681  ? -11.115 57.758 -6.645  1.00 63.41  ? 678  TYR A CE1 1 
ATOM 5290 C CE2 . TYR A 1 681  ? -9.542  59.561 -6.957  1.00 63.41  ? 678  TYR A CE2 1 
ATOM 5291 C CZ  . TYR A 1 681  ? -10.190 58.432 -7.430  1.00 63.41  ? 678  TYR A CZ  1 
ATOM 5292 O OH  . TYR A 1 681  ? -9.916  57.977 -8.689  1.00 63.41  ? 678  TYR A OH  1 
ATOM 5293 N N   . MET A 1 682  ? -10.279 60.553 -0.415  1.00 75.35  ? 679  MET A N   1 
ATOM 5294 C CA  . MET A 1 682  ? -10.627 60.896 0.960   1.00 75.35  ? 679  MET A CA  1 
ATOM 5295 C C   . MET A 1 682  ? -10.674 62.407 1.176   1.00 75.35  ? 679  MET A C   1 
ATOM 5296 O O   . MET A 1 682  ? -9.731  63.121 0.816   1.00 75.35  ? 679  MET A O   1 
ATOM 5297 C CB  . MET A 1 682  ? -9.623  60.253 1.924   1.00 95.64  ? 679  MET A CB  1 
ATOM 5298 C CG  . MET A 1 682  ? -9.360  61.042 3.194   1.00 95.64  ? 679  MET A CG  1 
ATOM 5299 S SD  . MET A 1 682  ? -8.158  62.351 2.903   1.00 95.64  ? 679  MET A SD  1 
ATOM 5300 C CE  . MET A 1 682  ? -8.765  63.631 3.984   1.00 95.64  ? 679  MET A CE  1 
ATOM 5301 N N   . CYS A 1 683  ? -11.754 62.893 1.783   1.00 91.63  ? 680  CYS A N   1 
ATOM 5302 C CA  . CYS A 1 683  ? -11.858 64.321 2.127   1.00 91.63  ? 680  CYS A CA  1 
ATOM 5303 C C   . CYS A 1 683  ? -12.166 64.570 3.617   1.00 91.63  ? 680  CYS A C   1 
ATOM 5304 O O   . CYS A 1 683  ? -12.813 63.737 4.262   1.00 91.63  ? 680  CYS A O   1 
ATOM 5305 C CB  . CYS A 1 683  ? -12.882 65.020 1.228   1.00 97.66  ? 680  CYS A CB  1 
ATOM 5306 S SG  . CYS A 1 683  ? -14.460 64.178 1.107   1.00 97.66  ? 680  CYS A SG  1 
ATOM 5307 N N   . PRO A 1 684  ? -11.705 65.719 4.164   1.00 107.89 ? 681  PRO A N   1 
ATOM 5308 C CA  . PRO A 1 684  ? -11.962 66.080 5.567   1.00 107.89 ? 681  PRO A CA  1 
ATOM 5309 C C   . PRO A 1 684  ? -13.426 66.462 5.740   1.00 107.89 ? 681  PRO A C   1 
ATOM 5310 O O   . PRO A 1 684  ? -14.195 66.305 4.794   1.00 107.89 ? 681  PRO A O   1 
ATOM 5311 C CB  . PRO A 1 684  ? -11.067 67.304 5.799   1.00 106.03 ? 681  PRO A CB  1 
ATOM 5312 C CG  . PRO A 1 684  ? -10.250 67.461 4.574   1.00 106.03 ? 681  PRO A CG  1 
ATOM 5313 C CD  . PRO A 1 684  ? -10.935 66.761 3.467   1.00 106.03 ? 681  PRO A CD  1 
ATOM 5314 N N   . LEU A 1 685  ? -13.814 66.961 6.917   1.00 154.42 ? 682  LEU A N   1 
ATOM 5315 C CA  . LEU A 1 685  ? -15.217 67.343 7.159   1.00 154.42 ? 682  LEU A CA  1 
ATOM 5316 C C   . LEU A 1 685  ? -15.458 68.115 8.470   1.00 154.42 ? 682  LEU A C   1 
ATOM 5317 O O   . LEU A 1 685  ? -14.504 68.506 9.152   1.00 154.42 ? 682  LEU A O   1 
ATOM 5318 C CB  . LEU A 1 685  ? -16.127 66.102 7.071   1.00 89.60  ? 682  LEU A CB  1 
ATOM 5319 C CG  . LEU A 1 685  ? -17.556 66.218 6.519   1.00 89.60  ? 682  LEU A CG  1 
ATOM 5320 C CD1 . LEU A 1 685  ? -17.743 67.419 5.572   1.00 89.60  ? 682  LEU A CD1 1 
ATOM 5321 C CD2 . LEU A 1 685  ? -18.009 64.904 5.853   1.00 89.60  ? 682  LEU A CD2 1 
ATOM 5322 N N   . ASN A 1 686  ? -16.741 68.342 8.785   1.00 119.99 ? 683  ASN A N   1 
ATOM 5323 C CA  . ASN A 1 686  ? -17.202 69.016 10.015  1.00 119.99 ? 683  ASN A CA  1 
ATOM 5324 C C   . ASN A 1 686  ? -18.740 69.007 10.151  1.00 119.99 ? 683  ASN A C   1 
ATOM 5325 O O   . ASN A 1 686  ? -19.320 69.908 10.757  1.00 119.99 ? 683  ASN A O   1 
ATOM 5326 C CB  . ASN A 1 686  ? -16.665 70.457 10.086  1.00 130.00 ? 683  ASN A CB  1 
ATOM 5327 C CG  . ASN A 1 686  ? -16.363 70.906 11.507  1.00 130.00 ? 683  ASN A CG  1 
ATOM 5328 O OD1 . ASN A 1 686  ? -16.625 70.188 12.474  1.00 130.00 ? 683  ASN A OD1 1 
ATOM 5329 N ND2 . ASN A 1 686  ? -15.801 72.103 11.637  1.00 130.00 ? 683  ASN A ND2 1 
ATOM 5330 N N   . SER A 1 687  ? -19.373 67.960 9.612   1.00 141.51 ? 684  SER A N   1 
ATOM 5331 C CA  . SER A 1 687  ? -20.839 67.840 9.433   1.00 141.51 ? 684  SER A CA  1 
ATOM 5332 C C   . SER A 1 687  ? -21.749 68.142 10.635  1.00 141.51 ? 684  SER A C   1 
ATOM 5333 O O   . SER A 1 687  ? -21.329 68.081 11.790  1.00 141.51 ? 684  SER A O   1 
ATOM 5334 C CB  . SER A 1 687  ? -21.175 66.445 8.875   1.00 133.52 ? 684  SER A CB  1 
ATOM 5335 O OG  . SER A 1 687  ? -22.565 66.156 8.919   1.00 133.52 ? 684  SER A OG  1 
ATOM 5336 N N   . ASP A 1 688  ? -23.009 68.454 10.325  1.00 104.69 ? 685  ASP A N   1 
ATOM 5337 C CA  . ASP A 1 688  ? -24.084 68.633 11.316  1.00 104.69 ? 685  ASP A CA  1 
ATOM 5338 C C   . ASP A 1 688  ? -24.499 67.322 11.990  1.00 104.69 ? 685  ASP A C   1 
ATOM 5339 O O   . ASP A 1 688  ? -25.216 67.340 12.988  1.00 104.69 ? 685  ASP A O   1 
ATOM 5340 C CB  . ASP A 1 688  ? -25.318 69.269 10.659  1.00 138.09 ? 685  ASP A CB  1 
ATOM 5341 C CG  . ASP A 1 688  ? -25.918 68.393 9.561   1.00 138.09 ? 685  ASP A CG  1 
ATOM 5342 O OD1 . ASP A 1 688  ? -25.391 68.401 8.425   1.00 138.09 ? 685  ASP A OD1 1 
ATOM 5343 O OD2 . ASP A 1 688  ? -26.920 67.699 9.837   1.00 138.09 ? 685  ASP A OD2 1 
ATOM 5344 N N   . GLY A 1 689  ? -24.065 66.196 11.420  1.00 108.22 ? 686  GLY A N   1 
ATOM 5345 C CA  . GLY A 1 689  ? -24.340 64.870 11.965  1.00 108.22 ? 686  GLY A CA  1 
ATOM 5346 C C   . GLY A 1 689  ? -23.112 63.977 12.010  1.00 108.22 ? 686  GLY A C   1 
ATOM 5347 O O   . GLY A 1 689  ? -23.189 62.845 12.490  1.00 108.22 ? 686  GLY A O   1 
ATOM 5348 N N   . TYR A 1 690  ? -21.983 64.486 11.501  1.00 137.16 ? 687  TYR A N   1 
ATOM 5349 C CA  . TYR A 1 690  ? -20.692 63.779 11.516  1.00 137.16 ? 687  TYR A CA  1 
ATOM 5350 C C   . TYR A 1 690  ? -19.507 64.749 11.704  1.00 137.16 ? 687  TYR A C   1 
ATOM 5351 O O   . TYR A 1 690  ? -18.732 64.950 10.769  1.00 137.16 ? 687  TYR A O   1 
ATOM 5352 C CB  . TYR A 1 690  ? -20.479 63.011 10.201  1.00 90.53  ? 687  TYR A CB  1 
ATOM 5353 C CG  . TYR A 1 690  ? -21.513 61.956 9.848   1.00 90.53  ? 687  TYR A CG  1 
ATOM 5354 C CD1 . TYR A 1 690  ? -21.327 60.612 10.204  1.00 90.53  ? 687  TYR A CD1 1 
ATOM 5355 C CD2 . TYR A 1 690  ? -22.661 62.291 9.121   1.00 90.53  ? 687  TYR A CD2 1 
ATOM 5356 C CE1 . TYR A 1 690  ? -22.272 59.634 9.868   1.00 90.53  ? 687  TYR A CE1 1 
ATOM 5357 C CE2 . TYR A 1 690  ? -23.612 61.320 8.782   1.00 90.53  ? 687  TYR A CE2 1 
ATOM 5358 C CZ  . TYR A 1 690  ? -23.410 59.995 9.155   1.00 90.53  ? 687  TYR A CZ  1 
ATOM 5359 O OH  . TYR A 1 690  ? -24.352 59.049 8.812   1.00 90.53  ? 687  TYR A OH  1 
ATOM 5360 N N   . PRO A 1 691  ? -19.354 65.353 12.904  1.00 131.62 ? 688  PRO A N   1 
ATOM 5361 C CA  . PRO A 1 691  ? -18.297 66.364 13.136  1.00 131.62 ? 688  PRO A CA  1 
ATOM 5362 C C   . PRO A 1 691  ? -16.867 65.807 13.119  1.00 131.62 ? 688  PRO A C   1 
ATOM 5363 O O   . PRO A 1 691  ? -16.696 64.593 13.001  1.00 131.62 ? 688  PRO A O   1 
ATOM 5364 C CB  . PRO A 1 691  ? -18.651 66.935 14.517  1.00 134.88 ? 688  PRO A CB  1 
ATOM 5365 C CG  . PRO A 1 691  ? -20.077 66.526 14.748  1.00 134.88 ? 688  PRO A CG  1 
ATOM 5366 C CD  . PRO A 1 691  ? -20.174 65.172 14.110  1.00 134.88 ? 688  PRO A CD  1 
ATOM 5367 N N   . ASP A 1 692  ? -15.867 66.689 13.258  1.00 110.80 ? 689  ASP A N   1 
ATOM 5368 C CA  . ASP A 1 692  ? -14.452 66.388 12.929  1.00 110.80 ? 689  ASP A CA  1 
ATOM 5369 C C   . ASP A 1 692  ? -14.217 64.966 12.368  1.00 110.80 ? 689  ASP A C   1 
ATOM 5370 O O   . ASP A 1 692  ? -13.810 64.049 13.086  1.00 110.80 ? 689  ASP A O   1 
ATOM 5371 C CB  . ASP A 1 692  ? -13.488 66.725 14.095  1.00 76.58  ? 689  ASP A CB  1 
ATOM 5372 C CG  . ASP A 1 692  ? -12.003 66.869 13.631  1.00 76.58  ? 689  ASP A CG  1 
ATOM 5373 O OD1 . ASP A 1 692  ? -11.279 67.734 14.182  1.00 76.58  ? 689  ASP A OD1 1 
ATOM 5374 O OD2 . ASP A 1 692  ? -11.562 66.125 12.715  1.00 76.58  ? 689  ASP A OD2 1 
ATOM 5375 N N   . SER A 1 693  ? -14.478 64.806 11.074  1.00 131.36 ? 690  SER A N   1 
ATOM 5376 C CA  . SER A 1 693  ? -14.448 63.492 10.430  1.00 131.36 ? 690  SER A CA  1 
ATOM 5377 C C   . SER A 1 693  ? -13.810 63.486 9.032   1.00 131.36 ? 690  SER A C   1 
ATOM 5378 O O   . SER A 1 693  ? -13.401 64.534 8.511   1.00 131.36 ? 690  SER A O   1 
ATOM 5379 C CB  . SER A 1 693  ? -15.863 62.910 10.359  1.00 67.11  ? 690  SER A CB  1 
ATOM 5380 O OG  . SER A 1 693  ? -15.894 61.741 9.560   1.00 67.11  ? 690  SER A OG  1 
ATOM 5381 N N   . LEU A 1 694  ? -13.727 62.291 8.442   1.00 72.50  ? 691  LEU A N   1 
ATOM 5382 C CA  . LEU A 1 694  ? -13.126 62.098 7.122   1.00 72.50  ? 691  LEU A CA  1 
ATOM 5383 C C   . LEU A 1 694  ? -13.993 61.149 6.304   1.00 72.50  ? 691  LEU A C   1 
ATOM 5384 O O   . LEU A 1 694  ? -14.589 60.221 6.849   1.00 72.50  ? 691  LEU A O   1 
ATOM 5385 C CB  . LEU A 1 694  ? -11.690 61.565 7.235   1.00 104.91 ? 691  LEU A CB  1 
ATOM 5386 C CG  . LEU A 1 694  ? -10.780 62.106 8.352   1.00 104.91 ? 691  LEU A CG  1 
ATOM 5387 C CD1 . LEU A 1 694  ? -9.508  61.287 8.434   1.00 104.91 ? 691  LEU A CD1 1 
ATOM 5388 C CD2 . LEU A 1 694  ? -10.446 63.586 8.205   1.00 104.91 ? 691  LEU A CD2 1 
ATOM 5389 N N   . ALA A 1 695  ? -14.080 61.406 5.001   1.00 86.67  ? 692  ALA A N   1 
ATOM 5390 C CA  . ALA A 1 695  ? -14.862 60.567 4.092   1.00 86.67  ? 692  ALA A CA  1 
ATOM 5391 C C   . ALA A 1 695  ? -13.925 59.794 3.178   1.00 86.67  ? 692  ALA A C   1 
ATOM 5392 O O   . ALA A 1 695  ? -12.931 60.342 2.700   1.00 86.67  ? 692  ALA A O   1 
ATOM 5393 C CB  . ALA A 1 695  ? -15.835 61.406 3.284   1.00 119.77 ? 692  ALA A CB  1 
ATOM 5394 N N   . LEU A 1 696  ? -14.237 58.520 2.955   1.00 73.44  ? 693  LEU A N   1 
ATOM 5395 C CA  . LEU A 1 696  ? -13.313 57.611 2.281   1.00 73.44  ? 693  LEU A CA  1 
ATOM 5396 C C   . LEU A 1 696  ? -14.032 56.649 1.348   1.00 73.44  ? 693  LEU A C   1 
ATOM 5397 O O   . LEU A 1 696  ? -15.048 56.047 1.714   1.00 73.44  ? 693  LEU A O   1 
ATOM 5398 C CB  . LEU A 1 696  ? -12.477 56.831 3.307   1.00 103.57 ? 693  LEU A CB  1 
ATOM 5399 C CG  . LEU A 1 696  ? -11.339 57.577 4.024   1.00 103.57 ? 693  LEU A CG  1 
ATOM 5400 C CD1 . LEU A 1 696  ? -11.801 58.322 5.275   1.00 103.57 ? 693  LEU A CD1 1 
ATOM 5401 C CD2 . LEU A 1 696  ? -10.251 56.616 4.411   1.00 103.57 ? 693  LEU A CD2 1 
ATOM 5402 N N   . ALA A 1 697  ? -13.500 56.500 0.142   1.00 82.90  ? 694  ALA A N   1 
ATOM 5403 C CA  . ALA A 1 697  ? -14.146 55.644 -0.836  1.00 82.90  ? 694  ALA A CA  1 
ATOM 5404 C C   . ALA A 1 697  ? -13.209 54.597 -1.406  1.00 82.90  ? 694  ALA A C   1 
ATOM 5405 O O   . ALA A 1 697  ? -12.071 54.897 -1.780  1.00 82.90  ? 694  ALA A O   1 
ATOM 5406 C CB  . ALA A 1 697  ? -14.761 56.473 -1.951  1.00 100.27 ? 694  ALA A CB  1 
ATOM 5407 N N   . ASN A 1 698  ? -13.697 53.366 -1.459  1.00 84.68  ? 695  ASN A N   1 
ATOM 5408 C CA  . ASN A 1 698  ? -12.968 52.288 -2.092  1.00 84.68  ? 695  ASN A CA  1 
ATOM 5409 C C   . ASN A 1 698  ? -13.669 51.925 -3.387  1.00 84.68  ? 695  ASN A C   1 
ATOM 5410 O O   . ASN A 1 698  ? -14.607 52.613 -3.808  1.00 84.68  ? 695  ASN A O   1 
ATOM 5411 C CB  . ASN A 1 698  ? -12.872 51.067 -1.162  1.00 116.33 ? 695  ASN A CB  1 
ATOM 5412 C CG  . ASN A 1 698  ? -14.019 50.086 -1.350  1.00 116.33 ? 695  ASN A CG  1 
ATOM 5413 O OD1 . ASN A 1 698  ? -15.184 50.444 -1.222  1.00 116.33 ? 695  ASN A OD1 1 
ATOM 5414 N ND2 . ASN A 1 698  ? -13.686 48.843 -1.673  1.00 116.33 ? 695  ASN A ND2 1 
ATOM 5415 N N   . ASN A 1 699  ? -13.205 50.843 -4.008  1.00 143.76 ? 696  ASN A N   1 
ATOM 5416 C CA  . ASN A 1 699  ? -13.866 50.235 -5.151  1.00 143.76 ? 696  ASN A CA  1 
ATOM 5417 C C   . ASN A 1 699  ? -15.381 50.421 -5.132  1.00 143.76 ? 696  ASN A C   1 
ATOM 5418 O O   . ASN A 1 699  ? -15.977 50.733 -6.164  1.00 143.76 ? 696  ASN A O   1 
ATOM 5419 C CB  . ASN A 1 699  ? -13.526 48.739 -5.219  1.00 123.79 ? 696  ASN A CB  1 
ATOM 5420 C CG  . ASN A 1 699  ? -12.089 48.472 -5.682  1.00 123.79 ? 696  ASN A CG  1 
ATOM 5421 O OD1 . ASN A 1 699  ? -11.219 49.348 -5.628  1.00 123.79 ? 696  ASN A OD1 1 
ATOM 5422 N ND2 . ASN A 1 699  ? -11.842 47.250 -6.134  1.00 123.79 ? 696  ASN A ND2 1 
ATOM 5423 N N   . SER A 1 700  ? -15.990 50.260 -3.953  1.00 117.69 ? 697  SER A N   1 
ATOM 5424 C CA  . SER A 1 700  ? -17.447 50.222 -3.846  1.00 117.69 ? 697  SER A CA  1 
ATOM 5425 C C   . SER A 1 700  ? -18.056 50.571 -2.477  1.00 117.69 ? 697  SER A C   1 
ATOM 5426 O O   . SER A 1 700  ? -19.110 50.044 -2.125  1.00 117.69 ? 697  SER A O   1 
ATOM 5427 C CB  . SER A 1 700  ? -17.947 48.844 -4.296  1.00 173.02 ? 697  SER A CB  1 
ATOM 5428 O OG  . SER A 1 700  ? -17.154 47.812 -3.734  1.00 173.02 ? 697  SER A OG  1 
ATOM 5429 N N   . THR A 1 701  ? -17.425 51.457 -1.711  1.00 138.30 ? 698  THR A N   1 
ATOM 5430 C CA  . THR A 1 701  ? -18.000 51.880 -0.426  1.00 138.30 ? 698  THR A CA  1 
ATOM 5431 C C   . THR A 1 701  ? -17.625 53.305 -0.084  1.00 138.30 ? 698  THR A C   1 
ATOM 5432 O O   . THR A 1 701  ? -16.489 53.719 -0.301  1.00 138.30 ? 698  THR A O   1 
ATOM 5433 C CB  . THR A 1 701  ? -17.527 50.999 0.753   1.00 118.04 ? 698  THR A CB  1 
ATOM 5434 O OG1 . THR A 1 701  ? -17.381 49.640 0.322   1.00 118.04 ? 698  THR A OG1 1 
ATOM 5435 C CG2 . THR A 1 701  ? -18.512 51.073 1.919   1.00 118.04 ? 698  THR A CG2 1 
ATOM 5436 N N   . LEU A 1 702  ? -18.581 54.045 0.466   1.00 85.30  ? 699  LEU A N   1 
ATOM 5437 C CA  . LEU A 1 702  ? -18.311 55.370 1.013   1.00 85.30  ? 699  LEU A CA  1 
ATOM 5438 C C   . LEU A 1 702  ? -18.341 55.242 2.516   1.00 85.30  ? 699  LEU A C   1 
ATOM 5439 O O   . LEU A 1 702  ? -19.225 54.579 3.059   1.00 85.30  ? 699  LEU A O   1 
ATOM 5440 C CB  . LEU A 1 702  ? -19.382 56.368 0.575   1.00 90.56  ? 699  LEU A CB  1 
ATOM 5441 C CG  . LEU A 1 702  ? -19.121 57.881 0.542   1.00 90.56  ? 699  LEU A CG  1 
ATOM 5442 C CD1 . LEU A 1 702  ? -20.390 58.570 0.083   1.00 90.56  ? 699  LEU A CD1 1 
ATOM 5443 C CD2 . LEU A 1 702  ? -18.654 58.470 1.875   1.00 90.56  ? 699  LEU A CD2 1 
ATOM 5444 N N   . THR A 1 703  ? -17.392 55.890 3.186   1.00 120.21 ? 700  THR A N   1 
ATOM 5445 C CA  . THR A 1 703  ? -17.280 55.797 4.637   1.00 120.21 ? 700  THR A CA  1 
ATOM 5446 C C   . THR A 1 703  ? -16.926 57.153 5.274   1.00 120.21 ? 700  THR A C   1 
ATOM 5447 O O   . THR A 1 703  ? -16.493 58.072 4.585   1.00 120.21 ? 700  THR A O   1 
ATOM 5448 C CB  . THR A 1 703  ? -16.267 54.697 5.038   1.00 99.36  ? 700  THR A CB  1 
ATOM 5449 O OG1 . THR A 1 703  ? -16.340 53.608 4.108   1.00 99.36  ? 700  THR A OG1 1 
ATOM 5450 C CG2 . THR A 1 703  ? -16.565 54.171 6.430   1.00 99.36  ? 700  THR A CG2 1 
ATOM 5451 N N   . ILE A 1 704  ? -17.144 57.261 6.587   1.00 91.19  ? 701  ILE A N   1 
ATOM 5452 C CA  . ILE A 1 704  ? -16.962 58.492 7.372   1.00 91.19  ? 701  ILE A CA  1 
ATOM 5453 C C   . ILE A 1 704  ? -16.774 58.169 8.859   1.00 91.19  ? 701  ILE A C   1 
ATOM 5454 O O   . ILE A 1 704  ? -17.583 57.435 9.434   1.00 91.19  ? 701  ILE A O   1 
ATOM 5455 C CB  . ILE A 1 704  ? -18.187 59.459 7.267   1.00 121.53 ? 701  ILE A CB  1 
ATOM 5456 C CG1 . ILE A 1 704  ? -19.526 58.691 7.091   1.00 121.53 ? 701  ILE A CG1 1 
ATOM 5457 C CG2 . ILE A 1 704  ? -17.937 60.549 6.221   1.00 121.53 ? 701  ILE A CG2 1 
ATOM 5458 C CD1 . ILE A 1 704  ? -19.941 58.312 5.640   1.00 121.53 ? 701  ILE A CD1 1 
ATOM 5459 N N   . GLY A 1 705  ? -15.738 58.728 9.487   1.00 101.51 ? 702  GLY A N   1 
ATOM 5460 C CA  . GLY A 1 705  ? -15.485 58.471 10.917  1.00 101.51 ? 702  GLY A CA  1 
ATOM 5461 C C   . GLY A 1 705  ? -14.406 59.302 11.608  1.00 101.51 ? 702  GLY A C   1 
ATOM 5462 O O   . GLY A 1 705  ? -14.073 60.398 11.151  1.00 101.51 ? 702  GLY A O   1 
ATOM 5463 N N   . THR A 1 706  ? -13.863 58.783 12.713  1.00 107.14 ? 703  THR A N   1 
ATOM 5464 C CA  . THR A 1 706  ? -12.794 59.478 13.452  1.00 107.14 ? 703  THR A CA  1 
ATOM 5465 C C   . THR A 1 706  ? -11.413 58.851 13.231  1.00 107.14 ? 703  THR A C   1 
ATOM 5466 O O   . THR A 1 706  ? -11.299 57.711 12.783  1.00 107.14 ? 703  THR A O   1 
ATOM 5467 C CB  . THR A 1 706  ? -13.080 59.551 14.972  1.00 158.41 ? 703  THR A CB  1 
ATOM 5468 O OG1 . THR A 1 706  ? -13.388 58.243 15.471  1.00 158.41 ? 703  THR A OG1 1 
ATOM 5469 C CG2 . THR A 1 706  ? -14.239 60.496 15.265  1.00 158.41 ? 703  THR A CG2 1 
ATOM 5470 N N   . ILE A 1 707  ? -10.368 59.601 13.554  1.00 108.59 ? 704  ILE A N   1 
ATOM 5471 C CA  . ILE A 1 707  ? -9.016  59.120 13.360  1.00 108.59 ? 704  ILE A CA  1 
ATOM 5472 C C   . ILE A 1 707  ? -8.303  58.968 14.694  1.00 108.59 ? 704  ILE A C   1 
ATOM 5473 O O   . ILE A 1 707  ? -8.485  59.787 15.602  1.00 108.59 ? 704  ILE A O   1 
ATOM 5474 C CB  . ILE A 1 707  ? -8.216  60.067 12.429  1.00 80.83  ? 704  ILE A CB  1 
ATOM 5475 C CG1 . ILE A 1 707  ? -7.623  59.287 11.240  1.00 80.83  ? 704  ILE A CG1 1 
ATOM 5476 C CG2 . ILE A 1 707  ? -7.173  60.934 13.218  1.00 80.83  ? 704  ILE A CG2 1 
ATOM 5477 C CD1 . ILE A 1 707  ? -6.216  58.755 11.432  1.00 80.83  ? 704  ILE A CD1 1 
ATOM 5478 N N   . ASP A 1 708  ? -7.487  57.917 14.789  1.00 57.18  ? 705  ASP A N   1 
ATOM 5479 C CA  . ASP A 1 708  ? -6.650  57.622 15.973  1.00 57.18  ? 705  ASP A CA  1 
ATOM 5480 C C   . ASP A 1 708  ? -5.423  58.521 16.173  1.00 57.18  ? 705  ASP A C   1 
ATOM 5481 O O   . ASP A 1 708  ? -5.249  59.520 15.494  1.00 57.18  ? 705  ASP A O   1 
ATOM 5482 C CB  . ASP A 1 708  ? -6.230  56.148 15.942  1.00 79.49  ? 705  ASP A CB  1 
ATOM 5483 C CG  . ASP A 1 708  ? -7.145  55.279 16.753  1.00 79.49  ? 705  ASP A CG  1 
ATOM 5484 O OD1 . ASP A 1 708  ? -6.914  55.221 17.986  1.00 79.49  ? 705  ASP A OD1 1 
ATOM 5485 O OD2 . ASP A 1 708  ? -8.081  54.673 16.173  1.00 79.49  ? 705  ASP A OD2 1 
ATOM 5486 N N   . GLU A 1 709  ? -4.586  58.150 17.127  1.00 95.88  ? 706  GLU A N   1 
ATOM 5487 C CA  . GLU A 1 709  ? -3.406  58.926 17.485  1.00 95.88  ? 706  GLU A CA  1 
ATOM 5488 C C   . GLU A 1 709  ? -2.614  59.456 16.275  1.00 95.88  ? 706  GLU A C   1 
ATOM 5489 O O   . GLU A 1 709  ? -3.143  60.225 15.464  1.00 95.88  ? 706  GLU A O   1 
ATOM 5490 C CB  . GLU A 1 709  ? -2.526  58.111 18.463  1.00 111.64 ? 706  GLU A CB  1 
ATOM 5491 C CG  . GLU A 1 709  ? -1.270  58.807 19.022  1.00 111.64 ? 706  GLU A CG  1 
ATOM 5492 C CD  . GLU A 1 709  ? -1.537  60.175 19.615  1.00 111.64 ? 706  GLU A CD  1 
ATOM 5493 O OE1 . GLU A 1 709  ? -2.680  60.439 20.047  1.00 111.64 ? 706  GLU A OE1 1 
ATOM 5494 O OE2 . GLU A 1 709  ? -0.590  60.986 19.654  1.00 111.64 ? 706  GLU A OE2 1 
ATOM 5495 N N   . ILE A 1 710  ? -1.352  59.045 16.167  1.00 76.85  ? 707  ILE A N   1 
ATOM 5496 C CA  . ILE A 1 710  ? -0.384  59.727 15.335  1.00 76.85  ? 707  ILE A CA  1 
ATOM 5497 C C   . ILE A 1 710  ? 0.795   58.807 15.097  1.00 76.85  ? 707  ILE A C   1 
ATOM 5498 O O   . ILE A 1 710  ? 1.369   58.792 14.008  1.00 76.85  ? 707  ILE A O   1 
ATOM 5499 C CB  . ILE A 1 710  ? 0.178   61.020 16.015  1.00 82.24  ? 707  ILE A CB  1 
ATOM 5500 C CG1 . ILE A 1 710  ? -0.895  62.107 16.206  1.00 82.24  ? 707  ILE A CG1 1 
ATOM 5501 C CG2 . ILE A 1 710  ? 1.387   61.574 15.234  1.00 82.24  ? 707  ILE A CG2 1 
ATOM 5502 C CD1 . ILE A 1 710  ? -0.490  63.229 17.182  1.00 82.24  ? 707  ILE A CD1 1 
ATOM 5503 N N   . GLN A 1 711  ? 1.179   58.056 16.121  1.00 67.32  ? 708  GLN A N   1 
ATOM 5504 C CA  . GLN A 1 711  ? 2.423   57.275 16.065  1.00 67.32  ? 708  GLN A CA  1 
ATOM 5505 C C   . GLN A 1 711  ? 2.358   56.086 15.082  1.00 67.32  ? 708  GLN A C   1 
ATOM 5506 O O   . GLN A 1 711  ? 1.322   55.849 14.456  1.00 67.32  ? 708  GLN A O   1 
ATOM 5507 C CB  . GLN A 1 711  ? 2.835   56.857 17.483  1.00 172.76 ? 708  GLN A CB  1 
ATOM 5508 C CG  . GLN A 1 711  ? 1.739   57.097 18.528  1.00 172.76 ? 708  GLN A CG  1 
ATOM 5509 C CD  . GLN A 1 711  ? 2.222   56.979 19.963  1.00 172.76 ? 708  GLN A CD  1 
ATOM 5510 O OE1 . GLN A 1 711  ? 1.417   56.840 20.883  1.00 172.76 ? 708  GLN A OE1 1 
ATOM 5511 N NE2 . GLN A 1 711  ? 3.536   57.037 20.164  1.00 172.76 ? 708  GLN A NE2 1 
ATOM 5512 N N   . LYS A 1 712  ? 3.473   55.373 14.916  1.00 101.45 ? 709  LYS A N   1 
ATOM 5513 C CA  . LYS A 1 712  ? 3.480   54.145 14.111  1.00 101.45 ? 709  LYS A CA  1 
ATOM 5514 C C   . LYS A 1 712  ? 2.939   52.971 14.937  1.00 101.45 ? 709  LYS A C   1 
ATOM 5515 O O   . LYS A 1 712  ? 2.308   52.056 14.395  1.00 101.45 ? 709  LYS A O   1 
ATOM 5516 C CB  . LYS A 1 712  ? 4.879   53.845 13.537  1.00 134.93 ? 709  LYS A CB  1 
ATOM 5517 C CG  . LYS A 1 712  ? 4.895   52.755 12.440  1.00 134.93 ? 709  LYS A CG  1 
ATOM 5518 C CD  . LYS A 1 712  ? 6.258   52.602 11.755  1.00 134.93 ? 709  LYS A CD  1 
ATOM 5519 C CE  . LYS A 1 712  ? 6.269   51.436 10.759  1.00 134.93 ? 709  LYS A CE  1 
ATOM 5520 N NZ  . LYS A 1 712  ? 6.303   50.092 11.410  1.00 134.93 ? 709  LYS A NZ  1 
ATOM 5521 N N   . LEU A 1 713  ? 3.206   53.015 16.244  1.00 59.33  ? 710  LEU A N   1 
ATOM 5522 C CA  . LEU A 1 713  ? 2.578   52.125 17.225  1.00 59.33  ? 710  LEU A CA  1 
ATOM 5523 C C   . LEU A 1 713  ? 1.751   52.991 18.157  1.00 59.33  ? 710  LEU A C   1 
ATOM 5524 O O   . LEU A 1 713  ? 2.251   53.965 18.720  1.00 59.33  ? 710  LEU A O   1 
ATOM 5525 C CB  . LEU A 1 713  ? 3.615   51.337 18.044  1.00 51.67  ? 710  LEU A CB  1 
ATOM 5526 C CG  . LEU A 1 713  ? 4.686   50.464 17.369  1.00 51.67  ? 710  LEU A CG  1 
ATOM 5527 C CD1 . LEU A 1 713  ? 5.903   50.257 18.295  1.00 51.67  ? 710  LEU A CD1 1 
ATOM 5528 C CD2 . LEU A 1 713  ? 4.118   49.120 16.844  1.00 51.67  ? 710  LEU A CD2 1 
ATOM 5529 N N   . HIS A 1 714  ? 0.484   52.623 18.300  1.00 55.63  ? 711  HIS A N   1 
ATOM 5530 C CA  . HIS A 1 714  ? -0.446  53.252 19.220  1.00 55.63  ? 711  HIS A CA  1 
ATOM 5531 C C   . HIS A 1 714  ? -0.463  52.419 20.512  1.00 55.63  ? 711  HIS A C   1 
ATOM 5532 O O   . HIS A 1 714  ? -0.552  51.184 20.461  1.00 55.63  ? 711  HIS A O   1 
ATOM 5533 C CB  . HIS A 1 714  ? -1.829  53.298 18.563  1.00 88.95  ? 711  HIS A CB  1 
ATOM 5534 C CG  . HIS A 1 714  ? -2.949  53.536 19.522  1.00 88.95  ? 711  HIS A CG  1 
ATOM 5535 N ND1 . HIS A 1 714  ? -3.158  54.754 20.137  1.00 88.95  ? 711  HIS A ND1 1 
ATOM 5536 C CD2 . HIS A 1 714  ? -3.919  52.711 19.979  1.00 88.95  ? 711  HIS A CD2 1 
ATOM 5537 C CE1 . HIS A 1 714  ? -4.209  54.667 20.931  1.00 88.95  ? 711  HIS A CE1 1 
ATOM 5538 N NE2 . HIS A 1 714  ? -4.687  53.437 20.856  1.00 88.95  ? 711  HIS A NE2 1 
ATOM 5539 N N   . ILE A 1 715  ? -0.368  53.087 21.666  1.00 33.99  ? 712  ILE A N   1 
ATOM 5540 C CA  . ILE A 1 715  ? -0.308  52.375 22.941  1.00 33.99  ? 712  ILE A CA  1 
ATOM 5541 C C   . ILE A 1 715  ? -1.358  52.747 23.976  1.00 33.99  ? 712  ILE A C   1 
ATOM 5542 O O   . ILE A 1 715  ? -1.305  53.832 24.535  1.00 33.99  ? 712  ILE A O   1 
ATOM 5543 C CB  . ILE A 1 715  ? 1.065   52.514 23.610  1.00 28.23  ? 712  ILE A CB  1 
ATOM 5544 C CG1 . ILE A 1 715  ? 2.197   52.251 22.603  1.00 28.23  ? 712  ILE A CG1 1 
ATOM 5545 C CG2 . ILE A 1 715  ? 1.147   51.537 24.805  1.00 28.23  ? 712  ILE A CG2 1 
ATOM 5546 C CD1 . ILE A 1 715  ? 3.599   52.190 23.237  1.00 28.23  ? 712  ILE A CD1 1 
ATOM 5547 N N   . ARG A 1 716  ? -2.260  51.820 24.290  1.00 44.04  ? 713  ARG A N   1 
ATOM 5548 C CA  . ARG A 1 716  ? -3.194  52.021 25.413  1.00 44.04  ? 713  ARG A CA  1 
ATOM 5549 C C   . ARG A 1 716  ? -2.578  51.693 26.795  1.00 44.04  ? 713  ARG A C   1 
ATOM 5550 O O   . ARG A 1 716  ? -1.915  50.675 26.934  1.00 44.04  ? 713  ARG A O   1 
ATOM 5551 C CB  . ARG A 1 716  ? -4.470  51.195 25.213  1.00 62.14  ? 713  ARG A CB  1 
ATOM 5552 C CG  . ARG A 1 716  ? -5.723  52.009 25.488  1.00 62.14  ? 713  ARG A CG  1 
ATOM 5553 C CD  . ARG A 1 716  ? -6.667  51.383 26.494  1.00 62.14  ? 713  ARG A CD  1 
ATOM 5554 N NE  . ARG A 1 716  ? -7.796  50.704 25.852  1.00 62.14  ? 713  ARG A NE  1 
ATOM 5555 C CZ  . ARG A 1 716  ? -8.984  50.495 26.425  1.00 62.14  ? 713  ARG A CZ  1 
ATOM 5556 N NH1 . ARG A 1 716  ? -9.227  50.918 27.664  1.00 62.14  ? 713  ARG A NH1 1 
ATOM 5557 N NH2 . ARG A 1 716  ? -9.933  49.860 25.748  1.00 62.14  ? 713  ARG A NH2 1 
ATOM 5558 N N   . THR A 1 717  ? -2.805  52.530 27.806  1.00 30.88  ? 714  THR A N   1 
ATOM 5559 C CA  . THR A 1 717  ? -2.357  52.218 29.177  1.00 30.88  ? 714  THR A CA  1 
ATOM 5560 C C   . THR A 1 717  ? -3.498  51.922 30.178  1.00 30.88  ? 714  THR A C   1 
ATOM 5561 O O   . THR A 1 717  ? -4.478  52.669 30.257  1.00 30.88  ? 714  THR A O   1 
ATOM 5562 C CB  . THR A 1 717  ? -1.434  53.307 29.743  1.00 22.69  ? 714  THR A CB  1 
ATOM 5563 O OG1 . THR A 1 717  ? -0.163  53.217 29.097  1.00 22.69  ? 714  THR A OG1 1 
ATOM 5564 C CG2 . THR A 1 717  ? -1.203  53.148 31.227  1.00 22.69  ? 714  THR A CG2 1 
ATOM 5565 N N   . VAL A 1 718  ? -3.365  50.820 30.922  1.00 33.14  ? 715  VAL A N   1 
ATOM 5566 C CA  . VAL A 1 718  ? -4.336  50.430 31.949  1.00 33.14  ? 715  VAL A CA  1 
ATOM 5567 C C   . VAL A 1 718  ? -3.570  50.348 33.254  1.00 33.14  ? 715  VAL A C   1 
ATOM 5568 O O   . VAL A 1 718  ? -2.947  49.337 33.544  1.00 33.14  ? 715  VAL A O   1 
ATOM 5569 C CB  . VAL A 1 718  ? -5.020  49.073 31.584  1.00 28.33  ? 715  VAL A CB  1 
ATOM 5570 C CG1 . VAL A 1 718  ? -5.999  48.562 32.674  1.00 28.33  ? 715  VAL A CG1 1 
ATOM 5571 C CG2 . VAL A 1 718  ? -5.700  49.185 30.220  1.00 28.33  ? 715  VAL A CG2 1 
ATOM 5572 N N   . PRO A 1 719  ? -3.557  51.444 34.015  1.00 43.97  ? 716  PRO A N   1 
ATOM 5573 C CA  . PRO A 1 719  ? -2.896  51.459 35.319  1.00 43.97  ? 716  PRO A CA  1 
ATOM 5574 C C   . PRO A 1 719  ? -3.443  50.366 36.255  1.00 43.97  ? 716  PRO A C   1 
ATOM 5575 O O   . PRO A 1 719  ? -4.640  50.111 36.249  1.00 43.97  ? 716  PRO A O   1 
ATOM 5576 C CB  . PRO A 1 719  ? -3.265  52.828 35.899  1.00 18.55  ? 716  PRO A CB  1 
ATOM 5577 C CG  . PRO A 1 719  ? -4.007  53.581 34.861  1.00 18.55  ? 716  PRO A CG  1 
ATOM 5578 C CD  . PRO A 1 719  ? -4.175  52.735 33.649  1.00 18.55  ? 716  PRO A CD  1 
ATOM 5579 N N   . LEU A 1 720  ? -2.587  49.730 37.053  1.00 38.19  ? 717  LEU A N   1 
ATOM 5580 C CA  . LEU A 1 720  ? -3.067  48.801 38.059  1.00 38.19  ? 717  LEU A CA  1 
ATOM 5581 C C   . LEU A 1 720  ? -2.701  49.216 39.460  1.00 38.19  ? 717  LEU A C   1 
ATOM 5582 O O   . LEU A 1 720  ? -3.329  48.759 40.396  1.00 38.19  ? 717  LEU A O   1 
ATOM 5583 C CB  . LEU A 1 720  ? -2.552  47.384 37.799  1.00 14.34  ? 717  LEU A CB  1 
ATOM 5584 C CG  . LEU A 1 720  ? -2.994  46.685 36.493  1.00 14.34  ? 717  LEU A CG  1 
ATOM 5585 C CD1 . LEU A 1 720  ? -2.139  45.409 36.143  1.00 14.34  ? 717  LEU A CD1 1 
ATOM 5586 C CD2 . LEU A 1 720  ? -4.478  46.424 36.490  1.00 14.34  ? 717  LEU A CD2 1 
ATOM 5587 N N   . TYR A 1 721  ? -1.686  50.061 39.617  1.00 31.25  ? 718  TYR A N   1 
ATOM 5588 C CA  . TYR A 1 721  ? -1.228  50.503 40.945  1.00 31.25  ? 718  TYR A CA  1 
ATOM 5589 C C   . TYR A 1 721  ? -0.625  49.362 41.789  1.00 31.25  ? 718  TYR A C   1 
ATOM 5590 O O   . TYR A 1 721  ? -0.412  49.498 43.011  1.00 31.25  ? 718  TYR A O   1 
ATOM 5591 C CB  . TYR A 1 721  ? -2.323  51.309 41.705  1.00 27.63  ? 718  TYR A CB  1 
ATOM 5592 C CG  . TYR A 1 721  ? -2.866  52.404 40.834  1.00 27.63  ? 718  TYR A CG  1 
ATOM 5593 C CD1 . TYR A 1 721  ? -3.988  52.208 40.023  1.00 27.63  ? 718  TYR A CD1 1 
ATOM 5594 C CD2 . TYR A 1 721  ? -2.183  53.616 40.730  1.00 27.63  ? 718  TYR A CD2 1 
ATOM 5595 C CE1 . TYR A 1 721  ? -4.407  53.194 39.156  1.00 27.63  ? 718  TYR A CE1 1 
ATOM 5596 C CE2 . TYR A 1 721  ? -2.600  54.618 39.885  1.00 27.63  ? 718  TYR A CE2 1 
ATOM 5597 C CZ  . TYR A 1 721  ? -3.707  54.405 39.101  1.00 27.63  ? 718  TYR A CZ  1 
ATOM 5598 O OH  . TYR A 1 721  ? -4.093  55.453 38.270  1.00 27.63  ? 718  TYR A OH  1 
ATOM 5599 N N   . GLU A 1 722  ? -0.307  48.247 41.139  1.00 33.67  ? 719  GLU A N   1 
ATOM 5600 C CA  . GLU A 1 722  ? 0.362   47.123 41.817  1.00 33.67  ? 719  GLU A CA  1 
ATOM 5601 C C   . GLU A 1 722  ? 1.139   46.344 40.754  1.00 33.67  ? 719  GLU A C   1 
ATOM 5602 O O   . GLU A 1 722  ? 1.061   46.689 39.581  1.00 33.67  ? 719  GLU A O   1 
ATOM 5603 C CB  . GLU A 1 722  ? -0.662  46.255 42.565  1.00 27.31  ? 719  GLU A CB  1 
ATOM 5604 C CG  . GLU A 1 722  ? -1.803  45.795 41.684  1.00 27.31  ? 719  GLU A CG  1 
ATOM 5605 C CD  . GLU A 1 722  ? -2.934  45.124 42.425  1.00 27.31  ? 719  GLU A CD  1 
ATOM 5606 O OE1 . GLU A 1 722  ? -3.508  44.146 41.881  1.00 27.31  ? 719  GLU A OE1 1 
ATOM 5607 O OE2 . GLU A 1 722  ? -3.286  45.573 43.548  1.00 27.31  ? 719  GLU A OE2 1 
ATOM 5608 N N   . SER A 1 723  ? 1.868   45.306 41.161  1.00 27.14  ? 720  SER A N   1 
ATOM 5609 C CA  . SER A 1 723  ? 2.720   44.498 40.283  1.00 27.14  ? 720  SER A CA  1 
ATOM 5610 C C   . SER A 1 723  ? 1.982   43.441 39.501  1.00 27.14  ? 720  SER A C   1 
ATOM 5611 O O   . SER A 1 723  ? 1.515   42.507 40.082  1.00 27.14  ? 720  SER A O   1 
ATOM 5612 C CB  . SER A 1 723  ? 3.713   43.745 41.125  1.00 25.14  ? 720  SER A CB  1 
ATOM 5613 O OG  . SER A 1 723  ? 4.600   44.632 41.750  1.00 25.14  ? 720  SER A OG  1 
ATOM 5614 N N   . PRO A 1 724  ? 1.897   43.547 38.170  1.00 24.21  ? 721  PRO A N   1 
ATOM 5615 C CA  . PRO A 1 724  ? 1.323   42.360 37.507  1.00 24.21  ? 721  PRO A CA  1 
ATOM 5616 C C   . PRO A 1 724  ? 2.422   41.422 37.073  1.00 24.21  ? 721  PRO A C   1 
ATOM 5617 O O   . PRO A 1 724  ? 3.448   41.895 36.583  1.00 24.21  ? 721  PRO A O   1 
ATOM 5618 C CB  . PRO A 1 724  ? 0.666   42.945 36.277  1.00 24.90  ? 721  PRO A CB  1 
ATOM 5619 C CG  . PRO A 1 724  ? 1.563   44.135 35.923  1.00 24.90  ? 721  PRO A CG  1 
ATOM 5620 C CD  . PRO A 1 724  ? 2.234   44.621 37.216  1.00 24.90  ? 721  PRO A CD  1 
ATOM 5621 N N   . ARG A 1 725  ? 2.230   40.110 37.218  1.00 26.73  ? 722  ARG A N   1 
ATOM 5622 C CA  . ARG A 1 725  ? 3.316   39.155 36.913  1.00 26.73  ? 722  ARG A CA  1 
ATOM 5623 C C   . ARG A 1 725  ? 3.055   38.179 35.750  1.00 26.73  ? 722  ARG A C   1 
ATOM 5624 O O   . ARG A 1 725  ? 4.004   37.726 35.097  1.00 26.73  ? 722  ARG A O   1 
ATOM 5625 C CB  . ARG A 1 725  ? 3.725   38.391 38.164  1.00 27.96  ? 722  ARG A CB  1 
ATOM 5626 C CG  . ARG A 1 725  ? 4.048   39.275 39.380  1.00 27.96  ? 722  ARG A CG  1 
ATOM 5627 C CD  . ARG A 1 725  ? 5.527   39.286 39.692  1.00 27.96  ? 722  ARG A CD  1 
ATOM 5628 N NE  . ARG A 1 725  ? 5.909   40.186 40.782  1.00 27.96  ? 722  ARG A NE  1 
ATOM 5629 C CZ  . ARG A 1 725  ? 5.862   39.867 42.068  1.00 27.96  ? 722  ARG A CZ  1 
ATOM 5630 N NH1 . ARG A 1 725  ? 5.410   38.684 42.411  1.00 27.96  ? 722  ARG A NH1 1 
ATOM 5631 N NH2 . ARG A 1 725  ? 6.223   40.735 43.010  1.00 27.96  ? 722  ARG A NH2 1 
ATOM 5632 N N   . LYS A 1 726  ? 1.788   37.844 35.505  1.00 25.34  ? 723  LYS A N   1 
ATOM 5633 C CA  . LYS A 1 726  ? 1.428   36.847 34.504  1.00 25.34  ? 723  LYS A CA  1 
ATOM 5634 C C   . LYS A 1 726  ? 0.118   37.227 33.850  1.00 25.34  ? 723  LYS A C   1 
ATOM 5635 O O   . LYS A 1 726  ? -0.742  37.855 34.471  1.00 25.34  ? 723  LYS A O   1 
ATOM 5636 C CB  . LYS A 1 726  ? 1.261   35.480 35.135  1.00 33.91  ? 723  LYS A CB  1 
ATOM 5637 C CG  . LYS A 1 726  ? 2.524   34.873 35.681  1.00 33.91  ? 723  LYS A CG  1 
ATOM 5638 C CD  . LYS A 1 726  ? 3.417   34.296 34.617  1.00 33.91  ? 723  LYS A CD  1 
ATOM 5639 C CE  . LYS A 1 726  ? 4.820   34.210 35.178  1.00 33.91  ? 723  LYS A CE  1 
ATOM 5640 N NZ  . LYS A 1 726  ? 5.709   33.405 34.323  1.00 33.91  ? 723  LYS A NZ  1 
ATOM 5641 N N   . ILE A 1 727  ? -0.048  36.836 32.602  1.00 26.47  ? 724  ILE A N   1 
ATOM 5642 C CA  . ILE A 1 727  ? -1.242  37.173 31.878  1.00 26.47  ? 724  ILE A CA  1 
ATOM 5643 C C   . ILE A 1 727  ? -1.615  36.051 30.900  1.00 26.47  ? 724  ILE A C   1 
ATOM 5644 O O   . ILE A 1 727  ? -0.757  35.523 30.204  1.00 26.47  ? 724  ILE A O   1 
ATOM 5645 C CB  . ILE A 1 727  ? -1.117  38.604 31.169  1.00 17.57  ? 724  ILE A CB  1 
ATOM 5646 C CG1 . ILE A 1 727  ? -2.440  38.993 30.506  1.00 17.57  ? 724  ILE A CG1 1 
ATOM 5647 C CG2 . ILE A 1 727  ? 0.001   38.635 30.136  1.00 17.57  ? 724  ILE A CG2 1 
ATOM 5648 C CD1 . ILE A 1 727  ? -2.507  40.440 30.032  1.00 17.57  ? 724  ILE A CD1 1 
ATOM 5649 N N   . CYS A 1 728  ? -2.888  35.684 30.872  1.00 30.75  ? 725  CYS A N   1 
ATOM 5650 C CA  . CYS A 1 728  ? -3.410  34.739 29.889  1.00 30.75  ? 725  CYS A CA  1 
ATOM 5651 C C   . CYS A 1 728  ? -4.719  35.255 29.308  1.00 30.75  ? 725  CYS A C   1 
ATOM 5652 O O   . CYS A 1 728  ? -5.576  35.770 30.043  1.00 30.75  ? 725  CYS A O   1 
ATOM 5653 C CB  . CYS A 1 728  ? -3.663  33.383 30.539  1.00 47.65  ? 725  CYS A CB  1 
ATOM 5654 S SG  . CYS A 1 728  ? -2.191  32.359 30.618  1.00 47.65  ? 725  CYS A SG  1 
ATOM 5655 N N   . TYR A 1 729  ? -4.873  35.141 27.996  1.00 35.14  ? 726  TYR A N   1 
ATOM 5656 C CA  . TYR A 1 729  ? -6.121  35.505 27.354  1.00 35.14  ? 726  TYR A CA  1 
ATOM 5657 C C   . TYR A 1 729  ? -7.066  34.323 27.434  1.00 35.14  ? 726  TYR A C   1 
ATOM 5658 O O   . TYR A 1 729  ? -6.611  33.191 27.299  1.00 35.14  ? 726  TYR A O   1 
ATOM 5659 C CB  . TYR A 1 729  ? -5.864  35.834 25.898  1.00 35.12  ? 726  TYR A CB  1 
ATOM 5660 C CG  . TYR A 1 729  ? -7.116  36.213 25.123  1.00 35.12  ? 726  TYR A CG  1 
ATOM 5661 C CD1 . TYR A 1 729  ? -8.052  37.094 25.672  1.00 35.12  ? 726  TYR A CD1 1 
ATOM 5662 C CD2 . TYR A 1 729  ? -7.343  35.729 23.817  1.00 35.12  ? 726  TYR A CD2 1 
ATOM 5663 C CE1 . TYR A 1 729  ? -9.178  37.450 24.957  1.00 35.12  ? 726  TYR A CE1 1 
ATOM 5664 C CE2 . TYR A 1 729  ? -8.463  36.082 23.105  1.00 35.12  ? 726  TYR A CE2 1 
ATOM 5665 C CZ  . TYR A 1 729  ? -9.386  36.941 23.674  1.00 35.12  ? 726  TYR A CZ  1 
ATOM 5666 O OH  . TYR A 1 729  ? -10.528 37.316 22.999  1.00 35.12  ? 726  TYR A OH  1 
ATOM 5667 N N   . GLN A 1 730  ? -8.359  34.575 27.665  1.00 40.50  ? 727  GLN A N   1 
ATOM 5668 C CA  . GLN A 1 730  ? -9.408  33.538 27.574  1.00 40.50  ? 727  GLN A CA  1 
ATOM 5669 C C   . GLN A 1 730  ? -10.511 33.903 26.550  1.00 40.50  ? 727  GLN A C   1 
ATOM 5670 O O   . GLN A 1 730  ? -11.486 34.634 26.857  1.00 40.50  ? 727  GLN A O   1 
ATOM 5671 C CB  . GLN A 1 730  ? -10.021 33.257 28.949  1.00 43.30  ? 727  GLN A CB  1 
ATOM 5672 C CG  . GLN A 1 730  ? -10.958 32.030 29.025  1.00 43.30  ? 727  GLN A CG  1 
ATOM 5673 C CD  . GLN A 1 730  ? -11.076 31.479 30.436  1.00 43.30  ? 727  GLN A CD  1 
ATOM 5674 O OE1 . GLN A 1 730  ? -10.146 30.879 30.951  1.00 43.30  ? 727  GLN A OE1 1 
ATOM 5675 N NE2 . GLN A 1 730  ? -12.211 31.694 31.068  1.00 43.30  ? 727  GLN A NE2 1 
ATOM 5676 N N   . GLU A 1 731  ? -10.348 33.380 25.337  1.00 52.28  ? 728  GLU A N   1 
ATOM 5677 C CA  . GLU A 1 731  ? -11.265 33.678 24.256  1.00 52.28  ? 728  GLU A CA  1 
ATOM 5678 C C   . GLU A 1 731  ? -12.724 33.501 24.650  1.00 52.28  ? 728  GLU A C   1 
ATOM 5679 O O   . GLU A 1 731  ? -13.442 34.474 24.754  1.00 52.28  ? 728  GLU A O   1 
ATOM 5680 C CB  . GLU A 1 731  ? -10.946 32.847 23.032  1.00 81.41  ? 728  GLU A CB  1 
ATOM 5681 C CG  . GLU A 1 731  ? -11.730 33.263 21.827  1.00 81.41  ? 728  GLU A CG  1 
ATOM 5682 C CD  . GLU A 1 731  ? -11.124 32.731 20.554  1.00 81.41  ? 728  GLU A CD  1 
ATOM 5683 O OE1 . GLU A 1 731  ? -11.095 33.482 19.562  1.00 81.41  ? 728  GLU A OE1 1 
ATOM 5684 O OE2 . GLU A 1 731  ? -10.663 31.566 20.543  1.00 81.41  ? 728  GLU A OE2 1 
ATOM 5685 N N   . VAL A 1 732  ? -13.154 32.269 24.901  1.00 41.64  ? 729  VAL A N   1 
ATOM 5686 C CA  . VAL A 1 732  ? -14.568 31.959 25.177  1.00 41.64  ? 729  VAL A CA  1 
ATOM 5687 C C   . VAL A 1 732  ? -15.183 32.750 26.315  1.00 41.64  ? 729  VAL A C   1 
ATOM 5688 O O   . VAL A 1 732  ? -16.375 32.781 26.453  1.00 41.64  ? 729  VAL A O   1 
ATOM 5689 C CB  . VAL A 1 732  ? -14.751 30.490 25.530  1.00 22.89  ? 729  VAL A CB  1 
ATOM 5690 C CG1 . VAL A 1 732  ? -14.182 29.580 24.408  1.00 22.89  ? 729  VAL A CG1 1 
ATOM 5691 C CG2 . VAL A 1 732  ? -14.100 30.191 26.927  1.00 22.89  ? 729  VAL A CG2 1 
ATOM 5692 N N   . SER A 1 733  ? -14.364 33.365 27.146  1.00 25.91  ? 730  SER A N   1 
ATOM 5693 C CA  . SER A 1 733  ? -14.825 34.233 28.232  1.00 25.91  ? 730  SER A CA  1 
ATOM 5694 C C   . SER A 1 733  ? -14.611 35.732 27.892  1.00 25.91  ? 730  SER A C   1 
ATOM 5695 O O   . SER A 1 733  ? -14.995 36.620 28.667  1.00 25.91  ? 730  SER A O   1 
ATOM 5696 C CB  . SER A 1 733  ? -14.062 33.876 29.494  1.00 65.28  ? 730  SER A CB  1 
ATOM 5697 O OG  . SER A 1 733  ? -14.836 34.145 30.636  1.00 65.28  ? 730  SER A OG  1 
ATOM 5698 N N   . GLN A 1 734  ? -14.003 36.003 26.741  1.00 42.31  ? 731  GLN A N   1 
ATOM 5699 C CA  . GLN A 1 734  ? -13.754 37.366 26.292  1.00 42.31  ? 731  GLN A CA  1 
ATOM 5700 C C   . GLN A 1 734  ? -13.015 38.224 27.329  1.00 42.31  ? 731  GLN A C   1 
ATOM 5701 O O   . GLN A 1 734  ? -13.405 39.361 27.601  1.00 42.31  ? 731  GLN A O   1 
ATOM 5702 C CB  . GLN A 1 734  ? -15.053 38.069 25.844  1.00 62.75  ? 731  GLN A CB  1 
ATOM 5703 C CG  . GLN A 1 734  ? -15.682 37.559 24.558  1.00 62.75  ? 731  GLN A CG  1 
ATOM 5704 C CD  . GLN A 1 734  ? -14.774 37.670 23.328  1.00 62.75  ? 731  GLN A CD  1 
ATOM 5705 O OE1 . GLN A 1 734  ? -14.896 38.599 22.531  1.00 62.75  ? 731  GLN A OE1 1 
ATOM 5706 N NE2 . GLN A 1 734  ? -13.874 36.713 23.165  1.00 62.75  ? 731  GLN A NE2 1 
ATOM 5707 N N   . CYS A 1 735  ? -11.939 37.703 27.907  1.00 35.44  ? 732  CYS A N   1 
ATOM 5708 C CA  . CYS A 1 735  ? -11.221 38.488 28.912  1.00 35.44  ? 732  CYS A CA  1 
ATOM 5709 C C   . CYS A 1 735  ? -9.844  37.953 29.210  1.00 35.44  ? 732  CYS A C   1 
ATOM 5710 O O   . CYS A 1 735  ? -9.384  37.010 28.560  1.00 35.44  ? 732  CYS A O   1 
ATOM 5711 C CB  . CYS A 1 735  ? -12.028 38.569 30.202  1.00 51.60  ? 732  CYS A CB  1 
ATOM 5712 S SG  . CYS A 1 735  ? -12.228 36.984 30.939  1.00 51.60  ? 732  CYS A SG  1 
ATOM 5713 N N   . PHE A 1 736  ? -9.205  38.565 30.201  1.00 30.58  ? 733  PHE A N   1 
ATOM 5714 C CA  . PHE A 1 736  ? -7.841  38.218 30.589  1.00 30.58  ? 733  PHE A CA  1 
ATOM 5715 C C   . PHE A 1 736  ? -7.787  37.840 32.032  1.00 30.58  ? 733  PHE A C   1 
ATOM 5716 O O   . PHE A 1 736  ? -8.521  38.385 32.840  1.00 30.58  ? 733  PHE A O   1 
ATOM 5717 C CB  . PHE A 1 736  ? -6.881  39.384 30.383  1.00 25.52  ? 733  PHE A CB  1 
ATOM 5718 C CG  . PHE A 1 736  ? -6.724  39.797 28.947  1.00 25.52  ? 733  PHE A CG  1 
ATOM 5719 C CD1 . PHE A 1 736  ? -7.511  40.823 28.405  1.00 25.52  ? 733  PHE A CD1 1 
ATOM 5720 C CD2 . PHE A 1 736  ? -5.783  39.180 28.134  1.00 25.52  ? 733  PHE A CD2 1 
ATOM 5721 C CE1 . PHE A 1 736  ? -7.327  41.227 27.084  1.00 25.52  ? 733  PHE A CE1 1 
ATOM 5722 C CE2 . PHE A 1 736  ? -5.614  39.554 26.801  1.00 25.52  ? 733  PHE A CE2 1 
ATOM 5723 C CZ  . PHE A 1 736  ? -6.368  40.573 26.272  1.00 25.52  ? 733  PHE A CZ  1 
ATOM 5724 N N   . GLY A 1 737  ? -6.918  36.887 32.344  1.00 20.05  ? 734  GLY A N   1 
ATOM 5725 C CA  . GLY A 1 737  ? -6.545  36.600 33.710  1.00 20.05  ? 734  GLY A CA  1 
ATOM 5726 C C   . GLY A 1 737  ? -5.206  37.250 33.926  1.00 20.05  ? 734  GLY A C   1 
ATOM 5727 O O   . GLY A 1 737  ? -4.290  37.113 33.100  1.00 20.05  ? 734  GLY A O   1 
ATOM 5728 N N   . VAL A 1 738  ? -5.069  37.987 35.016  1.00 21.53  ? 735  VAL A N   1 
ATOM 5729 C CA  . VAL A 1 738  ? -3.765  38.523 35.345  1.00 21.53  ? 735  VAL A CA  1 
ATOM 5730 C C   . VAL A 1 738  ? -3.478  38.169 36.776  1.00 21.53  ? 735  VAL A C   1 
ATOM 5731 O O   . VAL A 1 738  ? -4.311  38.396 37.640  1.00 21.53  ? 735  VAL A O   1 
ATOM 5732 C CB  . VAL A 1 738  ? -3.722  40.036 35.180  1.00 25.00  ? 735  VAL A CB  1 
ATOM 5733 C CG1 . VAL A 1 738  ? -2.448  40.608 35.807  1.00 25.00  ? 735  VAL A CG1 1 
ATOM 5734 C CG2 . VAL A 1 738  ? -3.808  40.422 33.711  1.00 25.00  ? 735  VAL A CG2 1 
ATOM 5735 N N   . LEU A 1 739  ? -2.313  37.588 37.024  1.00 28.60  ? 736  LEU A N   1 
ATOM 5736 C CA  . LEU A 1 739  ? -1.840  37.430 38.380  1.00 28.60  ? 736  LEU A CA  1 
ATOM 5737 C C   . LEU A 1 739  ? -1.158  38.713 38.746  1.00 28.60  ? 736  LEU A C   1 
ATOM 5738 O O   . LEU A 1 739  ? -0.251  39.111 38.028  1.00 28.60  ? 736  LEU A O   1 
ATOM 5739 C CB  . LEU A 1 739  ? -0.791  36.346 38.459  1.00 12.94  ? 736  LEU A CB  1 
ATOM 5740 C CG  . LEU A 1 739  ? -1.133  34.881 38.215  1.00 12.94  ? 736  LEU A CG  1 
ATOM 5741 C CD1 . LEU A 1 739  ? 0.160   34.058 38.552  1.00 12.94  ? 736  LEU A CD1 1 
ATOM 5742 C CD2 . LEU A 1 739  ? -2.291  34.349 39.034  1.00 12.94  ? 736  LEU A CD2 1 
ATOM 5743 N N   . SER A 1 740  ? -1.557  39.352 39.847  1.00 14.29  ? 737  SER A N   1 
ATOM 5744 C CA  . SER A 1 740  ? -0.750  40.438 40.395  1.00 14.29  ? 737  SER A CA  1 
ATOM 5745 C C   . SER A 1 740  ? -0.551  40.329 41.915  1.00 14.29  ? 737  SER A C   1 
ATOM 5746 O O   . SER A 1 740  ? -1.127  39.469 42.581  1.00 14.29  ? 737  SER A O   1 
ATOM 5747 C CB  . SER A 1 740  ? -1.371  41.754 40.054  1.00 25.64  ? 737  SER A CB  1 
ATOM 5748 O OG  . SER A 1 740  ? -2.568  41.842 40.776  1.00 25.64  ? 737  SER A OG  1 
ATOM 5749 N N   . SER A 1 741  ? 0.289   41.184 42.474  1.00 19.78  ? 738  SER A N   1 
ATOM 5750 C CA  . SER A 1 741  ? 0.609   41.144 43.885  1.00 19.78  ? 738  SER A CA  1 
ATOM 5751 C C   . SER A 1 741  ? 0.736   42.622 44.373  1.00 19.78  ? 738  SER A C   1 
ATOM 5752 O O   . SER A 1 741  ? 1.127   43.510 43.601  1.00 19.78  ? 738  SER A O   1 
ATOM 5753 C CB  . SER A 1 741  ? 1.939   40.432 44.085  1.00 41.30  ? 738  SER A CB  1 
ATOM 5754 O OG  . SER A 1 741  ? 2.990   41.376 44.232  1.00 41.30  ? 738  SER A OG  1 
ATOM 5755 N N   . ARG A 1 742  ? 0.407   42.859 45.638  1.00 30.75  ? 739  ARG A N   1 
ATOM 5756 C CA  . ARG A 1 742  ? 0.482   44.182 46.188  1.00 30.75  ? 739  ARG A CA  1 
ATOM 5757 C C   . ARG A 1 742  ? 1.127   44.071 47.549  1.00 30.75  ? 739  ARG A C   1 
ATOM 5758 O O   . ARG A 1 742  ? 1.136   42.999 48.131  1.00 30.75  ? 739  ARG A O   1 
ATOM 5759 C CB  . ARG A 1 742  ? -0.891  44.812 46.291  1.00 35.92  ? 739  ARG A CB  1 
ATOM 5760 C CG  . ARG A 1 742  ? -1.741  44.183 47.339  1.00 35.92  ? 739  ARG A CG  1 
ATOM 5761 C CD  . ARG A 1 742  ? -3.055  44.883 47.502  1.00 35.92  ? 739  ARG A CD  1 
ATOM 5762 N NE  . ARG A 1 742  ? -3.642  44.390 48.733  1.00 35.92  ? 739  ARG A NE  1 
ATOM 5763 C CZ  . ARG A 1 742  ? -4.657  43.531 48.814  1.00 35.92  ? 739  ARG A CZ  1 
ATOM 5764 N NH1 . ARG A 1 742  ? -5.283  43.089 47.723  1.00 35.92  ? 739  ARG A NH1 1 
ATOM 5765 N NH2 . ARG A 1 742  ? -5.060  43.136 50.012  1.00 35.92  ? 739  ARG A NH2 1 
ATOM 5766 N N   . ILE A 1 743  ? 1.678   45.169 48.043  1.00 42.75  ? 740  ILE A N   1 
ATOM 5767 C CA  . ILE A 1 743  ? 2.432   45.151 49.270  1.00 42.75  ? 740  ILE A CA  1 
ATOM 5768 C C   . ILE A 1 743  ? 1.623   45.779 50.395  1.00 42.75  ? 740  ILE A C   1 
ATOM 5769 O O   . ILE A 1 743  ? 1.140   46.904 50.264  1.00 42.75  ? 740  ILE A O   1 
ATOM 5770 C CB  . ILE A 1 743  ? 3.756   45.904 49.058  1.00 32.58  ? 740  ILE A CB  1 
ATOM 5771 C CG1 . ILE A 1 743  ? 4.792   44.946 48.431  1.00 32.58  ? 740  ILE A CG1 1 
ATOM 5772 C CG2 . ILE A 1 743  ? 4.254   46.617 50.385  1.00 32.58  ? 740  ILE A CG2 1 
ATOM 5773 C CD1 . ILE A 1 743  ? 5.999   45.647 47.888  1.00 32.58  ? 740  ILE A CD1 1 
ATOM 5774 N N   . GLU A 1 744  ? 1.442   45.038 51.481  1.00 38.33  ? 741  GLU A N   1 
ATOM 5775 C CA  . GLU A 1 744  ? 0.762   45.565 52.653  1.00 38.33  ? 741  GLU A CA  1 
ATOM 5776 C C   . GLU A 1 744  ? 1.788   45.638 53.786  1.00 38.33  ? 741  GLU A C   1 
ATOM 5777 O O   . GLU A 1 744  ? 2.902   45.164 53.628  1.00 38.33  ? 741  GLU A O   1 
ATOM 5778 C CB  . GLU A 1 744  ? -0.500  44.761 52.969  1.00 53.31  ? 741  GLU A CB  1 
ATOM 5779 C CG  . GLU A 1 744  ? -1.515  44.828 51.810  1.00 53.31  ? 741  GLU A CG  1 
ATOM 5780 C CD  . GLU A 1 744  ? -2.961  44.428 52.170  1.00 53.31  ? 741  GLU A CD  1 
ATOM 5781 O OE1 . GLU A 1 744  ? -3.187  43.592 53.077  1.00 53.31  ? 741  GLU A OE1 1 
ATOM 5782 O OE2 . GLU A 1 744  ? -3.893  44.938 51.510  1.00 53.31  ? 741  GLU A OE2 1 
ATOM 5783 N N   . VAL A 1 745  ? 1.482   46.297 54.893  1.00 72.28  ? 742  VAL A N   1 
ATOM 5784 C CA  . VAL A 1 745  ? 2.512   46.442 55.926  1.00 72.28  ? 742  VAL A CA  1 
ATOM 5785 C C   . VAL A 1 745  ? 2.037   45.938 57.260  1.00 72.28  ? 742  VAL A C   1 
ATOM 5786 O O   . VAL A 1 745  ? 0.825   45.815 57.479  1.00 72.28  ? 742  VAL A O   1 
ATOM 5787 C CB  . VAL A 1 745  ? 3.010   47.890 56.074  1.00 78.18  ? 742  VAL A CB  1 
ATOM 5788 C CG1 . VAL A 1 745  ? 3.930   48.252 54.916  1.00 78.18  ? 742  VAL A CG1 1 
ATOM 5789 C CG2 . VAL A 1 745  ? 1.831   48.868 56.181  1.00 78.18  ? 742  VAL A CG2 1 
ATOM 5790 N N   . GLN A 1 746  ? 3.006   45.624 58.125  1.00 103.57 ? 743  GLN A N   1 
ATOM 5791 C CA  . GLN A 1 746  ? 2.762   45.248 59.519  1.00 103.57 ? 743  GLN A CA  1 
ATOM 5792 C C   . GLN A 1 746  ? 1.939   46.342 60.193  1.00 103.57 ? 743  GLN A C   1 
ATOM 5793 O O   . GLN A 1 746  ? 2.356   47.502 60.269  1.00 103.57 ? 743  GLN A O   1 
ATOM 5794 C CB  . GLN A 1 746  ? 4.086   45.033 60.267  1.00 124.97 ? 743  GLN A CB  1 
ATOM 5795 C CG  . GLN A 1 746  ? 3.949   44.717 61.763  1.00 124.97 ? 743  GLN A CG  1 
ATOM 5796 C CD  . GLN A 1 746  ? 5.179   45.119 62.568  1.00 124.97 ? 743  GLN A CD  1 
ATOM 5797 O OE1 . GLN A 1 746  ? 6.217   44.460 62.516  1.00 124.97 ? 743  GLN A OE1 1 
ATOM 5798 N NE2 . GLN A 1 746  ? 5.060   46.206 63.323  1.00 124.97 ? 743  GLN A NE2 1 
ATOM 5799 N N   . ASP A 1 747  ? 0.755   45.951 60.649  1.00 168.09 ? 744  ASP A N   1 
ATOM 5800 C CA  . ASP A 1 747  ? -0.190  46.850 61.286  1.00 168.09 ? 744  ASP A CA  1 
ATOM 5801 C C   . ASP A 1 747  ? 0.179   47.022 62.759  1.00 168.09 ? 744  ASP A C   1 
ATOM 5802 O O   . ASP A 1 747  ? 1.002   46.270 63.289  1.00 168.09 ? 744  ASP A O   1 
ATOM 5803 C CB  . ASP A 1 747  ? -1.595  46.253 61.157  1.00 148.17 ? 744  ASP A CB  1 
ATOM 5804 C CG  . ASP A 1 747  ? -2.699  47.278 61.327  1.00 148.17 ? 744  ASP A CG  1 
ATOM 5805 O OD1 . ASP A 1 747  ? -2.412  48.432 61.713  1.00 148.17 ? 744  ASP A OD1 1 
ATOM 5806 O OD2 . ASP A 1 747  ? -3.871  46.919 61.074  1.00 148.17 ? 744  ASP A OD2 1 
ATOM 5807 N N   . THR A 1 748  ? -0.413  48.021 63.411  1.00 126.22 ? 745  THR A N   1 
ATOM 5808 C CA  . THR A 1 748  ? -0.374  48.105 64.874  1.00 126.22 ? 745  THR A CA  1 
ATOM 5809 C C   . THR A 1 748  ? -1.276  47.008 65.461  1.00 126.22 ? 745  THR A C   1 
ATOM 5810 O O   . THR A 1 748  ? -1.033  46.511 66.558  1.00 126.22 ? 745  THR A O   1 
ATOM 5811 C CB  . THR A 1 748  ? -0.743  49.522 65.419  1.00 120.09 ? 745  THR A CB  1 
ATOM 5812 O OG1 . THR A 1 748  ? -2.035  49.921 64.943  1.00 120.09 ? 745  THR A OG1 1 
ATOM 5813 C CG2 . THR A 1 748  ? 0.297   50.564 64.996  1.00 120.09 ? 745  THR A CG2 1 
ATOM 5814 N N   . SER A 1 749  ? -2.304  46.630 64.701  1.00 76.13  ? 746  SER A N   1 
ATOM 5815 C CA  . SER A 1 749  ? -3.090  45.420 64.952  1.00 76.13  ? 746  SER A CA  1 
ATOM 5816 C C   . SER A 1 749  ? -2.299  44.148 64.603  1.00 76.13  ? 746  SER A C   1 
ATOM 5817 O O   . SER A 1 749  ? -2.798  43.024 64.783  1.00 76.13  ? 746  SER A O   1 
ATOM 5818 C CB  . SER A 1 749  ? -4.392  45.462 64.144  1.00 84.74  ? 746  SER A CB  1 
ATOM 5819 O OG  . SER A 1 749  ? -4.888  44.158 63.876  1.00 84.74  ? 746  SER A OG  1 
ATOM 5820 N N   . GLY A 1 750  ? -1.079  44.334 64.100  1.00 97.96  ? 747  GLY A N   1 
ATOM 5821 C CA  . GLY A 1 750  ? -0.222  43.227 63.678  1.00 97.96  ? 747  GLY A CA  1 
ATOM 5822 C C   . GLY A 1 750  ? -0.339  42.908 62.193  1.00 97.96  ? 747  GLY A C   1 
ATOM 5823 O O   . GLY A 1 750  ? 0.677   42.856 61.477  1.00 97.96  ? 747  GLY A O   1 
ATOM 5824 N N   . GLY A 1 751  ? -1.582  42.711 61.742  1.00 121.57 ? 748  GLY A N   1 
ATOM 5825 C CA  . GLY A 1 751  ? -1.903  42.286 60.376  1.00 121.57 ? 748  GLY A CA  1 
ATOM 5826 C C   . GLY A 1 751  ? -1.420  43.198 59.267  1.00 121.57 ? 748  GLY A C   1 
ATOM 5827 O O   . GLY A 1 751  ? -0.421  43.907 59.414  1.00 121.57 ? 748  GLY A O   1 
ATOM 5828 N N   . THR A 1 752  ? -2.134  43.181 58.146  1.00 52.74  ? 749  THR A N   1 
ATOM 5829 C CA  . THR A 1 752  ? -1.779  44.009 57.000  1.00 52.74  ? 749  THR A CA  1 
ATOM 5830 C C   . THR A 1 752  ? -2.799  45.123 56.786  1.00 52.74  ? 749  THR A C   1 
ATOM 5831 O O   . THR A 1 752  ? -3.975  44.972 57.116  1.00 52.74  ? 749  THR A O   1 
ATOM 5832 C CB  . THR A 1 752  ? -1.669  43.172 55.711  1.00 57.83  ? 749  THR A CB  1 
ATOM 5833 O OG1 . THR A 1 752  ? -2.928  42.549 55.434  1.00 57.83  ? 749  THR A OG1 1 
ATOM 5834 C CG2 . THR A 1 752  ? -0.599  42.101 55.862  1.00 57.83  ? 749  THR A CG2 1 
ATOM 5835 N N   . THR A 1 753  ? -2.340  46.240 56.231  1.00 77.54  ? 750  THR A N   1 
ATOM 5836 C CA  . THR A 1 753  ? -3.211  47.380 55.971  1.00 77.54  ? 750  THR A CA  1 
ATOM 5837 C C   . THR A 1 753  ? -3.333  47.650 54.475  1.00 77.54  ? 750  THR A C   1 
ATOM 5838 O O   . THR A 1 753  ? -3.350  46.723 53.666  1.00 77.54  ? 750  THR A O   1 
ATOM 5839 C CB  . THR A 1 753  ? -2.699  48.652 56.673  1.00 99.08  ? 750  THR A CB  1 
ATOM 5840 O OG1 . THR A 1 753  ? -2.640  48.429 58.087  1.00 99.08  ? 750  THR A OG1 1 
ATOM 5841 C CG2 . THR A 1 753  ? -3.623  49.826 56.387  1.00 99.08  ? 750  THR A CG2 1 
ATOM 5842 N N   . ALA A 1 754  ? -3.419  48.927 54.115  1.00 87.92  ? 751  ALA A N   1 
ATOM 5843 C CA  . ALA A 1 754  ? -3.539  49.320 52.716  1.00 87.92  ? 751  ALA A CA  1 
ATOM 5844 C C   . ALA A 1 754  ? -2.731  50.580 52.427  1.00 87.92  ? 751  ALA A C   1 
ATOM 5845 O O   . ALA A 1 754  ? -3.108  51.679 52.836  1.00 87.92  ? 751  ALA A O   1 
ATOM 5846 C CB  . ALA A 1 754  ? -5.001  49.530 52.349  1.00 22.80  ? 751  ALA A CB  1 
ATOM 5847 N N   . LEU A 1 755  ? -1.618  50.414 51.720  1.00 54.12  ? 752  LEU A N   1 
ATOM 5848 C CA  . LEU A 1 755  ? -0.754  51.537 51.375  1.00 54.12  ? 752  LEU A CA  1 
ATOM 5849 C C   . LEU A 1 755  ? -1.306  52.311 50.183  1.00 54.12  ? 752  LEU A C   1 
ATOM 5850 O O   . LEU A 1 755  ? -0.599  53.109 49.567  1.00 54.12  ? 752  LEU A O   1 
ATOM 5851 C CB  . LEU A 1 755  ? 0.664   51.050 51.075  1.00 73.25  ? 752  LEU A CB  1 
ATOM 5852 C CG  . LEU A 1 755  ? 0.810   50.059 49.918  1.00 73.25  ? 752  LEU A CG  1 
ATOM 5853 C CD1 . LEU A 1 755  ? 0.240   50.644 48.635  1.00 73.25  ? 752  LEU A CD1 1 
ATOM 5854 C CD2 . LEU A 1 755  ? 2.266   49.662 49.730  1.00 73.25  ? 752  LEU A CD2 1 
ATOM 5855 N N   . ARG A 1 756  ? -2.573  52.070 49.862  1.00 41.46  ? 753  ARG A N   1 
ATOM 5856 C CA  . ARG A 1 756  ? -3.221  52.743 48.743  1.00 41.46  ? 753  ARG A CA  1 
ATOM 5857 C C   . ARG A 1 756  ? -4.103  51.780 47.956  1.00 41.46  ? 753  ARG A C   1 
ATOM 5858 O O   . ARG A 1 756  ? -3.886  50.568 47.975  1.00 41.46  ? 753  ARG A O   1 
ATOM 5859 C CB  . ARG A 1 756  ? -2.177  53.374 47.819  1.00 32.97  ? 753  ARG A CB  1 
ATOM 5860 C CG  . ARG A 1 756  ? -2.766  54.096 46.618  1.00 32.97  ? 753  ARG A CG  1 
ATOM 5861 C CD  . ARG A 1 756  ? -1.675  54.700 45.748  1.00 32.97  ? 753  ARG A CD  1 
ATOM 5862 N NE  . ARG A 1 756  ? -0.756  53.686 45.240  1.00 32.97  ? 753  ARG A NE  1 
ATOM 5863 C CZ  . ARG A 1 756  ? 0.350   53.299 45.867  1.00 32.97  ? 753  ARG A CZ  1 
ATOM 5864 N NH1 . ARG A 1 756  ? 0.679   53.842 47.031  1.00 32.97  ? 753  ARG A NH1 1 
ATOM 5865 N NH2 . ARG A 1 756  ? 1.128   52.369 45.330  1.00 32.97  ? 753  ARG A NH2 1 
ATOM 5866 N N   . PRO A 1 757  ? -5.099  52.326 47.266  1.00 44.42  ? 754  PRO A N   1 
ATOM 5867 C CA  . PRO A 1 757  ? -6.023  51.509 46.466  1.00 44.42  ? 754  PRO A CA  1 
ATOM 5868 C C   . PRO A 1 757  ? -5.316  51.101 45.193  1.00 44.42  ? 754  PRO A C   1 
ATOM 5869 O O   . PRO A 1 757  ? -4.516  51.852 44.665  1.00 44.42  ? 754  PRO A O   1 
ATOM 5870 C CB  . PRO A 1 757  ? -7.168  52.476 46.111  1.00 30.20  ? 754  PRO A CB  1 
ATOM 5871 C CG  . PRO A 1 757  ? -6.681  53.840 46.372  1.00 30.20  ? 754  PRO A CG  1 
ATOM 5872 C CD  . PRO A 1 757  ? -5.508  53.744 47.354  1.00 30.20  ? 754  PRO A CD  1 
ATOM 5873 N N   . SER A 1 758  ? -5.598  49.908 44.718  1.00 30.15  ? 755  SER A N   1 
ATOM 5874 C CA  . SER A 1 758  ? -5.020  49.387 43.462  1.00 30.15  ? 755  SER A CA  1 
ATOM 5875 C C   . SER A 1 758  ? -6.074  48.500 42.793  1.00 30.15  ? 755  SER A C   1 
ATOM 5876 O O   . SER A 1 758  ? -7.230  48.471 43.243  1.00 30.15  ? 755  SER A O   1 
ATOM 5877 C CB  . SER A 1 758  ? -3.725  48.606 43.739  1.00 23.54  ? 755  SER A CB  1 
ATOM 5878 O OG  . SER A 1 758  ? -3.872  47.756 44.881  1.00 23.54  ? 755  SER A OG  1 
ATOM 5879 N N   . ALA A 1 759  ? -5.694  47.794 41.738  1.00 32.27  ? 756  ALA A N   1 
ATOM 5880 C CA  . ALA A 1 759  ? -6.635  46.933 41.016  1.00 32.27  ? 756  ALA A CA  1 
ATOM 5881 C C   . ALA A 1 759  ? -7.282  45.856 41.913  1.00 32.27  ? 756  ALA A C   1 
ATOM 5882 O O   . ALA A 1 759  ? -8.492  45.663 41.899  1.00 32.27  ? 756  ALA A O   1 
ATOM 5883 C CB  . ALA A 1 759  ? -5.942  46.288 39.852  1.00 11.84  ? 756  ALA A CB  1 
ATOM 5884 N N   . SER A 1 760  ? -6.476  45.173 42.713  1.00 42.22  ? 757  SER A N   1 
ATOM 5885 C CA  . SER A 1 760  ? -7.026  44.130 43.538  1.00 42.22  ? 757  SER A CA  1 
ATOM 5886 C C   . SER A 1 760  ? -7.883  44.635 44.729  1.00 42.22  ? 757  SER A C   1 
ATOM 5887 O O   . SER A 1 760  ? -8.632  43.867 45.333  1.00 42.22  ? 757  SER A O   1 
ATOM 5888 C CB  . SER A 1 760  ? -5.906  43.214 44.013  1.00 40.84  ? 757  SER A CB  1 
ATOM 5889 O OG  . SER A 1 760  ? -5.075  43.864 44.951  1.00 40.84  ? 757  SER A OG  1 
ATOM 5890 N N   . THR A 1 761  ? -7.783  45.907 45.089  1.00 42.60  ? 758  THR A N   1 
ATOM 5891 C CA  . THR A 1 761  ? -8.600  46.372 46.199  1.00 42.60  ? 758  THR A CA  1 
ATOM 5892 C C   . THR A 1 761  ? -9.847  47.106 45.736  1.00 42.60  ? 758  THR A C   1 
ATOM 5893 O O   . THR A 1 761  ? -10.750 47.310 46.527  1.00 42.60  ? 758  THR A O   1 
ATOM 5894 C CB  . THR A 1 761  ? -7.833  47.236 47.219  1.00 37.70  ? 758  THR A CB  1 
ATOM 5895 O OG1 . THR A 1 761  ? -7.252  48.367 46.556  1.00 37.70  ? 758  THR A OG1 1 
ATOM 5896 C CG2 . THR A 1 761  ? -6.767  46.419 47.923  1.00 37.70  ? 758  THR A CG2 1 
ATOM 5897 N N   . GLN A 1 762  ? -9.910  47.473 44.460  1.00 47.38  ? 759  GLN A N   1 
ATOM 5898 C CA  . GLN A 1 762  ? -11.000 48.299 43.955  1.00 47.38  ? 759  GLN A CA  1 
ATOM 5899 C C   . GLN A 1 762  ? -11.806 47.630 42.833  1.00 47.38  ? 759  GLN A C   1 
ATOM 5900 O O   . GLN A 1 762  ? -12.538 48.290 42.090  1.00 47.38  ? 759  GLN A O   1 
ATOM 5901 C CB  . GLN A 1 762  ? -10.453 49.655 43.508  1.00 90.62  ? 759  GLN A CB  1 
ATOM 5902 C CG  . GLN A 1 762  ? -10.080 50.592 44.655  1.00 90.62  ? 759  GLN A CG  1 
ATOM 5903 C CD  . GLN A 1 762  ? -10.392 52.061 44.336  1.00 90.62  ? 759  GLN A CD  1 
ATOM 5904 O OE1 . GLN A 1 762  ? -9.558  52.948 44.541  1.00 90.62  ? 759  GLN A OE1 1 
ATOM 5905 N NE2 . GLN A 1 762  ? -11.597 52.316 43.820  1.00 90.62  ? 759  GLN A NE2 1 
ATOM 5906 N N   . ALA A 1 763  ? -11.675 46.308 42.738  1.00 39.82  ? 760  ALA A N   1 
ATOM 5907 C CA  . ALA A 1 763  ? -12.319 45.484 41.694  1.00 39.82  ? 760  ALA A CA  1 
ATOM 5908 C C   . ALA A 1 763  ? -13.803 45.561 41.836  1.00 39.82  ? 760  ALA A C   1 
ATOM 5909 O O   . ALA A 1 763  ? -14.291 45.797 42.934  1.00 39.82  ? 760  ALA A O   1 
ATOM 5910 C CB  . ALA A 1 763  ? -11.894 44.030 41.829  1.00 27.47  ? 760  ALA A CB  1 
ATOM 5911 N N   . LEU A 1 764  ? -14.520 45.326 40.739  1.00 48.30  ? 761  LEU A N   1 
ATOM 5912 C CA  . LEU A 1 764  ? -15.975 45.358 40.778  1.00 48.30  ? 761  LEU A CA  1 
ATOM 5913 C C   . LEU A 1 764  ? -16.526 44.270 41.686  1.00 48.30  ? 761  LEU A C   1 
ATOM 5914 O O   . LEU A 1 764  ? -17.564 44.454 42.287  1.00 48.30  ? 761  LEU A O   1 
ATOM 5915 C CB  . LEU A 1 764  ? -16.600 45.356 39.374  1.00 27.65  ? 761  LEU A CB  1 
ATOM 5916 C CG  . LEU A 1 764  ? -16.073 46.526 38.504  1.00 27.65  ? 761  LEU A CG  1 
ATOM 5917 C CD1 . LEU A 1 764  ? -16.519 46.501 37.040  1.00 27.65  ? 761  LEU A CD1 1 
ATOM 5918 C CD2 . LEU A 1 764  ? -16.328 47.930 39.158  1.00 27.65  ? 761  LEU A CD2 1 
ATOM 5919 N N   . SER A 1 765  ? -15.818 43.157 41.816  1.00 65.08  ? 762  SER A N   1 
ATOM 5920 C CA  . SER A 1 765  ? -16.193 42.123 42.783  1.00 65.08  ? 762  SER A CA  1 
ATOM 5921 C C   . SER A 1 765  ? -14.997 41.274 43.176  1.00 65.08  ? 762  SER A C   1 
ATOM 5922 O O   . SER A 1 765  ? -13.949 41.309 42.521  1.00 65.08  ? 762  SER A O   1 
ATOM 5923 C CB  . SER A 1 765  ? -17.289 41.234 42.231  1.00 45.60  ? 762  SER A CB  1 
ATOM 5924 O OG  . SER A 1 765  ? -16.993 40.880 40.889  1.00 45.60  ? 762  SER A OG  1 
ATOM 5925 N N   . SER A 1 766  ? -15.165 40.510 44.248  1.00 39.58  ? 763  SER A N   1 
ATOM 5926 C CA  . SER A 1 766  ? -14.055 39.830 44.870  1.00 39.58  ? 763  SER A CA  1 
ATOM 5927 C C   . SER A 1 766  ? -14.477 38.562 45.580  1.00 39.58  ? 763  SER A C   1 
ATOM 5928 O O   . SER A 1 766  ? -15.657 38.224 45.596  1.00 39.58  ? 763  SER A O   1 
ATOM 5929 C CB  . SER A 1 766  ? -13.295 40.746 45.846  1.00 24.81  ? 763  SER A CB  1 
ATOM 5930 O OG  . SER A 1 766  ? -14.071 41.832 46.293  1.00 24.81  ? 763  SER A OG  1 
ATOM 5931 N N   . SER A 1 767  ? -13.478 37.877 46.151  1.00 36.38  ? 764  SER A N   1 
ATOM 5932 C CA  . SER A 1 767  ? -13.600 36.589 46.808  1.00 36.38  ? 764  SER A CA  1 
ATOM 5933 C C   . SER A 1 767  ? -12.223 36.298 47.396  1.00 36.38  ? 764  SER A C   1 
ATOM 5934 O O   . SER A 1 767  ? -11.223 36.742 46.842  1.00 36.38  ? 764  SER A O   1 
ATOM 5935 C CB  . SER A 1 767  ? -13.965 35.526 45.791  1.00 31.06  ? 764  SER A CB  1 
ATOM 5936 O OG  . SER A 1 767  ? -12.996 35.456 44.784  1.00 31.06  ? 764  SER A OG  1 
ATOM 5937 N N   . VAL A 1 768  ? -12.158 35.609 48.529  1.00 37.22  ? 765  VAL A N   1 
ATOM 5938 C CA  . VAL A 1 768  ? -10.858 35.289 49.145  1.00 37.22  ? 765  VAL A CA  1 
ATOM 5939 C C   . VAL A 1 768  ? -10.720 33.786 49.148  1.00 37.22  ? 765  VAL A C   1 
ATOM 5940 O O   . VAL A 1 768  ? -11.640 33.102 48.769  1.00 37.22  ? 765  VAL A O   1 
ATOM 5941 C CB  . VAL A 1 768  ? -10.717 35.864 50.580  1.00 38.89  ? 765  VAL A CB  1 
ATOM 5942 C CG1 . VAL A 1 768  ? -9.818  37.122 50.617  1.00 38.89  ? 765  VAL A CG1 1 
ATOM 5943 C CG2 . VAL A 1 768  ? -12.083 36.173 51.139  1.00 38.89  ? 765  VAL A CG2 1 
ATOM 5944 N N   . SER A 1 769  ? -9.574  33.249 49.511  1.00 55.39  ? 766  SER A N   1 
ATOM 5945 C CA  . SER A 1 769  ? -9.444  31.809 49.456  1.00 55.39  ? 766  SER A CA  1 
ATOM 5946 C C   . SER A 1 769  ? -9.974  31.305 50.766  1.00 55.39  ? 766  SER A C   1 
ATOM 5947 O O   . SER A 1 769  ? -9.541  31.764 51.824  1.00 55.39  ? 766  SER A O   1 
ATOM 5948 C CB  . SER A 1 769  ? -7.996  31.386 49.255  1.00 63.46  ? 766  SER A CB  1 
ATOM 5949 O OG  . SER A 1 769  ? -7.930  30.386 48.255  1.00 63.46  ? 766  SER A OG  1 
ATOM 5950 N N   . SER A 1 770  ? -10.944 30.398 50.705  1.00 79.97  ? 767  SER A N   1 
ATOM 5951 C CA  . SER A 1 770  ? -11.473 29.790 51.923  1.00 79.97  ? 767  SER A CA  1 
ATOM 5952 C C   . SER A 1 770  ? -10.805 28.448 52.234  1.00 79.97  ? 767  SER A C   1 
ATOM 5953 O O   . SER A 1 770  ? -11.066 27.857 53.278  1.00 79.97  ? 767  SER A O   1 
ATOM 5954 C CB  . SER A 1 770  ? -13.007 29.670 51.878  1.00 57.72  ? 767  SER A CB  1 
ATOM 5955 O OG  . SER A 1 770  ? -13.456 28.874 50.796  1.00 57.72  ? 767  SER A OG  1 
ATOM 5956 N N   . SER A 1 771  ? -9.932  27.984 51.337  1.00 61.75  ? 768  SER A N   1 
ATOM 5957 C CA  . SER A 1 771  ? -9.249  26.707 51.492  1.00 61.75  ? 768  SER A CA  1 
ATOM 5958 C C   . SER A 1 771  ? -8.701  26.491 52.888  1.00 61.75  ? 768  SER A C   1 
ATOM 5959 O O   . SER A 1 771  ? -8.143  27.415 53.491  1.00 61.75  ? 768  SER A O   1 
ATOM 5960 C CB  . SER A 1 771  ? -8.079  26.613 50.520  1.00 51.44  ? 768  SER A CB  1 
ATOM 5961 O OG  . SER A 1 771  ? -6.994  25.861 51.082  1.00 51.44  ? 768  SER A OG  1 
ATOM 5962 N N   . LYS A 1 772  ? -8.838  25.255 53.374  1.00 76.30  ? 769  LYS A N   1 
ATOM 5963 C CA  . LYS A 1 772  ? -8.287  24.860 54.666  1.00 76.30  ? 769  LYS A CA  1 
ATOM 5964 C C   . LYS A 1 772  ? -7.088  23.931 54.524  1.00 76.30  ? 769  LYS A C   1 
ATOM 5965 O O   . LYS A 1 772  ? -6.710  23.275 55.493  1.00 76.30  ? 769  LYS A O   1 
ATOM 5966 C CB  . LYS A 1 772  ? -9.352  24.197 55.550  1.00 70.01  ? 769  LYS A CB  1 
ATOM 5967 C CG  . LYS A 1 772  ? -10.594 25.038 55.862  1.00 70.01  ? 769  LYS A CG  1 
ATOM 5968 C CD  . LYS A 1 772  ? -10.266 26.420 56.436  1.00 70.01  ? 769  LYS A CD  1 
ATOM 5969 C CE  . LYS A 1 772  ? -11.523 27.270 56.681  1.00 70.01  ? 769  LYS A CE  1 
ATOM 5970 N NZ  . LYS A 1 772  ? -12.515 27.203 55.558  1.00 70.01  ? 769  LYS A NZ  1 
ATOM 5971 N N   . LEU A 1 773  ? -6.480  23.899 53.333  1.00 62.57  ? 770  LEU A N   1 
ATOM 5972 C CA  . LEU A 1 773  ? -5.333  23.012 53.027  1.00 62.57  ? 770  LEU A CA  1 
ATOM 5973 C C   . LEU A 1 773  ? -4.143  23.055 53.992  1.00 62.57  ? 770  LEU A C   1 
ATOM 5974 O O   . LEU A 1 773  ? -3.385  22.089 54.075  1.00 62.57  ? 770  LEU A O   1 
ATOM 5975 C CB  . LEU A 1 773  ? -4.813  23.229 51.592  1.00 47.69  ? 770  LEU A CB  1 
ATOM 5976 C CG  . LEU A 1 773  ? -5.395  22.418 50.417  1.00 47.69  ? 770  LEU A CG  1 
ATOM 5977 C CD1 . LEU A 1 773  ? -4.579  22.561 49.151  1.00 47.69  ? 770  LEU A CD1 1 
ATOM 5978 C CD2 . LEU A 1 773  ? -5.587  20.937 50.749  1.00 47.69  ? 770  LEU A CD2 1 
ATOM 5979 N N   . PHE A 1 774  ? -3.962  24.159 54.709  1.00 82.35  ? 771  PHE A N   1 
ATOM 5980 C CA  . PHE A 1 774  ? -2.833  24.246 55.636  1.00 82.35  ? 771  PHE A CA  1 
ATOM 5981 C C   . PHE A 1 774  ? -3.224  24.584 57.082  1.00 82.35  ? 771  PHE A C   1 
ATOM 5982 O O   . PHE A 1 774  ? -4.152  25.364 57.336  1.00 82.35  ? 771  PHE A O   1 
ATOM 5983 C CB  . PHE A 1 774  ? -1.734  25.179 55.098  1.00 55.44  ? 771  PHE A CB  1 
ATOM 5984 C CG  . PHE A 1 774  ? -1.320  24.884 53.656  1.00 55.44  ? 771  PHE A CG  1 
ATOM 5985 C CD1 . PHE A 1 774  ? -1.736  25.712 52.609  1.00 55.44  ? 771  PHE A CD1 1 
ATOM 5986 C CD2 . PHE A 1 774  ? -0.516  23.777 53.346  1.00 55.44  ? 771  PHE A CD2 1 
ATOM 5987 C CE1 . PHE A 1 774  ? -1.360  25.450 51.277  1.00 55.44  ? 771  PHE A CE1 1 
ATOM 5988 C CE2 . PHE A 1 774  ? -0.138  23.503 52.002  1.00 55.44  ? 771  PHE A CE2 1 
ATOM 5989 C CZ  . PHE A 1 774  ? -0.570  24.340 50.971  1.00 55.44  ? 771  PHE A CZ  1 
ATOM 5990 N N   . SER A 1 775  ? -2.514  23.946 58.014  1.00 171.36 ? 772  SER A N   1 
ATOM 5991 C CA  . SER A 1 775  ? -2.700  24.124 59.454  1.00 171.36 ? 772  SER A CA  1 
ATOM 5992 C C   . SER A 1 775  ? -1.472  23.604 60.191  1.00 171.36 ? 772  SER A C   1 
ATOM 5993 O O   . SER A 1 775  ? -1.540  22.603 60.913  1.00 171.36 ? 772  SER A O   1 
ATOM 5994 C CB  . SER A 1 775  ? -3.957  23.400 59.939  1.00 79.98  ? 772  SER A CB  1 
ATOM 5995 O OG  . SER A 1 775  ? -5.118  24.092 59.514  1.00 79.98  ? 772  SER A OG  1 
ATOM 5996 N N   . SER A 1 776  ? -0.350  24.294 59.996  1.00 149.14 ? 773  SER A N   1 
ATOM 5997 C CA  . SER A 1 776  ? 0.939   23.881 60.550  1.00 149.14 ? 773  SER A CA  1 
ATOM 5998 C C   . SER A 1 776  ? 1.841   25.065 60.902  1.00 149.14 ? 773  SER A C   1 
ATOM 5999 O O   . SER A 1 776  ? 2.210   25.863 60.042  1.00 149.14 ? 773  SER A O   1 
ATOM 6000 C CB  . SER A 1 776  ? 1.654   22.915 59.594  1.00 123.83 ? 773  SER A CB  1 
ATOM 6001 O OG  . SER A 1 776  ? 1.274   23.143 58.246  1.00 123.83 ? 773  SER A OG  1 
ATOM 6002 N N   . GLY A 1 786  ? 6.106   47.561 60.251  1.00 127.54 ? 783  GLY A N   1 
ATOM 6003 C CA  . GLY A 1 786  ? 7.374   47.067 60.768  1.00 127.54 ? 783  GLY A CA  1 
ATOM 6004 C C   . GLY A 1 786  ? 7.933   45.934 59.932  1.00 127.54 ? 783  GLY A C   1 
ATOM 6005 O O   . GLY A 1 786  ? 9.088   45.542 60.105  1.00 127.54 ? 783  GLY A O   1 
ATOM 6006 N N   . GLU A 1 787  ? 7.104   45.411 59.029  1.00 105.90 ? 784  GLU A N   1 
ATOM 6007 C CA  . GLU A 1 787  ? 7.468   44.316 58.124  1.00 105.90 ? 784  GLU A CA  1 
ATOM 6008 C C   . GLU A 1 787  ? 6.605   44.433 56.860  1.00 105.90 ? 784  GLU A C   1 
ATOM 6009 O O   . GLU A 1 787  ? 5.527   45.032 56.904  1.00 105.90 ? 784  GLU A O   1 
ATOM 6010 C CB  . GLU A 1 787  ? 7.254   42.948 58.805  1.00 102.31 ? 784  GLU A CB  1 
ATOM 6011 C CG  . GLU A 1 787  ? 8.346   42.505 59.805  1.00 102.31 ? 784  GLU A CG  1 
ATOM 6012 C CD  . GLU A 1 787  ? 7.809   41.616 60.944  1.00 102.31 ? 784  GLU A CD  1 
ATOM 6013 O OE1 . GLU A 1 787  ? 7.216   42.152 61.915  1.00 102.31 ? 784  GLU A OE1 1 
ATOM 6014 O OE2 . GLU A 1 787  ? 7.998   40.379 60.881  1.00 102.31 ? 784  GLU A OE2 1 
ATOM 6015 N N   . GLU A 1 788  ? 7.072   43.876 55.743  1.00 77.15  ? 785  GLU A N   1 
ATOM 6016 C CA  . GLU A 1 788  ? 6.348   43.984 54.463  1.00 77.15  ? 785  GLU A CA  1 
ATOM 6017 C C   . GLU A 1 788  ? 5.911   42.640 53.913  1.00 77.15  ? 785  GLU A C   1 
ATOM 6018 O O   . GLU A 1 788  ? 6.665   41.670 53.967  1.00 77.15  ? 785  GLU A O   1 
ATOM 6019 C CB  . GLU A 1 788  ? 7.193   44.701 53.407  1.00 60.78  ? 785  GLU A CB  1 
ATOM 6020 C CG  . GLU A 1 788  ? 6.809   46.159 53.170  1.00 60.78  ? 785  GLU A CG  1 
ATOM 6021 C CD  . GLU A 1 788  ? 7.678   46.825 52.119  1.00 60.78  ? 785  GLU A CD  1 
ATOM 6022 O OE1 . GLU A 1 788  ? 8.580   46.143 51.582  1.00 60.78  ? 785  GLU A OE1 1 
ATOM 6023 O OE2 . GLU A 1 788  ? 7.456   48.025 51.826  1.00 60.78  ? 785  GLU A OE2 1 
ATOM 6024 N N   . VAL A 1 789  ? 4.706   42.593 53.356  1.00 57.57  ? 786  VAL A N   1 
ATOM 6025 C CA  . VAL A 1 789  ? 4.125   41.331 52.902  1.00 57.57  ? 786  VAL A CA  1 
ATOM 6026 C C   . VAL A 1 789  ? 3.439   41.458 51.532  1.00 57.57  ? 786  VAL A C   1 
ATOM 6027 O O   . VAL A 1 789  ? 2.620   42.341 51.318  1.00 57.57  ? 786  VAL A O   1 
ATOM 6028 C CB  . VAL A 1 789  ? 3.163   40.760 53.976  1.00 75.82  ? 786  VAL A CB  1 
ATOM 6029 C CG1 . VAL A 1 789  ? 2.170   39.758 53.383  1.00 75.82  ? 786  VAL A CG1 1 
ATOM 6030 C CG2 . VAL A 1 789  ? 3.964   40.099 55.084  1.00 75.82  ? 786  VAL A CG2 1 
ATOM 6031 N N   . GLU A 1 790  ? 3.799   40.594 50.595  1.00 32.74  ? 787  GLU A N   1 
ATOM 6032 C CA  . GLU A 1 790  ? 3.079   40.539 49.360  1.00 32.74  ? 787  GLU A CA  1 
ATOM 6033 C C   . GLU A 1 790  ? 1.741   39.838 49.611  1.00 32.74  ? 787  GLU A C   1 
ATOM 6034 O O   . GLU A 1 790  ? 1.631   38.975 50.499  1.00 32.74  ? 787  GLU A O   1 
ATOM 6035 C CB  . GLU A 1 790  ? 3.885   39.811 48.284  1.00 41.59  ? 787  GLU A CB  1 
ATOM 6036 C CG  . GLU A 1 790  ? 5.114   40.574 47.758  1.00 41.59  ? 787  GLU A CG  1 
ATOM 6037 C CD  . GLU A 1 790  ? 5.815   39.850 46.596  1.00 41.59  ? 787  GLU A CD  1 
ATOM 6038 O OE1 . GLU A 1 790  ? 7.051   39.920 46.485  1.00 41.59  ? 787  GLU A OE1 1 
ATOM 6039 O OE2 . GLU A 1 790  ? 5.134   39.182 45.787  1.00 41.59  ? 787  GLU A OE2 1 
ATOM 6040 N N   . VAL A 1 791  ? 0.730   40.229 48.837  1.00 40.69  ? 788  VAL A N   1 
ATOM 6041 C CA  . VAL A 1 791  ? -0.609  39.689 48.913  1.00 40.69  ? 788  VAL A CA  1 
ATOM 6042 C C   . VAL A 1 791  ? -0.974  39.542 47.472  1.00 40.69  ? 788  VAL A C   1 
ATOM 6043 O O   . VAL A 1 791  ? -1.012  40.544 46.755  1.00 40.69  ? 788  VAL A O   1 
ATOM 6044 C CB  . VAL A 1 791  ? -1.583  40.697 49.542  1.00 39.96  ? 788  VAL A CB  1 
ATOM 6045 C CG1 . VAL A 1 791  ? -3.021  40.232 49.407  1.00 39.96  ? 788  VAL A CG1 1 
ATOM 6046 C CG2 . VAL A 1 791  ? -1.248  40.946 51.001  1.00 39.96  ? 788  VAL A CG2 1 
ATOM 6047 N N   . HIS A 1 792  ? -1.250  38.309 47.045  1.00 33.31  ? 789  HIS A N   1 
ATOM 6048 C CA  . HIS A 1 792  ? -1.410  37.961 45.617  1.00 33.31  ? 789  HIS A CA  1 
ATOM 6049 C C   . HIS A 1 792  ? -2.841  37.701 45.277  1.00 33.31  ? 789  HIS A C   1 
ATOM 6050 O O   . HIS A 1 792  ? -3.609  37.206 46.104  1.00 33.31  ? 789  HIS A O   1 
ATOM 6051 C CB  . HIS A 1 792  ? -0.588  36.707 45.285  1.00 31.47  ? 789  HIS A CB  1 
ATOM 6052 C CG  . HIS A 1 792  ? 0.884   36.971 45.192  1.00 31.47  ? 789  HIS A CG  1 
ATOM 6053 N ND1 . HIS A 1 792  ? 1.616   36.708 44.053  1.00 31.47  ? 789  HIS A ND1 1 
ATOM 6054 C CD2 . HIS A 1 792  ? 1.744   37.549 46.069  1.00 31.47  ? 789  HIS A CD2 1 
ATOM 6055 C CE1 . HIS A 1 792  ? 2.868   37.095 44.243  1.00 31.47  ? 789  HIS A CE1 1 
ATOM 6056 N NE2 . HIS A 1 792  ? 2.970   37.618 45.451  1.00 31.47  ? 789  HIS A NE2 1 
ATOM 6057 N N   . ASN A 1 793  ? -3.205  38.011 44.045  1.00 40.24  ? 790  ASN A N   1 
ATOM 6058 C CA  . ASN A 1 793  ? -4.581  37.902 43.616  1.00 40.24  ? 790  ASN A CA  1 
ATOM 6059 C C   . ASN A 1 793  ? -4.607  37.423 42.199  1.00 40.24  ? 790  ASN A C   1 
ATOM 6060 O O   . ASN A 1 793  ? -3.597  37.519 41.505  1.00 40.24  ? 790  ASN A O   1 
ATOM 6061 C CB  . ASN A 1 793  ? -5.248  39.273 43.630  1.00 57.15  ? 790  ASN A CB  1 
ATOM 6062 C CG  . ASN A 1 793  ? -5.443  39.822 45.013  1.00 57.15  ? 790  ASN A CG  1 
ATOM 6063 O OD1 . ASN A 1 793  ? -6.519  39.690 45.584  1.00 57.15  ? 790  ASN A OD1 1 
ATOM 6064 N ND2 . ASN A 1 793  ? -4.416  40.470 45.550  1.00 57.15  ? 790  ASN A ND2 1 
ATOM 6065 N N   . LEU A 1 794  ? -5.769  36.931 41.766  1.00 33.37  ? 791  LEU A N   1 
ATOM 6066 C CA  . LEU A 1 794  ? -6.032  36.678 40.365  1.00 33.37  ? 791  LEU A CA  1 
ATOM 6067 C C   . LEU A 1 794  ? -7.068  37.665 39.819  1.00 33.37  ? 791  LEU A C   1 
ATOM 6068 O O   . LEU A 1 794  ? -8.216  37.586 40.188  1.00 33.37  ? 791  LEU A O   1 
ATOM 6069 C CB  . LEU A 1 794  ? -6.513  35.243 40.171  1.00 24.72  ? 791  LEU A CB  1 
ATOM 6070 C CG  . LEU A 1 794  ? -7.252  34.913 38.855  1.00 24.72  ? 791  LEU A CG  1 
ATOM 6071 C CD1 . LEU A 1 794  ? -6.354  35.051 37.621  1.00 24.72  ? 791  LEU A CD1 1 
ATOM 6072 C CD2 . LEU A 1 794  ? -7.892  33.508 38.916  1.00 24.72  ? 791  LEU A CD2 1 
ATOM 6073 N N   . LEU A 1 795  ? -6.650  38.564 38.924  1.00 28.78  ? 792  LEU A N   1 
ATOM 6074 C CA  . LEU A 1 795  ? -7.531  39.565 38.302  1.00 28.78  ? 792  LEU A CA  1 
ATOM 6075 C C   . LEU A 1 795  ? -8.189  39.072 37.047  1.00 28.78  ? 792  LEU A C   1 
ATOM 6076 O O   . LEU A 1 795  ? -7.555  38.386 36.259  1.00 28.78  ? 792  LEU A O   1 
ATOM 6077 C CB  . LEU A 1 795  ? -6.736  40.802 37.951  1.00 14.99  ? 792  LEU A CB  1 
ATOM 6078 C CG  . LEU A 1 795  ? -5.900  41.360 39.110  1.00 14.99  ? 792  LEU A CG  1 
ATOM 6079 C CD1 . LEU A 1 795  ? -5.342  42.740 38.818  1.00 14.99  ? 792  LEU A CD1 1 
ATOM 6080 C CD2 . LEU A 1 795  ? -6.762  41.421 40.328  1.00 14.99  ? 792  LEU A CD2 1 
ATOM 6081 N N   . ILE A 1 796  ? -9.470  39.405 36.877  1.00 29.12  ? 793  ILE A N   1 
ATOM 6082 C CA  . ILE A 1 796  ? -10.236 39.034 35.678  1.00 29.12  ? 793  ILE A CA  1 
ATOM 6083 C C   . ILE A 1 796  ? -10.621 40.332 35.000  1.00 29.12  ? 793  ILE A C   1 
ATOM 6084 O O   . ILE A 1 796  ? -11.325 41.171 35.575  1.00 29.12  ? 793  ILE A O   1 
ATOM 6085 C CB  . ILE A 1 796  ? -11.503 38.145 35.969  1.00 22.15  ? 793  ILE A CB  1 
ATOM 6086 C CG1 . ILE A 1 796  ? -11.119 36.778 36.548  1.00 22.15  ? 793  ILE A CG1 1 
ATOM 6087 C CG2 . ILE A 1 796  ? -12.313 37.875 34.705  1.00 22.15  ? 793  ILE A CG2 1 
ATOM 6088 C CD1 . ILE A 1 796  ? -9.934  36.050 35.806  1.00 22.15  ? 793  ILE A CD1 1 
ATOM 6089 N N   . ILE A 1 797  ? -10.146 40.489 33.773  1.00 31.45  ? 794  ILE A N   1 
ATOM 6090 C CA  . ILE A 1 797  ? -10.151 41.772 33.122  1.00 31.45  ? 794  ILE A CA  1 
ATOM 6091 C C   . ILE A 1 797  ? -10.845 41.725 31.756  1.00 31.45  ? 794  ILE A C   1 
ATOM 6092 O O   . ILE A 1 797  ? -10.523 40.886 30.902  1.00 31.45  ? 794  ILE A O   1 
ATOM 6093 C CB  . ILE A 1 797  ? -8.717  42.283 33.018  1.00 21.31  ? 794  ILE A CB  1 
ATOM 6094 C CG1 . ILE A 1 797  ? -8.117  42.356 34.433  1.00 21.31  ? 794  ILE A CG1 1 
ATOM 6095 C CG2 . ILE A 1 797  ? -8.677  43.632 32.267  1.00 21.31  ? 794  ILE A CG2 1 
ATOM 6096 C CD1 . ILE A 1 797  ? -6.878  43.267 34.594  1.00 21.31  ? 794  ILE A CD1 1 
ATOM 6097 N N   . ASP A 1 798  ? -11.818 42.615 31.562  1.00 42.42  ? 795  ASP A N   1 
ATOM 6098 C CA  . ASP A 1 798  ? -12.628 42.610 30.334  1.00 42.42  ? 795  ASP A CA  1 
ATOM 6099 C C   . ASP A 1 798  ? -11.755 42.943 29.119  1.00 42.42  ? 795  ASP A C   1 
ATOM 6100 O O   . ASP A 1 798  ? -11.007 43.934 29.130  1.00 42.42  ? 795  ASP A O   1 
ATOM 6101 C CB  . ASP A 1 798  ? -13.794 43.607 30.476  1.00 46.91  ? 795  ASP A CB  1 
ATOM 6102 C CG  . ASP A 1 798  ? -14.789 43.526 29.328  1.00 46.91  ? 795  ASP A CG  1 
ATOM 6103 O OD1 . ASP A 1 798  ? -14.529 44.158 28.285  1.00 46.91  ? 795  ASP A OD1 1 
ATOM 6104 O OD2 . ASP A 1 798  ? -15.838 42.847 29.495  1.00 46.91  ? 795  ASP A OD2 1 
ATOM 6105 N N   . GLN A 1 799  ? -11.820 42.129 28.077  1.00 38.21  ? 796  GLN A N   1 
ATOM 6106 C CA  . GLN A 1 799  ? -10.932 42.401 26.936  1.00 38.21  ? 796  GLN A CA  1 
ATOM 6107 C C   . GLN A 1 799  ? -11.292 43.710 26.215  1.00 38.21  ? 796  GLN A C   1 
ATOM 6108 O O   . GLN A 1 799  ? -10.455 44.272 25.497  1.00 38.21  ? 796  GLN A O   1 
ATOM 6109 C CB  . GLN A 1 799  ? -10.825 41.211 25.960  1.00 41.72  ? 796  GLN A CB  1 
ATOM 6110 C CG  . GLN A 1 799  ? -12.156 40.653 25.481  1.00 41.72  ? 796  GLN A CG  1 
ATOM 6111 C CD  . GLN A 1 799  ? -12.046 39.968 24.145  1.00 41.72  ? 796  GLN A CD  1 
ATOM 6112 O OE1 . GLN A 1 799  ? -11.957 40.625 23.125  1.00 41.72  ? 796  GLN A OE1 1 
ATOM 6113 N NE2 . GLN A 1 799  ? -12.065 38.654 24.137  1.00 41.72  ? 796  GLN A NE2 1 
ATOM 6114 N N   . HIS A 1 800  ? -12.529 44.195 26.416  1.00 34.68  ? 797  HIS A N   1 
ATOM 6115 C CA  . HIS A 1 800  ? -13.033 45.430 25.757  1.00 34.68  ? 797  HIS A CA  1 
ATOM 6116 C C   . HIS A 1 800  ? -12.852 46.678 26.638  1.00 34.68  ? 797  HIS A C   1 
ATOM 6117 O O   . HIS A 1 800  ? -12.129 47.569 26.286  1.00 34.68  ? 797  HIS A O   1 
ATOM 6118 C CB  . HIS A 1 800  ? -14.494 45.282 25.306  1.00 50.20  ? 797  HIS A CB  1 
ATOM 6119 C CG  . HIS A 1 800  ? -14.703 44.246 24.244  1.00 50.20  ? 797  HIS A CG  1 
ATOM 6120 N ND1 . HIS A 1 800  ? -14.142 44.342 22.984  1.00 50.20  ? 797  HIS A ND1 1 
ATOM 6121 C CD2 . HIS A 1 800  ? -15.421 43.093 24.251  1.00 50.20  ? 797  HIS A CD2 1 
ATOM 6122 C CE1 . HIS A 1 800  ? -14.499 43.288 22.265  1.00 50.20  ? 797  HIS A CE1 1 
ATOM 6123 N NE2 . HIS A 1 800  ? -15.275 42.517 23.011  1.00 50.20  ? 797  HIS A NE2 1 
ATOM 6124 N N   . THR A 1 801  ? -13.484 46.734 27.792  1.00 40.69  ? 798  THR A N   1 
ATOM 6125 C CA  . THR A 1 801  ? -13.400 47.935 28.613  1.00 40.69  ? 798  THR A CA  1 
ATOM 6126 C C   . THR A 1 801  ? -12.167 47.960 29.520  1.00 40.69  ? 798  THR A C   1 
ATOM 6127 O O   . THR A 1 801  ? -11.922 48.939 30.205  1.00 40.69  ? 798  THR A O   1 
ATOM 6128 C CB  . THR A 1 801  ? -14.712 48.140 29.469  1.00 32.31  ? 798  THR A CB  1 
ATOM 6129 O OG1 . THR A 1 801  ? -14.917 47.027 30.361  1.00 32.31  ? 798  THR A OG1 1 
ATOM 6130 C CG2 . THR A 1 801  ? -15.931 48.301 28.545  1.00 32.31  ? 798  THR A CG2 1 
ATOM 6131 N N   . PHE A 1 802  ? -11.410 46.867 29.527  1.00 39.80  ? 799  PHE A N   1 
ATOM 6132 C CA  . PHE A 1 802  ? -10.278 46.656 30.456  1.00 39.80  ? 799  PHE A CA  1 
ATOM 6133 C C   . PHE A 1 802  ? -10.561 46.973 31.938  1.00 39.80  ? 799  PHE A C   1 
ATOM 6134 O O   . PHE A 1 802  ? -9.713  47.466 32.671  1.00 39.80  ? 799  PHE A O   1 
ATOM 6135 C CB  . PHE A 1 802  ? -9.002  47.307 29.921  1.00 37.01  ? 799  PHE A CB  1 
ATOM 6136 C CG  . PHE A 1 802  ? -8.360  46.523 28.813  1.00 37.01  ? 799  PHE A CG  1 
ATOM 6137 C CD1 . PHE A 1 802  ? -8.616  46.837 27.472  1.00 37.01  ? 799  PHE A CD1 1 
ATOM 6138 C CD2 . PHE A 1 802  ? -7.539  45.440 29.097  1.00 37.01  ? 799  PHE A CD2 1 
ATOM 6139 C CE1 . PHE A 1 802  ? -8.038  46.106 26.435  1.00 37.01  ? 799  PHE A CE1 1 
ATOM 6140 C CE2 . PHE A 1 802  ? -6.959  44.690 28.065  1.00 37.01  ? 799  PHE A CE2 1 
ATOM 6141 C CZ  . PHE A 1 802  ? -7.216  45.022 26.733  1.00 37.01  ? 799  PHE A CZ  1 
ATOM 6142 N N   . GLU A 1 803  ? -11.777 46.690 32.381  1.00 47.54  ? 800  GLU A N   1 
ATOM 6143 C CA  . GLU A 1 803  ? -12.090 46.972 33.767  1.00 47.54  ? 800  GLU A CA  1 
ATOM 6144 C C   . GLU A 1 803  ? -11.833 45.718 34.563  1.00 47.54  ? 800  GLU A C   1 
ATOM 6145 O O   . GLU A 1 803  ? -11.819 44.599 34.022  1.00 47.54  ? 800  GLU A O   1 
ATOM 6146 C CB  . GLU A 1 803  ? -13.502 47.546 33.958  1.00 85.12  ? 800  GLU A CB  1 
ATOM 6147 C CG  . GLU A 1 803  ? -14.629 46.804 33.246  1.00 85.12  ? 800  GLU A CG  1 
ATOM 6148 C CD  . GLU A 1 803  ? -16.000 47.444 33.462  1.00 85.12  ? 800  GLU A CD  1 
ATOM 6149 O OE1 . GLU A 1 803  ? -17.016 46.755 33.203  1.00 85.12  ? 800  GLU A OE1 1 
ATOM 6150 O OE2 . GLU A 1 803  ? -16.064 48.622 33.892  1.00 85.12  ? 800  GLU A OE2 1 
ATOM 6151 N N   . VAL A 1 804  ? -11.578 45.897 35.843  1.00 34.93  ? 801  VAL A N   1 
ATOM 6152 C CA  . VAL A 1 804  ? -11.232 44.766 36.641  1.00 34.93  ? 801  VAL A CA  1 
ATOM 6153 C C   . VAL A 1 804  ? -12.514 44.107 37.175  1.00 34.93  ? 801  VAL A C   1 
ATOM 6154 O O   . VAL A 1 804  ? -12.977 44.387 38.300  1.00 34.93  ? 801  VAL A O   1 
ATOM 6155 C CB  . VAL A 1 804  ? -10.239 45.162 37.703  1.00 32.04  ? 801  VAL A CB  1 
ATOM 6156 C CG1 . VAL A 1 804  ? -10.002 44.002 38.679  1.00 32.04  ? 801  VAL A CG1 1 
ATOM 6157 C CG2 . VAL A 1 804  ? -8.942  45.618 37.038  1.00 32.04  ? 801  VAL A CG2 1 
ATOM 6158 N N   . LEU A 1 805  ? -13.099 43.256 36.329  1.00 26.37  ? 802  LEU A N   1 
ATOM 6159 C CA  . LEU A 1 805  ? -14.339 42.554 36.673  1.00 26.37  ? 802  LEU A CA  1 
ATOM 6160 C C   . LEU A 1 805  ? -14.324 41.879 38.067  1.00 26.37  ? 802  LEU A C   1 
ATOM 6161 O O   . LEU A 1 805  ? -15.181 42.168 38.902  1.00 26.37  ? 802  LEU A O   1 
ATOM 6162 C CB  . LEU A 1 805  ? -14.705 41.541 35.586  1.00 37.24  ? 802  LEU A CB  1 
ATOM 6163 C CG  . LEU A 1 805  ? -14.846 42.073 34.154  1.00 37.24  ? 802  LEU A CG  1 
ATOM 6164 C CD1 . LEU A 1 805  ? -15.255 40.951 33.208  1.00 37.24  ? 802  LEU A CD1 1 
ATOM 6165 C CD2 . LEU A 1 805  ? -15.817 43.253 34.062  1.00 37.24  ? 802  LEU A CD2 1 
ATOM 6166 N N   . HIS A 1 806  ? -13.360 41.001 38.329  1.00 38.74  ? 803  HIS A N   1 
ATOM 6167 C CA  . HIS A 1 806  ? -13.342 40.277 39.597  1.00 38.74  ? 803  HIS A CA  1 
ATOM 6168 C C   . HIS A 1 806  ? -11.914 40.108 40.065  1.00 38.74  ? 803  HIS A C   1 
ATOM 6169 O O   . HIS A 1 806  ? -11.003 40.032 39.238  1.00 38.74  ? 803  HIS A O   1 
ATOM 6170 C CB  . HIS A 1 806  ? -14.007 38.901 39.449  1.00 46.15  ? 803  HIS A CB  1 
ATOM 6171 C CG  . HIS A 1 806  ? -14.080 38.121 40.730  1.00 46.15  ? 803  HIS A CG  1 
ATOM 6172 N ND1 . HIS A 1 806  ? -15.125 38.249 41.624  1.00 46.15  ? 803  HIS A ND1 1 
ATOM 6173 C CD2 . HIS A 1 806  ? -13.232 37.215 41.277  1.00 46.15  ? 803  HIS A CD2 1 
ATOM 6174 C CE1 . HIS A 1 806  ? -14.918 37.451 42.659  1.00 46.15  ? 803  HIS A CE1 1 
ATOM 6175 N NE2 . HIS A 1 806  ? -13.778 36.810 42.471  1.00 46.15  ? 803  HIS A NE2 1 
ATOM 6176 N N   . ALA A 1 807  ? -11.713 40.039 41.376  1.00 29.65  ? 804  ALA A N   1 
ATOM 6177 C CA  . ALA A 1 807  ? -10.396 39.724 41.938  1.00 29.65  ? 804  ALA A CA  1 
ATOM 6178 C C   . ALA A 1 807  ? -10.488 38.652 43.051  1.00 29.65  ? 804  ALA A C   1 
ATOM 6179 O O   . ALA A 1 807  ? -11.263 38.786 44.004  1.00 29.65  ? 804  ALA A O   1 
ATOM 6180 C CB  . ALA A 1 807  ? -9.706  41.001 42.446  1.00 2.00   ? 804  ALA A CB  1 
ATOM 6181 N N   . HIS A 1 808  ? -9.721  37.578 42.911  1.00 38.14  ? 805  HIS A N   1 
ATOM 6182 C CA  . HIS A 1 808  ? -9.696  36.535 43.905  1.00 38.14  ? 805  HIS A CA  1 
ATOM 6183 C C   . HIS A 1 808  ? -8.377  36.631 44.614  1.00 38.14  ? 805  HIS A C   1 
ATOM 6184 O O   . HIS A 1 808  ? -7.340  36.620 43.968  1.00 38.14  ? 805  HIS A O   1 
ATOM 6185 C CB  . HIS A 1 808  ? -9.814  35.170 43.257  1.00 43.57  ? 805  HIS A CB  1 
ATOM 6186 C CG  . HIS A 1 808  ? -9.619  34.037 44.217  1.00 43.57  ? 805  HIS A CG  1 
ATOM 6187 N ND1 . HIS A 1 808  ? -10.641 33.545 44.996  1.00 43.57  ? 805  HIS A ND1 1 
ATOM 6188 C CD2 . HIS A 1 808  ? -8.514  33.322 44.545  1.00 43.57  ? 805  HIS A CD2 1 
ATOM 6189 C CE1 . HIS A 1 808  ? -10.176 32.565 45.751  1.00 43.57  ? 805  HIS A CE1 1 
ATOM 6190 N NE2 . HIS A 1 808  ? -8.893  32.403 45.488  1.00 43.57  ? 805  HIS A NE2 1 
ATOM 6191 N N   . GLN A 1 809  ? -8.403  36.719 45.934  1.00 41.59  ? 806  GLN A N   1 
ATOM 6192 C CA  . GLN A 1 809  ? -7.177  36.802 46.698  1.00 41.59  ? 806  GLN A CA  1 
ATOM 6193 C C   . GLN A 1 809  ? -6.782  35.427 47.204  1.00 41.59  ? 806  GLN A C   1 
ATOM 6194 O O   . GLN A 1 809  ? -7.625  34.694 47.722  1.00 41.59  ? 806  GLN A O   1 
ATOM 6195 C CB  . GLN A 1 809  ? -7.354  37.745 47.867  1.00 34.35  ? 806  GLN A CB  1 
ATOM 6196 C CG  . GLN A 1 809  ? -6.124  37.959 48.640  1.00 34.35  ? 806  GLN A CG  1 
ATOM 6197 C CD  . GLN A 1 809  ? -6.333  38.993 49.717  1.00 34.35  ? 806  GLN A CD  1 
ATOM 6198 O OE1 . GLN A 1 809  ? -6.581  40.182 49.442  1.00 34.35  ? 806  GLN A OE1 1 
ATOM 6199 N NE2 . GLN A 1 809  ? -6.218  38.554 50.969  1.00 34.35  ? 806  GLN A NE2 1 
ATOM 6200 N N   . PHE A 1 810  ? -5.503  35.080 47.045  1.00 25.85  ? 807  PHE A N   1 
ATOM 6201 C CA  . PHE A 1 810  ? -4.996  33.791 47.516  1.00 25.85  ? 807  PHE A CA  1 
ATOM 6202 C C   . PHE A 1 810  ? -4.734  33.881 49.026  1.00 25.85  ? 807  PHE A C   1 
ATOM 6203 O O   . PHE A 1 810  ? -4.935  34.947 49.642  1.00 25.85  ? 807  PHE A O   1 
ATOM 6204 C CB  . PHE A 1 810  ? -3.766  33.368 46.702  1.00 25.39  ? 807  PHE A CB  1 
ATOM 6205 C CG  . PHE A 1 810  ? -4.079  33.142 45.261  1.00 25.39  ? 807  PHE A CG  1 
ATOM 6206 C CD1 . PHE A 1 810  ? -4.046  34.186 44.367  1.00 25.39  ? 807  PHE A CD1 1 
ATOM 6207 C CD2 . PHE A 1 810  ? -4.473  31.890 44.815  1.00 25.39  ? 807  PHE A CD2 1 
ATOM 6208 C CE1 . PHE A 1 810  ? -4.381  34.002 43.044  1.00 25.39  ? 807  PHE A CE1 1 
ATOM 6209 C CE2 . PHE A 1 810  ? -4.827  31.693 43.508  1.00 25.39  ? 807  PHE A CE2 1 
ATOM 6210 C CZ  . PHE A 1 810  ? -4.781  32.772 42.603  1.00 25.39  ? 807  PHE A CZ  1 
ATOM 6211 N N   . LEU A 1 811  ? -4.323  32.768 49.626  1.00 35.98  ? 808  LEU A N   1 
ATOM 6212 C CA  . LEU A 1 811  ? -4.236  32.694 51.078  1.00 35.98  ? 808  LEU A CA  1 
ATOM 6213 C C   . LEU A 1 811  ? -3.123  33.598 51.572  1.00 35.98  ? 808  LEU A C   1 
ATOM 6214 O O   . LEU A 1 811  ? -2.269  34.016 50.775  1.00 35.98  ? 808  LEU A O   1 
ATOM 6215 C CB  . LEU A 1 811  ? -3.976  31.245 51.520  1.00 31.03  ? 808  LEU A CB  1 
ATOM 6216 C CG  . LEU A 1 811  ? -4.959  30.105 51.183  1.00 31.03  ? 808  LEU A CG  1 
ATOM 6217 C CD1 . LEU A 1 811  ? -4.264  28.762 51.132  1.00 31.03  ? 808  LEU A CD1 1 
ATOM 6218 C CD2 . LEU A 1 811  ? -6.045  30.079 52.222  1.00 31.03  ? 808  LEU A CD2 1 
ATOM 6219 N N   . GLN A 1 812  ? -3.130  33.892 52.875  1.00 52.38  ? 809  GLN A N   1 
ATOM 6220 C CA  . GLN A 1 812  ? -1.992  34.539 53.532  1.00 52.38  ? 809  GLN A CA  1 
ATOM 6221 C C   . GLN A 1 812  ? -0.699  33.834 53.177  1.00 52.38  ? 809  GLN A C   1 
ATOM 6222 O O   . GLN A 1 812  ? -0.573  32.633 53.396  1.00 52.38  ? 809  GLN A O   1 
ATOM 6223 C CB  . GLN A 1 812  ? -2.147  34.500 55.035  1.00 65.18  ? 809  GLN A CB  1 
ATOM 6224 C CG  . GLN A 1 812  ? -3.202  35.426 55.551  1.00 65.18  ? 809  GLN A CG  1 
ATOM 6225 C CD  . GLN A 1 812  ? -3.280  35.381 57.053  1.00 65.18  ? 809  GLN A CD  1 
ATOM 6226 O OE1 . GLN A 1 812  ? -2.393  35.895 57.751  1.00 65.18  ? 809  GLN A OE1 1 
ATOM 6227 N NE2 . GLN A 1 812  ? -4.331  34.740 57.570  1.00 65.18  ? 809  GLN A NE2 1 
ATOM 6228 N N   . ASN A 1 813  ? 0.230   34.586 52.596  1.00 48.38  ? 810  ASN A N   1 
ATOM 6229 C CA  . ASN A 1 813  ? 1.580   34.111 52.217  1.00 48.38  ? 810  ASN A CA  1 
ATOM 6230 C C   . ASN A 1 813  ? 1.739   33.291 50.956  1.00 48.38  ? 810  ASN A C   1 
ATOM 6231 O O   . ASN A 1 813  ? 2.849   33.001 50.550  1.00 48.38  ? 810  ASN A O   1 
ATOM 6232 C CB  . ASN A 1 813  ? 2.295   33.490 53.398  1.00 40.53  ? 810  ASN A CB  1 
ATOM 6233 C CG  . ASN A 1 813  ? 2.316   34.435 54.574  1.00 40.53  ? 810  ASN A CG  1 
ATOM 6234 O OD1 . ASN A 1 813  ? 3.123   35.378 54.625  1.00 40.53  ? 810  ASN A OD1 1 
ATOM 6235 N ND2 . ASN A 1 813  ? 1.367   34.249 55.486  1.00 40.53  ? 810  ASN A ND2 1 
ATOM 6236 N N   . GLU A 1 814  ? 0.626   32.974 50.310  1.00 39.54  ? 811  GLU A N   1 
ATOM 6237 C CA  . GLU A 1 814  ? 0.647   32.314 49.022  1.00 39.54  ? 811  GLU A CA  1 
ATOM 6238 C C   . GLU A 1 814  ? 0.986   33.286 47.879  1.00 39.54  ? 811  GLU A C   1 
ATOM 6239 O O   . GLU A 1 814  ? 0.303   34.299 47.675  1.00 39.54  ? 811  GLU A O   1 
ATOM 6240 C CB  . GLU A 1 814  ? -0.720  31.725 48.772  1.00 44.64  ? 811  GLU A CB  1 
ATOM 6241 C CG  . GLU A 1 814  ? -0.716  30.622 47.766  1.00 44.64  ? 811  GLU A CG  1 
ATOM 6242 C CD  . GLU A 1 814  ? -2.002  29.857 47.807  1.00 44.64  ? 811  GLU A CD  1 
ATOM 6243 O OE1 . GLU A 1 814  ? -3.052  30.502 48.014  1.00 44.64  ? 811  GLU A OE1 1 
ATOM 6244 O OE2 . GLU A 1 814  ? -1.963  28.625 47.659  1.00 44.64  ? 811  GLU A OE2 1 
ATOM 6245 N N   . TYR A 1 815  ? 2.057   32.980 47.156  1.00 39.67  ? 812  TYR A N   1 
ATOM 6246 C CA  . TYR A 1 815  ? 2.420   33.718 45.965  1.00 39.67  ? 812  TYR A CA  1 
ATOM 6247 C C   . TYR A 1 815  ? 1.931   32.865 44.822  1.00 39.67  ? 812  TYR A C   1 
ATOM 6248 O O   . TYR A 1 815  ? 2.233   31.676 44.776  1.00 39.67  ? 812  TYR A O   1 
ATOM 6249 C CB  . TYR A 1 815  ? 3.940   33.843 45.840  1.00 39.91  ? 812  TYR A CB  1 
ATOM 6250 C CG  . TYR A 1 815  ? 4.571   34.811 46.787  1.00 39.91  ? 812  TYR A CG  1 
ATOM 6251 C CD1 . TYR A 1 815  ? 5.803   35.401 46.507  1.00 39.91  ? 812  TYR A CD1 1 
ATOM 6252 C CD2 . TYR A 1 815  ? 3.932   35.145 47.976  1.00 39.91  ? 812  TYR A CD2 1 
ATOM 6253 C CE1 . TYR A 1 815  ? 6.390   36.297 47.409  1.00 39.91  ? 812  TYR A CE1 1 
ATOM 6254 C CE2 . TYR A 1 815  ? 4.483   36.032 48.872  1.00 39.91  ? 812  TYR A CE2 1 
ATOM 6255 C CZ  . TYR A 1 815  ? 5.711   36.607 48.602  1.00 39.91  ? 812  TYR A CZ  1 
ATOM 6256 O OH  . TYR A 1 815  ? 6.203   37.485 49.552  1.00 39.91  ? 812  TYR A OH  1 
ATOM 6257 N N   . ALA A 1 816  ? 1.186   33.458 43.901  1.00 34.17  ? 813  ALA A N   1 
ATOM 6258 C CA  . ALA A 1 816  ? 0.883   32.798 42.649  1.00 34.17  ? 813  ALA A CA  1 
ATOM 6259 C C   . ALA A 1 816  ? 2.101   32.946 41.711  1.00 34.17  ? 813  ALA A C   1 
ATOM 6260 O O   . ALA A 1 816  ? 2.604   34.042 41.528  1.00 34.17  ? 813  ALA A O   1 
ATOM 6261 C CB  . ALA A 1 816  ? -0.344  33.446 42.028  1.00 12.50  ? 813  ALA A CB  1 
ATOM 6262 N N   . LEU A 1 817  ? 2.591   31.861 41.133  1.00 32.18  ? 814  LEU A N   1 
ATOM 6263 C CA  . LEU A 1 817  ? 3.719   31.979 40.231  1.00 32.18  ? 814  LEU A CA  1 
ATOM 6264 C C   . LEU A 1 817  ? 3.385   31.715 38.780  1.00 32.18  ? 814  LEU A C   1 
ATOM 6265 O O   . LEU A 1 817  ? 4.017   32.291 37.894  1.00 32.18  ? 814  LEU A O   1 
ATOM 6266 C CB  . LEU A 1 817  ? 4.857   31.048 40.629  1.00 17.13  ? 814  LEU A CB  1 
ATOM 6267 C CG  . LEU A 1 817  ? 5.161   31.076 42.109  1.00 17.13  ? 814  LEU A CG  1 
ATOM 6268 C CD1 . LEU A 1 817  ? 6.262   30.065 42.465  1.00 17.13  ? 814  LEU A CD1 1 
ATOM 6269 C CD2 . LEU A 1 817  ? 5.496   32.517 42.517  1.00 17.13  ? 814  LEU A CD2 1 
ATOM 6270 N N   . SER A 1 818  ? 2.438   30.825 38.514  1.00 25.29  ? 815  SER A N   1 
ATOM 6271 C CA  . SER A 1 818  ? 2.175   30.467 37.136  1.00 25.29  ? 815  SER A CA  1 
ATOM 6272 C C   . SER A 1 818  ? 0.690   30.495 36.910  1.00 25.29  ? 815  SER A C   1 
ATOM 6273 O O   . SER A 1 818  ? -0.055  30.405 37.865  1.00 25.29  ? 815  SER A O   1 
ATOM 6274 C CB  . SER A 1 818  ? 2.793   29.095 36.796  1.00 22.05  ? 815  SER A CB  1 
ATOM 6275 O OG  . SER A 1 818  ? 2.294   28.086 37.634  1.00 22.05  ? 815  SER A OG  1 
ATOM 6276 N N   . LEU A 1 819  ? 0.283   30.628 35.656  1.00 20.79  ? 816  LEU A N   1 
ATOM 6277 C CA  . LEU A 1 819  ? -1.111  30.761 35.264  1.00 20.79  ? 816  LEU A CA  1 
ATOM 6278 C C   . LEU A 1 819  ? -1.320  30.181 33.874  1.00 20.79  ? 816  LEU A C   1 
ATOM 6279 O O   . LEU A 1 819  ? -0.451  30.311 33.002  1.00 20.79  ? 816  LEU A O   1 
ATOM 6280 C CB  . LEU A 1 819  ? -1.491  32.242 35.182  1.00 31.78  ? 816  LEU A CB  1 
ATOM 6281 C CG  . LEU A 1 819  ? -2.810  32.543 34.462  1.00 31.78  ? 816  LEU A CG  1 
ATOM 6282 C CD1 . LEU A 1 819  ? -3.983  32.225 35.358  1.00 31.78  ? 816  LEU A CD1 1 
ATOM 6283 C CD2 . LEU A 1 819  ? -2.854  33.979 33.991  1.00 31.78  ? 816  LEU A CD2 1 
ATOM 6284 N N   . VAL A 1 820  ? -2.477  29.553 33.657  1.00 32.31  ? 817  VAL A N   1 
ATOM 6285 C CA  . VAL A 1 820  ? -2.798  29.002 32.336  1.00 32.31  ? 817  VAL A CA  1 
ATOM 6286 C C   . VAL A 1 820  ? -4.296  29.043 32.075  1.00 32.31  ? 817  VAL A C   1 
ATOM 6287 O O   . VAL A 1 820  ? -5.104  28.995 33.010  1.00 32.31  ? 817  VAL A O   1 
ATOM 6288 C CB  . VAL A 1 820  ? -2.205  27.566 32.142  1.00 27.29  ? 817  VAL A CB  1 
ATOM 6289 C CG1 . VAL A 1 820  ? -3.115  26.489 32.715  1.00 27.29  ? 817  VAL A CG1 1 
ATOM 6290 C CG2 . VAL A 1 820  ? -2.017  27.287 30.722  1.00 27.29  ? 817  VAL A CG2 1 
ATOM 6291 N N   . SER A 1 821  ? -4.659  29.159 30.803  1.00 38.16  ? 818  SER A N   1 
ATOM 6292 C CA  . SER A 1 821  ? -6.068  29.093 30.399  1.00 38.16  ? 818  SER A CA  1 
ATOM 6293 C C   . SER A 1 821  ? -6.204  27.981 29.388  1.00 38.16  ? 818  SER A C   1 
ATOM 6294 O O   . SER A 1 821  ? -5.589  28.022 28.321  1.00 38.16  ? 818  SER A O   1 
ATOM 6295 C CB  . SER A 1 821  ? -6.580  30.441 29.857  1.00 38.62  ? 818  SER A CB  1 
ATOM 6296 O OG  . SER A 1 821  ? -7.765  30.301 29.075  1.00 38.62  ? 818  SER A OG  1 
ATOM 6297 N N   . CYS A 1 822  ? -6.990  26.969 29.746  1.00 42.96  ? 819  CYS A N   1 
ATOM 6298 C CA  . CYS A 1 822  ? -7.173  25.804 28.878  1.00 42.96  ? 819  CYS A CA  1 
ATOM 6299 C C   . CYS A 1 822  ? -8.392  24.972 29.255  1.00 42.96  ? 819  CYS A C   1 
ATOM 6300 O O   . CYS A 1 822  ? -8.917  25.077 30.380  1.00 42.96  ? 819  CYS A O   1 
ATOM 6301 C CB  . CYS A 1 822  ? -5.931  24.903 28.916  1.00 42.72  ? 819  CYS A CB  1 
ATOM 6302 S SG  . CYS A 1 822  ? -5.602  24.224 30.578  1.00 42.72  ? 819  CYS A SG  1 
ATOM 6303 N N   . LYS A 1 823  ? -8.824  24.159 28.285  1.00 35.18  ? 820  LYS A N   1 
ATOM 6304 C CA  . LYS A 1 823  ? -9.626  22.945 28.527  1.00 35.18  ? 820  LYS A CA  1 
ATOM 6305 C C   . LYS A 1 823  ? -8.750  21.762 29.015  1.00 35.18  ? 820  LYS A C   1 
ATOM 6306 O O   . LYS A 1 823  ? -7.571  21.669 28.688  1.00 35.18  ? 820  LYS A O   1 
ATOM 6307 C CB  . LYS A 1 823  ? -10.426 22.569 27.277  1.00 58.08  ? 820  LYS A CB  1 
ATOM 6308 C CG  . LYS A 1 823  ? -11.543 23.573 26.956  1.00 58.08  ? 820  LYS A CG  1 
ATOM 6309 C CD  . LYS A 1 823  ? -12.378 23.173 25.740  1.00 58.08  ? 820  LYS A CD  1 
ATOM 6310 C CE  . LYS A 1 823  ? -11.571 23.276 24.451  1.00 58.08  ? 820  LYS A CE  1 
ATOM 6311 N NZ  . LYS A 1 823  ? -12.377 22.922 23.253  1.00 58.08  ? 820  LYS A NZ  1 
ATOM 6312 N N   . LEU A 1 824  ? -9.331  20.875 29.812  1.00 62.08  ? 821  LEU A N   1 
ATOM 6313 C CA  . LEU A 1 824  ? -8.608  19.720 30.337  1.00 62.08  ? 821  LEU A CA  1 
ATOM 6314 C C   . LEU A 1 824  ? -9.342  18.391 30.132  1.00 62.08  ? 821  LEU A C   1 
ATOM 6315 O O   . LEU A 1 824  ? -10.526 18.273 30.471  1.00 62.08  ? 821  LEU A O   1 
ATOM 6316 C CB  . LEU A 1 824  ? -8.353  19.907 31.827  1.00 41.43  ? 821  LEU A CB  1 
ATOM 6317 C CG  . LEU A 1 824  ? -7.133  20.676 32.294  1.00 41.43  ? 821  LEU A CG  1 
ATOM 6318 C CD1 . LEU A 1 824  ? -7.136  20.710 33.833  1.00 41.43  ? 821  LEU A CD1 1 
ATOM 6319 C CD2 . LEU A 1 824  ? -5.851  20.069 31.741  1.00 41.43  ? 821  LEU A CD2 1 
ATOM 6320 N N   . GLY A 1 825  ? -8.624  17.395 29.607  1.00 68.08  ? 822  GLY A N   1 
ATOM 6321 C CA  . GLY A 1 825  ? -9.148  16.040 29.461  1.00 68.08  ? 822  GLY A CA  1 
ATOM 6322 C C   . GLY A 1 825  ? -10.374 16.042 28.581  1.00 68.08  ? 822  GLY A C   1 
ATOM 6323 O O   . GLY A 1 825  ? -10.331 16.546 27.462  1.00 68.08  ? 822  GLY A O   1 
ATOM 6324 N N   . LYS A 1 826  ? -11.477 15.516 29.103  1.00 42.95  ? 823  LYS A N   1 
ATOM 6325 C CA  . LYS A 1 826  ? -12.722 15.413 28.336  1.00 42.95  ? 823  LYS A CA  1 
ATOM 6326 C C   . LYS A 1 826  ? -13.666 16.612 28.515  1.00 42.95  ? 823  LYS A C   1 
ATOM 6327 O O   . LYS A 1 826  ? -14.557 16.819 27.694  1.00 42.95  ? 823  LYS A O   1 
ATOM 6328 C CB  . LYS A 1 826  ? -13.448 14.103 28.672  1.00 69.71  ? 823  LYS A CB  1 
ATOM 6329 C CG  . LYS A 1 826  ? -12.680 12.824 28.276  1.00 69.71  ? 823  LYS A CG  1 
ATOM 6330 C CD  . LYS A 1 826  ? -12.906 11.689 29.311  1.00 69.71  ? 823  LYS A CD  1 
ATOM 6331 C CE  . LYS A 1 826  ? -12.040 10.443 29.025  1.00 69.71  ? 823  LYS A CE  1 
ATOM 6332 N NZ  . LYS A 1 826  ? -10.572 10.650 29.265  1.00 69.71  ? 823  LYS A NZ  1 
ATOM 6333 N N   . ASP A 1 827  ? -13.452 17.390 29.574  1.00 42.09  ? 824  ASP A N   1 
ATOM 6334 C CA  . ASP A 1 827  ? -14.311 18.514 29.982  1.00 42.09  ? 824  ASP A CA  1 
ATOM 6335 C C   . ASP A 1 827  ? -14.282 19.635 28.941  1.00 42.09  ? 824  ASP A C   1 
ATOM 6336 O O   . ASP A 1 827  ? -13.206 20.013 28.488  1.00 42.09  ? 824  ASP A O   1 
ATOM 6337 C CB  . ASP A 1 827  ? -13.782 19.038 31.312  1.00 48.70  ? 824  ASP A CB  1 
ATOM 6338 C CG  . ASP A 1 827  ? -14.784 19.881 32.065  1.00 48.70  ? 824  ASP A CG  1 
ATOM 6339 O OD1 . ASP A 1 827  ? -15.646 20.522 31.418  1.00 48.70  ? 824  ASP A OD1 1 
ATOM 6340 O OD2 . ASP A 1 827  ? -14.691 19.918 33.321  1.00 48.70  ? 824  ASP A OD2 1 
ATOM 6341 N N   . PRO A 1 828  ? -15.453 20.133 28.503  1.00 63.40  ? 825  PRO A N   1 
ATOM 6342 C CA  . PRO A 1 828  ? -15.524 21.252 27.544  1.00 63.40  ? 825  PRO A CA  1 
ATOM 6343 C C   . PRO A 1 828  ? -15.241 22.627 28.127  1.00 63.40  ? 825  PRO A C   1 
ATOM 6344 O O   . PRO A 1 828  ? -14.936 23.547 27.380  1.00 63.40  ? 825  PRO A O   1 
ATOM 6345 C CB  . PRO A 1 828  ? -16.985 21.209 27.046  1.00 41.89  ? 825  PRO A CB  1 
ATOM 6346 C CG  . PRO A 1 828  ? -17.529 19.926 27.515  1.00 41.89  ? 825  PRO A CG  1 
ATOM 6347 C CD  . PRO A 1 828  ? -16.795 19.619 28.799  1.00 41.89  ? 825  PRO A CD  1 
ATOM 6348 N N   . ASN A 1 829  ? -15.371 22.768 29.442  1.00 56.76  ? 826  ASN A N   1 
ATOM 6349 C CA  . ASN A 1 829  ? -15.067 24.019 30.126  1.00 56.76  ? 826  ASN A CA  1 
ATOM 6350 C C   . ASN A 1 829  ? -13.594 24.411 30.008  1.00 56.76  ? 826  ASN A C   1 
ATOM 6351 O O   . ASN A 1 829  ? -12.706 23.531 29.987  1.00 56.76  ? 826  ASN A O   1 
ATOM 6352 C CB  . ASN A 1 829  ? -15.428 23.911 31.601  1.00 64.84  ? 826  ASN A CB  1 
ATOM 6353 C CG  . ASN A 1 829  ? -16.911 23.763 31.839  1.00 64.84  ? 826  ASN A CG  1 
ATOM 6354 O OD1 . ASN A 1 829  ? -17.672 23.426 30.939  1.00 64.84  ? 826  ASN A OD1 1 
ATOM 6355 N ND2 . ASN A 1 829  ? -17.329 24.016 33.068  1.00 64.84  ? 826  ASN A ND2 1 
ATOM 6356 N N   . THR A 1 830  ? -13.373 25.734 30.061  1.00 58.33  ? 827  THR A N   1 
ATOM 6357 C CA  . THR A 1 830  ? -12.074 26.439 30.049  1.00 58.33  ? 827  THR A CA  1 
ATOM 6358 C C   . THR A 1 830  ? -11.920 26.924 31.511  1.00 58.33  ? 827  THR A C   1 
ATOM 6359 O O   . THR A 1 830  ? -12.740 27.677 32.053  1.00 58.33  ? 827  THR A O   1 
ATOM 6360 C CB  . THR A 1 830  ? -12.016 27.483 28.988  1.00 49.37  ? 827  THR A CB  1 
ATOM 6361 O OG1 . THR A 1 830  ? -12.524 26.908 27.791  1.00 49.37  ? 827  THR A OG1 1 
ATOM 6362 C CG2 . THR A 1 830  ? -10.638 27.832 28.722  1.00 49.37  ? 827  THR A CG2 1 
ATOM 6363 N N   . TYR A 1 831  ? -10.871 26.438 32.161  1.00 57.53  ? 828  TYR A N   1 
ATOM 6364 C CA  . TYR A 1 831  ? -10.554 26.764 33.538  1.00 57.53  ? 828  TYR A CA  1 
ATOM 6365 C C   . TYR A 1 831  ? -9.248  27.554 33.338  1.00 57.53  ? 828  TYR A C   1 
ATOM 6366 O O   . TYR A 1 831  ? -8.461  27.343 32.361  1.00 57.53  ? 828  TYR A O   1 
ATOM 6367 C CB  . TYR A 1 831  ? -10.303 25.532 34.344  1.00 48.96  ? 828  TYR A CB  1 
ATOM 6368 C CG  . TYR A 1 831  ? -11.443 24.591 34.304  1.00 48.96  ? 828  TYR A CG  1 
ATOM 6369 C CD1 . TYR A 1 831  ? -11.384 23.466 33.556  1.00 48.96  ? 828  TYR A CD1 1 
ATOM 6370 C CD2 . TYR A 1 831  ? -12.579 24.829 35.012  1.00 48.96  ? 828  TYR A CD2 1 
ATOM 6371 C CE1 . TYR A 1 831  ? -12.397 22.630 33.510  1.00 48.96  ? 828  TYR A CE1 1 
ATOM 6372 C CE2 . TYR A 1 831  ? -13.602 23.975 34.968  1.00 48.96  ? 828  TYR A CE2 1 
ATOM 6373 C CZ  . TYR A 1 831  ? -13.507 22.879 34.210  1.00 48.96  ? 828  TYR A CZ  1 
ATOM 6374 O OH  . TYR A 1 831  ? -14.522 21.988 34.140  1.00 48.96  ? 828  TYR A OH  1 
ATOM 6375 N N   . PHE A 1 832  ? -9.035  28.464 34.273  1.00 35.88  ? 829  PHE A N   1 
ATOM 6376 C CA  . PHE A 1 832  ? -7.881  29.305 34.350  1.00 35.88  ? 829  PHE A CA  1 
ATOM 6377 C C   . PHE A 1 832  ? -7.256  28.577 35.535  1.00 35.88  ? 829  PHE A C   1 
ATOM 6378 O O   . PHE A 1 832  ? -7.905  28.557 36.561  1.00 35.88  ? 829  PHE A O   1 
ATOM 6379 C CB  . PHE A 1 832  ? -8.243  30.644 34.981  1.00 23.15  ? 829  PHE A CB  1 
ATOM 6380 C CG  . PHE A 1 832  ? -8.468  31.746 34.026  1.00 23.15  ? 829  PHE A CG  1 
ATOM 6381 C CD1 . PHE A 1 832  ? -7.513  32.130 33.167  1.00 23.15  ? 829  PHE A CD1 1 
ATOM 6382 C CD2 . PHE A 1 832  ? -9.639  32.401 34.007  1.00 23.15  ? 829  PHE A CD2 1 
ATOM 6383 C CE1 . PHE A 1 832  ? -7.738  33.117 32.308  1.00 23.15  ? 829  PHE A CE1 1 
ATOM 6384 C CE2 . PHE A 1 832  ? -9.850  33.371 33.140  1.00 23.15  ? 829  PHE A CE2 1 
ATOM 6385 C CZ  . PHE A 1 832  ? -8.904  33.733 32.294  1.00 23.15  ? 829  PHE A CZ  1 
ATOM 6386 N N   . ILE A 1 833  ? -6.052  28.001 35.393  1.00 30.83  ? 830  ILE A N   1 
ATOM 6387 C CA  . ILE A 1 833  ? -5.302  27.328 36.391  1.00 30.83  ? 830  ILE A CA  1 
ATOM 6388 C C   . ILE A 1 833  ? -4.199  28.119 36.919  1.00 30.83  ? 830  ILE A C   1 
ATOM 6389 O O   . ILE A 1 833  ? -3.459  28.732 36.240  1.00 30.83  ? 830  ILE A O   1 
ATOM 6390 C CB  . ILE A 1 833  ? -4.920  25.933 35.945  1.00 26.14  ? 830  ILE A CB  1 
ATOM 6391 C CG1 . ILE A 1 833  ? -6.156  25.182 35.522  1.00 26.14  ? 830  ILE A CG1 1 
ATOM 6392 C CG2 . ILE A 1 833  ? -4.389  25.189 37.066  1.00 26.14  ? 830  ILE A CG2 1 
ATOM 6393 C CD1 . ILE A 1 833  ? -6.119  24.691 34.183  1.00 26.14  ? 830  ILE A CD1 1 
ATOM 6394 N N   . VAL A 1 834  ? -4.102  28.072 38.204  1.00 30.83  ? 831  VAL A N   1 
ATOM 6395 C CA  . VAL A 1 834  ? -3.074  28.881 38.863  1.00 30.83  ? 831  VAL A CA  1 
ATOM 6396 C C   . VAL A 1 834  ? -2.175  28.026 39.763  1.00 30.83  ? 831  VAL A C   1 
ATOM 6397 O O   . VAL A 1 834  ? -2.665  27.275 40.629  1.00 30.83  ? 831  VAL A O   1 
ATOM 6398 C CB  . VAL A 1 834  ? -3.724  29.989 39.736  1.00 33.51  ? 831  VAL A CB  1 
ATOM 6399 C CG1 . VAL A 1 834  ? -2.664  30.934 40.306  1.00 33.51  ? 831  VAL A CG1 1 
ATOM 6400 C CG2 . VAL A 1 834  ? -4.741  30.755 38.923  1.00 33.51  ? 831  VAL A CG2 1 
ATOM 6401 N N   . GLY A 1 835  ? -0.865  28.153 39.574  1.00 34.05  ? 832  GLY A N   1 
ATOM 6402 C CA  . GLY A 1 835  ? 0.091   27.392 40.367  1.00 34.05  ? 832  GLY A CA  1 
ATOM 6403 C C   . GLY A 1 835  ? 0.649   28.315 41.431  1.00 34.05  ? 832  GLY A C   1 
ATOM 6404 O O   . GLY A 1 835  ? 1.074   29.431 41.104  1.00 34.05  ? 832  GLY A O   1 
ATOM 6405 N N   . THR A 1 836  ? 0.634   27.882 42.700  1.00 31.51  ? 833  THR A N   1 
ATOM 6406 C CA  . THR A 1 836  ? 1.061   28.766 43.777  1.00 31.51  ? 833  THR A CA  1 
ATOM 6407 C C   . THR A 1 836  ? 2.241   28.264 44.560  1.00 31.51  ? 833  THR A C   1 
ATOM 6408 O O   . THR A 1 836  ? 2.963   27.391 44.090  1.00 31.51  ? 833  THR A O   1 
ATOM 6409 C CB  . THR A 1 836  ? -0.069  29.167 44.759  1.00 37.81  ? 833  THR A CB  1 
ATOM 6410 O OG1 . THR A 1 836  ? -0.357  28.075 45.618  1.00 37.81  ? 833  THR A OG1 1 
ATOM 6411 C CG2 . THR A 1 836  ? -1.333  29.604 44.043  1.00 37.81  ? 833  THR A CG2 1 
ATOM 6412 N N   . ALA A 1 837  ? 2.433   28.834 45.751  1.00 33.56  ? 834  ALA A N   1 
ATOM 6413 C CA  . ALA A 1 837  ? 3.611   28.579 46.560  1.00 33.56  ? 834  ALA A CA  1 
ATOM 6414 C C   . ALA A 1 837  ? 3.496   29.316 47.865  1.00 33.56  ? 834  ALA A C   1 
ATOM 6415 O O   . ALA A 1 837  ? 3.216   30.537 47.875  1.00 33.56  ? 834  ALA A O   1 
ATOM 6416 C CB  . ALA A 1 837  ? 4.862   29.063 45.843  1.00 10.94  ? 834  ALA A CB  1 
ATOM 6417 N N   . MET A 1 838  ? 3.724   28.599 48.966  1.00 48.26  ? 835  MET A N   1 
ATOM 6418 C CA  . MET A 1 838  ? 3.665   29.210 50.283  1.00 48.26  ? 835  MET A CA  1 
ATOM 6419 C C   . MET A 1 838  ? 5.026   29.774 50.585  1.00 48.26  ? 835  MET A C   1 
ATOM 6420 O O   . MET A 1 838  ? 6.002   29.038 50.706  1.00 48.26  ? 835  MET A O   1 
ATOM 6421 C CB  . MET A 1 838  ? 3.256   28.207 51.340  1.00 36.93  ? 835  MET A CB  1 
ATOM 6422 C CG  . MET A 1 838  ? 1.917   27.573 51.095  1.00 36.93  ? 835  MET A CG  1 
ATOM 6423 S SD  . MET A 1 838  ? 0.566   28.773 50.974  1.00 36.93  ? 835  MET A SD  1 
ATOM 6424 C CE  . MET A 1 838  ? 0.314   29.388 52.631  1.00 36.93  ? 835  MET A CE  1 
ATOM 6425 N N   . VAL A 1 839  ? 5.098   31.091 50.696  1.00 42.94  ? 836  VAL A N   1 
ATOM 6426 C CA  . VAL A 1 839  ? 6.383   31.767 50.751  1.00 42.94  ? 836  VAL A CA  1 
ATOM 6427 C C   . VAL A 1 839  ? 6.665   32.452 52.073  1.00 42.94  ? 836  VAL A C   1 
ATOM 6428 O O   . VAL A 1 839  ? 5.998   33.409 52.446  1.00 42.94  ? 836  VAL A O   1 
ATOM 6429 C CB  . VAL A 1 839  ? 6.554   32.754 49.568  1.00 31.15  ? 836  VAL A CB  1 
ATOM 6430 C CG1 . VAL A 1 839  ? 7.853   33.483 49.691  1.00 31.15  ? 836  VAL A CG1 1 
ATOM 6431 C CG2 . VAL A 1 839  ? 6.559   31.989 48.260  1.00 31.15  ? 836  VAL A CG2 1 
ATOM 6432 N N   . TYR A 1 840  ? 7.680   31.956 52.764  1.00 75.44  ? 837  TYR A N   1 
ATOM 6433 C CA  . TYR A 1 840  ? 8.116   32.520 54.030  1.00 75.44  ? 837  TYR A CA  1 
ATOM 6434 C C   . TYR A 1 840  ? 9.554   32.973 53.852  1.00 75.44  ? 837  TYR A C   1 
ATOM 6435 O O   . TYR A 1 840  ? 10.302  32.315 53.121  1.00 75.44  ? 837  TYR A O   1 
ATOM 6436 C CB  . TYR A 1 840  ? 7.980   31.463 55.121  1.00 44.94  ? 837  TYR A CB  1 
ATOM 6437 C CG  . TYR A 1 840  ? 6.547   31.020 55.304  1.00 44.94  ? 837  TYR A CG  1 
ATOM 6438 C CD1 . TYR A 1 840  ? 6.138   29.705 55.018  1.00 44.94  ? 837  TYR A CD1 1 
ATOM 6439 C CD2 . TYR A 1 840  ? 5.581   31.939 55.742  1.00 44.94  ? 837  TYR A CD2 1 
ATOM 6440 C CE1 . TYR A 1 840  ? 4.794   29.311 55.198  1.00 44.94  ? 837  TYR A CE1 1 
ATOM 6441 C CE2 . TYR A 1 840  ? 4.242   31.568 55.921  1.00 44.94  ? 837  TYR A CE2 1 
ATOM 6442 C CZ  . TYR A 1 840  ? 3.859   30.263 55.653  1.00 44.94  ? 837  TYR A CZ  1 
ATOM 6443 O OH  . TYR A 1 840  ? 2.533   29.963 55.844  1.00 44.94  ? 837  TYR A OH  1 
ATOM 6444 N N   . PRO A 1 841  ? 9.945   34.097 54.501  1.00 115.04 ? 838  PRO A N   1 
ATOM 6445 C CA  . PRO A 1 841  ? 11.253  34.743 54.287  1.00 115.04 ? 838  PRO A CA  1 
ATOM 6446 C C   . PRO A 1 841  ? 12.465  33.894 54.694  1.00 115.04 ? 838  PRO A C   1 
ATOM 6447 O O   . PRO A 1 841  ? 13.439  33.822 53.942  1.00 115.04 ? 838  PRO A O   1 
ATOM 6448 C CB  . PRO A 1 841  ? 11.171  36.006 55.153  1.00 104.55 ? 838  PRO A CB  1 
ATOM 6449 C CG  . PRO A 1 841  ? 9.716   36.207 55.420  1.00 104.55 ? 838  PRO A CG  1 
ATOM 6450 C CD  . PRO A 1 841  ? 9.145   34.833 55.497  1.00 104.55 ? 838  PRO A CD  1 
ATOM 6451 N N   . GLU A 1 842  ? 12.394  33.260 55.866  1.00 88.69  ? 839  GLU A N   1 
ATOM 6452 C CA  . GLU A 1 842  ? 13.470  32.402 56.374  1.00 88.69  ? 839  GLU A CA  1 
ATOM 6453 C C   . GLU A 1 842  ? 13.842  31.223 55.461  1.00 88.69  ? 839  GLU A C   1 
ATOM 6454 O O   . GLU A 1 842  ? 15.004  30.839 55.402  1.00 88.69  ? 839  GLU A O   1 
ATOM 6455 C CB  . GLU A 1 842  ? 13.150  31.906 57.793  1.00 183.88 ? 839  GLU A CB  1 
ATOM 6456 C CG  . GLU A 1 842  ? 11.923  30.999 57.918  1.00 183.88 ? 839  GLU A CG  1 
ATOM 6457 C CD  . GLU A 1 842  ? 10.611  31.759 58.030  1.00 183.88 ? 839  GLU A CD  1 
ATOM 6458 O OE1 . GLU A 1 842  ? 10.610  33.006 57.940  1.00 183.88 ? 839  GLU A OE1 1 
ATOM 6459 O OE2 . GLU A 1 842  ? 9.570   31.096 58.213  1.00 183.88 ? 839  GLU A OE2 1 
ATOM 6460 N N   . GLU A 1 843  ? 12.867  30.658 54.757  1.00 78.39  ? 840  GLU A N   1 
ATOM 6461 C CA  . GLU A 1 843  ? 13.104  29.515 53.882  1.00 78.39  ? 840  GLU A CA  1 
ATOM 6462 C C   . GLU A 1 843  ? 13.798  29.912 52.578  1.00 78.39  ? 840  GLU A C   1 
ATOM 6463 O O   . GLU A 1 843  ? 13.568  30.995 52.055  1.00 78.39  ? 840  GLU A O   1 
ATOM 6464 C CB  . GLU A 1 843  ? 11.787  28.807 53.573  1.00 91.49  ? 840  GLU A CB  1 
ATOM 6465 C CG  . GLU A 1 843  ? 11.128  28.158 54.779  1.00 91.49  ? 840  GLU A CG  1 
ATOM 6466 C CD  . GLU A 1 843  ? 9.707   27.690 54.495  1.00 91.49  ? 840  GLU A CD  1 
ATOM 6467 O OE1 . GLU A 1 843  ? 9.503   26.848 53.588  1.00 91.49  ? 840  GLU A OE1 1 
ATOM 6468 O OE2 . GLU A 1 843  ? 8.789   28.164 55.194  1.00 91.49  ? 840  GLU A OE2 1 
ATOM 6469 N N   . ALA A 1 844  ? 14.650  29.032 52.062  1.00 75.08  ? 841  ALA A N   1 
ATOM 6470 C CA  . ALA A 1 844  ? 15.311  29.251 50.778  1.00 75.08  ? 841  ALA A CA  1 
ATOM 6471 C C   . ALA A 1 844  ? 14.416  28.792 49.625  1.00 75.08  ? 841  ALA A C   1 
ATOM 6472 O O   . ALA A 1 844  ? 14.182  29.554 48.671  1.00 75.08  ? 841  ALA A O   1 
ATOM 6473 C CB  . ALA A 1 844  ? 16.647  28.534 50.738  1.00 91.06  ? 841  ALA A CB  1 
ATOM 6474 N N   . GLU A 1 845  ? 13.954  27.538 49.713  1.00 68.53  ? 842  GLU A N   1 
ATOM 6475 C CA  . GLU A 1 845  ? 12.917  26.987 48.840  1.00 68.53  ? 842  GLU A CA  1 
ATOM 6476 C C   . GLU A 1 845  ? 11.660  26.701 49.640  1.00 68.53  ? 842  GLU A C   1 
ATOM 6477 O O   . GLU A 1 845  ? 11.740  26.332 50.808  1.00 68.53  ? 842  GLU A O   1 
ATOM 6478 C CB  . GLU A 1 845  ? 13.381  25.709 48.143  1.00 94.41  ? 842  GLU A CB  1 
ATOM 6479 C CG  . GLU A 1 845  ? 14.086  25.971 46.824  1.00 94.41  ? 842  GLU A CG  1 
ATOM 6480 C CD  . GLU A 1 845  ? 13.796  24.911 45.772  1.00 94.41  ? 842  GLU A CD  1 
ATOM 6481 O OE1 . GLU A 1 845  ? 14.043  23.712 46.042  1.00 94.41  ? 842  GLU A OE1 1 
ATOM 6482 O OE2 . GLU A 1 845  ? 13.331  25.281 44.669  1.00 94.41  ? 842  GLU A OE2 1 
ATOM 6483 N N   . PRO A 1 846  ? 10.484  26.923 49.032  1.00 58.58  ? 843  PRO A N   1 
ATOM 6484 C CA  . PRO A 1 846  ? 9.214   26.559 49.671  1.00 58.58  ? 843  PRO A CA  1 
ATOM 6485 C C   . PRO A 1 846  ? 8.934   25.068 49.543  1.00 58.58  ? 843  PRO A C   1 
ATOM 6486 O O   . PRO A 1 846  ? 9.392   24.437 48.582  1.00 58.58  ? 843  PRO A O   1 
ATOM 6487 C CB  . PRO A 1 846  ? 8.168   27.378 48.876  1.00 41.27  ? 843  PRO A CB  1 
ATOM 6488 C CG  . PRO A 1 846  ? 8.977   28.374 48.056  1.00 41.27  ? 843  PRO A CG  1 
ATOM 6489 C CD  . PRO A 1 846  ? 10.252  27.618 47.757  1.00 41.27  ? 843  PRO A CD  1 
ATOM 6490 N N   . LYS A 1 847  ? 8.193   24.520 50.508  1.00 51.29  ? 844  LYS A N   1 
ATOM 6491 C CA  . LYS A 1 847  ? 7.843   23.096 50.518  1.00 51.29  ? 844  LYS A CA  1 
ATOM 6492 C C   . LYS A 1 847  ? 6.338   22.864 50.252  1.00 51.29  ? 844  LYS A C   1 
ATOM 6493 O O   . LYS A 1 847  ? 5.880   21.722 50.155  1.00 51.29  ? 844  LYS A O   1 
ATOM 6494 C CB  . LYS A 1 847  ? 8.305   22.437 51.829  1.00 98.69  ? 844  LYS A CB  1 
ATOM 6495 C CG  . LYS A 1 847  ? 9.846   22.285 51.982  1.00 98.69  ? 844  LYS A CG  1 
ATOM 6496 C CD  . LYS A 1 847  ? 10.256  22.014 53.455  1.00 98.69  ? 844  LYS A CD  1 
ATOM 6497 C CE  . LYS A 1 847  ? 11.769  22.019 53.694  1.00 98.69  ? 844  LYS A CE  1 
ATOM 6498 N NZ  . LYS A 1 847  ? 12.375  20.677 53.492  1.00 98.69  ? 844  LYS A NZ  1 
ATOM 6499 N N   . GLN A 1 848  ? 5.581   23.951 50.099  1.00 59.82  ? 845  GLN A N   1 
ATOM 6500 C CA  . GLN A 1 848  ? 4.131   23.860 49.945  1.00 59.82  ? 845  GLN A CA  1 
ATOM 6501 C C   . GLN A 1 848  ? 3.565   24.870 48.950  1.00 59.82  ? 845  GLN A C   1 
ATOM 6502 O O   . GLN A 1 848  ? 3.991   26.022 48.909  1.00 59.82  ? 845  GLN A O   1 
ATOM 6503 C CB  . GLN A 1 848  ? 3.421   24.057 51.291  1.00 74.40  ? 845  GLN A CB  1 
ATOM 6504 C CG  . GLN A 1 848  ? 3.486   22.889 52.276  1.00 74.40  ? 845  GLN A CG  1 
ATOM 6505 C CD  . GLN A 1 848  ? 3.124   23.301 53.715  1.00 74.40  ? 845  GLN A CD  1 
ATOM 6506 O OE1 . GLN A 1 848  ? 2.579   24.387 53.952  1.00 74.40  ? 845  GLN A OE1 1 
ATOM 6507 N NE2 . GLN A 1 848  ? 3.434   22.428 54.679  1.00 74.40  ? 845  GLN A NE2 1 
ATOM 6508 N N   . GLY A 1 849  ? 2.582   24.417 48.172  1.00 57.50  ? 846  GLY A N   1 
ATOM 6509 C CA  . GLY A 1 849  ? 1.809   25.240 47.248  1.00 57.50  ? 846  GLY A CA  1 
ATOM 6510 C C   . GLY A 1 849  ? 0.600   24.460 46.750  1.00 57.50  ? 846  GLY A C   1 
ATOM 6511 O O   . GLY A 1 849  ? 0.443   23.279 47.078  1.00 57.50  ? 846  GLY A O   1 
ATOM 6512 N N   . ARG A 1 850  ? -0.230  25.076 45.935  1.00 33.51  ? 847  ARG A N   1 
ATOM 6513 C CA  . ARG A 1 850  ? -1.382  24.412 45.387  1.00 33.51  ? 847  ARG A CA  1 
ATOM 6514 C C   . ARG A 1 850  ? -1.623  24.711 43.936  1.00 33.51  ? 847  ARG A C   1 
ATOM 6515 O O   . ARG A 1 850  ? -1.015  25.554 43.362  1.00 33.51  ? 847  ARG A O   1 
ATOM 6516 C CB  . ARG A 1 850  ? -2.644  24.686 46.180  1.00 34.45  ? 847  ARG A CB  1 
ATOM 6517 C CG  . ARG A 1 850  ? -2.621  25.887 46.982  1.00 34.45  ? 847  ARG A CG  1 
ATOM 6518 C CD  . ARG A 1 850  ? -3.632  25.828 48.062  1.00 34.45  ? 847  ARG A CD  1 
ATOM 6519 N NE  . ARG A 1 850  ? -4.937  26.325 47.674  1.00 34.45  ? 847  ARG A NE  1 
ATOM 6520 C CZ  . ARG A 1 850  ? -5.259  27.596 47.597  1.00 34.45  ? 847  ARG A CZ  1 
ATOM 6521 N NH1 . ARG A 1 850  ? -4.367  28.522 47.839  1.00 34.45  ? 847  ARG A NH1 1 
ATOM 6522 N NH2 . ARG A 1 850  ? -6.458  27.935 47.245  1.00 34.45  ? 847  ARG A NH2 1 
ATOM 6523 N N   . ILE A 1 851  ? -2.537  23.972 43.359  1.00 34.20  ? 848  ILE A N   1 
ATOM 6524 C CA  . ILE A 1 851  ? -2.905  24.138 41.993  1.00 34.20  ? 848  ILE A CA  1 
ATOM 6525 C C   . ILE A 1 851  ? -4.390  24.339 42.098  1.00 34.20  ? 848  ILE A C   1 
ATOM 6526 O O   . ILE A 1 851  ? -5.105  23.486 42.506  1.00 34.20  ? 848  ILE A O   1 
ATOM 6527 C CB  . ILE A 1 851  ? -2.506  22.956 41.201  1.00 21.31  ? 848  ILE A CB  1 
ATOM 6528 C CG1 . ILE A 1 851  ? -1.016  22.892 41.211  1.00 21.31  ? 848  ILE A CG1 1 
ATOM 6529 C CG2 . ILE A 1 851  ? -2.868  23.123 39.818  1.00 21.31  ? 848  ILE A CG2 1 
ATOM 6530 C CD1 . ILE A 1 851  ? -0.523  22.017 40.246  1.00 21.31  ? 848  ILE A CD1 1 
ATOM 6531 N N   . VAL A 1 852  ? -4.839  25.515 41.738  1.00 34.23  ? 849  VAL A N   1 
ATOM 6532 C CA  . VAL A 1 852  ? -6.215  25.842 41.831  1.00 34.23  ? 849  VAL A CA  1 
ATOM 6533 C C   . VAL A 1 852  ? -6.839  26.010 40.492  1.00 34.23  ? 849  VAL A C   1 
ATOM 6534 O O   . VAL A 1 852  ? -6.271  26.586 39.629  1.00 34.23  ? 849  VAL A O   1 
ATOM 6535 C CB  . VAL A 1 852  ? -6.338  27.120 42.613  1.00 27.07  ? 849  VAL A CB  1 
ATOM 6536 C CG1 . VAL A 1 852  ? -7.637  27.225 43.236  1.00 27.07  ? 849  VAL A CG1 1 
ATOM 6537 C CG2 . VAL A 1 852  ? -5.320  27.168 43.648  1.00 27.07  ? 849  VAL A CG2 1 
ATOM 6538 N N   . VAL A 1 853  ? -8.037  25.492 40.336  1.00 27.83  ? 850  VAL A N   1 
ATOM 6539 C CA  . VAL A 1 853  ? -8.758  25.576 39.100  1.00 27.83  ? 850  VAL A CA  1 
ATOM 6540 C C   . VAL A 1 853  ? -9.959  26.439 39.298  1.00 27.83  ? 850  VAL A C   1 
ATOM 6541 O O   . VAL A 1 853  ? -10.760 26.189 40.131  1.00 27.83  ? 850  VAL A O   1 
ATOM 6542 C CB  . VAL A 1 853  ? -9.177  24.237 38.694  1.00 18.64  ? 850  VAL A CB  1 
ATOM 6543 C CG1 . VAL A 1 853  ? -9.923  24.289 37.470  1.00 18.64  ? 850  VAL A CG1 1 
ATOM 6544 C CG2 . VAL A 1 853  ? -8.008  23.402 38.554  1.00 18.64  ? 850  VAL A CG2 1 
ATOM 6545 N N   . PHE A 1 854  ? -10.073 27.479 38.512  1.00 32.17  ? 851  PHE A N   1 
ATOM 6546 C CA  . PHE A 1 854  ? -11.165 28.379 38.637  1.00 32.17  ? 851  PHE A CA  1 
ATOM 6547 C C   . PHE A 1 854  ? -11.970 28.456 37.423  1.00 32.17  ? 851  PHE A C   1 
ATOM 6548 O O   . PHE A 1 854  ? -11.519 28.148 36.378  1.00 32.17  ? 851  PHE A O   1 
ATOM 6549 C CB  . PHE A 1 854  ? -10.614 29.770 38.725  1.00 28.97  ? 851  PHE A CB  1 
ATOM 6550 C CG  . PHE A 1 854  ? -9.804  30.028 39.903  1.00 28.97  ? 851  PHE A CG  1 
ATOM 6551 C CD1 . PHE A 1 854  ? -8.472  30.024 39.830  1.00 28.97  ? 851  PHE A CD1 1 
ATOM 6552 C CD2 . PHE A 1 854  ? -10.377 30.330 41.079  1.00 28.97  ? 851  PHE A CD2 1 
ATOM 6553 C CE1 . PHE A 1 854  ? -7.755  30.272 40.902  1.00 28.97  ? 851  PHE A CE1 1 
ATOM 6554 C CE2 . PHE A 1 854  ? -9.639  30.581 42.134  1.00 28.97  ? 851  PHE A CE2 1 
ATOM 6555 C CZ  . PHE A 1 854  ? -8.338  30.552 42.042  1.00 28.97  ? 851  PHE A CZ  1 
ATOM 6556 N N   . GLN A 1 855  ? -13.190 28.915 37.565  1.00 65.22  ? 852  GLN A N   1 
ATOM 6557 C CA  . GLN A 1 855  ? -14.036 29.083 36.406  1.00 65.22  ? 852  GLN A CA  1 
ATOM 6558 C C   . GLN A 1 855  ? -14.799 30.400 36.305  1.00 65.22  ? 852  GLN A C   1 
ATOM 6559 O O   . GLN A 1 855  ? -15.507 30.796 37.182  1.00 65.22  ? 852  GLN A O   1 
ATOM 6560 C CB  . GLN A 1 855  ? -15.016 27.951 36.187  1.00 54.82  ? 852  GLN A CB  1 
ATOM 6561 C CG  . GLN A 1 855  ? -15.491 27.950 34.772  1.00 54.82  ? 852  GLN A CG  1 
ATOM 6562 C CD  . GLN A 1 855  ? -16.646 27.063 34.517  1.00 54.82  ? 852  GLN A CD  1 
ATOM 6563 O OE1 . GLN A 1 855  ? -17.304 26.617 35.424  1.00 54.82  ? 852  GLN A OE1 1 
ATOM 6564 N NE2 . GLN A 1 855  ? -16.911 26.807 33.267  1.00 54.82  ? 852  GLN A NE2 1 
ATOM 6565 N N   . TYR A 1 856  ? -14.616 31.065 35.194  1.00 59.90  ? 853  TYR A N   1 
ATOM 6566 C CA  . TYR A 1 856  ? -15.291 32.281 34.850  1.00 59.90  ? 853  TYR A CA  1 
ATOM 6567 C C   . TYR A 1 856  ? -16.082 31.975 33.599  1.00 59.90  ? 853  TYR A C   1 
ATOM 6568 O O   . TYR A 1 856  ? -15.513 31.883 32.506  1.00 59.90  ? 853  TYR A O   1 
ATOM 6569 C CB  . TYR A 1 856  ? -14.273 33.394 34.589  1.00 39.81  ? 853  TYR A CB  1 
ATOM 6570 C CG  . TYR A 1 856  ? -14.898 34.762 34.675  1.00 39.81  ? 853  TYR A CG  1 
ATOM 6571 C CD1 . TYR A 1 856  ? -15.196 35.344 35.924  1.00 39.81  ? 853  TYR A CD1 1 
ATOM 6572 C CD2 . TYR A 1 856  ? -15.228 35.468 33.520  1.00 39.81  ? 853  TYR A CD2 1 
ATOM 6573 C CE1 . TYR A 1 856  ? -15.794 36.586 36.009  1.00 39.81  ? 853  TYR A CE1 1 
ATOM 6574 C CE2 . TYR A 1 856  ? -15.823 36.712 33.599  1.00 39.81  ? 853  TYR A CE2 1 
ATOM 6575 C CZ  . TYR A 1 856  ? -16.104 37.263 34.846  1.00 39.81  ? 853  TYR A CZ  1 
ATOM 6576 O OH  . TYR A 1 856  ? -16.701 38.511 34.907  1.00 39.81  ? 853  TYR A OH  1 
ATOM 6577 N N   . SER A 1 857  ? -17.385 31.777 33.731  1.00 117.97 ? 854  SER A N   1 
ATOM 6578 C CA  . SER A 1 857  ? -18.160 31.376 32.558  1.00 117.97 ? 854  SER A CA  1 
ATOM 6579 C C   . SER A 1 857  ? -19.455 32.159 32.429  1.00 117.97 ? 854  SER A C   1 
ATOM 6580 O O   . SER A 1 857  ? -19.794 32.658 31.349  1.00 117.97 ? 854  SER A O   1 
ATOM 6581 C CB  . SER A 1 857  ? -18.436 29.872 32.584  1.00 97.56  ? 854  SER A CB  1 
ATOM 6582 O OG  . SER A 1 857  ? -19.085 29.515 33.789  1.00 97.56  ? 854  SER A OG  1 
ATOM 6583 N N   . ASP A 1 858  ? -20.171 32.264 33.538  1.00 108.14 ? 855  ASP A N   1 
ATOM 6584 C CA  . ASP A 1 858  ? -21.429 32.956 33.547  1.00 108.14 ? 855  ASP A CA  1 
ATOM 6585 C C   . ASP A 1 858  ? -21.088 34.425 33.606  1.00 108.14 ? 855  ASP A C   1 
ATOM 6586 O O   . ASP A 1 858  ? -20.569 34.994 32.647  1.00 108.14 ? 855  ASP A O   1 
ATOM 6587 C CB  . ASP A 1 858  ? -22.232 32.533 34.774  1.00 160.48 ? 855  ASP A CB  1 
ATOM 6588 C CG  . ASP A 1 858  ? -23.717 32.680 34.570  1.00 160.48 ? 855  ASP A CG  1 
ATOM 6589 O OD1 . ASP A 1 858  ? -24.258 32.008 33.664  1.00 160.48 ? 855  ASP A OD1 1 
ATOM 6590 O OD2 . ASP A 1 858  ? -24.339 33.460 35.321  1.00 160.48 ? 855  ASP A OD2 1 
ATOM 6591 N N   . GLY A 1 859  ? -21.370 35.032 34.746  1.00 67.29  ? 856  GLY A N   1 
ATOM 6592 C CA  . GLY A 1 859  ? -20.907 36.368 35.023  1.00 67.29  ? 856  GLY A CA  1 
ATOM 6593 C C   . GLY A 1 859  ? -19.973 36.375 36.213  1.00 67.29  ? 856  GLY A C   1 
ATOM 6594 O O   . GLY A 1 859  ? -19.638 37.445 36.727  1.00 67.29  ? 856  GLY A O   1 
ATOM 6595 N N   . LYS A 1 860  ? -19.554 35.196 36.677  1.00 61.27  ? 857  LYS A N   1 
ATOM 6596 C CA  . LYS A 1 860  ? -18.644 35.168 37.814  1.00 61.27  ? 857  LYS A CA  1 
ATOM 6597 C C   . LYS A 1 860  ? -17.634 34.016 37.914  1.00 61.27  ? 857  LYS A C   1 
ATOM 6598 O O   . LYS A 1 860  ? -17.618 33.088 37.086  1.00 61.27  ? 857  LYS A O   1 
ATOM 6599 C CB  . LYS A 1 860  ? -19.391 35.416 39.134  1.00 98.96  ? 857  LYS A CB  1 
ATOM 6600 C CG  . LYS A 1 860  ? -20.162 34.241 39.708  1.00 98.96  ? 857  LYS A CG  1 
ATOM 6601 C CD  . LYS A 1 860  ? -20.361 34.408 41.241  1.00 98.96  ? 857  LYS A CD  1 
ATOM 6602 C CE  . LYS A 1 860  ? -19.055 34.244 42.062  1.00 98.96  ? 857  LYS A CE  1 
ATOM 6603 N NZ  . LYS A 1 860  ? -18.161 35.441 42.021  1.00 98.96  ? 857  LYS A NZ  1 
ATOM 6604 N N   . LEU A 1 861  ? -16.798 34.123 38.949  1.00 56.88  ? 858  LEU A N   1 
ATOM 6605 C CA  . LEU A 1 861  ? -15.611 33.315 39.149  1.00 56.88  ? 858  LEU A CA  1 
ATOM 6606 C C   . LEU A 1 861  ? -15.824 32.224 40.194  1.00 56.88  ? 858  LEU A C   1 
ATOM 6607 O O   . LEU A 1 861  ? -16.054 32.515 41.366  1.00 56.88  ? 858  LEU A O   1 
ATOM 6608 C CB  . LEU A 1 861  ? -14.453 34.229 39.571  1.00 46.17  ? 858  LEU A CB  1 
ATOM 6609 C CG  . LEU A 1 861  ? -12.954 33.895 39.324  1.00 46.17  ? 858  LEU A CG  1 
ATOM 6610 C CD1 . LEU A 1 861  ? -12.303 33.276 40.539  1.00 46.17  ? 858  LEU A CD1 1 
ATOM 6611 C CD2 . LEU A 1 861  ? -12.664 33.073 38.054  1.00 46.17  ? 858  LEU A CD2 1 
ATOM 6612 N N   . GLN A 1 862  ? -15.704 30.971 39.758  1.00 60.27  ? 859  GLN A N   1 
ATOM 6613 C CA  . GLN A 1 862  ? -16.017 29.797 40.568  1.00 60.27  ? 859  GLN A CA  1 
ATOM 6614 C C   . GLN A 1 862  ? -14.750 28.992 40.865  1.00 60.27  ? 859  GLN A C   1 
ATOM 6615 O O   . GLN A 1 862  ? -14.012 28.649 39.944  1.00 60.27  ? 859  GLN A O   1 
ATOM 6616 C CB  . GLN A 1 862  ? -17.030 28.940 39.799  1.00 155.98 ? 859  GLN A CB  1 
ATOM 6617 C CG  . GLN A 1 862  ? -17.593 27.729 40.537  1.00 155.98 ? 859  GLN A CG  1 
ATOM 6618 C CD  . GLN A 1 862  ? -18.365 26.777 39.619  1.00 155.98 ? 859  GLN A CD  1 
ATOM 6619 O OE1 . GLN A 1 862  ? -18.796 27.153 38.526  1.00 155.98 ? 859  GLN A OE1 1 
ATOM 6620 N NE2 . GLN A 1 862  ? -18.539 25.538 40.068  1.00 155.98 ? 859  GLN A NE2 1 
ATOM 6621 N N   . THR A 1 863  ? -14.485 28.701 42.143  1.00 55.01  ? 860  THR A N   1 
ATOM 6622 C CA  . THR A 1 863  ? -13.387 27.785 42.489  1.00 55.01  ? 860  THR A CA  1 
ATOM 6623 C C   . THR A 1 863  ? -13.784 26.327 42.261  1.00 55.01  ? 860  THR A C   1 
ATOM 6624 O O   . THR A 1 863  ? -14.511 25.733 43.066  1.00 55.01  ? 860  THR A O   1 
ATOM 6625 C CB  . THR A 1 863  ? -12.910 27.886 43.949  1.00 30.61  ? 860  THR A CB  1 
ATOM 6626 O OG1 . THR A 1 863  ? -12.384 29.187 44.235  1.00 30.61  ? 860  THR A OG1 1 
ATOM 6627 C CG2 . THR A 1 863  ? -11.786 26.875 44.183  1.00 30.61  ? 860  THR A CG2 1 
ATOM 6628 N N   . VAL A 1 864  ? -13.271 25.747 41.184  1.00 49.83  ? 861  VAL A N   1 
ATOM 6629 C CA  . VAL A 1 864  ? -13.617 24.393 40.825  1.00 49.83  ? 861  VAL A CA  1 
ATOM 6630 C C   . VAL A 1 864  ? -12.887 23.342 41.634  1.00 49.83  ? 861  VAL A C   1 
ATOM 6631 O O   . VAL A 1 864  ? -13.534 22.552 42.294  1.00 49.83  ? 861  VAL A O   1 
ATOM 6632 C CB  . VAL A 1 864  ? -13.363 24.129 39.360  1.00 39.40  ? 861  VAL A CB  1 
ATOM 6633 C CG1 . VAL A 1 864  ? -13.849 22.672 38.979  1.00 39.40  ? 861  VAL A CG1 1 
ATOM 6634 C CG2 . VAL A 1 864  ? -14.024 25.218 38.523  1.00 39.40  ? 861  VAL A CG2 1 
ATOM 6635 N N   . ALA A 1 865  ? -11.556 23.299 41.539  1.00 46.37  ? 862  ALA A N   1 
ATOM 6636 C CA  . ALA A 1 865  ? -10.671 22.328 42.217  1.00 46.37  ? 862  ALA A CA  1 
ATOM 6637 C C   . ALA A 1 865  ? -9.446  22.948 42.914  1.00 46.37  ? 862  ALA A C   1 
ATOM 6638 O O   . ALA A 1 865  ? -9.019  24.002 42.555  1.00 46.37  ? 862  ALA A O   1 
ATOM 6639 C CB  . ALA A 1 865  ? -10.230 21.309 41.243  1.00 12.96  ? 862  ALA A CB  1 
ATOM 6640 N N   . GLU A 1 866  ? -8.899  22.259 43.908  1.00 59.75  ? 863  GLU A N   1 
ATOM 6641 C CA  . GLU A 1 866  ? -7.735  22.656 44.707  1.00 59.75  ? 863  GLU A CA  1 
ATOM 6642 C C   . GLU A 1 866  ? -6.880  21.356 44.690  1.00 59.75  ? 863  GLU A C   1 
ATOM 6643 O O   . GLU A 1 866  ? -7.438  20.289 44.724  1.00 59.75  ? 863  GLU A O   1 
ATOM 6644 C CB  . GLU A 1 866  ? -8.224  22.953 46.102  1.00 54.44  ? 863  GLU A CB  1 
ATOM 6645 C CG  . GLU A 1 866  ? -7.318  23.700 46.983  1.00 54.44  ? 863  GLU A CG  1 
ATOM 6646 C CD  . GLU A 1 866  ? -7.885  23.776 48.340  1.00 54.44  ? 863  GLU A CD  1 
ATOM 6647 O OE1 . GLU A 1 866  ? -7.219  24.214 49.267  1.00 54.44  ? 863  GLU A OE1 1 
ATOM 6648 O OE2 . GLU A 1 866  ? -9.018  23.375 48.487  1.00 54.44  ? 863  GLU A OE2 1 
ATOM 6649 N N   . LYS A 1 867  ? -5.556  21.408 44.622  1.00 38.47  ? 864  LYS A N   1 
ATOM 6650 C CA  . LYS A 1 867  ? -4.713  20.195 44.607  1.00 38.47  ? 864  LYS A CA  1 
ATOM 6651 C C   . LYS A 1 867  ? -3.523  20.647 45.438  1.00 38.47  ? 864  LYS A C   1 
ATOM 6652 O O   . LYS A 1 867  ? -2.948  21.639 45.161  1.00 38.47  ? 864  LYS A O   1 
ATOM 6653 C CB  . LYS A 1 867  ? -4.358  19.772 43.191  1.00 44.95  ? 864  LYS A CB  1 
ATOM 6654 C CG  . LYS A 1 867  ? -3.345  18.666 43.032  1.00 44.95  ? 864  LYS A CG  1 
ATOM 6655 C CD  . LYS A 1 867  ? -3.644  17.476 43.852  1.00 44.95  ? 864  LYS A CD  1 
ATOM 6656 C CE  . LYS A 1 867  ? -4.180  16.349 43.050  1.00 44.95  ? 864  LYS A CE  1 
ATOM 6657 N NZ  . LYS A 1 867  ? -4.378  15.195 43.934  1.00 44.95  ? 864  LYS A NZ  1 
ATOM 6658 N N   . GLU A 1 868  ? -3.179  19.901 46.463  1.00 47.39  ? 865  GLU A N   1 
ATOM 6659 C CA  . GLU A 1 868  ? -2.146  20.179 47.456  1.00 47.39  ? 865  GLU A CA  1 
ATOM 6660 C C   . GLU A 1 868  ? -1.018  19.599 46.694  1.00 47.39  ? 865  GLU A C   1 
ATOM 6661 O O   . GLU A 1 868  ? -1.159  18.621 45.974  1.00 47.39  ? 865  GLU A O   1 
ATOM 6662 C CB  . GLU A 1 868  ? -2.281  19.440 48.755  1.00 72.20  ? 865  GLU A CB  1 
ATOM 6663 C CG  . GLU A 1 868  ? -0.985  19.456 49.487  1.00 72.20  ? 865  GLU A CG  1 
ATOM 6664 C CD  . GLU A 1 868  ? -1.147  19.493 50.945  1.00 72.20  ? 865  GLU A CD  1 
ATOM 6665 O OE1 . GLU A 1 868  ? -0.169  19.760 51.646  1.00 72.20  ? 865  GLU A OE1 1 
ATOM 6666 O OE2 . GLU A 1 868  ? -2.251  19.249 51.403  1.00 72.20  ? 865  GLU A OE2 1 
ATOM 6667 N N   . VAL A 1 869  ? 0.123   20.196 46.892  1.00 39.75  ? 866  VAL A N   1 
ATOM 6668 C CA  . VAL A 1 869  ? 1.315   19.922 46.104  1.00 39.75  ? 866  VAL A CA  1 
ATOM 6669 C C   . VAL A 1 869  ? 2.507   20.283 46.976  1.00 39.75  ? 866  VAL A C   1 
ATOM 6670 O O   . VAL A 1 869  ? 2.456   21.277 47.687  1.00 39.75  ? 866  VAL A O   1 
ATOM 6671 C CB  . VAL A 1 869  ? 1.274   20.739 44.769  1.00 30.45  ? 866  VAL A CB  1 
ATOM 6672 C CG1 . VAL A 1 869  ? 2.403   21.792 44.690  1.00 30.45  ? 866  VAL A CG1 1 
ATOM 6673 C CG2 . VAL A 1 869  ? 1.231   19.829 43.579  1.00 30.45  ? 866  VAL A CG2 1 
ATOM 6674 N N   . LYS A 1 870  ? 3.574   19.483 46.919  1.00 51.70  ? 867  LYS A N   1 
ATOM 6675 C CA  . LYS A 1 870  ? 4.680   19.591 47.894  1.00 51.70  ? 867  LYS A CA  1 
ATOM 6676 C C   . LYS A 1 870  ? 5.802   20.591 47.527  1.00 51.70  ? 867  LYS A C   1 
ATOM 6677 O O   . LYS A 1 870  ? 6.974   20.358 47.785  1.00 51.70  ? 867  LYS A O   1 
ATOM 6678 C CB  . LYS A 1 870  ? 5.250   18.201 48.218  1.00 90.91  ? 867  LYS A CB  1 
ATOM 6679 C CG  . LYS A 1 870  ? 4.319   17.302 49.039  1.00 90.91  ? 867  LYS A CG  1 
ATOM 6680 C CD  . LYS A 1 870  ? 4.439   15.816 48.623  1.00 90.91  ? 867  LYS A CD  1 
ATOM 6681 C CE  . LYS A 1 870  ? 3.520   15.460 47.425  1.00 90.91  ? 867  LYS A CE  1 
ATOM 6682 N NZ  . LYS A 1 870  ? 3.661   14.047 46.913  1.00 90.91  ? 867  LYS A NZ  1 
ATOM 6683 N N   . GLY A 1 871  ? 5.434   21.727 46.959  1.00 42.30  ? 868  GLY A N   1 
ATOM 6684 C CA  . GLY A 1 871  ? 6.415   22.760 46.675  1.00 42.30  ? 868  GLY A CA  1 
ATOM 6685 C C   . GLY A 1 871  ? 5.820   23.926 45.921  1.00 42.30  ? 868  GLY A C   1 
ATOM 6686 O O   . GLY A 1 871  ? 4.627   24.173 45.999  1.00 42.30  ? 868  GLY A O   1 
ATOM 6687 N N   . ALA A 1 872  ? 6.670   24.625 45.182  1.00 45.91  ? 869  ALA A N   1 
ATOM 6688 C CA  . ALA A 1 872  ? 6.298   25.846 44.477  1.00 45.91  ? 869  ALA A CA  1 
ATOM 6689 C C   . ALA A 1 872  ? 6.073   25.536 43.008  1.00 45.91  ? 869  ALA A C   1 
ATOM 6690 O O   . ALA A 1 872  ? 6.894   24.889 42.364  1.00 45.91  ? 869  ALA A O   1 
ATOM 6691 C CB  . ALA A 1 872  ? 7.396   26.894 44.641  1.00 65.42  ? 869  ALA A CB  1 
ATOM 6692 N N   . VAL A 1 873  ? 4.949   25.987 42.479  1.00 57.50  ? 870  VAL A N   1 
ATOM 6693 C CA  . VAL A 1 873  ? 4.564   25.607 41.129  1.00 57.50  ? 870  VAL A CA  1 
ATOM 6694 C C   . VAL A 1 873  ? 5.104   26.648 40.160  1.00 57.50  ? 870  VAL A C   1 
ATOM 6695 O O   . VAL A 1 873  ? 4.376   27.528 39.683  1.00 57.50  ? 870  VAL A O   1 
ATOM 6696 C CB  . VAL A 1 873  ? 3.045   25.444 41.015  1.00 32.17  ? 870  VAL A CB  1 
ATOM 6697 C CG1 . VAL A 1 873  ? 2.676   24.765 39.709  1.00 32.17  ? 870  VAL A CG1 1 
ATOM 6698 C CG2 . VAL A 1 873  ? 2.537   24.653 42.162  1.00 32.17  ? 870  VAL A CG2 1 
ATOM 6699 N N   . TYR A 1 874  ? 6.402   26.526 39.894  1.00 43.15  ? 871  TYR A N   1 
ATOM 6700 C CA  . TYR A 1 874  ? 7.164   27.484 39.104  1.00 43.15  ? 871  TYR A CA  1 
ATOM 6701 C C   . TYR A 1 874  ? 6.629   27.692 37.716  1.00 43.15  ? 871  TYR A C   1 
ATOM 6702 O O   . TYR A 1 874  ? 6.623   28.804 37.228  1.00 43.15  ? 871  TYR A O   1 
ATOM 6703 C CB  . TYR A 1 874  ? 8.664   27.122 39.045  1.00 52.86  ? 871  TYR A CB  1 
ATOM 6704 C CG  . TYR A 1 874  ? 9.395   27.382 40.346  1.00 52.86  ? 871  TYR A CG  1 
ATOM 6705 C CD1 . TYR A 1 874  ? 10.024  26.350 41.029  1.00 52.86  ? 871  TYR A CD1 1 
ATOM 6706 C CD2 . TYR A 1 874  ? 9.434   28.657 40.900  1.00 52.86  ? 871  TYR A CD2 1 
ATOM 6707 C CE1 . TYR A 1 874  ? 10.677  26.586 42.225  1.00 52.86  ? 871  TYR A CE1 1 
ATOM 6708 C CE2 . TYR A 1 874  ? 10.068  28.902 42.088  1.00 52.86  ? 871  TYR A CE2 1 
ATOM 6709 C CZ  . TYR A 1 874  ? 10.690  27.868 42.749  1.00 52.86  ? 871  TYR A CZ  1 
ATOM 6710 O OH  . TYR A 1 874  ? 11.322  28.111 43.945  1.00 52.86  ? 871  TYR A OH  1 
ATOM 6711 N N   . SER A 1 875  ? 6.201   26.633 37.059  1.00 34.86  ? 872  SER A N   1 
ATOM 6712 C CA  . SER A 1 875  ? 5.596   26.801 35.739  1.00 34.86  ? 872  SER A CA  1 
ATOM 6713 C C   . SER A 1 875  ? 4.610   25.718 35.442  1.00 34.86  ? 872  SER A C   1 
ATOM 6714 O O   . SER A 1 875  ? 4.560   24.707 36.122  1.00 34.86  ? 872  SER A O   1 
ATOM 6715 C CB  . SER A 1 875  ? 6.647   26.867 34.634  1.00 50.91  ? 872  SER A CB  1 
ATOM 6716 O OG  . SER A 1 875  ? 7.303   25.631 34.529  1.00 50.91  ? 872  SER A OG  1 
ATOM 6717 N N   . MET A 1 876  ? 3.782   25.945 34.448  1.00 34.92  ? 873  MET A N   1 
ATOM 6718 C CA  . MET A 1 876  ? 2.870   24.894 34.039  1.00 34.92  ? 873  MET A CA  1 
ATOM 6719 C C   . MET A 1 876  ? 2.375   25.144 32.650  1.00 34.92  ? 873  MET A C   1 
ATOM 6720 O O   . MET A 1 876  ? 2.539   26.219 32.148  1.00 34.92  ? 873  MET A O   1 
ATOM 6721 C CB  . MET A 1 876  ? 1.776   24.580 35.079  1.00 27.56  ? 873  MET A CB  1 
ATOM 6722 C CG  . MET A 1 876  ? 0.772   25.622 35.346  1.00 27.56  ? 873  MET A CG  1 
ATOM 6723 S SD  . MET A 1 876  ? -0.122  25.288 36.909  1.00 27.56  ? 873  MET A SD  1 
ATOM 6724 C CE  . MET A 1 876  ? -1.294  26.610 36.880  1.00 27.56  ? 873  MET A CE  1 
ATOM 6725 N N   . VAL A 1 877  ? 1.860   24.114 32.006  1.00 41.09  ? 874  VAL A N   1 
ATOM 6726 C CA  . VAL A 1 877  ? 1.567   24.156 30.572  1.00 41.09  ? 874  VAL A CA  1 
ATOM 6727 C C   . VAL A 1 877  ? 0.610   23.018 30.299  1.00 41.09  ? 874  VAL A C   1 
ATOM 6728 O O   . VAL A 1 877  ? 0.816   21.920 30.798  1.00 41.09  ? 874  VAL A O   1 
ATOM 6729 C CB  . VAL A 1 877  ? 2.872   23.985 29.710  1.00 37.10  ? 874  VAL A CB  1 
ATOM 6730 C CG1 . VAL A 1 877  ? 3.331   22.502 29.645  1.00 37.10  ? 874  VAL A CG1 1 
ATOM 6731 C CG2 . VAL A 1 877  ? 2.663   24.463 28.327  1.00 37.10  ? 874  VAL A CG2 1 
ATOM 6732 N N   . GLU A 1 878  ? -0.447  23.282 29.550  1.00 46.48  ? 875  GLU A N   1 
ATOM 6733 C CA  . GLU A 1 878  ? -1.332  22.209 29.118  1.00 46.48  ? 875  GLU A CA  1 
ATOM 6734 C C   . GLU A 1 878  ? -0.555  21.375 28.111  1.00 46.48  ? 875  GLU A C   1 
ATOM 6735 O O   . GLU A 1 878  ? -0.060  21.895 27.101  1.00 46.48  ? 875  GLU A O   1 
ATOM 6736 C CB  . GLU A 1 878  ? -2.627  22.754 28.502  1.00 74.73  ? 875  GLU A CB  1 
ATOM 6737 C CG  . GLU A 1 878  ? -3.610  21.676 27.987  1.00 74.73  ? 875  GLU A CG  1 
ATOM 6738 C CD  . GLU A 1 878  ? -3.440  21.334 26.501  1.00 74.73  ? 875  GLU A CD  1 
ATOM 6739 O OE1 . GLU A 1 878  ? -3.107  22.244 25.713  1.00 74.73  ? 875  GLU A OE1 1 
ATOM 6740 O OE2 . GLU A 1 878  ? -3.658  20.158 26.121  1.00 74.73  ? 875  GLU A OE2 1 
ATOM 6741 N N   . PHE A 1 879  ? -0.419  20.087 28.404  1.00 66.25  ? 876  PHE A N   1 
ATOM 6742 C CA  . PHE A 1 879  ? 0.303   19.212 27.509  1.00 66.25  ? 876  PHE A CA  1 
ATOM 6743 C C   . PHE A 1 879  ? -0.648  18.720 26.428  1.00 66.25  ? 876  PHE A C   1 
ATOM 6744 O O   . PHE A 1 879  ? -0.963  19.460 25.467  1.00 66.25  ? 876  PHE A O   1 
ATOM 6745 C CB  . PHE A 1 879  ? 0.957   18.054 28.268  1.00 60.12  ? 876  PHE A CB  1 
ATOM 6746 C CG  . PHE A 1 879  ? 2.088   17.388 27.515  1.00 60.12  ? 876  PHE A CG  1 
ATOM 6747 C CD1 . PHE A 1 879  ? 3.067   18.153 26.871  1.00 60.12  ? 876  PHE A CD1 1 
ATOM 6748 C CD2 . PHE A 1 879  ? 2.187   15.996 27.471  1.00 60.12  ? 876  PHE A CD2 1 
ATOM 6749 C CE1 . PHE A 1 879  ? 4.122   17.549 26.189  1.00 60.12  ? 876  PHE A CE1 1 
ATOM 6750 C CE2 . PHE A 1 879  ? 3.239   15.375 26.789  1.00 60.12  ? 876  PHE A CE2 1 
ATOM 6751 C CZ  . PHE A 1 879  ? 4.209   16.155 26.148  1.00 60.12  ? 876  PHE A CZ  1 
ATOM 6752 N N   . ASN A 1 880  ? -1.113  17.484 26.600  1.00 64.51  ? 877  ASN A N   1 
ATOM 6753 C CA  . ASN A 1 880  ? -1.928  16.838 25.601  1.00 64.51  ? 877  ASN A CA  1 
ATOM 6754 C C   . ASN A 1 880  ? -3.206  16.361 26.225  1.00 64.51  ? 877  ASN A C   1 
ATOM 6755 O O   . ASN A 1 880  ? -3.582  15.207 26.057  1.00 64.51  ? 877  ASN A O   1 
ATOM 6756 C CB  . ASN A 1 880  ? -1.175  15.672 24.967  1.00 39.01  ? 877  ASN A CB  1 
ATOM 6757 C CG  . ASN A 1 880  ? -0.160  16.123 23.930  1.00 39.01  ? 877  ASN A CG  1 
ATOM 6758 O OD1 . ASN A 1 880  ? -0.515  16.606 22.855  1.00 39.01  ? 877  ASN A OD1 1 
ATOM 6759 N ND2 . ASN A 1 880  ? 1.113   15.949 24.239  1.00 39.01  ? 877  ASN A ND2 1 
ATOM 6760 N N   . GLY A 1 881  ? -3.879  17.258 26.939  1.00 49.43  ? 878  GLY A N   1 
ATOM 6761 C CA  . GLY A 1 881  ? -5.132  16.918 27.605  1.00 49.43  ? 878  GLY A CA  1 
ATOM 6762 C C   . GLY A 1 881  ? -4.929  16.873 29.101  1.00 49.43  ? 878  GLY A C   1 
ATOM 6763 O O   . GLY A 1 881  ? -5.895  16.860 29.857  1.00 49.43  ? 878  GLY A O   1 
ATOM 6764 N N   . LYS A 1 882  ? -3.660  16.857 29.521  1.00 47.06  ? 879  LYS A N   1 
ATOM 6765 C CA  . LYS A 1 882  ? -3.299  16.901 30.934  1.00 47.06  ? 879  LYS A CA  1 
ATOM 6766 C C   . LYS A 1 882  ? -2.601  18.229 31.309  1.00 47.06  ? 879  LYS A C   1 
ATOM 6767 O O   . LYS A 1 882  ? -2.331  19.094 30.450  1.00 47.06  ? 879  LYS A O   1 
ATOM 6768 C CB  . LYS A 1 882  ? -2.400  15.706 31.291  1.00 52.37  ? 879  LYS A CB  1 
ATOM 6769 C CG  . LYS A 1 882  ? -2.983  14.330 30.948  1.00 52.37  ? 879  LYS A CG  1 
ATOM 6770 C CD  . LYS A 1 882  ? -2.165  13.224 31.612  1.00 52.37  ? 879  LYS A CD  1 
ATOM 6771 C CE  . LYS A 1 882  ? -2.794  11.831 31.455  1.00 52.37  ? 879  LYS A CE  1 
ATOM 6772 N NZ  . LYS A 1 882  ? -2.569  11.014 32.707  1.00 52.37  ? 879  LYS A NZ  1 
ATOM 6773 N N   . LEU A 1 883  ? -2.305  18.367 32.600  1.00 38.84  ? 880  LEU A N   1 
ATOM 6774 C CA  . LEU A 1 883  ? -1.610  19.524 33.126  1.00 38.84  ? 880  LEU A CA  1 
ATOM 6775 C C   . LEU A 1 883  ? -0.223  19.117 33.556  1.00 38.84  ? 880  LEU A C   1 
ATOM 6776 O O   . LEU A 1 883  ? -0.059  18.341 34.520  1.00 38.84  ? 880  LEU A O   1 
ATOM 6777 C CB  . LEU A 1 883  ? -2.362  20.071 34.337  1.00 24.57  ? 880  LEU A CB  1 
ATOM 6778 C CG  . LEU A 1 883  ? -2.056  21.481 34.830  1.00 24.57  ? 880  LEU A CG  1 
ATOM 6779 C CD1 . LEU A 1 883  ? -2.685  22.457 33.831  1.00 24.57  ? 880  LEU A CD1 1 
ATOM 6780 C CD2 . LEU A 1 883  ? -2.636  21.667 36.219  1.00 24.57  ? 880  LEU A CD2 1 
ATOM 6781 N N   . LEU A 1 884  ? 0.764   19.643 32.830  1.00 49.52  ? 881  LEU A N   1 
ATOM 6782 C CA  . LEU A 1 884  ? 2.176   19.454 33.130  1.00 49.52  ? 881  LEU A CA  1 
ATOM 6783 C C   . LEU A 1 884  ? 2.591   20.581 34.048  1.00 49.52  ? 881  LEU A C   1 
ATOM 6784 O O   . LEU A 1 884  ? 2.502   21.737 33.674  1.00 49.52  ? 881  LEU A O   1 
ATOM 6785 C CB  . LEU A 1 884  ? 2.993   19.535 31.836  1.00 20.70  ? 881  LEU A CB  1 
ATOM 6786 C CG  . LEU A 1 884  ? 4.521   19.477 31.915  1.00 20.70  ? 881  LEU A CG  1 
ATOM 6787 C CD1 . LEU A 1 884  ? 4.880   18.156 32.450  1.00 20.70  ? 881  LEU A CD1 1 
ATOM 6788 C CD2 . LEU A 1 884  ? 5.205   19.639 30.618  1.00 20.70  ? 881  LEU A CD2 1 
ATOM 6789 N N   . ALA A 1 885  ? 3.049   20.260 35.243  1.00 28.92  ? 882  ALA A N   1 
ATOM 6790 C CA  . ALA A 1 885  ? 3.365   21.276 36.205  1.00 28.92  ? 882  ALA A CA  1 
ATOM 6791 C C   . ALA A 1 885  ? 4.778   21.038 36.706  1.00 28.92  ? 882  ALA A C   1 
ATOM 6792 O O   . ALA A 1 885  ? 5.204   19.886 36.824  1.00 28.92  ? 882  ALA A O   1 
ATOM 6793 C CB  . ALA A 1 885  ? 2.374   21.212 37.359  1.00 19.91  ? 882  ALA A CB  1 
ATOM 6794 N N   . SER A 1 886  ? 5.516   22.110 36.973  1.00 32.10  ? 883  SER A N   1 
ATOM 6795 C CA  . SER A 1 886  ? 6.873   21.985 37.406  1.00 32.10  ? 883  SER A CA  1 
ATOM 6796 C C   . SER A 1 886  ? 6.904   22.417 38.869  1.00 32.10  ? 883  SER A C   1 
ATOM 6797 O O   . SER A 1 886  ? 6.848   23.622 39.170  1.00 32.10  ? 883  SER A O   1 
ATOM 6798 C CB  . SER A 1 886  ? 7.754   22.882 36.576  1.00 62.24  ? 883  SER A CB  1 
ATOM 6799 O OG  . SER A 1 886  ? 8.992   23.058 37.234  1.00 62.24  ? 883  SER A OG  1 
ATOM 6800 N N   . ILE A 1 887  ? 6.963   21.454 39.789  1.00 39.41  ? 884  ILE A N   1 
ATOM 6801 C CA  . ILE A 1 887  ? 6.880   21.792 41.195  1.00 39.41  ? 884  ILE A CA  1 
ATOM 6802 C C   . ILE A 1 887  ? 8.222   21.623 41.817  1.00 39.41  ? 884  ILE A C   1 
ATOM 6803 O O   . ILE A 1 887  ? 8.590   20.493 42.136  1.00 39.41  ? 884  ILE A O   1 
ATOM 6804 C CB  . ILE A 1 887  ? 5.980   20.851 41.955  1.00 25.96  ? 884  ILE A CB  1 
ATOM 6805 C CG1 . ILE A 1 887  ? 4.596   20.822 41.352  1.00 25.96  ? 884  ILE A CG1 1 
ATOM 6806 C CG2 . ILE A 1 887  ? 5.847   21.294 43.365  1.00 25.96  ? 884  ILE A CG2 1 
ATOM 6807 C CD1 . ILE A 1 887  ? 4.026   19.389 41.293  1.00 25.96  ? 884  ILE A CD1 1 
ATOM 6808 N N   . ASN A 1 888  ? 8.956   22.725 41.954  1.00 63.62  ? 885  ASN A N   1 
ATOM 6809 C CA  . ASN A 1 888  ? 10.089  22.805 42.855  1.00 63.62  ? 885  ASN A CA  1 
ATOM 6810 C C   . ASN A 1 888  ? 11.152  21.713 42.621  1.00 63.62  ? 885  ASN A C   1 
ATOM 6811 O O   . ASN A 1 888  ? 11.378  20.864 43.496  1.00 63.62  ? 885  ASN A O   1 
ATOM 6812 C CB  . ASN A 1 888  ? 9.523   22.746 44.276  1.00 73.22  ? 885  ASN A CB  1 
ATOM 6813 C CG  . ASN A 1 888  ? 10.431  23.357 45.296  1.00 73.22  ? 885  ASN A CG  1 
ATOM 6814 O OD1 . ASN A 1 888  ? 11.509  22.843 45.564  1.00 73.22  ? 885  ASN A OD1 1 
ATOM 6815 N ND2 . ASN A 1 888  ? 9.990   24.455 45.897  1.00 73.22  ? 885  ASN A ND2 1 
ATOM 6816 N N   . SER A 1 889  ? 11.788  21.716 41.444  1.00 46.61  ? 886  SER A N   1 
ATOM 6817 C CA  . SER A 1 889  ? 12.727  20.617 41.006  1.00 46.61  ? 886  SER A CA  1 
ATOM 6818 C C   . SER A 1 889  ? 12.096  19.297 40.585  1.00 46.61  ? 886  SER A C   1 
ATOM 6819 O O   . SER A 1 889  ? 12.811  18.366 40.277  1.00 46.61  ? 886  SER A O   1 
ATOM 6820 C CB  . SER A 1 889  ? 13.810  20.281 42.030  1.00 45.86  ? 886  SER A CB  1 
ATOM 6821 O OG  . SER A 1 889  ? 14.539  21.428 42.420  1.00 45.86  ? 886  SER A OG  1 
ATOM 6822 N N   . THR A 1 890  ? 10.774  19.215 40.556  1.00 54.59  ? 887  THR A N   1 
ATOM 6823 C CA  . THR A 1 890  ? 10.092  18.022 40.071  1.00 54.59  ? 887  THR A CA  1 
ATOM 6824 C C   . THR A 1 890  ? 9.148   18.400 38.922  1.00 54.59  ? 887  THR A C   1 
ATOM 6825 O O   . THR A 1 890  ? 8.612   19.509 38.926  1.00 54.59  ? 887  THR A O   1 
ATOM 6826 C CB  . THR A 1 890  ? 9.289   17.329 41.215  1.00 56.35  ? 887  THR A CB  1 
ATOM 6827 O OG1 . THR A 1 890  ? 10.153  17.054 42.332  1.00 56.35  ? 887  THR A OG1 1 
ATOM 6828 C CG2 . THR A 1 890  ? 8.669   16.035 40.726  1.00 56.35  ? 887  THR A CG2 1 
ATOM 6829 N N   . VAL A 1 891  ? 8.955   17.504 37.946  1.00 41.92  ? 888  VAL A N   1 
ATOM 6830 C CA  . VAL A 1 891  ? 7.977   17.727 36.883  1.00 41.92  ? 888  VAL A CA  1 
ATOM 6831 C C   . VAL A 1 891  ? 6.967   16.582 36.845  1.00 41.92  ? 888  VAL A C   1 
ATOM 6832 O O   . VAL A 1 891  ? 7.344   15.416 36.724  1.00 41.92  ? 888  VAL A O   1 
ATOM 6833 C CB  . VAL A 1 891  ? 8.644   18.014 35.480  1.00 35.97  ? 888  VAL A CB  1 
ATOM 6834 C CG1 . VAL A 1 891  ? 7.703   17.698 34.327  1.00 35.97  ? 888  VAL A CG1 1 
ATOM 6835 C CG2 . VAL A 1 891  ? 9.039   19.473 35.382  1.00 35.97  ? 888  VAL A CG2 1 
ATOM 6836 N N   . ARG A 1 892  ? 5.683   16.928 36.949  1.00 33.29  ? 889  ARG A N   1 
ATOM 6837 C CA  . ARG A 1 892  ? 4.610   15.949 37.164  1.00 33.29  ? 889  ARG A CA  1 
ATOM 6838 C C   . ARG A 1 892  ? 3.477   16.247 36.253  1.00 33.29  ? 889  ARG A C   1 
ATOM 6839 O O   . ARG A 1 892  ? 3.135   17.415 36.047  1.00 33.29  ? 889  ARG A O   1 
ATOM 6840 C CB  . ARG A 1 892  ? 4.068   16.018 38.577  1.00 55.33  ? 889  ARG A CB  1 
ATOM 6841 C CG  . ARG A 1 892  ? 5.028   15.579 39.621  1.00 55.33  ? 889  ARG A CG  1 
ATOM 6842 C CD  . ARG A 1 892  ? 4.338   15.573 40.954  1.00 55.33  ? 889  ARG A CD  1 
ATOM 6843 N NE  . ARG A 1 892  ? 5.278   15.188 41.982  1.00 55.33  ? 889  ARG A NE  1 
ATOM 6844 C CZ  . ARG A 1 892  ? 5.695   13.943 42.159  1.00 55.33  ? 889  ARG A CZ  1 
ATOM 6845 N NH1 . ARG A 1 892  ? 5.232   12.954 41.380  1.00 55.33  ? 889  ARG A NH1 1 
ATOM 6846 N NH2 . ARG A 1 892  ? 6.570   13.690 43.123  1.00 55.33  ? 889  ARG A NH2 1 
ATOM 6847 N N   . LEU A 1 893  ? 2.886   15.185 35.719  1.00 39.32  ? 890  LEU A N   1 
ATOM 6848 C CA  . LEU A 1 893  ? 1.791   15.296 34.782  1.00 39.32  ? 890  LEU A CA  1 
ATOM 6849 C C   . LEU A 1 893  ? 0.523   15.098 35.574  1.00 39.32  ? 890  LEU A C   1 
ATOM 6850 O O   . LEU A 1 893  ? 0.498   14.259 36.457  1.00 39.32  ? 890  LEU A O   1 
ATOM 6851 C CB  . LEU A 1 893  ? 1.940   14.231 33.718  1.00 46.69  ? 890  LEU A CB  1 
ATOM 6852 C CG  . LEU A 1 893  ? 1.582   14.552 32.269  1.00 46.69  ? 890  LEU A CG  1 
ATOM 6853 C CD1 . LEU A 1 893  ? 1.875   15.988 31.844  1.00 46.69  ? 890  LEU A CD1 1 
ATOM 6854 C CD2 . LEU A 1 893  ? 2.321   13.558 31.361  1.00 46.69  ? 890  LEU A CD2 1 
ATOM 6855 N N   . TYR A 1 894  ? -0.506  15.907 35.322  1.00 36.47  ? 891  TYR A N   1 
ATOM 6856 C CA  . TYR A 1 894  ? -1.773  15.768 36.061  1.00 36.47  ? 891  TYR A CA  1 
ATOM 6857 C C   . TYR A 1 894  ? -2.944  15.481 35.158  1.00 36.47  ? 891  TYR A C   1 
ATOM 6858 O O   . TYR A 1 894  ? -3.049  16.036 34.055  1.00 36.47  ? 891  TYR A O   1 
ATOM 6859 C CB  . TYR A 1 894  ? -2.067  16.991 36.918  1.00 39.53  ? 891  TYR A CB  1 
ATOM 6860 C CG  . TYR A 1 894  ? -1.165  17.107 38.108  1.00 39.53  ? 891  TYR A CG  1 
ATOM 6861 C CD1 . TYR A 1 894  ? 0.126   17.583 37.969  1.00 39.53  ? 891  TYR A CD1 1 
ATOM 6862 C CD2 . TYR A 1 894  ? -1.605  16.735 39.371  1.00 39.53  ? 891  TYR A CD2 1 
ATOM 6863 C CE1 . TYR A 1 894  ? 0.970   17.684 39.048  1.00 39.53  ? 891  TYR A CE1 1 
ATOM 6864 C CE2 . TYR A 1 894  ? -0.781  16.850 40.472  1.00 39.53  ? 891  TYR A CE2 1 
ATOM 6865 C CZ  . TYR A 1 894  ? 0.522   17.325 40.301  1.00 39.53  ? 891  TYR A CZ  1 
ATOM 6866 O OH  . TYR A 1 894  ? 1.373   17.436 41.378  1.00 39.53  ? 891  TYR A OH  1 
ATOM 6867 N N   . GLU A 1 895  ? -3.808  14.597 35.649  1.00 50.28  ? 892  GLU A N   1 
ATOM 6868 C CA  . GLU A 1 895  ? -5.001  14.116 34.955  1.00 50.28  ? 892  GLU A CA  1 
ATOM 6869 C C   . GLU A 1 895  ? -6.247  14.829 35.498  1.00 50.28  ? 892  GLU A C   1 
ATOM 6870 O O   . GLU A 1 895  ? -6.367  15.095 36.701  1.00 50.28  ? 892  GLU A O   1 
ATOM 6871 C CB  . GLU A 1 895  ? -5.089  12.612 35.204  1.00 83.25  ? 892  GLU A CB  1 
ATOM 6872 C CG  . GLU A 1 895  ? -6.173  11.834 34.494  1.00 83.25  ? 892  GLU A CG  1 
ATOM 6873 C CD  . GLU A 1 895  ? -6.303  10.424 35.057  1.00 83.25  ? 892  GLU A CD  1 
ATOM 6874 O OE1 . GLU A 1 895  ? -5.480  10.024 35.921  1.00 83.25  ? 892  GLU A OE1 1 
ATOM 6875 O OE2 . GLU A 1 895  ? -7.240  9.716  34.649  1.00 83.25  ? 892  GLU A OE2 1 
ATOM 6876 N N   . TRP A 1 896  ? -7.178  15.157 34.618  1.00 45.08  ? 893  TRP A N   1 
ATOM 6877 C CA  . TRP A 1 896  ? -8.411  15.801 35.068  1.00 45.08  ? 893  TRP A CA  1 
ATOM 6878 C C   . TRP A 1 896  ? -9.555  14.815 34.961  1.00 45.08  ? 893  TRP A C   1 
ATOM 6879 O O   . TRP A 1 896  ? -10.197 14.676 33.922  1.00 45.08  ? 893  TRP A O   1 
ATOM 6880 C CB  . TRP A 1 896  ? -8.670  17.100 34.301  1.00 29.03  ? 893  TRP A CB  1 
ATOM 6881 C CG  . TRP A 1 896  ? -9.925  17.862 34.643  1.00 29.03  ? 893  TRP A CG  1 
ATOM 6882 C CD1 . TRP A 1 896  ? -10.986 18.074 33.818  1.00 29.03  ? 893  TRP A CD1 1 
ATOM 6883 C CD2 . TRP A 1 896  ? -10.214 18.576 35.856  1.00 29.03  ? 893  TRP A CD2 1 
ATOM 6884 N NE1 . TRP A 1 896  ? -11.927 18.873 34.440  1.00 29.03  ? 893  TRP A NE1 1 
ATOM 6885 C CE2 . TRP A 1 896  ? -11.479 19.191 35.692  1.00 29.03  ? 893  TRP A CE2 1 
ATOM 6886 C CE3 . TRP A 1 896  ? -9.531  18.755 37.066  1.00 29.03  ? 893  TRP A CE3 1 
ATOM 6887 C CZ2 . TRP A 1 896  ? -12.083 19.960 36.693  1.00 29.03  ? 893  TRP A CZ2 1 
ATOM 6888 C CZ3 . TRP A 1 896  ? -10.134 19.545 38.083  1.00 29.03  ? 893  TRP A CZ3 1 
ATOM 6889 C CH2 . TRP A 1 896  ? -11.394 20.129 37.880  1.00 29.03  ? 893  TRP A CH2 1 
ATOM 6890 N N   . THR A 1 897  ? -9.729  14.107 36.070  1.00 68.91  ? 894  THR A N   1 
ATOM 6891 C CA  . THR A 1 897  ? -10.803 13.167 36.351  1.00 68.91  ? 894  THR A CA  1 
ATOM 6892 C C   . THR A 1 897  ? -12.147 13.678 35.855  1.00 68.91  ? 894  THR A C   1 
ATOM 6893 O O   . THR A 1 897  ? -12.302 14.877 35.619  1.00 68.91  ? 894  THR A O   1 
ATOM 6894 C CB  . THR A 1 897  ? -10.824 12.970 37.855  1.00 63.81  ? 894  THR A CB  1 
ATOM 6895 O OG1 . THR A 1 897  ? -9.760  12.090 38.219  1.00 63.81  ? 894  THR A OG1 1 
ATOM 6896 C CG2 . THR A 1 897  ? -12.112 12.437 38.351  1.00 63.81  ? 894  THR A CG2 1 
ATOM 6897 N N   . THR A 1 898  ? -13.122 12.789 35.679  1.00 42.68  ? 895  THR A N   1 
ATOM 6898 C CA  . THR A 1 898  ? -14.403 13.244 35.134  1.00 42.68  ? 895  THR A CA  1 
ATOM 6899 C C   . THR A 1 898  ? -15.304 13.776 36.221  1.00 42.68  ? 895  THR A C   1 
ATOM 6900 O O   . THR A 1 898  ? -16.295 14.460 35.945  1.00 42.68  ? 895  THR A O   1 
ATOM 6901 C CB  . THR A 1 898  ? -15.162 12.165 34.415  1.00 42.62  ? 895  THR A CB  1 
ATOM 6902 O OG1 . THR A 1 898  ? -15.646 11.248 35.400  1.00 42.62  ? 895  THR A OG1 1 
ATOM 6903 C CG2 . THR A 1 898  ? -14.259 11.465 33.321  1.00 42.62  ? 895  THR A CG2 1 
ATOM 6904 N N   . GLU A 1 899  ? -14.936 13.450 37.449  1.00 43.57  ? 896  GLU A N   1 
ATOM 6905 C CA  . GLU A 1 899  ? -15.552 13.981 38.640  1.00 43.57  ? 896  GLU A CA  1 
ATOM 6906 C C   . GLU A 1 899  ? -14.910 15.323 39.007  1.00 43.57  ? 896  GLU A C   1 
ATOM 6907 O O   . GLU A 1 899  ? -14.998 15.762 40.167  1.00 43.57  ? 896  GLU A O   1 
ATOM 6908 C CB  . GLU A 1 899  ? -15.366 12.988 39.799  1.00 74.09  ? 896  GLU A CB  1 
ATOM 6909 C CG  . GLU A 1 899  ? -16.111 11.653 39.669  1.00 74.09  ? 896  GLU A CG  1 
ATOM 6910 C CD  . GLU A 1 899  ? -15.504 10.698 38.645  1.00 74.09  ? 896  GLU A CD  1 
ATOM 6911 O OE1 . GLU A 1 899  ? -14.282 10.453 38.674  1.00 74.09  ? 896  GLU A OE1 1 
ATOM 6912 O OE2 . GLU A 1 899  ? -16.267 10.160 37.824  1.00 74.09  ? 896  GLU A OE2 1 
ATOM 6913 N N   . LYS A 1 900  ? -14.241 15.955 38.030  1.00 36.98  ? 897  LYS A N   1 
ATOM 6914 C CA  . LYS A 1 900  ? -13.622 17.278 38.178  1.00 36.98  ? 897  LYS A CA  1 
ATOM 6915 C C   . LYS A 1 900  ? -12.588 17.367 39.300  1.00 36.98  ? 897  LYS A C   1 
ATOM 6916 O O   . LYS A 1 900  ? -12.663 18.262 40.121  1.00 36.98  ? 897  LYS A O   1 
ATOM 6917 C CB  . LYS A 1 900  ? -14.697 18.357 38.336  1.00 44.45  ? 897  LYS A CB  1 
ATOM 6918 C CG  . LYS A 1 900  ? -15.561 18.540 37.066  1.00 44.45  ? 897  LYS A CG  1 
ATOM 6919 C CD  . LYS A 1 900  ? -16.503 19.741 37.155  1.00 44.45  ? 897  LYS A CD  1 
ATOM 6920 C CE  . LYS A 1 900  ? -17.597 19.698 36.048  1.00 44.45  ? 897  LYS A CE  1 
ATOM 6921 N NZ  . LYS A 1 900  ? -17.138 19.889 34.620  1.00 44.45  ? 897  LYS A NZ  1 
ATOM 6922 N N   . ASP A 1 901  ? -11.621 16.445 39.288  1.00 39.66  ? 898  ASP A N   1 
ATOM 6923 C CA  . ASP A 1 901  ? -10.597 16.260 40.297  1.00 39.66  ? 898  ASP A CA  1 
ATOM 6924 C C   . ASP A 1 901  ? -9.266  16.275 39.509  1.00 39.66  ? 898  ASP A C   1 
ATOM 6925 O O   . ASP A 1 901  ? -9.221  15.757 38.364  1.00 39.66  ? 898  ASP A O   1 
ATOM 6926 C CB  . ASP A 1 901  ? -10.803 14.866 40.894  1.00 76.22  ? 898  ASP A CB  1 
ATOM 6927 C CG  . ASP A 1 901  ? -10.776 14.846 42.413  1.00 76.22  ? 898  ASP A CG  1 
ATOM 6928 O OD1 . ASP A 1 901  ? -11.110 13.792 43.014  1.00 76.22  ? 898  ASP A OD1 1 
ATOM 6929 O OD2 . ASP A 1 901  ? -10.422 15.880 43.007  1.00 76.22  ? 898  ASP A OD2 1 
ATOM 6930 N N   . VAL A 1 902  ? -8.186  16.872 40.049  1.00 38.73  ? 899  VAL A N   1 
ATOM 6931 C CA  . VAL A 1 902  ? -6.857  16.725 39.376  1.00 38.73  ? 899  VAL A CA  1 
ATOM 6932 C C   . VAL A 1 902  ? -6.025  15.654 40.081  1.00 38.73  ? 899  VAL A C   1 
ATOM 6933 O O   . VAL A 1 902  ? -5.944  15.667 41.318  1.00 38.73  ? 899  VAL A O   1 
ATOM 6934 C CB  . VAL A 1 902  ? -5.981  18.084 39.198  1.00 54.85  ? 899  VAL A CB  1 
ATOM 6935 C CG1 . VAL A 1 902  ? -6.426  18.933 38.024  1.00 54.85  ? 899  VAL A CG1 1 
ATOM 6936 C CG2 . VAL A 1 902  ? -5.924  18.907 40.439  1.00 54.85  ? 899  VAL A CG2 1 
ATOM 6937 N N   . ARG A 1 903  ? -5.414  14.740 39.326  1.00 41.42  ? 900  ARG A N   1 
ATOM 6938 C CA  . ARG A 1 903  ? -4.617  13.655 39.966  1.00 41.42  ? 900  ARG A CA  1 
ATOM 6939 C C   . ARG A 1 903  ? -3.454  13.130 39.141  1.00 41.42  ? 900  ARG A C   1 
ATOM 6940 O O   . ARG A 1 903  ? -3.521  13.067 37.895  1.00 41.42  ? 900  ARG A O   1 
ATOM 6941 C CB  . ARG A 1 903  ? -5.490  12.467 40.379  1.00 60.04  ? 900  ARG A CB  1 
ATOM 6942 C CG  . ARG A 1 903  ? -6.012  11.680 39.208  1.00 60.04  ? 900  ARG A CG  1 
ATOM 6943 C CD  . ARG A 1 903  ? -6.690  10.404 39.638  1.00 60.04  ? 900  ARG A CD  1 
ATOM 6944 N NE  . ARG A 1 903  ? -6.972  9.599  38.452  1.00 60.04  ? 900  ARG A NE  1 
ATOM 6945 C CZ  . ARG A 1 903  ? -8.094  8.922  38.219  1.00 60.04  ? 900  ARG A CZ  1 
ATOM 6946 N NH1 . ARG A 1 903  ? -9.100  8.920  39.089  1.00 60.04  ? 900  ARG A NH1 1 
ATOM 6947 N NH2 . ARG A 1 903  ? -8.206  8.256  37.085  1.00 60.04  ? 900  ARG A NH2 1 
ATOM 6948 N N   . THR A 1 904  ? -2.406  12.723 39.850  1.00 50.18  ? 901  THR A N   1 
ATOM 6949 C CA  . THR A 1 904  ? -1.152  12.311 39.230  1.00 50.18  ? 901  THR A CA  1 
ATOM 6950 C C   . THR A 1 904  ? -0.826  10.885 39.625  1.00 50.18  ? 901  THR A C   1 
ATOM 6951 O O   . THR A 1 904  ? -1.410  10.354 40.567  1.00 50.18  ? 901  THR A O   1 
ATOM 6952 C CB  . THR A 1 904  ? 0.023   13.258 39.647  1.00 62.46  ? 901  THR A CB  1 
ATOM 6953 O OG1 . THR A 1 904  ? 1.259   12.775 39.108  1.00 62.46  ? 901  THR A OG1 1 
ATOM 6954 C CG2 . THR A 1 904  ? 0.156   13.353 41.162  1.00 62.46  ? 901  THR A CG2 1 
ATOM 6955 N N   . GLU A 1 905  ? 0.105   10.265 38.913  1.00 49.52  ? 902  GLU A N   1 
ATOM 6956 C CA  . GLU A 1 905  ? 0.637   8.980  39.340  1.00 49.52  ? 902  GLU A CA  1 
ATOM 6957 C C   . GLU A 1 905  ? 1.989   9.205  39.978  1.00 49.52  ? 902  GLU A C   1 
ATOM 6958 O O   . GLU A 1 905  ? 3.003   9.222  39.283  1.00 49.52  ? 902  GLU A O   1 
ATOM 6959 C CB  . GLU A 1 905  ? 0.782   8.020  38.167  1.00 57.55  ? 902  GLU A CB  1 
ATOM 6960 C CG  . GLU A 1 905  ? -0.506  7.674  37.487  1.00 57.55  ? 902  GLU A CG  1 
ATOM 6961 C CD  . GLU A 1 905  ? -0.260  6.822  36.284  1.00 57.55  ? 902  GLU A CD  1 
ATOM 6962 O OE1 . GLU A 1 905  ? 0.531   5.852  36.400  1.00 57.55  ? 902  GLU A OE1 1 
ATOM 6963 O OE2 . GLU A 1 905  ? -0.844  7.117  35.220  1.00 57.55  ? 902  GLU A OE2 1 
ATOM 6964 N N   . CYS A 1 906  ? 1.984   9.347  41.304  1.00 36.32  ? 903  CYS A N   1 
ATOM 6965 C CA  . CYS A 1 906  ? 3.146   9.748  42.107  1.00 36.32  ? 903  CYS A CA  1 
ATOM 6966 C C   . CYS A 1 906  ? 4.499   9.043  41.877  1.00 36.32  ? 903  CYS A C   1 
ATOM 6967 O O   . CYS A 1 906  ? 5.534   9.564  42.274  1.00 36.32  ? 903  CYS A O   1 
ATOM 6968 C CB  . CYS A 1 906  ? 2.780   9.897  43.598  1.00 68.56  ? 903  CYS A CB  1 
ATOM 6969 S SG  . CYS A 1 906  ? 2.588   11.671 44.110  1.00 68.56  ? 903  CYS A SG  1 
ATOM 6970 N N   . ASN A 1 907  ? 4.519   7.903  41.201  1.00 68.94  ? 904  ASN A N   1 
ATOM 6971 C CA  . ASN A 1 907  ? 5.809   7.350  40.785  1.00 68.94  ? 904  ASN A CA  1 
ATOM 6972 C C   . ASN A 1 907  ? 6.246   7.788  39.377  1.00 68.94  ? 904  ASN A C   1 
ATOM 6973 O O   . ASN A 1 907  ? 7.326   7.414  38.902  1.00 68.94  ? 904  ASN A O   1 
ATOM 6974 C CB  . ASN A 1 907  ? 5.851   5.829  40.937  1.00 88.99  ? 904  ASN A CB  1 
ATOM 6975 C CG  . ASN A 1 907  ? 7.205   5.340  41.443  1.00 88.99  ? 904  ASN A CG  1 
ATOM 6976 O OD1 . ASN A 1 907  ? 8.145   5.128  40.668  1.00 88.99  ? 904  ASN A OD1 1 
ATOM 6977 N ND2 . ASN A 1 907  ? 7.312   5.174  42.755  1.00 88.99  ? 904  ASN A ND2 1 
ATOM 6978 N N   . HIS A 1 908  ? 5.406   8.589  38.722  1.00 68.97  ? 905  HIS A N   1 
ATOM 6979 C CA  . HIS A 1 908  ? 5.701   9.104  37.385  1.00 68.97  ? 905  HIS A CA  1 
ATOM 6980 C C   . HIS A 1 908  ? 6.041   10.587 37.442  1.00 68.97  ? 905  HIS A C   1 
ATOM 6981 O O   . HIS A 1 908  ? 5.160   11.460 37.363  1.00 68.97  ? 905  HIS A O   1 
ATOM 6982 C CB  . HIS A 1 908  ? 4.549   8.825  36.421  1.00 90.96  ? 905  HIS A CB  1 
ATOM 6983 C CG  . HIS A 1 908  ? 4.424   7.385  36.037  1.00 90.96  ? 905  HIS A CG  1 
ATOM 6984 N ND1 . HIS A 1 908  ? 3.239   6.831  35.604  1.00 90.96  ? 905  HIS A ND1 1 
ATOM 6985 C CD2 . HIS A 1 908  ? 5.336   6.382  36.029  1.00 90.96  ? 905  HIS A CD2 1 
ATOM 6986 C CE1 . HIS A 1 908  ? 3.428   5.551  35.337  1.00 90.96  ? 905  HIS A CE1 1 
ATOM 6987 N NE2 . HIS A 1 908  ? 4.691   5.253  35.588  1.00 90.96  ? 905  HIS A NE2 1 
ATOM 6988 N N   . TYR A 1 909  ? 7.334   10.859 37.600  1.00 40.02  ? 906  TYR A N   1 
ATOM 6989 C CA  . TYR A 1 909  ? 7.814   12.208 37.810  1.00 40.02  ? 906  TYR A CA  1 
ATOM 6990 C C   . TYR A 1 909  ? 9.159   12.446 37.149  1.00 40.02  ? 906  TYR A C   1 
ATOM 6991 O O   . TYR A 1 909  ? 9.585   11.677 36.285  1.00 40.02  ? 906  TYR A O   1 
ATOM 6992 C CB  . TYR A 1 909  ? 7.842   12.553 39.295  1.00 106.68 ? 906  TYR A CB  1 
ATOM 6993 C CG  . TYR A 1 909  ? 8.683   11.641 40.145  1.00 106.68 ? 906  TYR A CG  1 
ATOM 6994 C CD1 . TYR A 1 909  ? 10.060  11.836 40.262  1.00 106.68 ? 906  TYR A CD1 1 
ATOM 6995 C CD2 . TYR A 1 909  ? 8.100   10.609 40.863  1.00 106.68 ? 906  TYR A CD2 1 
ATOM 6996 C CE1 . TYR A 1 909  ? 10.836  11.015 41.057  1.00 106.68 ? 906  TYR A CE1 1 
ATOM 6997 C CE2 . TYR A 1 909  ? 8.862   9.780  41.664  1.00 106.68 ? 906  TYR A CE2 1 
ATOM 6998 C CZ  . TYR A 1 909  ? 10.232  9.984  41.757  1.00 106.68 ? 906  TYR A CZ  1 
ATOM 6999 O OH  . TYR A 1 909  ? 10.999  9.153  42.551  1.00 106.68 ? 906  TYR A OH  1 
ATOM 7000 N N   . ASN A 1 910  ? 9.808   13.533 37.568  1.00 99.90  ? 907  ASN A N   1 
ATOM 7001 C CA  . ASN A 1 910  ? 10.942  14.132 36.883  1.00 99.90  ? 907  ASN A CA  1 
ATOM 7002 C C   . ASN A 1 910  ? 11.858  14.858 37.831  1.00 99.90  ? 907  ASN A C   1 
ATOM 7003 O O   . ASN A 1 910  ? 11.390  15.548 38.737  1.00 99.90  ? 907  ASN A O   1 
ATOM 7004 C CB  . ASN A 1 910  ? 10.420  15.174 35.907  1.00 197.99 ? 907  ASN A CB  1 
ATOM 7005 C CG  . ASN A 1 910  ? 11.451  16.209 35.562  1.00 197.99 ? 907  ASN A CG  1 
ATOM 7006 O OD1 . ASN A 1 910  ? 11.380  17.341 36.030  1.00 197.99 ? 907  ASN A OD1 1 
ATOM 7007 N ND2 . ASN A 1 910  ? 12.436  15.821 34.764  1.00 197.99 ? 907  ASN A ND2 1 
ATOM 7008 N N   . ASN A 1 911  ? 13.162  14.747 37.601  1.00 56.52  ? 908  ASN A N   1 
ATOM 7009 C CA  . ASN A 1 911  ? 14.123  15.543 38.366  1.00 56.52  ? 908  ASN A CA  1 
ATOM 7010 C C   . ASN A 1 911  ? 14.650  16.698 37.535  1.00 56.52  ? 908  ASN A C   1 
ATOM 7011 O O   . ASN A 1 911  ? 15.807  16.679 37.089  1.00 56.52  ? 908  ASN A O   1 
ATOM 7012 C CB  . ASN A 1 911  ? 15.260  14.681 38.890  1.00 76.99  ? 908  ASN A CB  1 
ATOM 7013 C CG  . ASN A 1 911  ? 14.778  13.583 39.800  1.00 76.99  ? 908  ASN A CG  1 
ATOM 7014 O OD1 . ASN A 1 911  ? 13.692  13.664 40.390  1.00 76.99  ? 908  ASN A OD1 1 
ATOM 7015 N ND2 . ASN A 1 911  ? 15.584  12.538 39.923  1.00 76.99  ? 908  ASN A ND2 1 
ATOM 7016 N N   . ILE A 1 912  ? 13.763  17.680 37.311  1.00 75.09  ? 909  ILE A N   1 
ATOM 7017 C CA  . ILE A 1 912  ? 14.074  18.943 36.630  1.00 75.09  ? 909  ILE A CA  1 
ATOM 7018 C C   . ILE A 1 912  ? 13.489  20.113 37.407  1.00 75.09  ? 909  ILE A C   1 
ATOM 7019 O O   . ILE A 1 912  ? 12.401  20.009 37.951  1.00 75.09  ? 909  ILE A O   1 
ATOM 7020 C CB  . ILE A 1 912  ? 13.531  18.989 35.159  1.00 77.23  ? 909  ILE A CB  1 
ATOM 7021 C CG1 . ILE A 1 912  ? 14.352  18.109 34.227  1.00 77.23  ? 909  ILE A CG1 1 
ATOM 7022 C CG2 . ILE A 1 912  ? 13.605  20.391 34.588  1.00 77.23  ? 909  ILE A CG2 1 
ATOM 7023 C CD1 . ILE A 1 912  ? 13.867  18.154 32.804  1.00 77.23  ? 909  ILE A CD1 1 
ATOM 7024 N N   . MET A 1 913  ? 14.228  21.218 37.436  1.00 50.31  ? 910  MET A N   1 
ATOM 7025 C CA  . MET A 1 913  ? 13.740  22.519 37.920  1.00 50.31  ? 910  MET A CA  1 
ATOM 7026 C C   . MET A 1 913  ? 13.331  23.445 36.717  1.00 50.31  ? 910  MET A C   1 
ATOM 7027 O O   . MET A 1 913  ? 14.046  24.411 36.378  1.00 50.31  ? 910  MET A O   1 
ATOM 7028 C CB  . MET A 1 913  ? 14.802  23.126 38.863  1.00 61.34  ? 910  MET A CB  1 
ATOM 7029 C CG  . MET A 1 913  ? 15.017  24.638 38.827  1.00 61.34  ? 910  MET A CG  1 
ATOM 7030 S SD  . MET A 1 913  ? 13.924  25.545 39.934  1.00 61.34  ? 910  MET A SD  1 
ATOM 7031 C CE  . MET A 1 913  ? 14.436  24.929 41.554  1.00 61.34  ? 910  MET A CE  1 
ATOM 7032 N N   . ALA A 1 914  ? 12.185  23.147 36.078  1.00 42.25  ? 911  ALA A N   1 
ATOM 7033 C CA  . ALA A 1 914  ? 11.757  23.873 34.857  1.00 42.25  ? 911  ALA A CA  1 
ATOM 7034 C C   . ALA A 1 914  ? 11.261  25.314 35.103  1.00 42.25  ? 911  ALA A C   1 
ATOM 7035 O O   . ALA A 1 914  ? 10.064  25.601 35.117  1.00 42.25  ? 911  ALA A O   1 
ATOM 7036 C CB  . ALA A 1 914  ? 10.748  23.057 34.030  1.00 43.80  ? 911  ALA A CB  1 
ATOM 7037 N N   . LEU A 1 915  ? 12.218  26.221 35.278  1.00 40.76  ? 912  LEU A N   1 
ATOM 7038 C CA  . LEU A 1 915  ? 11.917  27.605 35.556  1.00 40.76  ? 912  LEU A CA  1 
ATOM 7039 C C   . LEU A 1 915  ? 11.198  28.228 34.381  1.00 40.76  ? 912  LEU A C   1 
ATOM 7040 O O   . LEU A 1 915  ? 10.365  29.096 34.559  1.00 40.76  ? 912  LEU A O   1 
ATOM 7041 C CB  . LEU A 1 915  ? 13.206  28.353 35.786  1.00 58.28  ? 912  LEU A CB  1 
ATOM 7042 C CG  . LEU A 1 915  ? 13.284  29.354 36.934  1.00 58.28  ? 912  LEU A CG  1 
ATOM 7043 C CD1 . LEU A 1 915  ? 14.452  30.295 36.589  1.00 58.28  ? 912  LEU A CD1 1 
ATOM 7044 C CD2 . LEU A 1 915  ? 11.975  30.122 37.217  1.00 58.28  ? 912  LEU A CD2 1 
ATOM 7045 N N   . TYR A 1 916  ? 11.549  27.793 33.179  1.00 34.32  ? 913  TYR A N   1 
ATOM 7046 C CA  . TYR A 1 916  ? 10.880  28.227 31.965  1.00 34.32  ? 913  TYR A CA  1 
ATOM 7047 C C   . TYR A 1 916  ? 10.506  26.960 31.222  1.00 34.32  ? 913  TYR A C   1 
ATOM 7048 O O   . TYR A 1 916  ? 11.274  25.989 31.265  1.00 34.32  ? 913  TYR A O   1 
ATOM 7049 C CB  . TYR A 1 916  ? 11.830  29.085 31.129  1.00 32.10  ? 913  TYR A CB  1 
ATOM 7050 C CG  . TYR A 1 916  ? 12.623  30.089 31.952  1.00 32.10  ? 913  TYR A CG  1 
ATOM 7051 C CD1 . TYR A 1 916  ? 14.009  29.993 32.072  1.00 32.10  ? 913  TYR A CD1 1 
ATOM 7052 C CD2 . TYR A 1 916  ? 11.977  31.125 32.632  1.00 32.10  ? 913  TYR A CD2 1 
ATOM 7053 C CE1 . TYR A 1 916  ? 14.721  30.905 32.828  1.00 32.10  ? 913  TYR A CE1 1 
ATOM 7054 C CE2 . TYR A 1 916  ? 12.677  32.038 33.399  1.00 32.10  ? 913  TYR A CE2 1 
ATOM 7055 C CZ  . TYR A 1 916  ? 14.042  31.939 33.486  1.00 32.10  ? 913  TYR A CZ  1 
ATOM 7056 O OH  . TYR A 1 916  ? 14.717  32.871 34.255  1.00 32.10  ? 913  TYR A OH  1 
ATOM 7057 N N   . LEU A 1 917  ? 9.358   26.953 30.538  1.00 32.56  ? 914  LEU A N   1 
ATOM 7058 C CA  . LEU A 1 917  ? 8.825   25.747 29.915  1.00 32.56  ? 914  LEU A CA  1 
ATOM 7059 C C   . LEU A 1 917  ? 8.089   26.026 28.588  1.00 32.56  ? 914  LEU A C   1 
ATOM 7060 O O   . LEU A 1 917  ? 7.335   26.975 28.495  1.00 32.56  ? 914  LEU A O   1 
ATOM 7061 C CB  . LEU A 1 917  ? 7.845   25.140 30.916  1.00 38.44  ? 914  LEU A CB  1 
ATOM 7062 C CG  . LEU A 1 917  ? 7.140   23.779 30.795  1.00 38.44  ? 914  LEU A CG  1 
ATOM 7063 C CD1 . LEU A 1 917  ? 8.103   22.578 30.968  1.00 38.44  ? 914  LEU A CD1 1 
ATOM 7064 C CD2 . LEU A 1 917  ? 6.028   23.749 31.847  1.00 38.44  ? 914  LEU A CD2 1 
ATOM 7065 N N   . LYS A 1 918  ? 8.267   25.194 27.563  1.00 45.35  ? 915  LYS A N   1 
ATOM 7066 C CA  . LYS A 1 918  ? 7.442   25.322 26.344  1.00 45.35  ? 915  LYS A CA  1 
ATOM 7067 C C   . LYS A 1 918  ? 7.111   23.959 25.716  1.00 45.35  ? 915  LYS A C   1 
ATOM 7068 O O   . LYS A 1 918  ? 7.857   22.993 25.913  1.00 45.35  ? 915  LYS A O   1 
ATOM 7069 C CB  . LYS A 1 918  ? 8.135   26.201 25.295  1.00 50.88  ? 915  LYS A CB  1 
ATOM 7070 C CG  . LYS A 1 918  ? 8.299   27.673 25.649  1.00 50.88  ? 915  LYS A CG  1 
ATOM 7071 C CD  . LYS A 1 918  ? 6.974   28.389 25.781  1.00 50.88  ? 915  LYS A CD  1 
ATOM 7072 C CE  . LYS A 1 918  ? 7.152   29.773 26.363  1.00 50.88  ? 915  LYS A CE  1 
ATOM 7073 N NZ  . LYS A 1 918  ? 7.713   30.663 25.343  1.00 50.88  ? 915  LYS A NZ  1 
ATOM 7074 N N   . THR A 1 919  ? 6.018   23.895 24.948  1.00 36.99  ? 916  THR A N   1 
ATOM 7075 C CA  . THR A 1 919  ? 5.571   22.646 24.359  1.00 36.99  ? 916  THR A CA  1 
ATOM 7076 C C   . THR A 1 919  ? 5.371   22.734 22.875  1.00 36.99  ? 916  THR A C   1 
ATOM 7077 O O   . THR A 1 919  ? 4.847   23.726 22.386  1.00 36.99  ? 916  THR A O   1 
ATOM 7078 C CB  . THR A 1 919  ? 4.289   22.135 25.006  1.00 50.84  ? 916  THR A CB  1 
ATOM 7079 O OG1 . THR A 1 919  ? 4.645   21.439 26.197  1.00 50.84  ? 916  THR A OG1 1 
ATOM 7080 C CG2 . THR A 1 919  ? 3.520   21.141 24.080  1.00 50.84  ? 916  THR A CG2 1 
ATOM 7081 N N   . LYS A 1 920  ? 5.813   21.689 22.167  1.00 84.12  ? 917  LYS A N   1 
ATOM 7082 C CA  . LYS A 1 920  ? 5.504   21.489 20.749  1.00 84.12  ? 917  LYS A CA  1 
ATOM 7083 C C   . LYS A 1 920  ? 4.350   20.520 20.678  1.00 84.12  ? 917  LYS A C   1 
ATOM 7084 O O   . LYS A 1 920  ? 4.430   19.441 21.269  1.00 84.12  ? 917  LYS A O   1 
ATOM 7085 C CB  . LYS A 1 920  ? 6.680   20.854 20.011  1.00 200.23 ? 917  LYS A CB  1 
ATOM 7086 C CG  . LYS A 1 920  ? 7.965   21.618 20.095  1.00 200.23 ? 917  LYS A CG  1 
ATOM 7087 C CD  . LYS A 1 920  ? 9.122   20.782 19.603  1.00 200.23 ? 917  LYS A CD  1 
ATOM 7088 C CE  . LYS A 1 920  ? 10.436  21.313 20.135  1.00 200.23 ? 917  LYS A CE  1 
ATOM 7089 N NZ  . LYS A 1 920  ? 10.487  21.356 21.628  1.00 200.23 ? 917  LYS A NZ  1 
ATOM 7090 N N   . GLY A 1 921  ? 3.297   20.910 19.948  1.00 150.17 ? 918  GLY A N   1 
ATOM 7091 C CA  . GLY A 1 921  ? 2.053   20.137 19.787  1.00 150.17 ? 918  GLY A CA  1 
ATOM 7092 C C   . GLY A 1 921  ? 2.228   18.632 19.826  1.00 150.17 ? 918  GLY A C   1 
ATOM 7093 O O   . GLY A 1 921  ? 1.288   17.891 20.124  1.00 150.17 ? 918  GLY A O   1 
ATOM 7094 N N   . ASP A 1 922  ? 3.447   18.196 19.513  1.00 94.79  ? 919  ASP A N   1 
ATOM 7095 C CA  . ASP A 1 922  ? 3.893   16.813 19.661  1.00 94.79  ? 919  ASP A CA  1 
ATOM 7096 C C   . ASP A 1 922  ? 4.065   16.496 21.153  1.00 94.79  ? 919  ASP A C   1 
ATOM 7097 O O   . ASP A 1 922  ? 3.469   17.150 22.015  1.00 94.79  ? 919  ASP A O   1 
ATOM 7098 C CB  . ASP A 1 922  ? 5.204   16.606 18.868  1.00 166.16 ? 919  ASP A CB  1 
ATOM 7099 C CG  . ASP A 1 922  ? 5.700   15.154 18.874  1.00 166.16 ? 919  ASP A CG  1 
ATOM 7100 O OD1 . ASP A 1 922  ? 4.891   14.228 19.092  1.00 166.16 ? 919  ASP A OD1 1 
ATOM 7101 O OD2 . ASP A 1 922  ? 6.912   14.939 18.656  1.00 166.16 ? 919  ASP A OD2 1 
ATOM 7102 N N   . PHE A 1 923  ? 4.882   15.491 21.445  1.00 51.39  ? 920  PHE A N   1 
ATOM 7103 C CA  . PHE A 1 923  ? 5.029   14.973 22.783  1.00 51.39  ? 920  PHE A CA  1 
ATOM 7104 C C   . PHE A 1 923  ? 6.300   15.562 23.398  1.00 51.39  ? 920  PHE A C   1 
ATOM 7105 O O   . PHE A 1 923  ? 6.976   14.882 24.184  1.00 51.39  ? 920  PHE A O   1 
ATOM 7106 C CB  . PHE A 1 923  ? 5.109   13.434 22.736  1.00 149.78 ? 920  PHE A CB  1 
ATOM 7107 C CG  . PHE A 1 923  ? 3.809   12.737 22.353  1.00 149.78 ? 920  PHE A CG  1 
ATOM 7108 C CD1 . PHE A 1 923  ? 2.904   13.310 21.452  1.00 149.78 ? 920  PHE A CD1 1 
ATOM 7109 C CD2 . PHE A 1 923  ? 3.516   11.473 22.873  1.00 149.78 ? 920  PHE A CD2 1 
ATOM 7110 C CE1 . PHE A 1 923  ? 1.721   12.655 21.099  1.00 149.78 ? 920  PHE A CE1 1 
ATOM 7111 C CE2 . PHE A 1 923  ? 2.337   10.805 22.524  1.00 149.78 ? 920  PHE A CE2 1 
ATOM 7112 C CZ  . PHE A 1 923  ? 1.438   11.398 21.637  1.00 149.78 ? 920  PHE A CZ  1 
ATOM 7113 N N   . ILE A 1 924  ? 6.604   16.822 23.032  1.00 42.83  ? 921  ILE A N   1 
ATOM 7114 C CA  . ILE A 1 924  ? 7.919   17.470 23.281  1.00 42.83  ? 921  ILE A CA  1 
ATOM 7115 C C   . ILE A 1 924  ? 7.862   18.663 24.247  1.00 42.83  ? 921  ILE A C   1 
ATOM 7116 O O   . ILE A 1 924  ? 6.783   19.116 24.606  1.00 42.83  ? 921  ILE A O   1 
ATOM 7117 C CB  . ILE A 1 924  ? 8.566   17.967 21.970  1.00 71.69  ? 921  ILE A CB  1 
ATOM 7118 C CG1 . ILE A 1 924  ? 8.286   17.010 20.808  1.00 71.69  ? 921  ILE A CG1 1 
ATOM 7119 C CG2 . ILE A 1 924  ? 10.045  18.113 22.164  1.00 71.69  ? 921  ILE A CG2 1 
ATOM 7120 C CD1 . ILE A 1 924  ? 9.101   17.276 19.522  1.00 71.69  ? 921  ILE A CD1 1 
ATOM 7121 N N   . LEU A 1 925  ? 9.032   19.213 24.588  1.00 55.30  ? 922  LEU A N   1 
ATOM 7122 C CA  . LEU A 1 925  ? 9.193   20.147 25.693  1.00 55.30  ? 922  LEU A CA  1 
ATOM 7123 C C   . LEU A 1 925  ? 10.610  20.712 25.836  1.00 55.30  ? 922  LEU A C   1 
ATOM 7124 O O   . LEU A 1 925  ? 11.554  19.922 25.954  1.00 55.30  ? 922  LEU A O   1 
ATOM 7125 C CB  . LEU A 1 925  ? 9.008   19.331 26.926  1.00 32.49  ? 922  LEU A CB  1 
ATOM 7126 C CG  . LEU A 1 925  ? 8.097   19.751 28.030  1.00 32.49  ? 922  LEU A CG  1 
ATOM 7127 C CD1 . LEU A 1 925  ? 6.695   19.874 27.444  1.00 32.49  ? 922  LEU A CD1 1 
ATOM 7128 C CD2 . LEU A 1 925  ? 8.251   18.618 29.089  1.00 32.49  ? 922  LEU A CD2 1 
ATOM 7129 N N   . VAL A 1 926  ? 10.749  22.049 25.884  1.00 38.65  ? 923  VAL A N   1 
ATOM 7130 C CA  . VAL A 1 926  ? 12.018  22.744 26.195  1.00 38.65  ? 923  VAL A CA  1 
ATOM 7131 C C   . VAL A 1 926  ? 11.924  23.195 27.637  1.00 38.65  ? 923  VAL A C   1 
ATOM 7132 O O   . VAL A 1 926  ? 10.986  23.911 27.966  1.00 38.65  ? 923  VAL A O   1 
ATOM 7133 C CB  . VAL A 1 926  ? 12.232  24.048 25.340  1.00 44.05  ? 923  VAL A CB  1 
ATOM 7134 C CG1 . VAL A 1 926  ? 13.658  24.182 24.829  1.00 44.05  ? 923  VAL A CG1 1 
ATOM 7135 C CG2 . VAL A 1 926  ? 11.289  24.110 24.174  1.00 44.05  ? 923  VAL A CG2 1 
ATOM 7136 N N   . GLY A 1 927  ? 12.865  22.781 28.489  1.00 47.09  ? 924  GLY A N   1 
ATOM 7137 C CA  . GLY A 1 927  ? 12.920  23.196 29.897  1.00 47.09  ? 924  GLY A CA  1 
ATOM 7138 C C   . GLY A 1 927  ? 14.155  24.046 30.159  1.00 47.09  ? 924  GLY A C   1 
ATOM 7139 O O   . GLY A 1 927  ? 14.806  24.466 29.198  1.00 47.09  ? 924  GLY A O   1 
ATOM 7140 N N   . ASP A 1 928  ? 14.425  24.336 31.450  1.00 132.56 ? 925  ASP A N   1 
ATOM 7141 C CA  . ASP A 1 928  ? 15.769  24.672 32.038  1.00 132.56 ? 925  ASP A CA  1 
ATOM 7142 C C   . ASP A 1 928  ? 15.955  24.043 33.442  1.00 132.56 ? 925  ASP A C   1 
ATOM 7143 O O   . ASP A 1 928  ? 15.113  24.246 34.311  1.00 132.56 ? 925  ASP A O   1 
ATOM 7144 C CB  . ASP A 1 928  ? 16.024  26.185 32.165  1.00 85.62  ? 925  ASP A CB  1 
ATOM 7145 C CG  . ASP A 1 928  ? 17.262  26.523 33.092  1.00 85.62  ? 925  ASP A CG  1 
ATOM 7146 O OD1 . ASP A 1 928  ? 17.532  25.799 34.070  1.00 85.62  ? 925  ASP A OD1 1 
ATOM 7147 O OD2 . ASP A 1 928  ? 17.978  27.527 32.867  1.00 85.62  ? 925  ASP A OD2 1 
ATOM 7148 N N   . LEU A 1 929  ? 17.078  23.350 33.678  1.00 91.71  ? 926  LEU A N   1 
ATOM 7149 C CA  . LEU A 1 929  ? 17.334  22.593 34.927  1.00 91.71  ? 926  LEU A CA  1 
ATOM 7150 C C   . LEU A 1 929  ? 18.397  23.254 35.817  1.00 91.71  ? 926  LEU A C   1 
ATOM 7151 O O   . LEU A 1 929  ? 18.070  24.117 36.637  1.00 91.71  ? 926  LEU A O   1 
ATOM 7152 C CB  . LEU A 1 929  ? 17.707  21.128 34.584  1.00 98.92  ? 926  LEU A CB  1 
ATOM 7153 C CG  . LEU A 1 929  ? 18.544  20.139 35.433  1.00 98.92  ? 926  LEU A CG  1 
ATOM 7154 C CD1 . LEU A 1 929  ? 17.741  19.462 36.550  1.00 98.92  ? 926  LEU A CD1 1 
ATOM 7155 C CD2 . LEU A 1 929  ? 19.212  19.097 34.532  1.00 98.92  ? 926  LEU A CD2 1 
ATOM 7156 N N   . MET A 1 930  ? 19.654  22.824 35.655  1.00 104.32 ? 927  MET A N   1 
ATOM 7157 C CA  . MET A 1 930  ? 20.811  23.344 36.393  1.00 104.32 ? 927  MET A CA  1 
ATOM 7158 C C   . MET A 1 930  ? 21.620  24.222 35.460  1.00 104.32 ? 927  MET A C   1 
ATOM 7159 O O   . MET A 1 930  ? 22.794  23.950 35.180  1.00 104.32 ? 927  MET A O   1 
ATOM 7160 C CB  . MET A 1 930  ? 21.698  22.213 36.926  1.00 150.12 ? 927  MET A CB  1 
ATOM 7161 C CG  . MET A 1 930  ? 21.536  21.910 38.410  1.00 150.12 ? 927  MET A CG  1 
ATOM 7162 S SD  . MET A 1 930  ? 20.324  20.619 38.763  1.00 150.12 ? 927  MET A SD  1 
ATOM 7163 C CE  . MET A 1 930  ? 21.204  19.134 38.267  1.00 150.12 ? 927  MET A CE  1 
ATOM 7164 N N   . ARG A 1 931  ? 20.950  25.261 34.966  1.00 121.97 ? 928  ARG A N   1 
ATOM 7165 C CA  . ARG A 1 931  ? 21.525  26.267 34.072  1.00 121.97 ? 928  ARG A CA  1 
ATOM 7166 C C   . ARG A 1 931  ? 21.975  25.720 32.711  1.00 121.97 ? 928  ARG A C   1 
ATOM 7167 O O   . ARG A 1 931  ? 23.168  25.569 32.433  1.00 121.97 ? 928  ARG A O   1 
ATOM 7168 C CB  . ARG A 1 931  ? 22.583  27.108 34.802  1.00 92.99  ? 928  ARG A CB  1 
ATOM 7169 C CG  . ARG A 1 931  ? 21.989  27.902 35.992  1.00 92.99  ? 928  ARG A CG  1 
ATOM 7170 C CD  . ARG A 1 931  ? 20.748  28.771 35.598  1.00 92.99  ? 928  ARG A CD  1 
ATOM 7171 N NE  . ARG A 1 931  ? 19.512  27.989 35.461  1.00 92.99  ? 928  ARG A NE  1 
ATOM 7172 C CZ  . ARG A 1 931  ? 18.475  28.054 36.290  1.00 92.99  ? 928  ARG A CZ  1 
ATOM 7173 N NH1 . ARG A 1 931  ? 18.489  28.886 37.324  1.00 92.99  ? 928  ARG A NH1 1 
ATOM 7174 N NH2 . ARG A 1 931  ? 17.415  27.292 36.077  1.00 92.99  ? 928  ARG A NH2 1 
ATOM 7175 N N   . SER A 1 932  ? 20.967  25.457 31.876  1.00 112.75 ? 929  SER A N   1 
ATOM 7176 C CA  . SER A 1 932  ? 21.091  24.751 30.606  1.00 112.75 ? 929  SER A CA  1 
ATOM 7177 C C   . SER A 1 932  ? 19.718  24.686 29.929  1.00 112.75 ? 929  SER A C   1 
ATOM 7178 O O   . SER A 1 932  ? 18.700  24.820 30.597  1.00 112.75 ? 929  SER A O   1 
ATOM 7179 C CB  . SER A 1 932  ? 21.597  23.324 30.860  1.00 60.93  ? 929  SER A CB  1 
ATOM 7180 O OG  . SER A 1 932  ? 20.987  22.740 32.007  1.00 60.93  ? 929  SER A OG  1 
ATOM 7181 N N   . VAL A 1 933  ? 19.688  24.496 28.611  1.00 41.14  ? 930  VAL A N   1 
ATOM 7182 C CA  . VAL A 1 933  ? 18.432  24.196 27.895  1.00 41.14  ? 930  VAL A CA  1 
ATOM 7183 C C   . VAL A 1 933  ? 18.287  22.693 27.578  1.00 41.14  ? 930  VAL A C   1 
ATOM 7184 O O   . VAL A 1 933  ? 19.211  22.067 27.065  1.00 41.14  ? 930  VAL A O   1 
ATOM 7185 C CB  . VAL A 1 933  ? 18.361  24.941 26.558  1.00 34.69  ? 930  VAL A CB  1 
ATOM 7186 C CG1 . VAL A 1 933  ? 17.147  24.473 25.772  1.00 34.69  ? 930  VAL A CG1 1 
ATOM 7187 C CG2 . VAL A 1 933  ? 18.322  26.438 26.747  1.00 34.69  ? 930  VAL A CG2 1 
ATOM 7188 N N   . LEU A 1 934  ? 17.116  22.124 27.857  1.00 39.59  ? 931  LEU A N   1 
ATOM 7189 C CA  . LEU A 1 934  ? 16.907  20.664 27.691  1.00 39.59  ? 931  LEU A CA  1 
ATOM 7190 C C   . LEU A 1 934  ? 15.711  20.341 26.803  1.00 39.59  ? 931  LEU A C   1 
ATOM 7191 O O   . LEU A 1 934  ? 14.768  21.091 26.728  1.00 39.59  ? 931  LEU A O   1 
ATOM 7192 C CB  . LEU A 1 934  ? 16.744  19.929 29.037  1.00 56.90  ? 931  LEU A CB  1 
ATOM 7193 C CG  . LEU A 1 934  ? 17.621  20.231 30.250  1.00 56.90  ? 931  LEU A CG  1 
ATOM 7194 C CD1 . LEU A 1 934  ? 16.783  20.145 31.520  1.00 56.90  ? 931  LEU A CD1 1 
ATOM 7195 C CD2 . LEU A 1 934  ? 18.796  19.296 30.355  1.00 56.90  ? 931  LEU A CD2 1 
ATOM 7196 N N   . LEU A 1 935  ? 15.769  19.193 26.150  1.00 40.01  ? 932  LEU A N   1 
ATOM 7197 C CA  . LEU A 1 935  ? 14.722  18.769 25.251  1.00 40.01  ? 932  LEU A CA  1 
ATOM 7198 C C   . LEU A 1 935  ? 14.165  17.402 25.682  1.00 40.01  ? 932  LEU A C   1 
ATOM 7199 O O   . LEU A 1 935  ? 14.899  16.435 25.790  1.00 40.01  ? 932  LEU A O   1 
ATOM 7200 C CB  . LEU A 1 935  ? 15.266  18.743 23.824  1.00 36.88  ? 932  LEU A CB  1 
ATOM 7201 C CG  . LEU A 1 935  ? 14.443  17.963 22.805  1.00 36.88  ? 932  LEU A CG  1 
ATOM 7202 C CD1 . LEU A 1 935  ? 13.040  18.525 22.750  1.00 36.88  ? 932  LEU A CD1 1 
ATOM 7203 C CD2 . LEU A 1 935  ? 15.121  17.996 21.449  1.00 36.88  ? 932  LEU A CD2 1 
ATOM 7204 N N   . LEU A 1 936  ? 12.868  17.329 25.944  1.00 50.83  ? 933  LEU A N   1 
ATOM 7205 C CA  . LEU A 1 936  ? 12.294  16.082 26.441  1.00 50.83  ? 933  LEU A CA  1 
ATOM 7206 C C   . LEU A 1 936  ? 11.025  15.686 25.698  1.00 50.83  ? 933  LEU A C   1 
ATOM 7207 O O   . LEU A 1 936  ? 10.200  16.533 25.317  1.00 50.83  ? 933  LEU A O   1 
ATOM 7208 C CB  . LEU A 1 936  ? 12.067  16.129 27.962  1.00 42.04  ? 933  LEU A CB  1 
ATOM 7209 C CG  . LEU A 1 936  ? 13.301  16.348 28.878  1.00 42.04  ? 933  LEU A CG  1 
ATOM 7210 C CD1 . LEU A 1 936  ? 13.614  17.845 29.122  1.00 42.04  ? 933  LEU A CD1 1 
ATOM 7211 C CD2 . LEU A 1 936  ? 13.194  15.606 30.234  1.00 42.04  ? 933  LEU A CD2 1 
ATOM 7212 N N   . ALA A 1 937  ? 10.892  14.384 25.463  1.00 54.08  ? 934  ALA A N   1 
ATOM 7213 C CA  . ALA A 1 937  ? 9.689   13.858 24.836  1.00 54.08  ? 934  ALA A CA  1 
ATOM 7214 C C   . ALA A 1 937  ? 9.001   12.837 25.734  1.00 54.08  ? 934  ALA A C   1 
ATOM 7215 O O   . ALA A 1 937  ? 9.647   12.122 26.497  1.00 54.08  ? 934  ALA A O   1 
ATOM 7216 C CB  . ALA A 1 937  ? 9.985   13.288 23.438  1.00 36.29  ? 934  ALA A CB  1 
ATOM 7217 N N   . TYR A 1 938  ? 7.678   12.801 25.634  1.00 75.73  ? 935  TYR A N   1 
ATOM 7218 C CA  . TYR A 1 938  ? 6.851   11.888 26.399  1.00 75.73  ? 935  TYR A CA  1 
ATOM 7219 C C   . TYR A 1 938  ? 6.916   10.467 25.821  1.00 75.73  ? 935  TYR A C   1 
ATOM 7220 O O   . TYR A 1 938  ? 6.697   10.262 24.620  1.00 75.73  ? 935  TYR A O   1 
ATOM 7221 C CB  . TYR A 1 938  ? 5.417   12.411 26.400  1.00 63.66  ? 935  TYR A CB  1 
ATOM 7222 C CG  . TYR A 1 938  ? 4.463   11.622 27.236  1.00 63.66  ? 935  TYR A CG  1 
ATOM 7223 C CD1 . TYR A 1 938  ? 4.635   11.519 28.610  1.00 63.66  ? 935  TYR A CD1 1 
ATOM 7224 C CD2 . TYR A 1 938  ? 3.367   10.996 26.658  1.00 63.66  ? 935  TYR A CD2 1 
ATOM 7225 C CE1 . TYR A 1 938  ? 3.752   10.793 29.392  1.00 63.66  ? 935  TYR A CE1 1 
ATOM 7226 C CE2 . TYR A 1 938  ? 2.467   10.273 27.429  1.00 63.66  ? 935  TYR A CE2 1 
ATOM 7227 C CZ  . TYR A 1 938  ? 2.671   10.177 28.795  1.00 63.66  ? 935  TYR A CZ  1 
ATOM 7228 O OH  . TYR A 1 938  ? 1.790   9.469  29.566  1.00 63.66  ? 935  TYR A OH  1 
ATOM 7229 N N   . LYS A 1 939  ? 7.235   9.497  26.681  1.00 64.27  ? 936  LYS A N   1 
ATOM 7230 C CA  . LYS A 1 939  ? 7.240   8.075  26.323  1.00 64.27  ? 936  LYS A CA  1 
ATOM 7231 C C   . LYS A 1 939  ? 6.187   7.367  27.173  1.00 64.27  ? 936  LYS A C   1 
ATOM 7232 O O   . LYS A 1 939  ? 6.416   7.145  28.365  1.00 64.27  ? 936  LYS A O   1 
ATOM 7233 C CB  . LYS A 1 939  ? 8.621   7.453  26.593  1.00 89.48  ? 936  LYS A CB  1 
ATOM 7234 C CG  . LYS A 1 939  ? 9.815   8.131  25.890  1.00 89.48  ? 936  LYS A CG  1 
ATOM 7235 C CD  . LYS A 1 939  ? 10.263  7.413  24.608  1.00 89.48  ? 936  LYS A CD  1 
ATOM 7236 C CE  . LYS A 1 939  ? 11.263  6.276  24.888  1.00 89.48  ? 936  LYS A CE  1 
ATOM 7237 N NZ  . LYS A 1 939  ? 10.685  5.064  25.576  1.00 89.48  ? 936  LYS A NZ  1 
ATOM 7238 N N   . PRO A 1 940  ? 5.038   6.987  26.574  1.00 57.92  ? 937  PRO A N   1 
ATOM 7239 C CA  . PRO A 1 940  ? 3.972   6.494  27.459  1.00 57.92  ? 937  PRO A CA  1 
ATOM 7240 C C   . PRO A 1 940  ? 4.252   5.079  28.015  1.00 57.92  ? 937  PRO A C   1 
ATOM 7241 O O   . PRO A 1 940  ? 3.633   4.665  29.002  1.00 57.92  ? 937  PRO A O   1 
ATOM 7242 C CB  . PRO A 1 940  ? 2.699   6.545  26.586  1.00 56.45  ? 937  PRO A CB  1 
ATOM 7243 C CG  . PRO A 1 940  ? 3.169   6.661  25.154  1.00 56.45  ? 937  PRO A CG  1 
ATOM 7244 C CD  . PRO A 1 940  ? 4.671   6.915  25.143  1.00 56.45  ? 937  PRO A CD  1 
ATOM 7245 N N   . MET A 1 941  ? 5.186   4.352  27.408  1.00 101.60 ? 938  MET A N   1 
ATOM 7246 C CA  . MET A 1 941  ? 5.626   3.079  27.969  1.00 101.60 ? 938  MET A CA  1 
ATOM 7247 C C   . MET A 1 941  ? 5.959   3.268  29.455  1.00 101.60 ? 938  MET A C   1 
ATOM 7248 O O   . MET A 1 941  ? 5.560   2.460  30.296  1.00 101.60 ? 938  MET A O   1 
ATOM 7249 C CB  . MET A 1 941  ? 6.835   2.548  27.193  1.00 161.42 ? 938  MET A CB  1 
ATOM 7250 C CG  . MET A 1 941  ? 7.400   1.226  27.700  1.00 161.42 ? 938  MET A CG  1 
ATOM 7251 S SD  . MET A 1 941  ? 8.666   0.534  26.612  1.00 161.42 ? 938  MET A SD  1 
ATOM 7252 C CE  . MET A 1 941  ? 9.985   1.744  26.748  1.00 161.42 ? 938  MET A CE  1 
ATOM 7253 N N   . GLU A 1 942  ? 6.655   4.362  29.765  1.00 72.88  ? 939  GLU A N   1 
ATOM 7254 C CA  . GLU A 1 942  ? 7.097   4.666  31.135  1.00 72.88  ? 939  GLU A CA  1 
ATOM 7255 C C   . GLU A 1 942  ? 6.223   5.725  31.819  1.00 72.88  ? 939  GLU A C   1 
ATOM 7256 O O   . GLU A 1 942  ? 6.496   6.123  32.948  1.00 72.88  ? 939  GLU A O   1 
ATOM 7257 C CB  . GLU A 1 942  ? 8.569   5.104  31.127  1.00 162.71 ? 939  GLU A CB  1 
ATOM 7258 C CG  . GLU A 1 942  ? 9.543   4.053  30.592  1.00 162.71 ? 939  GLU A CG  1 
ATOM 7259 C CD  . GLU A 1 942  ? 10.655  4.647  29.737  1.00 162.71 ? 939  GLU A CD  1 
ATOM 7260 O OE1 . GLU A 1 942  ? 10.964  5.852  29.885  1.00 162.71 ? 939  GLU A OE1 1 
ATOM 7261 O OE2 . GLU A 1 942  ? 11.224  3.901  28.909  1.00 162.71 ? 939  GLU A OE2 1 
ATOM 7262 N N   . GLY A 1 943  ? 5.173   6.163  31.124  1.00 75.36  ? 940  GLY A N   1 
ATOM 7263 C CA  . GLY A 1 943  ? 4.261   7.206  31.605  1.00 75.36  ? 940  GLY A CA  1 
ATOM 7264 C C   . GLY A 1 943  ? 5.037   8.454  31.969  1.00 75.36  ? 940  GLY A C   1 
ATOM 7265 O O   . GLY A 1 943  ? 4.696   9.166  32.921  1.00 75.36  ? 940  GLY A O   1 
ATOM 7266 N N   . ASN A 1 944  ? 6.073   8.719  31.181  1.00 77.43  ? 941  ASN A N   1 
ATOM 7267 C CA  . ASN A 1 944  ? 7.187   9.566  31.590  1.00 77.43  ? 941  ASN A CA  1 
ATOM 7268 C C   . ASN A 1 944  ? 7.608   10.528 30.479  1.00 77.43  ? 941  ASN A C   1 
ATOM 7269 O O   . ASN A 1 944  ? 6.952   10.639 29.443  1.00 77.43  ? 941  ASN A O   1 
ATOM 7270 C CB  . ASN A 1 944  ? 8.365   8.645  31.938  1.00 60.58  ? 941  ASN A CB  1 
ATOM 7271 C CG  . ASN A 1 944  ? 9.317   9.247  32.924  1.00 60.58  ? 941  ASN A CG  1 
ATOM 7272 O OD1 . ASN A 1 944  ? 8.945   9.567  34.050  1.00 60.58  ? 941  ASN A OD1 1 
ATOM 7273 N ND2 . ASN A 1 944  ? 10.572  9.373  32.521  1.00 60.58  ? 941  ASN A ND2 1 
ATOM 7274 N N   . PHE A 1 945  ? 8.724   11.204 30.698  1.00 46.43  ? 942  PHE A N   1 
ATOM 7275 C CA  . PHE A 1 945  ? 9.344   12.055 29.695  1.00 46.43  ? 942  PHE A CA  1 
ATOM 7276 C C   . PHE A 1 945  ? 10.798  11.547 29.535  1.00 46.43  ? 942  PHE A C   1 
ATOM 7277 O O   . PHE A 1 945  ? 11.451  11.193 30.526  1.00 46.43  ? 942  PHE A O   1 
ATOM 7278 C CB  . PHE A 1 945  ? 9.362   13.451 30.274  1.00 79.59  ? 942  PHE A CB  1 
ATOM 7279 C CG  . PHE A 1 945  ? 9.797   13.439 31.691  1.00 79.59  ? 942  PHE A CG  1 
ATOM 7280 C CD1 . PHE A 1 945  ? 11.154  13.355 32.011  1.00 79.59  ? 942  PHE A CD1 1 
ATOM 7281 C CD2 . PHE A 1 945  ? 8.868   13.369 32.705  1.00 79.59  ? 942  PHE A CD2 1 
ATOM 7282 C CE1 . PHE A 1 945  ? 11.579  13.275 33.307  1.00 79.59  ? 942  PHE A CE1 1 
ATOM 7283 C CE2 . PHE A 1 945  ? 9.286   13.298 34.002  1.00 79.59  ? 942  PHE A CE2 1 
ATOM 7284 C CZ  . PHE A 1 945  ? 10.655  13.248 34.300  1.00 79.59  ? 942  PHE A CZ  1 
ATOM 7285 N N   . GLU A 1 946  ? 11.305  11.507 28.309  1.00 55.40  ? 943  GLU A N   1 
ATOM 7286 C CA  . GLU A 1 946  ? 12.668  11.050 28.066  1.00 55.40  ? 943  GLU A CA  1 
ATOM 7287 C C   . GLU A 1 946  ? 13.539  12.239 27.696  1.00 55.40  ? 943  GLU A C   1 
ATOM 7288 O O   . GLU A 1 946  ? 13.075  13.146 27.010  1.00 55.40  ? 943  GLU A O   1 
ATOM 7289 C CB  . GLU A 1 946  ? 12.684  10.033 26.929  1.00 69.39  ? 943  GLU A CB  1 
ATOM 7290 C CG  . GLU A 1 946  ? 13.866  9.074  26.973  1.00 69.39  ? 943  GLU A CG  1 
ATOM 7291 C CD  . GLU A 1 946  ? 14.296  8.578  25.592  1.00 69.39  ? 943  GLU A CD  1 
ATOM 7292 O OE1 . GLU A 1 946  ? 15.514  8.321  25.402  1.00 69.39  ? 943  GLU A OE1 1 
ATOM 7293 O OE2 . GLU A 1 946  ? 13.420  8.450  24.700  1.00 69.39  ? 943  GLU A OE2 1 
ATOM 7294 N N   . GLU A 1 947  ? 14.797  12.226 28.131  1.00 53.63  ? 944  GLU A N   1 
ATOM 7295 C CA  . GLU A 1 947  ? 15.696  13.332 27.865  1.00 53.63  ? 944  GLU A CA  1 
ATOM 7296 C C   . GLU A 1 947  ? 16.389  13.227 26.505  1.00 53.63  ? 944  GLU A C   1 
ATOM 7297 O O   . GLU A 1 947  ? 17.594  12.975 26.443  1.00 53.63  ? 944  GLU A O   1 
ATOM 7298 C CB  . GLU A 1 947  ? 16.738  13.451 28.963  1.00 72.51  ? 944  GLU A CB  1 
ATOM 7299 C CG  . GLU A 1 947  ? 16.914  14.869 29.385  1.00 72.51  ? 944  GLU A CG  1 
ATOM 7300 C CD  . GLU A 1 947  ? 18.324  15.203 29.824  1.00 72.51  ? 944  GLU A CD  1 
ATOM 7301 O OE1 . GLU A 1 947  ? 19.187  15.456 28.953  1.00 72.51  ? 944  GLU A OE1 1 
ATOM 7302 O OE2 . GLU A 1 947  ? 18.558  15.262 31.049  1.00 72.51  ? 944  GLU A OE2 1 
ATOM 7303 N N   . ILE A 1 948  ? 15.642  13.456 25.423  1.00 50.02  ? 945  ILE A N   1 
ATOM 7304 C CA  . ILE A 1 948  ? 16.193  13.429 24.057  1.00 50.02  ? 945  ILE A CA  1 
ATOM 7305 C C   . ILE A 1 948  ? 17.554  14.122 23.885  1.00 50.02  ? 945  ILE A C   1 
ATOM 7306 O O   . ILE A 1 948  ? 18.476  13.551 23.275  1.00 50.02  ? 945  ILE A O   1 
ATOM 7307 C CB  . ILE A 1 948  ? 15.206  13.987 23.020  1.00 69.42  ? 945  ILE A CB  1 
ATOM 7308 C CG1 . ILE A 1 948  ? 14.146  12.940 22.686  1.00 69.42  ? 945  ILE A CG1 1 
ATOM 7309 C CG2 . ILE A 1 948  ? 15.931  14.409 21.749  1.00 69.42  ? 945  ILE A CG2 1 
ATOM 7310 C CD1 . ILE A 1 948  ? 13.065  13.435 21.690  1.00 69.42  ? 945  ILE A CD1 1 
ATOM 7311 N N   . ALA A 1 949  ? 17.675  15.342 24.407  1.00 44.30  ? 946  ALA A N   1 
ATOM 7312 C CA  . ALA A 1 949  ? 18.900  16.135 24.225  1.00 44.30  ? 946  ALA A CA  1 
ATOM 7313 C C   . ALA A 1 949  ? 19.062  17.304 25.202  1.00 44.30  ? 946  ALA A C   1 
ATOM 7314 O O   . ALA A 1 949  ? 18.104  17.739 25.867  1.00 44.30  ? 946  ALA A O   1 
ATOM 7315 C CB  . ALA A 1 949  ? 19.026  16.626 22.778  1.00 58.24  ? 946  ALA A CB  1 
ATOM 7316 N N   . ARG A 1 950  ? 20.293  17.810 25.242  1.00 63.49  ? 947  ARG A N   1 
ATOM 7317 C CA  . ARG A 1 950  ? 20.724  18.839 26.173  1.00 63.49  ? 947  ARG A CA  1 
ATOM 7318 C C   . ARG A 1 950  ? 21.779  19.783 25.551  1.00 63.49  ? 947  ARG A C   1 
ATOM 7319 O O   . ARG A 1 950  ? 22.585  19.406 24.695  1.00 63.49  ? 947  ARG A O   1 
ATOM 7320 C CB  . ARG A 1 950  ? 21.267  18.155 27.430  1.00 84.87  ? 947  ARG A CB  1 
ATOM 7321 C CG  . ARG A 1 950  ? 21.927  19.041 28.441  1.00 84.87  ? 947  ARG A CG  1 
ATOM 7322 C CD  . ARG A 1 950  ? 22.141  18.263 29.706  1.00 84.87  ? 947  ARG A CD  1 
ATOM 7323 N NE  . ARG A 1 950  ? 23.037  18.978 30.604  1.00 84.87  ? 947  ARG A NE  1 
ATOM 7324 C CZ  . ARG A 1 950  ? 22.908  19.027 31.926  1.00 84.87  ? 947  ARG A CZ  1 
ATOM 7325 N NH1 . ARG A 1 950  ? 21.895  18.412 32.531  1.00 84.87  ? 947  ARG A NH1 1 
ATOM 7326 N NH2 . ARG A 1 950  ? 23.791  19.711 32.639  1.00 84.87  ? 947  ARG A NH2 1 
ATOM 7327 N N   . ASP A 1 951  ? 21.727  21.033 25.970  1.00 44.36  ? 948  ASP A N   1 
ATOM 7328 C CA  . ASP A 1 951  ? 22.780  21.968 25.730  1.00 44.36  ? 948  ASP A CA  1 
ATOM 7329 C C   . ASP A 1 951  ? 23.643  21.921 26.971  1.00 44.36  ? 948  ASP A C   1 
ATOM 7330 O O   . ASP A 1 951  ? 23.260  22.450 28.031  1.00 44.36  ? 948  ASP A O   1 
ATOM 7331 C CB  . ASP A 1 951  ? 22.198  23.371 25.547  1.00 49.30  ? 948  ASP A CB  1 
ATOM 7332 C CG  . ASP A 1 951  ? 23.249  24.404 25.176  1.00 49.30  ? 948  ASP A CG  1 
ATOM 7333 O OD1 . ASP A 1 951  ? 24.274  24.034 24.565  1.00 49.30  ? 948  ASP A OD1 1 
ATOM 7334 O OD2 . ASP A 1 951  ? 23.029  25.596 25.484  1.00 49.30  ? 948  ASP A OD2 1 
ATOM 7335 N N   . PHE A 1 952  ? 24.788  21.248 26.856  1.00 68.32  ? 949  PHE A N   1 
ATOM 7336 C CA  . PHE A 1 952  ? 25.885  21.415 27.795  1.00 68.32  ? 949  PHE A CA  1 
ATOM 7337 C C   . PHE A 1 952  ? 26.331  22.828 27.459  1.00 68.32  ? 949  PHE A C   1 
ATOM 7338 O O   . PHE A 1 952  ? 25.645  23.507 26.694  1.00 68.32  ? 949  PHE A O   1 
ATOM 7339 C CB  . PHE A 1 952  ? 26.965  20.370 27.535  1.00 47.12  ? 949  PHE A CB  1 
ATOM 7340 C CG  . PHE A 1 952  ? 26.465  18.937 27.638  1.00 47.12  ? 949  PHE A CG  1 
ATOM 7341 C CD1 . PHE A 1 952  ? 25.666  18.378 26.626  1.00 47.12  ? 949  PHE A CD1 1 
ATOM 7342 C CD2 . PHE A 1 952  ? 26.779  18.149 28.747  1.00 47.12  ? 949  PHE A CD2 1 
ATOM 7343 C CE1 . PHE A 1 952  ? 25.167  17.063 26.715  1.00 47.12  ? 949  PHE A CE1 1 
ATOM 7344 C CE2 . PHE A 1 952  ? 26.301  16.819 28.845  1.00 47.12  ? 949  PHE A CE2 1 
ATOM 7345 C CZ  . PHE A 1 952  ? 25.488  16.279 27.813  1.00 47.12  ? 949  PHE A CZ  1 
ATOM 7346 N N   . ASN A 1 953  ? 27.446  23.307 27.994  1.00 52.75  ? 950  ASN A N   1 
ATOM 7347 C CA  . ASN A 1 953  ? 27.774  24.741 27.824  1.00 52.75  ? 950  ASN A CA  1 
ATOM 7348 C C   . ASN A 1 953  ? 26.750  25.539 28.638  1.00 52.75  ? 950  ASN A C   1 
ATOM 7349 O O   . ASN A 1 953  ? 25.585  25.655 28.243  1.00 52.75  ? 950  ASN A O   1 
ATOM 7350 C CB  . ASN A 1 953  ? 27.760  25.139 26.332  1.00 137.55 ? 950  ASN A CB  1 
ATOM 7351 C CG  . ASN A 1 953  ? 28.389  26.491 26.072  1.00 137.55 ? 950  ASN A CG  1 
ATOM 7352 O OD1 . ASN A 1 953  ? 29.612  26.634 26.075  1.00 137.55 ? 950  ASN A OD1 1 
ATOM 7353 N ND2 . ASN A 1 953  ? 27.553  27.489 25.816  1.00 137.55 ? 950  ASN A ND2 1 
ATOM 7354 N N   . PRO A 1 954  ? 27.175  26.070 29.793  1.00 61.88  ? 951  PRO A N   1 
ATOM 7355 C CA  . PRO A 1 954  ? 26.218  26.590 30.780  1.00 61.88  ? 951  PRO A CA  1 
ATOM 7356 C C   . PRO A 1 954  ? 25.732  27.987 30.445  1.00 61.88  ? 951  PRO A C   1 
ATOM 7357 O O   . PRO A 1 954  ? 26.446  28.766 29.822  1.00 61.88  ? 951  PRO A O   1 
ATOM 7358 C CB  . PRO A 1 954  ? 27.018  26.613 32.089  1.00 141.42 ? 951  PRO A CB  1 
ATOM 7359 C CG  . PRO A 1 954  ? 28.488  26.567 31.681  1.00 141.42 ? 951  PRO A CG  1 
ATOM 7360 C CD  . PRO A 1 954  ? 28.577  26.278 30.203  1.00 141.42 ? 951  PRO A CD  1 
ATOM 7361 N N   . ASN A 1 955  ? 24.517  28.290 30.877  1.00 39.71  ? 952  ASN A N   1 
ATOM 7362 C CA  . ASN A 1 955  ? 23.817  29.526 30.512  1.00 39.71  ? 952  ASN A CA  1 
ATOM 7363 C C   . ASN A 1 955  ? 22.755  29.798 31.543  1.00 39.71  ? 952  ASN A C   1 
ATOM 7364 O O   . ASN A 1 955  ? 21.871  28.963 31.752  1.00 39.71  ? 952  ASN A O   1 
ATOM 7365 C CB  . ASN A 1 955  ? 23.126  29.376 29.153  1.00 52.58  ? 952  ASN A CB  1 
ATOM 7366 C CG  . ASN A 1 955  ? 24.081  29.475 27.983  1.00 52.58  ? 952  ASN A CG  1 
ATOM 7367 O OD1 . ASN A 1 955  ? 24.812  30.477 27.836  1.00 52.58  ? 952  ASN A OD1 1 
ATOM 7368 N ND2 . ASN A 1 955  ? 24.060  28.452 27.119  1.00 52.58  ? 952  ASN A ND2 1 
ATOM 7369 N N   . TRP A 1 956  ? 22.844  30.966 32.180  1.00 41.03  ? 953  TRP A N   1 
ATOM 7370 C CA  . TRP A 1 956  ? 21.831  31.432 33.124  1.00 41.03  ? 953  TRP A CA  1 
ATOM 7371 C C   . TRP A 1 956  ? 20.639  31.988 32.340  1.00 41.03  ? 953  TRP A C   1 
ATOM 7372 O O   . TRP A 1 956  ? 20.555  33.177 32.035  1.00 41.03  ? 953  TRP A O   1 
ATOM 7373 C CB  . TRP A 1 956  ? 22.438  32.444 34.099  1.00 199.15 ? 953  TRP A CB  1 
ATOM 7374 C CG  . TRP A 1 956  ? 23.437  31.799 34.994  1.00 199.15 ? 953  TRP A CG  1 
ATOM 7375 C CD1 . TRP A 1 956  ? 24.709  31.431 34.669  1.00 199.15 ? 953  TRP A CD1 1 
ATOM 7376 C CD2 . TRP A 1 956  ? 23.241  31.406 36.355  1.00 199.15 ? 953  TRP A CD2 1 
ATOM 7377 N NE1 . TRP A 1 956  ? 25.320  30.843 35.745  1.00 199.15 ? 953  TRP A NE1 1 
ATOM 7378 C CE2 . TRP A 1 956  ? 24.442  30.816 36.796  1.00 199.15 ? 953  TRP A CE2 1 
ATOM 7379 C CE3 . TRP A 1 956  ? 22.168  31.505 37.250  1.00 199.15 ? 953  TRP A CE3 1 
ATOM 7380 C CZ2 . TRP A 1 956  ? 24.603  30.322 38.094  1.00 199.15 ? 953  TRP A CZ2 1 
ATOM 7381 C CZ3 . TRP A 1 956  ? 22.328  31.012 38.541  1.00 199.15 ? 953  TRP A CZ3 1 
ATOM 7382 C CH2 . TRP A 1 956  ? 23.537  30.429 38.949  1.00 199.15 ? 953  TRP A CH2 1 
ATOM 7383 N N   . MET A 1 957  ? 19.738  31.081 31.988  1.00 32.58  ? 954  MET A N   1 
ATOM 7384 C CA  . MET A 1 957  ? 18.615  31.368 31.115  1.00 32.58  ? 954  MET A CA  1 
ATOM 7385 C C   . MET A 1 957  ? 17.670  32.360 31.765  1.00 32.58  ? 954  MET A C   1 
ATOM 7386 O O   . MET A 1 957  ? 17.528  32.400 33.021  1.00 32.58  ? 954  MET A O   1 
ATOM 7387 C CB  . MET A 1 957  ? 17.844  30.073 30.819  1.00 64.78  ? 954  MET A CB  1 
ATOM 7388 C CG  . MET A 1 957  ? 18.634  29.013 30.056  1.00 64.78  ? 954  MET A CG  1 
ATOM 7389 S SD  . MET A 1 957  ? 19.303  29.632 28.492  1.00 64.78  ? 954  MET A SD  1 
ATOM 7390 C CE  . MET A 1 957  ? 17.815  29.888 27.542  1.00 64.78  ? 954  MET A CE  1 
ATOM 7391 N N   . SER A 1 958  ? 17.008  33.141 30.914  1.00 44.37  ? 955  SER A N   1 
ATOM 7392 C CA  . SER A 1 958  ? 16.004  34.102 31.366  1.00 44.37  ? 955  SER A CA  1 
ATOM 7393 C C   . SER A 1 958  ? 14.677  33.893 30.626  1.00 44.37  ? 955  SER A C   1 
ATOM 7394 O O   . SER A 1 958  ? 13.631  34.331 31.094  1.00 44.37  ? 955  SER A O   1 
ATOM 7395 C CB  . SER A 1 958  ? 16.514  35.524 31.146  1.00 29.94  ? 955  SER A CB  1 
ATOM 7396 O OG  . SER A 1 958  ? 16.472  35.819 29.773  1.00 29.94  ? 955  SER A OG  1 
ATOM 7397 N N   . ALA A 1 959  ? 14.740  33.247 29.460  1.00 38.92  ? 956  ALA A N   1 
ATOM 7398 C CA  . ALA A 1 959  ? 13.550  32.895 28.673  1.00 38.92  ? 956  ALA A CA  1 
ATOM 7399 C C   . ALA A 1 959  ? 13.948  31.840 27.625  1.00 38.92  ? 956  ALA A C   1 
ATOM 7400 O O   . ALA A 1 959  ? 15.133  31.555 27.497  1.00 38.92  ? 956  ALA A O   1 
ATOM 7401 C CB  . ALA A 1 959  ? 12.917  34.142 28.022  1.00 51.73  ? 956  ALA A CB  1 
ATOM 7402 N N   . VAL A 1 960  ? 12.979  31.281 26.880  1.00 34.94  ? 957  VAL A N   1 
ATOM 7403 C CA  . VAL A 1 960  ? 13.173  30.054 26.095  1.00 34.94  ? 957  VAL A CA  1 
ATOM 7404 C C   . VAL A 1 960  ? 12.009  29.869 25.146  1.00 34.94  ? 957  VAL A C   1 
ATOM 7405 O O   . VAL A 1 960  ? 10.864  30.058 25.542  1.00 34.94  ? 957  VAL A O   1 
ATOM 7406 C CB  . VAL A 1 960  ? 13.214  28.820 27.054  1.00 20.73  ? 957  VAL A CB  1 
ATOM 7407 C CG1 . VAL A 1 960  ? 12.120  27.698 26.715  1.00 20.73  ? 957  VAL A CG1 1 
ATOM 7408 C CG2 . VAL A 1 960  ? 14.623  28.290 27.228  1.00 20.73  ? 957  VAL A CG2 1 
ATOM 7409 N N   . GLU A 1 961  ? 12.278  29.486 23.902  1.00 52.06  ? 958  GLU A N   1 
ATOM 7410 C CA  . GLU A 1 961  ? 11.191  29.268 22.942  1.00 52.06  ? 958  GLU A CA  1 
ATOM 7411 C C   . GLU A 1 961  ? 11.526  28.254 21.843  1.00 52.06  ? 958  GLU A C   1 
ATOM 7412 O O   . GLU A 1 961  ? 12.677  28.171 21.363  1.00 52.06  ? 958  GLU A O   1 
ATOM 7413 C CB  . GLU A 1 961  ? 10.734  30.593 22.321  1.00 34.74  ? 958  GLU A CB  1 
ATOM 7414 C CG  . GLU A 1 961  ? 9.586   30.490 21.332  1.00 34.74  ? 958  GLU A CG  1 
ATOM 7415 C CD  . GLU A 1 961  ? 8.246   30.215 21.995  1.00 34.74  ? 958  GLU A CD  1 
ATOM 7416 O OE1 . GLU A 1 961  ? 7.913   29.025 22.198  1.00 34.74  ? 958  GLU A OE1 1 
ATOM 7417 O OE2 . GLU A 1 961  ? 7.509   31.192 22.302  1.00 34.74  ? 958  GLU A OE2 1 
ATOM 7418 N N   . ILE A 1 962  ? 10.497  27.486 21.468  1.00 37.60  ? 959  ILE A N   1 
ATOM 7419 C CA  . ILE A 1 962  ? 10.542  26.601 20.314  1.00 37.60  ? 959  ILE A CA  1 
ATOM 7420 C C   . ILE A 1 962  ? 10.314  27.390 19.028  1.00 37.60  ? 959  ILE A C   1 
ATOM 7421 O O   . ILE A 1 962  ? 9.244   27.993 18.845  1.00 37.60  ? 959  ILE A O   1 
ATOM 7422 C CB  . ILE A 1 962  ? 9.430   25.558 20.404  1.00 16.84  ? 959  ILE A CB  1 
ATOM 7423 C CG1 . ILE A 1 962  ? 9.616   24.683 21.658  1.00 16.84  ? 959  ILE A CG1 1 
ATOM 7424 C CG2 . ILE A 1 962  ? 9.327   24.748 19.070  1.00 16.84  ? 959  ILE A CG2 1 
ATOM 7425 C CD1 . ILE A 1 962  ? 8.233   24.168 22.318  1.00 16.84  ? 959  ILE A CD1 1 
ATOM 7426 N N   . LEU A 1 963  ? 11.293  27.370 18.129  1.00 49.48  ? 960  LEU A N   1 
ATOM 7427 C CA  . LEU A 1 963  ? 11.081  27.982 16.813  1.00 49.48  ? 960  LEU A CA  1 
ATOM 7428 C C   . LEU A 1 963  ? 10.395  26.990 15.861  1.00 49.48  ? 960  LEU A C   1 
ATOM 7429 O O   . LEU A 1 963  ? 9.369   27.304 15.258  1.00 49.48  ? 960  LEU A O   1 
ATOM 7430 C CB  . LEU A 1 963  ? 12.393  28.516 16.234  1.00 31.92  ? 960  LEU A CB  1 
ATOM 7431 C CG  . LEU A 1 963  ? 13.277  29.300 17.208  1.00 31.92  ? 960  LEU A CG  1 
ATOM 7432 C CD1 . LEU A 1 963  ? 14.647  29.419 16.645  1.00 31.92  ? 960  LEU A CD1 1 
ATOM 7433 C CD2 . LEU A 1 963  ? 12.673  30.676 17.568  1.00 31.92  ? 960  LEU A CD2 1 
ATOM 7434 N N   . ASP A 1 964  ? 10.981  25.802 15.744  1.00 56.93  ? 961  ASP A N   1 
ATOM 7435 C CA  . ASP A 1 964  ? 10.348  24.638 15.135  1.00 56.93  ? 961  ASP A CA  1 
ATOM 7436 C C   . ASP A 1 964  ? 10.813  23.406 15.921  1.00 56.93  ? 961  ASP A C   1 
ATOM 7437 O O   . ASP A 1 964  ? 11.303  23.536 17.063  1.00 56.93  ? 961  ASP A O   1 
ATOM 7438 C CB  . ASP A 1 964  ? 10.673  24.524 13.624  1.00 76.17  ? 961  ASP A CB  1 
ATOM 7439 C CG  . ASP A 1 964  ? 12.153  24.213 13.331  1.00 76.17  ? 961  ASP A CG  1 
ATOM 7440 O OD1 . ASP A 1 964  ? 12.649  24.683 12.288  1.00 76.17  ? 961  ASP A OD1 1 
ATOM 7441 O OD2 . ASP A 1 964  ? 12.825  23.493 14.105  1.00 76.17  ? 961  ASP A OD2 1 
ATOM 7442 N N   . ASP A 1 965  ? 10.706  22.232 15.290  1.00 43.43  ? 962  ASP A N   1 
ATOM 7443 C CA  . ASP A 1 965  ? 10.960  20.941 15.949  1.00 43.43  ? 962  ASP A CA  1 
ATOM 7444 C C   . ASP A 1 965  ? 12.409  20.610 16.270  1.00 43.43  ? 962  ASP A C   1 
ATOM 7445 O O   . ASP A 1 965  ? 12.676  19.724 17.087  1.00 43.43  ? 962  ASP A O   1 
ATOM 7446 C CB  . ASP A 1 965  ? 10.350  19.831 15.133  1.00 53.21  ? 962  ASP A CB  1 
ATOM 7447 C CG  . ASP A 1 965  ? 8.879   19.846 15.221  1.00 53.21  ? 962  ASP A CG  1 
ATOM 7448 O OD1 . ASP A 1 965  ? 8.372   19.726 16.354  1.00 53.21  ? 962  ASP A OD1 1 
ATOM 7449 O OD2 . ASP A 1 965  ? 8.222   20.015 14.176  1.00 53.21  ? 962  ASP A OD2 1 
ATOM 7450 N N   . ASP A 1 966  ? 13.338  21.323 15.639  1.00 63.48  ? 963  ASP A N   1 
ATOM 7451 C CA  . ASP A 1 966  ? 14.758  21.013 15.782  1.00 63.48  ? 963  ASP A CA  1 
ATOM 7452 C C   . ASP A 1 966  ? 15.540  22.206 16.309  1.00 63.48  ? 963  ASP A C   1 
ATOM 7453 O O   . ASP A 1 966  ? 16.728  22.075 16.599  1.00 63.48  ? 963  ASP A O   1 
ATOM 7454 C CB  . ASP A 1 966  ? 15.354  20.546 14.434  1.00 95.44  ? 963  ASP A CB  1 
ATOM 7455 C CG  . ASP A 1 966  ? 14.556  19.405 13.781  1.00 95.44  ? 963  ASP A CG  1 
ATOM 7456 O OD1 . ASP A 1 966  ? 14.703  18.242 14.224  1.00 95.44  ? 963  ASP A OD1 1 
ATOM 7457 O OD2 . ASP A 1 966  ? 13.801  19.678 12.815  1.00 95.44  ? 963  ASP A OD2 1 
ATOM 7458 N N   . ASN A 1 967  ? 14.869  23.355 16.433  1.00 55.50  ? 964  ASN A N   1 
ATOM 7459 C CA  . ASN A 1 967  ? 15.526  24.622 16.788  1.00 55.50  ? 964  ASN A CA  1 
ATOM 7460 C C   . ASN A 1 967  ? 14.861  25.371 17.928  1.00 55.50  ? 964  ASN A C   1 
ATOM 7461 O O   . ASN A 1 967  ? 13.639  25.567 17.919  1.00 55.50  ? 964  ASN A O   1 
ATOM 7462 C CB  . ASN A 1 967  ? 15.604  25.530 15.570  1.00 62.14  ? 964  ASN A CB  1 
ATOM 7463 C CG  . ASN A 1 967  ? 16.552  25.004 14.521  1.00 62.14  ? 964  ASN A CG  1 
ATOM 7464 O OD1 . ASN A 1 967  ? 17.771  25.160 14.630  1.00 62.14  ? 964  ASN A OD1 1 
ATOM 7465 N ND2 . ASN A 1 967  ? 15.997  24.371 13.494  1.00 62.14  ? 964  ASN A ND2 1 
ATOM 7466 N N   . PHE A 1 968  ? 15.684  25.800 18.890  1.00 41.18  ? 965  PHE A N   1 
ATOM 7467 C CA  . PHE A 1 968  ? 15.213  26.332 20.174  1.00 41.18  ? 965  PHE A CA  1 
ATOM 7468 C C   . PHE A 1 968  ? 15.928  27.623 20.570  1.00 41.18  ? 965  PHE A C   1 
ATOM 7469 O O   . PHE A 1 968  ? 17.155  27.632 20.803  1.00 41.18  ? 965  PHE A O   1 
ATOM 7470 C CB  . PHE A 1 968  ? 15.382  25.287 21.271  1.00 46.00  ? 965  PHE A CB  1 
ATOM 7471 C CG  . PHE A 1 968  ? 15.141  23.894 20.805  1.00 46.00  ? 965  PHE A CG  1 
ATOM 7472 C CD1 . PHE A 1 968  ? 16.187  22.991 20.713  1.00 46.00  ? 965  PHE A CD1 1 
ATOM 7473 C CD2 . PHE A 1 968  ? 13.866  23.483 20.410  1.00 46.00  ? 965  PHE A CD2 1 
ATOM 7474 C CE1 . PHE A 1 968  ? 15.966  21.685 20.244  1.00 46.00  ? 965  PHE A CE1 1 
ATOM 7475 C CE2 . PHE A 1 968  ? 13.642  22.170 19.941  1.00 46.00  ? 965  PHE A CE2 1 
ATOM 7476 C CZ  . PHE A 1 968  ? 14.693  21.277 19.862  1.00 46.00  ? 965  PHE A CZ  1 
ATOM 7477 N N   . LEU A 1 969  ? 15.160  28.710 20.655  1.00 39.29  ? 966  LEU A N   1 
ATOM 7478 C CA  . LEU A 1 969  ? 15.714  30.034 20.970  1.00 39.29  ? 966  LEU A CA  1 
ATOM 7479 C C   . LEU A 1 969  ? 15.825  30.196 22.469  1.00 39.29  ? 966  LEU A C   1 
ATOM 7480 O O   . LEU A 1 969  ? 14.899  29.852 23.191  1.00 39.29  ? 966  LEU A O   1 
ATOM 7481 C CB  . LEU A 1 969  ? 14.799  31.141 20.433  1.00 41.52  ? 966  LEU A CB  1 
ATOM 7482 C CG  . LEU A 1 969  ? 15.384  32.473 19.971  1.00 41.52  ? 966  LEU A CG  1 
ATOM 7483 C CD1 . LEU A 1 969  ? 14.369  33.563 20.223  1.00 41.52  ? 966  LEU A CD1 1 
ATOM 7484 C CD2 . LEU A 1 969  ? 16.694  32.812 20.646  1.00 41.52  ? 966  LEU A CD2 1 
ATOM 7485 N N   . GLY A 1 970  ? 16.950  30.725 22.929  1.00 40.19  ? 967  GLY A N   1 
ATOM 7486 C CA  . GLY A 1 970  ? 17.165  30.999 24.345  1.00 40.19  ? 967  GLY A CA  1 
ATOM 7487 C C   . GLY A 1 970  ? 17.696  32.411 24.542  1.00 40.19  ? 967  GLY A C   1 
ATOM 7488 O O   . GLY A 1 970  ? 18.277  32.999 23.619  1.00 40.19  ? 967  GLY A O   1 
ATOM 7489 N N   . ALA A 1 971  ? 17.476  32.949 25.744  1.00 36.78  ? 968  ALA A N   1 
ATOM 7490 C CA  . ALA A 1 971  ? 18.003  34.247 26.180  1.00 36.78  ? 968  ALA A CA  1 
ATOM 7491 C C   . ALA A 1 971  ? 18.573  34.084 27.576  1.00 36.78  ? 968  ALA A C   1 
ATOM 7492 O O   . ALA A 1 971  ? 18.144  33.218 28.329  1.00 36.78  ? 968  ALA A O   1 
ATOM 7493 C CB  . ALA A 1 971  ? 16.896  35.325 26.172  1.00 26.63  ? 968  ALA A CB  1 
ATOM 7494 N N   . GLU A 1 972  ? 19.504  34.950 27.946  1.00 30.11  ? 969  GLU A N   1 
ATOM 7495 C CA  . GLU A 1 972  ? 20.379  34.646 29.066  1.00 30.11  ? 969  GLU A CA  1 
ATOM 7496 C C   . GLU A 1 972  ? 20.946  35.870 29.844  1.00 30.11  ? 969  GLU A C   1 
ATOM 7497 O O   . GLU A 1 972  ? 20.972  36.984 29.352  1.00 30.11  ? 969  GLU A O   1 
ATOM 7498 C CB  . GLU A 1 972  ? 21.460  33.662 28.557  1.00 54.71  ? 969  GLU A CB  1 
ATOM 7499 C CG  . GLU A 1 972  ? 22.883  33.928 28.926  1.00 54.71  ? 969  GLU A CG  1 
ATOM 7500 C CD  . GLU A 1 972  ? 23.543  34.971 28.055  1.00 54.71  ? 969  GLU A CD  1 
ATOM 7501 O OE1 . GLU A 1 972  ? 23.102  36.136 28.035  1.00 54.71  ? 969  GLU A OE1 1 
ATOM 7502 O OE2 . GLU A 1 972  ? 24.538  34.627 27.414  1.00 54.71  ? 969  GLU A OE2 1 
ATOM 7503 N N   . ASN A 1 973  ? 21.366  35.621 31.075  1.00 34.68  ? 970  ASN A N   1 
ATOM 7504 C CA  . ASN A 1 973  ? 21.930  36.582 31.975  1.00 34.68  ? 970  ASN A CA  1 
ATOM 7505 C C   . ASN A 1 973  ? 22.857  37.655 31.370  1.00 34.68  ? 970  ASN A C   1 
ATOM 7506 O O   . ASN A 1 973  ? 23.040  38.741 31.957  1.00 34.68  ? 970  ASN A O   1 
ATOM 7507 C CB  . ASN A 1 973  ? 22.733  35.794 32.994  1.00 88.53  ? 970  ASN A CB  1 
ATOM 7508 C CG  . ASN A 1 973  ? 22.542  36.295 34.383  1.00 88.53  ? 970  ASN A CG  1 
ATOM 7509 O OD1 . ASN A 1 973  ? 23.475  36.806 34.996  1.00 88.53  ? 970  ASN A OD1 1 
ATOM 7510 N ND2 . ASN A 1 973  ? 21.321  36.166 34.901  1.00 88.53  ? 970  ASN A ND2 1 
ATOM 7511 N N   . ALA A 1 974  ? 23.487  37.369 30.232  1.00 54.47  ? 971  ALA A N   1 
ATOM 7512 C CA  . ALA A 1 974  ? 24.477  38.308 29.695  1.00 54.47  ? 971  ALA A CA  1 
ATOM 7513 C C   . ALA A 1 974  ? 23.991  39.054 28.445  1.00 54.47  ? 971  ALA A C   1 
ATOM 7514 O O   . ALA A 1 974  ? 24.769  39.539 27.619  1.00 54.47  ? 971  ALA A O   1 
ATOM 7515 C CB  . ALA A 1 974  ? 25.789  37.615 29.459  1.00 35.27  ? 971  ALA A CB  1 
ATOM 7516 N N   . PHE A 1 975  ? 22.678  39.154 28.346  1.00 30.83  ? 972  PHE A N   1 
ATOM 7517 C CA  . PHE A 1 975  ? 21.984  39.872 27.269  1.00 30.83  ? 972  PHE A CA  1 
ATOM 7518 C C   . PHE A 1 975  ? 22.290  39.268 25.880  1.00 30.83  ? 972  PHE A C   1 
ATOM 7519 O O   . PHE A 1 975  ? 22.157  39.933 24.850  1.00 30.83  ? 972  PHE A O   1 
ATOM 7520 C CB  . PHE A 1 975  ? 22.151  41.424 27.377  1.00 29.26  ? 972  PHE A CB  1 
ATOM 7521 C CG  . PHE A 1 975  ? 22.355  41.911 28.797  1.00 29.26  ? 972  PHE A CG  1 
ATOM 7522 C CD1 . PHE A 1 975  ? 23.588  42.444 29.198  1.00 29.26  ? 972  PHE A CD1 1 
ATOM 7523 C CD2 . PHE A 1 975  ? 21.329  41.788 29.759  1.00 29.26  ? 972  PHE A CD2 1 
ATOM 7524 C CE1 . PHE A 1 975  ? 23.811  42.872 30.525  1.00 29.26  ? 972  PHE A CE1 1 
ATOM 7525 C CE2 . PHE A 1 975  ? 21.525  42.217 31.112  1.00 29.26  ? 972  PHE A CE2 1 
ATOM 7526 C CZ  . PHE A 1 975  ? 22.776  42.770 31.490  1.00 29.26  ? 972  PHE A CZ  1 
ATOM 7527 N N   . ASN A 1 976  ? 22.645  37.986 25.871  1.00 37.10  ? 973  ASN A N   1 
ATOM 7528 C CA  . ASN A 1 976  ? 22.854  37.245 24.623  1.00 37.10  ? 973  ASN A CA  1 
ATOM 7529 C C   . ASN A 1 976  ? 21.646  36.360 24.230  1.00 37.10  ? 973  ASN A C   1 
ATOM 7530 O O   . ASN A 1 976  ? 20.897  35.851 25.081  1.00 37.10  ? 973  ASN A O   1 
ATOM 7531 C CB  . ASN A 1 976  ? 24.141  36.413 24.683  1.00 41.84  ? 973  ASN A CB  1 
ATOM 7532 C CG  . ASN A 1 976  ? 25.396  37.250 24.972  1.00 41.84  ? 973  ASN A CG  1 
ATOM 7533 O OD1 . ASN A 1 976  ? 25.848  38.043 24.150  1.00 41.84  ? 973  ASN A OD1 1 
ATOM 7534 N ND2 . ASN A 1 976  ? 25.977  37.043 26.139  1.00 41.84  ? 973  ASN A ND2 1 
ATOM 7535 N N   . LEU A 1 977  ? 21.442  36.212 22.933  1.00 39.83  ? 974  LEU A N   1 
ATOM 7536 C CA  . LEU A 1 977  ? 20.464  35.280 22.432  1.00 39.83  ? 974  LEU A CA  1 
ATOM 7537 C C   . LEU A 1 977  ? 21.218  34.091 21.881  1.00 39.83  ? 974  LEU A C   1 
ATOM 7538 O O   . LEU A 1 977  ? 22.413  34.216 21.531  1.00 39.83  ? 974  LEU A O   1 
ATOM 7539 C CB  . LEU A 1 977  ? 19.674  35.894 21.291  1.00 41.64  ? 974  LEU A CB  1 
ATOM 7540 C CG  . LEU A 1 977  ? 18.699  37.018 21.581  1.00 41.64  ? 974  LEU A CG  1 
ATOM 7541 C CD1 . LEU A 1 977  ? 17.865  37.284 20.326  1.00 41.64  ? 974  LEU A CD1 1 
ATOM 7542 C CD2 . LEU A 1 977  ? 17.797  36.663 22.752  1.00 41.64  ? 974  LEU A CD2 1 
ATOM 7543 N N   . PHE A 1 978  ? 20.544  32.941 21.801  1.00 54.04  ? 975  PHE A N   1 
ATOM 7544 C CA  . PHE A 1 978  ? 21.152  31.793 21.153  1.00 54.04  ? 975  PHE A CA  1 
ATOM 7545 C C   . PHE A 1 978  ? 20.181  30.749 20.664  1.00 54.04  ? 975  PHE A C   1 
ATOM 7546 O O   . PHE A 1 978  ? 19.127  30.521 21.249  1.00 54.04  ? 975  PHE A O   1 
ATOM 7547 C CB  . PHE A 1 978  ? 22.215  31.163 22.040  1.00 39.94  ? 975  PHE A CB  1 
ATOM 7548 C CG  . PHE A 1 978  ? 21.670  30.414 23.203  1.00 39.94  ? 975  PHE A CG  1 
ATOM 7549 C CD1 . PHE A 1 978  ? 21.221  29.094 23.058  1.00 39.94  ? 975  PHE A CD1 1 
ATOM 7550 C CD2 . PHE A 1 978  ? 21.640  30.997 24.457  1.00 39.94  ? 975  PHE A CD2 1 
ATOM 7551 C CE1 . PHE A 1 978  ? 20.720  28.377 24.142  1.00 39.94  ? 975  PHE A CE1 1 
ATOM 7552 C CE2 . PHE A 1 978  ? 21.158  30.286 25.555  1.00 39.94  ? 975  PHE A CE2 1 
ATOM 7553 C CZ  . PHE A 1 978  ? 20.700  28.965 25.388  1.00 39.94  ? 975  PHE A CZ  1 
ATOM 7554 N N   . VAL A 1 979  ? 20.562  30.107 19.574  1.00 55.61  ? 976  VAL A N   1 
ATOM 7555 C CA  . VAL A 1 979  ? 19.763  29.037 18.997  1.00 55.61  ? 976  VAL A CA  1 
ATOM 7556 C C   . VAL A 1 979  ? 20.474  27.677 19.134  1.00 55.61  ? 976  VAL A C   1 
ATOM 7557 O O   . VAL A 1 979  ? 21.593  27.484 18.648  1.00 55.61  ? 976  VAL A O   1 
ATOM 7558 C CB  . VAL A 1 979  ? 19.391  29.364 17.531  1.00 39.51  ? 976  VAL A CB  1 
ATOM 7559 C CG1 . VAL A 1 979  ? 18.650  28.191 16.862  1.00 39.51  ? 976  VAL A CG1 1 
ATOM 7560 C CG2 . VAL A 1 979  ? 18.558  30.656 17.482  1.00 39.51  ? 976  VAL A CG2 1 
ATOM 7561 N N   . CYS A 1 980  ? 19.813  26.767 19.849  1.00 55.17  ? 977  CYS A N   1 
ATOM 7562 C CA  . CYS A 1 980  ? 20.253  25.389 20.024  1.00 55.17  ? 977  CYS A CA  1 
ATOM 7563 C C   . CYS A 1 980  ? 19.504  24.524 19.049  1.00 55.17  ? 977  CYS A C   1 
ATOM 7564 O O   . CYS A 1 980  ? 18.313  24.718 18.822  1.00 55.17  ? 977  CYS A O   1 
ATOM 7565 C CB  . CYS A 1 980  ? 19.960  24.913 21.430  1.00 55.40  ? 977  CYS A CB  1 
ATOM 7566 S SG  . CYS A 1 980  ? 21.240  25.342 22.582  1.00 55.40  ? 977  CYS A SG  1 
ATOM 7567 N N   . GLN A 1 981  ? 20.212  23.570 18.466  1.00 63.38  ? 978  GLN A N   1 
ATOM 7568 C CA  . GLN A 1 981  ? 19.654  22.708 17.430  1.00 63.38  ? 978  GLN A CA  1 
ATOM 7569 C C   . GLN A 1 981  ? 20.148  21.302 17.675  1.00 63.38  ? 978  GLN A C   1 
ATOM 7570 O O   . GLN A 1 981  ? 21.240  21.121 18.214  1.00 63.38  ? 978  GLN A O   1 
ATOM 7571 C CB  . GLN A 1 981  ? 20.122  23.204 16.078  1.00 63.20  ? 978  GLN A CB  1 
ATOM 7572 C CG  . GLN A 1 981  ? 19.644  22.447 14.898  1.00 63.20  ? 978  GLN A CG  1 
ATOM 7573 C CD  . GLN A 1 981  ? 20.416  22.861 13.664  1.00 63.20  ? 978  GLN A CD  1 
ATOM 7574 O OE1 . GLN A 1 981  ? 21.606  22.537 13.523  1.00 63.20  ? 978  GLN A OE1 1 
ATOM 7575 N NE2 . GLN A 1 981  ? 19.751  23.590 12.761  1.00 63.20  ? 978  GLN A NE2 1 
ATOM 7576 N N   . LYS A 1 982  ? 19.337  20.311 17.313  1.00 59.32  ? 979  LYS A N   1 
ATOM 7577 C CA  . LYS A 1 982  ? 19.728  18.923 17.524  1.00 59.32  ? 979  LYS A CA  1 
ATOM 7578 C C   . LYS A 1 982  ? 20.523  18.386 16.344  1.00 59.32  ? 979  LYS A C   1 
ATOM 7579 O O   . LYS A 1 982  ? 20.141  18.581 15.196  1.00 59.32  ? 979  LYS A O   1 
ATOM 7580 C CB  . LYS A 1 982  ? 18.522  18.048 17.832  1.00 58.00  ? 979  LYS A CB  1 
ATOM 7581 C CG  . LYS A 1 982  ? 17.376  18.171 16.863  1.00 58.00  ? 979  LYS A CG  1 
ATOM 7582 C CD  . LYS A 1 982  ? 16.098  17.609 17.483  1.00 58.00  ? 979  LYS A CD  1 
ATOM 7583 C CE  . LYS A 1 982  ? 16.063  16.097 17.532  1.00 58.00  ? 979  LYS A CE  1 
ATOM 7584 N NZ  . LYS A 1 982  ? 14.931  15.653 18.389  1.00 58.00  ? 979  LYS A NZ  1 
ATOM 7585 N N   . ASP A 1 983  ? 21.638  17.726 16.651  1.00 78.85  ? 980  ASP A N   1 
ATOM 7586 C CA  . ASP A 1 983  ? 22.545  17.201 15.638  1.00 78.85  ? 980  ASP A CA  1 
ATOM 7587 C C   . ASP A 1 983  ? 21.824  16.237 14.705  1.00 78.85  ? 980  ASP A C   1 
ATOM 7588 O O   . ASP A 1 983  ? 21.037  15.385 15.139  1.00 78.85  ? 980  ASP A O   1 
ATOM 7589 C CB  . ASP A 1 983  ? 23.759  16.519 16.286  1.00 97.29  ? 980  ASP A CB  1 
ATOM 7590 C CG  . ASP A 1 983  ? 24.924  16.335 15.317  1.00 97.29  ? 980  ASP A CG  1 
ATOM 7591 O OD1 . ASP A 1 983  ? 24.748  16.561 14.102  1.00 97.29  ? 980  ASP A OD1 1 
ATOM 7592 O OD2 . ASP A 1 983  ? 26.025  15.960 15.773  1.00 97.29  ? 980  ASP A OD2 1 
ATOM 7593 N N   . SER A 1 984  ? 22.087  16.392 13.415  1.00 76.10  ? 981  SER A N   1 
ATOM 7594 C CA  . SER A 1 984  ? 21.521  15.499 12.426  1.00 76.10  ? 981  SER A CA  1 
ATOM 7595 C C   . SER A 1 984  ? 22.634  14.608 11.842  1.00 76.10  ? 981  SER A C   1 
ATOM 7596 O O   . SER A 1 984  ? 22.866  14.597 10.633  1.00 76.10  ? 981  SER A O   1 
ATOM 7597 C CB  . SER A 1 984  ? 20.804  16.316 11.354  1.00 100.02 ? 981  SER A CB  1 
ATOM 7598 O OG  . SER A 1 984  ? 19.508  15.796 11.133  1.00 100.02 ? 981  SER A OG  1 
ATOM 7599 N N   . ALA A 1 985  ? 23.325  13.872 12.718  1.00 190.30 ? 982  ALA A N   1 
ATOM 7600 C CA  . ALA A 1 985  ? 24.471  13.043 12.318  1.00 190.30 ? 982  ALA A CA  1 
ATOM 7601 C C   . ALA A 1 985  ? 24.769  11.861 13.273  1.00 190.30 ? 982  ALA A C   1 
ATOM 7602 O O   . ALA A 1 985  ? 24.107  11.705 14.300  1.00 190.30 ? 982  ALA A O   1 
ATOM 7603 C CB  . ALA A 1 985  ? 25.710  13.923 12.096  1.00 56.55  ? 982  ALA A CB  1 
ATOM 7604 N N   . ALA A 1 986  ? 25.782  11.061 12.925  1.00 121.87 ? 983  ALA A N   1 
ATOM 7605 C CA  . ALA A 1 986  ? 26.018  9.700  13.465  1.00 121.87 ? 983  ALA A CA  1 
ATOM 7606 C C   . ALA A 1 986  ? 26.242  9.557  14.975  1.00 121.87 ? 983  ALA A C   1 
ATOM 7607 O O   . ALA A 1 986  ? 26.221  10.544 15.710  1.00 121.87 ? 983  ALA A O   1 
ATOM 7608 C CB  . ALA A 1 986  ? 27.160  9.014  12.687  1.00 84.91  ? 983  ALA A CB  1 
ATOM 7609 N N   . THR A 1 987  ? 26.480  8.311  15.403  1.00 90.55  ? 984  THR A N   1 
ATOM 7610 C CA  . THR A 1 987  ? 26.525  7.888  16.828  1.00 90.55  ? 984  THR A CA  1 
ATOM 7611 C C   . THR A 1 987  ? 25.349  8.444  17.657  1.00 90.55  ? 984  THR A C   1 
ATOM 7612 O O   . THR A 1 987  ? 25.519  8.907  18.807  1.00 90.55  ? 984  THR A O   1 
ATOM 7613 C CB  . THR A 1 987  ? 27.917  8.108  17.538  1.00 121.49 ? 984  THR A CB  1 
ATOM 7614 O OG1 . THR A 1 987  ? 27.896  9.292  18.349  1.00 121.49 ? 984  THR A OG1 1 
ATOM 7615 C CG2 . THR A 1 987  ? 29.071  8.162  16.531  1.00 121.49 ? 984  THR A CG2 1 
ATOM 7616 N N   . THR A 1 988  ? 24.163  8.374  17.038  1.00 141.69 ? 985  THR A N   1 
ATOM 7617 C CA  . THR A 1 988  ? 22.900  8.918  17.557  1.00 141.69 ? 985  THR A CA  1 
ATOM 7618 C C   . THR A 1 988  ? 22.515  8.281  18.885  1.00 141.69 ? 985  THR A C   1 
ATOM 7619 O O   . THR A 1 988  ? 21.488  7.605  18.995  1.00 141.69 ? 985  THR A O   1 
ATOM 7620 C CB  . THR A 1 988  ? 21.738  8.743  16.538  1.00 123.83 ? 985  THR A CB  1 
ATOM 7621 O OG1 . THR A 1 988  ? 21.859  7.474  15.886  1.00 123.83 ? 985  THR A OG1 1 
ATOM 7622 C CG2 . THR A 1 988  ? 21.761  9.838  15.482  1.00 123.83 ? 985  THR A CG2 1 
ATOM 7623 N N   . ASP A 1 989  ? 23.353  8.519  19.890  1.00 101.76 ? 986  ASP A N   1 
ATOM 7624 C CA  . ASP A 1 989  ? 23.241  7.873  21.189  1.00 101.76 ? 986  ASP A CA  1 
ATOM 7625 C C   . ASP A 1 989  ? 24.317  8.429  22.103  1.00 101.76 ? 986  ASP A C   1 
ATOM 7626 O O   . ASP A 1 989  ? 24.731  7.764  23.047  1.00 101.76 ? 986  ASP A O   1 
ATOM 7627 C CB  . ASP A 1 989  ? 23.418  6.359  21.042  1.00 170.28 ? 986  ASP A CB  1 
ATOM 7628 C CG  . ASP A 1 989  ? 22.363  5.575  21.789  1.00 170.28 ? 986  ASP A CG  1 
ATOM 7629 O OD1 . ASP A 1 989  ? 22.140  5.849  22.988  1.00 170.28 ? 986  ASP A OD1 1 
ATOM 7630 O OD2 . ASP A 1 989  ? 21.753  4.679  21.172  1.00 170.28 ? 986  ASP A OD2 1 
ATOM 7631 N N   . GLU A 1 990  ? 24.767  9.647  21.806  1.00 84.74  ? 987  GLU A N   1 
ATOM 7632 C CA  . GLU A 1 990  ? 25.879  10.300 22.514  1.00 84.74  ? 987  GLU A CA  1 
ATOM 7633 C C   . GLU A 1 990  ? 26.058  11.728 21.983  1.00 84.74  ? 987  GLU A C   1 
ATOM 7634 O O   . GLU A 1 990  ? 25.902  12.703 22.721  1.00 84.74  ? 987  GLU A O   1 
ATOM 7635 C CB  . GLU A 1 990  ? 27.178  9.504  22.330  1.00 147.10 ? 987  GLU A CB  1 
ATOM 7636 C CG  . GLU A 1 990  ? 28.382  10.078 23.061  1.00 147.10 ? 987  GLU A CG  1 
ATOM 7637 C CD  . GLU A 1 990  ? 28.269  9.949  24.564  1.00 147.10 ? 987  GLU A CD  1 
ATOM 7638 O OE1 . GLU A 1 990  ? 28.254  8.806  25.066  1.00 147.10 ? 987  GLU A OE1 1 
ATOM 7639 O OE2 . GLU A 1 990  ? 28.203  10.993 25.244  1.00 147.10 ? 987  GLU A OE2 1 
ATOM 7640 N N   . GLU A 1 991  ? 26.404  11.824 20.699  1.00 69.83  ? 988  GLU A N   1 
ATOM 7641 C CA  . GLU A 1 991  ? 26.401  13.075 19.947  1.00 69.83  ? 988  GLU A CA  1 
ATOM 7642 C C   . GLU A 1 991  ? 24.967  13.610 19.729  1.00 69.83  ? 988  GLU A C   1 
ATOM 7643 O O   . GLU A 1 991  ? 24.773  14.778 19.365  1.00 69.83  ? 988  GLU A O   1 
ATOM 7644 C CB  . GLU A 1 991  ? 27.064  12.855 18.585  1.00 118.31 ? 988  GLU A CB  1 
ATOM 7645 C CG  . GLU A 1 991  ? 28.551  12.533 18.639  1.00 118.31 ? 988  GLU A CG  1 
ATOM 7646 C CD  . GLU A 1 991  ? 29.103  12.082 17.290  1.00 118.31 ? 988  GLU A CD  1 
ATOM 7647 O OE1 . GLU A 1 991  ? 28.578  12.534 16.239  1.00 118.31 ? 988  GLU A OE1 1 
ATOM 7648 O OE2 . GLU A 1 991  ? 30.065  11.276 17.280  1.00 118.31 ? 988  GLU A OE2 1 
ATOM 7649 N N   . ARG A 1 992  ? 23.982  12.729 19.917  1.00 63.45  ? 989  ARG A N   1 
ATOM 7650 C CA  . ARG A 1 992  ? 22.564  13.049 19.802  1.00 63.45  ? 989  ARG A CA  1 
ATOM 7651 C C   . ARG A 1 992  ? 22.078  13.648 21.120  1.00 63.45  ? 989  ARG A C   1 
ATOM 7652 O O   . ARG A 1 992  ? 21.082  14.368 21.179  1.00 63.45  ? 989  ARG A O   1 
ATOM 7653 C CB  . ARG A 1 992  ? 21.786  11.768 19.486  1.00 133.84 ? 989  ARG A CB  1 
ATOM 7654 C CG  . ARG A 1 992  ? 20.374  11.975 18.964  1.00 133.84 ? 989  ARG A CG  1 
ATOM 7655 C CD  . ARG A 1 992  ? 20.378  12.573 17.560  1.00 133.84 ? 989  ARG A CD  1 
ATOM 7656 N NE  . ARG A 1 992  ? 19.036  12.945 17.106  1.00 133.84 ? 989  ARG A NE  1 
ATOM 7657 C CZ  . ARG A 1 992  ? 18.260  12.190 16.330  1.00 133.84 ? 989  ARG A CZ  1 
ATOM 7658 N NH1 . ARG A 1 992  ? 18.677  10.999 15.901  1.00 133.84 ? 989  ARG A NH1 1 
ATOM 7659 N NH2 . ARG A 1 992  ? 17.058  12.632 15.979  1.00 133.84 ? 989  ARG A NH2 1 
ATOM 7660 N N   . GLN A 1 993  ? 22.799  13.329 22.183  1.00 64.80  ? 990  GLN A N   1 
ATOM 7661 C CA  . GLN A 1 993  ? 22.463  13.791 23.521  1.00 64.80  ? 990  GLN A CA  1 
ATOM 7662 C C   . GLN A 1 993  ? 22.868  15.266 23.696  1.00 64.80  ? 990  GLN A C   1 
ATOM 7663 O O   . GLN A 1 993  ? 22.439  15.915 24.646  1.00 64.80  ? 990  GLN A O   1 
ATOM 7664 C CB  . GLN A 1 993  ? 23.146  12.890 24.564  1.00 103.23 ? 990  GLN A CB  1 
ATOM 7665 C CG  . GLN A 1 993  ? 22.214  12.308 25.628  1.00 103.23 ? 990  GLN A CG  1 
ATOM 7666 C CD  . GLN A 1 993  ? 21.311  11.183 25.105  1.00 103.23 ? 990  GLN A CD  1 
ATOM 7667 O OE1 . GLN A 1 993  ? 20.635  11.331 24.084  1.00 103.23 ? 990  GLN A OE1 1 
ATOM 7668 N NE2 . GLN A 1 993  ? 21.283  10.062 25.823  1.00 103.23 ? 990  GLN A NE2 1 
ATOM 7669 N N   . HIS A 1 994  ? 23.679  15.769 22.760  1.00 69.88  ? 991  HIS A N   1 
ATOM 7670 C CA  . HIS A 1 994  ? 24.246  17.120 22.785  1.00 69.88  ? 991  HIS A CA  1 
ATOM 7671 C C   . HIS A 1 994  ? 23.579  18.017 21.739  1.00 69.88  ? 991  HIS A C   1 
ATOM 7672 O O   . HIS A 1 994  ? 23.839  17.869 20.549  1.00 69.88  ? 991  HIS A O   1 
ATOM 7673 C CB  . HIS A 1 994  ? 25.751  17.061 22.466  1.00 77.05  ? 991  HIS A CB  1 
ATOM 7674 C CG  . HIS A 1 994  ? 26.612  16.610 23.608  1.00 77.05  ? 991  HIS A CG  1 
ATOM 7675 N ND1 . HIS A 1 994  ? 27.557  17.427 24.193  1.00 77.05  ? 991  HIS A ND1 1 
ATOM 7676 C CD2 . HIS A 1 994  ? 26.681  15.429 24.266  1.00 77.05  ? 991  HIS A CD2 1 
ATOM 7677 C CE1 . HIS A 1 994  ? 28.160  16.776 25.171  1.00 77.05  ? 991  HIS A CE1 1 
ATOM 7678 N NE2 . HIS A 1 994  ? 27.644  15.563 25.239  1.00 77.05  ? 991  HIS A NE2 1 
ATOM 7679 N N   . LEU A 1 995  ? 22.722  18.949 22.144  1.00 54.92  ? 992  LEU A N   1 
ATOM 7680 C CA  . LEU A 1 995  ? 22.296  19.925 21.152  1.00 54.92  ? 992  LEU A CA  1 
ATOM 7681 C C   . LEU A 1 995  ? 23.369  21.004 20.979  1.00 54.92  ? 992  LEU A C   1 
ATOM 7682 O O   . LEU A 1 995  ? 24.286  21.133 21.805  1.00 54.92  ? 992  LEU A O   1 
ATOM 7683 C CB  . LEU A 1 995  ? 20.850  20.440 21.322  1.00 42.38  ? 992  LEU A CB  1 
ATOM 7684 C CG  . LEU A 1 995  ? 19.930  20.382 22.549  1.00 42.38  ? 992  LEU A CG  1 
ATOM 7685 C CD1 . LEU A 1 995  ? 19.974  21.684 23.312  1.00 42.38  ? 992  LEU A CD1 1 
ATOM 7686 C CD2 . LEU A 1 995  ? 18.484  20.111 22.120  1.00 42.38  ? 992  LEU A CD2 1 
ATOM 7687 N N   . GLN A 1 996  ? 23.309  21.727 19.870  1.00 63.48  ? 993  GLN A N   1 
ATOM 7688 C CA  . GLN A 1 996  ? 24.388  22.647 19.571  1.00 63.48  ? 993  GLN A CA  1 
ATOM 7689 C C   . GLN A 1 996  ? 23.997  24.042 19.165  1.00 63.48  ? 993  GLN A C   1 
ATOM 7690 O O   . GLN A 1 996  ? 23.061  24.258 18.385  1.00 63.48  ? 993  GLN A O   1 
ATOM 7691 C CB  . GLN A 1 996  ? 25.392  22.050 18.598  1.00 98.83  ? 993  GLN A CB  1 
ATOM 7692 C CG  . GLN A 1 996  ? 26.621  21.565 19.324  1.00 98.83  ? 993  GLN A CG  1 
ATOM 7693 C CD  . GLN A 1 996  ? 27.266  20.414 18.624  1.00 98.83  ? 993  GLN A CD  1 
ATOM 7694 O OE1 . GLN A 1 996  ? 27.885  20.587 17.576  1.00 98.83  ? 993  GLN A OE1 1 
ATOM 7695 N NE2 . GLN A 1 996  ? 27.122  19.219 19.191  1.00 98.83  ? 993  GLN A NE2 1 
ATOM 7696 N N   . GLU A 1 997  ? 24.761  24.972 19.735  1.00 47.88  ? 994  GLU A N   1 
ATOM 7697 C CA  . GLU A 1 997  ? 24.589  26.384 19.536  1.00 47.88  ? 994  GLU A CA  1 
ATOM 7698 C C   . GLU A 1 997  ? 24.940  26.696 18.100  1.00 47.88  ? 994  GLU A C   1 
ATOM 7699 O O   . GLU A 1 997  ? 26.099  26.888 17.768  1.00 47.88  ? 994  GLU A O   1 
ATOM 7700 C CB  . GLU A 1 997  ? 25.494  27.141 20.498  1.00 44.35  ? 994  GLU A CB  1 
ATOM 7701 C CG  . GLU A 1 997  ? 25.647  26.431 21.846  1.00 44.35  ? 994  GLU A CG  1 
ATOM 7702 C CD  . GLU A 1 997  ? 25.461  27.338 23.048  1.00 44.35  ? 994  GLU A CD  1 
ATOM 7703 O OE1 . GLU A 1 997  ? 26.271  28.278 23.233  1.00 44.35  ? 994  GLU A OE1 1 
ATOM 7704 O OE2 . GLU A 1 997  ? 24.503  27.088 23.812  1.00 44.35  ? 994  GLU A OE2 1 
ATOM 7705 N N   . VAL A 1 998  ? 23.925  26.686 17.248  1.00 46.67  ? 995  VAL A N   1 
ATOM 7706 C CA  . VAL A 1 998  ? 24.089  26.985 15.843  1.00 46.67  ? 995  VAL A CA  1 
ATOM 7707 C C   . VAL A 1 998  ? 24.101  28.486 15.587  1.00 46.67  ? 995  VAL A C   1 
ATOM 7708 O O   . VAL A 1 998  ? 24.589  28.935 14.552  1.00 46.67  ? 995  VAL A O   1 
ATOM 7709 C CB  . VAL A 1 998  ? 22.976  26.335 14.977  1.00 28.88  ? 995  VAL A CB  1 
ATOM 7710 C CG1 . VAL A 1 998  ? 23.187  24.859 14.893  1.00 28.88  ? 995  VAL A CG1 1 
ATOM 7711 C CG2 . VAL A 1 998  ? 21.598  26.581 15.541  1.00 28.88  ? 995  VAL A CG2 1 
ATOM 7712 N N   . GLY A 1 999  ? 23.540  29.251 16.530  1.00 66.85  ? 996  GLY A N   1 
ATOM 7713 C CA  . GLY A 1 999  ? 23.407  30.705 16.404  1.00 66.85  ? 996  GLY A CA  1 
ATOM 7714 C C   . GLY A 1 999  ? 23.784  31.423 17.678  1.00 66.85  ? 996  GLY A C   1 
ATOM 7715 O O   . GLY A 1 999  ? 23.474  30.948 18.772  1.00 66.85  ? 996  GLY A O   1 
ATOM 7716 N N   . LEU A 1 1000 ? 24.470  32.554 17.530  1.00 46.28  ? 997  LEU A N   1 
ATOM 7717 C CA  . LEU A 1 1000 ? 24.861  33.409 18.662  1.00 46.28  ? 997  LEU A CA  1 
ATOM 7718 C C   . LEU A 1 1000 ? 24.658  34.883 18.305  1.00 46.28  ? 997  LEU A C   1 
ATOM 7719 O O   . LEU A 1 1000 ? 24.586  35.243 17.126  1.00 46.28  ? 997  LEU A O   1 
ATOM 7720 C CB  . LEU A 1 1000 ? 26.313  33.166 19.075  1.00 62.72  ? 997  LEU A CB  1 
ATOM 7721 C CG  . LEU A 1 1000 ? 26.705  31.748 19.516  1.00 62.72  ? 997  LEU A CG  1 
ATOM 7722 C CD1 . LEU A 1 1000 ? 28.218  31.560 19.498  1.00 62.72  ? 997  LEU A CD1 1 
ATOM 7723 C CD2 . LEU A 1 1000 ? 26.145  31.369 20.900  1.00 62.72  ? 997  LEU A CD2 1 
ATOM 7724 N N   . PHE A 1 1001 ? 24.558  35.739 19.319  1.00 54.31  ? 998  PHE A N   1 
ATOM 7725 C CA  . PHE A 1 1001 ? 24.213  37.142 19.091  1.00 54.31  ? 998  PHE A CA  1 
ATOM 7726 C C   . PHE A 1 1001 ? 24.079  37.927 20.385  1.00 54.31  ? 998  PHE A C   1 
ATOM 7727 O O   . PHE A 1 1001 ? 23.268  37.581 21.246  1.00 54.31  ? 998  PHE A O   1 
ATOM 7728 C CB  . PHE A 1 1001 ? 22.901  37.216 18.314  1.00 46.63  ? 998  PHE A CB  1 
ATOM 7729 C CG  . PHE A 1 1001 ? 22.502  38.603 17.922  1.00 46.63  ? 998  PHE A CG  1 
ATOM 7730 C CD1 . PHE A 1 1001 ? 22.902  39.135 16.702  1.00 46.63  ? 998  PHE A CD1 1 
ATOM 7731 C CD2 . PHE A 1 1001 ? 21.715  39.381 18.772  1.00 46.63  ? 998  PHE A CD2 1 
ATOM 7732 C CE1 . PHE A 1 1001 ? 22.531  40.412 16.324  1.00 46.63  ? 998  PHE A CE1 1 
ATOM 7733 C CE2 . PHE A 1 1001 ? 21.337  40.660 18.402  1.00 46.63  ? 998  PHE A CE2 1 
ATOM 7734 C CZ  . PHE A 1 1001 ? 21.741  41.175 17.165  1.00 46.63  ? 998  PHE A CZ  1 
ATOM 7735 N N   . HIS A 1 1002 ? 24.866  38.990 20.517  1.00 38.10  ? 999  HIS A N   1 
ATOM 7736 C CA  . HIS A 1 1002 ? 24.715  39.881 21.674  1.00 38.10  ? 999  HIS A CA  1 
ATOM 7737 C C   . HIS A 1 1002 ? 23.613  40.862 21.387  1.00 38.10  ? 999  HIS A C   1 
ATOM 7738 O O   . HIS A 1 1002 ? 23.776  41.747 20.566  1.00 38.10  ? 999  HIS A O   1 
ATOM 7739 C CB  . HIS A 1 1002 ? 25.980  40.643 22.020  1.00 36.46  ? 999  HIS A CB  1 
ATOM 7740 C CG  . HIS A 1 1002 ? 25.884  41.386 23.322  1.00 36.46  ? 999  HIS A CG  1 
ATOM 7741 N ND1 . HIS A 1 1002 ? 26.236  40.822 24.527  1.00 36.46  ? 999  HIS A ND1 1 
ATOM 7742 C CD2 . HIS A 1 1002 ? 25.484  42.653 23.608  1.00 36.46  ? 999  HIS A CD2 1 
ATOM 7743 C CE1 . HIS A 1 1002 ? 26.051  41.701 25.499  1.00 36.46  ? 999  HIS A CE1 1 
ATOM 7744 N NE2 . HIS A 1 1002 ? 25.613  42.825 24.968  1.00 36.46  ? 999  HIS A NE2 1 
ATOM 7745 N N   . LEU A 1 1003 ? 22.496  40.683 22.087  1.00 34.90  ? 1000 LEU A N   1 
ATOM 7746 C CA  . LEU A 1 1003 ? 21.267  41.460 21.897  1.00 34.90  ? 1000 LEU A CA  1 
ATOM 7747 C C   . LEU A 1 1003 ? 21.256  42.770 22.679  1.00 34.90  ? 1000 LEU A C   1 
ATOM 7748 O O   . LEU A 1 1003 ? 20.708  43.751 22.205  1.00 34.90  ? 1000 LEU A O   1 
ATOM 7749 C CB  . LEU A 1 1003 ? 20.071  40.593 22.283  1.00 34.83  ? 1000 LEU A CB  1 
ATOM 7750 C CG  . LEU A 1 1003 ? 18.574  40.842 22.058  1.00 34.83  ? 1000 LEU A CG  1 
ATOM 7751 C CD1 . LEU A 1 1003 ? 17.958  41.013 23.424  1.00 34.83  ? 1000 LEU A CD1 1 
ATOM 7752 C CD2 . LEU A 1 1003 ? 18.181  41.957 21.063  1.00 34.83  ? 1000 LEU A CD2 1 
ATOM 7753 N N   . GLY A 1 1004 ? 21.879  42.784 23.859  1.00 31.67  ? 1001 GLY A N   1 
ATOM 7754 C CA  . GLY A 1 1004 ? 21.920  43.986 24.712  1.00 31.67  ? 1001 GLY A CA  1 
ATOM 7755 C C   . GLY A 1 1004 ? 20.646  44.253 25.508  1.00 31.67  ? 1001 GLY A C   1 
ATOM 7756 O O   . GLY A 1 1004 ? 20.513  45.305 26.114  1.00 31.67  ? 1001 GLY A O   1 
ATOM 7757 N N   . GLU A 1 1005 ? 19.698  43.321 25.503  1.00 35.73  ? 1002 GLU A N   1 
ATOM 7758 C CA  . GLU A 1 1005 ? 18.520  43.434 26.375  1.00 35.73  ? 1002 GLU A CA  1 
ATOM 7759 C C   . GLU A 1 1005 ? 18.404  42.223 27.297  1.00 35.73  ? 1002 GLU A C   1 
ATOM 7760 O O   . GLU A 1 1005 ? 19.091  41.229 27.102  1.00 35.73  ? 1002 GLU A O   1 
ATOM 7761 C CB  . GLU A 1 1005 ? 17.231  43.589 25.572  1.00 40.02  ? 1002 GLU A CB  1 
ATOM 7762 C CG  . GLU A 1 1005 ? 17.112  44.821 24.684  1.00 40.02  ? 1002 GLU A CG  1 
ATOM 7763 C CD  . GLU A 1 1005 ? 17.205  46.164 25.424  1.00 40.02  ? 1002 GLU A CD  1 
ATOM 7764 O OE1 . GLU A 1 1005 ? 17.125  46.234 26.678  1.00 40.02  ? 1002 GLU A OE1 1 
ATOM 7765 O OE2 . GLU A 1 1005 ? 17.365  47.171 24.704  1.00 40.02  ? 1002 GLU A OE2 1 
ATOM 7766 N N   . PHE A 1 1006 ? 17.564  42.312 28.320  1.00 24.20  ? 1003 PHE A N   1 
ATOM 7767 C CA  . PHE A 1 1006 ? 17.307  41.167 29.187  1.00 24.20  ? 1003 PHE A CA  1 
ATOM 7768 C C   . PHE A 1 1006 ? 15.905  40.662 28.822  1.00 24.20  ? 1003 PHE A C   1 
ATOM 7769 O O   . PHE A 1 1006 ? 14.931  41.336 29.133  1.00 24.20  ? 1003 PHE A O   1 
ATOM 7770 C CB  . PHE A 1 1006 ? 17.407  41.541 30.663  1.00 28.92  ? 1003 PHE A CB  1 
ATOM 7771 C CG  . PHE A 1 1006 ? 17.290  40.364 31.593  1.00 28.92  ? 1003 PHE A CG  1 
ATOM 7772 C CD1 . PHE A 1 1006 ? 18.426  39.738 32.092  1.00 28.92  ? 1003 PHE A CD1 1 
ATOM 7773 C CD2 . PHE A 1 1006 ? 16.029  39.857 31.963  1.00 28.92  ? 1003 PHE A CD2 1 
ATOM 7774 C CE1 . PHE A 1 1006 ? 18.322  38.641 32.944  1.00 28.92  ? 1003 PHE A CE1 1 
ATOM 7775 C CE2 . PHE A 1 1006 ? 15.922  38.760 32.813  1.00 28.92  ? 1003 PHE A CE2 1 
ATOM 7776 C CZ  . PHE A 1 1006 ? 17.073  38.146 33.310  1.00 28.92  ? 1003 PHE A CZ  1 
ATOM 7777 N N   . VAL A 1 1007 ? 15.792  39.513 28.146  1.00 29.41  ? 1004 VAL A N   1 
ATOM 7778 C CA  . VAL A 1 1007 ? 14.481  39.038 27.702  1.00 29.41  ? 1004 VAL A CA  1 
ATOM 7779 C C   . VAL A 1 1007 ? 13.661  38.270 28.768  1.00 29.41  ? 1004 VAL A C   1 
ATOM 7780 O O   . VAL A 1 1007 ? 14.179  37.372 29.441  1.00 29.41  ? 1004 VAL A O   1 
ATOM 7781 C CB  . VAL A 1 1007 ? 14.604  38.212 26.426  1.00 29.29  ? 1004 VAL A CB  1 
ATOM 7782 C CG1 . VAL A 1 1007 ? 13.229  37.887 25.864  1.00 29.29  ? 1004 VAL A CG1 1 
ATOM 7783 C CG2 . VAL A 1 1007 ? 15.419  38.966 25.399  1.00 29.29  ? 1004 VAL A CG2 1 
ATOM 7784 N N   . ASN A 1 1008 ? 12.384  38.631 28.921  1.00 28.95  ? 1005 ASN A N   1 
ATOM 7785 C CA  . ASN A 1 1008 ? 11.478  37.963 29.864  1.00 28.95  ? 1005 ASN A CA  1 
ATOM 7786 C C   . ASN A 1 1008 ? 10.447  37.143 29.145  1.00 28.95  ? 1005 ASN A C   1 
ATOM 7787 O O   . ASN A 1 1008 ? 9.833   36.274 29.730  1.00 28.95  ? 1005 ASN A O   1 
ATOM 7788 C CB  . ASN A 1 1008 ? 10.725  38.956 30.742  1.00 32.67  ? 1005 ASN A CB  1 
ATOM 7789 C CG  . ASN A 1 1008 ? 11.558  39.500 31.861  1.00 32.67  ? 1005 ASN A CG  1 
ATOM 7790 O OD1 . ASN A 1 1008 ? 12.454  38.834 32.395  1.00 32.67  ? 1005 ASN A OD1 1 
ATOM 7791 N ND2 . ASN A 1 1008 ? 11.233  40.717 32.271  1.00 32.67  ? 1005 ASN A ND2 1 
ATOM 7792 N N   . VAL A 1 1009 ? 10.188  37.426 27.885  1.00 37.74  ? 1006 VAL A N   1 
ATOM 7793 C CA  . VAL A 1 1009 ? 9.138   36.661 27.263  1.00 37.74  ? 1006 VAL A CA  1 
ATOM 7794 C C   . VAL A 1 1009 ? 9.238   36.646 25.740  1.00 37.74  ? 1006 VAL A C   1 
ATOM 7795 O O   . VAL A 1 1009 ? 9.364   37.689 25.114  1.00 37.74  ? 1006 VAL A O   1 
ATOM 7796 C CB  . VAL A 1 1009 ? 7.725   37.093 27.788  1.00 23.11  ? 1006 VAL A CB  1 
ATOM 7797 C CG1 . VAL A 1 1009 ? 7.584   38.633 27.897  1.00 23.11  ? 1006 VAL A CG1 1 
ATOM 7798 C CG2 . VAL A 1 1009 ? 6.608   36.517 26.924  1.00 23.11  ? 1006 VAL A CG2 1 
ATOM 7799 N N   . PHE A 1 1010 ? 9.226   35.437 25.178  1.00 25.25  ? 1007 PHE A N   1 
ATOM 7800 C CA  . PHE A 1 1010 ? 8.975   35.237 23.777  1.00 25.25  ? 1007 PHE A CA  1 
ATOM 7801 C C   . PHE A 1 1010 ? 7.555   34.716 23.681  1.00 25.25  ? 1007 PHE A C   1 
ATOM 7802 O O   . PHE A 1 1010 ? 7.049   34.068 24.597  1.00 25.25  ? 1007 PHE A O   1 
ATOM 7803 C CB  . PHE A 1 1010 ? 9.870   34.146 23.175  1.00 29.45  ? 1007 PHE A CB  1 
ATOM 7804 C CG  . PHE A 1 1010 ? 11.326  34.325 23.409  1.00 29.45  ? 1007 PHE A CG  1 
ATOM 7805 C CD1 . PHE A 1 1010 ? 11.990  33.524 24.325  1.00 29.45  ? 1007 PHE A CD1 1 
ATOM 7806 C CD2 . PHE A 1 1010 ? 12.058  35.229 22.658  1.00 29.45  ? 1007 PHE A CD2 1 
ATOM 7807 C CE1 . PHE A 1 1010 ? 13.391  33.674 24.526  1.00 29.45  ? 1007 PHE A CE1 1 
ATOM 7808 C CE2 . PHE A 1 1010 ? 13.409  35.381 22.850  1.00 29.45  ? 1007 PHE A CE2 1 
ATOM 7809 C CZ  . PHE A 1 1010 ? 14.080  34.609 23.783  1.00 29.45  ? 1007 PHE A CZ  1 
ATOM 7810 N N   . CYS A 1 1011 ? 6.915   34.997 22.557  1.00 41.11  ? 1008 CYS A N   1 
ATOM 7811 C CA  . CYS A 1 1011 ? 5.676   34.334 22.238  1.00 41.11  ? 1008 CYS A CA  1 
ATOM 7812 C C   . CYS A 1 1011 ? 5.401   34.473 20.755  1.00 41.11  ? 1008 CYS A C   1 
ATOM 7813 O O   . CYS A 1 1011 ? 5.607   35.532 20.182  1.00 41.11  ? 1008 CYS A O   1 
ATOM 7814 C CB  . CYS A 1 1011 ? 4.514   34.851 23.094  1.00 52.79  ? 1008 CYS A CB  1 
ATOM 7815 S SG  . CYS A 1 1011 ? 3.992   36.508 22.732  1.00 52.79  ? 1008 CYS A SG  1 
ATOM 7816 N N   . HIS A 1 1012 ? 4.977   33.375 20.141  1.00 47.45  ? 1009 HIS A N   1 
ATOM 7817 C CA  . HIS A 1 1012 ? 4.602   33.363 18.744  1.00 47.45  ? 1009 HIS A CA  1 
ATOM 7818 C C   . HIS A 1 1012 ? 3.475   34.358 18.491  1.00 47.45  ? 1009 HIS A C   1 
ATOM 7819 O O   . HIS A 1 1012 ? 2.520   34.419 19.259  1.00 47.45  ? 1009 HIS A O   1 
ATOM 7820 C CB  . HIS A 1 1012 ? 4.176   31.946 18.339  1.00 65.95  ? 1009 HIS A CB  1 
ATOM 7821 C CG  . HIS A 1 1012 ? 5.273   30.933 18.455  1.00 65.95  ? 1009 HIS A CG  1 
ATOM 7822 N ND1 . HIS A 1 1012 ? 6.083   30.587 17.396  1.00 65.95  ? 1009 HIS A ND1 1 
ATOM 7823 C CD2 . HIS A 1 1012 ? 5.711   30.209 19.512  1.00 65.95  ? 1009 HIS A CD2 1 
ATOM 7824 C CE1 . HIS A 1 1012 ? 6.964   29.687 17.790  1.00 65.95  ? 1009 HIS A CE1 1 
ATOM 7825 N NE2 . HIS A 1 1012 ? 6.760   29.441 19.071  1.00 65.95  ? 1009 HIS A NE2 1 
ATOM 7826 N N   . GLY A 1 1013 ? 3.588   35.139 17.421  1.00 35.93  ? 1010 GLY A N   1 
ATOM 7827 C CA  . GLY A 1 1013 ? 2.586   36.160 17.113  1.00 35.93  ? 1010 GLY A CA  1 
ATOM 7828 C C   . GLY A 1 1013 ? 3.208   37.272 16.282  1.00 35.93  ? 1010 GLY A C   1 
ATOM 7829 O O   . GLY A 1 1013 ? 4.445   37.386 16.227  1.00 35.93  ? 1010 GLY A O   1 
ATOM 7830 N N   . SER A 1 1014 ? 2.363   38.054 15.605  1.00 51.12  ? 1011 SER A N   1 
ATOM 7831 C CA  . SER A 1 1014 ? 2.813   39.242 14.894  1.00 51.12  ? 1011 SER A CA  1 
ATOM 7832 C C   . SER A 1 1014 ? 1.807   40.365 14.966  1.00 51.12  ? 1011 SER A C   1 
ATOM 7833 O O   . SER A 1 1014 ? 0.604   40.120 15.038  1.00 51.12  ? 1011 SER A O   1 
ATOM 7834 C CB  . SER A 1 1014 ? 3.079   38.957 13.428  1.00 53.61  ? 1011 SER A CB  1 
ATOM 7835 O OG  . SER A 1 1014 ? 3.201   40.192 12.738  1.00 53.61  ? 1011 SER A OG  1 
ATOM 7836 N N   . LEU A 1 1015 ? 2.303   41.597 14.895  1.00 48.93  ? 1012 LEU A N   1 
ATOM 7837 C CA  . LEU A 1 1015 ? 1.427   42.768 14.895  1.00 48.93  ? 1012 LEU A CA  1 
ATOM 7838 C C   . LEU A 1 1015 ? 1.071   43.290 13.502  1.00 48.93  ? 1012 LEU A C   1 
ATOM 7839 O O   . LEU A 1 1015 ? 0.589   44.419 13.376  1.00 48.93  ? 1012 LEU A O   1 
ATOM 7840 C CB  . LEU A 1 1015 ? 2.084   43.897 15.675  1.00 28.35  ? 1012 LEU A CB  1 
ATOM 7841 C CG  . LEU A 1 1015 ? 2.689   43.548 17.033  1.00 28.35  ? 1012 LEU A CG  1 
ATOM 7842 C CD1 . LEU A 1 1015 ? 3.198   44.827 17.689  1.00 28.35  ? 1012 LEU A CD1 1 
ATOM 7843 C CD2 . LEU A 1 1015 ? 1.643   42.873 17.891  1.00 28.35  ? 1012 LEU A CD2 1 
ATOM 7844 N N   . VAL A 1 1016 ? 1.284   42.475 12.473  1.00 67.71  ? 1013 VAL A N   1 
ATOM 7845 C CA  . VAL A 1 1016 ? 1.311   42.991 11.117  1.00 67.71  ? 1013 VAL A CA  1 
ATOM 7846 C C   . VAL A 1 1016 ? 0.129   42.601 10.262  1.00 67.71  ? 1013 VAL A C   1 
ATOM 7847 O O   . VAL A 1 1016 ? -0.544  43.478 9.715   1.00 67.71  ? 1013 VAL A O   1 
ATOM 7848 C CB  . VAL A 1 1016 ? 2.623   42.614 10.394  1.00 70.48  ? 1013 VAL A CB  1 
ATOM 7849 C CG1 . VAL A 1 1016 ? 2.588   43.037 8.929   1.00 70.48  ? 1013 VAL A CG1 1 
ATOM 7850 C CG2 . VAL A 1 1016 ? 3.795   43.268 11.090  1.00 70.48  ? 1013 VAL A CG2 1 
ATOM 7851 N N   . MET A 1 1017 ? -0.099  41.291 10.145  1.00 107.12 ? 1014 MET A N   1 
ATOM 7852 C CA  . MET A 1 1017 ? -0.979  40.685 9.128   1.00 107.12 ? 1014 MET A CA  1 
ATOM 7853 C C   . MET A 1 1017 ? -2.277  41.452 8.831   1.00 107.12 ? 1014 MET A C   1 
ATOM 7854 O O   . MET A 1 1017 ? -2.825  42.143 9.693   1.00 107.12 ? 1014 MET A O   1 
ATOM 7855 C CB  . MET A 1 1017 ? -1.267  39.215 9.493   1.00 106.81 ? 1014 MET A CB  1 
ATOM 7856 C CG  . MET A 1 1017 ? -2.077  38.397 8.470   1.00 106.81 ? 1014 MET A CG  1 
ATOM 7857 S SD  . MET A 1 1017 ? -1.358  38.222 6.812   1.00 106.81 ? 1014 MET A SD  1 
ATOM 7858 C CE  . MET A 1 1017 ? 0.321   37.664 7.176   1.00 106.81 ? 1014 MET A CE  1 
ATOM 7859 N N   . GLN A 1 1018 ? -2.757  41.319 7.599   1.00 90.04  ? 1015 GLN A N   1 
ATOM 7860 C CA  . GLN A 1 1018 ? -3.985  41.977 7.175   1.00 90.04  ? 1015 GLN A CA  1 
ATOM 7861 C C   . GLN A 1 1018 ? -5.191  41.338 7.859   1.00 90.04  ? 1015 GLN A C   1 
ATOM 7862 O O   . GLN A 1 1018 ? -5.750  41.899 8.803   1.00 90.04  ? 1015 GLN A O   1 
ATOM 7863 C CB  . GLN A 1 1018 ? -4.134  41.900 5.651   1.00 172.22 ? 1015 GLN A CB  1 
ATOM 7864 C CG  . GLN A 1 1018 ? -4.837  43.102 5.010   1.00 172.22 ? 1015 GLN A CG  1 
ATOM 7865 C CD  . GLN A 1 1018 ? -6.329  43.173 5.315   1.00 172.22 ? 1015 GLN A CD  1 
ATOM 7866 O OE1 . GLN A 1 1018 ? -7.023  42.155 5.350   1.00 172.22 ? 1015 GLN A OE1 1 
ATOM 7867 N NE2 . GLN A 1 1018 ? -6.827  44.386 5.529   1.00 172.22 ? 1015 GLN A NE2 1 
ATOM 7868 N N   . PRO A 1 1026 ? 9.572   37.521 0.845   1.00 108.41 ? 1023 PRO A N   1 
ATOM 7869 C CA  . PRO A 1 1026 ? 8.746   37.011 1.946   1.00 108.41 ? 1023 PRO A CA  1 
ATOM 7870 C C   . PRO A 1 1026 ? 9.473   35.924 2.734   1.00 108.41 ? 1023 PRO A C   1 
ATOM 7871 O O   . PRO A 1 1026 ? 9.902   34.916 2.158   1.00 108.41 ? 1023 PRO A O   1 
ATOM 7872 C CB  . PRO A 1 1026 ? 7.519   36.432 1.232   1.00 137.99 ? 1023 PRO A CB  1 
ATOM 7873 C CG  . PRO A 1 1026 ? 7.473   37.143 -0.096  1.00 137.99 ? 1023 PRO A CG  1 
ATOM 7874 C CD  . PRO A 1 1026 ? 8.905   37.391 -0.467  1.00 137.99 ? 1023 PRO A CD  1 
ATOM 7875 N N   . THR A 1 1027 ? 9.605   36.139 4.042   1.00 99.78  ? 1024 THR A N   1 
ATOM 7876 C CA  . THR A 1 1027 ? 10.357  35.231 4.925   1.00 99.78  ? 1024 THR A CA  1 
ATOM 7877 C C   . THR A 1 1027 ? 9.465   34.426 5.888   1.00 99.78  ? 1024 THR A C   1 
ATOM 7878 O O   . THR A 1 1027 ? 8.256   34.659 5.969   1.00 99.78  ? 1024 THR A O   1 
ATOM 7879 C CB  . THR A 1 1027 ? 11.432  35.995 5.705   1.00 94.33  ? 1024 THR A CB  1 
ATOM 7880 O OG1 . THR A 1 1027 ? 10.821  37.086 6.403   1.00 94.33  ? 1024 THR A OG1 1 
ATOM 7881 C CG2 . THR A 1 1027 ? 12.487  36.534 4.741   1.00 94.33  ? 1024 THR A CG2 1 
ATOM 7882 N N   . GLN A 1 1028 ? 10.075  33.486 6.612   1.00 80.91  ? 1025 GLN A N   1 
ATOM 7883 C CA  . GLN A 1 1028 ? 9.334   32.490 7.404   1.00 80.91  ? 1025 GLN A CA  1 
ATOM 7884 C C   . GLN A 1 1028 ? 9.493   32.620 8.927   1.00 80.91  ? 1025 GLN A C   1 
ATOM 7885 O O   . GLN A 1 1028 ? 10.606  32.614 9.451   1.00 80.91  ? 1025 GLN A O   1 
ATOM 7886 C CB  . GLN A 1 1028 ? 9.687   31.065 6.921   1.00 125.16 ? 1025 GLN A CB  1 
ATOM 7887 C CG  . GLN A 1 1028 ? 9.530   29.918 7.951   1.00 125.16 ? 1025 GLN A CG  1 
ATOM 7888 C CD  . GLN A 1 1028 ? 8.084   29.480 8.189   1.00 125.16 ? 1025 GLN A CD  1 
ATOM 7889 O OE1 . GLN A 1 1028 ? 7.179   30.303 8.345   1.00 125.16 ? 1025 GLN A OE1 1 
ATOM 7890 N NE2 . GLN A 1 1028 ? 7.872   28.170 8.237   1.00 125.16 ? 1025 GLN A NE2 1 
ATOM 7891 N N   . GLY A 1 1029 ? 8.365   32.725 9.626   1.00 103.26 ? 1026 GLY A N   1 
ATOM 7892 C CA  . GLY A 1 1029 ? 8.356   32.769 11.091  1.00 103.26 ? 1026 GLY A CA  1 
ATOM 7893 C C   . GLY A 1 1029 ? 8.047   34.141 11.670  1.00 103.26 ? 1026 GLY A C   1 
ATOM 7894 O O   . GLY A 1 1029 ? 8.057   35.142 10.941  1.00 103.26 ? 1026 GLY A O   1 
ATOM 7895 N N   . SER A 1 1030 ? 7.764   34.177 12.981  1.00 47.00  ? 1027 SER A N   1 
ATOM 7896 C CA  . SER A 1 1030 ? 7.490   35.418 13.742  1.00 47.00  ? 1027 SER A CA  1 
ATOM 7897 C C   . SER A 1 1030 ? 7.423   35.195 15.254  1.00 47.00  ? 1027 SER A C   1 
ATOM 7898 O O   . SER A 1 1030 ? 6.417   34.719 15.793  1.00 47.00  ? 1027 SER A O   1 
ATOM 7899 C CB  . SER A 1 1030 ? 6.179   36.028 13.298  1.00 40.11  ? 1027 SER A CB  1 
ATOM 7900 O OG  . SER A 1 1030 ? 5.926   37.178 14.058  1.00 40.11  ? 1027 SER A OG  1 
ATOM 7901 N N   . VAL A 1 1031 ? 8.483   35.562 15.951  1.00 41.21  ? 1028 VAL A N   1 
ATOM 7902 C CA  . VAL A 1 1031 ? 8.466   35.447 17.407  1.00 41.21  ? 1028 VAL A CA  1 
ATOM 7903 C C   . VAL A 1 1031 ? 8.761   36.794 18.045  1.00 41.21  ? 1028 VAL A C   1 
ATOM 7904 O O   . VAL A 1 1031 ? 9.837   37.345 17.847  1.00 41.21  ? 1028 VAL A O   1 
ATOM 7905 C CB  . VAL A 1 1031 ? 9.445   34.350 17.892  1.00 21.58  ? 1028 VAL A CB  1 
ATOM 7906 C CG1 . VAL A 1 1031 ? 9.942   34.641 19.290  1.00 21.58  ? 1028 VAL A CG1 1 
ATOM 7907 C CG2 . VAL A 1 1031 ? 8.770   32.990 17.858  1.00 21.58  ? 1028 VAL A CG2 1 
ATOM 7908 N N   . LEU A 1 1032 ? 7.791   37.340 18.773  1.00 42.20  ? 1029 LEU A N   1 
ATOM 7909 C CA  . LEU A 1 1032 ? 7.980   38.600 19.501  1.00 42.20  ? 1029 LEU A CA  1 
ATOM 7910 C C   . LEU A 1 1032 ? 8.605   38.337 20.876  1.00 42.20  ? 1029 LEU A C   1 
ATOM 7911 O O   . LEU A 1 1032 ? 8.465   37.230 21.418  1.00 42.20  ? 1029 LEU A O   1 
ATOM 7912 C CB  . LEU A 1 1032 ? 6.644   39.326 19.647  1.00 41.91  ? 1029 LEU A CB  1 
ATOM 7913 C CG  . LEU A 1 1032 ? 5.968   39.802 18.361  1.00 41.91  ? 1029 LEU A CG  1 
ATOM 7914 C CD1 . LEU A 1 1032 ? 4.560   40.207 18.629  1.00 41.91  ? 1029 LEU A CD1 1 
ATOM 7915 C CD2 . LEU A 1 1032 ? 6.736   40.952 17.723  1.00 41.91  ? 1029 LEU A CD2 1 
ATOM 7916 N N   . PHE A 1 1033 ? 9.309   39.333 21.415  1.00 24.51  ? 1030 PHE A N   1 
ATOM 7917 C CA  . PHE A 1 1033 ? 9.917   39.259 22.748  1.00 24.51  ? 1030 PHE A CA  1 
ATOM 7918 C C   . PHE A 1 1033 ? 9.898   40.572 23.544  1.00 24.51  ? 1030 PHE A C   1 
ATOM 7919 O O   . PHE A 1 1033 ? 9.940   41.651 22.964  1.00 24.51  ? 1030 PHE A O   1 
ATOM 7920 C CB  . PHE A 1 1033 ? 11.319  38.616 22.724  1.00 32.66  ? 1030 PHE A CB  1 
ATOM 7921 C CG  . PHE A 1 1033 ? 12.382  39.449 22.085  1.00 32.66  ? 1030 PHE A CG  1 
ATOM 7922 C CD1 . PHE A 1 1033 ? 12.985  40.482 22.775  1.00 32.66  ? 1030 PHE A CD1 1 
ATOM 7923 C CD2 . PHE A 1 1033 ? 12.813  39.174 20.781  1.00 32.66  ? 1030 PHE A CD2 1 
ATOM 7924 C CE1 . PHE A 1 1033 ? 13.976  41.272 22.159  1.00 32.66  ? 1030 PHE A CE1 1 
ATOM 7925 C CE2 . PHE A 1 1033 ? 13.799  39.960 20.156  1.00 32.66  ? 1030 PHE A CE2 1 
ATOM 7926 C CZ  . PHE A 1 1033 ? 14.381  41.008 20.849  1.00 32.66  ? 1030 PHE A CZ  1 
ATOM 7927 N N   . GLY A 1 1034 ? 9.814   40.484 24.872  1.00 30.71  ? 1031 GLY A N   1 
ATOM 7928 C CA  . GLY A 1 1034 ? 9.666   41.644 25.732  1.00 30.71  ? 1031 GLY A CA  1 
ATOM 7929 C C   . GLY A 1 1034 ? 10.807  41.686 26.711  1.00 30.71  ? 1031 GLY A C   1 
ATOM 7930 O O   . GLY A 1 1034 ? 11.342  40.664 27.099  1.00 30.71  ? 1031 GLY A O   1 
ATOM 7931 N N   . THR A 1 1035 ? 11.142  42.895 27.149  1.00 39.76  ? 1032 THR A N   1 
ATOM 7932 C CA  . THR A 1 1035 ? 12.440  43.244 27.715  1.00 39.76  ? 1032 THR A CA  1 
ATOM 7933 C C   . THR A 1 1035 ? 12.236  43.900 29.053  1.00 39.76  ? 1032 THR A C   1 
ATOM 7934 O O   . THR A 1 1035 ? 11.148  44.385 29.338  1.00 39.76  ? 1032 THR A O   1 
ATOM 7935 C CB  . THR A 1 1035 ? 13.083  44.293 26.799  1.00 77.22  ? 1032 THR A CB  1 
ATOM 7936 O OG1 . THR A 1 1035 ? 13.278  43.728 25.505  1.00 77.22  ? 1032 THR A OG1 1 
ATOM 7937 C CG2 . THR A 1 1035 ? 14.404  44.783 27.323  1.00 77.22  ? 1032 THR A CG2 1 
ATOM 7938 N N   . VAL A 1 1036 ? 13.289  43.928 29.866  1.00 28.11  ? 1033 VAL A N   1 
ATOM 7939 C CA  . VAL A 1 1036 ? 13.307  44.693 31.099  1.00 28.11  ? 1033 VAL A CA  1 
ATOM 7940 C C   . VAL A 1 1036 ? 13.262  46.192 30.768  1.00 28.11  ? 1033 VAL A C   1 
ATOM 7941 O O   . VAL A 1 1036 ? 12.497  46.950 31.351  1.00 28.11  ? 1033 VAL A O   1 
ATOM 7942 C CB  . VAL A 1 1036 ? 14.557  44.338 31.942  1.00 9.62   ? 1033 VAL A CB  1 
ATOM 7943 C CG1 . VAL A 1 1036 ? 14.907  45.415 32.964  1.00 9.62   ? 1033 VAL A CG1 1 
ATOM 7944 C CG2 . VAL A 1 1036 ? 14.419  42.963 32.606  1.00 9.62   ? 1033 VAL A CG2 1 
ATOM 7945 N N   . ASN A 1 1037 ? 14.065  46.622 29.809  1.00 20.63  ? 1034 ASN A N   1 
ATOM 7946 C CA  . ASN A 1 1037 ? 13.990  48.016 29.334  1.00 20.63  ? 1034 ASN A CA  1 
ATOM 7947 C C   . ASN A 1 1037 ? 12.720  48.405 28.578  1.00 20.63  ? 1034 ASN A C   1 
ATOM 7948 O O   . ASN A 1 1037 ? 12.511  49.585 28.292  1.00 20.63  ? 1034 ASN A O   1 
ATOM 7949 C CB  . ASN A 1 1037 ? 15.229  48.376 28.538  1.00 22.51  ? 1034 ASN A CB  1 
ATOM 7950 C CG  . ASN A 1 1037 ? 16.415  48.533 29.412  1.00 22.51  ? 1034 ASN A CG  1 
ATOM 7951 O OD1 . ASN A 1 1037 ? 17.542  48.309 28.985  1.00 22.51  ? 1034 ASN A OD1 1 
ATOM 7952 N ND2 . ASN A 1 1037 ? 16.191  48.895 30.678  1.00 22.51  ? 1034 ASN A ND2 1 
ATOM 7953 N N   . GLY A 1 1038 ? 11.886  47.425 28.260  1.00 28.40  ? 1035 GLY A N   1 
ATOM 7954 C CA  . GLY A 1 1038 ? 10.595  47.677 27.641  1.00 28.40  ? 1035 GLY A CA  1 
ATOM 7955 C C   . GLY A 1 1038 ? 10.653  47.702 26.128  1.00 28.40  ? 1035 GLY A C   1 
ATOM 7956 O O   . GLY A 1 1038 ? 9.862   48.389 25.490  1.00 28.40  ? 1035 GLY A O   1 
ATOM 7957 N N   . MET A 1 1039 ? 11.535  46.887 25.560  1.00 41.55  ? 1036 MET A N   1 
ATOM 7958 C CA  . MET A 1 1039 ? 11.935  46.988 24.184  1.00 41.55  ? 1036 MET A CA  1 
ATOM 7959 C C   . MET A 1 1039 ? 10.985  46.322 23.160  1.00 41.55  ? 1036 MET A C   1 
ATOM 7960 O O   . MET A 1 1039 ? 10.575  46.934 22.181  1.00 41.55  ? 1036 MET A O   1 
ATOM 7961 C CB  . MET A 1 1039 ? 13.396  46.549 24.083  1.00 44.29  ? 1036 MET A CB  1 
ATOM 7962 C CG  . MET A 1 1039 ? 14.030  46.571 22.739  1.00 44.29  ? 1036 MET A CG  1 
ATOM 7963 S SD  . MET A 1 1039 ? 14.149  44.898 22.078  1.00 44.29  ? 1036 MET A SD  1 
ATOM 7964 C CE  . MET A 1 1039 ? 15.555  45.068 20.999  1.00 44.29  ? 1036 MET A CE  1 
ATOM 7965 N N   . ILE A 1 1040 ? 10.571  45.097 23.353  1.00 30.94  ? 1037 ILE A N   1 
ATOM 7966 C CA  . ILE A 1 1040 ? 9.821   44.438 22.242  1.00 30.94  ? 1037 ILE A CA  1 
ATOM 7967 C C   . ILE A 1 1040 ? 10.645  44.233 20.962  1.00 30.94  ? 1037 ILE A C   1 
ATOM 7968 O O   . ILE A 1 1040 ? 10.880  45.173 20.186  1.00 30.94  ? 1037 ILE A O   1 
ATOM 7969 C CB  . ILE A 1 1040 ? 8.489   45.091 21.796  1.00 15.90  ? 1037 ILE A CB  1 
ATOM 7970 C CG1 . ILE A 1 1040 ? 7.606   45.512 22.983  1.00 15.90  ? 1037 ILE A CG1 1 
ATOM 7971 C CG2 . ILE A 1 1040 ? 7.694   44.029 20.988  1.00 15.90  ? 1037 ILE A CG2 1 
ATOM 7972 C CD1 . ILE A 1 1040 ? 6.264   46.225 22.611  1.00 15.90  ? 1037 ILE A CD1 1 
ATOM 7973 N N   . GLY A 1 1041 ? 11.061  42.981 20.757  1.00 56.45  ? 1038 GLY A N   1 
ATOM 7974 C CA  . GLY A 1 1041 ? 11.798  42.581 19.576  1.00 56.45  ? 1038 GLY A CA  1 
ATOM 7975 C C   . GLY A 1 1041 ? 10.986  41.638 18.717  1.00 56.45  ? 1038 GLY A C   1 
ATOM 7976 O O   . GLY A 1 1041 ? 9.865   41.280 19.074  1.00 56.45  ? 1038 GLY A O   1 
ATOM 7977 N N   . LEU A 1 1042 ? 11.553  41.274 17.566  1.00 39.61  ? 1039 LEU A N   1 
ATOM 7978 C CA  . LEU A 1 1042 ? 10.971  40.308 16.654  1.00 39.61  ? 1039 LEU A CA  1 
ATOM 7979 C C   . LEU A 1 1042 ? 12.050  39.428 16.060  1.00 39.61  ? 1039 LEU A C   1 
ATOM 7980 O O   . LEU A 1 1042 ? 13.159  39.896 15.782  1.00 39.61  ? 1039 LEU A O   1 
ATOM 7981 C CB  . LEU A 1 1042 ? 10.221  41.018 15.548  1.00 42.57  ? 1039 LEU A CB  1 
ATOM 7982 C CG  . LEU A 1 1042 ? 9.780   40.318 14.259  1.00 42.57  ? 1039 LEU A CG  1 
ATOM 7983 C CD1 . LEU A 1 1042 ? 8.833   39.160 14.505  1.00 42.57  ? 1039 LEU A CD1 1 
ATOM 7984 C CD2 . LEU A 1 1042 ? 9.084   41.369 13.434  1.00 42.57  ? 1039 LEU A CD2 1 
ATOM 7985 N N   . VAL A 1 1043 ? 11.729  38.147 15.902  1.00 45.99  ? 1040 VAL A N   1 
ATOM 7986 C CA  . VAL A 1 1043 ? 12.679  37.180 15.389  1.00 45.99  ? 1040 VAL A CA  1 
ATOM 7987 C C   . VAL A 1 1043 ? 11.999  36.328 14.329  1.00 45.99  ? 1040 VAL A C   1 
ATOM 7988 O O   . VAL A 1 1043 ? 10.847  35.909 14.514  1.00 45.99  ? 1040 VAL A O   1 
ATOM 7989 C CB  . VAL A 1 1043 ? 13.242  36.262 16.491  1.00 33.30  ? 1040 VAL A CB  1 
ATOM 7990 C CG1 . VAL A 1 1043 ? 14.165  35.212 15.884  1.00 33.30  ? 1040 VAL A CG1 1 
ATOM 7991 C CG2 . VAL A 1 1043 ? 14.012  37.055 17.536  1.00 33.30  ? 1040 VAL A CG2 1 
ATOM 7992 N N   . THR A 1 1044 ? 12.719  36.081 13.230  1.00 60.01  ? 1041 THR A N   1 
ATOM 7993 C CA  . THR A 1 1044 ? 12.212  35.325 12.086  1.00 60.01  ? 1041 THR A CA  1 
ATOM 7994 C C   . THR A 1 1044 ? 13.333  34.481 11.521  1.00 60.01  ? 1041 THR A C   1 
ATOM 7995 O O   . THR A 1 1044 ? 14.514  34.758 11.762  1.00 60.01  ? 1041 THR A O   1 
ATOM 7996 C CB  . THR A 1 1044 ? 11.812  36.265 10.957  1.00 66.66  ? 1041 THR A CB  1 
ATOM 7997 O OG1 . THR A 1 1044 ? 11.559  37.565 11.487  1.00 66.66  ? 1041 THR A OG1 1 
ATOM 7998 C CG2 . THR A 1 1044 ? 10.587  35.774 10.239  1.00 66.66  ? 1041 THR A CG2 1 
ATOM 7999 N N   . SER A 1 1045 ? 12.952  33.458 10.758  1.00 62.24  ? 1042 SER A N   1 
ATOM 8000 C CA  . SER A 1 1045 ? 13.896  32.610 10.042  1.00 62.24  ? 1042 SER A CA  1 
ATOM 8001 C C   . SER A 1 1045 ? 14.108  33.140 8.622   1.00 62.24  ? 1042 SER A C   1 
ATOM 8002 O O   . SER A 1 1045 ? 13.246  33.833 8.055   1.00 62.24  ? 1042 SER A O   1 
ATOM 8003 C CB  . SER A 1 1045 ? 13.387  31.175 10.001  1.00 99.41  ? 1042 SER A CB  1 
ATOM 8004 O OG  . SER A 1 1045 ? 12.666  30.867 11.184  1.00 99.41  ? 1042 SER A OG  1 
ATOM 8005 N N   . LEU A 1 1046 ? 15.270  32.828 8.059   1.00 76.47  ? 1043 LEU A N   1 
ATOM 8006 C CA  . LEU A 1 1046 ? 15.580  33.207 6.681   1.00 76.47  ? 1043 LEU A CA  1 
ATOM 8007 C C   . LEU A 1 1046 ? 15.824  31.972 5.812   1.00 76.47  ? 1043 LEU A C   1 
ATOM 8008 O O   . LEU A 1 1046 ? 15.122  30.965 5.922   1.00 76.47  ? 1043 LEU A O   1 
ATOM 8009 C CB  . LEU A 1 1046 ? 16.783  34.162 6.645   1.00 61.95  ? 1043 LEU A CB  1 
ATOM 8010 C CG  . LEU A 1 1046 ? 16.623  35.538 7.316   1.00 61.95  ? 1043 LEU A CG  1 
ATOM 8011 C CD1 . LEU A 1 1046 ? 17.958  35.986 7.870   1.00 61.95  ? 1043 LEU A CD1 1 
ATOM 8012 C CD2 . LEU A 1 1046 ? 16.031  36.596 6.378   1.00 61.95  ? 1043 LEU A CD2 1 
ATOM 8013 N N   . SER A 1 1047 ? 16.817  32.068 4.940   1.00 88.08  ? 1044 SER A N   1 
ATOM 8014 C CA  . SER A 1 1047 ? 17.191  30.983 4.055   1.00 88.08  ? 1044 SER A CA  1 
ATOM 8015 C C   . SER A 1 1047 ? 18.521  31.340 3.426   1.00 88.08  ? 1044 SER A C   1 
ATOM 8016 O O   . SER A 1 1047 ? 18.764  32.512 3.085   1.00 88.08  ? 1044 SER A O   1 
ATOM 8017 C CB  . SER A 1 1047 ? 16.131  30.767 2.972   1.00 62.04  ? 1044 SER A CB  1 
ATOM 8018 O OG  . SER A 1 1047 ? 15.858  31.975 2.287   1.00 62.04  ? 1044 SER A OG  1 
ATOM 8019 N N   . GLU A 1 1048 ? 19.372  30.319 3.297   1.00 64.36  ? 1045 GLU A N   1 
ATOM 8020 C CA  . GLU A 1 1048 ? 20.682  30.398 2.607   1.00 64.36  ? 1045 GLU A CA  1 
ATOM 8021 C C   . GLU A 1 1048 ? 20.949  31.720 1.869   1.00 64.36  ? 1045 GLU A C   1 
ATOM 8022 O O   . GLU A 1 1048 ? 21.810  32.486 2.280   1.00 64.36  ? 1045 GLU A O   1 
ATOM 8023 C CB  . GLU A 1 1048 ? 20.885  29.176 1.679   1.00 176.16 ? 1045 GLU A CB  1 
ATOM 8024 C CG  . GLU A 1 1048 ? 20.272  29.261 0.260   1.00 176.16 ? 1045 GLU A CG  1 
ATOM 8025 C CD  . GLU A 1 1048 ? 18.745  29.317 0.239   1.00 176.16 ? 1045 GLU A CD  1 
ATOM 8026 O OE1 . GLU A 1 1048 ? 18.101  28.311 0.599   1.00 176.16 ? 1045 GLU A OE1 1 
ATOM 8027 O OE2 . GLU A 1 1048 ? 18.188  30.365 -0.158  1.00 176.16 ? 1045 GLU A OE2 1 
ATOM 8028 N N   . SER A 1 1049 ? 20.187  31.999 0.814   1.00 64.00  ? 1046 SER A N   1 
ATOM 8029 C CA  . SER A 1 1049 ? 20.446  33.191 -0.003  1.00 64.00  ? 1046 SER A CA  1 
ATOM 8030 C C   . SER A 1 1049 ? 20.396  34.504 0.811   1.00 64.00  ? 1046 SER A C   1 
ATOM 8031 O O   . SER A 1 1049 ? 21.431  35.182 0.957   1.00 64.00  ? 1046 SER A O   1 
ATOM 8032 C CB  . SER A 1 1049 ? 19.583  33.228 -1.289  1.00 92.20  ? 1046 SER A CB  1 
ATOM 8033 O OG  . SER A 1 1049 ? 18.421  34.027 -1.159  1.00 92.20  ? 1046 SER A OG  1 
ATOM 8034 N N   . TRP A 1 1050 ? 19.220  34.834 1.353   1.00 52.40  ? 1047 TRP A N   1 
ATOM 8035 C CA  . TRP A 1 1050 ? 19.070  36.025 2.183   1.00 52.40  ? 1047 TRP A CA  1 
ATOM 8036 C C   . TRP A 1 1050 ? 20.164  36.115 3.244   1.00 52.40  ? 1047 TRP A C   1 
ATOM 8037 O O   . TRP A 1 1050 ? 20.922  37.090 3.286   1.00 52.40  ? 1047 TRP A O   1 
ATOM 8038 C CB  . TRP A 1 1050 ? 17.716  36.019 2.868   1.00 98.51  ? 1047 TRP A CB  1 
ATOM 8039 C CG  . TRP A 1 1050 ? 16.601  36.063 1.923   1.00 98.51  ? 1047 TRP A CG  1 
ATOM 8040 C CD1 . TRP A 1 1050 ? 16.002  35.002 1.324   1.00 98.51  ? 1047 TRP A CD1 1 
ATOM 8041 C CD2 . TRP A 1 1050 ? 15.931  37.234 1.446   1.00 98.51  ? 1047 TRP A CD2 1 
ATOM 8042 N NE1 . TRP A 1 1050 ? 14.991  35.434 0.498   1.00 98.51  ? 1047 TRP A NE1 1 
ATOM 8043 C CE2 . TRP A 1 1050 ? 14.924  36.800 0.554   1.00 98.51  ? 1047 TRP A CE2 1 
ATOM 8044 C CE3 . TRP A 1 1050 ? 16.079  38.608 1.687   1.00 98.51  ? 1047 TRP A CE3 1 
ATOM 8045 C CZ2 . TRP A 1 1050 ? 14.064  37.689 -0.098  1.00 98.51  ? 1047 TRP A CZ2 1 
ATOM 8046 C CZ3 . TRP A 1 1050 ? 15.224  39.493 1.042   1.00 98.51  ? 1047 TRP A CZ3 1 
ATOM 8047 C CH2 . TRP A 1 1050 ? 14.228  39.029 0.159   1.00 98.51  ? 1047 TRP A CH2 1 
ATOM 8048 N N   . TYR A 1 1051 ? 20.253  35.092 4.091   1.00 63.58  ? 1048 TYR A N   1 
ATOM 8049 C CA  . TYR A 1 1051 ? 21.170  35.172 5.209   1.00 63.58  ? 1048 TYR A CA  1 
ATOM 8050 C C   . TYR A 1 1051 ? 22.543  35.560 4.717   1.00 63.58  ? 1048 TYR A C   1 
ATOM 8051 O O   . TYR A 1 1051 ? 23.168  36.428 5.308   1.00 63.58  ? 1048 TYR A O   1 
ATOM 8052 C CB  . TYR A 1 1051 ? 21.216  33.888 6.033   1.00 66.04  ? 1048 TYR A CB  1 
ATOM 8053 C CG  . TYR A 1 1051 ? 22.391  33.838 6.988   1.00 66.04  ? 1048 TYR A CG  1 
ATOM 8054 C CD1 . TYR A 1 1051 ? 22.296  34.325 8.286   1.00 66.04  ? 1048 TYR A CD1 1 
ATOM 8055 C CD2 . TYR A 1 1051 ? 23.609  33.297 6.580   1.00 66.04  ? 1048 TYR A CD2 1 
ATOM 8056 C CE1 . TYR A 1 1051 ? 23.405  34.273 9.164   1.00 66.04  ? 1048 TYR A CE1 1 
ATOM 8057 C CE2 . TYR A 1 1051 ? 24.710  33.225 7.435   1.00 66.04  ? 1048 TYR A CE2 1 
ATOM 8058 C CZ  . TYR A 1 1051 ? 24.616  33.714 8.723   1.00 66.04  ? 1048 TYR A CZ  1 
ATOM 8059 O OH  . TYR A 1 1051 ? 25.744  33.626 9.539   1.00 66.04  ? 1048 TYR A OH  1 
ATOM 8060 N N   . ASN A 1 1052 ? 23.001  34.942 3.626   1.00 50.48  ? 1049 ASN A N   1 
ATOM 8061 C CA  . ASN A 1 1052 ? 24.309  35.279 3.039   1.00 50.48  ? 1049 ASN A CA  1 
ATOM 8062 C C   . ASN A 1 1052 ? 24.339  36.669 2.416   1.00 50.48  ? 1049 ASN A C   1 
ATOM 8063 O O   . ASN A 1 1052 ? 25.223  37.463 2.720   1.00 50.48  ? 1049 ASN A O   1 
ATOM 8064 C CB  . ASN A 1 1052 ? 24.752  34.226 2.037   1.00 57.73  ? 1049 ASN A CB  1 
ATOM 8065 C CG  . ASN A 1 1052 ? 25.216  32.964 2.707   1.00 57.73  ? 1049 ASN A CG  1 
ATOM 8066 O OD1 . ASN A 1 1052 ? 26.224  32.957 3.410   1.00 57.73  ? 1049 ASN A OD1 1 
ATOM 8067 N ND2 . ASN A 1 1052 ? 24.483  31.882 2.497   1.00 57.73  ? 1049 ASN A ND2 1 
ATOM 8068 N N   . LEU A 1 1053 ? 23.367  36.961 1.565   1.00 46.44  ? 1050 LEU A N   1 
ATOM 8069 C CA  . LEU A 1 1053 ? 23.226  38.265 0.972   1.00 46.44  ? 1050 LEU A CA  1 
ATOM 8070 C C   . LEU A 1 1053 ? 23.241  39.315 2.079   1.00 46.44  ? 1050 LEU A C   1 
ATOM 8071 O O   . LEU A 1 1053 ? 24.035  40.276 2.043   1.00 46.44  ? 1050 LEU A O   1 
ATOM 8072 C CB  . LEU A 1 1053 ? 21.889  38.308 0.244   1.00 44.27  ? 1050 LEU A CB  1 
ATOM 8073 C CG  . LEU A 1 1053 ? 21.413  39.412 -0.703  1.00 44.27  ? 1050 LEU A CG  1 
ATOM 8074 C CD1 . LEU A 1 1053 ? 19.912  39.251 -0.875  1.00 44.27  ? 1050 LEU A CD1 1 
ATOM 8075 C CD2 . LEU A 1 1053 ? 21.743  40.846 -0.245  1.00 44.27  ? 1050 LEU A CD2 1 
ATOM 8076 N N   . LEU A 1 1054 ? 22.364  39.137 3.072   1.00 48.55  ? 1051 LEU A N   1 
ATOM 8077 C CA  . LEU A 1 1054 ? 22.264  40.083 4.193   1.00 48.55  ? 1051 LEU A CA  1 
ATOM 8078 C C   . LEU A 1 1054 ? 23.541  40.119 5.027   1.00 48.55  ? 1051 LEU A C   1 
ATOM 8079 O O   . LEU A 1 1054 ? 23.967  41.185 5.491   1.00 48.55  ? 1051 LEU A O   1 
ATOM 8080 C CB  . LEU A 1 1054 ? 21.044  39.773 5.063   1.00 34.75  ? 1051 LEU A CB  1 
ATOM 8081 C CG  . LEU A 1 1054 ? 19.638  40.073 4.479   1.00 34.75  ? 1051 LEU A CG  1 
ATOM 8082 C CD1 . LEU A 1 1054 ? 18.551  39.659 5.442   1.00 34.75  ? 1051 LEU A CD1 1 
ATOM 8083 C CD2 . LEU A 1 1054 ? 19.481  41.560 4.100   1.00 34.75  ? 1051 LEU A CD2 1 
ATOM 8084 N N   . LEU A 1 1055 ? 24.164  38.953 5.183   1.00 64.06  ? 1052 LEU A N   1 
ATOM 8085 C CA  . LEU A 1 1055 ? 25.443  38.857 5.873   1.00 64.06  ? 1052 LEU A CA  1 
ATOM 8086 C C   . LEU A 1 1055 ? 26.495  39.647 5.089   1.00 64.06  ? 1052 LEU A C   1 
ATOM 8087 O O   . LEU A 1 1055 ? 27.375  40.298 5.674   1.00 64.06  ? 1052 LEU A O   1 
ATOM 8088 C CB  . LEU A 1 1055 ? 25.862  37.392 6.046   1.00 35.26  ? 1052 LEU A CB  1 
ATOM 8089 C CG  . LEU A 1 1055 ? 26.683  36.990 7.298   1.00 35.26  ? 1052 LEU A CG  1 
ATOM 8090 C CD1 . LEU A 1 1055 ? 27.274  35.587 7.154   1.00 35.26  ? 1052 LEU A CD1 1 
ATOM 8091 C CD2 . LEU A 1 1055 ? 27.812  37.952 7.664   1.00 35.26  ? 1052 LEU A CD2 1 
ATOM 8092 N N   . ASP A 1 1056 ? 26.379  39.587 3.763   1.00 46.87  ? 1053 ASP A N   1 
ATOM 8093 C CA  . ASP A 1 1056 ? 27.229  40.332 2.865   1.00 46.87  ? 1053 ASP A CA  1 
ATOM 8094 C C   . ASP A 1 1056 ? 26.987  41.788 3.210   1.00 46.87  ? 1053 ASP A C   1 
ATOM 8095 O O   . ASP A 1 1056 ? 27.908  42.525 3.656   1.00 46.87  ? 1053 ASP A O   1 
ATOM 8096 C CB  . ASP A 1 1056 ? 26.810  40.023 1.420   1.00 90.66  ? 1053 ASP A CB  1 
ATOM 8097 C CG  . ASP A 1 1056 ? 27.746  40.610 0.368   1.00 90.66  ? 1053 ASP A CG  1 
ATOM 8098 O OD1 . ASP A 1 1056 ? 28.204  41.768 0.496   1.00 90.66  ? 1053 ASP A OD1 1 
ATOM 8099 O OD2 . ASP A 1 1056 ? 27.989  39.903 -0.632  1.00 90.66  ? 1053 ASP A OD2 1 
ATOM 8100 N N   . MET A 1 1057 ? 25.720  42.171 3.071   1.00 67.70  ? 1054 MET A N   1 
ATOM 8101 C CA  . MET A 1 1057 ? 25.319  43.547 3.246   1.00 67.70  ? 1054 MET A CA  1 
ATOM 8102 C C   . MET A 1 1057 ? 25.777  44.139 4.581   1.00 67.70  ? 1054 MET A C   1 
ATOM 8103 O O   . MET A 1 1057 ? 26.113  45.313 4.655   1.00 67.70  ? 1054 MET A O   1 
ATOM 8104 C CB  . MET A 1 1057 ? 23.827  43.674 3.087   1.00 94.01  ? 1054 MET A CB  1 
ATOM 8105 C CG  . MET A 1 1057 ? 23.470  44.915 2.362   1.00 94.01  ? 1054 MET A CG  1 
ATOM 8106 S SD  . MET A 1 1057 ? 21.699  45.036 2.205   1.00 94.01  ? 1054 MET A SD  1 
ATOM 8107 C CE  . MET A 1 1057 ? 21.305  46.120 3.572   1.00 94.01  ? 1054 MET A CE  1 
ATOM 8108 N N   . GLN A 1 1058 ? 25.808  43.311 5.619   1.00 40.29  ? 1055 GLN A N   1 
ATOM 8109 C CA  . GLN A 1 1058 ? 26.295  43.718 6.916   1.00 40.29  ? 1055 GLN A CA  1 
ATOM 8110 C C   . GLN A 1 1058 ? 27.740  44.192 6.893   1.00 40.29  ? 1055 GLN A C   1 
ATOM 8111 O O   . GLN A 1 1058 ? 28.040  45.315 7.343   1.00 40.29  ? 1055 GLN A O   1 
ATOM 8112 C CB  . GLN A 1 1058 ? 26.135  42.576 7.900   1.00 66.37  ? 1055 GLN A CB  1 
ATOM 8113 C CG  . GLN A 1 1058 ? 24.698  42.359 8.331   1.00 66.37  ? 1055 GLN A CG  1 
ATOM 8114 C CD  . GLN A 1 1058 ? 24.597  41.682 9.676   1.00 66.37  ? 1055 GLN A CD  1 
ATOM 8115 O OE1 . GLN A 1 1058 ? 25.536  41.701 10.474  1.00 66.37  ? 1055 GLN A OE1 1 
ATOM 8116 N NE2 . GLN A 1 1058 ? 23.459  41.071 9.932   1.00 66.37  ? 1055 GLN A NE2 1 
ATOM 8117 N N   . ASN A 1 1059 ? 28.636  43.363 6.358   1.00 79.81  ? 1056 ASN A N   1 
ATOM 8118 C CA  . ASN A 1 1059 ? 30.064  43.689 6.376   1.00 79.81  ? 1056 ASN A CA  1 
ATOM 8119 C C   . ASN A 1 1059 ? 30.418  44.932 5.563   1.00 79.81  ? 1056 ASN A C   1 
ATOM 8120 O O   . ASN A 1 1059 ? 31.241  45.744 5.998   1.00 79.81  ? 1056 ASN A O   1 
ATOM 8121 C CB  . ASN A 1 1059 ? 30.917  42.486 5.984   1.00 98.01  ? 1056 ASN A CB  1 
ATOM 8122 C CG  . ASN A 1 1059 ? 31.065  41.500 7.119   1.00 98.01  ? 1056 ASN A CG  1 
ATOM 8123 O OD1 . ASN A 1 1059 ? 30.577  40.374 7.046   1.00 98.01  ? 1056 ASN A OD1 1 
ATOM 8124 N ND2 . ASN A 1 1059 ? 31.719  41.931 8.195   1.00 98.01  ? 1056 ASN A ND2 1 
ATOM 8125 N N   . ARG A 1 1060 ? 29.766  45.088 4.412   1.00 68.52  ? 1057 ARG A N   1 
ATOM 8126 C CA  . ARG A 1 1060 ? 29.912  46.286 3.586   1.00 68.52  ? 1057 ARG A CA  1 
ATOM 8127 C C   . ARG A 1 1060 ? 29.400  47.524 4.329   1.00 68.52  ? 1057 ARG A C   1 
ATOM 8128 O O   . ARG A 1 1060 ? 30.082  48.561 4.397   1.00 68.52  ? 1057 ARG A O   1 
ATOM 8129 C CB  . ARG A 1 1060 ? 29.159  46.111 2.267   1.00 83.26  ? 1057 ARG A CB  1 
ATOM 8130 C CG  . ARG A 1 1060 ? 29.577  44.901 1.463   1.00 83.26  ? 1057 ARG A CG  1 
ATOM 8131 C CD  . ARG A 1 1060 ? 28.903  44.892 0.101   1.00 83.26  ? 1057 ARG A CD  1 
ATOM 8132 N NE  . ARG A 1 1060 ? 29.657  44.090 -0.866  1.00 83.26  ? 1057 ARG A NE  1 
ATOM 8133 C CZ  . ARG A 1 1060 ? 29.505  44.153 -2.186  1.00 83.26  ? 1057 ARG A CZ  1 
ATOM 8134 N NH1 . ARG A 1 1060 ? 28.615  44.976 -2.729  1.00 83.26  ? 1057 ARG A NH1 1 
ATOM 8135 N NH2 . ARG A 1 1060 ? 30.248  43.384 -2.964  1.00 83.26  ? 1057 ARG A NH2 1 
ATOM 8136 N N   . LEU A 1 1061 ? 28.199  47.378 4.890   1.00 78.43  ? 1058 LEU A N   1 
ATOM 8137 C CA  . LEU A 1 1061 ? 27.523  48.390 5.687   1.00 78.43  ? 1058 LEU A CA  1 
ATOM 8138 C C   . LEU A 1 1061 ? 28.331  48.880 6.878   1.00 78.43  ? 1058 LEU A C   1 
ATOM 8139 O O   . LEU A 1 1061 ? 28.193  50.038 7.290   1.00 78.43  ? 1058 LEU A O   1 
ATOM 8140 C CB  . LEU A 1 1061 ? 26.218  47.815 6.207   1.00 50.20  ? 1058 LEU A CB  1 
ATOM 8141 C CG  . LEU A 1 1061 ? 24.916  48.282 5.571   1.00 50.20  ? 1058 LEU A CG  1 
ATOM 8142 C CD1 . LEU A 1 1061 ? 23.790  47.313 5.878   1.00 50.20  ? 1058 LEU A CD1 1 
ATOM 8143 C CD2 . LEU A 1 1061 ? 24.587  49.679 6.067   1.00 50.20  ? 1058 LEU A CD2 1 
ATOM 8144 N N   . ASN A 1 1062 ? 29.138  47.990 7.456   1.00 59.55  ? 1059 ASN A N   1 
ATOM 8145 C CA  . ASN A 1 1062 ? 30.023  48.375 8.551   1.00 59.55  ? 1059 ASN A CA  1 
ATOM 8146 C C   . ASN A 1 1062 ? 31.052  49.413 8.091   1.00 59.55  ? 1059 ASN A C   1 
ATOM 8147 O O   . ASN A 1 1062 ? 31.273  50.436 8.752   1.00 59.55  ? 1059 ASN A O   1 
ATOM 8148 C CB  . ASN A 1 1062 ? 30.720  47.146 9.148   1.00 63.21  ? 1059 ASN A CB  1 
ATOM 8149 C CG  . ASN A 1 1062 ? 29.763  46.228 9.926   1.00 63.21  ? 1059 ASN A CG  1 
ATOM 8150 O OD1 . ASN A 1 1062 ? 28.746  46.669 10.472  1.00 63.21  ? 1059 ASN A OD1 1 
ATOM 8151 N ND2 . ASN A 1 1062 ? 30.108  44.938 9.990   1.00 63.21  ? 1059 ASN A ND2 1 
ATOM 8152 N N   . LYS A 1 1063 ? 31.645  49.137 6.932   1.00 86.94  ? 1060 LYS A N   1 
ATOM 8153 C CA  . LYS A 1 1063 ? 32.719  49.935 6.358   1.00 86.94  ? 1060 LYS A CA  1 
ATOM 8154 C C   . LYS A 1 1063 ? 32.240  51.317 5.968   1.00 86.94  ? 1060 LYS A C   1 
ATOM 8155 O O   . LYS A 1 1063 ? 32.963  52.303 6.100   1.00 86.94  ? 1060 LYS A O   1 
ATOM 8156 C CB  . LYS A 1 1063 ? 33.305  49.205 5.153   1.00 69.87  ? 1060 LYS A CB  1 
ATOM 8157 C CG  . LYS A 1 1063 ? 34.224  48.077 5.567   1.00 69.87  ? 1060 LYS A CG  1 
ATOM 8158 C CD  . LYS A 1 1063 ? 34.886  47.371 4.396   1.00 69.87  ? 1060 LYS A CD  1 
ATOM 8159 C CE  . LYS A 1 1063 ? 35.996  46.430 4.900   1.00 69.87  ? 1060 LYS A CE  1 
ATOM 8160 N NZ  . LYS A 1 1063 ? 37.106  47.178 5.574   1.00 69.87  ? 1060 LYS A NZ  1 
ATOM 8161 N N   . VAL A 1 1064 ? 31.004  51.375 5.502   1.00 62.97  ? 1061 VAL A N   1 
ATOM 8162 C CA  . VAL A 1 1064 ? 30.368  52.633 5.162   1.00 62.97  ? 1061 VAL A CA  1 
ATOM 8163 C C   . VAL A 1 1064 ? 30.013  53.449 6.424   1.00 62.97  ? 1061 VAL A C   1 
ATOM 8164 O O   . VAL A 1 1064 ? 30.591  54.515 6.640   1.00 62.97  ? 1061 VAL A O   1 
ATOM 8165 C CB  . VAL A 1 1064 ? 29.121  52.380 4.288   1.00 81.44  ? 1061 VAL A CB  1 
ATOM 8166 C CG1 . VAL A 1 1064 ? 28.601  53.666 3.688   1.00 81.44  ? 1061 VAL A CG1 1 
ATOM 8167 C CG2 . VAL A 1 1064 ? 29.462  51.401 3.195   1.00 81.44  ? 1061 VAL A CG2 1 
ATOM 8168 N N   . ILE A 1 1065 ? 29.098  52.927 7.251   1.00 94.60  ? 1062 ILE A N   1 
ATOM 8169 C CA  . ILE A 1 1065 ? 28.488  53.673 8.368   1.00 94.60  ? 1062 ILE A CA  1 
ATOM 8170 C C   . ILE A 1 1065 ? 29.466  54.173 9.431   1.00 94.60  ? 1062 ILE A C   1 
ATOM 8171 O O   . ILE A 1 1065 ? 30.309  53.423 9.930   1.00 94.60  ? 1062 ILE A O   1 
ATOM 8172 C CB  . ILE A 1 1065 ? 27.373  52.854 9.088   1.00 40.05  ? 1062 ILE A CB  1 
ATOM 8173 C CG1 . ILE A 1 1065 ? 26.257  52.481 8.123   1.00 40.05  ? 1062 ILE A CG1 1 
ATOM 8174 C CG2 . ILE A 1 1065 ? 26.801  53.631 10.330  1.00 40.05  ? 1062 ILE A CG2 1 
ATOM 8175 C CD1 . ILE A 1 1065 ? 25.072  51.852 8.804   1.00 40.05  ? 1062 ILE A CD1 1 
ATOM 8176 N N   . LYS A 1 1066 ? 29.314  55.449 9.773   1.00 83.67  ? 1063 LYS A N   1 
ATOM 8177 C CA  . LYS A 1 1066 ? 30.047  56.070 10.861  1.00 83.67  ? 1063 LYS A CA  1 
ATOM 8178 C C   . LYS A 1 1066 ? 29.331  55.809 12.187  1.00 83.67  ? 1063 LYS A C   1 
ATOM 8179 O O   . LYS A 1 1066 ? 28.155  56.155 12.348  1.00 83.67  ? 1063 LYS A O   1 
ATOM 8180 C CB  . LYS A 1 1066 ? 30.206  57.576 10.602  1.00 111.99 ? 1063 LYS A CB  1 
ATOM 8181 C CG  . LYS A 1 1066 ? 28.966  58.268 10.015  1.00 111.99 ? 1063 LYS A CG  1 
ATOM 8182 C CD  . LYS A 1 1066 ? 29.340  59.520 9.218   1.00 111.99 ? 1063 LYS A CD  1 
ATOM 8183 C CE  . LYS A 1 1066 ? 28.163  60.064 8.412   1.00 111.99 ? 1063 LYS A CE  1 
ATOM 8184 N NZ  . LYS A 1 1066 ? 28.619  60.903 7.272   1.00 111.99 ? 1063 LYS A NZ  1 
ATOM 8185 N N   . SER A 1 1067 ? 30.046  55.194 13.130  1.00 52.54  ? 1064 SER A N   1 
ATOM 8186 C CA  . SER A 1 1067 ? 29.468  54.786 14.422  1.00 52.54  ? 1064 SER A CA  1 
ATOM 8187 C C   . SER A 1 1067 ? 30.062  55.605 15.553  1.00 52.54  ? 1064 SER A C   1 
ATOM 8188 O O   . SER A 1 1067 ? 31.284  55.774 15.629  1.00 52.54  ? 1064 SER A O   1 
ATOM 8189 C CB  . SER A 1 1067 ? 29.699  53.295 14.675  1.00 42.36  ? 1064 SER A CB  1 
ATOM 8190 O OG  . SER A 1 1067 ? 30.867  53.082 15.439  1.00 42.36  ? 1064 SER A OG  1 
ATOM 8191 N N   . VAL A 1 1068 ? 29.202  56.065 16.454  1.00 114.80 ? 1065 VAL A N   1 
ATOM 8192 C CA  . VAL A 1 1068 ? 29.521  57.211 17.298  1.00 114.80 ? 1065 VAL A CA  1 
ATOM 8193 C C   . VAL A 1 1068 ? 30.884  57.220 17.945  1.00 114.80 ? 1065 VAL A C   1 
ATOM 8194 O O   . VAL A 1 1068 ? 31.729  58.020 17.571  1.00 114.80 ? 1065 VAL A O   1 
ATOM 8195 C CB  . VAL A 1 1068 ? 28.457  57.466 18.338  1.00 33.84  ? 1065 VAL A CB  1 
ATOM 8196 C CG1 . VAL A 1 1068 ? 28.917  58.488 19.343  1.00 33.84  ? 1065 VAL A CG1 1 
ATOM 8197 C CG2 . VAL A 1 1068 ? 27.205  57.988 17.648  1.00 33.84  ? 1065 VAL A CG2 1 
ATOM 8198 N N   . GLY A 1 1069 ? 31.097  56.346 18.915  1.00 38.82  ? 1066 GLY A N   1 
ATOM 8199 C CA  . GLY A 1 1069 ? 32.361  56.360 19.650  1.00 38.82  ? 1066 GLY A CA  1 
ATOM 8200 C C   . GLY A 1 1069 ? 33.403  55.419 19.050  1.00 38.82  ? 1066 GLY A C   1 
ATOM 8201 O O   . GLY A 1 1069 ? 34.239  54.849 19.796  1.00 38.82  ? 1066 GLY A O   1 
ATOM 8202 N N   . LYS A 1 1070 ? 33.359  55.249 17.720  1.00 57.24  ? 1067 LYS A N   1 
ATOM 8203 C CA  . LYS A 1 1070 ? 34.252  54.343 16.987  1.00 57.24  ? 1067 LYS A CA  1 
ATOM 8204 C C   . LYS A 1 1070 ? 34.282  52.936 17.622  1.00 57.24  ? 1067 LYS A C   1 
ATOM 8205 O O   . LYS A 1 1070 ? 35.334  52.427 18.065  1.00 57.24  ? 1067 LYS A O   1 
ATOM 8206 C CB  . LYS A 1 1070 ? 35.660  54.937 16.854  1.00 82.42  ? 1067 LYS A CB  1 
ATOM 8207 C CG  . LYS A 1 1070 ? 35.768  56.064 15.848  1.00 82.42  ? 1067 LYS A CG  1 
ATOM 8208 C CD  . LYS A 1 1070 ? 37.124  56.750 15.946  1.00 82.42  ? 1067 LYS A CD  1 
ATOM 8209 C CE  . LYS A 1 1070 ? 37.270  57.828 14.898  1.00 82.42  ? 1067 LYS A CE  1 
ATOM 8210 N NZ  . LYS A 1 1070 ? 37.577  57.236 13.566  1.00 82.42  ? 1067 LYS A NZ  1 
ATOM 8211 N N   . ILE A 1 1071 ? 33.095  52.334 17.675  1.00 43.17  ? 1068 ILE A N   1 
ATOM 8212 C CA  . ILE A 1 1071 ? 32.892  50.969 18.178  1.00 43.17  ? 1068 ILE A CA  1 
ATOM 8213 C C   . ILE A 1 1071 ? 32.486  50.048 17.014  1.00 43.17  ? 1068 ILE A C   1 
ATOM 8214 O O   . ILE A 1 1071 ? 31.503  50.299 16.332  1.00 43.17  ? 1068 ILE A O   1 
ATOM 8215 C CB  . ILE A 1 1071 ? 31.784  50.923 19.318  1.00 55.05  ? 1068 ILE A CB  1 
ATOM 8216 C CG1 . ILE A 1 1071 ? 32.116  51.871 20.481  1.00 55.05  ? 1068 ILE A CG1 1 
ATOM 8217 C CG2 . ILE A 1 1071 ? 31.553  49.488 19.825  1.00 55.05  ? 1068 ILE A CG2 1 
ATOM 8218 C CD1 . ILE A 1 1071 ? 30.908  52.188 21.374  1.00 55.05  ? 1068 ILE A CD1 1 
ATOM 8219 N N   . GLU A 1 1072 ? 33.246  48.987 16.798  1.00 48.72  ? 1069 GLU A N   1 
ATOM 8220 C CA  . GLU A 1 1072 ? 32.898  48.001 15.794  1.00 48.72  ? 1069 GLU A CA  1 
ATOM 8221 C C   . GLU A 1 1072 ? 31.604  47.276 16.127  1.00 48.72  ? 1069 GLU A C   1 
ATOM 8222 O O   . GLU A 1 1072 ? 31.523  46.581 17.148  1.00 48.72  ? 1069 GLU A O   1 
ATOM 8223 C CB  . GLU A 1 1072 ? 34.018  46.978 15.625  1.00 80.11  ? 1069 GLU A CB  1 
ATOM 8224 C CG  . GLU A 1 1072 ? 34.666  47.030 14.279  1.00 80.11  ? 1069 GLU A CG  1 
ATOM 8225 C CD  . GLU A 1 1072 ? 35.345  48.342 14.039  1.00 80.11  ? 1069 GLU A CD  1 
ATOM 8226 O OE1 . GLU A 1 1072 ? 34.779  49.188 13.308  1.00 80.11  ? 1069 GLU A OE1 1 
ATOM 8227 O OE2 . GLU A 1 1072 ? 36.441  48.524 14.604  1.00 80.11  ? 1069 GLU A OE2 1 
ATOM 8228 N N   . HIS A 1 1073 ? 30.605  47.443 15.253  1.00 44.78  ? 1070 HIS A N   1 
ATOM 8229 C CA  . HIS A 1 1073 ? 29.413  46.593 15.258  1.00 44.78  ? 1070 HIS A CA  1 
ATOM 8230 C C   . HIS A 1 1073 ? 29.793  45.134 15.529  1.00 44.78  ? 1070 HIS A C   1 
ATOM 8231 O O   . HIS A 1 1073 ? 29.079  44.406 16.213  1.00 44.78  ? 1070 HIS A O   1 
ATOM 8232 C CB  . HIS A 1 1073 ? 28.685  46.679 13.911  1.00 49.10  ? 1070 HIS A CB  1 
ATOM 8233 C CG  . HIS A 1 1073 ? 27.510  45.755 13.801  1.00 49.10  ? 1070 HIS A CG  1 
ATOM 8234 N ND1 . HIS A 1 1073 ? 26.216  46.166 14.042  1.00 49.10  ? 1070 HIS A ND1 1 
ATOM 8235 C CD2 . HIS A 1 1073 ? 27.431  44.438 13.487  1.00 49.10  ? 1070 HIS A CD2 1 
ATOM 8236 C CE1 . HIS A 1 1073 ? 25.389  45.143 13.872  1.00 49.10  ? 1070 HIS A CE1 1 
ATOM 8237 N NE2 . HIS A 1 1073 ? 26.101  44.085 13.532  1.00 49.10  ? 1070 HIS A NE2 1 
ATOM 8238 N N   . SER A 1 1074 ? 30.921  44.725 14.960  1.00 42.35  ? 1071 SER A N   1 
ATOM 8239 C CA  . SER A 1 1074 ? 31.404  43.364 15.073  1.00 42.35  ? 1071 SER A CA  1 
ATOM 8240 C C   . SER A 1 1074 ? 31.678  42.984 16.520  1.00 42.35  ? 1071 SER A C   1 
ATOM 8241 O O   . SER A 1 1074 ? 31.313  41.901 16.939  1.00 42.35  ? 1071 SER A O   1 
ATOM 8242 C CB  . SER A 1 1074 ? 32.676  43.191 14.249  1.00 54.34  ? 1071 SER A CB  1 
ATOM 8243 O OG  . SER A 1 1074 ? 32.764  41.851 13.801  1.00 54.34  ? 1071 SER A OG  1 
ATOM 8244 N N   . PHE A 1 1075 ? 32.333  43.875 17.257  1.00 48.14  ? 1072 PHE A N   1 
ATOM 8245 C CA  . PHE A 1 1075 ? 32.692  43.678 18.652  1.00 48.14  ? 1072 PHE A CA  1 
ATOM 8246 C C   . PHE A 1 1075 ? 31.423  43.657 19.483  1.00 48.14  ? 1072 PHE A C   1 
ATOM 8247 O O   . PHE A 1 1075 ? 31.238  42.799 20.351  1.00 48.14  ? 1072 PHE A O   1 
ATOM 8248 C CB  . PHE A 1 1075 ? 33.564  44.857 19.110  1.00 27.51  ? 1072 PHE A CB  1 
ATOM 8249 C CG  . PHE A 1 1075 ? 33.854  44.866 20.588  1.00 27.51  ? 1072 PHE A CG  1 
ATOM 8250 C CD1 . PHE A 1 1075 ? 34.932  44.133 21.107  1.00 27.51  ? 1072 PHE A CD1 1 
ATOM 8251 C CD2 . PHE A 1 1075 ? 33.050  45.611 21.468  1.00 27.51  ? 1072 PHE A CD2 1 
ATOM 8252 C CE1 . PHE A 1 1075 ? 35.220  44.130 22.475  1.00 27.51  ? 1072 PHE A CE1 1 
ATOM 8253 C CE2 . PHE A 1 1075 ? 33.331  45.612 22.849  1.00 27.51  ? 1072 PHE A CE2 1 
ATOM 8254 C CZ  . PHE A 1 1075 ? 34.422  44.852 23.362  1.00 27.51  ? 1072 PHE A CZ  1 
ATOM 8255 N N   . TRP A 1 1076 ? 30.555  44.630 19.196  1.00 48.92  ? 1073 TRP A N   1 
ATOM 8256 C CA  . TRP A 1 1076 ? 29.335  44.886 19.935  1.00 48.92  ? 1073 TRP A CA  1 
ATOM 8257 C C   . TRP A 1 1076 ? 28.398  43.687 19.888  1.00 48.92  ? 1073 TRP A C   1 
ATOM 8258 O O   . TRP A 1 1076 ? 28.108  43.104 20.936  1.00 48.92  ? 1073 TRP A O   1 
ATOM 8259 C CB  . TRP A 1 1076 ? 28.714  46.188 19.439  1.00 53.09  ? 1073 TRP A CB  1 
ATOM 8260 C CG  . TRP A 1 1076 ? 27.231  46.323 19.543  1.00 53.09  ? 1073 TRP A CG  1 
ATOM 8261 C CD1 . TRP A 1 1076 ? 26.356  46.475 18.507  1.00 53.09  ? 1073 TRP A CD1 1 
ATOM 8262 C CD2 . TRP A 1 1076 ? 26.440  46.366 20.735  1.00 53.09  ? 1073 TRP A CD2 1 
ATOM 8263 N NE1 . TRP A 1 1076 ? 25.074  46.608 18.979  1.00 53.09  ? 1073 TRP A NE1 1 
ATOM 8264 C CE2 . TRP A 1 1076 ? 25.099  46.539 20.342  1.00 53.09  ? 1073 TRP A CE2 1 
ATOM 8265 C CE3 . TRP A 1 1076 ? 26.731  46.249 22.095  1.00 53.09  ? 1073 TRP A CE3 1 
ATOM 8266 C CZ2 . TRP A 1 1076 ? 24.060  46.591 21.252  1.00 53.09  ? 1073 TRP A CZ2 1 
ATOM 8267 C CZ3 . TRP A 1 1076 ? 25.696  46.314 22.996  1.00 53.09  ? 1073 TRP A CZ3 1 
ATOM 8268 C CH2 . TRP A 1 1076 ? 24.381  46.483 22.574  1.00 53.09  ? 1073 TRP A CH2 1 
ATOM 8269 N N   . ARG A 1 1077 ? 27.974  43.285 18.693  1.00 43.94  ? 1074 ARG A N   1 
ATOM 8270 C CA  . ARG A 1 1077 ? 27.075  42.128 18.526  1.00 43.94  ? 1074 ARG A CA  1 
ATOM 8271 C C   . ARG A 1 1077 ? 27.672  40.746 18.901  1.00 43.94  ? 1074 ARG A C   1 
ATOM 8272 O O   . ARG A 1 1077 ? 26.944  39.735 18.956  1.00 43.94  ? 1074 ARG A O   1 
ATOM 8273 C CB  . ARG A 1 1077 ? 26.512  42.073 17.104  1.00 53.41  ? 1074 ARG A CB  1 
ATOM 8274 C CG  . ARG A 1 1077 ? 25.596  43.214 16.749  1.00 53.41  ? 1074 ARG A CG  1 
ATOM 8275 C CD  . ARG A 1 1077 ? 24.431  43.339 17.703  1.00 53.41  ? 1074 ARG A CD  1 
ATOM 8276 N NE  . ARG A 1 1077 ? 23.299  44.031 17.092  1.00 53.41  ? 1074 ARG A NE  1 
ATOM 8277 C CZ  . ARG A 1 1077 ? 22.229  44.468 17.752  1.00 53.41  ? 1074 ARG A CZ  1 
ATOM 8278 N NH1 . ARG A 1 1077 ? 22.143  44.314 19.070  1.00 53.41  ? 1074 ARG A NH1 1 
ATOM 8279 N NH2 . ARG A 1 1077 ? 21.251  45.075 17.091  1.00 53.41  ? 1074 ARG A NH2 1 
ATOM 8280 N N   . SER A 1 1078 ? 28.978  40.692 19.153  1.00 43.24  ? 1075 SER A N   1 
ATOM 8281 C CA  . SER A 1 1078 ? 29.580  39.410 19.486  1.00 43.24  ? 1075 SER A CA  1 
ATOM 8282 C C   . SER A 1 1078 ? 29.122  38.929 20.873  1.00 43.24  ? 1075 SER A C   1 
ATOM 8283 O O   . SER A 1 1078 ? 29.052  39.702 21.839  1.00 43.24  ? 1075 SER A O   1 
ATOM 8284 C CB  . SER A 1 1078 ? 31.112  39.408 19.306  1.00 60.16  ? 1075 SER A CB  1 
ATOM 8285 O OG  . SER A 1 1078 ? 31.761  40.411 20.058  1.00 60.16  ? 1075 SER A OG  1 
ATOM 8286 N N   . PHE A 1 1079 ? 28.755  37.655 20.920  1.00 44.55  ? 1076 PHE A N   1 
ATOM 8287 C CA  . PHE A 1 1079 ? 28.229  36.999 22.107  1.00 44.55  ? 1076 PHE A CA  1 
ATOM 8288 C C   . PHE A 1 1079 ? 29.283  37.106 23.176  1.00 44.55  ? 1076 PHE A C   1 
ATOM 8289 O O   . PHE A 1 1079 ? 30.431  36.684 22.969  1.00 44.55  ? 1076 PHE A O   1 
ATOM 8290 C CB  . PHE A 1 1079 ? 27.958  35.535 21.761  1.00 37.72  ? 1076 PHE A CB  1 
ATOM 8291 C CG  . PHE A 1 1079 ? 27.406  34.698 22.899  1.00 37.72  ? 1076 PHE A CG  1 
ATOM 8292 C CD1 . PHE A 1 1079 ? 26.053  34.316 22.900  1.00 37.72  ? 1076 PHE A CD1 1 
ATOM 8293 C CD2 . PHE A 1 1079 ? 28.244  34.234 23.921  1.00 37.72  ? 1076 PHE A CD2 1 
ATOM 8294 C CE1 . PHE A 1 1079 ? 25.544  33.523 23.922  1.00 37.72  ? 1076 PHE A CE1 1 
ATOM 8295 C CE2 . PHE A 1 1079 ? 27.748  33.447 24.934  1.00 37.72  ? 1076 PHE A CE2 1 
ATOM 8296 C CZ  . PHE A 1 1079 ? 26.390  33.082 24.934  1.00 37.72  ? 1076 PHE A CZ  1 
ATOM 8297 N N   . HIS A 1 1080 ? 28.917  37.674 24.316  1.00 46.01  ? 1077 HIS A N   1 
ATOM 8298 C CA  . HIS A 1 1080 ? 29.909  37.875 25.377  1.00 46.01  ? 1077 HIS A CA  1 
ATOM 8299 C C   . HIS A 1 1080 ? 29.388  37.519 26.776  1.00 46.01  ? 1077 HIS A C   1 
ATOM 8300 O O   . HIS A 1 1080 ? 28.341  37.989 27.207  1.00 46.01  ? 1077 HIS A O   1 
ATOM 8301 C CB  . HIS A 1 1080 ? 30.432  39.309 25.315  1.00 63.26  ? 1077 HIS A CB  1 
ATOM 8302 C CG  . HIS A 1 1080 ? 31.231  39.712 26.507  1.00 63.26  ? 1077 HIS A CG  1 
ATOM 8303 N ND1 . HIS A 1 1080 ? 32.587  39.484 26.602  1.00 63.26  ? 1077 HIS A ND1 1 
ATOM 8304 C CD2 . HIS A 1 1080 ? 30.865  40.311 27.665  1.00 63.26  ? 1077 HIS A CD2 1 
ATOM 8305 C CE1 . HIS A 1 1080 ? 33.022  39.927 27.767  1.00 63.26  ? 1077 HIS A CE1 1 
ATOM 8306 N NE2 . HIS A 1 1080 ? 31.997  40.432 28.432  1.00 63.26  ? 1077 HIS A NE2 1 
ATOM 8307 N N   . THR A 1 1081 ? 30.120  36.661 27.462  1.00 47.86  ? 1078 THR A N   1 
ATOM 8308 C CA  . THR A 1 1081 ? 29.826  36.305 28.855  1.00 47.86  ? 1078 THR A CA  1 
ATOM 8309 C C   . THR A 1 1081 ? 31.098  36.459 29.711  1.00 47.86  ? 1078 THR A C   1 
ATOM 8310 O O   . THR A 1 1081 ? 32.154  36.822 29.192  1.00 47.86  ? 1078 THR A O   1 
ATOM 8311 C CB  . THR A 1 1081 ? 29.207  34.866 28.985  1.00 48.49  ? 1078 THR A CB  1 
ATOM 8312 O OG1 . THR A 1 1081 ? 29.945  33.919 28.199  1.00 48.49  ? 1078 THR A OG1 1 
ATOM 8313 C CG2 . THR A 1 1081 ? 27.795  34.849 28.490  1.00 48.49  ? 1078 THR A CG2 1 
ATOM 8314 N N   . GLU A 1 1082 ? 30.988  36.209 31.013  1.00 91.49  ? 1079 GLU A N   1 
ATOM 8315 C CA  . GLU A 1 1082 ? 32.151  36.203 31.912  1.00 91.49  ? 1079 GLU A CA  1 
ATOM 8316 C C   . GLU A 1 1082 ? 33.216  35.205 31.430  1.00 91.49  ? 1079 GLU A C   1 
ATOM 8317 O O   . GLU A 1 1082 ? 34.420  35.450 31.540  1.00 91.49  ? 1079 GLU A O   1 
ATOM 8318 C CB  . GLU A 1 1082 ? 31.708  35.840 33.333  1.00 156.81 ? 1079 GLU A CB  1 
ATOM 8319 C CG  . GLU A 1 1082 ? 32.627  36.344 34.435  1.00 156.81 ? 1079 GLU A CG  1 
ATOM 8320 C CD  . GLU A 1 1082 ? 32.397  37.810 34.762  1.00 156.81 ? 1079 GLU A CD  1 
ATOM 8321 O OE1 . GLU A 1 1082 ? 31.542  38.109 35.628  1.00 156.81 ? 1079 GLU A OE1 1 
ATOM 8322 O OE2 . GLU A 1 1082 ? 33.080  38.661 34.156  1.00 156.81 ? 1079 GLU A OE2 1 
ATOM 8323 N N   . ARG A 1 1083 ? 32.741  34.091 30.877  1.00 79.02  ? 1080 ARG A N   1 
ATOM 8324 C CA  . ARG A 1 1083 ? 33.568  32.969 30.450  1.00 79.02  ? 1080 ARG A CA  1 
ATOM 8325 C C   . ARG A 1 1083 ? 34.208  33.130 29.049  1.00 79.02  ? 1080 ARG A C   1 
ATOM 8326 O O   . ARG A 1 1083 ? 35.403  32.889 28.898  1.00 79.02  ? 1080 ARG A O   1 
ATOM 8327 C CB  . ARG A 1 1083 ? 32.744  31.671 30.547  1.00 95.33  ? 1080 ARG A CB  1 
ATOM 8328 C CG  . ARG A 1 1083 ? 33.335  30.451 29.844  1.00 95.33  ? 1080 ARG A CG  1 
ATOM 8329 C CD  . ARG A 1 1083 ? 32.765  29.152 30.396  1.00 95.33  ? 1080 ARG A CD  1 
ATOM 8330 N NE  . ARG A 1 1083 ? 32.906  29.062 31.854  1.00 95.33  ? 1080 ARG A NE  1 
ATOM 8331 C CZ  . ARG A 1 1083 ? 34.019  28.702 32.497  1.00 95.33  ? 1080 ARG A CZ  1 
ATOM 8332 N NH1 . ARG A 1 1083 ? 35.126  28.391 31.827  1.00 95.33  ? 1080 ARG A NH1 1 
ATOM 8333 N NH2 . ARG A 1 1083 ? 34.028  28.660 33.825  1.00 95.33  ? 1080 ARG A NH2 1 
ATOM 8334 N N   . LYS A 1 1084 ? 33.430  33.534 28.041  1.00 65.79  ? 1081 LYS A N   1 
ATOM 8335 C CA  . LYS A 1 1084 ? 33.897  33.516 26.639  1.00 65.79  ? 1081 LYS A CA  1 
ATOM 8336 C C   . LYS A 1 1084 ? 33.454  34.712 25.768  1.00 65.79  ? 1081 LYS A C   1 
ATOM 8337 O O   . LYS A 1 1084 ? 32.514  35.445 26.117  1.00 65.79  ? 1081 LYS A O   1 
ATOM 8338 C CB  . LYS A 1 1084 ? 33.487  32.197 25.964  1.00 67.00  ? 1081 LYS A CB  1 
ATOM 8339 C CG  . LYS A 1 1084 ? 32.252  31.507 26.580  1.00 67.00  ? 1081 LYS A CG  1 
ATOM 8340 C CD  . LYS A 1 1084 ? 31.245  31.101 25.516  1.00 67.00  ? 1081 LYS A CD  1 
ATOM 8341 C CE  . LYS A 1 1084 ? 31.658  29.852 24.746  1.00 67.00  ? 1081 LYS A CE  1 
ATOM 8342 N NZ  . LYS A 1 1084 ? 31.058  29.866 23.378  1.00 67.00  ? 1081 LYS A NZ  1 
ATOM 8343 N N   . THR A 1 1085 ? 34.141  34.901 24.637  1.00 76.73  ? 1082 THR A N   1 
ATOM 8344 C CA  . THR A 1 1085 ? 33.708  35.874 23.627  1.00 76.73  ? 1082 THR A CA  1 
ATOM 8345 C C   . THR A 1 1085 ? 33.791  35.319 22.197  1.00 76.73  ? 1082 THR A C   1 
ATOM 8346 O O   . THR A 1 1085 ? 34.862  35.295 21.584  1.00 76.73  ? 1082 THR A O   1 
ATOM 8347 C CB  . THR A 1 1085 ? 34.472  37.219 23.753  1.00 55.27  ? 1082 THR A CB  1 
ATOM 8348 O OG1 . THR A 1 1085 ? 34.385  37.684 25.100  1.00 55.27  ? 1082 THR A OG1 1 
ATOM 8349 C CG2 . THR A 1 1085 ? 33.884  38.301 22.831  1.00 55.27  ? 1082 THR A CG2 1 
ATOM 8350 N N   . GLU A 1 1086 ? 32.651  34.871 21.678  1.00 54.63  ? 1083 GLU A N   1 
ATOM 8351 C CA  . GLU A 1 1086 ? 32.565  34.367 20.307  1.00 54.63  ? 1083 GLU A CA  1 
ATOM 8352 C C   . GLU A 1 1086 ? 32.022  35.461 19.408  1.00 54.63  ? 1083 GLU A C   1 
ATOM 8353 O O   . GLU A 1 1086 ? 31.249  36.305 19.865  1.00 54.63  ? 1083 GLU A O   1 
ATOM 8354 C CB  . GLU A 1 1086 ? 31.625  33.168 20.230  1.00 112.32 ? 1083 GLU A CB  1 
ATOM 8355 C CG  . GLU A 1 1086 ? 32.006  32.016 21.117  1.00 112.32 ? 1083 GLU A CG  1 
ATOM 8356 C CD  . GLU A 1 1086 ? 33.254  31.311 20.642  1.00 112.32 ? 1083 GLU A CD  1 
ATOM 8357 O OE1 . GLU A 1 1086 ? 34.377  31.764 20.978  1.00 112.32 ? 1083 GLU A OE1 1 
ATOM 8358 O OE2 . GLU A 1 1086 ? 33.099  30.292 19.935  1.00 112.32 ? 1083 GLU A OE2 1 
ATOM 8359 N N   . PRO A 1 1087 ? 32.409  35.459 18.119  1.00 58.38  ? 1084 PRO A N   1 
ATOM 8360 C CA  . PRO A 1 1087 ? 31.700  36.352 17.212  1.00 58.38  ? 1084 PRO A CA  1 
ATOM 8361 C C   . PRO A 1 1087 ? 30.262  35.871 17.127  1.00 58.38  ? 1084 PRO A C   1 
ATOM 8362 O O   . PRO A 1 1087 ? 29.955  34.787 17.639  1.00 58.38  ? 1084 PRO A O   1 
ATOM 8363 C CB  . PRO A 1 1087 ? 32.407  36.132 15.868  1.00 42.03  ? 1084 PRO A CB  1 
ATOM 8364 C CG  . PRO A 1 1087 ? 33.733  35.544 16.225  1.00 42.03  ? 1084 PRO A CG  1 
ATOM 8365 C CD  . PRO A 1 1087 ? 33.451  34.688 17.416  1.00 42.03  ? 1084 PRO A CD  1 
ATOM 8366 N N   . ALA A 1 1088 ? 29.399  36.667 16.498  1.00 53.69  ? 1085 ALA A N   1 
ATOM 8367 C CA  . ALA A 1 1088 ? 28.009  36.294 16.278  1.00 53.69  ? 1085 ALA A CA  1 
ATOM 8368 C C   . ALA A 1 1088 ? 27.878  35.281 15.139  1.00 53.69  ? 1085 ALA A C   1 
ATOM 8369 O O   . ALA A 1 1088 ? 28.620  35.342 14.173  1.00 53.69  ? 1085 ALA A O   1 
ATOM 8370 C CB  . ALA A 1 1088 ? 27.200  37.531 15.979  1.00 40.06  ? 1085 ALA A CB  1 
ATOM 8371 N N   . THR A 1 1089 ? 26.937  34.348 15.258  1.00 47.16  ? 1086 THR A N   1 
ATOM 8372 C CA  . THR A 1 1089 ? 26.637  33.402 14.186  1.00 47.16  ? 1086 THR A CA  1 
ATOM 8373 C C   . THR A 1 1089 ? 25.107  33.185 14.025  1.00 47.16  ? 1086 THR A C   1 
ATOM 8374 O O   . THR A 1 1089 ? 24.344  33.300 15.005  1.00 47.16  ? 1086 THR A O   1 
ATOM 8375 C CB  . THR A 1 1089 ? 27.328  32.047 14.420  1.00 50.12  ? 1086 THR A CB  1 
ATOM 8376 O OG1 . THR A 1 1089 ? 26.805  31.442 15.611  1.00 50.12  ? 1086 THR A OG1 1 
ATOM 8377 C CG2 . THR A 1 1089 ? 28.839  32.200 14.571  1.00 50.12  ? 1086 THR A CG2 1 
ATOM 8378 N N   . GLY A 1 1090 ? 24.681  32.880 12.787  1.00 46.08  ? 1087 GLY A N   1 
ATOM 8379 C CA  . GLY A 1 1090 ? 23.278  32.678 12.423  1.00 46.08  ? 1087 GLY A CA  1 
ATOM 8380 C C   . GLY A 1 1090 ? 22.303  33.807 12.730  1.00 46.08  ? 1087 GLY A C   1 
ATOM 8381 O O   . GLY A 1 1090 ? 21.092  33.589 12.756  1.00 46.08  ? 1087 GLY A O   1 
ATOM 8382 N N   . PHE A 1 1091 ? 22.794  35.019 12.960  1.00 60.68  ? 1088 PHE A N   1 
ATOM 8383 C CA  . PHE A 1 1091 ? 21.895  36.124 13.296  1.00 60.68  ? 1088 PHE A CA  1 
ATOM 8384 C C   . PHE A 1 1091 ? 22.174  37.352 12.451  1.00 60.68  ? 1088 PHE A C   1 
ATOM 8385 O O   . PHE A 1 1091 ? 23.279  37.544 11.979  1.00 60.68  ? 1088 PHE A O   1 
ATOM 8386 C CB  . PHE A 1 1091 ? 22.006  36.486 14.785  1.00 55.44  ? 1088 PHE A CB  1 
ATOM 8387 C CG  . PHE A 1 1091 ? 21.138  35.655 15.686  1.00 55.44  ? 1088 PHE A CG  1 
ATOM 8388 C CD1 . PHE A 1 1091 ? 21.660  34.567 16.378  1.00 55.44  ? 1088 PHE A CD1 1 
ATOM 8389 C CD2 . PHE A 1 1091 ? 19.801  35.951 15.848  1.00 55.44  ? 1088 PHE A CD2 1 
ATOM 8390 C CE1 . PHE A 1 1091 ? 20.848  33.785 17.216  1.00 55.44  ? 1088 PHE A CE1 1 
ATOM 8391 C CE2 . PHE A 1 1091 ? 18.998  35.171 16.681  1.00 55.44  ? 1088 PHE A CE2 1 
ATOM 8392 C CZ  . PHE A 1 1091 ? 19.530  34.095 17.369  1.00 55.44  ? 1088 PHE A CZ  1 
ATOM 8393 N N   . ILE A 1 1092 ? 21.171  38.199 12.294  1.00 65.82  ? 1089 ILE A N   1 
ATOM 8394 C CA  . ILE A 1 1092 ? 21.282  39.407 11.506  1.00 65.82  ? 1089 ILE A CA  1 
ATOM 8395 C C   . ILE A 1 1092 ? 20.433  40.482 12.162  1.00 65.82  ? 1089 ILE A C   1 
ATOM 8396 O O   . ILE A 1 1092 ? 19.243  40.239 12.378  1.00 65.82  ? 1089 ILE A O   1 
ATOM 8397 C CB  . ILE A 1 1092 ? 20.720  39.145 10.103  1.00 54.20  ? 1089 ILE A CB  1 
ATOM 8398 C CG1 . ILE A 1 1092 ? 21.698  38.288 9.301   1.00 54.20  ? 1089 ILE A CG1 1 
ATOM 8399 C CG2 . ILE A 1 1092 ? 20.358  40.457 9.376   1.00 54.20  ? 1089 ILE A CG2 1 
ATOM 8400 C CD1 . ILE A 1 1092 ? 21.033  37.550 8.188   1.00 54.20  ? 1089 ILE A CD1 1 
ATOM 8401 N N   . ASP A 1 1093 ? 20.997  41.656 12.487  1.00 48.88  ? 1090 ASP A N   1 
ATOM 8402 C CA  . ASP A 1 1093 ? 20.108  42.711 12.978  1.00 48.88  ? 1090 ASP A CA  1 
ATOM 8403 C C   . ASP A 1 1093 ? 19.520  43.529 11.878  1.00 48.88  ? 1090 ASP A C   1 
ATOM 8404 O O   . ASP A 1 1093 ? 20.205  44.355 11.268  1.00 48.88  ? 1090 ASP A O   1 
ATOM 8405 C CB  . ASP A 1 1093 ? 20.647  43.608 14.114  1.00 50.50  ? 1090 ASP A CB  1 
ATOM 8406 C CG  . ASP A 1 1093 ? 22.051  44.025 13.910  1.00 50.50  ? 1090 ASP A CG  1 
ATOM 8407 O OD1 . ASP A 1 1093 ? 22.467  45.079 14.465  1.00 50.50  ? 1090 ASP A OD1 1 
ATOM 8408 O OD2 . ASP A 1 1093 ? 22.738  43.266 13.207  1.00 50.50  ? 1090 ASP A OD2 1 
ATOM 8409 N N   . GLY A 1 1094 ? 18.234  43.270 11.632  1.00 41.07  ? 1091 GLY A N   1 
ATOM 8410 C CA  . GLY A 1 1094 ? 17.380  44.173 10.876  1.00 41.07  ? 1091 GLY A CA  1 
ATOM 8411 C C   . GLY A 1 1094 ? 17.698  45.619 11.174  1.00 41.07  ? 1091 GLY A C   1 
ATOM 8412 O O   . GLY A 1 1094 ? 17.633  46.459 10.290  1.00 41.07  ? 1091 GLY A O   1 
ATOM 8413 N N   . ASP A 1 1095 ? 18.076  45.910 12.415  1.00 40.20  ? 1092 ASP A N   1 
ATOM 8414 C CA  . ASP A 1 1095 ? 18.410  47.263 12.805  1.00 40.20  ? 1092 ASP A CA  1 
ATOM 8415 C C   . ASP A 1 1095 ? 19.527  47.791 11.923  1.00 40.20  ? 1092 ASP A C   1 
ATOM 8416 O O   . ASP A 1 1095 ? 19.419  48.908 11.399  1.00 40.20  ? 1092 ASP A O   1 
ATOM 8417 C CB  . ASP A 1 1095 ? 18.809  47.336 14.279  1.00 39.01  ? 1092 ASP A CB  1 
ATOM 8418 C CG  . ASP A 1 1095 ? 17.601  47.380 15.226  1.00 39.01  ? 1092 ASP A CG  1 
ATOM 8419 O OD1 . ASP A 1 1095 ? 16.450  47.109 14.785  1.00 39.01  ? 1092 ASP A OD1 1 
ATOM 8420 O OD2 . ASP A 1 1095 ? 17.831  47.686 16.421  1.00 39.01  ? 1092 ASP A OD2 1 
ATOM 8421 N N   . LEU A 1 1096 ? 20.578  46.992 11.734  1.00 61.37  ? 1093 LEU A N   1 
ATOM 8422 C CA  . LEU A 1 1096 ? 21.685  47.351 10.840  1.00 61.37  ? 1093 LEU A CA  1 
ATOM 8423 C C   . LEU A 1 1096 ? 21.226  47.318 9.389   1.00 61.37  ? 1093 LEU A C   1 
ATOM 8424 O O   . LEU A 1 1096 ? 21.579  48.195 8.590   1.00 61.37  ? 1093 LEU A O   1 
ATOM 8425 C CB  . LEU A 1 1096 ? 22.829  46.360 10.999  1.00 56.67  ? 1093 LEU A CB  1 
ATOM 8426 C CG  . LEU A 1 1096 ? 24.290  46.768 10.827  1.00 56.67  ? 1093 LEU A CG  1 
ATOM 8427 C CD1 . LEU A 1 1096 ? 25.031  45.603 10.164  1.00 56.67  ? 1093 LEU A CD1 1 
ATOM 8428 C CD2 . LEU A 1 1096 ? 24.478  48.061 10.036  1.00 56.67  ? 1093 LEU A CD2 1 
ATOM 8429 N N   . ILE A 1 1097 ? 20.433  46.310 9.046   1.00 43.33  ? 1094 ILE A N   1 
ATOM 8430 C CA  . ILE A 1 1097 ? 20.015  46.172 7.666   1.00 43.33  ? 1094 ILE A CA  1 
ATOM 8431 C C   . ILE A 1 1097 ? 18.992  47.210 7.231   1.00 43.33  ? 1094 ILE A C   1 
ATOM 8432 O O   . ILE A 1 1097 ? 18.807  47.424 6.037   1.00 43.33  ? 1094 ILE A O   1 
ATOM 8433 C CB  . ILE A 1 1097 ? 19.694  44.720 7.287   1.00 38.74  ? 1094 ILE A CB  1 
ATOM 8434 C CG1 . ILE A 1 1097 ? 21.015  44.096 6.848   1.00 38.74  ? 1094 ILE A CG1 1 
ATOM 8435 C CG2 . ILE A 1 1097 ? 18.697  44.618 6.123   1.00 38.74  ? 1094 ILE A CG2 1 
ATOM 8436 C CD1 . ILE A 1 1097 ? 21.035  42.609 6.836   1.00 38.74  ? 1094 ILE A CD1 1 
ATOM 8437 N N   . GLU A 1 1098 ? 18.384  47.890 8.201   1.00 55.44  ? 1095 GLU A N   1 
ATOM 8438 C CA  . GLU A 1 1098 ? 17.399  48.928 7.902   1.00 55.44  ? 1095 GLU A CA  1 
ATOM 8439 C C   . GLU A 1 1098 ? 18.019  50.312 7.750   1.00 55.44  ? 1095 GLU A C   1 
ATOM 8440 O O   . GLU A 1 1098 ? 17.487  51.160 7.045   1.00 55.44  ? 1095 GLU A O   1 
ATOM 8441 C CB  . GLU A 1 1098 ? 16.257  48.906 8.921   1.00 45.74  ? 1095 GLU A CB  1 
ATOM 8442 C CG  . GLU A 1 1098 ? 15.377  47.672 8.731   1.00 45.74  ? 1095 GLU A CG  1 
ATOM 8443 C CD  . GLU A 1 1098 ? 14.073  47.690 9.510   1.00 45.74  ? 1095 GLU A CD  1 
ATOM 8444 O OE1 . GLU A 1 1098 ? 13.684  48.751 10.054  1.00 45.74  ? 1095 GLU A OE1 1 
ATOM 8445 O OE2 . GLU A 1 1098 ? 13.417  46.616 9.555   1.00 45.74  ? 1095 GLU A OE2 1 
ATOM 8446 N N   . SER A 1 1099 ? 19.167  50.518 8.386   1.00 54.66  ? 1096 SER A N   1 
ATOM 8447 C CA  . SER A 1 1099 ? 19.906  51.766 8.267   1.00 54.66  ? 1096 SER A CA  1 
ATOM 8448 C C   . SER A 1 1099 ? 20.543  51.918 6.896   1.00 54.66  ? 1096 SER A C   1 
ATOM 8449 O O   . SER A 1 1099 ? 21.196  52.919 6.632   1.00 54.66  ? 1096 SER A O   1 
ATOM 8450 C CB  . SER A 1 1099 ? 20.986  51.846 9.332   1.00 60.58  ? 1096 SER A CB  1 
ATOM 8451 O OG  . SER A 1 1099 ? 21.811  50.692 9.271   1.00 60.58  ? 1096 SER A OG  1 
ATOM 8452 N N   . PHE A 1 1100 ? 20.366  50.922 6.030   1.00 85.23  ? 1097 PHE A N   1 
ATOM 8453 C CA  . PHE A 1 1100 ? 20.785  51.038 4.640   1.00 85.23  ? 1097 PHE A CA  1 
ATOM 8454 C C   . PHE A 1 1100 ? 19.992  52.120 3.916   1.00 85.23  ? 1097 PHE A C   1 
ATOM 8455 O O   . PHE A 1 1100 ? 20.543  52.830 3.069   1.00 85.23  ? 1097 PHE A O   1 
ATOM 8456 C CB  . PHE A 1 1100 ? 20.621  49.714 3.896   1.00 96.32  ? 1097 PHE A CB  1 
ATOM 8457 C CG  . PHE A 1 1100 ? 20.627  49.861 2.397   1.00 96.32  ? 1097 PHE A CG  1 
ATOM 8458 C CD1 . PHE A 1 1100 ? 21.827  49.947 1.698   1.00 96.32  ? 1097 PHE A CD1 1 
ATOM 8459 C CD2 . PHE A 1 1100 ? 19.430  49.931 1.687   1.00 96.32  ? 1097 PHE A CD2 1 
ATOM 8460 C CE1 . PHE A 1 1100 ? 21.836  50.092 0.314   1.00 96.32  ? 1097 PHE A CE1 1 
ATOM 8461 C CE2 . PHE A 1 1100 ? 19.429  50.075 0.299   1.00 96.32  ? 1097 PHE A CE2 1 
ATOM 8462 C CZ  . PHE A 1 1100 ? 20.632  50.156 -0.387  1.00 96.32  ? 1097 PHE A CZ  1 
ATOM 8463 N N   . LEU A 1 1101 ? 18.700  52.224 4.229   1.00 75.34  ? 1098 LEU A N   1 
ATOM 8464 C CA  . LEU A 1 1101 ? 17.837  53.219 3.587   1.00 75.34  ? 1098 LEU A CA  1 
ATOM 8465 C C   . LEU A 1 1101 ? 18.205  54.629 4.041   1.00 75.34  ? 1098 LEU A C   1 
ATOM 8466 O O   . LEU A 1 1101 ? 17.968  55.607 3.326   1.00 75.34  ? 1098 LEU A O   1 
ATOM 8467 C CB  . LEU A 1 1101 ? 16.349  52.954 3.865   1.00 52.22  ? 1098 LEU A CB  1 
ATOM 8468 C CG  . LEU A 1 1101 ? 15.730  51.556 3.729   1.00 52.22  ? 1098 LEU A CG  1 
ATOM 8469 C CD1 . LEU A 1 1101 ? 14.258  51.589 4.160   1.00 52.22  ? 1098 LEU A CD1 1 
ATOM 8470 C CD2 . LEU A 1 1101 ? 15.877  50.939 2.317   1.00 52.22  ? 1098 LEU A CD2 1 
ATOM 8471 N N   . ASP A 1 1102 ? 18.785  54.728 5.232   1.00 78.50  ? 1099 ASP A N   1 
ATOM 8472 C CA  . ASP A 1 1102 ? 19.150  56.026 5.780   1.00 78.50  ? 1099 ASP A CA  1 
ATOM 8473 C C   . ASP A 1 1102 ? 20.614  56.351 5.457   1.00 78.50  ? 1099 ASP A C   1 
ATOM 8474 O O   . ASP A 1 1102 ? 21.416  56.747 6.309   1.00 78.50  ? 1099 ASP A O   1 
ATOM 8475 C CB  . ASP A 1 1102 ? 18.801  56.095 7.269   1.00 95.43  ? 1099 ASP A CB  1 
ATOM 8476 C CG  . ASP A 1 1102 ? 17.303  55.975 7.513   1.00 95.43  ? 1099 ASP A CG  1 
ATOM 8477 O OD1 . ASP A 1 1102 ? 16.830  56.376 8.594   1.00 95.43  ? 1099 ASP A OD1 1 
ATOM 8478 O OD2 . ASP A 1 1102 ? 16.586  55.487 6.616   1.00 95.43  ? 1099 ASP A OD2 1 
ATOM 8479 N N   . ILE A 1 1103 ? 20.937  56.164 4.188   1.00 83.08  ? 1100 ILE A N   1 
ATOM 8480 C CA  . ILE A 1 1103 ? 22.242  56.465 3.658   1.00 83.08  ? 1100 ILE A CA  1 
ATOM 8481 C C   . ILE A 1 1103 ? 22.013  57.266 2.375   1.00 83.08  ? 1100 ILE A C   1 
ATOM 8482 O O   . ILE A 1 1103 ? 20.944  57.186 1.759   1.00 83.08  ? 1100 ILE A O   1 
ATOM 8483 C CB  . ILE A 1 1103 ? 23.038  55.161 3.398   1.00 94.03  ? 1100 ILE A CB  1 
ATOM 8484 C CG1 . ILE A 1 1103 ? 23.431  54.501 4.720   1.00 94.03  ? 1100 ILE A CG1 1 
ATOM 8485 C CG2 . ILE A 1 1103 ? 24.290  55.427 2.585   1.00 94.03  ? 1100 ILE A CG2 1 
ATOM 8486 C CD1 . ILE A 1 1103 ? 23.964  53.090 4.569   1.00 94.03  ? 1100 ILE A CD1 1 
ATOM 8487 N N   . SER A 1 1104 ? 23.004  58.067 2.000   1.00 150.87 ? 1101 SER A N   1 
ATOM 8488 C CA  . SER A 1 1104 ? 22.968  58.801 0.744   1.00 150.87 ? 1101 SER A CA  1 
ATOM 8489 C C   . SER A 1 1104 ? 23.220  57.855 -0.419  1.00 150.87 ? 1101 SER A C   1 
ATOM 8490 O O   . SER A 1 1104 ? 24.000  56.911 -0.298  1.00 150.87 ? 1101 SER A O   1 
ATOM 8491 C CB  . SER A 1 1104 ? 24.031  59.897 0.746   1.00 89.57  ? 1101 SER A CB  1 
ATOM 8492 O OG  . SER A 1 1104 ? 25.322  59.336 0.916   1.00 89.57  ? 1101 SER A OG  1 
ATOM 8493 N N   . ARG A 1 1105 ? 22.562  58.127 -1.543  1.00 119.74 ? 1102 ARG A N   1 
ATOM 8494 C CA  . ARG A 1 1105 ? 22.789  57.402 -2.795  1.00 119.74 ? 1102 ARG A CA  1 
ATOM 8495 C C   . ARG A 1 1105 ? 24.286  57.154 -3.081  1.00 119.74 ? 1102 ARG A C   1 
ATOM 8496 O O   . ARG A 1 1105 ? 24.645  56.042 -3.479  1.00 119.74 ? 1102 ARG A O   1 
ATOM 8497 C CB  . ARG A 1 1105 ? 22.107  58.122 -3.969  1.00 100.26 ? 1102 ARG A CB  1 
ATOM 8498 C CG  . ARG A 1 1105 ? 20.586  58.305 -3.809  1.00 100.26 ? 1102 ARG A CG  1 
ATOM 8499 C CD  . ARG A 1 1105 ? 19.771  57.389 -4.723  1.00 100.26 ? 1102 ARG A CD  1 
ATOM 8500 N NE  . ARG A 1 1105 ? 20.490  56.165 -5.082  1.00 100.26 ? 1102 ARG A NE  1 
ATOM 8501 C CZ  . ARG A 1 1105 ? 19.967  55.142 -5.757  1.00 100.26 ? 1102 ARG A CZ  1 
ATOM 8502 N NH1 . ARG A 1 1105 ? 18.699  55.168 -6.155  1.00 100.26 ? 1102 ARG A NH1 1 
ATOM 8503 N NH2 . ARG A 1 1105 ? 20.719  54.080 -6.027  1.00 100.26 ? 1102 ARG A NH2 1 
ATOM 8504 N N   . PRO A 1 1106 ? 25.156  58.188 -2.902  1.00 107.85 ? 1103 PRO A N   1 
ATOM 8505 C CA  . PRO A 1 1106 ? 26.622  58.009 -2.907  1.00 107.85 ? 1103 PRO A CA  1 
ATOM 8506 C C   . PRO A 1 1106 ? 27.109  56.782 -2.130  1.00 107.85 ? 1103 PRO A C   1 
ATOM 8507 O O   . PRO A 1 1106 ? 27.344  55.732 -2.735  1.00 107.85 ? 1103 PRO A O   1 
ATOM 8508 C CB  . PRO A 1 1106 ? 27.135  59.293 -2.240  1.00 96.92  ? 1103 PRO A CB  1 
ATOM 8509 C CG  . PRO A 1 1106 ? 26.134  60.318 -2.580  1.00 96.92  ? 1103 PRO A CG  1 
ATOM 8510 C CD  . PRO A 1 1106 ? 24.800  59.617 -2.761  1.00 96.92  ? 1103 PRO A CD  1 
ATOM 8511 N N   . LYS A 1 1107 ? 27.255  56.919 -0.810  1.00 79.52  ? 1104 LYS A N   1 
ATOM 8512 C CA  . LYS A 1 1107 ? 27.642  55.808 0.067   1.00 79.52  ? 1104 LYS A CA  1 
ATOM 8513 C C   . LYS A 1 1107 ? 26.814  54.568 -0.222  1.00 79.52  ? 1104 LYS A C   1 
ATOM 8514 O O   . LYS A 1 1107 ? 27.279  53.461 -0.027  1.00 79.52  ? 1104 LYS A O   1 
ATOM 8515 C CB  . LYS A 1 1107 ? 27.486  56.194 1.540   1.00 75.59  ? 1104 LYS A CB  1 
ATOM 8516 C CG  . LYS A 1 1107 ? 28.532  57.176 2.065   1.00 75.59  ? 1104 LYS A CG  1 
ATOM 8517 C CD  . LYS A 1 1107 ? 28.593  57.176 3.600   1.00 75.59  ? 1104 LYS A CD  1 
ATOM 8518 C CE  . LYS A 1 1107 ? 29.657  58.144 4.143   1.00 75.59  ? 1104 LYS A CE  1 
ATOM 8519 N NZ  . LYS A 1 1107 ? 31.065  57.811 3.715   1.00 75.59  ? 1104 LYS A NZ  1 
ATOM 8520 N N   . MET A 1 1108 ? 25.606  54.777 -0.736  1.00 63.24  ? 1105 MET A N   1 
ATOM 8521 C CA  . MET A 1 1108 ? 24.721  53.677 -1.085  1.00 63.24  ? 1105 MET A CA  1 
ATOM 8522 C C   . MET A 1 1108 ? 25.309  52.874 -2.251  1.00 63.24  ? 1105 MET A C   1 
ATOM 8523 O O   . MET A 1 1108 ? 25.290  51.644 -2.229  1.00 63.24  ? 1105 MET A O   1 
ATOM 8524 C CB  . MET A 1 1108 ? 23.331  54.200 -1.452  1.00 78.21  ? 1105 MET A CB  1 
ATOM 8525 C CG  . MET A 1 1108 ? 22.239  53.144 -1.412  1.00 78.21  ? 1105 MET A CG  1 
ATOM 8526 S SD  . MET A 1 1108 ? 20.583  53.856 -1.374  1.00 78.21  ? 1105 MET A SD  1 
ATOM 8527 C CE  . MET A 1 1108 ? 20.641  54.764 0.168   1.00 78.21  ? 1105 MET A CE  1 
ATOM 8528 N N   . GLN A 1 1109 ? 25.832  53.567 -3.264  1.00 104.22 ? 1106 GLN A N   1 
ATOM 8529 C CA  . GLN A 1 1109 ? 26.421  52.881 -4.421  1.00 104.22 ? 1106 GLN A CA  1 
ATOM 8530 C C   . GLN A 1 1109 ? 27.822  52.321 -4.133  1.00 104.22 ? 1106 GLN A C   1 
ATOM 8531 O O   . GLN A 1 1109 ? 28.400  51.599 -4.947  1.00 104.22 ? 1106 GLN A O   1 
ATOM 8532 C CB  . GLN A 1 1109 ? 26.397  53.772 -5.667  1.00 127.01 ? 1106 GLN A CB  1 
ATOM 8533 C CG  . GLN A 1 1109 ? 25.191  53.509 -6.558  1.00 127.01 ? 1106 GLN A CG  1 
ATOM 8534 C CD  . GLN A 1 1109 ? 24.491  54.777 -7.006  1.00 127.01 ? 1106 GLN A CD  1 
ATOM 8535 O OE1 . GLN A 1 1109 ? 25.030  55.879 -6.890  1.00 127.01 ? 1106 GLN A OE1 1 
ATOM 8536 N NE2 . GLN A 1 1109 ? 23.274  54.625 -7.519  1.00 127.01 ? 1106 GLN A NE2 1 
ATOM 8537 N N   . GLU A 1 1110 ? 28.354  52.662 -2.964  1.00 106.31 ? 1107 GLU A N   1 
ATOM 8538 C CA  . GLU A 1 1110 ? 29.595  52.082 -2.474  1.00 106.31 ? 1107 GLU A CA  1 
ATOM 8539 C C   . GLU A 1 1110 ? 29.302  50.641 -2.062  1.00 106.31 ? 1107 GLU A C   1 
ATOM 8540 O O   . GLU A 1 1110 ? 29.884  49.703 -2.612  1.00 106.31 ? 1107 GLU A O   1 
ATOM 8541 C CB  . GLU A 1 1110 ? 30.114  52.911 -1.305  1.00 71.07  ? 1107 GLU A CB  1 
ATOM 8542 C CG  . GLU A 1 1110 ? 31.528  52.607 -0.860  1.00 71.07  ? 1107 GLU A CG  1 
ATOM 8543 C CD  . GLU A 1 1110 ? 32.096  53.722 0.009   1.00 71.07  ? 1107 GLU A CD  1 
ATOM 8544 O OE1 . GLU A 1 1110 ? 33.160  53.508 0.622   1.00 71.07  ? 1107 GLU A OE1 1 
ATOM 8545 O OE2 . GLU A 1 1110 ? 31.477  54.813 0.079   1.00 71.07  ? 1107 GLU A OE2 1 
ATOM 8546 N N   . VAL A 1 1111 ? 28.411  50.506 -1.079  1.00 89.85  ? 1108 VAL A N   1 
ATOM 8547 C CA  . VAL A 1 1111 ? 28.001  49.216 -0.541  1.00 89.85  ? 1108 VAL A CA  1 
ATOM 8548 C C   . VAL A 1 1111 ? 27.773  48.252 -1.684  1.00 89.85  ? 1108 VAL A C   1 
ATOM 8549 O O   . VAL A 1 1111 ? 27.878  47.033 -1.531  1.00 89.85  ? 1108 VAL A O   1 
ATOM 8550 C CB  . VAL A 1 1111 ? 26.711  49.333 0.289   1.00 68.88  ? 1108 VAL A CB  1 
ATOM 8551 C CG1 . VAL A 1 1111 ? 26.527  48.100 1.161   1.00 68.88  ? 1108 VAL A CG1 1 
ATOM 8552 C CG2 . VAL A 1 1111 ? 26.739  50.595 1.138   1.00 68.88  ? 1108 VAL A CG2 1 
ATOM 8553 N N   . VAL A 1 1112 ? 27.462  48.813 -2.842  1.00 87.77  ? 1109 VAL A N   1 
ATOM 8554 C CA  . VAL A 1 1112 ? 27.212  47.997 -4.010  1.00 87.77  ? 1109 VAL A CA  1 
ATOM 8555 C C   . VAL A 1 1112 ? 28.295  48.050 -5.065  1.00 87.77  ? 1109 VAL A C   1 
ATOM 8556 O O   . VAL A 1 1112 ? 28.538  49.080 -5.695  1.00 87.77  ? 1109 VAL A O   1 
ATOM 8557 C CB  . VAL A 1 1112 ? 25.867  48.367 -4.670  1.00 63.66  ? 1109 VAL A CB  1 
ATOM 8558 C CG1 . VAL A 1 1112 ? 25.774  47.759 -6.062  1.00 63.66  ? 1109 VAL A CG1 1 
ATOM 8559 C CG2 . VAL A 1 1112 ? 24.706  47.908 -3.802  1.00 63.66  ? 1109 VAL A CG2 1 
ATOM 8560 N N   . ALA A 1 1113 ? 28.940  46.912 -5.252  1.00 154.79 ? 1110 ALA A N   1 
ATOM 8561 C CA  . ALA A 1 1113 ? 29.995  46.792 -6.228  1.00 154.79 ? 1110 ALA A CA  1 
ATOM 8562 C C   . ALA A 1 1113 ? 29.852  45.446 -6.891  1.00 154.79 ? 1110 ALA A C   1 
ATOM 8563 O O   . ALA A 1 1113 ? 30.188  45.298 -8.058  1.00 154.79 ? 1110 ALA A O   1 
ATOM 8564 C CB  . ALA A 1 1113 ? 31.354  46.916 -5.560  1.00 58.73  ? 1110 ALA A CB  1 
ATOM 8565 N N   . ASN A 1 1114 ? 29.348  44.459 -6.156  1.00 86.12  ? 1111 ASN A N   1 
ATOM 8566 C CA  . ASN A 1 1114 ? 29.196  43.139 -6.775  1.00 86.12  ? 1111 ASN A CA  1 
ATOM 8567 C C   . ASN A 1 1114 ? 28.589  42.131 -5.803  1.00 86.12  ? 1111 ASN A C   1 
ATOM 8568 O O   . ASN A 1 1114 ? 27.521  42.375 -5.233  1.00 86.12  ? 1111 ASN A O   1 
ATOM 8569 C CB  . ASN A 1 1114 ? 30.523  42.628 -7.349  1.00 112.20 ? 1111 ASN A CB  1 
ATOM 8570 C CG  . ASN A 1 1114 ? 31.687  42.797 -6.387  1.00 112.20 ? 1111 ASN A CG  1 
ATOM 8571 O OD1 . ASN A 1 1114 ? 32.202  41.814 -5.851  1.00 112.20 ? 1111 ASN A OD1 1 
ATOM 8572 N ND2 . ASN A 1 1114 ? 32.115  44.044 -6.170  1.00 112.20 ? 1111 ASN A ND2 1 
ATOM 8573 N N   . ARG A 1 1125 ? 22.542  35.933 -9.589  1.00 115.49 ? 1122 ARG A N   1 
ATOM 8574 C CA  . ARG A 1 1125 ? 22.356  37.203 -8.897  1.00 115.49 ? 1122 ARG A CA  1 
ATOM 8575 C C   . ARG A 1 1125 ? 22.605  38.382 -9.832  1.00 115.49 ? 1122 ARG A C   1 
ATOM 8576 O O   . ARG A 1 1125 ? 22.814  38.202 -11.031 1.00 115.49 ? 1122 ARG A O   1 
ATOM 8577 C CB  . ARG A 1 1125 ? 23.281  37.292 -7.681  1.00 98.90  ? 1122 ARG A CB  1 
ATOM 8578 C CG  . ARG A 1 1125 ? 24.760  37.199 -8.019  1.00 98.90  ? 1122 ARG A CG  1 
ATOM 8579 C CD  . ARG A 1 1125 ? 25.619  37.282 -6.767  1.00 98.90  ? 1122 ARG A CD  1 
ATOM 8580 N NE  . ARG A 1 1125 ? 25.415  38.535 -6.047  1.00 98.90  ? 1122 ARG A NE  1 
ATOM 8581 C CZ  . ARG A 1 1125 ? 26.040  38.860 -4.920  1.00 98.90  ? 1122 ARG A CZ  1 
ATOM 8582 N NH1 . ARG A 1 1125 ? 26.914  38.022 -4.379  1.00 98.90  ? 1122 ARG A NH1 1 
ATOM 8583 N NH2 . ARG A 1 1125 ? 25.792  40.022 -4.332  1.00 98.90  ? 1122 ARG A NH2 1 
ATOM 8584 N N   . GLU A 1 1126 ? 22.580  39.588 -9.275  1.00 102.26 ? 1123 GLU A N   1 
ATOM 8585 C CA  . GLU A 1 1126 ? 22.802  40.798 -10.057 1.00 102.26 ? 1123 GLU A CA  1 
ATOM 8586 C C   . GLU A 1 1126 ? 23.511  41.867 -9.232  1.00 102.26 ? 1123 GLU A C   1 
ATOM 8587 O O   . GLU A 1 1126 ? 24.678  42.177 -9.471  1.00 102.26 ? 1123 GLU A O   1 
ATOM 8588 C CB  . GLU A 1 1126 ? 21.476  41.342 -10.594 1.00 102.45 ? 1123 GLU A CB  1 
ATOM 8589 C CG  . GLU A 1 1126 ? 20.728  40.376 -11.499 1.00 102.45 ? 1123 GLU A CG  1 
ATOM 8590 C CD  . GLU A 1 1126 ? 20.266  39.130 -10.769 1.00 102.45 ? 1123 GLU A CD  1 
ATOM 8591 O OE1 . GLU A 1 1126 ? 20.345  39.105 -9.523  1.00 102.45 ? 1123 GLU A OE1 1 
ATOM 8592 O OE2 . GLU A 1 1126 ? 19.822  38.176 -11.442 1.00 102.45 ? 1123 GLU A OE2 1 
ATOM 8593 N N   . ALA A 1 1127 ? 22.798  42.426 -8.260  1.00 144.67 ? 1124 ALA A N   1 
ATOM 8594 C CA  . ALA A 1 1127 ? 23.356  43.460 -7.397  1.00 144.67 ? 1124 ALA A CA  1 
ATOM 8595 C C   . ALA A 1 1127 ? 23.118  44.850 -7.978  1.00 144.67 ? 1124 ALA A C   1 
ATOM 8596 O O   . ALA A 1 1127 ? 23.635  45.186 -9.043  1.00 144.67 ? 1124 ALA A O   1 
ATOM 8597 C CB  . ALA A 1 1127 ? 24.843  43.222 -7.179  1.00 90.08  ? 1124 ALA A CB  1 
ATOM 8598 N N   . THR A 1 1128 ? 22.331  45.654 -7.270  1.00 103.85 ? 1125 THR A N   1 
ATOM 8599 C CA  . THR A 1 1128 ? 22.022  47.008 -7.714  1.00 103.85 ? 1125 THR A CA  1 
ATOM 8600 C C   . THR A 1 1128 ? 21.542  47.873 -6.553  1.00 103.85 ? 1125 THR A C   1 
ATOM 8601 O O   . THR A 1 1128 ? 21.151  47.360 -5.504  1.00 103.85 ? 1125 THR A O   1 
ATOM 8602 C CB  . THR A 1 1128 ? 20.951  47.010 -8.820  1.00 150.09 ? 1125 THR A CB  1 
ATOM 8603 O OG1 . THR A 1 1128 ? 21.418  46.252 -9.943  1.00 150.09 ? 1125 THR A OG1 1 
ATOM 8604 C CG2 . THR A 1 1128 ? 20.646  48.432 -9.265  1.00 150.09 ? 1125 THR A CG2 1 
ATOM 8605 N N   . ALA A 1 1129 ? 21.574  49.187 -6.748  1.00 71.51  ? 1126 ALA A N   1 
ATOM 8606 C CA  . ALA A 1 1129 ? 21.142  50.125 -5.718  1.00 71.51  ? 1126 ALA A CA  1 
ATOM 8607 C C   . ALA A 1 1129 ? 19.621  50.172 -5.619  1.00 71.51  ? 1126 ALA A C   1 
ATOM 8608 O O   . ALA A 1 1129 ? 19.068  50.627 -4.617  1.00 71.51  ? 1126 ALA A O   1 
ATOM 8609 C CB  . ALA A 1 1129 ? 21.701  51.512 -5.996  1.00 94.43  ? 1126 ALA A CB  1 
ATOM 8610 N N   . ASP A 1 1130 ? 18.950  49.700 -6.664  1.00 110.98 ? 1127 ASP A N   1 
ATOM 8611 C CA  . ASP A 1 1130 ? 17.492  49.687 -6.697  1.00 110.98 ? 1127 ASP A CA  1 
ATOM 8612 C C   . ASP A 1 1130 ? 16.948  48.284 -6.450  1.00 110.98 ? 1127 ASP A C   1 
ATOM 8613 O O   . ASP A 1 1130 ? 15.964  48.107 -5.732  1.00 110.98 ? 1127 ASP A O   1 
ATOM 8614 C CB  . ASP A 1 1130 ? 16.981  50.221 -8.037  1.00 119.73 ? 1127 ASP A CB  1 
ATOM 8615 C CG  . ASP A 1 1130 ? 17.424  51.646 -8.303  1.00 119.73 ? 1127 ASP A CG  1 
ATOM 8616 O OD1 . ASP A 1 1130 ? 18.124  52.223 -7.444  1.00 119.73 ? 1127 ASP A OD1 1 
ATOM 8617 O OD2 . ASP A 1 1130 ? 17.073  52.189 -9.372  1.00 119.73 ? 1127 ASP A OD2 1 
ATOM 8618 N N   . ASP A 1 1131 ? 17.595  47.290 -7.049  1.00 121.62 ? 1128 ASP A N   1 
ATOM 8619 C CA  . ASP A 1 1131 ? 17.178  45.902 -6.895  1.00 121.62 ? 1128 ASP A CA  1 
ATOM 8620 C C   . ASP A 1 1131 ? 17.048  45.611 -5.389  1.00 121.62 ? 1128 ASP A C   1 
ATOM 8621 O O   . ASP A 1 1131 ? 16.205  44.820 -4.958  1.00 121.62 ? 1128 ASP A O   1 
ATOM 8622 C CB  . ASP A 1 1131 ? 18.261  44.994 -7.506  1.00 141.76 ? 1128 ASP A CB  1 
ATOM 8623 C CG  . ASP A 1 1131 ? 17.699  43.866 -8.367  1.00 141.76 ? 1128 ASP A CG  1 
ATOM 8624 O OD1 . ASP A 1 1131 ? 18.514  43.075 -8.887  1.00 141.76 ? 1128 ASP A OD1 1 
ATOM 8625 O OD2 . ASP A 1 1131 ? 16.465  43.764 -8.539  1.00 141.76 ? 1128 ASP A OD2 1 
ATOM 8626 N N   . LEU A 1 1132 ? 17.866  46.318 -4.608  1.00 88.29  ? 1129 LEU A N   1 
ATOM 8627 C CA  . LEU A 1 1132 ? 18.229  45.972 -3.230  1.00 88.29  ? 1129 LEU A CA  1 
ATOM 8628 C C   . LEU A 1 1132 ? 17.595  46.915 -2.192  1.00 88.29  ? 1129 LEU A C   1 
ATOM 8629 O O   . LEU A 1 1132 ? 17.112  46.473 -1.147  1.00 88.29  ? 1129 LEU A O   1 
ATOM 8630 C CB  . LEU A 1 1132 ? 19.762  45.998 -3.151  1.00 66.92  ? 1129 LEU A CB  1 
ATOM 8631 C CG  . LEU A 1 1132 ? 20.702  45.677 -1.985  1.00 66.92  ? 1129 LEU A CG  1 
ATOM 8632 C CD1 . LEU A 1 1132 ? 20.697  46.813 -0.958  1.00 66.92  ? 1129 LEU A CD1 1 
ATOM 8633 C CD2 . LEU A 1 1132 ? 20.413  44.318 -1.371  1.00 66.92  ? 1129 LEU A CD2 1 
ATOM 8634 N N   . ILE A 1 1133 ? 17.614  48.213 -2.481  1.00 84.65  ? 1130 ILE A N   1 
ATOM 8635 C CA  . ILE A 1 1133 ? 16.782  49.181 -1.771  1.00 84.65  ? 1130 ILE A CA  1 
ATOM 8636 C C   . ILE A 1 1133 ? 15.392  48.596 -1.487  1.00 84.65  ? 1130 ILE A C   1 
ATOM 8637 O O   . ILE A 1 1133 ? 14.876  48.723 -0.384  1.00 84.65  ? 1130 ILE A O   1 
ATOM 8638 C CB  . ILE A 1 1133 ? 16.672  50.509 -2.580  1.00 79.48  ? 1130 ILE A CB  1 
ATOM 8639 C CG1 . ILE A 1 1133 ? 16.506  51.715 -1.646  1.00 79.48  ? 1130 ILE A CG1 1 
ATOM 8640 C CG2 . ILE A 1 1133 ? 15.572  50.443 -3.670  1.00 79.48  ? 1130 ILE A CG2 1 
ATOM 8641 C CD1 . ILE A 1 1133 ? 16.896  53.069 -2.280  1.00 79.48  ? 1130 ILE A CD1 1 
ATOM 8642 N N   . LYS A 1 1134 ? 14.832  47.932 -2.496  1.00 87.70  ? 1131 LYS A N   1 
ATOM 8643 C CA  . LYS A 1 1134 ? 13.515  47.298 -2.466  1.00 87.70  ? 1131 LYS A CA  1 
ATOM 8644 C C   . LYS A 1 1134 ? 13.473  46.084 -1.528  1.00 87.70  ? 1131 LYS A C   1 
ATOM 8645 O O   . LYS A 1 1134 ? 12.489  45.874 -0.806  1.00 87.70  ? 1131 LYS A O   1 
ATOM 8646 C CB  . LYS A 1 1134 ? 13.150  46.882 -3.898  1.00 97.97  ? 1131 LYS A CB  1 
ATOM 8647 C CG  . LYS A 1 1134 ? 11.790  46.221 -4.100  1.00 97.97  ? 1131 LYS A CG  1 
ATOM 8648 C CD  . LYS A 1 1134 ? 11.657  45.731 -5.541  1.00 97.97  ? 1131 LYS A CD  1 
ATOM 8649 C CE  . LYS A 1 1134 ? 11.806  46.880 -6.553  1.00 97.97  ? 1131 LYS A CE  1 
ATOM 8650 N NZ  . LYS A 1 1134 ? 12.103  46.404 -7.937  1.00 97.97  ? 1131 LYS A NZ  1 
ATOM 8651 N N   . VAL A 1 1135 ? 14.542  45.288 -1.554  1.00 85.31  ? 1132 VAL A N   1 
ATOM 8652 C CA  . VAL A 1 1135 ? 14.693  44.127 -0.673  1.00 85.31  ? 1132 VAL A CA  1 
ATOM 8653 C C   . VAL A 1 1135 ? 14.481  44.538 0.785   1.00 85.31  ? 1132 VAL A C   1 
ATOM 8654 O O   . VAL A 1 1135 ? 13.685  43.931 1.500   1.00 85.31  ? 1132 VAL A O   1 
ATOM 8655 C CB  . VAL A 1 1135 ? 16.096  43.486 -0.838  1.00 84.91  ? 1132 VAL A CB  1 
ATOM 8656 C CG1 . VAL A 1 1135 ? 16.405  42.539 0.304   1.00 84.91  ? 1132 VAL A CG1 1 
ATOM 8657 C CG2 . VAL A 1 1135 ? 16.224  42.781 -2.186  1.00 84.91  ? 1132 VAL A CG2 1 
ATOM 8658 N N   . VAL A 1 1136 ? 15.183  45.589 1.198   1.00 96.56  ? 1133 VAL A N   1 
ATOM 8659 C CA  . VAL A 1 1136 ? 15.153  46.055 2.572   1.00 96.56  ? 1133 VAL A CA  1 
ATOM 8660 C C   . VAL A 1 1136 ? 13.761  46.540 2.963   1.00 96.56  ? 1133 VAL A C   1 
ATOM 8661 O O   . VAL A 1 1136 ? 13.380  46.465 4.129   1.00 96.56  ? 1133 VAL A O   1 
ATOM 8662 C CB  . VAL A 1 1136 ? 16.236  47.140 2.825   1.00 62.87  ? 1133 VAL A CB  1 
ATOM 8663 C CG1 . VAL A 1 1136 ? 15.923  47.968 4.063   1.00 62.87  ? 1133 VAL A CG1 1 
ATOM 8664 C CG2 . VAL A 1 1136 ? 17.607  46.501 2.967   1.00 62.87  ? 1133 VAL A CG2 1 
ATOM 8665 N N   . GLU A 1 1137 ? 12.988  47.011 1.994   1.00 62.34  ? 1134 GLU A N   1 
ATOM 8666 C CA  . GLU A 1 1137 ? 11.643  47.506 2.302   1.00 62.34  ? 1134 GLU A CA  1 
ATOM 8667 C C   . GLU A 1 1137 ? 10.638  46.386 2.580   1.00 62.34  ? 1134 GLU A C   1 
ATOM 8668 O O   . GLU A 1 1137 ? 9.858   46.464 3.535   1.00 62.34  ? 1134 GLU A O   1 
ATOM 8669 C CB  . GLU A 1 1137 ? 11.161  48.492 1.249   1.00 110.93 ? 1134 GLU A CB  1 
ATOM 8670 C CG  . GLU A 1 1137 ? 11.969  49.770 1.310   1.00 110.93 ? 1134 GLU A CG  1 
ATOM 8671 C CD  . GLU A 1 1137 ? 11.412  50.876 0.461   1.00 110.93 ? 1134 GLU A CD  1 
ATOM 8672 O OE1 . GLU A 1 1137 ? 10.369  50.674 -0.192  1.00 110.93 ? 1134 GLU A OE1 1 
ATOM 8673 O OE2 . GLU A 1 1137 ? 12.023  51.963 0.452   1.00 110.93 ? 1134 GLU A OE2 1 
ATOM 8674 N N   . GLU A 1 1138 ? 10.699  45.329 1.773   1.00 68.97  ? 1135 GLU A N   1 
ATOM 8675 C CA  . GLU A 1 1138 ? 9.949   44.108 2.043   1.00 68.97  ? 1135 GLU A CA  1 
ATOM 8676 C C   . GLU A 1 1138 ? 10.213  43.620 3.471   1.00 68.97  ? 1135 GLU A C   1 
ATOM 8677 O O   . GLU A 1 1138 ? 9.372   42.940 4.074   1.00 68.97  ? 1135 GLU A O   1 
ATOM 8678 C CB  . GLU A 1 1138 ? 10.315  43.024 1.031   1.00 151.14 ? 1135 GLU A CB  1 
ATOM 8679 C CG  . GLU A 1 1138 ? 9.959   43.375 -0.408  1.00 151.14 ? 1135 GLU A CG  1 
ATOM 8680 C CD  . GLU A 1 1138 ? 10.784  42.605 -1.421  1.00 151.14 ? 1135 GLU A CD  1 
ATOM 8681 O OE1 . GLU A 1 1138 ? 11.033  41.397 -1.194  1.00 151.14 ? 1135 GLU A OE1 1 
ATOM 8682 O OE2 . GLU A 1 1138 ? 11.179  43.208 -2.447  1.00 151.14 ? 1135 GLU A OE2 1 
ATOM 8683 N N   . LEU A 1 1139 ? 11.375  43.988 4.009   1.00 60.33  ? 1136 LEU A N   1 
ATOM 8684 C CA  . LEU A 1 1139 ? 11.756  43.607 5.368   1.00 60.33  ? 1136 LEU A CA  1 
ATOM 8685 C C   . LEU A 1 1139 ? 11.170  44.535 6.431   1.00 60.33  ? 1136 LEU A C   1 
ATOM 8686 O O   . LEU A 1 1139 ? 10.853  44.101 7.545   1.00 60.33  ? 1136 LEU A O   1 
ATOM 8687 C CB  . LEU A 1 1139 ? 13.276  43.579 5.515   1.00 32.88  ? 1136 LEU A CB  1 
ATOM 8688 C CG  . LEU A 1 1139 ? 14.095  42.437 4.905   1.00 32.88  ? 1136 LEU A CG  1 
ATOM 8689 C CD1 . LEU A 1 1139 ? 15.556  42.583 5.348   1.00 32.88  ? 1136 LEU A CD1 1 
ATOM 8690 C CD2 . LEU A 1 1139 ? 13.508  41.068 5.285   1.00 32.88  ? 1136 LEU A CD2 1 
ATOM 8691 N N   . THR A 1 1140 ? 11.044  45.815 6.079   1.00 58.83  ? 1137 THR A N   1 
ATOM 8692 C CA  . THR A 1 1140 ? 10.488  46.806 6.994   1.00 58.83  ? 1137 THR A CA  1 
ATOM 8693 C C   . THR A 1 1140 ? 9.042   46.440 7.290   1.00 58.83  ? 1137 THR A C   1 
ATOM 8694 O O   . THR A 1 1140 ? 8.576   46.614 8.411   1.00 58.83  ? 1137 THR A O   1 
ATOM 8695 C CB  . THR A 1 1140 ? 10.555  48.228 6.417   1.00 57.67  ? 1137 THR A CB  1 
ATOM 8696 O OG1 . THR A 1 1140 ? 10.077  48.205 5.072   1.00 57.67  ? 1137 THR A OG1 1 
ATOM 8697 C CG2 . THR A 1 1140 ? 11.976  48.758 6.422   1.00 57.67  ? 1137 THR A CG2 1 
ATOM 8698 N N   . ARG A 1 1141 ? 8.349   45.894 6.294   1.00 61.24  ? 1138 ARG A N   1 
ATOM 8699 C CA  . ARG A 1 1141 ? 6.936   45.515 6.450   1.00 61.24  ? 1138 ARG A CA  1 
ATOM 8700 C C   . ARG A 1 1141 ? 6.717   44.310 7.372   1.00 61.24  ? 1138 ARG A C   1 
ATOM 8701 O O   . ARG A 1 1141 ? 5.575   43.868 7.579   1.00 61.24  ? 1138 ARG A O   1 
ATOM 8702 C CB  . ARG A 1 1141 ? 6.287   45.276 5.088   1.00 98.30  ? 1138 ARG A CB  1 
ATOM 8703 C CG  . ARG A 1 1141 ? 6.228   46.517 4.233   1.00 98.30  ? 1138 ARG A CG  1 
ATOM 8704 C CD  . ARG A 1 1141 ? 5.455   46.267 2.962   1.00 98.30  ? 1138 ARG A CD  1 
ATOM 8705 N NE  . ARG A 1 1141 ? 5.953   47.117 1.886   1.00 98.30  ? 1138 ARG A NE  1 
ATOM 8706 C CZ  . ARG A 1 1141 ? 6.742   46.700 0.899   1.00 98.30  ? 1138 ARG A CZ  1 
ATOM 8707 N NH1 . ARG A 1 1141 ? 7.120   45.426 0.819   1.00 98.30  ? 1138 ARG A NH1 1 
ATOM 8708 N NH2 . ARG A 1 1141 ? 7.144   47.567 -0.018  1.00 98.30  ? 1138 ARG A NH2 1 
ATOM 8709 N N   . ILE A 1 1142 ? 7.819   43.805 7.925   1.00 54.69  ? 1139 ILE A N   1 
ATOM 8710 C CA  . ILE A 1 1142 ? 7.805   42.664 8.852   1.00 54.69  ? 1139 ILE A CA  1 
ATOM 8711 C C   . ILE A 1 1142 ? 7.310   43.019 10.280  1.00 54.69  ? 1139 ILE A C   1 
ATOM 8712 O O   . ILE A 1 1142 ? 6.863   42.140 11.028  1.00 54.69  ? 1139 ILE A O   1 
ATOM 8713 C CB  . ILE A 1 1142 ? 9.182   41.933 8.827   1.00 108.58 ? 1139 ILE A CB  1 
ATOM 8714 C CG1 . ILE A 1 1142 ? 9.023   40.558 8.159   1.00 108.58 ? 1139 ILE A CG1 1 
ATOM 8715 C CG2 . ILE A 1 1142 ? 9.788   41.788 10.213  1.00 108.58 ? 1139 ILE A CG2 1 
ATOM 8716 C CD1 . ILE A 1 1142 ? 10.307  40.040 7.524   1.00 108.58 ? 1139 ILE A CD1 1 
ATOM 8717 N N   . HIS A 1 1143 ? 7.363   44.312 10.623  1.00 48.84  ? 1140 HIS A N   1 
ATOM 8718 C CA  . HIS A 1 1143 ? 6.910   44.810 11.918  1.00 48.84  ? 1140 HIS A CA  1 
ATOM 8719 C C   . HIS A 1 1143 ? 6.253   46.191 11.805  1.00 48.84  ? 1140 HIS A C   1 
ATOM 8720 O O   . HIS A 1 1143 ? 6.266   47.003 12.755  1.00 48.84  ? 1140 HIS A O   1 
ATOM 8721 C CB  . HIS A 1 1143 ? 8.081   44.870 12.878  1.00 57.21  ? 1140 HIS A CB  1 
ATOM 8722 C CG  . HIS A 1 1143 ? 9.176   45.765 12.417  1.00 57.21  ? 1140 HIS A CG  1 
ATOM 8723 N ND1 . HIS A 1 1143 ? 10.152  45.347 11.539  1.00 57.21  ? 1140 HIS A ND1 1 
ATOM 8724 C CD2 . HIS A 1 1143 ? 9.452   47.056 12.705  1.00 57.21  ? 1140 HIS A CD2 1 
ATOM 8725 C CE1 . HIS A 1 1143 ? 10.985  46.345 11.305  1.00 57.21  ? 1140 HIS A CE1 1 
ATOM 8726 N NE2 . HIS A 1 1143 ? 10.580  47.394 11.997  1.00 57.21  ? 1140 HIS A NE2 1 
ATOM 8727 N N   . ASN B 2 1    ? 14.685  34.748 49.414  1.00 51.12  ? 86   ASN B N   1 
ATOM 8728 C CA  . ASN B 2 1    ? 14.068  33.520 48.931  1.00 51.12  ? 86   ASN B CA  1 
ATOM 8729 C C   . ASN B 2 1    ? 14.275  33.446 47.420  1.00 51.12  ? 86   ASN B C   1 
ATOM 8730 O O   . ASN B 2 1    ? 14.220  34.474 46.731  1.00 51.12  ? 86   ASN B O   1 
ATOM 8731 C CB  . ASN B 2 1    ? 12.573  33.510 49.275  1.00 78.28  ? 86   ASN B CB  1 
ATOM 8732 C CG  . ASN B 2 1    ? 11.913  32.171 48.973  1.00 78.28  ? 86   ASN B CG  1 
ATOM 8733 O OD1 . ASN B 2 1    ? 11.584  31.869 47.819  1.00 78.28  ? 86   ASN B OD1 1 
ATOM 8734 N ND2 . ASN B 2 1    ? 11.719  31.356 50.011  1.00 78.28  ? 86   ASN B ND2 1 
ATOM 8735 N N   . PHE B 2 2    ? 14.518  32.240 46.905  1.00 37.11  ? 87   PHE B N   1 
ATOM 8736 C CA  . PHE B 2 2    ? 14.649  32.064 45.472  1.00 37.11  ? 87   PHE B CA  1 
ATOM 8737 C C   . PHE B 2 2    ? 13.510  32.767 44.725  1.00 37.11  ? 87   PHE B C   1 
ATOM 8738 O O   . PHE B 2 2    ? 13.709  33.399 43.670  1.00 37.11  ? 87   PHE B O   1 
ATOM 8739 C CB  . PHE B 2 2    ? 14.622  30.587 45.101  1.00 33.09  ? 87   PHE B CB  1 
ATOM 8740 C CG  . PHE B 2 2    ? 14.635  30.377 43.635  1.00 33.09  ? 87   PHE B CG  1 
ATOM 8741 C CD1 . PHE B 2 2    ? 15.838  30.376 42.948  1.00 33.09  ? 87   PHE B CD1 1 
ATOM 8742 C CD2 . PHE B 2 2    ? 13.433  30.281 42.928  1.00 33.09  ? 87   PHE B CD2 1 
ATOM 8743 C CE1 . PHE B 2 2    ? 15.867  30.257 41.560  1.00 33.09  ? 87   PHE B CE1 1 
ATOM 8744 C CE2 . PHE B 2 2    ? 13.429  30.153 41.544  1.00 33.09  ? 87   PHE B CE2 1 
ATOM 8745 C CZ  . PHE B 2 2    ? 14.655  30.146 40.838  1.00 33.09  ? 87   PHE B CZ  1 
ATOM 8746 N N   . VAL B 2 3    ? 12.309  32.640 45.286  1.00 44.58  ? 88   VAL B N   1 
ATOM 8747 C CA  . VAL B 2 3    ? 11.081  33.067 44.621  1.00 44.58  ? 88   VAL B CA  1 
ATOM 8748 C C   . VAL B 2 3    ? 11.041  34.554 44.331  1.00 44.58  ? 88   VAL B C   1 
ATOM 8749 O O   . VAL B 2 3    ? 10.597  34.988 43.262  1.00 44.58  ? 88   VAL B O   1 
ATOM 8750 C CB  . VAL B 2 3    ? 9.864   32.644 45.433  1.00 32.39  ? 88   VAL B CB  1 
ATOM 8751 C CG1 . VAL B 2 3    ? 8.708   33.592 45.240  1.00 32.39  ? 88   VAL B CG1 1 
ATOM 8752 C CG2 . VAL B 2 3    ? 9.467   31.238 45.052  1.00 32.39  ? 88   VAL B CG2 1 
ATOM 8753 N N   . SER B 2 4    ? 11.507  35.333 45.288  1.00 40.36  ? 89   SER B N   1 
ATOM 8754 C CA  . SER B 2 4    ? 11.443  36.764 45.139  1.00 40.36  ? 89   SER B CA  1 
ATOM 8755 C C   . SER B 2 4    ? 12.728  37.253 44.474  1.00 40.36  ? 89   SER B C   1 
ATOM 8756 O O   . SER B 2 4    ? 12.827  38.431 44.039  1.00 40.36  ? 89   SER B O   1 
ATOM 8757 C CB  . SER B 2 4    ? 11.210  37.421 46.491  1.00 55.08  ? 89   SER B CB  1 
ATOM 8758 O OG  . SER B 2 4    ? 12.345  37.222 47.284  1.00 55.08  ? 89   SER B OG  1 
ATOM 8759 N N   . TRP B 2 5    ? 13.711  36.353 44.411  1.00 28.36  ? 90   TRP B N   1 
ATOM 8760 C CA  . TRP B 2 5    ? 14.931  36.641 43.698  1.00 28.36  ? 90   TRP B CA  1 
ATOM 8761 C C   . TRP B 2 5    ? 14.503  36.612 42.252  1.00 28.36  ? 90   TRP B C   1 
ATOM 8762 O O   . TRP B 2 5    ? 14.840  37.522 41.476  1.00 28.36  ? 90   TRP B O   1 
ATOM 8763 C CB  . TRP B 2 5    ? 15.995  35.586 43.961  1.00 31.13  ? 90   TRP B CB  1 
ATOM 8764 C CG  . TRP B 2 5    ? 17.161  35.633 42.984  1.00 31.13  ? 90   TRP B CG  1 
ATOM 8765 C CD1 . TRP B 2 5    ? 18.312  36.441 43.079  1.00 31.13  ? 90   TRP B CD1 1 
ATOM 8766 C CD2 . TRP B 2 5    ? 17.309  34.867 41.774  1.00 31.13  ? 90   TRP B CD2 1 
ATOM 8767 N NE1 . TRP B 2 5    ? 19.137  36.202 41.995  1.00 31.13  ? 90   TRP B NE1 1 
ATOM 8768 C CE2 . TRP B 2 5    ? 18.563  35.244 41.185  1.00 31.13  ? 90   TRP B CE2 1 
ATOM 8769 C CE3 . TRP B 2 5    ? 16.507  33.920 41.122  1.00 31.13  ? 90   TRP B CE3 1 
ATOM 8770 C CZ2 . TRP B 2 5    ? 19.033  34.694 39.980  1.00 31.13  ? 90   TRP B CZ2 1 
ATOM 8771 C CZ3 . TRP B 2 5    ? 16.975  33.356 39.899  1.00 31.13  ? 90   TRP B CZ3 1 
ATOM 8772 C CH2 . TRP B 2 5    ? 18.238  33.763 39.346  1.00 31.13  ? 90   TRP B CH2 1 
ATOM 8773 N N   . HIS B 2 6    ? 13.699  35.601 41.905  1.00 27.07  ? 91   HIS B N   1 
ATOM 8774 C CA  . HIS B 2 6    ? 13.214  35.510 40.550  1.00 27.07  ? 91   HIS B CA  1 
ATOM 8775 C C   . HIS B 2 6    ? 12.304  36.708 40.178  1.00 27.07  ? 91   HIS B C   1 
ATOM 8776 O O   . HIS B 2 6    ? 12.466  37.296 39.099  1.00 27.07  ? 91   HIS B O   1 
ATOM 8777 C CB  . HIS B 2 6    ? 12.560  34.172 40.271  1.00 37.78  ? 91   HIS B CB  1 
ATOM 8778 C CG  . HIS B 2 6    ? 12.275  33.959 38.827  1.00 37.78  ? 91   HIS B CG  1 
ATOM 8779 N ND1 . HIS B 2 6    ? 13.248  33.590 37.927  1.00 37.78  ? 91   HIS B ND1 1 
ATOM 8780 C CD2 . HIS B 2 6    ? 11.141  34.126 38.107  1.00 37.78  ? 91   HIS B CD2 1 
ATOM 8781 C CE1 . HIS B 2 6    ? 12.725  33.512 36.716  1.00 37.78  ? 91   HIS B CE1 1 
ATOM 8782 N NE2 . HIS B 2 6    ? 11.444  33.829 36.800  1.00 37.78  ? 91   HIS B NE2 1 
ATOM 8783 N N   . ALA B 2 7    ? 11.390  37.118 41.049  1.00 40.24  ? 92   ALA B N   1 
ATOM 8784 C CA  . ALA B 2 7    ? 10.568  38.265 40.680  1.00 40.24  ? 92   ALA B CA  1 
ATOM 8785 C C   . ALA B 2 7    ? 11.424  39.516 40.603  1.00 40.24  ? 92   ALA B C   1 
ATOM 8786 O O   . ALA B 2 7    ? 11.166  40.387 39.767  1.00 40.24  ? 92   ALA B O   1 
ATOM 8787 C CB  . ALA B 2 7    ? 9.366   38.460 41.603  1.00 47.58  ? 92   ALA B CB  1 
ATOM 8788 N N   . ASN B 2 8    ? 12.453  39.602 41.436  1.00 34.98  ? 93   ASN B N   1 
ATOM 8789 C CA  . ASN B 2 8    ? 13.359  40.737 41.333  1.00 34.98  ? 93   ASN B CA  1 
ATOM 8790 C C   . ASN B 2 8    ? 14.070  40.772 39.988  1.00 34.98  ? 93   ASN B C   1 
ATOM 8791 O O   . ASN B 2 8    ? 14.166  41.828 39.338  1.00 34.98  ? 93   ASN B O   1 
ATOM 8792 C CB  . ASN B 2 8    ? 14.409  40.723 42.435  1.00 45.34  ? 93   ASN B CB  1 
ATOM 8793 C CG  . ASN B 2 8    ? 13.870  41.174 43.783  1.00 45.34  ? 93   ASN B CG  1 
ATOM 8794 O OD1 . ASN B 2 8    ? 12.721  41.619 43.909  1.00 45.34  ? 93   ASN B OD1 1 
ATOM 8795 N ND2 . ASN B 2 8    ? 14.715  41.061 44.807  1.00 45.34  ? 93   ASN B ND2 1 
ATOM 8796 N N   . ARG B 2 9    ? 14.557  39.607 39.559  1.00 30.33  ? 94   ARG B N   1 
ATOM 8797 C CA  . ARG B 2 9    ? 15.343  39.513 38.320  1.00 30.33  ? 94   ARG B CA  1 
ATOM 8798 C C   . ARG B 2 9    ? 14.562  40.011 37.074  1.00 30.33  ? 94   ARG B C   1 
ATOM 8799 O O   . ARG B 2 9    ? 15.142  40.616 36.173  1.00 30.33  ? 94   ARG B O   1 
ATOM 8800 C CB  . ARG B 2 9    ? 15.827  38.081 38.133  1.00 32.22  ? 94   ARG B CB  1 
ATOM 8801 C CG  . ARG B 2 9    ? 16.997  37.892 37.205  1.00 32.22  ? 94   ARG B CG  1 
ATOM 8802 C CD  . ARG B 2 9    ? 17.443  36.456 37.408  1.00 32.22  ? 94   ARG B CD  1 
ATOM 8803 N NE  . ARG B 2 9    ? 18.207  35.819 36.336  1.00 32.22  ? 94   ARG B NE  1 
ATOM 8804 C CZ  . ARG B 2 9    ? 17.710  34.947 35.467  1.00 32.22  ? 94   ARG B CZ  1 
ATOM 8805 N NH1 . ARG B 2 9    ? 16.436  34.594 35.482  1.00 32.22  ? 94   ARG B NH1 1 
ATOM 8806 N NH2 . ARG B 2 9    ? 18.511  34.436 34.555  1.00 32.22  ? 94   ARG B NH2 1 
ATOM 8807 N N   . GLN B 2 10   ? 13.257  39.760 37.017  1.00 25.25  ? 95   GLN B N   1 
ATOM 8808 C CA  . GLN B 2 10   ? 12.514  40.152 35.807  1.00 25.25  ? 95   GLN B CA  1 
ATOM 8809 C C   . GLN B 2 10   ? 12.267  41.662 35.846  1.00 25.25  ? 95   GLN B C   1 
ATOM 8810 O O   . GLN B 2 10   ? 11.902  42.240 34.819  1.00 25.25  ? 95   GLN B O   1 
ATOM 8811 C CB  . GLN B 2 10   ? 11.180  39.414 35.642  1.00 33.44  ? 95   GLN B CB  1 
ATOM 8812 C CG  . GLN B 2 10   ? 11.242  37.960 35.871  1.00 33.44  ? 95   GLN B CG  1 
ATOM 8813 C CD  . GLN B 2 10   ? 10.134  37.216 35.137  1.00 33.44  ? 95   GLN B CD  1 
ATOM 8814 O OE1 . GLN B 2 10   ? 8.977   37.233 35.570  1.00 33.44  ? 95   GLN B OE1 1 
ATOM 8815 N NE2 . GLN B 2 10   ? 10.490  36.535 34.011  1.00 33.44  ? 95   GLN B NE2 1 
ATOM 8816 N N   . LEU B 2 11   ? 12.449  42.270 37.028  1.00 27.64  ? 96   LEU B N   1 
ATOM 8817 C CA  . LEU B 2 11   ? 12.279  43.714 37.206  1.00 27.64  ? 96   LEU B CA  1 
ATOM 8818 C C   . LEU B 2 11   ? 13.614  44.383 36.975  1.00 27.64  ? 96   LEU B C   1 
ATOM 8819 O O   . LEU B 2 11   ? 13.740  45.633 36.878  1.00 27.64  ? 96   LEU B O   1 
ATOM 8820 C CB  . LEU B 2 11   ? 11.827  44.011 38.628  1.00 19.96  ? 96   LEU B CB  1 
ATOM 8821 C CG  . LEU B 2 11   ? 10.361  43.690 38.939  1.00 19.96  ? 96   LEU B CG  1 
ATOM 8822 C CD1 . LEU B 2 11   ? 9.981   44.404 40.227  1.00 19.96  ? 96   LEU B CD1 1 
ATOM 8823 C CD2 . LEU B 2 11   ? 9.445   44.064 37.750  1.00 19.96  ? 96   LEU B CD2 1 
ATOM 8824 N N   . GLY B 2 12   ? 14.583  43.492 36.774  1.00 29.41  ? 97   GLY B N   1 
ATOM 8825 C CA  . GLY B 2 12   ? 16.002  43.757 36.803  1.00 29.41  ? 97   GLY B CA  1 
ATOM 8826 C C   . GLY B 2 12   ? 16.418  43.164 38.131  1.00 29.41  ? 97   GLY B C   1 
ATOM 8827 O O   . GLY B 2 12   ? 16.281  41.966 38.377  1.00 29.41  ? 97   GLY B O   1 
ATOM 8828 N N   . MET B 2 13   ? 16.911  44.035 38.992  1.00 63.35  ? 98   MET B N   1 
ATOM 8829 C CA  . MET B 2 13   ? 17.003  43.809 40.458  1.00 63.35  ? 98   MET B CA  1 
ATOM 8830 C C   . MET B 2 13   ? 16.105  44.192 41.671  1.00 63.35  ? 98   MET B C   1 
ATOM 8831 O O   . MET B 2 13   ? 16.183  43.510 42.702  1.00 63.35  ? 98   MET B O   1 
ATOM 8832 C CB  . MET B 2 13   ? 18.265  44.693 40.371  1.00 64.77  ? 98   MET B CB  1 
ATOM 8833 C CG  . MET B 2 13   ? 18.830  45.258 41.685  1.00 64.77  ? 98   MET B CG  1 
ATOM 8834 S SD  . MET B 2 13   ? 19.988  44.141 42.516  1.00 64.77  ? 98   MET B SD  1 
ATOM 8835 C CE  . MET B 2 13   ? 21.409  44.117 41.392  1.00 64.77  ? 98   MET B CE  1 
ATOM 8836 N N   . PRO B 2 14   ? 15.230  45.231 41.546  1.00 78.58  ? 99   PRO B N   1 
ATOM 8837 C CA  . PRO B 2 14   ? 14.637  45.985 42.693  1.00 78.58  ? 99   PRO B CA  1 
ATOM 8838 C C   . PRO B 2 14   ? 13.932  45.196 43.831  1.00 78.58  ? 99   PRO B C   1 
ATOM 8839 O O   . PRO B 2 14   ? 14.292  45.332 45.022  1.00 78.58  ? 99   PRO B O   1 
ATOM 8840 C CB  . PRO B 2 14   ? 13.611  46.920 42.028  1.00 45.91  ? 99   PRO B CB  1 
ATOM 8841 C CG  . PRO B 2 14   ? 13.921  46.936 40.644  1.00 45.91  ? 99   PRO B CG  1 
ATOM 8842 C CD  . PRO B 2 14   ? 14.687  45.712 40.266  1.00 45.91  ? 99   PRO B CD  1 
ATOM 8843 O OXT . PRO B 2 14   ? 12.968  44.442 43.606  1.00 95.90  ? 99   PRO B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    GLY 1    -2   ?    ?   ?   A . n 
A 1 2    SER 2    -1   ?    ?   ?   A . n 
A 1 3    HIS 3    0    ?    ?   ?   A . n 
A 1 4    MET 4    1    1    MET MET A . n 
A 1 5    SER 5    2    2    SER SER A . n 
A 1 6    TYR 6    3    3    TYR TYR A . n 
A 1 7    ASN 7    4    4    ASN ASN A . n 
A 1 8    TYR 8    5    5    TYR TYR A . n 
A 1 9    VAL 9    6    6    VAL VAL A . n 
A 1 10   VAL 10   7    7    VAL VAL A . n 
A 1 11   THR 11   8    8    THR THR A . n 
A 1 12   ALA 12   9    9    ALA ALA A . n 
A 1 13   GLN 13   10   10   GLN GLN A . n 
A 1 14   LYS 14   11   11   LYS LYS A . n 
A 1 15   PRO 15   12   12   PRO PRO A . n 
A 1 16   THR 16   13   13   THR THR A . n 
A 1 17   ALA 17   14   14   ALA ALA A . n 
A 1 18   VAL 18   15   15   VAL VAL A . n 
A 1 19   ASN 19   16   16   ASN ASN A . n 
A 1 20   GLY 20   17   17   GLY GLY A . n 
A 1 21   CYS 21   18   18   CYS CYS A . n 
A 1 22   VAL 22   19   19   VAL VAL A . n 
A 1 23   THR 23   20   20   THR THR A . n 
A 1 24   GLY 24   21   21   GLY GLY A . n 
A 1 25   HIS 25   22   22   HIS HIS A . n 
A 1 26   PHE 26   23   23   PHE PHE A . n 
A 1 27   THR 27   24   24   THR THR A . n 
A 1 28   SER 28   25   25   SER SER A . n 
A 1 29   ALA 29   26   26   ALA ALA A . n 
A 1 30   GLU 30   27   27   GLU GLU A . n 
A 1 31   ASP 31   28   28   ASP ASP A . n 
A 1 32   LEU 32   29   29   LEU LEU A . n 
A 1 33   ASN 33   30   30   ASN ASN A . n 
A 1 34   LEU 34   31   31   LEU LEU A . n 
A 1 35   LEU 35   32   32   LEU LEU A . n 
A 1 36   ILE 36   33   33   ILE ILE A . n 
A 1 37   ALA 37   34   34   ALA ALA A . n 
A 1 38   LYS 38   35   35   LYS LYS A . n 
A 1 39   ASN 39   36   36   ASN ASN A . n 
A 1 40   THR 40   37   37   THR THR A . n 
A 1 41   ARG 41   38   38   ARG ARG A . n 
A 1 42   LEU 42   39   39   LEU LEU A . n 
A 1 43   GLU 43   40   40   GLU GLU A . n 
A 1 44   ILE 44   41   41   ILE ILE A . n 
A 1 45   TYR 45   42   42   TYR TYR A . n 
A 1 46   VAL 46   43   43   VAL VAL A . n 
A 1 47   VAL 47   44   44   VAL VAL A . n 
A 1 48   THR 48   45   45   THR THR A . n 
A 1 49   ALA 49   46   46   ALA ALA A . n 
A 1 50   GLU 50   47   47   GLU GLU A . n 
A 1 51   GLY 51   48   48   GLY GLY A . n 
A 1 52   LEU 52   49   49   LEU LEU A . n 
A 1 53   ARG 53   50   50   ARG ARG A . n 
A 1 54   PRO 54   51   51   PRO PRO A . n 
A 1 55   VAL 55   52   52   VAL VAL A . n 
A 1 56   LYS 56   53   53   LYS LYS A . n 
A 1 57   GLU 57   54   54   GLU GLU A . n 
A 1 58   VAL 58   55   55   VAL VAL A . n 
A 1 59   GLY 59   56   56   GLY GLY A . n 
A 1 60   MET 60   57   57   MET MET A . n 
A 1 61   TYR 61   58   58   TYR TYR A . n 
A 1 62   GLY 62   59   59   GLY GLY A . n 
A 1 63   LYS 63   60   60   LYS LYS A . n 
A 1 64   ILE 64   61   61   ILE ILE A . n 
A 1 65   ALA 65   62   62   ALA ALA A . n 
A 1 66   VAL 66   63   63   VAL VAL A . n 
A 1 67   MET 67   64   64   MET MET A . n 
A 1 68   GLU 68   65   65   GLU GLU A . n 
A 1 69   LEU 69   66   66   LEU LEU A . n 
A 1 70   PHE 70   67   67   PHE PHE A . n 
A 1 71   ARG 71   68   68   ARG ARG A . n 
A 1 72   PRO 72   69   69   PRO PRO A . n 
A 1 73   LYS 73   70   70   LYS LYS A . n 
A 1 74   GLY 74   71   71   GLY GLY A . n 
A 1 75   GLU 75   72   72   GLU GLU A . n 
A 1 76   SER 76   73   73   SER SER A . n 
A 1 77   LYS 77   74   74   LYS LYS A . n 
A 1 78   ASP 78   75   75   ASP ASP A . n 
A 1 79   LEU 79   76   76   LEU LEU A . n 
A 1 80   LEU 80   77   77   LEU LEU A . n 
A 1 81   PHE 81   78   78   PHE PHE A . n 
A 1 82   ILE 82   79   79   ILE ILE A . n 
A 1 83   LEU 83   80   80   LEU LEU A . n 
A 1 84   THR 84   81   81   THR THR A . n 
A 1 85   ALA 85   82   82   ALA ALA A . n 
A 1 86   LYS 86   83   83   LYS LYS A . n 
A 1 87   TYR 87   84   84   TYR TYR A . n 
A 1 88   ASN 88   85   85   ASN ASN A . n 
A 1 89   ALA 89   86   86   ALA ALA A . n 
A 1 90   CYS 90   87   87   CYS CYS A . n 
A 1 91   ILE 91   88   88   ILE ILE A . n 
A 1 92   LEU 92   89   89   LEU LEU A . n 
A 1 93   GLU 93   90   90   GLU GLU A . n 
A 1 94   TYR 94   91   91   TYR TYR A . n 
A 1 95   LYS 95   92   92   LYS LYS A . n 
A 1 96   GLN 96   93   93   GLN GLN A . n 
A 1 97   SER 97   94   94   SER SER A . n 
A 1 98   GLY 98   95   95   GLY GLY A . n 
A 1 99   GLU 99   96   96   GLU GLU A . n 
A 1 100  SER 100  97   97   SER SER A . n 
A 1 101  ILE 101  98   98   ILE ILE A . n 
A 1 102  ASP 102  99   99   ASP ASP A . n 
A 1 103  ILE 103  100  100  ILE ILE A . n 
A 1 104  ILE 104  101  101  ILE ILE A . n 
A 1 105  THR 105  102  102  THR THR A . n 
A 1 106  ARG 106  103  103  ARG ARG A . n 
A 1 107  ALA 107  104  104  ALA ALA A . n 
A 1 108  HIS 108  105  105  HIS HIS A . n 
A 1 109  GLY 109  106  106  GLY GLY A . n 
A 1 110  ASN 110  107  107  ASN ASN A . n 
A 1 111  VAL 111  108  108  VAL VAL A . n 
A 1 112  GLN 112  109  109  GLN GLN A . n 
A 1 113  ASP 113  110  110  ASP ASP A . n 
A 1 114  ARG 114  111  111  ARG ARG A . n 
A 1 115  ILE 115  112  112  ILE ILE A . n 
A 1 116  GLY 116  113  113  GLY GLY A . n 
A 1 117  ARG 117  114  114  ARG ARG A . n 
A 1 118  PRO 118  115  115  PRO PRO A . n 
A 1 119  SER 119  116  116  SER SER A . n 
A 1 120  GLU 120  117  117  GLU GLU A . n 
A 1 121  THR 121  118  118  THR THR A . n 
A 1 122  GLY 122  119  119  GLY GLY A . n 
A 1 123  ILE 123  120  120  ILE ILE A . n 
A 1 124  ILE 124  121  121  ILE ILE A . n 
A 1 125  GLY 125  122  122  GLY GLY A . n 
A 1 126  ILE 126  123  123  ILE ILE A . n 
A 1 127  ILE 127  124  124  ILE ILE A . n 
A 1 128  ASP 128  125  125  ASP ASP A . n 
A 1 129  PRO 129  126  126  PRO PRO A . n 
A 1 130  GLU 130  127  127  GLU GLU A . n 
A 1 131  CYS 131  128  128  CYS CYS A . n 
A 1 132  ARG 132  129  129  ARG ARG A . n 
A 1 133  MET 133  130  130  MET MET A . n 
A 1 134  ILE 134  131  131  ILE ILE A . n 
A 1 135  GLY 135  132  132  GLY GLY A . n 
A 1 136  LEU 136  133  133  LEU LEU A . n 
A 1 137  ARG 137  134  134  ARG ARG A . n 
A 1 138  LEU 138  135  135  LEU LEU A . n 
A 1 139  TYR 139  136  136  TYR TYR A . n 
A 1 140  ASP 140  137  137  ASP ASP A . n 
A 1 141  GLY 141  138  138  GLY GLY A . n 
A 1 142  LEU 142  139  139  LEU LEU A . n 
A 1 143  PHE 143  140  140  PHE PHE A . n 
A 1 144  LYS 144  141  141  LYS LYS A . n 
A 1 145  VAL 145  142  142  VAL VAL A . n 
A 1 146  ILE 146  143  143  ILE ILE A . n 
A 1 147  PRO 147  144  144  PRO PRO A . n 
A 1 148  LEU 148  145  145  LEU LEU A . n 
A 1 149  ASP 149  146  146  ASP ASP A . n 
A 1 150  ARG 150  147  147  ARG ARG A . n 
A 1 151  ASP 151  148  148  ASP ASP A . n 
A 1 152  ASN 152  149  149  ASN ASN A . n 
A 1 153  LYS 153  150  150  LYS LYS A . n 
A 1 154  GLU 154  151  151  GLU GLU A . n 
A 1 155  LEU 155  152  152  LEU LEU A . n 
A 1 156  LYS 156  153  153  LYS LYS A . n 
A 1 157  ALA 157  154  154  ALA ALA A . n 
A 1 158  PHE 158  155  155  PHE PHE A . n 
A 1 159  ASN 159  156  156  ASN ASN A . n 
A 1 160  ILE 160  157  157  ILE ILE A . n 
A 1 161  ARG 161  158  158  ARG ARG A . n 
A 1 162  LEU 162  159  159  LEU LEU A . n 
A 1 163  GLU 163  160  160  GLU GLU A . n 
A 1 164  GLU 164  161  161  GLU GLU A . n 
A 1 165  LEU 165  162  162  LEU LEU A . n 
A 1 166  HIS 166  163  163  HIS HIS A . n 
A 1 167  VAL 167  164  164  VAL VAL A . n 
A 1 168  ILE 168  165  165  ILE ILE A . n 
A 1 169  ASP 169  166  166  ASP ASP A . n 
A 1 170  VAL 170  167  167  VAL VAL A . n 
A 1 171  LYS 171  168  168  LYS LYS A . n 
A 1 172  PHE 172  169  169  PHE PHE A . n 
A 1 173  LEU 173  170  170  LEU LEU A . n 
A 1 174  TYR 174  171  171  TYR TYR A . n 
A 1 175  GLY 175  172  172  GLY GLY A . n 
A 1 176  CYS 176  173  173  CYS CYS A . n 
A 1 177  GLN 177  174  174  GLN GLN A . n 
A 1 178  ALA 178  175  175  ALA ALA A . n 
A 1 179  PRO 179  176  176  PRO PRO A . n 
A 1 180  THR 180  177  177  THR THR A . n 
A 1 181  ILE 181  178  178  ILE ILE A . n 
A 1 182  CYS 182  179  179  CYS CYS A . n 
A 1 183  PHE 183  180  180  PHE PHE A . n 
A 1 184  VAL 184  181  181  VAL VAL A . n 
A 1 185  TYR 185  182  182  TYR TYR A . n 
A 1 186  GLN 186  183  183  GLN GLN A . n 
A 1 187  ASP 187  184  184  ASP ASP A . n 
A 1 188  PRO 188  185  185  PRO PRO A . n 
A 1 189  GLN 189  186  186  GLN GLN A . n 
A 1 190  GLY 190  187  187  GLY GLY A . n 
A 1 191  ARG 191  188  188  ARG ARG A . n 
A 1 192  HIS 192  189  189  HIS HIS A . n 
A 1 193  VAL 193  190  190  VAL VAL A . n 
A 1 194  LYS 194  191  191  LYS LYS A . n 
A 1 195  THR 195  192  192  THR THR A . n 
A 1 196  TYR 196  193  193  TYR TYR A . n 
A 1 197  GLU 197  194  194  GLU GLU A . n 
A 1 198  VAL 198  195  195  VAL VAL A . n 
A 1 199  SER 199  196  196  SER SER A . n 
A 1 200  LEU 200  197  197  LEU LEU A . n 
A 1 201  ARG 201  198  198  ARG ARG A . n 
A 1 202  GLU 202  199  199  GLU GLU A . n 
A 1 203  LYS 203  200  200  LYS LYS A . n 
A 1 204  GLU 204  201  201  GLU GLU A . n 
A 1 205  PHE 205  202  202  PHE PHE A . n 
A 1 206  ASN 206  203  203  ASN ASN A . n 
A 1 207  LYS 207  204  204  LYS LYS A . n 
A 1 208  GLY 208  205  205  GLY GLY A . n 
A 1 209  PRO 209  206  206  PRO PRO A . n 
A 1 210  TRP 210  207  207  TRP TRP A . n 
A 1 211  LYS 211  208  208  LYS LYS A . n 
A 1 212  GLN 212  209  209  GLN GLN A . n 
A 1 213  GLU 213  210  210  GLU GLU A . n 
A 1 214  ASN 214  211  211  ASN ASN A . n 
A 1 215  VAL 215  212  212  VAL VAL A . n 
A 1 216  GLU 216  213  213  GLU GLU A . n 
A 1 217  ALA 217  214  214  ALA ALA A . n 
A 1 218  GLU 218  215  215  GLU GLU A . n 
A 1 219  ALA 219  216  216  ALA ALA A . n 
A 1 220  SER 220  217  217  SER SER A . n 
A 1 221  MET 221  218  218  MET MET A . n 
A 1 222  VAL 222  219  219  VAL VAL A . n 
A 1 223  ILE 223  220  220  ILE ILE A . n 
A 1 224  ALA 224  221  221  ALA ALA A . n 
A 1 225  VAL 225  222  222  VAL VAL A . n 
A 1 226  PRO 226  223  223  PRO PRO A . n 
A 1 227  GLU 227  224  224  GLU GLU A . n 
A 1 228  PRO 228  225  225  PRO PRO A . n 
A 1 229  PHE 229  226  226  PHE PHE A . n 
A 1 230  GLY 230  227  227  GLY GLY A . n 
A 1 231  GLY 231  228  228  GLY GLY A . n 
A 1 232  ALA 232  229  229  ALA ALA A . n 
A 1 233  ILE 233  230  230  ILE ILE A . n 
A 1 234  ILE 234  231  231  ILE ILE A . n 
A 1 235  ILE 235  232  232  ILE ILE A . n 
A 1 236  GLY 236  233  233  GLY GLY A . n 
A 1 237  GLN 237  234  234  GLN GLN A . n 
A 1 238  GLU 238  235  235  GLU GLU A . n 
A 1 239  SER 239  236  236  SER SER A . n 
A 1 240  ILE 240  237  237  ILE ILE A . n 
A 1 241  THR 241  238  238  THR THR A . n 
A 1 242  TYR 242  239  239  TYR TYR A . n 
A 1 243  HIS 243  240  240  HIS HIS A . n 
A 1 244  ASN 244  241  241  ASN ASN A . n 
A 1 245  GLY 245  242  242  GLY GLY A . n 
A 1 246  ASP 246  243  243  ASP ASP A . n 
A 1 247  LYS 247  244  244  LYS LYS A . n 
A 1 248  TYR 248  245  245  TYR TYR A . n 
A 1 249  LEU 249  246  246  LEU LEU A . n 
A 1 250  ALA 250  247  247  ALA ALA A . n 
A 1 251  ILE 251  248  248  ILE ILE A . n 
A 1 252  ALA 252  249  249  ALA ALA A . n 
A 1 253  PRO 253  250  250  PRO PRO A . n 
A 1 254  PRO 254  251  251  PRO PRO A . n 
A 1 255  ILE 255  252  252  ILE ILE A . n 
A 1 256  ILE 256  253  253  ILE ILE A . n 
A 1 257  LYS 257  254  254  LYS LYS A . n 
A 1 258  GLN 258  255  255  GLN GLN A . n 
A 1 259  SER 259  256  256  SER SER A . n 
A 1 260  THR 260  257  257  THR THR A . n 
A 1 261  ILE 261  258  258  ILE ILE A . n 
A 1 262  VAL 262  259  259  VAL VAL A . n 
A 1 263  CYS 263  260  260  CYS CYS A . n 
A 1 264  HIS 264  261  261  HIS HIS A . n 
A 1 265  ASN 265  262  262  ASN ASN A . n 
A 1 266  ARG 266  263  263  ARG ARG A . n 
A 1 267  VAL 267  264  264  VAL VAL A . n 
A 1 268  ASP 268  265  265  ASP ASP A . n 
A 1 269  PRO 269  266  266  PRO PRO A . n 
A 1 270  ASN 270  267  267  ASN ASN A . n 
A 1 271  GLY 271  268  268  GLY GLY A . n 
A 1 272  SER 272  269  269  SER SER A . n 
A 1 273  ARG 273  270  270  ARG ARG A . n 
A 1 274  TYR 274  271  271  TYR TYR A . n 
A 1 275  LEU 275  272  272  LEU LEU A . n 
A 1 276  LEU 276  273  273  LEU LEU A . n 
A 1 277  GLY 277  274  274  GLY GLY A . n 
A 1 278  ASP 278  275  275  ASP ASP A . n 
A 1 279  MET 279  276  276  MET MET A . n 
A 1 280  GLU 280  277  277  GLU GLU A . n 
A 1 281  GLY 281  278  278  GLY GLY A . n 
A 1 282  ARG 282  279  279  ARG ARG A . n 
A 1 283  LEU 283  280  280  LEU LEU A . n 
A 1 284  PHE 284  281  281  PHE PHE A . n 
A 1 285  MET 285  282  282  MET MET A . n 
A 1 286  LEU 286  283  283  LEU LEU A . n 
A 1 287  LEU 287  284  284  LEU LEU A . n 
A 1 288  LEU 288  285  285  LEU LEU A . n 
A 1 289  GLU 289  286  286  GLU GLU A . n 
A 1 290  LYS 290  287  287  LYS LYS A . n 
A 1 291  GLU 291  288  288  GLU GLU A . n 
A 1 292  GLU 292  289  289  GLU GLU A . n 
A 1 293  GLN 293  290  290  GLN GLN A . n 
A 1 294  MET 294  291  291  MET MET A . n 
A 1 295  ASP 295  292  292  ASP ASP A . n 
A 1 296  GLY 296  293  293  GLY GLY A . n 
A 1 297  THR 297  294  294  THR THR A . n 
A 1 298  VAL 298  295  295  VAL VAL A . n 
A 1 299  THR 299  296  296  THR THR A . n 
A 1 300  LEU 300  297  297  LEU LEU A . n 
A 1 301  LYS 301  298  298  LYS LYS A . n 
A 1 302  ASP 302  299  299  ASP ASP A . n 
A 1 303  LEU 303  300  300  LEU LEU A . n 
A 1 304  ARG 304  301  301  ARG ARG A . n 
A 1 305  VAL 305  302  302  VAL VAL A . n 
A 1 306  GLU 306  303  303  GLU GLU A . n 
A 1 307  LEU 307  304  304  LEU LEU A . n 
A 1 308  LEU 308  305  305  LEU LEU A . n 
A 1 309  GLY 309  306  306  GLY GLY A . n 
A 1 310  GLU 310  307  307  GLU GLU A . n 
A 1 311  THR 311  308  308  THR THR A . n 
A 1 312  SER 312  309  309  SER SER A . n 
A 1 313  ILE 313  310  310  ILE ILE A . n 
A 1 314  ALA 314  311  311  ALA ALA A . n 
A 1 315  GLU 315  312  312  GLU GLU A . n 
A 1 316  CYS 316  313  313  CYS CYS A . n 
A 1 317  LEU 317  314  314  LEU LEU A . n 
A 1 318  THR 318  315  315  THR THR A . n 
A 1 319  TYR 319  316  316  TYR TYR A . n 
A 1 320  LEU 320  317  317  LEU LEU A . n 
A 1 321  ASP 321  318  318  ASP ASP A . n 
A 1 322  ASN 322  319  319  ASN ASN A . n 
A 1 323  GLY 323  320  320  GLY GLY A . n 
A 1 324  VAL 324  321  321  VAL VAL A . n 
A 1 325  VAL 325  322  322  VAL VAL A . n 
A 1 326  PHE 326  323  323  PHE PHE A . n 
A 1 327  VAL 327  324  324  VAL VAL A . n 
A 1 328  GLY 328  325  325  GLY GLY A . n 
A 1 329  SER 329  326  326  SER SER A . n 
A 1 330  ARG 330  327  327  ARG ARG A . n 
A 1 331  LEU 331  328  328  LEU LEU A . n 
A 1 332  GLY 332  329  329  GLY GLY A . n 
A 1 333  ASP 333  330  330  ASP ASP A . n 
A 1 334  SER 334  331  331  SER SER A . n 
A 1 335  GLN 335  332  332  GLN GLN A . n 
A 1 336  LEU 336  333  333  LEU LEU A . n 
A 1 337  VAL 337  334  334  VAL VAL A . n 
A 1 338  LYS 338  335  335  LYS LYS A . n 
A 1 339  LEU 339  336  336  LEU LEU A . n 
A 1 340  ASN 340  337  337  ASN ASN A . n 
A 1 341  VAL 341  338  338  VAL VAL A . n 
A 1 342  ASP 342  339  339  ASP ASP A . n 
A 1 343  SER 343  340  340  SER SER A . n 
A 1 344  ASN 344  341  341  ASN ASN A . n 
A 1 345  GLU 345  342  342  GLU GLU A . n 
A 1 346  GLN 346  343  343  GLN GLN A . n 
A 1 347  GLY 347  344  344  GLY GLY A . n 
A 1 348  SER 348  345  345  SER SER A . n 
A 1 349  TYR 349  346  346  TYR TYR A . n 
A 1 350  VAL 350  347  347  VAL VAL A . n 
A 1 351  VAL 351  348  348  VAL VAL A . n 
A 1 352  ALA 352  349  349  ALA ALA A . n 
A 1 353  MET 353  350  350  MET MET A . n 
A 1 354  GLU 354  351  351  GLU GLU A . n 
A 1 355  THR 355  352  352  THR THR A . n 
A 1 356  PHE 356  353  353  PHE PHE A . n 
A 1 357  THR 357  354  354  THR THR A . n 
A 1 358  ASN 358  355  355  ASN ASN A . n 
A 1 359  LEU 359  356  356  LEU LEU A . n 
A 1 360  GLY 360  357  357  GLY GLY A . n 
A 1 361  PRO 361  358  358  PRO PRO A . n 
A 1 362  ILE 362  359  359  ILE ILE A . n 
A 1 363  VAL 363  360  360  VAL VAL A . n 
A 1 364  ASP 364  361  361  ASP ASP A . n 
A 1 365  MET 365  362  362  MET MET A . n 
A 1 366  CYS 366  363  363  CYS CYS A . n 
A 1 367  VAL 367  364  364  VAL VAL A . n 
A 1 368  VAL 368  365  365  VAL VAL A . n 
A 1 369  ASP 369  366  366  ASP ASP A . n 
A 1 370  LEU 370  367  367  LEU LEU A . n 
A 1 371  GLU 371  368  368  GLU GLU A . n 
A 1 372  ARG 372  369  369  ARG ARG A . n 
A 1 373  GLN 373  370  370  GLN GLN A . n 
A 1 374  GLY 374  371  371  GLY GLY A . n 
A 1 375  GLN 375  372  372  GLN GLN A . n 
A 1 376  GLY 376  373  373  GLY GLY A . n 
A 1 377  GLN 377  374  374  GLN GLN A . n 
A 1 378  LEU 378  375  375  LEU LEU A . n 
A 1 379  VAL 379  376  376  VAL VAL A . n 
A 1 380  THR 380  377  377  THR THR A . n 
A 1 381  CYS 381  378  378  CYS CYS A . n 
A 1 382  SER 382  379  379  SER SER A . n 
A 1 383  GLY 383  380  380  GLY GLY A . n 
A 1 384  ALA 384  381  381  ALA ALA A . n 
A 1 385  PHE 385  382  382  PHE PHE A . n 
A 1 386  LYS 386  383  383  LYS LYS A . n 
A 1 387  GLU 387  384  384  GLU GLU A . n 
A 1 388  GLY 388  385  385  GLY GLY A . n 
A 1 389  SER 389  386  386  SER SER A . n 
A 1 390  LEU 390  387  387  LEU LEU A . n 
A 1 391  ARG 391  388  388  ARG ARG A . n 
A 1 392  ILE 392  389  389  ILE ILE A . n 
A 1 393  ILE 393  390  390  ILE ILE A . n 
A 1 394  ARG 394  391  391  ARG ARG A . n 
A 1 395  ASN 395  392  392  ASN ASN A . n 
A 1 396  GLY 396  393  393  GLY GLY A . n 
A 1 397  ILE 397  394  394  ILE ILE A . n 
A 1 398  GLY 398  395  395  GLY GLY A . n 
A 1 399  ILE 399  396  396  ILE ILE A . n 
A 1 400  HIS 400  397  397  HIS HIS A . n 
A 1 401  GLU 401  398  398  GLU GLU A . n 
A 1 402  HIS 402  399  399  HIS HIS A . n 
A 1 403  ALA 403  400  400  ALA ALA A . n 
A 1 404  SER 404  401  401  SER SER A . n 
A 1 405  ILE 405  402  402  ILE ILE A . n 
A 1 406  ASP 406  403  403  ASP ASP A . n 
A 1 407  LEU 407  404  404  LEU LEU A . n 
A 1 408  PRO 408  405  405  PRO PRO A . n 
A 1 409  GLY 409  406  406  GLY GLY A . n 
A 1 410  ILE 410  407  407  ILE ILE A . n 
A 1 411  LYS 411  408  408  LYS LYS A . n 
A 1 412  GLY 412  409  409  GLY GLY A . n 
A 1 413  LEU 413  410  410  LEU LEU A . n 
A 1 414  TRP 414  411  411  TRP TRP A . n 
A 1 415  PRO 415  412  412  PRO PRO A . n 
A 1 416  LEU 416  413  413  LEU LEU A . n 
A 1 417  ARG 417  414  414  ARG ARG A . n 
A 1 418  SER 418  415  415  SER SER A . n 
A 1 419  ASP 419  416  416  ASP ASP A . n 
A 1 420  PRO 420  417  417  PRO PRO A . n 
A 1 421  ASN 421  418  418  ASN ASN A . n 
A 1 422  ARG 422  419  419  ARG ARG A . n 
A 1 423  GLU 423  420  420  GLU GLU A . n 
A 1 424  THR 424  421  421  THR THR A . n 
A 1 425  TYR 425  422  422  TYR TYR A . n 
A 1 426  ASP 426  423  423  ASP ASP A . n 
A 1 427  THR 427  424  424  THR THR A . n 
A 1 428  LEU 428  425  425  LEU LEU A . n 
A 1 429  VAL 429  426  426  VAL VAL A . n 
A 1 430  LEU 430  427  427  LEU LEU A . n 
A 1 431  SER 431  428  428  SER SER A . n 
A 1 432  PHE 432  429  429  PHE PHE A . n 
A 1 433  VAL 433  430  430  VAL VAL A . n 
A 1 434  GLY 434  431  431  GLY GLY A . n 
A 1 435  GLN 435  432  432  GLN GLN A . n 
A 1 436  THR 436  433  433  THR THR A . n 
A 1 437  ARG 437  434  434  ARG ARG A . n 
A 1 438  VAL 438  435  435  VAL VAL A . n 
A 1 439  LEU 439  436  436  LEU LEU A . n 
A 1 440  MET 440  437  437  MET MET A . n 
A 1 441  LEU 441  438  438  LEU LEU A . n 
A 1 442  ASN 442  439  439  ASN ASN A . n 
A 1 443  GLY 443  440  440  GLY GLY A . n 
A 1 444  GLU 444  441  441  GLU GLU A . n 
A 1 445  GLU 445  442  442  GLU GLU A . n 
A 1 446  VAL 446  443  443  VAL VAL A . n 
A 1 447  GLU 447  444  444  GLU GLU A . n 
A 1 448  GLU 448  445  445  GLU GLU A . n 
A 1 449  THR 449  446  446  THR THR A . n 
A 1 450  GLU 450  447  447  GLU GLU A . n 
A 1 451  LEU 451  448  448  LEU LEU A . n 
A 1 452  MET 452  449  449  MET MET A . n 
A 1 453  GLY 453  450  450  GLY GLY A . n 
A 1 454  PHE 454  451  451  PHE PHE A . n 
A 1 455  VAL 455  452  452  VAL VAL A . n 
A 1 456  ASP 456  453  453  ASP ASP A . n 
A 1 457  ASP 457  454  454  ASP ASP A . n 
A 1 458  GLN 458  455  455  GLN GLN A . n 
A 1 459  GLN 459  456  456  GLN GLN A . n 
A 1 460  THR 460  457  457  THR THR A . n 
A 1 461  PHE 461  458  458  PHE PHE A . n 
A 1 462  PHE 462  459  459  PHE PHE A . n 
A 1 463  CYS 463  460  460  CYS CYS A . n 
A 1 464  GLY 464  461  461  GLY GLY A . n 
A 1 465  ASN 465  462  462  ASN ASN A . n 
A 1 466  VAL 466  463  463  VAL VAL A . n 
A 1 467  ALA 467  464  464  ALA ALA A . n 
A 1 468  HIS 468  465  465  HIS HIS A . n 
A 1 469  GLN 469  466  466  GLN GLN A . n 
A 1 470  GLN 470  467  467  GLN GLN A . n 
A 1 471  LEU 471  468  468  LEU LEU A . n 
A 1 472  ILE 472  469  469  ILE ILE A . n 
A 1 473  GLN 473  470  470  GLN GLN A . n 
A 1 474  ILE 474  471  471  ILE ILE A . n 
A 1 475  THR 475  472  472  THR THR A . n 
A 1 476  SER 476  473  473  SER SER A . n 
A 1 477  ALA 477  474  474  ALA ALA A . n 
A 1 478  SER 478  475  475  SER SER A . n 
A 1 479  VAL 479  476  476  VAL VAL A . n 
A 1 480  ARG 480  477  477  ARG ARG A . n 
A 1 481  LEU 481  478  478  LEU LEU A . n 
A 1 482  VAL 482  479  479  VAL VAL A . n 
A 1 483  SER 483  480  480  SER SER A . n 
A 1 484  GLN 484  481  481  GLN GLN A . n 
A 1 485  GLU 485  482  482  GLU GLU A . n 
A 1 486  PRO 486  483  483  PRO PRO A . n 
A 1 487  LYS 487  484  484  LYS LYS A . n 
A 1 488  ALA 488  485  485  ALA ALA A . n 
A 1 489  LEU 489  486  486  LEU LEU A . n 
A 1 490  VAL 490  487  487  VAL VAL A . n 
A 1 491  SER 491  488  488  SER SER A . n 
A 1 492  GLU 492  489  489  GLU GLU A . n 
A 1 493  TRP 493  490  490  TRP TRP A . n 
A 1 494  LYS 494  491  491  LYS LYS A . n 
A 1 495  GLU 495  492  492  GLU GLU A . n 
A 1 496  PRO 496  493  493  PRO PRO A . n 
A 1 497  GLN 497  494  494  GLN GLN A . n 
A 1 498  ALA 498  495  495  ALA ALA A . n 
A 1 499  LYS 499  496  496  LYS LYS A . n 
A 1 500  ASN 500  497  497  ASN ASN A . n 
A 1 501  ILE 501  498  498  ILE ILE A . n 
A 1 502  SER 502  499  499  SER SER A . n 
A 1 503  VAL 503  500  500  VAL VAL A . n 
A 1 504  ALA 504  501  501  ALA ALA A . n 
A 1 505  SER 505  502  502  SER SER A . n 
A 1 506  CYS 506  503  503  CYS CYS A . n 
A 1 507  ASN 507  504  504  ASN ASN A . n 
A 1 508  SER 508  505  505  SER SER A . n 
A 1 509  SER 509  506  506  SER SER A . n 
A 1 510  GLN 510  507  507  GLN GLN A . n 
A 1 511  VAL 511  508  508  VAL VAL A . n 
A 1 512  VAL 512  509  509  VAL VAL A . n 
A 1 513  VAL 513  510  510  VAL VAL A . n 
A 1 514  ALA 514  511  511  ALA ALA A . n 
A 1 515  VAL 515  512  512  VAL VAL A . n 
A 1 516  GLY 516  513  513  GLY GLY A . n 
A 1 517  ARG 517  514  514  ARG ARG A . n 
A 1 518  ALA 518  515  515  ALA ALA A . n 
A 1 519  LEU 519  516  516  LEU LEU A . n 
A 1 520  TYR 520  517  517  TYR TYR A . n 
A 1 521  TYR 521  518  518  TYR TYR A . n 
A 1 522  LEU 522  519  519  LEU LEU A . n 
A 1 523  GLN 523  520  520  GLN GLN A . n 
A 1 524  ILE 524  521  521  ILE ILE A . n 
A 1 525  HIS 525  522  522  HIS HIS A . n 
A 1 526  PRO 526  523  523  PRO PRO A . n 
A 1 527  GLN 527  524  524  GLN GLN A . n 
A 1 528  GLU 528  525  525  GLU GLU A . n 
A 1 529  LEU 529  526  526  LEU LEU A . n 
A 1 530  ARG 530  527  527  ARG ARG A . n 
A 1 531  GLN 531  528  528  GLN GLN A . n 
A 1 532  ILE 532  529  529  ILE ILE A . n 
A 1 533  SER 533  530  530  SER SER A . n 
A 1 534  HIS 534  531  531  HIS HIS A . n 
A 1 535  THR 535  532  532  THR THR A . n 
A 1 536  GLU 536  533  533  GLU GLU A . n 
A 1 537  MET 537  534  534  MET MET A . n 
A 1 538  GLU 538  535  535  GLU GLU A . n 
A 1 539  HIS 539  536  536  HIS HIS A . n 
A 1 540  GLU 540  537  537  GLU GLU A . n 
A 1 541  VAL 541  538  538  VAL VAL A . n 
A 1 542  ALA 542  539  539  ALA ALA A . n 
A 1 543  CYS 543  540  540  CYS CYS A . n 
A 1 544  LEU 544  541  541  LEU LEU A . n 
A 1 545  ASP 545  542  542  ASP ASP A . n 
A 1 546  ILE 546  543  543  ILE ILE A . n 
A 1 547  THR 547  544  544  THR THR A . n 
A 1 548  PRO 548  545  545  PRO PRO A . n 
A 1 549  LEU 549  546  546  LEU LEU A . n 
A 1 550  GLY 550  547  547  GLY GLY A . n 
A 1 551  ASP 551  548  548  ASP ASP A . n 
A 1 552  SER 552  549  549  SER SER A . n 
A 1 553  ASN 553  550  550  ASN ASN A . n 
A 1 554  GLY 554  551  551  GLY GLY A . n 
A 1 555  LEU 555  552  552  LEU LEU A . n 
A 1 556  SER 556  553  553  SER SER A . n 
A 1 557  PRO 557  554  554  PRO PRO A . n 
A 1 558  LEU 558  555  555  LEU LEU A . n 
A 1 559  CYS 559  556  556  CYS CYS A . n 
A 1 560  ALA 560  557  557  ALA ALA A . n 
A 1 561  ILE 561  558  558  ILE ILE A . n 
A 1 562  GLY 562  559  559  GLY GLY A . n 
A 1 563  LEU 563  560  560  LEU LEU A . n 
A 1 564  TRP 564  561  561  TRP TRP A . n 
A 1 565  THR 565  562  562  THR THR A . n 
A 1 566  ASP 566  563  563  ASP ASP A . n 
A 1 567  ILE 567  564  564  ILE ILE A . n 
A 1 568  SER 568  565  565  SER SER A . n 
A 1 569  ALA 569  566  566  ALA ALA A . n 
A 1 570  ARG 570  567  567  ARG ARG A . n 
A 1 571  ILE 571  568  568  ILE ILE A . n 
A 1 572  LEU 572  569  569  LEU LEU A . n 
A 1 573  LYS 573  570  570  LYS LYS A . n 
A 1 574  LEU 574  571  571  LEU LEU A . n 
A 1 575  PRO 575  572  572  PRO PRO A . n 
A 1 576  SER 576  573  573  SER SER A . n 
A 1 577  PHE 577  574  574  PHE PHE A . n 
A 1 578  GLU 578  575  575  GLU GLU A . n 
A 1 579  LEU 579  576  576  LEU LEU A . n 
A 1 580  LEU 580  577  577  LEU LEU A . n 
A 1 581  HIS 581  578  578  HIS HIS A . n 
A 1 582  LYS 582  579  579  LYS LYS A . n 
A 1 583  GLU 583  580  580  GLU GLU A . n 
A 1 584  MET 584  581  581  MET MET A . n 
A 1 585  LEU 585  582  582  LEU LEU A . n 
A 1 586  GLY 586  583  583  GLY GLY A . n 
A 1 587  GLY 587  584  584  GLY GLY A . n 
A 1 588  GLU 588  585  585  GLU GLU A . n 
A 1 589  ILE 589  586  586  ILE ILE A . n 
A 1 590  ILE 590  587  587  ILE ILE A . n 
A 1 591  PRO 591  588  588  PRO PRO A . n 
A 1 592  ARG 592  589  589  ARG ARG A . n 
A 1 593  SER 593  590  590  SER SER A . n 
A 1 594  ILE 594  591  591  ILE ILE A . n 
A 1 595  LEU 595  592  592  LEU LEU A . n 
A 1 596  MET 596  593  593  MET MET A . n 
A 1 597  THR 597  594  594  THR THR A . n 
A 1 598  THR 598  595  595  THR THR A . n 
A 1 599  PHE 599  596  596  PHE PHE A . n 
A 1 600  GLU 600  597  597  GLU GLU A . n 
A 1 601  SER 601  598  598  SER SER A . n 
A 1 602  SER 602  599  599  SER SER A . n 
A 1 603  HIS 603  600  600  HIS HIS A . n 
A 1 604  TYR 604  601  601  TYR TYR A . n 
A 1 605  LEU 605  602  602  LEU LEU A . n 
A 1 606  LEU 606  603  603  LEU LEU A . n 
A 1 607  CYS 607  604  604  CYS CYS A . n 
A 1 608  ALA 608  605  605  ALA ALA A . n 
A 1 609  LEU 609  606  606  LEU LEU A . n 
A 1 610  GLY 610  607  607  GLY GLY A . n 
A 1 611  ASP 611  608  608  ASP ASP A . n 
A 1 612  GLY 612  609  609  GLY GLY A . n 
A 1 613  ALA 613  610  610  ALA ALA A . n 
A 1 614  LEU 614  611  611  LEU LEU A . n 
A 1 615  PHE 615  612  612  PHE PHE A . n 
A 1 616  TYR 616  613  613  TYR TYR A . n 
A 1 617  PHE 617  614  614  PHE PHE A . n 
A 1 618  GLY 618  615  615  GLY GLY A . n 
A 1 619  LEU 619  616  616  LEU LEU A . n 
A 1 620  ASN 620  617  617  ASN ASN A . n 
A 1 621  ILE 621  618  618  ILE ILE A . n 
A 1 622  GLU 622  619  619  GLU GLU A . n 
A 1 623  THR 623  620  620  THR THR A . n 
A 1 624  GLY 624  621  621  GLY GLY A . n 
A 1 625  LEU 625  622  622  LEU LEU A . n 
A 1 626  LEU 626  623  623  LEU LEU A . n 
A 1 627  SER 627  624  624  SER SER A . n 
A 1 628  ASP 628  625  625  ASP ASP A . n 
A 1 629  ARG 629  626  626  ARG ARG A . n 
A 1 630  LYS 630  627  627  LYS LYS A . n 
A 1 631  LYS 631  628  628  LYS LYS A . n 
A 1 632  VAL 632  629  629  VAL VAL A . n 
A 1 633  THR 633  630  630  THR THR A . n 
A 1 634  LEU 634  631  631  LEU LEU A . n 
A 1 635  GLY 635  632  632  GLY GLY A . n 
A 1 636  THR 636  633  633  THR THR A . n 
A 1 637  GLN 637  634  634  GLN GLN A . n 
A 1 638  PRO 638  635  635  PRO PRO A . n 
A 1 639  THR 639  636  636  THR THR A . n 
A 1 640  VAL 640  637  637  VAL VAL A . n 
A 1 641  LEU 641  638  638  LEU LEU A . n 
A 1 642  ARG 642  639  639  ARG ARG A . n 
A 1 643  THR 643  640  640  THR THR A . n 
A 1 644  PHE 644  641  641  PHE PHE A . n 
A 1 645  ARG 645  642  642  ARG ARG A . n 
A 1 646  SER 646  643  643  SER SER A . n 
A 1 647  LEU 647  644  644  LEU LEU A . n 
A 1 648  SER 648  645  645  SER SER A . n 
A 1 649  THR 649  646  646  THR THR A . n 
A 1 650  THR 650  647  647  THR THR A . n 
A 1 651  ASN 651  648  648  ASN ASN A . n 
A 1 652  VAL 652  649  649  VAL VAL A . n 
A 1 653  PHE 653  650  650  PHE PHE A . n 
A 1 654  ALA 654  651  651  ALA ALA A . n 
A 1 655  CYS 655  652  652  CYS CYS A . n 
A 1 656  SER 656  653  653  SER SER A . n 
A 1 657  ASP 657  654  654  ASP ASP A . n 
A 1 658  ARG 658  655  655  ARG ARG A . n 
A 1 659  PRO 659  656  656  PRO PRO A . n 
A 1 660  THR 660  657  657  THR THR A . n 
A 1 661  VAL 661  658  658  VAL VAL A . n 
A 1 662  ILE 662  659  659  ILE ILE A . n 
A 1 663  TYR 663  660  660  TYR TYR A . n 
A 1 664  SER 664  661  661  SER SER A . n 
A 1 665  SER 665  662  662  SER SER A . n 
A 1 666  ASN 666  663  663  ASN ASN A . n 
A 1 667  HIS 667  664  664  HIS HIS A . n 
A 1 668  LYS 668  665  665  LYS LYS A . n 
A 1 669  LEU 669  666  666  LEU LEU A . n 
A 1 670  VAL 670  667  667  VAL VAL A . n 
A 1 671  PHE 671  668  668  PHE PHE A . n 
A 1 672  SER 672  669  669  SER SER A . n 
A 1 673  ASN 673  670  670  ASN ASN A . n 
A 1 674  VAL 674  671  671  VAL VAL A . n 
A 1 675  ASN 675  672  672  ASN ASN A . n 
A 1 676  LEU 676  673  673  LEU LEU A . n 
A 1 677  LYS 677  674  674  LYS LYS A . n 
A 1 678  GLU 678  675  675  GLU GLU A . n 
A 1 679  VAL 679  676  676  VAL VAL A . n 
A 1 680  ASN 680  677  677  ASN ASN A . n 
A 1 681  TYR 681  678  678  TYR TYR A . n 
A 1 682  MET 682  679  679  MET MET A . n 
A 1 683  CYS 683  680  680  CYS CYS A . n 
A 1 684  PRO 684  681  681  PRO PRO A . n 
A 1 685  LEU 685  682  682  LEU LEU A . n 
A 1 686  ASN 686  683  683  ASN ASN A . n 
A 1 687  SER 687  684  684  SER SER A . n 
A 1 688  ASP 688  685  685  ASP ASP A . n 
A 1 689  GLY 689  686  686  GLY GLY A . n 
A 1 690  TYR 690  687  687  TYR TYR A . n 
A 1 691  PRO 691  688  688  PRO PRO A . n 
A 1 692  ASP 692  689  689  ASP ASP A . n 
A 1 693  SER 693  690  690  SER SER A . n 
A 1 694  LEU 694  691  691  LEU LEU A . n 
A 1 695  ALA 695  692  692  ALA ALA A . n 
A 1 696  LEU 696  693  693  LEU LEU A . n 
A 1 697  ALA 697  694  694  ALA ALA A . n 
A 1 698  ASN 698  695  695  ASN ASN A . n 
A 1 699  ASN 699  696  696  ASN ASN A . n 
A 1 700  SER 700  697  697  SER SER A . n 
A 1 701  THR 701  698  698  THR THR A . n 
A 1 702  LEU 702  699  699  LEU LEU A . n 
A 1 703  THR 703  700  700  THR THR A . n 
A 1 704  ILE 704  701  701  ILE ILE A . n 
A 1 705  GLY 705  702  702  GLY GLY A . n 
A 1 706  THR 706  703  703  THR THR A . n 
A 1 707  ILE 707  704  704  ILE ILE A . n 
A 1 708  ASP 708  705  705  ASP ASP A . n 
A 1 709  GLU 709  706  706  GLU GLU A . n 
A 1 710  ILE 710  707  707  ILE ILE A . n 
A 1 711  GLN 711  708  708  GLN GLN A . n 
A 1 712  LYS 712  709  709  LYS LYS A . n 
A 1 713  LEU 713  710  710  LEU LEU A . n 
A 1 714  HIS 714  711  711  HIS HIS A . n 
A 1 715  ILE 715  712  712  ILE ILE A . n 
A 1 716  ARG 716  713  713  ARG ARG A . n 
A 1 717  THR 717  714  714  THR THR A . n 
A 1 718  VAL 718  715  715  VAL VAL A . n 
A 1 719  PRO 719  716  716  PRO PRO A . n 
A 1 720  LEU 720  717  717  LEU LEU A . n 
A 1 721  TYR 721  718  718  TYR TYR A . n 
A 1 722  GLU 722  719  719  GLU GLU A . n 
A 1 723  SER 723  720  720  SER SER A . n 
A 1 724  PRO 724  721  721  PRO PRO A . n 
A 1 725  ARG 725  722  722  ARG ARG A . n 
A 1 726  LYS 726  723  723  LYS LYS A . n 
A 1 727  ILE 727  724  724  ILE ILE A . n 
A 1 728  CYS 728  725  725  CYS CYS A . n 
A 1 729  TYR 729  726  726  TYR TYR A . n 
A 1 730  GLN 730  727  727  GLN GLN A . n 
A 1 731  GLU 731  728  728  GLU GLU A . n 
A 1 732  VAL 732  729  729  VAL VAL A . n 
A 1 733  SER 733  730  730  SER SER A . n 
A 1 734  GLN 734  731  731  GLN GLN A . n 
A 1 735  CYS 735  732  732  CYS CYS A . n 
A 1 736  PHE 736  733  733  PHE PHE A . n 
A 1 737  GLY 737  734  734  GLY GLY A . n 
A 1 738  VAL 738  735  735  VAL VAL A . n 
A 1 739  LEU 739  736  736  LEU LEU A . n 
A 1 740  SER 740  737  737  SER SER A . n 
A 1 741  SER 741  738  738  SER SER A . n 
A 1 742  ARG 742  739  739  ARG ARG A . n 
A 1 743  ILE 743  740  740  ILE ILE A . n 
A 1 744  GLU 744  741  741  GLU GLU A . n 
A 1 745  VAL 745  742  742  VAL VAL A . n 
A 1 746  GLN 746  743  743  GLN GLN A . n 
A 1 747  ASP 747  744  744  ASP ASP A . n 
A 1 748  THR 748  745  745  THR THR A . n 
A 1 749  SER 749  746  746  SER SER A . n 
A 1 750  GLY 750  747  747  GLY GLY A . n 
A 1 751  GLY 751  748  748  GLY GLY A . n 
A 1 752  THR 752  749  749  THR THR A . n 
A 1 753  THR 753  750  750  THR THR A . n 
A 1 754  ALA 754  751  751  ALA ALA A . n 
A 1 755  LEU 755  752  752  LEU LEU A . n 
A 1 756  ARG 756  753  753  ARG ARG A . n 
A 1 757  PRO 757  754  754  PRO PRO A . n 
A 1 758  SER 758  755  755  SER SER A . n 
A 1 759  ALA 759  756  756  ALA ALA A . n 
A 1 760  SER 760  757  757  SER SER A . n 
A 1 761  THR 761  758  758  THR THR A . n 
A 1 762  GLN 762  759  759  GLN GLN A . n 
A 1 763  ALA 763  760  760  ALA ALA A . n 
A 1 764  LEU 764  761  761  LEU LEU A . n 
A 1 765  SER 765  762  762  SER SER A . n 
A 1 766  SER 766  763  763  SER SER A . n 
A 1 767  SER 767  764  764  SER SER A . n 
A 1 768  VAL 768  765  765  VAL VAL A . n 
A 1 769  SER 769  766  766  SER SER A . n 
A 1 770  SER 770  767  767  SER SER A . n 
A 1 771  SER 771  768  768  SER SER A . n 
A 1 772  LYS 772  769  769  LYS LYS A . n 
A 1 773  LEU 773  770  770  LEU LEU A . n 
A 1 774  PHE 774  771  771  PHE PHE A . n 
A 1 775  SER 775  772  772  SER SER A . n 
A 1 776  SER 776  773  773  SER SER A . n 
A 1 777  SER 777  774  ?    ?   ?   A . n 
A 1 778  THR 778  775  ?    ?   ?   A . n 
A 1 779  ALA 779  776  ?    ?   ?   A . n 
A 1 780  PRO 780  777  ?    ?   ?   A . n 
A 1 781  HIS 781  778  ?    ?   ?   A . n 
A 1 782  GLU 782  779  ?    ?   ?   A . n 
A 1 783  THR 783  780  ?    ?   ?   A . n 
A 1 784  SER 784  781  ?    ?   ?   A . n 
A 1 785  PHE 785  782  ?    ?   ?   A . n 
A 1 786  GLY 786  783  783  GLY GLY A . n 
A 1 787  GLU 787  784  784  GLU GLU A . n 
A 1 788  GLU 788  785  785  GLU GLU A . n 
A 1 789  VAL 789  786  786  VAL VAL A . n 
A 1 790  GLU 790  787  787  GLU GLU A . n 
A 1 791  VAL 791  788  788  VAL VAL A . n 
A 1 792  HIS 792  789  789  HIS HIS A . n 
A 1 793  ASN 793  790  790  ASN ASN A . n 
A 1 794  LEU 794  791  791  LEU LEU A . n 
A 1 795  LEU 795  792  792  LEU LEU A . n 
A 1 796  ILE 796  793  793  ILE ILE A . n 
A 1 797  ILE 797  794  794  ILE ILE A . n 
A 1 798  ASP 798  795  795  ASP ASP A . n 
A 1 799  GLN 799  796  796  GLN GLN A . n 
A 1 800  HIS 800  797  797  HIS HIS A . n 
A 1 801  THR 801  798  798  THR THR A . n 
A 1 802  PHE 802  799  799  PHE PHE A . n 
A 1 803  GLU 803  800  800  GLU GLU A . n 
A 1 804  VAL 804  801  801  VAL VAL A . n 
A 1 805  LEU 805  802  802  LEU LEU A . n 
A 1 806  HIS 806  803  803  HIS HIS A . n 
A 1 807  ALA 807  804  804  ALA ALA A . n 
A 1 808  HIS 808  805  805  HIS HIS A . n 
A 1 809  GLN 809  806  806  GLN GLN A . n 
A 1 810  PHE 810  807  807  PHE PHE A . n 
A 1 811  LEU 811  808  808  LEU LEU A . n 
A 1 812  GLN 812  809  809  GLN GLN A . n 
A 1 813  ASN 813  810  810  ASN ASN A . n 
A 1 814  GLU 814  811  811  GLU GLU A . n 
A 1 815  TYR 815  812  812  TYR TYR A . n 
A 1 816  ALA 816  813  813  ALA ALA A . n 
A 1 817  LEU 817  814  814  LEU LEU A . n 
A 1 818  SER 818  815  815  SER SER A . n 
A 1 819  LEU 819  816  816  LEU LEU A . n 
A 1 820  VAL 820  817  817  VAL VAL A . n 
A 1 821  SER 821  818  818  SER SER A . n 
A 1 822  CYS 822  819  819  CYS CYS A . n 
A 1 823  LYS 823  820  820  LYS LYS A . n 
A 1 824  LEU 824  821  821  LEU LEU A . n 
A 1 825  GLY 825  822  822  GLY GLY A . n 
A 1 826  LYS 826  823  823  LYS LYS A . n 
A 1 827  ASP 827  824  824  ASP ASP A . n 
A 1 828  PRO 828  825  825  PRO PRO A . n 
A 1 829  ASN 829  826  826  ASN ASN A . n 
A 1 830  THR 830  827  827  THR THR A . n 
A 1 831  TYR 831  828  828  TYR TYR A . n 
A 1 832  PHE 832  829  829  PHE PHE A . n 
A 1 833  ILE 833  830  830  ILE ILE A . n 
A 1 834  VAL 834  831  831  VAL VAL A . n 
A 1 835  GLY 835  832  832  GLY GLY A . n 
A 1 836  THR 836  833  833  THR THR A . n 
A 1 837  ALA 837  834  834  ALA ALA A . n 
A 1 838  MET 838  835  835  MET MET A . n 
A 1 839  VAL 839  836  836  VAL VAL A . n 
A 1 840  TYR 840  837  837  TYR TYR A . n 
A 1 841  PRO 841  838  838  PRO PRO A . n 
A 1 842  GLU 842  839  839  GLU GLU A . n 
A 1 843  GLU 843  840  840  GLU GLU A . n 
A 1 844  ALA 844  841  841  ALA ALA A . n 
A 1 845  GLU 845  842  842  GLU GLU A . n 
A 1 846  PRO 846  843  843  PRO PRO A . n 
A 1 847  LYS 847  844  844  LYS LYS A . n 
A 1 848  GLN 848  845  845  GLN GLN A . n 
A 1 849  GLY 849  846  846  GLY GLY A . n 
A 1 850  ARG 850  847  847  ARG ARG A . n 
A 1 851  ILE 851  848  848  ILE ILE A . n 
A 1 852  VAL 852  849  849  VAL VAL A . n 
A 1 853  VAL 853  850  850  VAL VAL A . n 
A 1 854  PHE 854  851  851  PHE PHE A . n 
A 1 855  GLN 855  852  852  GLN GLN A . n 
A 1 856  TYR 856  853  853  TYR TYR A . n 
A 1 857  SER 857  854  854  SER SER A . n 
A 1 858  ASP 858  855  855  ASP ASP A . n 
A 1 859  GLY 859  856  856  GLY GLY A . n 
A 1 860  LYS 860  857  857  LYS LYS A . n 
A 1 861  LEU 861  858  858  LEU LEU A . n 
A 1 862  GLN 862  859  859  GLN GLN A . n 
A 1 863  THR 863  860  860  THR THR A . n 
A 1 864  VAL 864  861  861  VAL VAL A . n 
A 1 865  ALA 865  862  862  ALA ALA A . n 
A 1 866  GLU 866  863  863  GLU GLU A . n 
A 1 867  LYS 867  864  864  LYS LYS A . n 
A 1 868  GLU 868  865  865  GLU GLU A . n 
A 1 869  VAL 869  866  866  VAL VAL A . n 
A 1 870  LYS 870  867  867  LYS LYS A . n 
A 1 871  GLY 871  868  868  GLY GLY A . n 
A 1 872  ALA 872  869  869  ALA ALA A . n 
A 1 873  VAL 873  870  870  VAL VAL A . n 
A 1 874  TYR 874  871  871  TYR TYR A . n 
A 1 875  SER 875  872  872  SER SER A . n 
A 1 876  MET 876  873  873  MET MET A . n 
A 1 877  VAL 877  874  874  VAL VAL A . n 
A 1 878  GLU 878  875  875  GLU GLU A . n 
A 1 879  PHE 879  876  876  PHE PHE A . n 
A 1 880  ASN 880  877  877  ASN ASN A . n 
A 1 881  GLY 881  878  878  GLY GLY A . n 
A 1 882  LYS 882  879  879  LYS LYS A . n 
A 1 883  LEU 883  880  880  LEU LEU A . n 
A 1 884  LEU 884  881  881  LEU LEU A . n 
A 1 885  ALA 885  882  882  ALA ALA A . n 
A 1 886  SER 886  883  883  SER SER A . n 
A 1 887  ILE 887  884  884  ILE ILE A . n 
A 1 888  ASN 888  885  885  ASN ASN A . n 
A 1 889  SER 889  886  886  SER SER A . n 
A 1 890  THR 890  887  887  THR THR A . n 
A 1 891  VAL 891  888  888  VAL VAL A . n 
A 1 892  ARG 892  889  889  ARG ARG A . n 
A 1 893  LEU 893  890  890  LEU LEU A . n 
A 1 894  TYR 894  891  891  TYR TYR A . n 
A 1 895  GLU 895  892  892  GLU GLU A . n 
A 1 896  TRP 896  893  893  TRP TRP A . n 
A 1 897  THR 897  894  894  THR THR A . n 
A 1 898  THR 898  895  895  THR THR A . n 
A 1 899  GLU 899  896  896  GLU GLU A . n 
A 1 900  LYS 900  897  897  LYS LYS A . n 
A 1 901  ASP 901  898  898  ASP ASP A . n 
A 1 902  VAL 902  899  899  VAL VAL A . n 
A 1 903  ARG 903  900  900  ARG ARG A . n 
A 1 904  THR 904  901  901  THR THR A . n 
A 1 905  GLU 905  902  902  GLU GLU A . n 
A 1 906  CYS 906  903  903  CYS CYS A . n 
A 1 907  ASN 907  904  904  ASN ASN A . n 
A 1 908  HIS 908  905  905  HIS HIS A . n 
A 1 909  TYR 909  906  906  TYR TYR A . n 
A 1 910  ASN 910  907  907  ASN ASN A . n 
A 1 911  ASN 911  908  908  ASN ASN A . n 
A 1 912  ILE 912  909  909  ILE ILE A . n 
A 1 913  MET 913  910  910  MET MET A . n 
A 1 914  ALA 914  911  911  ALA ALA A . n 
A 1 915  LEU 915  912  912  LEU LEU A . n 
A 1 916  TYR 916  913  913  TYR TYR A . n 
A 1 917  LEU 917  914  914  LEU LEU A . n 
A 1 918  LYS 918  915  915  LYS LYS A . n 
A 1 919  THR 919  916  916  THR THR A . n 
A 1 920  LYS 920  917  917  LYS LYS A . n 
A 1 921  GLY 921  918  918  GLY GLY A . n 
A 1 922  ASP 922  919  919  ASP ASP A . n 
A 1 923  PHE 923  920  920  PHE PHE A . n 
A 1 924  ILE 924  921  921  ILE ILE A . n 
A 1 925  LEU 925  922  922  LEU LEU A . n 
A 1 926  VAL 926  923  923  VAL VAL A . n 
A 1 927  GLY 927  924  924  GLY GLY A . n 
A 1 928  ASP 928  925  925  ASP ASP A . n 
A 1 929  LEU 929  926  926  LEU LEU A . n 
A 1 930  MET 930  927  927  MET MET A . n 
A 1 931  ARG 931  928  928  ARG ARG A . n 
A 1 932  SER 932  929  929  SER SER A . n 
A 1 933  VAL 933  930  930  VAL VAL A . n 
A 1 934  LEU 934  931  931  LEU LEU A . n 
A 1 935  LEU 935  932  932  LEU LEU A . n 
A 1 936  LEU 936  933  933  LEU LEU A . n 
A 1 937  ALA 937  934  934  ALA ALA A . n 
A 1 938  TYR 938  935  935  TYR TYR A . n 
A 1 939  LYS 939  936  936  LYS LYS A . n 
A 1 940  PRO 940  937  937  PRO PRO A . n 
A 1 941  MET 941  938  938  MET MET A . n 
A 1 942  GLU 942  939  939  GLU GLU A . n 
A 1 943  GLY 943  940  940  GLY GLY A . n 
A 1 944  ASN 944  941  941  ASN ASN A . n 
A 1 945  PHE 945  942  942  PHE PHE A . n 
A 1 946  GLU 946  943  943  GLU GLU A . n 
A 1 947  GLU 947  944  944  GLU GLU A . n 
A 1 948  ILE 948  945  945  ILE ILE A . n 
A 1 949  ALA 949  946  946  ALA ALA A . n 
A 1 950  ARG 950  947  947  ARG ARG A . n 
A 1 951  ASP 951  948  948  ASP ASP A . n 
A 1 952  PHE 952  949  949  PHE PHE A . n 
A 1 953  ASN 953  950  950  ASN ASN A . n 
A 1 954  PRO 954  951  951  PRO PRO A . n 
A 1 955  ASN 955  952  952  ASN ASN A . n 
A 1 956  TRP 956  953  953  TRP TRP A . n 
A 1 957  MET 957  954  954  MET MET A . n 
A 1 958  SER 958  955  955  SER SER A . n 
A 1 959  ALA 959  956  956  ALA ALA A . n 
A 1 960  VAL 960  957  957  VAL VAL A . n 
A 1 961  GLU 961  958  958  GLU GLU A . n 
A 1 962  ILE 962  959  959  ILE ILE A . n 
A 1 963  LEU 963  960  960  LEU LEU A . n 
A 1 964  ASP 964  961  961  ASP ASP A . n 
A 1 965  ASP 965  962  962  ASP ASP A . n 
A 1 966  ASP 966  963  963  ASP ASP A . n 
A 1 967  ASN 967  964  964  ASN ASN A . n 
A 1 968  PHE 968  965  965  PHE PHE A . n 
A 1 969  LEU 969  966  966  LEU LEU A . n 
A 1 970  GLY 970  967  967  GLY GLY A . n 
A 1 971  ALA 971  968  968  ALA ALA A . n 
A 1 972  GLU 972  969  969  GLU GLU A . n 
A 1 973  ASN 973  970  970  ASN ASN A . n 
A 1 974  ALA 974  971  971  ALA ALA A . n 
A 1 975  PHE 975  972  972  PHE PHE A . n 
A 1 976  ASN 976  973  973  ASN ASN A . n 
A 1 977  LEU 977  974  974  LEU LEU A . n 
A 1 978  PHE 978  975  975  PHE PHE A . n 
A 1 979  VAL 979  976  976  VAL VAL A . n 
A 1 980  CYS 980  977  977  CYS CYS A . n 
A 1 981  GLN 981  978  978  GLN GLN A . n 
A 1 982  LYS 982  979  979  LYS LYS A . n 
A 1 983  ASP 983  980  980  ASP ASP A . n 
A 1 984  SER 984  981  981  SER SER A . n 
A 1 985  ALA 985  982  982  ALA ALA A . n 
A 1 986  ALA 986  983  983  ALA ALA A . n 
A 1 987  THR 987  984  984  THR THR A . n 
A 1 988  THR 988  985  985  THR THR A . n 
A 1 989  ASP 989  986  986  ASP ASP A . n 
A 1 990  GLU 990  987  987  GLU GLU A . n 
A 1 991  GLU 991  988  988  GLU GLU A . n 
A 1 992  ARG 992  989  989  ARG ARG A . n 
A 1 993  GLN 993  990  990  GLN GLN A . n 
A 1 994  HIS 994  991  991  HIS HIS A . n 
A 1 995  LEU 995  992  992  LEU LEU A . n 
A 1 996  GLN 996  993  993  GLN GLN A . n 
A 1 997  GLU 997  994  994  GLU GLU A . n 
A 1 998  VAL 998  995  995  VAL VAL A . n 
A 1 999  GLY 999  996  996  GLY GLY A . n 
A 1 1000 LEU 1000 997  997  LEU LEU A . n 
A 1 1001 PHE 1001 998  998  PHE PHE A . n 
A 1 1002 HIS 1002 999  999  HIS HIS A . n 
A 1 1003 LEU 1003 1000 1000 LEU LEU A . n 
A 1 1004 GLY 1004 1001 1001 GLY GLY A . n 
A 1 1005 GLU 1005 1002 1002 GLU GLU A . n 
A 1 1006 PHE 1006 1003 1003 PHE PHE A . n 
A 1 1007 VAL 1007 1004 1004 VAL VAL A . n 
A 1 1008 ASN 1008 1005 1005 ASN ASN A . n 
A 1 1009 VAL 1009 1006 1006 VAL VAL A . n 
A 1 1010 PHE 1010 1007 1007 PHE PHE A . n 
A 1 1011 CYS 1011 1008 1008 CYS CYS A . n 
A 1 1012 HIS 1012 1009 1009 HIS HIS A . n 
A 1 1013 GLY 1013 1010 1010 GLY GLY A . n 
A 1 1014 SER 1014 1011 1011 SER SER A . n 
A 1 1015 LEU 1015 1012 1012 LEU LEU A . n 
A 1 1016 VAL 1016 1013 1013 VAL VAL A . n 
A 1 1017 MET 1017 1014 1014 MET MET A . n 
A 1 1018 GLN 1018 1015 1015 GLN GLN A . n 
A 1 1019 ASN 1019 1016 ?    ?   ?   A . n 
A 1 1020 LEU 1020 1017 ?    ?   ?   A . n 
A 1 1021 GLY 1021 1018 ?    ?   ?   A . n 
A 1 1022 GLU 1022 1019 ?    ?   ?   A . n 
A 1 1023 THR 1023 1020 ?    ?   ?   A . n 
A 1 1024 SER 1024 1021 ?    ?   ?   A . n 
A 1 1025 THR 1025 1022 ?    ?   ?   A . n 
A 1 1026 PRO 1026 1023 1023 PRO PRO A . n 
A 1 1027 THR 1027 1024 1024 THR THR A . n 
A 1 1028 GLN 1028 1025 1025 GLN GLN A . n 
A 1 1029 GLY 1029 1026 1026 GLY GLY A . n 
A 1 1030 SER 1030 1027 1027 SER SER A . n 
A 1 1031 VAL 1031 1028 1028 VAL VAL A . n 
A 1 1032 LEU 1032 1029 1029 LEU LEU A . n 
A 1 1033 PHE 1033 1030 1030 PHE PHE A . n 
A 1 1034 GLY 1034 1031 1031 GLY GLY A . n 
A 1 1035 THR 1035 1032 1032 THR THR A . n 
A 1 1036 VAL 1036 1033 1033 VAL VAL A . n 
A 1 1037 ASN 1037 1034 1034 ASN ASN A . n 
A 1 1038 GLY 1038 1035 1035 GLY GLY A . n 
A 1 1039 MET 1039 1036 1036 MET MET A . n 
A 1 1040 ILE 1040 1037 1037 ILE ILE A . n 
A 1 1041 GLY 1041 1038 1038 GLY GLY A . n 
A 1 1042 LEU 1042 1039 1039 LEU LEU A . n 
A 1 1043 VAL 1043 1040 1040 VAL VAL A . n 
A 1 1044 THR 1044 1041 1041 THR THR A . n 
A 1 1045 SER 1045 1042 1042 SER SER A . n 
A 1 1046 LEU 1046 1043 1043 LEU LEU A . n 
A 1 1047 SER 1047 1044 1044 SER SER A . n 
A 1 1048 GLU 1048 1045 1045 GLU GLU A . n 
A 1 1049 SER 1049 1046 1046 SER SER A . n 
A 1 1050 TRP 1050 1047 1047 TRP TRP A . n 
A 1 1051 TYR 1051 1048 1048 TYR TYR A . n 
A 1 1052 ASN 1052 1049 1049 ASN ASN A . n 
A 1 1053 LEU 1053 1050 1050 LEU LEU A . n 
A 1 1054 LEU 1054 1051 1051 LEU LEU A . n 
A 1 1055 LEU 1055 1052 1052 LEU LEU A . n 
A 1 1056 ASP 1056 1053 1053 ASP ASP A . n 
A 1 1057 MET 1057 1054 1054 MET MET A . n 
A 1 1058 GLN 1058 1055 1055 GLN GLN A . n 
A 1 1059 ASN 1059 1056 1056 ASN ASN A . n 
A 1 1060 ARG 1060 1057 1057 ARG ARG A . n 
A 1 1061 LEU 1061 1058 1058 LEU LEU A . n 
A 1 1062 ASN 1062 1059 1059 ASN ASN A . n 
A 1 1063 LYS 1063 1060 1060 LYS LYS A . n 
A 1 1064 VAL 1064 1061 1061 VAL VAL A . n 
A 1 1065 ILE 1065 1062 1062 ILE ILE A . n 
A 1 1066 LYS 1066 1063 1063 LYS LYS A . n 
A 1 1067 SER 1067 1064 1064 SER SER A . n 
A 1 1068 VAL 1068 1065 1065 VAL VAL A . n 
A 1 1069 GLY 1069 1066 1066 GLY GLY A . n 
A 1 1070 LYS 1070 1067 1067 LYS LYS A . n 
A 1 1071 ILE 1071 1068 1068 ILE ILE A . n 
A 1 1072 GLU 1072 1069 1069 GLU GLU A . n 
A 1 1073 HIS 1073 1070 1070 HIS HIS A . n 
A 1 1074 SER 1074 1071 1071 SER SER A . n 
A 1 1075 PHE 1075 1072 1072 PHE PHE A . n 
A 1 1076 TRP 1076 1073 1073 TRP TRP A . n 
A 1 1077 ARG 1077 1074 1074 ARG ARG A . n 
A 1 1078 SER 1078 1075 1075 SER SER A . n 
A 1 1079 PHE 1079 1076 1076 PHE PHE A . n 
A 1 1080 HIS 1080 1077 1077 HIS HIS A . n 
A 1 1081 THR 1081 1078 1078 THR THR A . n 
A 1 1082 GLU 1082 1079 1079 GLU GLU A . n 
A 1 1083 ARG 1083 1080 1080 ARG ARG A . n 
A 1 1084 LYS 1084 1081 1081 LYS LYS A . n 
A 1 1085 THR 1085 1082 1082 THR THR A . n 
A 1 1086 GLU 1086 1083 1083 GLU GLU A . n 
A 1 1087 PRO 1087 1084 1084 PRO PRO A . n 
A 1 1088 ALA 1088 1085 1085 ALA ALA A . n 
A 1 1089 THR 1089 1086 1086 THR THR A . n 
A 1 1090 GLY 1090 1087 1087 GLY GLY A . n 
A 1 1091 PHE 1091 1088 1088 PHE PHE A . n 
A 1 1092 ILE 1092 1089 1089 ILE ILE A . n 
A 1 1093 ASP 1093 1090 1090 ASP ASP A . n 
A 1 1094 GLY 1094 1091 1091 GLY GLY A . n 
A 1 1095 ASP 1095 1092 1092 ASP ASP A . n 
A 1 1096 LEU 1096 1093 1093 LEU LEU A . n 
A 1 1097 ILE 1097 1094 1094 ILE ILE A . n 
A 1 1098 GLU 1098 1095 1095 GLU GLU A . n 
A 1 1099 SER 1099 1096 1096 SER SER A . n 
A 1 1100 PHE 1100 1097 1097 PHE PHE A . n 
A 1 1101 LEU 1101 1098 1098 LEU LEU A . n 
A 1 1102 ASP 1102 1099 1099 ASP ASP A . n 
A 1 1103 ILE 1103 1100 1100 ILE ILE A . n 
A 1 1104 SER 1104 1101 1101 SER SER A . n 
A 1 1105 ARG 1105 1102 1102 ARG ARG A . n 
A 1 1106 PRO 1106 1103 1103 PRO PRO A . n 
A 1 1107 LYS 1107 1104 1104 LYS LYS A . n 
A 1 1108 MET 1108 1105 1105 MET MET A . n 
A 1 1109 GLN 1109 1106 1106 GLN GLN A . n 
A 1 1110 GLU 1110 1107 1107 GLU GLU A . n 
A 1 1111 VAL 1111 1108 1108 VAL VAL A . n 
A 1 1112 VAL 1112 1109 1109 VAL VAL A . n 
A 1 1113 ALA 1113 1110 1110 ALA ALA A . n 
A 1 1114 ASN 1114 1111 1111 ASN ASN A . n 
A 1 1115 LEU 1115 1112 ?    ?   ?   A . n 
A 1 1116 GLN 1116 1113 ?    ?   ?   A . n 
A 1 1117 TYR 1117 1114 ?    ?   ?   A . n 
A 1 1118 ASP 1118 1115 ?    ?   ?   A . n 
A 1 1119 ASP 1119 1116 ?    ?   ?   A . n 
A 1 1120 GLY 1120 1117 ?    ?   ?   A . n 
A 1 1121 SER 1121 1118 ?    ?   ?   A . n 
A 1 1122 GLY 1122 1119 ?    ?   ?   A . n 
A 1 1123 MET 1123 1120 ?    ?   ?   A . n 
A 1 1124 LYS 1124 1121 ?    ?   ?   A . n 
A 1 1125 ARG 1125 1122 1122 ARG ARG A . n 
A 1 1126 GLU 1126 1123 1123 GLU GLU A . n 
A 1 1127 ALA 1127 1124 1124 ALA ALA A . n 
A 1 1128 THR 1128 1125 1125 THR THR A . n 
A 1 1129 ALA 1129 1126 1126 ALA ALA A . n 
A 1 1130 ASP 1130 1127 1127 ASP ASP A . n 
A 1 1131 ASP 1131 1128 1128 ASP ASP A . n 
A 1 1132 LEU 1132 1129 1129 LEU LEU A . n 
A 1 1133 ILE 1133 1130 1130 ILE ILE A . n 
A 1 1134 LYS 1134 1131 1131 LYS LYS A . n 
A 1 1135 VAL 1135 1132 1132 VAL VAL A . n 
A 1 1136 VAL 1136 1133 1133 VAL VAL A . n 
A 1 1137 GLU 1137 1134 1134 GLU GLU A . n 
A 1 1138 GLU 1138 1135 1135 GLU GLU A . n 
A 1 1139 LEU 1139 1136 1136 LEU LEU A . n 
A 1 1140 THR 1140 1137 1137 THR THR A . n 
A 1 1141 ARG 1141 1138 1138 ARG ARG A . n 
A 1 1142 ILE 1142 1139 1139 ILE ILE A . n 
A 1 1143 HIS 1143 1140 1140 HIS HIS A . n 
B 2 1    ASN 1    86   86   ASN ASN B . n 
B 2 2    PHE 2    87   87   PHE PHE B . n 
B 2 3    VAL 3    88   88   VAL VAL B . n 
B 2 4    SER 4    89   89   SER SER B . n 
B 2 5    TRP 5    90   90   TRP TRP B . n 
B 2 6    HIS 6    91   91   HIS HIS B . n 
B 2 7    ALA 7    92   92   ALA ALA B . n 
B 2 8    ASN 8    93   93   ASN ASN B . n 
B 2 9    ARG 9    94   94   ARG ARG B . n 
B 2 10   GLN 10   95   95   GLN GLN B . n 
B 2 11   LEU 11   96   96   LEU LEU B . n 
B 2 12   GLY 12   97   97   GLY GLY B . n 
B 2 13   MET 13   98   98   MET MET B . n 
B 2 14   PRO 14   99   99   PRO PRO B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1570  ? 
1 MORE         -8    ? 
1 'SSA (A^2)'  48980 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASER   phasing           .        ? 2 
REFMAC   refinement        5.2.0019 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_entry_details.entry_id             3I7K 
_pdbx_entry_details.sequence_details     'MUTATIONS OCCURRED DURING THE CLONING OF DDB1' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    277 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    279 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.05 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             313 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             313 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.690 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.122 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A GLN 290  ? ? CA A GLN 290  ? ? C  A GLN 290  ? ? 150.81 110.40 40.41  2.00 N 
2  1 N  A GLN 290  ? ? CA A GLN 290  ? ? C  A GLN 290  ? ? 84.38  111.00 -26.62 2.70 N 
3  1 CB A MET 291  ? ? CA A MET 291  ? ? C  A MET 291  ? ? 79.78  110.40 -30.62 2.00 N 
4  1 N  A MET 291  ? ? CA A MET 291  ? ? C  A MET 291  ? ? 68.99  111.00 -42.01 2.70 N 
5  1 N  A ASP 292  ? ? CA A ASP 292  ? ? C  A ASP 292  ? ? 131.33 111.00 20.33  2.70 N 
6  1 CB A THR 308  ? ? CA A THR 308  ? ? C  A THR 308  ? ? 133.80 111.60 22.20  2.70 N 
7  1 N  A SER 309  ? ? CA A SER 309  ? ? CB A SER 309  ? ? 84.28  110.50 -26.22 1.50 N 
8  1 N  A ARG 514  ? ? CA A ARG 514  ? ? CB A ARG 514  ? ? 93.38  110.60 -17.22 1.80 N 
9  1 CA A LEU 992  ? ? CB A LEU 992  ? ? CG A LEU 992  ? ? 129.55 115.30 14.25  2.30 N 
10 1 CA A LEU 1000 ? ? CB A LEU 1000 ? ? CG A LEU 1000 ? ? 129.43 115.30 14.13  2.30 N 
11 1 CA A LEU 1129 ? ? CB A LEU 1129 ? ? CG A LEU 1129 ? ? 130.42 115.30 15.12  2.30 N 
12 1 N  B MET 98   ? ? CA B MET 98   ? ? CB B MET 98   ? ? 84.72  110.60 -25.88 1.80 N 
13 1 N  B MET 98   ? ? CA B MET 98   ? ? C  B MET 98   ? ? 134.06 111.00 23.06  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LYS A 35   ? ? -83.70  -131.35 
2   1 ASN A 36   ? ? -92.64  -76.15  
3   1 THR A 45   ? ? -110.43 -137.72 
4   1 VAL A 52   ? ? -131.17 -39.16  
5   1 TYR A 58   ? ? -91.11  58.43   
6   1 SER A 73   ? ? -55.91  -71.36  
7   1 SER A 94   ? ? -25.92  -64.66  
8   1 HIS A 105  ? ? 169.76  153.57  
9   1 THR A 118  ? ? 88.88   -7.00   
10  1 ASN A 149  ? ? 74.64   35.13   
11  1 LYS A 150  ? ? -64.43  3.27    
12  1 LEU A 162  ? ? -28.17  -43.02  
13  1 GLN A 174  ? ? -77.81  22.93   
14  1 ALA A 175  ? ? 172.66  144.95  
15  1 GLN A 186  ? ? 104.89  1.74    
16  1 GLU A 201  ? ? -103.74 -154.52 
17  1 ASN A 203  ? ? 61.50   -148.43 
18  1 TRP A 207  ? ? -172.23 133.03  
19  1 LYS A 208  ? ? -29.29  150.70  
20  1 SER A 217  ? ? -144.67 -5.24   
21  1 GLU A 235  ? ? 44.73   -5.61   
22  1 ASN A 241  ? ? -174.61 104.99  
23  1 GLN A 255  ? ? -82.85  -148.25 
24  1 SER A 256  ? ? -8.31   128.52  
25  1 PRO A 266  ? ? -48.60  -19.39  
26  1 GLN A 290  ? ? -100.83 -128.72 
27  1 MET A 291  ? ? -169.75 117.46  
28  1 ASP A 292  ? ? 66.09   -24.72  
29  1 THR A 294  ? ? 61.28   -158.05 
30  1 THR A 308  ? ? -93.05  -117.63 
31  1 LEU A 317  ? ? -101.92 -114.87 
32  1 ASN A 341  ? ? -77.84  -160.33 
33  1 GLU A 342  ? ? -47.64  158.17  
34  1 GLN A 343  ? ? 60.57   -12.50  
35  1 LEU A 356  ? ? -69.98  10.56   
36  1 ASP A 366  ? ? -65.09  82.13   
37  1 GLU A 368  ? ? -95.12  40.83   
38  1 GLN A 372  ? ? -82.23  -110.71 
39  1 PHE A 382  ? ? 45.60   -141.79 
40  1 LEU A 404  ? ? -173.38 95.89   
41  1 PRO A 405  ? ? -46.51  156.82  
42  1 SER A 415  ? ? -81.96  45.59   
43  1 ASN A 418  ? ? -94.86  -63.41  
44  1 ASP A 423  ? ? -146.72 12.69   
45  1 GLU A 445  ? ? -116.71 63.71   
46  1 VAL A 463  ? ? -106.68 -120.87 
47  1 LYS A 484  ? ? -66.01  74.48   
48  1 LEU A 486  ? ? -64.62  92.45   
49  1 SER A 488  ? ? 169.45  172.67  
50  1 SER A 502  ? ? 164.94  110.68  
51  1 CYS A 503  ? ? -160.31 114.18  
52  1 ASN A 504  ? ? -83.33  -81.09  
53  1 SER A 505  ? ? -159.98 -26.23  
54  1 ILE A 521  ? ? -96.68  51.72   
55  1 PRO A 523  ? ? -27.73  117.93  
56  1 ILE A 529  ? ? -135.02 -38.75  
57  1 HIS A 531  ? ? -167.45 117.23  
58  1 LEU A 546  ? ? -119.85 76.80   
59  1 ASP A 548  ? ? -56.90  -4.28   
60  1 ILE A 564  ? ? 39.15   64.90   
61  1 PHE A 574  ? ? 88.20   1.75    
62  1 LEU A 577  ? ? -86.00  -91.52  
63  1 PHE A 596  ? ? -121.26 -56.21  
64  1 GLU A 597  ? ? -146.65 -129.05 
65  1 SER A 598  ? ? -85.88  47.28   
66  1 THR A 620  ? ? -126.69 -103.31 
67  1 SER A 624  ? ? -99.42  -140.17 
68  1 LYS A 628  ? ? -62.71  94.20   
69  1 LEU A 631  ? ? -115.35 -108.14 
70  1 SER A 643  ? ? -131.19 -115.26 
71  1 LEU A 644  ? ? -77.18  -126.75 
72  1 ASN A 648  ? ? -115.18 -165.56 
73  1 SER A 653  ? ? -173.57 -179.37 
74  1 TYR A 660  ? ? -105.34 -145.38 
75  1 SER A 662  ? ? -81.67  -145.86 
76  1 HIS A 664  ? ? -161.10 18.20   
77  1 LEU A 682  ? ? -170.24 -172.83 
78  1 ASN A 683  ? ? -174.57 30.65   
79  1 SER A 684  ? ? -49.56  158.58  
80  1 ASP A 689  ? ? 1.55    81.20   
81  1 SER A 697  ? ? -157.26 32.10   
82  1 GLU A 706  ? ? -43.48  -119.45 
83  1 ILE A 707  ? ? -163.06 -38.43  
84  1 THR A 750  ? ? -115.46 -144.18 
85  1 ARG A 753  ? ? 139.21  155.58  
86  1 SER A 764  ? ? -175.01 147.52  
87  1 SER A 772  ? ? -162.33 67.07   
88  1 HIS A 797  ? ? -94.66  -62.67  
89  1 ASN A 810  ? ? 78.54   -4.32   
90  1 THR A 833  ? ? -119.29 -162.33 
91  1 ALA A 834  ? ? -177.31 130.17  
92  1 SER A 854  ? ? -134.73 -46.95  
93  1 ASP A 855  ? ? -79.32  -109.96 
94  1 LYS A 867  ? ? -88.09  38.72   
95  1 PHE A 876  ? ? -85.13  -101.43 
96  1 THR A 894  ? ? -40.82  160.34  
97  1 CYS A 903  ? ? -48.21  -15.49  
98  1 ASN A 908  ? ? -103.74 71.29   
99  1 ASP A 919  ? ? -71.75  -157.27 
100 1 PHE A 920  ? ? -99.82  34.12   
101 1 LEU A 922  ? ? -176.30 126.97  
102 1 LEU A 926  ? ? -108.53 -93.67  
103 1 MET A 927  ? ? -105.63 59.61   
104 1 ARG A 928  ? ? 63.98   74.96   
105 1 PHE A 949  ? ? -69.01  -171.38 
106 1 ASN A 950  ? ? 68.59   105.06  
107 1 ASP A 961  ? ? -144.00 -159.30 
108 1 ASN A 970  ? ? -37.76  -25.28  
109 1 SER A 981  ? ? -109.74 57.18   
110 1 ALA A 983  ? ? -60.28  -178.55 
111 1 THR A 985  ? ? -60.64  64.21   
112 1 ASP A 986  ? ? -177.37 24.78   
113 1 GLU A 987  ? ? -175.76 -63.49  
114 1 GLU A 994  ? ? -67.61  92.73   
115 1 PHE A 998  ? ? 176.94  122.24  
116 1 MET A 1014 ? ? -39.61  150.66  
117 1 SER A 1027 ? ? -170.61 102.63  
118 1 ILE A 1037 ? ? 63.80   103.94  
119 1 LEU A 1043 ? ? -118.68 -139.75 
120 1 GLU A 1045 ? ? -7.41   -66.49  
121 1 VAL A 1065 ? ? -46.09  -70.52  
122 1 HIS A 1070 ? ? -39.94  -38.20  
123 1 ASP A 1099 ? ? -94.60  48.53   
124 1 PRO A 1103 ? ? -43.02  -83.37  
125 1 ALA A 1110 ? ? -140.52 -30.98  
126 1 GLU A 1123 ? ? -146.84 -70.09  
127 1 ALA A 1124 ? ? 89.89   115.36  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLU A 312 ? ? CYS A 313 ? ? -147.01 
2 1 HIS A 522 ? ? PRO A 523 ? ? -149.63 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2   ? A GLY 1    
2  1 Y 1 A SER -1   ? A SER 2    
3  1 Y 1 A HIS 0    ? A HIS 3    
4  1 Y 1 A SER 774  ? A SER 777  
5  1 Y 1 A THR 775  ? A THR 778  
6  1 Y 1 A ALA 776  ? A ALA 779  
7  1 Y 1 A PRO 777  ? A PRO 780  
8  1 Y 1 A HIS 778  ? A HIS 781  
9  1 Y 1 A GLU 779  ? A GLU 782  
10 1 Y 1 A THR 780  ? A THR 783  
11 1 Y 1 A SER 781  ? A SER 784  
12 1 Y 1 A PHE 782  ? A PHE 785  
13 1 Y 1 A ASN 1016 ? A ASN 1019 
14 1 Y 1 A LEU 1017 ? A LEU 1020 
15 1 Y 1 A GLY 1018 ? A GLY 1021 
16 1 Y 1 A GLU 1019 ? A GLU 1022 
17 1 Y 1 A THR 1020 ? A THR 1023 
18 1 Y 1 A SER 1021 ? A SER 1024 
19 1 Y 1 A THR 1022 ? A THR 1025 
20 1 Y 1 A LEU 1112 ? A LEU 1115 
21 1 Y 1 A GLN 1113 ? A GLN 1116 
22 1 Y 1 A TYR 1114 ? A TYR 1117 
23 1 Y 1 A ASP 1115 ? A ASP 1118 
24 1 Y 1 A ASP 1116 ? A ASP 1119 
25 1 Y 1 A GLY 1117 ? A GLY 1120 
26 1 Y 1 A SER 1118 ? A SER 1121 
27 1 Y 1 A GLY 1119 ? A GLY 1122 
28 1 Y 1 A MET 1120 ? A MET 1123 
29 1 Y 1 A LYS 1121 ? A LYS 1124 
#